1XHKA

Crystal structure of m. jannaschii lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
185
structure length
185
Chain Sequence
b'EPKVGVIYGLAVLGAGGIGDVTKIIVQILESKNPGTHLLNISGDIAKHSITLASALSKKLVAEKKLPLPKKDIDLNNKEIYIQFSQSYSKIDGDSATAAVCLAIISALLDIPLKQDFAITGSLDLSGNVLAIGGVNEKIEAAKRYGFKRVIIPEANMIDVIETEGIEIIPVKTLDEIVPLVFDLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog
publication title The active site of a lon protease from Methanococcus jannaschii distinctly differs from the canonical catalytic Dyad of Lon proteases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
total genus 53
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2004-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xhkA00
5LMNI 5LMNE 4DR2E 4WUDA 1Z0VA 1IBKE 1IBKI 1IBMI 1IBME 4LF6E 2WW4A 4JI4I 4MYTA 4HXZA 1WUUA 2AJ4A 1PVGA 4DV1I 4DV1E 4NXNI 1Z5CA 4DR6I 4DR6E 1MU5A 3T1YE 4LFBI 4LFBE 1Z0TA 1H7SA 1Z0GA 4MYUA 4UTGA 4AQYI 4AQYE 3JAMQ 2V2ZA 4DV4E 2UXDI 2UXDE 3QT7A 2BM0A 4GKJI 5IT9C 4GKJE 1QZRA 2V2QA 2VF3A 3PYEA 3PYFA 3QT6A 2HHHE 1PIEA 1XHKA 1FI4A 4FN5A 3J7AM 4DPUA 2X36A 4DR1I 4DR1E 2UUCI 4DR5I 2UUCE 4DR5E 1FJGE 4DV6I 4DV6E 3CWVA 1H73A 3J81C 4EMDA 1XNRI 1NZ0A 2UXCE 1KTVA 1N0VC 4P7AA 2BM1A 1N34I 1N34E 4Z7CA 4UT4A 1ZM3A 2ZM6I 1IBLI 4B3TI 2ZM6E 1IBLE 4B3TE 1BKNA 1H74A 4HYMA 4LF5I 4LF5E 4K0KE 1FWLA 1ZM4A 2HKJA 4JI8I 4JI8E 4X66I 4X66E 5FLXQ 3J80Q 2HK2A 4DUYI 1J5EI 4DUYE 1J5EE 3B8HA 5IT9Q 2ZITA 2UXBI 2UXBE 1MX0A 1HR0I 1HR0E 4DR2I 1N32I 1N32E 1XMQI 1XMQE 4LF6I 4JI1I 4JI1E 1FNMA 1NHIA 1RR9A 5GMDA 3F0NA 4LF7I 4LF7E 2R42A 4I3HA 3PYDA 1B62A 3J81Q 1ZXNA 3T1YI 4LF4I 3PYGA 4LF4E 4DR7I 4DR7E 1N36I 1N36E 1KIJA 1Z0CA 4DV4I 3K1JA 4DV5E 1S4EA 4DPYA 2UU9I 2UU9E 4M1KA 2V2VA 1RREA 4USKA 4WUBA 3Q1QA 2DEJA 1Z59A 1XNQI 1XNQE 1PKPA 1N0UA 4HY1A 3HULA 2GS8A 2HHHI 1B63A 4JI2I 5BR8I 4JI2E 5BR8E 3LTOA 4Z7YA 3H4LA 4OX9I 4DR3I 4OX9E 4DR3E 3GONA 2ZBKB 1FJGI 1K47A 4XTJA 1HNWE 3M6AA 2UXCI 4X62I 4X62E 4JI0E 3WU6A 3LNUA 5A2QC 2E1RA 2VQEI 2VQEE 1XMOI 4PRVA 1XMOE 1OJ4A 2CZ9A 2V8PA 4PRXA 1ELOA 3QT8A 3B78A 1ZXMA 3K17A 1UEKA 4P52A 4PU9A 2EFGA 4DUZE 4X64E 3ZKDA 2OI2A 4DXLA 1A6FA 4K0KI 2HKEA 4DU7A 1FKAE 4JI3I 4JI3E 4LFCI 2NPFA 4DV2I 4DV2E 4LFCE 4DV7E 4JI6I 4JI6E 1EA6A 4LF8I 4LF8E 4DPTA 3J7AG 3LPSA 1I94I 4USMA 1I94E 4FWHA 4B3SE 3WU4A 1Z5BA 4X65I 1H72C 4X65E 1KKHA 1NHHA 4DU8A 4B3RI 4B3RE 1S16A 4YHHI 4YHHE 3OTOI 4JG4A 3OTOE 1ZM2A 4URLA 1Z0EA 5GMEA 4DPXA 2UUBI 4FW9A 2A2DA 2UUBE 2V34A 3V5RA 4JI7I 4ZVIA 4JI7E 2DEIA 5A2QQ 1ZM9A 2X7IA 3V2UC 4JI4E 3WU5A 1MG7A 4R1FA 4HACB 3ZZTA 3T1HI 4NXNE 3T1HE 4DV5I 4NXMI 4NXME 2Q2EB 2LJPA 1DARA 2HK3A 5L3JA 3QT5A 1N33I 1EI1A 1N33E 2E5LI 4FWGA 2E5LE 1HNZI 1HNZE 1Z5AA 4RPFA 5IWAI 1KVKA 5IWAE 4FWDA 1HNXI 1HNXE 2HFUA 5FLXC 3J80C 2F4VI 4JYAI 3WU3A 2F4VE 4JYAE 4JI5I 4LF9I 4JI5E 4LF9E 2HFSA 3ZZUA 2XEXA 2A2CA 3ZZ0A 1HNWI 4WUCA 4HACA 3ZM7A 2VQFI 4JI0I 2VQFE 4DV0I 4KHPI 4DV0E 4KHPE 4KQVA 1D6TA 4JV5I 4JV5E 2UUAI 2UUAE 2R3VA 4DUZI 4X64I 1XNRE 3D4JA 1H7UA 1NHJA 1Z0WA 5LL6R 4DV7I 1FWKA 3JAMC 2BV3A 3B82A 4B3SI 4GKKI 1VISA 4GKKE 2J7KA 4DPWA 3ZKBA 4LFAI 4LFAE 4DR4I 5LMUI 4DR4E 5LMUE 4DV3I 4YY3I 4DV3E 1Z0BA 4ED4A 4YY3E 1U2RA 4B3MI 4B3ME
