1XHKA

Crystal structure of m. jannaschii lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
185
structure length
185
Chain Sequence
EPKVGVIYGLAVLGAGGIGDVTKIIVQILESKNPGTHLLNISGDIAKHSITLASALSKKLVAEKKLPLPKKDIDLNNKEIYIQFSQSYSKIDGDSATAAVCLAIISALLDIPLKQDFAITGSLDLSGNVLAIGGVNEKIEAAKRYGFKRVIIPEANMIDVIETEGIEIIPVKTLDEIVPLVFDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog
publication title The active site of a lon protease from Methanococcus jannaschii distinctly differs from the canonical catalytic Dyad of Lon proteases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
total genus 53
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2004-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xhkA00
2Q2EB 5A2QC 4X62E 1KVKA 2V34A 5BR8I 4NXNE 1S16A 4X65I 4ED4A 4DPYA 1XNRE 4USMA 4JI4I 4LF5I 1N0UA 2A2DA 4JI3E 1VISA 4FWDA 1OJ4A 1S4EA 4DR4I 4WUDA 1IBME 4DV0I 2XEXA 2UU9I 3QT8A 2V2QA 1BKNA 4JI7E 3D4JA 3B8HA 5IWAI 1FJGI 4FN5A 1Z5BA 4NXNI 4X62I 4DR2E 2UUBE 1XNRI 3B82A 1N33E 3V2UC 3WU5A 2EFGA 4JI3I 2UXDE 4B3SE 3F0NA 4DR1E 4DV2E 4DR3I 5GMEA 1IBMI 1NHHA 1IBKI 2DEIA 1HNXE 4WUBA 2VQFE 2CZ9A 4YY3I 1FWKA 4MYUA 1ELOA 4JI7I 2UUAI 1WUUA 4DR2I 1EI1A 2UUBI 3V5RA 1MX0A 3J80Q 5A2QQ 1N33I 4LFAE 2UXDI 1Z0TA 4B3SI 4DXLA 4DR1I 1H72C 4LFBE 4KHPI 4DPTA 1Z0WA 1HNXI 1Z5AA 1PVGA 4ZVIA 2VQFI 1N32I 4DU7A 1A6FA 4DU8A 4DUZE 1N36E 2HK2A 4DPXA 3QT5A 4LFAI 4JI1E 1FJGE 4LFBI 1RR9A 4DR5E 5GMDA 4JV5E 2OI2A 2HK3A 4B3TE 5LMNI 4URLA 3WU3A 4JI2I 2UXBE 4DR6E 1Z0GA 4XTJA 3J7AM 4DR3E 1Z0VA 4DUZI 1Z59A 1N36I 2R42A 1IBKE 4NXME 2ZITA 5LL6R 1NHJA 1ZXNA 4YY3E 3QT6A 1ZXMA 2UUAE 4JI1I 2R3VA 3QT7A 3ZZUA 3LPSA 4K0KE 1N0VC 4DR5I 4X64E 3ZZTA 4JV5I 4GKJE 1EA6A 4UT4A 4B3TI 4JYAI 1PKPA 2UXBI 1B62A 4DR6I 5FLXC 1PIEA 4MYTA 4KHPE 4LF6I 4X66E 1XNQE 4NXMI 4KQVA 4JI6E 2HFSA 2DEJA 4OX9I 3J81C 1NZ0A 5IT9C 1HNWE 1N32E 4B3RE 4M1KA 1KKHA 4K0KI 1ZM3A 4X64I 5L3JA 4DV1E 1FWLA 1Z0BA 4LFCE 4GKJI 1KTVA 4YHHE 1ZM2A 4USKA 4FWHA 3K1JA 3PYEA 4JG4A 3JAMC 3PYFA 2HFUA 3T1YE 4X66I 1XNQI 4I3HA 5LMNE 2BM0A 4JI6I 4JI2E 1HNWI 4B3RI 3OTOI 4UTGA 4LF4E 1H74A 1B63A 4DV3I 3PYDA 3ZKBA 1H7UA 2V2VA 4DV1I 4LFCI 4YHHI 3WU4A 2VF3A 4HACB 4GKKE 2V8PA 1MU5A 3T1YI 1K47A 3GONA 4LF8E 2ZBKB 2GS8A 5FLXQ 4LF9E 4B3ME 2J7KA 5LMUE 4DUYI 4JYAE 4DV6E 4DV5I 4LF4I 3J81Q 4LF6E 5IT9Q 2UUCI 3ZKDA 4OX9E 3LNUA 4PU9A 4R1FA 3WU6A 3K17A 4GKKI 2AJ4A 1KIJA 2ZM6I 2V2ZA 1Z0EA 4LF8I 4DV7E 3JAMQ 4LF9I 3PYGA 3T1HE 4B3MI 1FKAE 1RREA 5LMUI 4DV6I 1FNMA 4P7AA 2NPFA 1HNZE 1D6TA 1ZM9A 2BM1A 2E5LE 1Z5CA 3LTOA 4DR7E 4DPWA 4JI5E 4JI8E 4HXZA 4DV4E 1Z0CA 1J5EE 1XMQE 3H4LA 3OTOE 1N34E 1HR0E 3ZM7A 3J7AG 4DV3E 2VQEE 1IBLE 2HHHE 4LF7E 2E1RA 4DV7I 1I94E 3B78A 3CWVA 3T1HI 4JI0E 1FI4A 4FWGA 1HNZI 2E5LI 4DR7I 1MG7A 2X7IA 4JI5I 4DPUA 1XMOE 4JI8I 3HULA 4P52A 4DUYE 4FW9A 2UXCE 4DV4I 1J5EI 1NHIA 4Z7YA 2F4VE 1DARA 4AQYE 1XMQI 4DV5E 4HACA 1N34I 1QZRA 1HR0I 3ZZ0A 5BR8E 2VQEI 4DV2I 1IBLI 2HHHI 2UUCE 4X65E 4LF7I 4HY1A 4WUCA 1I94I 4JI4E 4LF5E 1H7SA 4JI0I 2WW4A 2LJPA 2ZM6E 4DR4E 3M6AA 4DV0E 1H73A 4Z7CA 1U2RA 2UU9E 4HYMA 1XMOI 1XHKA 1ZM4A 2UXCI 4PRXA 2HKJA 1UEKA 4EMDA 2BV3A 2F4VI 4RPFA 4AQYI 2A2CA 4PRVA 3Q1QA 2X36A 5IWAE 2HKEA 3J80C
