1XHKA

Crystal structure of m. jannaschii lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
185
structure length
185
Chain Sequence
EPKVGVIYGLAVLGAGGIGDVTKIIVQILESKNPGTHLLNISGDIAKHSITLASALSKKLVAEKKLPLPKKDIDLNNKEIYIQFSQSYSKIDGDSATAAVCLAIISALLDIPLKQDFAITGSLDLSGNVLAIGGVNEKIEAAKRYGFKRVIIPEANMIDVIETEGIEIIPVKTLDEIVPLVFDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Putative protease La homolog
publication title The active site of a lon protease from Methanococcus jannaschii distinctly differs from the canonical catalytic Dyad of Lon proteases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 53
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2004-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xhkA00
4DV0I 5BR8E 4DUZE 3B78A 5A2QQ 4URLA 1MX0A 4JI7I 4LF6I 4PU9A 4X64E 2LJPA 1HNXE 4HACB 3WU4A 2V2VA 5LMNE 3OTOI 2UUCE 4OX9E 4GKJI 4DR2E 2VQFI 4JV5I 4B3MI 1IBLI 4JI5E 4X62I 4HYMA 4DR1I 1HNZI 1FKAE 4B3SI 1KTVA 3V2UC 2A2DA 3T1YE 3ZM7A 4DR6I 4DR3I 4LF9I 1HNWI 2AJ4A 3PYGA 4JYAI 3ZZUA 4B3TE 4LF8I 2J7KA 4KHPI 5LMUE 1EI1A 2R3VA 2UXBE 4FWDA 4DR4I 3LTOA 1N0VC 2ZM6I 5IT9Q 4JI1I 4DXLA 2BM0A 4X65I 4LF5E 1J5EE 3CWVA 1XNQE 4YHHI 4DV5I 1MU5A 2V2QA 4USMA 3F0NA 4JI6I 2UXDE 3ZZTA 1Z0CA 4XTJA 1OJ4A 3GONA 1IBKE 1XNRI 3J81Q 4AQYE 4LF7I 1D6TA 1Z0WA 3J80Q 2CZ9A 4DV1I 4M1KA 3V5RA 1XMOI 4GKKE 4K0KI 4FWHA 4MYUA 4R1FA 1NZ0A 3J81C 4NXMI 5L3JA 1HR0E 2VF3A 5GMEA 4X66E 3ZKDA 2ZITA 4MYTA 4JI4E 4JG4A 4LFAI 4DPXA 4DV4I 2V2ZA 1ZXMA 1PIEA 2HK2A 4LFCI 4DV2I 4NXNI 5LL6R 4JI3I 4DR5I 4KHPE 3HULA 4JI0E 1Z5CA 1A6FA 3J7AM 4DR4E 1FWLA 4DV3I 1QZRA 2HFUA 3JAMQ 1Z59A 4JI1E 4LFBE 3B82A 1XMQE 4Z7YA 3K1JA 2E5LE 4LF4I 1FWKA 3ZKBA 1N33I 4HY1A 2V34A 4Z7CA 5A2QC 4YY3I 4HXZA 2A2CA 2UUBI 3LPSA 1IBME 2BV3A 2V8PA 2Q2EB 2UUAE 1MG7A 4LF7E 5GMDA 4JI2I 1N36E 1I94E 4DUYE 1Z5AA 4DPWA 5IWAI 4DR7E 1PKPA 2UXCI 1FJGI 4B3RE 3QT5A 4JI8E 3QT7A 1N32I 4WUDA 2HHHE 1ELOA 4LFAE 3WU6A 2ZBKB 3T1HE 1H7UA 2F4VI 1ZM9A 4UTGA 1KIJA 2HKJA 4USKA 1N34E 1Z0EA 4DV6E 1B63A 4DV7E 5IT9C 2OI2A 4DV0E 1ZM3A 4JI7E 4LF6E 5BR8I 4DUZI 3PYEA 