chains in the Genus database with same CATH superfamily
3L7ZB 5LMNI 4OKGA 5LMNE 2PO0B 4WUDA 1Z0VA 4DR2E 1IBKE 1IBKI 2C39A 2F1DA 1IBMI 1IBME 4FW6A 4LF6E 2WW4A 4JI4I 4MYTA 4HXZA 1WUUA 4OO1D 2AJ4A 1PVGA 1UDOA 4DV1I 4DV1E 4NXNI 3PRYA 4IFDD 1Z5CA 4DR6I 4DR6E 4LCGA 1MU5A 3T1YE 4LFBI 1RHYA 2PNLA 4LFBE 1Z0TA 1H7SA 1Z0GA 4MYUA 4FW5A 4U3DA 2J65A 4LPFA 4UTGA 4AIDA 2CG9A 4AQYI 4AQYE 2WNRB 3JAMQ 3CDJA 2BA0G 2V2ZA 4LOMA 5C0XD 4MU3A 4DV4E 4BA2A 2UXDI 2UXDE 3QT7A 2BM0A 5DROA 4J3DA 4LCFA 3L7ZA 4GKJI 5IT9C 2JE6B 4GKJE 1QZRA 2V2QA 1R6LA 2BA1G 2VF3A 3PYEA 3PYFA 3U1KA 2BR2B 3QT6A 1PIEA 1XHKA 2HHHE 2JEBA 1FI4A 2Z5BB 4FN5A 3J7AM 4DPUA 2X36A 5DRRA 3B4TA 3P3CA 4DR1I 4DR1E 2UUCI 4DR5I 2UUCE 4DR5E 1FJGE 4DV6I 4DV6E 3CWVA 4NBQA 2JT2A 1YHCA 5DNLA 1H73A 3J81C 4EMDA 1XNRI 1NZ0A 2UXCE 1HK7A 1KTVA 1N0VC 2IOQA 4P7AA 2GO3A 2BM1A 2Z5CB 1N34I 1N34E 4Z7CA 4IS9A 4IFDE 4UT4A 1ZM3A 2JE6A 2ZM6I 1IBLI 4B3TI 4N3OA 2ZM6E 1IBLE 4B3TE 2WP8A 1BKNA 1H74A 4HYMA 4LF5I 4LF5E 5ELWA 2VESA 4K0KE 2BR2A 1FWLA 1ZM4A 1OYRA 2HKJA 4JI8I 4JI8E 4X66I 4X66E 5FLXQ 5C0XE 3J80Q 2HK2A 4DUYI 1J5EI 4DUYE 1J5EE 3B8HA 5IT9Q 1Y4SA 2ZITA 2UXBI 2UXBE 4FW4A 1MX0A 5C0XC 3HKMA 1HR0I 1HR0E 4DR2I 1N32I 1N32E 1XMQI 1XMQE 5K36D 1VI7A 4LF6I 4JI1I 4JI1E 1FNMA 1NHIA 1RR9A 5GMDA 3M7ND 3F0NA 4LF7I 4LF7E 2IERA 2R42A 4I3HA 2C38B 4IZJA 3PYDA 1B62A 3J81Q 1ZXNA 3T1YI 2NN6A 3PYGA 4LF4I 4LF4E 4DR7I 4DR7E 1N36I 5EL9A 1N36E 3PS3A 1KIJA 3H1CA 1Z0CA 4DV4I 4IZKB 3K1JA 4DV5E 1S4EA 4DPYA 5JEAE 2UU9I 4IZJD 2UU9E 4M1KA 2V2VA 1RREA 2IOPA 4USKA 4WUBA 3Q6MA 2DEJA 3Q1QA 1Z59A 2NN6D 2PO0A 1XNQI 1XNQE 1PKPA 2PNMA 1N0UA 4HY1A 5JEAC 4OO1F 3HULA 4IFDF 1USUA 2GS8A 2HHHI 3DD6A 1B63A 4JI2I 5BR8I 4JI2E 5BR8E 3LTOA 2C38A 4Z7YA 3H4LA 4OX9I 4DR3I 4OX9E 4DR3E 1UDQA 3GONA 2ZBKB 1FJGI 1K47A 4U3BA 4XTJA 1HNWE 5C0XF 2WNRA 3M6AA 2UXCI 4GQUA 4X62I 4X62E 4JI0E 5K36E 3WU6A 3LNUA 5A2QC 2E1RA 2VQEI 2VQEE 2GQ0A 1XMOI 4PRVA 1XMOE 4OO1E 1OJ4A 4OO1B 2JEAB 5K36C 2CZ9A 3P76A 2V8PA 4IFDB 4PRXA 1ELOA 3QT8A 3B78A 1ZXMA 4LCHA 2C37B 1UEKA 2O1UA 3K17A 4P52A 2EFGA 3PS1A 4PU9A 4OO1C 4DUZE 4X64E 3ZKDA 2OI2A 3Q6NA 4DXLA 1A6FA 3NZKA 4IFDC 4K0KI 2O1TA 2HKEA 4DU7A 1FKAE 4JI3I 4OZEA 4JI3E 2Z5BA 4LFCI 2NPFA 4DV2I 4DV2E 4LFCE 4DV7E 4JI6I 4JI6E 1EA6A 2PO1B 4LF8I 4LF8E 4DPTA 3J7AG 3M85D 3LPSA 5C0XB 4USMA 1I94E 4FWHA 2O1WA 1I94I 3P3EA 3WU4A 4B3SE 1Z5BA 1R6MA 4X65I 1H72C 4X65E 1Y6ZA 5EKWA 1KKHA 1NHHA 3KRNA 4DU8A 1UDNA 2PNZB 4B3RI 4B3RE 1S16A 4YHHI 4YHHE 3OTOI 4JG4A 3OTOE 5JEAF 1ZM2A 2Z5CA 2AE8A 4URLA 3M7NG 4FW3A 2JEAA 1Y60A 1Z0EA 5GMEA 4DPXA 2UUBI 4FW9A 2A2DA 2UUBE 