chains in the Genus database with same CATH superfamily
2Q2EB 2PO0B 5A2QC 4X62E 1KVKA 2V34A 5BR8I 4NXNE 1S16A 4X65I 4ED4A 4DPYA 4U3DA 2CVEA 1XNRE 4USMA 4JI4I 2O1VA 4LF5I 1N0UA 2A2DA 4JI3E 1VISA 2PNZA 4FWDA 5C0XE 1OJ4A 4OO1D 1S4EA 4DR4I 4WUDA 1IBME 4DV0I 2XEXA 1Y6ZA 2UU9I 3Q6MA 3PS1A 3QT8A 5C0XC 4U3BA 2V2QA 1BKNA 2Z5CA 4JI7E 3H1CA 3D4JA 3B8HA 1HK7A 2C37B 5IWAI 3HKMA 2JEAB 1FJGI 4FN5A 1Z5BA 4NXNI 4X62I 5JEAF 3Q6NA 4DR2E 2UUBE 1XNRI 2PO1B 4AIDA 3B82A 1N33E 3V2UC 2O1WA 3WU5A 2EFGA 4JI3I 4OO1A 2UXDE 4LCGA 4B3SE 4N3OA 3F0NA 4BA1B 4DR1E 4DV2E 4LCHA 4DR3I 5GMEA 1IBMI 1NHHA 2GO3A 1IBKI 2DEIA 4IFDA 1HNXE 1UDQA 4WUBA 2JE6A 2CGEA 2VQFE 1USVA 2CZ9A 4YY3I 1FWKA 4GQUA 4MYUA 5K36B 1ELOA 4JI7I 2C39B 2PNLA 1USUA 1WUUA 2UUAI 5JEAD 3PRYA 4DR2I 4FW7A 1EI1A 2UUBI 3V5RA 2O3ZA 2Z5EA 1MX0A 3J80Q 2NN6C 5A2QQ 1N33I 1E3HA 4LFAE 2UXDI 2C38A 1Z0TA 2WP8A 4MU4A 4MU3A 4B3SI 4DXLA 4DR1I 4LOMA 1H72C 4LFBE 2NN6F 4KHPI 4FW6A 4DPTA 1Z0WA 1HNXI 1Z5AA 1PVGA 4ZVIA 2VQFI 2AE8A 1N32I 4OKGA 5DNLA 3L7ZA 4DU7A 1A6FA 4DU8A 4DUZE 1N36E 2HK2A 2IERA 4DPXA 2PO0A 5K36F 3QT5A 5C0XB 1UDSA 5FWKA 4IFDE 3PS3A 4LFAI 3DD6A 4JI1E 4AM3A 1FJGE 4J3DA 4LFBI 1UDOA 1RR9A 4DR5E 5GMDA 4IFDC 4JV5E 2OI2A 2HK3A 4B3TE 5LMNI 4URLA 3WU3A 4JI2I 2UXBE 4DR6E 1Z0GA 4XTJA 3J7AM 4BA2B 1Y60A 4DR3E 1Z0VA 4DUZI 1Z59A 1N36I 2R42A 3K85A 2JEAA 1IBKE 4NXME 5K36D 2ZITA 2IOQA 5LL6R 3GMEA 3P76A 4NBQA 1NHJA 4FW3A 1ZXNA 2PO1A 4YY3E 3QT6A 5EKWA 1ZXMA 2UUAE 4JI1I 2R3VA 3QT7A 2WNRB 5C0XF 3ZZUA 3LPSA 3P3GA 4K0KE 1N0VC 1UDNA 4X64E 4DR5I 3ZZTA 4JV5I 4GKJE 1EA6A 2BR2B 2NN6B 4UT4A 3PS2A 4ISAA 5DROA 4B3TI 4JYAI 4IS9A 4MU1A 2PNZB 1PKPA 2UXBI 1B62A 4DR6I 5FLXC 1PIEA 4MYTA 4KHPE 4LF6I 2C39A 5DRPA 4X66E 1XNQE 4NXMI 3U1YA 4KQVA 1R6MA 4JI6E 2HFSA 2DEJA 4OX9I 3J81C 1NZ0A 5IT9C 1HNWE 1N32E 4B3RE 5DRRA 5C0XD 3GCMA 4M1KA 4LPFA 1KKHA 4QNKA 4K0KI 1ZM3A 4X64I 4IZJB 5L3JA 4DV1E 1FWLA 1YH8A 1Z0BA 4LFCE 4GKJI 1KTVA 4YHHE 1ZM2A 4USKA 1XXEA 4FWHA 3K1JA 3PYEA 4JG4A 3JAMC 5ELWA 3P06A 2F1DA 2Z5BB 3PYFA 1Y4UA 2HFUA 3T1YE 4IZKA 3UHMA 4X66I 1XNQI 4IFDB 2BA1G 2JT2A 4LCFA 4I3HA 5LMNE 2BM0A 4JI6I 2CG9A 4JI2E 1HNWI 5JEAA 2PO2B 4B3RI 3M85D 3OTOI 4UTGA 4LF4E 1H74A 4OO1E 1B63A 4DV3I 3PYDA 3ZKBA 1H7UA 2V2VA 2PNMA 1YHCA 3P3CA 4DV1I 4LFCI 4YHHI 4OO1C 3WU4A 4FW5A 2VF3A 4HACB 2BA1D 1RHYA 4GKKE 1Y5YA 2NN6D 2V8PA 1MU5A 2JEBB 4BA2A 3T1YI 1K47A 3GONA 4OZEA 4LF8E 2ZBKB 2GS8A 5FLXQ 4LF9E 4B3ME 2J7KA 1VI7A 5LMUE 4DUYI 4JYAE 4DV6E 2BA0G 4DV5I 4IFDF 4MU0A 4LF4I 3J81Q 4LF6E 5IT9Q 2C37A 2UUCI 2WNRA 4QNJA 3ZKDA 4OX9E 3LNUA 4PU9A 3U1KA 2BR2A 1R6LA 2NN6A 4R1FA 