1H74A 5FLXQ 2UU9I 4LF4E 4X64I 3ZZ0A 3QT8A 3OTOE 1RREA 1FNMA 4UT4A 1HNXI 2HKEA 4GKJE 5LMNI 2VQFE 2UUCI 4JV5E 1Z5BA 4OX9I 2NPFA 4DR2I 4B3ME 4FW9A 4P7AA 1IBLE 3J80C 2EFGA 4DPUA 1H73A 4X62E 4DR1E 1HNZE 1EA6A 4B3SE 4WUCA 1DARA 4DR6E 1Z0VA 1FJGE 1S16A 4DR3E 4LF9E 1HNWE 4EMDA 3B8HA 4JYAE 1NHJA 3T1YI 4LF8E 1PVGA 4B3TI 5LMUI 3PYDA 2ZM6E 2UXBI 1S4EA 1H72C 4X65E 1WUUA 4YHHE 4LF5I 4DV5E 1J5EI 1RR9A 1Z0TA 3JAMC 2BM1A 1XNQI 4JI6E 4KQVA 3J7AG 4HACA 1H7SA 3K17A 2UXDI 2UU9E 1XNRE 3Q1QA 1IBKI 1VISA 3QT6A 4PRXA 1BKNA 4DV1E 4AQYI 4K0KE 1XMOE 1ZM2A 3WU5A 2HFSA 4NXME 4GKKI 4FWGA 2VQEI 1FI4A 1HR0I 4X66I 1UEKA 4DV4E 4ED4A 4JI4I 1N0UA 2X7IA 4LFCE 4DV2E 4NXNE 4ZVIA 2HK3A 4JI3E 4DR5E 1NHHA 4JI0I 4DV3E 4DU7A 2WW4A 4FN5A 2XEXA 4LFBI 2DEJA 1N33E 4DPTA 1XMQI 2E5LI 4YY3E 2UUBE 1Z0GA 5FLXC 4DPYA 1IBMI 4RPFA 2E1RA 4JI2E 2UUAI 3M6AA 1NHIA 4I3HA 4JI5I 5IWAE 1XHKA 1N36I 2UXCE 1I94I 3PYFA 4DUYI 3WU3A 4WUBA 4DU8A 2VQEE 4DR7I 1N32E 2GS8A 4B3RI 1ZM4A 4JI8I 1ZXNA 1Z0BA 2X36A 3H4LA 2HHHI 2F4VE 1U2RA 1B62A 2DEIA 1KVKA 3T1HI 2R42A 4P52A 3D4JA 4PRVA 1N34I 1K47A 3LNUA 4DV6I 4DV7I 1KKHA
chains in the Genus database with same CATH superfamily
2WNRA 2BA1D 4OO1E 4IZJA 4DV0I 5BR8E 4AM3A 4DUZE 3B78A 5A2QQ 4URLA 1MX0A 4JI7I 4LF6I 2BA0D 4PU9A 4X64E 4LCHA 5K36C 2Z5EA 4IZJD 1XXEA 2LJPA 1HNXE 4HACB 3WU4A 4AIDA 2V2VA 2JEBB 5LMNE 3OTOI 2UUCE 4OX9E 2PO2A 2C38A 2JEAB 4GKJI 4DR2E 5DRQA 5C0XF 2VQFI 4JV5I 1R6MA 2GQ0A 4OKGA 1VI7A 1Y4SA 4B3MI 1IBLI 2IESA 4JI5E 2PNLA 4X62I 4HYMA 3P3EA 4DR1I 1HNZI 1FKAE 4B3SI 4FW5A 1KTVA 3V2UC 2A2DA 2BR2A 3T1YE 2O1WA 3ZM7A 4DR6I 4DR3I 2C39B 4LF9I 1HNWI 2AJ4A 3PYGA 4JYAI 4IZKA 3ZZUA 4B3TE 4LF8I 5DNLA 2J7KA 4KHPI 5LMUE 1EI1A 2R3VA 3PS1A 2UXBE 4FWDA 3HKMA 4DR4I 3LTOA 1N0VC 4MU1A 4OO1C 2ZM6I 2NN6A 5IT9Q 4JI1I 4DXLA 4IFDB 1UDNA 1Y6ZA 3HJCA 3GMEA 3M85G 2BM0A 4AIMA 4X65I 4LF5E 1J5EE 3CWVA 3L7ZA 4LOMA 4U3DA 1XNQE 4YHHI 2NN6D 4DV5I 1MU5A 2V2QA 4USMA 3F0NA 4JI6I 2PO0A 2UXDE 4BA1A 1UDQA 2WP8A 3CDJA 3ZZTA 1Z0CA 1R6LA 4XTJA 1OJ4A 3GONA 1IBKE 1XNRI 4MDTA 3J81Q 4AQYE 4LF7I 1D6TA 5EL9A 1Z0WA 3J80Q 4IS9A 