2V34A 3UHMA 3V5RA 4JI7I 4ZVIA 4JI7E 2DEIA 5A2QQ 3HJCA 1ZM9A 2X7IA 3V2UC 4JI4E 2PO1A 3WU5A 1MG7A 4R1FA 4HACB 2CGEA 3ZZTA 5C0XA 1USVA 1UDSA 2JEBB 3T1HI 4MDTA 4NXNE 5DRQA 3T1HE 4DV5I 3GLLA 5DRPA 4NXMI 4NXME 2Q2EB 1OYSA 5JEAB 2LJPA 2PNZA 5K36F 2IESA 1DARA 2HK3A 5L3JA 3QT5A 1N33I 1EI1A 1N33E 2E5LI 3PS2A 4FWGA 2E5LE 1HNZI 1HNZE 5FWKA 1Z5AA 2BA0D 4RPFA 5IWAI 1KVKA 1E3PA 5IWAE 4FWDA 3GMEA 1HNXI 1HNXE 2HFUA 5FLXC 3J80C 3CDIA 4MU4A 2F4VI 4JYAI 3WU3A 2F4VE 4JYAE 4JI5I 4LF9I 4JI5E 4LF9E 4ISAA 2HFSA 3ZZUA 3U1YA 4AIMA 2WP8B 2BA1D 2XEXA 2A2CA 3ZZ0A 1HNWI 1Y5YA 4WUCA 4HACA 3ZM7A 2VQFI 4JI0I 2VQFE 4DV0I 4KHPI 4IZKA 4DV0E 4KHPE 5K36B 2O1VA 3K85A 4KQVA 4AM3A 1YH8A 5JEAA 2NN6F 1D6TA 4JV5I 4BA1B 5DNXA 2GO4A 4JV5E 2UUAI 3P06A 2UUAE 2R3VA 4DUZI 4X64I 1XNRE 2PO2B 2CVEA 3D4JA 1H7UA 1NHJA 1Z0WA 2C39B 5LL6R 4QNJA 4DV7I 1E3HA 3P3GA 1FWKA 3JAMC 5JEAD 2BV3A 3M85G 4MU1A 4MQYA 3B82A 2O3ZA 4B3SI 4FW7A 4GKKI 1Y4UA 1VISA 4IZJB 4GKKE 1XXEA 2J7KA 4DPWA 1P42A 2NN6E 2NN6B 3ZKBA 4LFAI 5K36A 4LFAE 2Z5EA 4MU0A 3GCMA 4QNKA 2NN6C 4OO1A 4DR4I 5LMUI 4DR4E 5LMUE 4BA1A 4DV3I 4YY3I 4DV3E 1Z0BA 4ED4A 4YY3E 4BA2B 4IFDA 1U2RA 4B3MI 1OYPA 4B3ME 2C37A 2PO2A
chains in the Genus database with same CATH topology
5LMNI 5LMNE 4DR2E 4WUDA 1Z0VA 1IBKE 1IBKI 1IBMI 1IBME 4LF6E 2WW4A 4JI4I 4MYTA 4HXZA 1WUUA 2AJ4A 1PVGA 4DV1I 4DV1E 4NXNI 3PRYA 1Z5CA 4DR6I 4DR6E 1MU5A 3T1YE 4LFBI 2PNLA 4LFBE 1Z0TA 1H7SA 1Z0GA 4MYUA 4UTGA 2CG9A 4AQYI 4AQYE 3JAMQ 2V2ZA 4DV4E 2UXDI 2UXDE 3QT7A 2BM0A 4GKJI 5IT9C 4GKJE 1QZRA 2V2QA 2VF3A 3PYEA 3PYFA 3QT6A 2HHHE 1PIEA 1XHKA 1FI4A 2Z5BB 4FN5A 3J7AM 4DPUA 2X36A 4DR1I 4DR1E 2UUCI 4DR5I 2UUCE 4DR5E 1FJGE 4DV6I 4DV6E 3CWVA 1H73A 3J81C 4EMDA 1XNRI 1NZ0A 2UXCE 1HK7A 1KTVA 1N0VC 2IOQA 4P7AA 2BM1A 2Z5CB 1N34I 1N34E 4Z7CA 4UT4A 1ZM3A 2ZM6I 1IBLI 4B3TI 4N3OA 2ZM6E 1IBLE 4B3TE 1BKNA 1H74A 4HYMA 4LF5I 4LF5E 4K0KE 1FWLA 1ZM4A 2HKJA 4JI8I 4JI8E 4X66I 4X66E 5FLXQ 3J80Q 2HK2A 4DUYI 1J5EI 4DUYE 1J5EE 3B8HA 5IT9Q 1Y4SA 2ZITA 2UXBI 2UXBE 1MX0A 1HR0I 1HR0E 4DR2I 1N32I 1N32E 1XMQI 1XMQE 4LF6I 4JI1I 4JI1E 1FNMA 1NHIA 1RR9A 5GMDA 3F0NA 4LF7I 4LF7E 2R42A 4I3HA 4IZJA 3PYDA 1B62A 3J81Q 1ZXNA 3T1YI 4LF4I 3PYGA 4LF4E 4DR7I 4DR7E 1N36I 1N36E 1KIJA 1Z0CA 4DV4I 4IZKB 3K1JA 4DV5E 1S4EA 4DPYA 2UU9I 4IZJD 2UU9E 4M1KA 2V2VA 1RREA 2IOPA 4USKA 4WUBA 3Q6MA 2DEJA 3Q1QA 1Z59A 1XNQI 1XNQE 1PKPA 2PNMA 1N0UA 4HY1A 3HULA 1USUA 2GS8A 2HHHI 1B63A 4JI2I 5BR8I 4JI2E 5BR8E 3LTOA 4Z7YA 3H4LA 4OX9I 4DR3I 4OX9E 4DR3E 3GONA 2ZBKB 1FJGI 1K47A 4XTJA 1HNWE 3M6AA 2UXCI 4X62I 4X62E 4JI0E 3WU6A 3LNUA 5A2QC 2E1RA 2VQEI 2VQEE 2GQ0A 1XMOI 4PRVA 1XMOE 1OJ4A 2CZ9A 2V8PA 4PRXA 1ELOA 3QT8A 3B78A 1ZXMA 2O1UA 1UEKA 3K17A 4P52A 4PU9A 2EFGA 4DUZE 4X64E 3ZKDA 2OI2A 3Q6NA 4DXLA 1A6FA 4K0KI 2O1TA 2HKEA 4DU7A 1FKAE 4JI3I 4JI3E 4DV2I 2Z5BA 4LFCI 2NPFA 4DV2E 4LFCE 4DV7E 4JI6I 4JI6E 1EA6A 4LF8I 4LF8E 4DPTA 