3WU6A 3K17A 1Y4SA 4GKKI 2AJ4A 4IZJD 2IESA 1KIJA 5JEAE 2ZM6I 2V2ZA 1Z0EA 4BA1A 3M7NG 5DRQA 4LF8I 4DV7E 2BA0D 3JAMQ 4LF9I 3P3EA 3PYGA 3T1HE 4B3MI 1FKAE 3NZKA 1RREA 5LMUI 2O1UA 5JEAC 2O1TA 1OYPA 4DV6I 1FNMA 4IFDD 4P7AA 2NPFA 1HNZE 5K36A 1D6TA 4MDTA 1ZM9A 2BM1A 1OYSA 2E5LE 1Z5CA 3LTOA 4DR7E 4DPWA 4JI5E 4JI8E 2J65A 4HXZA 4DV4E 3M7ND 1Z0CA 1J5EE 4IZJA 2Z5CB 1XMQE 2GQ0A 3H4LA 3OTOE 3CDIA 1N34E 1HR0E 3ZM7A 3J7AG 4DV3E 1E3PA 2Z5BA 2VQEE 1IBLE 2HHHE 3CDJA 4LF7E 5EL9A 2E1RA 4DV7I 1OYRA 1I94E 3B78A 3M85G 3CWVA 3T1HI 4JI0E 1FI4A 4AIMA 4OO1B 2PO2A 4FWGA 1P42A 2NN6E 1HNZI 5DNXA 2E5LI 4DR7I 1MG7A 2X7IA 4JI5I 4DPUA 1XMOE 3KRNA 4JI8I 3HULA 4P52A 4DUYE 2GO4A 4FW9A 2UXCE 2JE6B 4DV4I 1J5EI 5C0XA 1NHIA 4Z7YA 2F4VE 1DARA 4AQYE 1XMQI 2IOPA 4DV5E 4MQYA 4HACA 1N34I 1QZRA 1HR0I 3ZZ0A 5BR8E 2VQEI 4DV2I 1IBLI 2HHHI 2UUCE 5K36E 4X65E 4LF7I 2JEBA 4HY1A 4WUCA 3GLLA 1I94I 4JI4E 4LF5E 1H7SA 4JI0I 2WW4A 2LJPA 2C38B 2WP8B 5K36C 2ZM6E 3HJCA 4IZKB 4DR4E 3M6AA 4FW4A 4DV0E 1H73A 4OO1F 4Z7CA 1U2RA 3B4TA 2UU9E 2VESA 4HYMA 1XMOI 1XHKA 1ZM4A 2UXCI 4PRXA 2HKJA 1UEKA 5JEAB 4EMDA 2BV3A 2F4VI 4RPFA 3L7ZB 4AQYI 2A2CA 4PRVA 3Q1QA 2X36A 5IWAE 2HKEA 3J80C
chains in the Genus database with same CATH topology
2Q2EB 5A2QC 4X62E 1KVKA 2V34A 5BR8I 4NXNE 1S16A 4X65I 4ED4A 4DPYA 1XNRE 4USMA 4JI4I 2O1VA 4LF5I 1N0UA 2A2DA 4JI3E 1VISA 4FWDA 1OJ4A 1S4EA 4DR4I 4WUDA 1IBME 4DV0I 2XEXA 1Y6ZA 2UU9I 3Q6MA 3QT8A 2V2QA 1BKNA 2Z5CA 4JI7E 3D4JA 3B8HA 1HK7A 5IWAI 1FJGI 4FN5A 1Z5BA 4NXNI 4X62I 4DR2E 3Q6NA 2UUBE 1XNRI 3B82A 1N33E 3V2UC 2O1WA 3WU5A 2EFGA 4JI3I 2UXDE 4B3SE 4N3OA 3F0NA 4DR1E 4DV2E 4DR3I 5GMEA 1IBMI 1NHHA 1IBKI 2DEIA 1HNXE 4WUBA 2VQFE 2CGEA 1USVA 2CZ9A 4YY3I 1FWKA 4MYUA 1ELOA 4JI7I 2PNLA 1USUA 1WUUA 2UUAI 3PRYA 4DR2I 1EI1A 2UUBI 3V5RA 2Z5EA 1MX0A 3J80Q 5A2QQ 1N33I 4LFAE 2UXDI 1Z0TA 4B3SI 4DXLA 4DR1I 1H72C 4LFBE 4KHPI 4DPTA 1Z0WA 1HNXI 1Z5AA 1PVGA 4ZVIA 2VQFI 1N32I 4DU7A 1A6FA 4DU8A 4DUZE 1N36E 2HK2A 4DPXA 3QT5A 5FWKA 4LFAI 4JI1E 1FJGE 4LFBI 1RR9A 4DR5E 5GMDA 4JV5E 2OI2A 2HK3A 4B3TE 5LMNI 4URLA 3WU3A 4JI2I 2UXBE 4DR6E 1Z0GA 4XTJA 3J7AM 4DR3E 1Z0VA 4DUZI 1Z59A 1N36I 2R42A 3K85A 1IBKE 4NXME 2ZITA 2IOQA 5LL6R 1NHJA 1ZXNA 4YY3E 3QT6A 1ZXMA 2UUAE 4JI1I 2R3VA 3QT7A 3ZZUA 3LPSA 4K0KE 1N0VC 4DR5I 4X64E 3ZZTA 4JV5I 4GKJE 1EA6A 4UT4A 4B3TI 4JYAI 1PKPA 2UXBI 1B62A 4DR6I 5FLXC 1PIEA 4MYTA 4KHPE 4LF6I 4X66E 1XNQE 4NXMI 4KQVA 4JI6E 2HFSA 2DEJA 4OX9I 3J81C 1NZ0A 5IT9C 1HNWE 1N32E 4B3RE 4M1KA 1KKHA 4K0KI 1ZM3A 4X64I 4IZJB 5L3JA 4DV1E 1FWLA 1Z0BA 4LFCE 4GKJI 1KTVA 4YHHE 1ZM2A 4USKA 4FWHA 3K1JA 3PYEA 4JG4A 3JAMC 3P06A 2Z5BB 3PYFA 1Y4UA 2HFUA 3T1YE 4IZKA 4X66I 1XNQI 4I3HA 5LMNE 2BM0A 4JI6I 2CG9A 4JI2E 1HNWI 4B3RI 3OTOI 4UTGA 4LF4E 1H74A 1B63A 4DV3I 3PYDA 3ZKBA 1H7UA 2V2VA 2PNMA 4DV1I 4LFCI 4YHHI 3WU4A 2VF3A 4HACB 4GKKE 2V8PA 1MU5A 3T1YI 1K47A 3GONA 4LF8E 2ZBKB 2GS8A 5FLXQ 