2CZ9A 2IOQA 4DV1I 3M85D 4M1KA 3V5RA 1XMOI 4GKKE 4K0KI 4FWHA 1E3HA 2Z5CB 4MYUA 4R1FA 1NZ0A 3J81C 4NXMI 5L3JA 1HR0E 2VF3A 5GMEA 4X66E 2NN6F 3ZKDA 2ZITA 4MYTA 4JI4E 4JG4A 4LFAI 4DPXA 4DV4I 2V2ZA 2JE6B 4IFDE 2C37A 1ZXMA 1PIEA 4FW6A 2IERA 2HK2A 4LFCI 4DV2I 3UHMA 4NXNI 2IOPA 5LL6R 4JI3I 1HK7A 4DR5I 4KHPE 3HULA 4JI0E 1Z5CA 1A6FA 2AE8A 2O1UA 3J7AM 2O1TA 5C0XB 4DR4E 1FWLA 4FW4A 3DD6A 5EKWA 4DV3I 1QZRA 2HFUA 1YH8A 5FWKA 3JAMQ 1OYPA 1Z59A 2PO1B 4JI1E 3Q6NA 4LFBE 3B82A 1XMQE 4Z7YA 3K1JA 2E5LE 4LF4I 5JEAA 1FWKA 3ZKBA 1N33I 4HY1A 2V34A 2WNRB 4Z7CA 4IZJB 5A2QC 5DROA 4YY3I 4HXZA 2A2CA 2UUBI 1USVA 3LPSA 1IBME 2BV3A 5JEAD 2V8PA 2Q2EB 2UUAE 3GLLA 1MG7A 4LF7E 5GMDA 4JI2I 2PNZA 1N36E 1I94E 2PO2B 4DUYE 2C38B 5K36A 1Z5AA 4DPWA 5IWAI 4DR7E 4IFDC 1PKPA 2UXCI 4FW7A 1FJGI 4B3RE 3QT5A 4J3DA 4JI8E 3QT7A 2O1VA 1N32I 3B4TA 5C0XE 4WUDA 5K36D 2C39A 1RHYA 5DNXA 1ELOA 2HHHE 4LFAE 2NN6C 3WU6A 3H1CA 2ZBKB 4QNKA 4NBQA 3T1HE 2BR2B 5JEAF 1H7UA 2F4VI 2J65A 4MU0A 1ZM9A 4UTGA 1KIJA 2HKJA 4USKA 1N34E 2GO4A 4IZKB 5DRRA 2CG9A 1Z0EA 4DV6E 1B63A 4DV7E 5IT9C 2OI2A 2NN6B 4MU4A 2VESA 4DV0E 1ZM3A 4JI7E 4LF6E 5BR8I 4DUZI 3L7ZB 5K36F 3PYEA 1H74A 4OO1A 5FLXQ 2UU9I 4LF4E 1USUA 4X64I 3P76A 3PRYA 4LCFA 3ZZ0A 3QT8A 2PO0B 3OTOE 1RREA 1FNMA 4BA1B 4UT4A 1HNXI 2HKEA 4GKJE 4OO1D 5LMNI 4ISAA 4LCGA 4N3OA 2VQFE 2UUCI 4JV5E 1Z5BA 4OX9I 2NPFA 4DR2I 4B3ME 4FW9A 2Z5BA 4P7AA 5C0XC 1IBLE 3J80C 4BA2A 2EFGA 4DPUA 1H73A 4X62E 4DR1E 1HNZE 1EA6A 4B3SE 2GO3A 4WUCA 1DARA 4DR6E 1Z0VA 1FJGE 1S16A 4DR3E 1OYRA 4LF9E 1HNWE 4EMDA 3B8HA 4JYAE 2BA1G 1NHJA 3T1YI 4LPFA 4LF8E 4U3BA 1PVGA 2NN6E 4B3TI 2BA0G 3P06A 5LMUI 4OO1F 3PYDA 2ZM6E 2C37B 2UXBI 1S4EA 3NZKA 1H72C 4MU3A 4X65E 1WUUA 4YHHE 4GQUA 4LF5I 4DV5E 1J5EI 1RR9A 1Z0TA 3JAMC 2BM1A 1XNQI 4JI6E 4KQVA 3J7AG 4HACA 1H7SA 3GCMA 3K17A 2JEBA 2UXDI 3KRNA 3M7NG 2UU9E 5JEAB 1XNRE 2JEAA 3U1YA 3Q1QA 3U1KA 1UDOA 3PS2A 1IBKI 1VISA 3QT6A 4PRXA 1BKNA 4DV1E 4AQYI 4K0KE 1XMOE 1ZM2A 3WU5A 2HFSA 4NXME 4GKKI 4FWGA 5DRPA 2VQEI 1FI4A 1Y5YA 2PNZB 1HR0I 4X66I 1UEKA 4DV4E 4QNJA 5K36B 4ED4A 4JI4I 1N0UA 2X7IA 3M7ND 4LFCE 