3J7AG 3LPSA 1I94I 4USMA 1I94E 4FWHA 2O1WA 4B3SE 3WU4A 1Z5BA 4X65I 1H72C 4X65E 1Y6ZA 1KKHA 1NHHA 4DU8A 4B3RI 4B3RE 1S16A 4YHHI 4YHHE 3OTOI 4JG4A 3OTOE 1ZM2A 2Z5CA 4URLA 1Z0EA 5GMEA 4DPXA 2UUBI 4FW9A 2A2DA 2UUBE 2V34A 3V5RA 4JI7I 4ZVIA 4JI7E 2DEIA 5A2QQ 3HJCA 1ZM9A 2X7IA 3V2UC 4JI4E 3WU5A 1MG7A 4R1FA 4HACB 2CGEA 3ZZTA 1USVA 3T1HI 4NXNE 3T1HE 4DV5I 4NXMI 4NXME 2Q2EB 2LJPA 1DARA 2HK3A 5L3JA 3QT5A 1N33I 1EI1A 1N33E 2E5LI 4FWGA 2E5LE 1HNZI 1HNZE 5FWKA 1Z5AA 5IWAI 4RPFA 1KVKA 5IWAE 4FWDA 1HNXI 1HNXE 2HFUA 5FLXC 3J80C 2F4VI 4JYAI 3WU3A 2F4VE 4JYAE 4JI5I 4LF9I 4JI5E 4LF9E 2HFSA 3ZZUA 2XEXA 2A2CA 3ZZ0A 1HNWI 4WUCA 4HACA 3ZM7A 2VQFI 4JI0I 2VQFE 4DV0I 4KHPI 4IZKA 4DV0E 4KHPE 2O1VA 3K85A 4KQVA 1D6TA 4JV5I 4JV5E 2UUAI 3P06A 2UUAE 2R3VA 4DUZI 4X64I 1XNRE 3D4JA 1H7UA 1NHJA 1Z0WA 5LL6R 4DV7I 1FWKA 3JAMC 2BV3A 3B82A 4B3SI 4GKKI 1Y4UA 1VISA 4IZJB 4GKKE 2J7KA 4DPWA 3ZKBA 4LFAI 4LFAE 2Z5EA 4DR4I 5LMUI 4DR4E 5LMUE 4DV3I 4YY3I 4DV3E 1Z0BA 4ED4A 4YY3E 1U2RA 4B3MI 4B3ME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN I;  5LMN E;  4DR2 E;  4WUD A;  1Z0V A;  1IBK E;  1IBK I;  1IBM I;  1IBM E;  4LF6 E;  2WW4 A;  4JI4 I;  4MYT A;  4HXZ A;  1WUU A;  2AJ4 A;  1PVG A;  4DV1 I;  4DV1 E;  4NXN I;  1Z5C A;  4DR6 I;  4DR6 E;  1MU5 A;  3T1Y E;  4LFB I;  4LFB E;  1Z0T A;  1H7S A;  1Z0G A;  4MYU A;  4UTG A;  4AQY I;  4AQY E;  3JAM Q;  2V2Z A;  4DV4 E;  2UXD I;  2UXD E;  3QT7 A;  2BM0 A;  4GKJ I;  5IT9 C;  4GKJ E;  1QZR A;  2V2Q A;  2VF3 A;  3PYE A;  3PYF A;  3QT6 A;  2HHH E;  1PIE A;  1XHK A;  1FI4 A;  4FN5 A;  3J7A M;  4DPU A;  2X36 A;  4DR1 I;  4DR1 E;  2UUC I;  4DR5 I;  2UUC E;  4DR5 E;  1FJG E;  4DV6 I;  4DV6 E;  3CWV A;  1H73 A;  3J81 C;  4EMD A;  1XNR I;  1NZ0 A;  2UXC E;  1KTV A;  1N0V C;  4P7A A;  2BM1 A;  1N34 I;  1N34 E;  4Z7C A;  4UT4 A;  1ZM3 A;  2ZM6 I;  1IBL I;  4B3T I;  2ZM6 E;  1IBL E;  4B3T E;  1BKN A;  1H74 A;  4HYM A;  4LF5 I;  4LF5 E;  4K0K E;  1FWL A;  1ZM4 A;  2HKJ A;  4JI8 I;  4JI8 E;  4X66 I;  4X66 E;  5FLX Q;  3J80 Q;  2HK2 A;  4DUY I;  1J5E I;  4DUY E;  1J5E E;  3B8H A;  5IT9 Q;  2ZIT A;  2UXB I;  2UXB E;  1MX0 A;  1HR0 I;  1HR0 E;  4DR2 I;  1N32 I;  1N32 E;  1XMQ I;  1XMQ E;  4LF6 I;  4JI1 I;  4JI1 E;  1FNM A;  1NHI A;  1RR9 A;  5GMD A;  3F0N A;  4LF7 I;  4LF7 E;  2R42 A;  4I3H A;  3PYD A;  1B62 A;  3J81 Q;  1ZXN A;  3T1Y I;  4LF4 I;  3PYG A;  4LF4 E;  4DR7 I;  4DR7 E;  1N36 I;  1N36 E;  1KIJ A;  1Z0C A;  4DV4 I;  3K1J A;  4DV5 E;  1S4E A;  4DPY A;  2UU9 I;  2UU9 E;  4M1K A;  2V2V A;  1RRE A;  4USK A;  4WUB A;  3Q1Q A;  2DEJ A;  1Z59 A;  1XNQ I;  1XNQ E;  1PKP A;  1N0U A;  4HY1 A;  3HUL A;  2GS8 A;  2HHH I;  1B63 A;  4JI2 I;  5BR8 I;  4JI2 E;  5BR8 E;  3LTO A;  4Z7Y A;  3H4L A;  4OX9 I;  4DR3 I;  4OX9 E;  4DR3 E;  3GON A;  2ZBK B;  1FJG I;  1K47 A;  4XTJ A;  1HNW E;  3M6A A;  2UXC I;  4X62 I;  4X62 