4LF9E 4B3ME 2J7KA 5LMUE 4DUYI 4JYAE 4DV6E 4DV5I 4LF4I 3J81Q 4LF6E 5IT9Q 2UUCI 3ZKDA 4OX9E 3LNUA 4PU9A 4R1FA 3WU6A 3K17A 1Y4SA 4GKKI 2AJ4A 4IZJD 1KIJA 2ZM6I 2V2ZA 1Z0EA 4LF8I 4DV7E 3JAMQ 4LF9I 3PYGA 3T1HE 4B3MI 1FKAE 1RREA 5LMUI 2O1UA 2O1TA 4DV6I 1FNMA 4P7AA 2NPFA 1HNZE 1D6TA 1ZM9A 2BM1A 2E5LE 1Z5CA 3LTOA 4DR7E 4DPWA 4JI5E 4JI8E 4HXZA 4DV4E 1Z0CA 1J5EE 4IZJA 2Z5CB 1XMQE 2GQ0A 3H4LA 3OTOE 1N34E 1HR0E 3ZM7A 3J7AG 4DV3E 2VQEE 2Z5BA 1IBLE 2HHHE 4LF7E 2E1RA 4DV7I 1I94E 3B78A 3CWVA 3T1HI 4JI0E 1FI4A 4FWGA 1HNZI 2E5LI 4DR7I 1MG7A 2X7IA 4JI5I 4DPUA 1XMOE 4JI8I 3HULA 4P52A 4DUYE 4FW9A 2UXCE 4DV4I 1J5EI 1NHIA 4Z7YA 2F4VE 1DARA 4AQYE 1XMQI 2IOPA 4DV5E 4HACA 1N34I 1QZRA 1HR0I 3ZZ0A 5BR8E 2VQEI 4DV2I 1IBLI 2HHHI 2UUCE 4X65E 4LF7I 4HY1A 4WUCA 1I94I 4JI4E 4LF5E 1H7SA 4JI0I 2WW4A 2LJPA 2ZM6E 3HJCA 4IZKB 4DR4E 3M6AA 4DV0E 1H73A 4Z7CA 1U2RA 2UU9E 4HYMA 1XMOI 1XHKA 1ZM4A 2UXCI 4PRXA 2HKJA 1UEKA 4EMDA 2BV3A 2F4VI 4RPFA 4AQYI 2A2CA 4PRVA 3Q1QA 2X36A 5IWAE 2HKEA 3J80C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2E B;  5A2Q C;  4X62 E;  1KVK A;  2V34 A;  5BR8 I;  4NXN E;  1S16 A;  4X65 I;  4ED4 A;  4DPY A;  1XNR E;  4USM A;  4JI4 I;  4LF5 I;  1N0U A;  2A2D A;  4JI3 E;  1VIS A;  4FWD A;  1OJ4 A;  1S4E A;  4DR4 I;  4WUD A;  1IBM E;  4DV0 I;  2XEX A;  2UU9 I;  3QT8 A;  2V2Q A;  1BKN A;  4JI7 E;  3D4J A;  3B8H A;  5IWA I;  1FJG I;  4FN5 A;  1Z5B A;  4NXN I;  4X62 I;  4DR2 E;  2UUB E;  1XNR I;  3B82 A;  1N33 E;  3V2U C;  3WU5 A;  2EFG A;  4JI3 I;  2UXD E;  4B3S E;  3F0N A;  4DR1 E;  4DV2 E;  4DR3 I;  5GME A;  1IBM I;  1NHH A;  1IBK I;  2DEI A;  1HNX E;  4WUB A;  2VQF E;  2CZ9 A;  4YY3 I;  1FWK A;  4MYU A;  1ELO A;  4JI7 I;  2UUA I;  1WUU A;  4DR2 I;  1EI1 A;  2UUB I;  3V5R A;  1MX0 A;  3J80 Q;  5A2Q Q;  1N33 I;  4LFA E;  2UXD I;  1Z0T A;  4B3S I;  4DXL A;  4DR1 I;  1H72 C;  4LFB E;  4KHP I;  4DPT A;  1Z0W A;  1HNX I;  1Z5A A;  1PVG A;  4ZVI A;  2VQF I;  1N32 I;  4DU7 A;  1A6F A;  4DU8 A;  4DUZ E;  1N36 E;  2HK2 A;  4DPX A;  3QT5 A;  4LFA I;  4JI1 E;  1FJG E;  4LFB I;  1RR9 A;  4DR5 E;  5GMD A;  4JV5 E;  2OI2 A;  2HK3 A;  4B3T E;  5LMN I;  4URL A;  3WU3 A;  4JI2 I;  2UXB E;  4DR6 E;  1Z0G A;  4XTJ A;  3J7A M;  4DR3 E;  1Z0V A;  4DUZ I;  1Z59 A;  1N36 I;  2R42 A;  1IBK E;  4NXM E;  2ZIT A;  5LL6 R;  1NHJ A;  1ZXN A;  4YY3 E;  3QT6 A;  1ZXM A;  2UUA E;  4JI1 I;  2R3V A;  3QT7 A;  3ZZU A;  3LPS A;  4K0K E;  1N0V C;  4DR5 I;  4X64 E;  3ZZT A;  4JV5 I;  4GKJ E;  1EA6 A;  4UT4 A;  4B3T I;  4JYA I;  1PKP A;  2UXB I;  1B62 A;  4DR6 I;  5FLX C;  1PIE A;  4MYT A;  4KHP E;  4LF6 I;  4X66 E;  1XNQ E;  4NXM I;  4KQV A;  4JI6 E;  2HFS A;  2DEJ A;  4OX9 I;  3J81 C;  1NZ0 A;  5IT9 C;  1HNW E;  1N32 E;  4B3R E;  4M1K A;  1KKH A;  4K0K I;  1ZM3 A;  4X64 I;  5L3J A;  4DV1 E;  1FWL A;  1Z0B A;  4LFC E;  4GKJ I;  1KTV A;  4YHH E;  1ZM2 A;  