4DV2E 4NXNE 4ZVIA 2HK3A 4JI3E 4DR5E 2F1DA 2PNMA 4IFDA 1E3PA 1NHHA 4JI0I 4DV3E 4MQYA 4DU7A 2WW4A 4FN5A 5JEAE 4IFDD 2O3ZA 4FW3A 2XEXA 1UDSA 4LFBI 1YHCA 2CGEA 2DEJA 1N33E 1P42A 4DPTA 2CVEA 1XMQI 3P3GA 2E5LI 4YY3E 2UUBE 1Z0GA 2WP8B 5FLXC 4DPYA 4OO1B 1IBMI 4RPFA 2Z5CA 2E1RA 5K36E 4JI2E 2UUAI 3M6AA 1NHIA 1OYSA 5ELWA 4I3HA 3CDIA 4JI5I 5IWAE 3P3CA 1XHKA 4IFDF 1N36I 2UXCE 1I94I 3PYFA 1Y60A 3Q6MA 4DUYI 3WU3A 4WUBA 4DU8A 2VQEE 4DR7I 2JE6A 2Z5BB 3PS3A 1N32E 2GS8A 4BA2B 4B3RI 1ZM4A 4JI8I 1ZXNA 1Z0BA 2X36A 3H4LA 2HHHI 2F4VE 1U2RA 3K85A 5C0XA 1B62A 2DEIA 1KVKA 3T1HI 5JEAC 2R42A 4P52A 2PO1A 3D4JA 4PRVA 1N34I 1Y4UA 1K47A 5C0XD 3LNUA 4OZEA 4DV6I 4DV7I 2JT2A 1KKHA
chains in the Genus database with same CATH topology
4IZJA 4DV0I 5BR8E 4DUZE 3B78A 5A2QQ 4URLA 1MX0A 4JI7I 4LF6I 4PU9A 4X64E 2Z5EA 4IZJD 2LJPA 1HNXE 4HACB 3WU4A 2V2VA 5LMNE 3OTOI 2UUCE 4OX9E 4GKJI 4DR2E 2VQFI 4JV5I 2GQ0A 1Y4SA 4B3MI 1IBLI 4JI5E 2PNLA 4X62I 4HYMA 4DR1I 1HNZI 1FKAE 4B3SI 1KTVA 3V2UC 2A2DA 3T1YE 2O1WA 3ZM7A 4DR6I 4DR3I 4LF9I 1HNWI 2AJ4A 3PYGA 4JYAI 4IZKA 3ZZUA 4B3TE 4LF8I 2J7KA 4KHPI 5LMUE 1EI1A 2R3VA 2UXBE 4FWDA 4DR4I 3LTOA 1N0VC 2ZM6I 5IT9Q 4JI1I 4DXLA 1Y6ZA 3HJCA 2BM0A 4X65I 4LF5E 1J5EE 3CWVA 1XNQE 4YHHI 4DV5I 1MU5A 2V2QA 4USMA 3F0NA 4JI6I 2UXDE 3ZZTA 1Z0CA 4XTJA 1OJ4A 3GONA 1IBKE 1XNRI 3J81Q 4AQYE 4LF7I 1D6TA 1Z0WA 3J80Q 2CZ9A 2IOQA 4DV1I 4M1KA 3V5RA 1XMOI 4GKKE 4K0KI 4FWHA 2Z5CB 4MYUA 4R1FA 1NZ0A 3J81C 4NXMI 5L3JA 1HR0E 2VF3A 5GMEA 4X66E 3ZKDA 2ZITA 4MYTA 4JI4E 4JG4A 4LFAI 4DPXA 4DV4I 2V2ZA 1ZXMA 1PIEA 2HK2A 4LFCI 4DV2I 4NXNI 2IOPA 5LL6R 4JI3I 1HK7A 4DR5I 4KHPE 3HULA 4JI0E 1Z5CA 1A6FA 2O1UA 3J7AM 2O1TA 4DR4E 1FWLA 4DV3I 1QZRA 2HFUA 5FWKA 3JAMQ 1Z59A 4JI1E 3Q6NA 4LFBE 3B82A 1XMQE 4Z7YA 3K1JA 2E5LE 4LF4I 1FWKA 3ZKBA 1N33I 4HY1A 2V34A 4Z7CA 4IZJB 5A2QC 4YY3I 4HXZA 2A2CA 2UUBI 1USVA 3LPSA 1IBME 2BV3A 2V8PA 2Q2EB 2UUAE 1MG7A 4LF7E 5GMDA 4JI2I 1N36E 1I94E 4DUYE 1Z5AA 4DPWA 5IWAI 4DR7E 1PKPA 2UXCI 1FJGI 4B3RE 3QT5A 4JI8E 3QT7A 2O1VA 1N32I 4WUDA 2HHHE 1ELOA 4LFAE 3WU6A 2ZBKB 3T1HE 1H7UA 2F4VI 1ZM9A 4UTGA 