E;  4JI0 E;  3WU6 A;  3LNU A;  5A2Q C;  2E1R A;  2VQE I;  2VQE E;  1XMO I;  4PRV A;  1XMO E;  1OJ4 A;  2CZ9 A;  2V8P A;  4PRX A;  1ELO A;  3QT8 A;  3B78 A;  1ZXM A;  3K17 A;  1UEK A;  4P52 A;  4PU9 A;  2EFG A;  4DUZ E;  4X64 E;  3ZKD A;  2OI2 A;  4DXL A;  1A6F A;  4K0K I;  2HKE A;  4DU7 A;  1FKA E;  4JI3 I;  4JI3 E;  4LFC I;  2NPF A;  4DV2 I;  4DV2 E;  4LFC E;  4DV7 E;  4JI6 I;  4JI6 E;  1EA6 A;  4LF8 I;  4LF8 E;  4DPT A;  3J7A G;  3LPS A;  1I94 I;  4USM A;  1I94 E;  4FWH A;  4B3S E;  3WU4 A;  1Z5B A;  4X65 I;  1H72 C;  4X65 E;  1KKH A;  1NHH A;  4DU8 A;  4B3R I;  4B3R E;  1S16 A;  4YHH I;  4YHH E;  3OTO I;  4JG4 A;  3OTO E;  1ZM2 A;  4URL A;  1Z0E A;  5GME A;  4DPX A;  2UUB I;  4FW9 A;  2A2D A;  2UUB E;  2V34 A;  3V5R A;  4JI7 I;  4ZVI A;  4JI7 E;  2DEI A;  5A2Q Q;  1ZM9 A;  2X7I A;  3V2U C;  4JI4 E;  3WU5 A;  1MG7 A;  4R1F A;  4HAC B;  3ZZT A;  3T1H I;  4NXN E;  3T1H E;  4DV5 I;  4NXM I;  4NXM E;  2Q2E B;  2LJP A;  1DAR A;  2HK3 A;  5L3J A;  3QT5 A;  1N33 I;  1EI1 A;  1N33 E;  2E5L I;  4FWG A;  2E5L E;  1HNZ I;  1HNZ E;  1Z5A A;  4RPF A;  5IWA I;  1KVK A;  5IWA E;  4FWD A;  1HNX I;  1HNX E;  2HFU A;  5FLX C;  3J80 C;  2F4V I;  4JYA I;  3WU3 A;  2F4V E;  4JYA E;  4JI5 I;  4LF9 I;  4JI5 E;  4LF9 E;  2HFS A;  3ZZU A;  2XEX A;  2A2C A;  3ZZ0 A;  1HNW I;  4WUC A;  4HAC A;  3ZM7 A;  2VQF I;  4JI0 I;  2VQF E;  4DV0 I;  4KHP I;  4DV0 E;  4KHP E;  4KQV A;  1D6T A;  4JV5 I;  4JV5 E;  2UUA I;  2UUA E;  2R3V A;  4DUZ I;  4X64 I;  1XNR E;  3D4J A;  1H7U A;  1NHJ A;  1Z0W A;  5LL6 R;  4DV7 I;  1FWK A;  3JAM C;  2BV3 A;  3B82 A;  4B3S I;  4GKK I;  1VIS A;  4GKK E;  2J7K A;  4DPW A;  3ZKB A;  4LFA I;  4LFA E;  4DR4 I;  5LMU I;  4DR4 E;  5LMU E;  4DV3 I;  4YY3 I;  4DV3 E;  1Z0B A;  4ED4 A;  4YY3 E;  1U2R A;  4B3M I;  4B3M E; 
#chains in the Genus database with same CATH topology
 3L7Z B;  5LMN I;  4OKG A;  5LMN E;  2PO0 B;  4WUD A;  1Z0V A;  4DR2 E;  1IBK E;  1IBK I;  2C39 A;  2F1D A;  1IBM I;  1IBM E;  4FW6 A;  4LF6 E;  2WW4 A;  4JI4 I;  4MYT A;  4HXZ A;  1WUU A;  4OO1 D;  2AJ4 A;  1PVG A;  1UDO A;  4DV1 I;  4DV1 E;  4NXN I;  3PRY A;  4IFD D;  1Z5C A;  4DR6 I;  4DR6 E;  4LCG A;  1MU5 A;  3T1Y E;  4LFB I;  1RHY A;  2PNL A;  4LFB E;  1Z0T A;  1H7S A;  1Z0G A;  4MYU A;  4FW5 A;  4U3D A;  2J65 A;  4LPF A;  4UTG A;  4AID A;  2CG9 A;  4AQY I;  4AQY E;  2WNR B;  3JAM Q;  3CDJ A;  2BA0 G;  2V2Z A;  4LOM A;  5C0X D;  4MU3 A;  4DV4 E;  4BA2 A;  2UXD I;  2UXD E;  3QT7 A;  2BM0 A;  5DRO A;  4J3D A;  4LCF A;  3L7Z A;  4GKJ I;  5IT9 C;  2JE6 B;  4GKJ E;  1QZR A;  2V2Q A;  1R6L A;  2BA1 G;  2VF3 A;  3PYE A;  3PYF A;  3U1K A;  2BR2 B;  3QT6 A;  1PIE A;  1XHK A;  2HHH E;  2JEB A;  1FI4 A;  2Z5B B;  4FN5 A;  3J7A M;  4DPU A;  2X36 A;  5DRR A;  3B4T A;  3P3C A;  4DR1 I;  4DR1 E;  2UUC I;  4DR5 I;  2UUC E;  4DR5 E;  1FJG E;  4DV6 