4USK A;  4FWH A;  3K1J A;  3PYE A;  4JG4 A;  3JAM C;  3PYF A;  2HFU A;  3T1Y E;  4X66 I;  1XNQ I;  4I3H A;  5LMN E;  2BM0 A;  4JI6 I;  4JI2 E;  1HNW I;  4B3R I;  3OTO I;  4UTG A;  4LF4 E;  1H74 A;  1B63 A;  4DV3 I;  3PYD A;  3ZKB A;  1H7U A;  2V2V A;  4DV1 I;  4LFC I;  4YHH I;  3WU4 A;  2VF3 A;  4HAC B;  4GKK E;  2V8P A;  1MU5 A;  3T1Y I;  1K47 A;  3GON A;  4LF8 E;  2ZBK B;  2GS8 A;  5FLX Q;  4LF9 E;  4B3M E;  2J7K A;  5LMU E;  4DUY I;  4JYA E;  4DV6 E;  4DV5 I;  4LF4 I;  3J81 Q;  4LF6 E;  5IT9 Q;  2UUC I;  3ZKD A;  4OX9 E;  3LNU A;  4PU9 A;  4R1F A;  3WU6 A;  3K17 A;  4GKK I;  2AJ4 A;  1KIJ A;  2ZM6 I;  2V2Z A;  1Z0E A;  4LF8 I;  4DV7 E;  3JAM Q;  4LF9 I;  3PYG A;  3T1H E;  4B3M I;  1FKA E;  1RRE A;  5LMU I;  4DV6 I;  1FNM A;  4P7A A;  2NPF A;  1HNZ E;  1D6T A;  1ZM9 A;  2BM1 A;  2E5L E;  1Z5C A;  3LTO A;  4DR7 E;  4DPW A;  4JI5 E;  4JI8 E;  4HXZ A;  4DV4 E;  1Z0C A;  1J5E E;  1XMQ E;  3H4L A;  3OTO E;  1N34 E;  1HR0 E;  3ZM7 A;  3J7A G;  4DV3 E;  2VQE E;  1IBL E;  2HHH E;  4LF7 E;  2E1R A;  4DV7 I;  1I94 E;  3B78 A;  3CWV A;  3T1H I;  4JI0 E;  1FI4 A;  4FWG A;  1HNZ I;  2E5L I;  4DR7 I;  1MG7 A;  2X7I A;  4JI5 I;  4DPU A;  1XMO E;  4JI8 I;  3HUL A;  4P52 A;  4DUY E;  4FW9 A;  2UXC E;  4DV4 I;  1J5E I;  1NHI A;  4Z7Y A;  2F4V E;  1DAR A;  4AQY E;  1XMQ I;  4DV5 E;  4HAC A;  1N34 I;  1QZR A;  1HR0 I;  3ZZ0 A;  5BR8 E;  2VQE I;  4DV2 I;  1IBL I;  2HHH I;  2UUC E;  4X65 E;  4LF7 I;  4HY1 A;  4WUC A;  1I94 I;  4JI4 E;  4LF5 E;  1H7S A;  4JI0 I;  2WW4 A;  2LJP A;  2ZM6 E;  4DR4 E;  3M6A A;  4DV0 E;  1H73 A;  4Z7C A;  1U2R A;  2UU9 E;  4HYM A;  1XMO I;  1XHK A;  1ZM4 A;  2UXC I;  4PRX A;  2HKJ A;  1UEK A;  4EMD A;  2BV3 A;  2F4V I;  4RPF A;  4AQY I;  2A2C A;  4PRV A;  3Q1Q A;  2X36 A;  5IWA E;  2HKE A;  3J80 C; 
#chains in the Genus database with same CATH topology
 2Q2E B;  2PO0 B;  5A2Q C;  4X62 E;  1KVK A;  2V34 A;  5BR8 I;  4NXN E;  1S16 A;  4X65 I;  4ED4 A;  4DPY A;  4U3D A;  2CVE A;  1XNR E;  4USM A;  4JI4 I;  2O1V A;  4LF5 I;  1N0U A;  2A2D A;  4JI3 E;  1VIS A;  2PNZ A;  4FWD A;  5C0X E;  1OJ4 A;  4OO1 D;  1S4E A;  4DR4 I;  4WUD A;  1IBM E;  4DV0 I;  2XEX A;  1Y6Z A;  2UU9 I;  3Q6M A;  3PS1 A;  3QT8 A;  5C0X C;  4U3B A;  2V2Q A;  1BKN A;  2Z5C A;  4JI7 E;  3H1C A;  3D4J A;  3B8H A;  1HK7 A;  2C37 B;  5IWA I;  3HKM A;  2JEA B;  1FJG I;  4FN5 A;  1Z5B A;  4NXN I;  4X62 I;  5JEA F;  3Q6N A;  4DR2 E;  2UUB E;  1XNR I;  2PO1 B;  4AID A;  3B82 A;  1N33 E;  3V2U C;  2O1W A;  3WU5 A;  2EFG A;  4JI3 I;  4OO1 A;  2UXD E;  4LCG A;  4B3S E;  4N3O A;  3F0N A;  4BA1 B;  4DR1 E;  4DV2 E;  4LCH A;  4DR3 I;  5GME A;  1IBM I;  1NHH A;  2GO3 A;  1IBK I;  2DEI A;  4IFD A;  1HNX E;  1UDQ A;  4WUB A;  2JE6 A;  2CGE A;  2VQF E;  1USV A;  2CZ9 A;  4YY3 I;  1FWK A;  4GQU A;  4MYU A;  5K36 B;  1ELO A;  4JI7 I;  2C39 