1KIJA 2HKJA 4USKA 1N34E 4IZKB 2CG9A 1Z0EA 4DV6E 1B63A 4DV7E 5IT9C 2OI2A 4DV0E 1ZM3A 4JI7E 4LF6E 5BR8I 4DUZI 3PYEA 1H74A 5FLXQ 2UU9I 4LF4E 1USUA 4X64I 3PRYA 3ZZ0A 3QT8A 3OTOE 1RREA 1FNMA 4UT4A 1HNXI 2HKEA 4GKJE 5LMNI 4N3OA 2VQFE 2UUCI 4JV5E 1Z5BA 4OX9I 2NPFA 4DR2I 4B3ME 4FW9A 2Z5BA 4P7AA 1IBLE 3J80C 2EFGA 4DPUA 1H73A 4X62E 4DR1E 1HNZE 1EA6A 4B3SE 4WUCA 1DARA 4DR6E 1Z0VA 1FJGE 1S16A 4DR3E 4LF9E 1HNWE 4EMDA 3B8HA 4JYAE 1NHJA 3T1YI 4LF8E 1PVGA 4B3TI 3P06A 5LMUI 3PYDA 2ZM6E 2UXBI 1S4EA 1H72C 4X65E 1WUUA 4YHHE 4LF5I 4DV5E 1J5EI 1RR9A 1Z0TA 3JAMC 2BM1A 1XNQI 4JI6E 4KQVA 3J7AG 4HACA 1H7SA 3K17A 2UXDI 2UU9E 1XNRE 3Q1QA 1IBKI 1VISA 3QT6A 4PRXA 1BKNA 4DV1E 4AQYI 4K0KE 1XMOE 1ZM2A 3WU5A 2HFSA 4NXME 4GKKI 4FWGA 2VQEI 1FI4A 1HR0I 4X66I 1UEKA 4DV4E 4ED4A 4JI4I 1N0UA 2X7IA 4LFCE 4DV2E 4NXNE 4ZVIA 2HK3A 4JI3E 4DR5E 2PNMA 1NHHA 4JI0I 4DV3E 4DU7A 2WW4A 4FN5A 2XEXA 4LFBI 2CGEA 2DEJA 1N33E 4DPTA 1XMQI 2E5LI 4YY3E 2UUBE 1Z0GA 5FLXC 4DPYA 1IBMI 4RPFA 2Z5CA 2E1RA 4JI2E 2UUAI 3M6AA 1NHIA 4I3HA 4JI5I 5IWAE 1XHKA 1N36I 2UXCE 1I94I 3PYFA 4DUYI 3Q6MA 3WU3A 4WUBA 4DU8A 2VQEE 4DR7I 2Z5BB 1N32E 2GS8A 4B3RI 1ZM4A 4JI8I 1ZXNA 1Z0BA 2X36A 3H4LA 2HHHI 2F4VE 1U2RA 3K85A 1B62A 2DEIA 1KVKA 3T1HI 2R42A 4P52A 3D4JA 4PRVA 1N34I 1Y4UA 1K47A 3LNUA 4DV6I 4DV7I 1KKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 I;  5BR8 E;  4DUZ E;  3B78 A;  5A2Q Q;  4URL A;  1MX0 A;  4JI7 I;  4LF6 I;  4PU9 A;  4X64 E;  2LJP A;  1HNX E;  4HAC B;  3WU4 A;  2V2V A;  5LMN E;  3OTO I;  2UUC E;  4OX9 E;  4GKJ I;  4DR2 E;  2VQF I;  4JV5 I;  4B3M I;  1IBL I;  4JI5 E;  4X62 I;  4HYM A;  4DR1 I;  1HNZ I;  1FKA E;  4B3S I;  1KTV A;  3V2U C;  2A2D A;  3T1Y E;  3ZM7 A;  4DR6 I;  4DR3 I;  4LF9 I;  1HNW I;  2AJ4 A;  3PYG A;  4JYA I;  3ZZU A;  4B3T E;  4LF8 I;  2J7K A;  4KHP I;  5LMU E;  1EI1 A;  2R3V A;  2UXB E;  4FWD A;  4DR4 I;  3LTO A;  1N0V C;  2ZM6 I;  5IT9 Q;  4JI1 I;  4DXL A;  2BM0 A;  4X65 I;  4LF5 E;  1J5E E;  3CWV A;  1XNQ E;  4YHH I;  4DV5 I;  1MU5 A;  2V2Q A;  4USM A;  3F0N A;  4JI6 I;  2UXD E;  3ZZT A;  1Z0C