I;  4DV6 E;  3CWV A;  4NBQ A;  2JT2 A;  1YHC A;  5DNL A;  1H73 A;  3J81 C;  4EMD A;  1XNR I;  1NZ0 A;  2UXC E;  1HK7 A;  1KTV A;  1N0V C;  2IOQ A;  4P7A A;  2GO3 A;  2BM1 A;  2Z5C B;  1N34 I;  1N34 E;  4Z7C A;  4IS9 A;  4IFD E;  4UT4 A;  1ZM3 A;  2JE6 A;  2ZM6 I;  1IBL I;  4B3T I;  4N3O A;  2ZM6 E;  1IBL E;  4B3T E;  2WP8 A;  1BKN A;  1H74 A;  4HYM A;  4LF5 I;  4LF5 E;  5ELW A;  2VES A;  4K0K E;  2BR2 A;  1FWL A;  1ZM4 A;  1OYR A;  2HKJ A;  4JI8 I;  4JI8 E;  4X66 I;  4X66 E;  5FLX Q;  5C0X E;  3J80 Q;  2HK2 A;  4DUY I;  1J5E I;  4DUY E;  1J5E E;  3B8H A;  5IT9 Q;  1Y4S A;  2ZIT A;  2UXB I;  2UXB E;  4FW4 A;  1MX0 A;  5C0X C;  3HKM A;  1HR0 I;  1HR0 E;  4DR2 I;  1N32 I;  1N32 E;  1XMQ I;  1XMQ E;  5K36 D;  1VI7 A;  4LF6 I;  4JI1 I;  4JI1 E;  1FNM A;  1NHI A;  1RR9 A;  5GMD A;  3M7N D;  3F0N A;  4LF7 I;  4LF7 E;  2IER A;  2R42 A;  4I3H A;  2C38 B;  4IZJ A;  3PYD A;  1B62 A;  3J81 Q;  1ZXN A;  3T1Y I;  2NN6 A;  3PYG A;  4LF4 I;  4LF4 E;  4DR7 I;  4DR7 E;  1N36 I;  5EL9 A;  1N36 E;  3PS3 A;  1KIJ A;  3H1C A;  1Z0C A;  4DV4 I;  4IZK B;  3K1J A;  4DV5 E;  1S4E A;  4DPY A;  5JEA E;  2UU9 I;  4IZJ D;  2UU9 E;  4M1K A;  2V2V A;  1RRE A;  2IOP A;  4USK A;  4WUB A;  3Q6M A;  2DEJ A;  3Q1Q A;  1Z59 A;  2NN6 D;  2PO0 A;  1XNQ I;  1XNQ E;  1PKP A;  2PNM A;  1N0U A;  4HY1 A;  5JEA C;  4OO1 F;  3HUL A;  4IFD F;  1USU A;  2GS8 A;  2HHH I;  3DD6 A;  1B63 A;  4JI2 I;  5BR8 I;  4JI2 E;  5BR8 E;  3LTO A;  2C38 A;  4Z7Y A;  3H4L A;  4OX9 I;  4DR3 I;  4OX9 E;  4DR3 E;  1UDQ A;  3GON A;  2ZBK B;  1FJG I;  1K47 A;  4U3B A;  4XTJ A;  1HNW E;  5C0X F;  2WNR A;  3M6A A;  2UXC I;  4GQU A;  4X62 I;  4X62 E;  4JI0 E;  5K36 E;  3WU6 A;  3LNU A;  5A2Q C;  2E1R A;  2VQE I;  2VQE E;  2GQ0 A;  1XMO I;  4PRV A;  1XMO E;  4OO1 E;  1OJ4 A;  4OO1 B;  2JEA B;  5K36 C;  2CZ9 A;  3P76 A;  2V8P A;  4IFD B;  4PRX A;  1ELO A;  3QT8 A;  3B78 A;  1ZXM A;  4LCH A;  2C37 B;  1UEK A;  2O1U A;  3K17 A;  4P52 A;  2EFG A;  3PS1 A;  4PU9 A;  4OO1 C;  4DUZ E;  4X64 E;  3ZKD A;  2OI2 A;  3Q6N A;  4DXL A;  1A6F A;  3NZK A;  4IFD C;  4K0K I;  2O1T A;  2HKE A;  4DU7 A;  1FKA E;  4JI3 I;  4OZE A;  4JI3 E;  2Z5B A;  4LFC I;  2NPF A;  4DV2 I;  4DV2 E;  4LFC E;  4DV7 E;  4JI6 I;  4JI6 E;  1EA6 A;  2PO1 B;  4LF8 I;  4LF8 E;  4DPT A;  3J7A G;  3M85 D;  3LPS A;  5C0X B;  4USM A;  1I94 E;  4FWH A;  2O1W A;  1I94 I;  3P3E A;  3WU4 A;  4B3S E;  1Z5B A;  1R6M A;  4X65 I;  1H72 C;  4X65 E;  1Y6Z A;  5EKW A;  1KKH A;  1NHH A;  3KRN A;  4DU8 A;  1UDN A;  2PNZ B;  4B3R I;  4B3R E;  1S16 A;  4YHH I;  4YHH E;  3OTO I;  4JG4 A;  3OTO E;  5JEA F;  1ZM2 A;  2Z5C A;  2AE8 A;  4URL A;  3M7N G;  4FW3 A;  2JEA A;  1Y60 A;  1Z0E A;  5GME A;  4DPX A;  2UUB I;  4FW9 A;  2A2D A;  2UUB E;  2V34 A;  3UHM A;  3V5R A;  4JI7 I;  4ZVI A;  4JI7 E;  2DEI A;  5A2Q Q;  3HJC A;  1ZM9 A;  2X7I