B;  2PNL A;  1USU A;  1WUU A;  2UUA I;  5JEA D;  3PRY A;  4DR2 I;  4FW7 A;  1EI1 A;  2UUB I;  3V5R A;  2O3Z A;  2Z5E A;  1MX0 A;  3J80 Q;  2NN6 C;  5A2Q Q;  1N33 I;  1E3H A;  4LFA E;  2UXD I;  2C38 A;  1Z0T A;  2WP8 A;  4MU4 A;  4MU3 A;  4B3S I;  4DXL A;  4DR1 I;  4LOM A;  1H72 C;  4LFB E;  2NN6 F;  4KHP I;  4FW6 A;  4DPT A;  1Z0W A;  1HNX I;  1Z5A A;  1PVG A;  4ZVI A;  2VQF I;  2AE8 A;  1N32 I;  4OKG A;  5DNL A;  3L7Z A;  4DU7 A;  1A6F A;  4DU8 A;  4DUZ E;  1N36 E;  2HK2 A;  2IER A;  4DPX A;  2PO0 A;  5K36 F;  3QT5 A;  5C0X B;  1UDS A;  5FWK A;  4IFD E;  3PS3 A;  4LFA I;  3DD6 A;  4JI1 E;  4AM3 A;  1FJG E;  4J3D A;  4LFB I;  1UDO A;  1RR9 A;  4DR5 E;  5GMD A;  4IFD C;  4JV5 E;  2OI2 A;  2HK3 A;  4B3T E;  5LMN I;  4URL A;  3WU3 A;  4JI2 I;  2UXB E;  4DR6 E;  1Z0G A;  4XTJ A;  3J7A M;  4BA2 B;  1Y60 A;  4DR3 E;  1Z0V A;  4DUZ I;  1Z59 A;  1N36 I;  2R42 A;  3K85 A;  2JEA A;  1IBK E;  4NXM E;  5K36 D;  2ZIT A;  2IOQ A;  5LL6 R;  3GME A;  3P76 A;  4NBQ A;  1NHJ A;  4FW3 A;  1ZXN A;  2PO1 A;  4YY3 E;  3QT6 A;  5EKW A;  1ZXM A;  2UUA E;  4JI1 I;  2R3V A;  3QT7 A;  2WNR B;  5C0X F;  3ZZU A;  3LPS A;  3P3G A;  4K0K E;  1N0V C;  1UDN A;  4X64 E;  4DR5 I;  3ZZT A;  4JV5 I;  4GKJ E;  1EA6 A;  2BR2 B;  2NN6 B;  4UT4 A;  3PS2 A;  4ISA A;  5DRO A;  4B3T I;  4JYA I;  4IS9 A;  4MU1 A;  2PNZ B;  1PKP A;  2UXB I;  1B62 A;  4DR6 I;  5FLX C;  1PIE A;  4MYT A;  4KHP E;  4LF6 I;  2C39 A;  5DRP A;  4X66 E;  1XNQ E;  4NXM I;  3U1Y A;  4KQV A;  1R6M A;  4JI6 E;  2HFS A;  2DEJ A;  4OX9 I;  3J81 C;  1NZ0 A;  5IT9 C;  1HNW E;  1N32 E;  4B3R E;  5DRR A;  5C0X D;  3GCM A;  4M1K A;  4LPF A;  1KKH A;  4QNK A;  4K0K I;  1ZM3 A;  4X64 I;  4IZJ B;  5L3J A;  4DV1 E;  1FWL A;  1YH8 A;  1Z0B A;  4LFC E;  4GKJ I;  1KTV A;  4YHH E;  1ZM2 A;  4USK A;  1XXE A;  4FWH A;  3K1J A;  3PYE A;  4JG4 A;  3JAM C;  5ELW A;  3P06 A;  2F1D A;  2Z5B B;  3PYF A;  1Y4U A;  2HFU A;  3T1Y E;  4IZK A;  3UHM A;  4X66 I;  1XNQ I;  4IFD B;  2BA1 G;  2JT2 A;  4LCF A;  4I3H A;  5LMN E;  2BM0 A;  4JI6 I;  2CG9 A;  4JI2 E;  1HNW I;  5JEA A;  2PO2 B;  4B3R I;  3M85 D;  3OTO I;  4UTG A;  4LF4 E;  1H74 A;  4OO1 E;  1B63 A;  4DV3 I;  3PYD A;  3ZKB A;  1H7U A;  2V2V A;  2PNM A;  1YHC A;  3P3C A;  4DV1 I;  4LFC I;  4YHH I;  4OO1 C;  3WU4 A;  4FW5 A;  2VF3 A;  4HAC B;  2BA1 D;  1RHY A;  4GKK E;  1Y5Y A;  2NN6 D;  2V8P A;  1MU5 A;  2JEB B;  4BA2 A;  3T1Y I;  1K47 A;  3GON A;  4OZE A;  4LF8 E;  2ZBK B;  2GS8 A;  5FLX Q;  4LF9 E;  4B3M E;  2J7K A;  1VI7 A;  5LMU E;  4DUY I;  4JYA E;  4DV6 E;  2BA0 G;  4DV5 I;  4IFD F;  4MU0 A;  4LF4 I;  3J81 Q;  4LF6 E;  5IT9 Q;  2C37 A;  2UUC I;  2WNR A;  4QNJ A;  3ZKD A;  4OX9 E;  3LNU A;  4PU9 A;  3U1K A;  2BR2 A;  1R6L A;  2NN6 A;  4R1F A;  3WU6 A;  3K17 A;  1Y4S A;  4GKK I;  2AJ4 A;  4IZJ D;  2IES A;  1KIJ A;  5JEA E;  2ZM6 I;  2V2Z