A;  4XTJ A;  1OJ4 A;  3GON A;  1IBK E;  1XNR I;  3J81 Q;  4AQY E;  4LF7 I;  1D6T A;  1Z0W A;  3J80 Q;  2CZ9 A;  4DV1 I;  4M1K A;  3V5R A;  1XMO I;  4GKK E;  4K0K I;  4FWH A;  4MYU A;  4R1F A;  1NZ0 A;  3J81 C;  4NXM I;  5L3J A;  1HR0 E;  2VF3 A;  5GME A;  4X66 E;  3ZKD A;  2ZIT A;  4MYT A;  4JI4 E;  4JG4 A;  4LFA I;  4DPX A;  4DV4 I;  2V2Z A;  1ZXM A;  1PIE A;  2HK2 A;  4LFC I;  4DV2 I;  4NXN I;  5LL6 R;  4JI3 I;  4DR5 I;  4KHP E;  3HUL A;  4JI0 E;  1Z5C A;  1A6F A;  3J7A M;  4DR4 E;  1FWL A;  4DV3 I;  1QZR A;  2HFU A;  3JAM Q;  1Z59 A;  4JI1 E;  4LFB E;  3B82 A;  1XMQ E;  4Z7Y A;  3K1J A;  2E5L E;  4LF4 I;  1FWK A;  3ZKB A;  1N33 I;  4HY1 A;  2V34 A;  4Z7C A;  5A2Q C;  4YY3 I;  4HXZ A;  2A2C A;  2UUB I;  3LPS A;  1IBM E;  2BV3 A;  2V8P A;  2Q2E B;  2UUA E;  1MG7 A;  4LF7 E;  5GMD A;  4JI2 I;  1N36 E;  1I94 E;  4DUY E;  1Z5A A;  4DPW A;  5IWA I;  4DR7 E;  1PKP A;  2UXC I;  1FJG I;  4B3R E;  3QT5 A;  4JI8 E;  3QT7 A;  1N32 I;  4WUD A;  2HHH E;  1ELO A;  4LFA E;  3WU6 A;  2ZBK B;  3T1H E;  1H7U A;  2F4V I;  1ZM9 A;  4UTG A;  1KIJ A;  2HKJ A;  4USK A;  1N34 E;  1Z0E A;  4DV6 E;  1B63 A;  4DV7 E;  5IT9 C;  2OI2 A;  4DV0 E;  1ZM3 A;  4JI7 E;  4LF6 E;  5BR8 I;  4DUZ I;  3PYE A;  1H74 A;  5FLX Q;  2UU9 I;  4LF4 E;  4X64 I;  3ZZ0 A;  3QT8 A;  3OTO E;  1RRE A;  1FNM A;  4UT4 A;  1HNX I;  2HKE A;  4GKJ E;  5LMN I;  2VQF E;  2UUC I;  4JV5 E;  1Z5B A;  4OX9 I;  2NPF A;  4DR2 I;  4B3M E;  4FW9 A;  4P7A A;  1IBL E;  3J80 C;  2EFG A;  4DPU A;  1H73 A;  4X62 E;  4DR1 E;  1HNZ E;  1EA6 A;  4B3S E;  4WUC A;  1DAR A;  4DR6 E;  1Z0V A;  1FJG E;  1S16 A;  4DR3 E;  4LF9 E;  1HNW E;  4EMD A;  3B8H A;  4JYA E;  1NHJ A;  3T1Y I;  4LF8 E;  1PVG A;  4B3T I;  5LMU I;  3PYD A;  2ZM6 E;  2UXB I;  1S4E A;  1H72 C;  4X65 E;  1WUU A;  4YHH E;  4LF5 I;  4DV5 E;  1J5E I;  1RR9 A;  1Z0T A;  3JAM C;  2BM1 A;  1XNQ I;  4JI6 E;  4KQV A;  3J7A G;  4HAC A;  1H7S A;  3K17 A;  2UXD I;  2UU9 E;  1XNR E;  3Q1Q A;  1IBK I;  1VIS A;  3QT6 A;  4PRX A;  1BKN A;  4DV1 E;  4AQY I;  4K0K E;  1XMO E;  1ZM2 A;  