A;  3V2U C;  4JI4 E;  2PO1 A;  3WU5 A;  1MG7 A;  4R1F A;  4HAC B;  2CGE A;  3ZZT A;  5C0X A;  1USV A;  1UDS A;  2JEB B;  3T1H I;  4MDT A;  4NXN E;  5DRQ A;  3T1H E;  4DV5 I;  3GLL A;  5DRP A;  4NXM I;  4NXM E;  2Q2E B;  1OYS A;  5JEA B;  2LJP A;  2PNZ A;  5K36 F;  2IES A;  1DAR A;  2HK3 A;  5L3J A;  3QT5 A;  1N33 I;  1EI1 A;  1N33 E;  2E5L I;  3PS2 A;  4FWG A;  2E5L E;  1HNZ I;  1HNZ E;  5FWK A;  1Z5A A;  2BA0 D;  4RPF A;  5IWA I;  1KVK A;  1E3P A;  5IWA E;  4FWD A;  3GME A;  1HNX I;  1HNX E;  2HFU A;  5FLX C;  3J80 C;  3CDI A;  4MU4 A;  2F4V I;  4JYA I;  3WU3 A;  2F4V E;  4JYA E;  4JI5 I;  4LF9 I;  4JI5 E;  4LF9 E;  4ISA A;  2HFS A;  3ZZU A;  3U1Y A;  4AIM A;  2WP8 B;  2BA1 D;  2XEX A;  2A2C A;  3ZZ0 A;  1HNW I;  1Y5Y A;  4WUC A;  4HAC A;  3ZM7 A;  2VQF I;  4JI0 I;  2VQF E;  4DV0 I;  4KHP I;  4IZK A;  4DV0 E;  4KHP E;  5K36 B;  2O1V A;  3K85 A;  4KQV A;  4AM3 A;  1YH8 A;  5JEA A;  2NN6 F;  1D6T A;  4JV5 I;  4BA1 B;  5DNX A;  2GO4 A;  4JV5 E;  2UUA I;  3P06 A;  2UUA E;  2R3V A;  4DUZ I;  4X64 I;  1XNR E;  2PO2 B;  2CVE A;  3D4J A;  1H7U A;  1NHJ A;  1Z0W A;  2C39 B;  5LL6 R;  4QNJ A;  4DV7 I;  1E3H A;  3P3G A;  1FWK A;  3JAM C;  5JEA D;  2BV3 A;  3M85 G;  4MU1 A;  4MQY A;  3B82 A;  2O3Z A;  4B3S I;  4FW7 A;  4GKK I;  1Y4U A;  1VIS A;  4IZJ B;  4GKK E;  1XXE A;  2J7K A;  4DPW A;  1P42 A;  2NN6 E;  2NN6 B;  3ZKB A;  4LFA I;  5K36 A;  4LFA E;  2Z5E A;  4MU0 A;  3GCM A;  4QNK A;  2NN6 C;  4OO1 A;  4DR4 I;  5LMU I;  4DR4 E;  5LMU E;  4BA1 A;  4DV3 I;  4YY3 I;  4DV3 E;  1Z0B A;  4ED4 A;  4YY3 E;  4BA2 B;  4IFD A;  1U2R A;  4B3M I;  1OYP A;  4B3M E;  2C37 A;  2PO2 A; 
#chains in the Genus database with same CATH homology
 5LMN I;  5LMN E;  4DR2 E;  4WUD A;  1Z0V A;  1IBK E;  1IBK I;  1IBM I;  1IBM E;  4LF6 E;  2WW4 A;  4JI4 I;  4MYT A;  4HXZ A;  1WUU A;  2AJ4 A;  1PVG A;  4DV1 I;  4DV1 E;  4NXN I;  3PRY A;  1Z5C A;  4DR6 I;  4DR6 E;  1MU5 A;  3T1Y E;  4LFB I;  2PNL A;  4LFB E;  1Z0T A;  1H7S A;  1Z0G A;  4MYU A;  4UTG A;  2CG9 A;  4AQY I;  4AQY E;  3JAM Q;  2V2Z A;  4DV4 E;  2UXD I;  2UXD E;  3QT7 A;  2BM0 A;  4GKJ I;  5IT9 C;  4GKJ E;  1QZR A;  2V2Q A;  2VF3 A;  3PYE A;  3PYF A;  3QT6 A;  2HHH E;  1PIE A;  1XHK A;  1FI4 A;  2Z5B B;  4FN5 A;  3J7A M;  4DPU A;  2X36 A;  4DR1 I;  4DR1 E;  2UUC I;  4DR5 I;  2UUC E;  4DR5 E;  1FJG E;  4DV6 I;  4DV6 E;  3CWV A;  1H73 A;  3J81 C;  4EMD A;  1XNR I;  1NZ0 A;  2UXC E;  1HK7 A;  1KTV A;  1N0V C;  2IOQ A;  4P7A A;  2BM1 A;  2Z5C B;  1N34 I;  1N34 E;  4Z7C A;  4UT4 A;  1ZM3 A;  2ZM6 I;  1IBL I;  4B3T I;  4N3O A;  2ZM6 E;  1IBL E;  4B3T E;  1BKN A;  1H74 A;  4HYM A;  4LF5 I;  4LF5 E;  4K0K E;  1FWL A;  1ZM4 A;  2HKJ A;  4JI8 I;  4JI8 E;  4X66 I;  4X66 E;  5FLX Q;  3J80 Q;  2HK2 A;  4DUY I;  1J5E I;  4DUY E;  1J5E E;  3B8H A;  5IT9 Q;  1Y4S A;  2ZIT A;  2UXB I;  