A;  1Z0E A;  4BA1 A;  3M7N G;  5DRQ A;  4LF8 I;  4DV7 E;  2BA0 D;  3JAM Q;  4LF9 I;  3P3E A;  3PYG A;  3T1H E;  4B3M I;  1FKA E;  3NZK A;  1RRE A;  5LMU I;  2O1U A;  5JEA C;  2O1T A;  1OYP A;  4DV6 I;  1FNM A;  4IFD D;  4P7A A;  2NPF A;  1HNZ E;  5K36 A;  1D6T A;  4MDT A;  1ZM9 A;  2BM1 A;  1OYS A;  2E5L E;  1Z5C A;  3LTO A;  4DR7 E;  4DPW A;  4JI5 E;  4JI8 E;  2J65 A;  4HXZ A;  4DV4 E;  3M7N D;  1Z0C A;  1J5E E;  4IZJ A;  2Z5C B;  1XMQ E;  2GQ0 A;  3H4L A;  3OTO E;  3CDI A;  1N34 E;  1HR0 E;  3ZM7 A;  3J7A G;  4DV3 E;  1E3P A;  2Z5B A;  2VQE E;  1IBL E;  2HHH E;  3CDJ A;  4LF7 E;  5EL9 A;  2E1R A;  4DV7 I;  1OYR A;  1I94 E;  3B78 A;  3M85 G;  3CWV A;  3T1H I;  4JI0 E;  1FI4 A;  4AIM A;  4OO1 B;  2PO2 A;  4FWG A;  1P42 A;  2NN6 E;  1HNZ I;  5DNX A;  2E5L I;  4DR7 I;  1MG7 A;  2X7I A;  4JI5 I;  4DPU A;  1XMO E;  3KRN A;  4JI8 I;  3HUL A;  4P52 A;  4DUY E;  2GO4 A;  4FW9 A;  2UXC E;  2JE6 B;  4DV4 I;  1J5E I;  5C0X A;  1NHI A;  4Z7Y A;  2F4V E;  1DAR A;  4AQY E;  1XMQ I;  2IOP A;  4DV5 E;  4MQY A;  4HAC A;  1N34 I;  1QZR A;  1HR0 I;  3ZZ0 A;  5BR8 E;  2VQE I;  4DV2 I;  1IBL I;  2HHH I;  2UUC E;  5K36 E;  4X65 E;  4LF7 I;  2JEB A;  4HY1 A;  4WUC A;  3GLL A;  1I94 I;  4JI4 E;  4LF5 E;  1H7S A;  4JI0 I;  2WW4 A;  2LJP A;  2C38 B;  2WP8 B;  5K36 C;  2ZM6 E;  3HJC A;  4IZK B;  4DR4 E;  3M6A A;  4FW4 A;  4DV0 E;  1H73 A;  4OO1 F;  4Z7C A;  1U2R A;  3B4T A;  2UU9 E;  2VES A;  4HYM A;  1XMO I;  1XHK A;  1ZM4 A;  2UXC I;  4PRX A;  2HKJ A;  1UEK A;  5JEA B;  4EMD A;  2BV3 A;  2F4V I;  4RPF A;  3L7Z B;  4AQY I;  2A2C A;  4PRV A;  3Q1Q A;  2X36 A;  5IWA E;  2HKE A;  3J80 C; 
#chains in the Genus database with same CATH homology
 2Q2E B;  5A2Q C;  4X62 E;  1KVK A;  2V34 A;  5BR8 I;  4NXN E;  1S16 A;  4X65 I;  4ED4 A;  4DPY A;  1XNR E;  4USM A;  4JI4 I;  2O1V A;  4LF5 I;  1N0U A;  2A2D A;  4JI3 E;  1VIS A;  4FWD A;  1OJ4 A;  1S4E A;  4DR4 I;  4WUD A;  1IBM E;  4DV0 I;  2XEX A;  1Y6Z A;  2UU9 I;  3Q6M A;  3QT8 A;  2V2Q A;  1BKN A;  2Z5C A;  4JI7 E;  3D4J A;  3B8H A;  1HK7 A;  5IWA I;  1FJG I;  4FN5 A;  1Z5B A;  4NXN I;  4X62 I;  4DR2 E;  3Q6N A;  2UUB E;  1XNR I;  3B82 A;  1N33 E;  3V2U C;  2O1W A;  3WU5 A;  2EFG A;  4JI3 I;  2UXD E;  4B3S E;  4N3O A;  3F0N A;  4DR1 E;  4DV2 E;  4DR3 I;  5GME A;  1IBM I;  1NHH A;  1IBK I;  2DEI A;  1HNX E;  4WUB A;  2VQF E;  2CGE A;  1USV A;  2CZ9 A;  4YY3 I;  1FWK A;  4MYU A;  1ELO A;  4JI7 I;  2PNL A;  1USU A;  1WUU A;  2UUA I;  3PRY A;  4DR2 I;  1EI1 A;  2UUB I;  3V5R A;  2Z5E A;  1MX0 A;  3J80 Q;  5A2Q Q;  1N33 I;  4LFA E;  2UXD I;  1Z0T A;  4B3S I;  4DXL A;  4DR1 I;  1H72 C;  4LFB E;  4KHP I;  4DPT A;  1Z0W A;  1HNX I;  1Z5A A;  1PVG A;  4ZVI A;  2VQF I;  1N32 I;  4DU7 A;  1A6F A;  4DU8 A;  4DUZ E;  1N36 E;  2HK2 A;  4DPX A;  3QT5 A;  5FWK A;  4LFA I;  4JI1 E;  1FJG E;  