3WU5 A;  2HFS A;  4NXM E;  4GKK I;  4FWG A;  2VQE I;  1FI4 A;  1HR0 I;  4X66 I;  1UEK A;  4DV4 E;  4ED4 A;  4JI4 I;  1N0U A;  2X7I A;  4LFC E;  4DV2 E;  4NXN E;  4ZVI A;  2HK3 A;  4JI3 E;  4DR5 E;  1NHH A;  4JI0 I;  4DV3 E;  4DU7 A;  2WW4 A;  4FN5 A;  2XEX A;  4LFB I;  2DEJ A;  1N33 E;  4DPT A;  1XMQ I;  2E5L I;  4YY3 E;  2UUB E;  1Z0G A;  5FLX C;  4DPY A;  1IBM I;  4RPF A;  2E1R A;  4JI2 E;  2UUA I;  3M6A A;  1NHI A;  4I3H A;  4JI5 I;  5IWA E;  1XHK A;  1N36 I;  2UXC E;  1I94 I;  3PYF A;  4DUY I;  3WU3 A;  4WUB A;  4DU8 A;  2VQE E;  4DR7 I;  1N32 E;  2GS8 A;  4B3R I;  1ZM4 A;  4JI8 I;  1ZXN A;  1Z0B A;  2X36 A;  3H4L A;  2HHH I;  2F4V E;  1U2R A;  1B62 A;  2DEI A;  1KVK A;  3T1H I;  2R42 A;  4P52 A;  3D4J A;  4PRV A;  1N34 I;  1K47 A;  3LNU A;  4DV6 I;  4DV7 I;  1KKH A; 
#chains in the Genus database with same CATH topology
 2WNR A;  2BA1 D;  4OO1 E;  4IZJ A;  4DV0 I;  5BR8 E;  4AM3 A;  4DUZ E;  3B78 A;  5A2Q Q;  4URL A;  1MX0 A;  4JI7 I;  4LF6 I;  2BA0 D;  4PU9 A;  4X64 E;  4LCH A;  5K36 C;  2Z5E A;  4IZJ D;  1XXE A;  2LJP A;  1HNX E;  4HAC B;  3WU4 A;  4AID A;  2V2V A;  2JEB B;  5LMN E;  3OTO I;  2UUC E;  4OX9 E;  2PO2 A;  2C38 A;  2JEA B;  4GKJ I;  4DR2 E;  5DRQ A;  5C0X F;  2VQF I;  4JV5 I;  1R6M A;  2GQ0 A;  4OKG A;  1VI7 A;  1Y4S A;  4B3M I;  1IBL I;  2IES A;  4JI5 E;  2PNL A;  4X62 I;  4HYM A;  3P3E A;  4DR1 I;  1HNZ I;  1FKA E;  4B3S I;  4FW5 A;  1KTV A;  3V2U C;  2A2D A;  2BR2 A;  3T1Y E;  2O1W A;  3ZM7 A;  4DR6 I;  4DR3 I;  2C39 B;  4LF9 I;  1HNW I;  2AJ4 A;  3PYG A;  4JYA I;  4IZK A;  3ZZU A;  4B3T E;  4LF8 I;  5DNL A;  2J7K A;  4KHP I;  5LMU E;  1EI1 A;  2R3V A;  3PS1 A;  2UXB E;  4FWD A;  3HKM A;  4DR4 I;  3LTO A;  1N0V C;  4MU1 A;  4OO1 C;  2ZM6 I;  2NN6 A;  5IT9 Q;  4JI1 I;  4DXL A;  4IFD B;  1UDN A;  1Y6Z A;  3HJC A;  3GME A;  3M85 G;  2BM0 A;  4AIM A;  4X65 I;  4LF5 E;  1J5E E;  3CWV A;  3L7Z A;  4LOM A;  4U3D A;  1XNQ E;  4YHH I;  2NN6 D;  4DV5 I;  1MU5 A;  2V2Q A;  4USM A;  3F0N A;  4JI6 I;  2PO0 A;  2UXD E;  4BA1 A;  1UDQ A;  2WP8 