2UXB E;  1MX0 A;  1HR0 I;  1HR0 E;  4DR2 I;  1N32 I;  1N32 E;  1XMQ I;  1XMQ E;  4LF6 I;  4JI1 I;  4JI1 E;  1FNM A;  1NHI A;  1RR9 A;  5GMD A;  3F0N A;  4LF7 I;  4LF7 E;  2R42 A;  4I3H A;  4IZJ A;  3PYD A;  1B62 A;  3J81 Q;  1ZXN A;  3T1Y I;  4LF4 I;  3PYG A;  4LF4 E;  4DR7 I;  4DR7 E;  1N36 I;  1N36 E;  1KIJ A;  1Z0C A;  4DV4 I;  4IZK B;  3K1J A;  4DV5 E;  1S4E A;  4DPY A;  2UU9 I;  4IZJ D;  2UU9 E;  4M1K A;  2V2V A;  1RRE A;  2IOP A;  4USK A;  4WUB A;  3Q6M A;  2DEJ A;  3Q1Q A;  1Z59 A;  1XNQ I;  1XNQ E;  1PKP A;  2PNM A;  1N0U A;  4HY1 A;  3HUL A;  1USU A;  2GS8 A;  2HHH I;  1B63 A;  4JI2 I;  5BR8 I;  4JI2 E;  5BR8 E;  3LTO A;  4Z7Y A;  3H4L A;  4OX9 I;  4DR3 I;  4OX9 E;  4DR3 E;  3GON A;  2ZBK B;  1FJG I;  1K47 A;  4XTJ A;  1HNW E;  3M6A A;  2UXC I;  4X62 I;  4X62 E;  4JI0 E;  3WU6 A;  3LNU A;  5A2Q C;  2E1R A;  2VQE I;  2VQE E;  2GQ0 A;  1XMO I;  4PRV A;  1XMO E;  1OJ4 A;  2CZ9 A;  2V8P A;  4PRX A;  1ELO A;  3QT8 A;  3B78 A;  1ZXM A;  2O1U A;  1UEK A;  3K17 A;  4P52 A;  4PU9 A;  2EFG A;  4DUZ E;  4X64 E;  3ZKD A;  2OI2 A;  3Q6N A;  4DXL A;  1A6F A;  4K0K I;  2O1T A;  2HKE A;  4DU7 A;  1FKA E;  4JI3 I;  4JI3 E;  4DV2 I;  2Z5B A;  4LFC I;  2NPF A;  4DV2 E;  4LFC E;  4DV7 E;  4JI6 I;  4JI6 E;  1EA6 A;  4LF8 I;  4LF8 E;  4DPT A;  3J7A G;  3LPS A;  1I94 I;  4USM A;  1I94 E;  4FWH A;  2O1W A;  4B3S E;  3WU4 A;  1Z5B A;  4X65 I;  1H72 C;  4X65 E;  1Y6Z A;  1KKH A;  1NHH A;  4DU8 A;  4B3R I;  4B3R E;  1S16 A;  4YHH I;  4YHH E;  3OTO I;  4JG4 A;  3OTO E;  1ZM2 A;  2Z5C A;  4URL A;  1Z0E A;  5GME A;  4DPX A;  2UUB I;  4FW9 A;  2A2D A;  2UUB E;  2V34 A;  3V5R A;  4JI7 I;  4ZVI A;  4JI7 E;  2DEI A;  5A2Q Q;  3HJC A;  1ZM9 A;  2X7I A;  3V2U C;  4JI4 E;  3WU5 A;  1MG7 A;  4R1F A;  4HAC B;  2CGE A;  3ZZT A;  1USV A;  3T1H I;  4NXN E;  3T1H E;  4DV5 I;  4NXM I;  4NXM E;  2Q2E B;  2LJP A;  1DAR A;  2HK3 A;  5L3J A;  3QT5 A;  1N33 I;  1EI1 A;  1N33 E;  2E5L I;  4FWG A;  2E5L E;  1HNZ I;  1HNZ E;  5FWK A;  1Z5A A;  5IWA I;  4RPF A;  1KVK A;  5IWA E;  4FWD A;  1HNX I;  1HNX E;  2HFU A;  5FLX C;  3J80 C;  2F4V I;  4JYA I;  3WU3 A;  2F4V E;  4JYA E;  4JI5 I;  4LF9 I;  4JI5 E;  4LF9 E;  2HFS A;  3ZZU A;  2XEX A;  2A2C A;  3ZZ0 A;  1HNW I;  4WUC A;  4HAC A;  3ZM7 A;  2VQF I;  4JI0 I;  2VQF E;  4DV0 I;  4KHP I;  4IZK A;  4DV0 E;  4KHP E;  2O1V A;  3K85 A;  4KQV A;  1D6T A;  4JV5 I;  4JV5 E;  2UUA I;  3P06 A;  2UUA E;  2R3V A;  4DUZ I;  4X64 I;  1XNR E;  3D4J A;  1H7U A;  1NHJ A;  1Z0W A;  5LL6 R;  4DV7 I;  1FWK A;  3JAM C;  2BV3 A;  3B82 A;  4B3S I;  4GKK I;  1Y4U A;  1VIS A;  4IZJ B;  4GKK E;  2J7K A;  4DPW A;  3ZKB A;  4LFA I;  4LFA E;  2Z5E A;  4DR4 I;  5LMU I;  4DR4 E;  5LMU E;  4DV3 I;  4YY3 I;  4DV3 E;  1Z0B A;  4ED4 A;  4YY3 E;  1U2R A;  4B3M I;  4B3M E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...