4LFB I;  1RR9 A;  4DR5 E;  5GMD A;  4JV5 E;  2OI2 A;  2HK3 A;  4B3T E;  5LMN I;  4URL A;  3WU3 A;  4JI2 I;  2UXB E;  4DR6 E;  1Z0G A;  4XTJ A;  3J7A M;  4DR3 E;  1Z0V A;  4DUZ I;  1Z59 A;  1N36 I;  2R42 A;  3K85 A;  1IBK E;  4NXM E;  2ZIT A;  2IOQ A;  5LL6 R;  1NHJ A;  1ZXN A;  4YY3 E;  3QT6 A;  1ZXM A;  2UUA E;  4JI1 I;  2R3V A;  3QT7 A;  3ZZU A;  3LPS A;  4K0K E;  1N0V C;  4DR5 I;  4X64 E;  3ZZT A;  4JV5 I;  4GKJ E;  1EA6 A;  4UT4 A;  4B3T I;  4JYA I;  1PKP A;  2UXB I;  1B62 A;  4DR6 I;  5FLX C;  1PIE A;  4MYT A;  4KHP E;  4LF6 I;  4X66 E;  1XNQ E;  4NXM I;  4KQV A;  4JI6 E;  2HFS A;  2DEJ A;  4OX9 I;  3J81 C;  1NZ0 A;  5IT9 C;  1HNW E;  1N32 E;  4B3R E;  4M1K A;  1KKH A;  4K0K I;  1ZM3 A;  4X64 I;  4IZJ B;  5L3J A;  4DV1 E;  1FWL A;  1Z0B A;  4LFC E;  4GKJ I;  1KTV A;  4YHH E;  1ZM2 A;  4USK A;  4FWH A;  3K1J A;  3PYE A;  4JG4 A;  3JAM C;  3P06 A;  2Z5B B;  3PYF A;  1Y4U A;  2HFU A;  3T1Y E;  4IZK A;  4X66 I;  1XNQ I;  4I3H A;  5LMN E;  2BM0 A;  4JI6 I;  2CG9 A;  4JI2 E;  1HNW I;  4B3R I;  3OTO I;  4UTG A;  4LF4 E;  1H74 A;  1B63 A;  4DV3 I;  3PYD A;  3ZKB A;  1H7U A;  2V2V A;  2PNM A;  4DV1 I;  4LFC I;  4YHH I;  3WU4 A;  2VF3 A;  4HAC B;  4GKK E;  2V8P A;  1MU5 A;  3T1Y I;  1K47 A;  3GON A;  4LF8 E;  2ZBK B;  2GS8 A;  5FLX Q;  4LF9 E;  4B3M E;  2J7K A;  5LMU E;  4DUY I;  4JYA E;  4DV6 E;  4DV5 I;  4LF4 I;  3J81 Q;  4LF6 E;  5IT9 Q;  2UUC I;  3ZKD A;  4OX9 E;  3LNU A;  4PU9 A;  4R1F A;  3WU6 A;  3K17 A;  1Y4S A;  4GKK I;  2AJ4 A;  4IZJ D;  1KIJ A;  2ZM6 I;  2V2Z A;  1Z0E A;  4LF8 I;  4DV7 E;  3JAM Q;  4LF9 I;  3PYG A;  3T1H E;  4B3M I;  1FKA E;  1RRE A;  5LMU I;  2O1U A;  2O1T A;  4DV6 I;  1FNM A;  4P7A A;  2NPF A;  1HNZ E;  1D6T A;  1ZM9 A;  2BM1 A;  2E5L E;  1Z5C A;  3LTO A;  4DR7 E;  4DPW A;  4JI5 E;  4JI8 E;  4HXZ A;  4DV4 E;  1Z0C A;  1J5E E;  4IZJ A;  2Z5C B;  1XMQ E;  2GQ0 A;  3H4L A;  3OTO E;  1N34 E;  1HR0 E;  3ZM7 A;  3J7A G;  4DV3 E;  2VQE E;  2Z5B A;  1IBL E;  2HHH E;  4LF7 E;  2E1R A;  4DV7 I;  1I94 E;  3B78 A;  3CWV A;  3T1H I;  4JI0 E;  1FI4 A;  4FWG A;  1HNZ I;  2E5L I;  4DR7 I;  1MG7 A;  2X7I A;  4JI5 I;  4DPU A;  1XMO E;  4JI8 I;  3HUL A;  4P52 A;  4DUY E;  4FW9 A;  2UXC E;  4DV4 I;  1J5E I;  1NHI A;  4Z7Y A;  2F4V E;  1DAR A;  4AQY E;  1XMQ I;  2IOP A;  4DV5 E;  4HAC A;  1N34 I;  1QZR A;  1HR0 I;  3ZZ0 A;  5BR8 E;  2VQE I;  4DV2 I;  1IBL I;  2HHH I;  2UUC E;  4X65 E;  4LF7 I;  4HY1 A;  4WUC A;  1I94 I;  4JI4 E;  4LF5 E;  1H7S A;  4JI0 I;  2WW4 A;  2LJP A;  2ZM6 E;  3HJC A;  4IZK B;  4DR4 E;  3M6A A;  4DV0 E;  1H73 A;  4Z7C A;  1U2R A;  2UU9 E;  4HYM A;  1XMO I;  1XHK A;  1ZM4 A;  2UXC I;  4PRX A;  2HKJ A;  1UEK A;  4EMD A;  2BV3 A;  2F4V I;  4RPF A;  4AQY I;  2A2C A;  4PRV A;  3Q1Q A;  2X36 A;  5IWA E;  2HKE A;  3J80 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...