A;  3CDJ A;  3ZZT A;  1Z0C A;  1R6L A;  4XTJ A;  1OJ4 A;  3GON A;  1IBK E;  1XNR I;  4MDT A;  3J81 Q;  4AQY E;  4LF7 I;  1D6T A;  5EL9 A;  1Z0W A;  3J80 Q;  4IS9 A;  2CZ9 A;  2IOQ A;  4DV1 I;  3M85 D;  4M1K A;  3V5R A;  1XMO I;  4GKK E;  4K0K I;  4FWH A;  1E3H A;  2Z5C B;  4MYU A;  4R1F A;  1NZ0 A;  3J81 C;  4NXM I;  5L3J A;  1HR0 E;  2VF3 A;  5GME A;  4X66 E;  2NN6 F;  3ZKD A;  2ZIT A;  4MYT A;  4JI4 E;  4JG4 A;  4LFA I;  4DPX A;  4DV4 I;  2V2Z A;  2JE6 B;  4IFD E;  2C37 A;  1ZXM A;  1PIE A;  4FW6 A;  2IER A;  2HK2 A;  4LFC I;  4DV2 I;  3UHM A;  4NXN I;  2IOP A;  5LL6 R;  4JI3 I;  1HK7 A;  4DR5 I;  4KHP E;  3HUL A;  4JI0 E;  1Z5C A;  1A6F A;  2AE8 A;  2O1U A;  3J7A M;  2O1T A;  5C0X B;  4DR4 E;  1FWL A;  4FW4 A;  3DD6 A;  5EKW A;  4DV3 I;  1QZR A;  2HFU A;  1YH8 A;  5FWK A;  3JAM Q;  1OYP A;  1Z59 A;  2PO1 B;  4JI1 E;  3Q6N A;  4LFB E;  3B82 A;  1XMQ E;  4Z7Y A;  3K1J A;  2E5L E;  4LF4 I;  5JEA A;  1FWK A;  3ZKB A;  1N33 I;  4HY1 A;  2V34 A;  2WNR B;  4Z7C A;  4IZJ B;  5A2Q C;  5DRO A;  4YY3 I;  4HXZ A;  2A2C A;  2UUB I;  1USV A;  3LPS A;  1IBM E;  2BV3 A;  5JEA D;  2V8P A;  2Q2E B;  2UUA E;  3GLL A;  1MG7 A;  4LF7 E;  5GMD A;  4JI2 I;  2PNZ A;  1N36 E;  1I94 E;  2PO2 B;  4DUY E;  2C38 B;  5K36 A;  1Z5A A;  4DPW A;  5IWA I;  4DR7 E;  4IFD C;  1PKP A;  2UXC I;  4FW7 A;  1FJG I;  4B3R E;  3QT5 A;  4J3D A;  4JI8 E;  3QT7 A;  2O1V A;  1N32 I;  3B4T A;  5C0X E;  4WUD A;  5K36 D;  2C39 A;  1RHY A;  5DNX A;  1ELO A;  2HHH E;  4LFA E;  2NN6 C;  3WU6 A;  3H1C A;  2ZBK B;  4QNK A;  4NBQ A;  3T1H E;  2BR2 B;  5JEA F;  1H7U A;  2F4V I;  2J65 A;  4MU0 A;  1ZM9 A;  4UTG A;  1KIJ A;  2HKJ A;  4USK A;  1N34 E;  2GO4 A;  4IZK B;  5DRR A;  2CG9 A;  1Z0E A;  4DV6 E;  1B63 A;  4DV7 E;  5IT9 C;  2OI2 A;  2NN6 B;  4MU4 A;  2VES A;  4DV0 E;  1ZM3 A;  4JI7 E;  4LF6 E;  5BR8 I;  4DUZ I;  3L7Z B;  5K36 F;  3PYE A;  1H74 A;  4OO1 A;  5FLX Q;  2UU9 I;  4LF4 E;  1USU A;  4X64 I;  3P76 A;  3PRY A;  4LCF A;  3ZZ0 A;  3QT8 A;  2PO0 B;  3OTO E;  1RRE A;  1FNM A;  4BA1 B;  4UT4 A;  1HNX I;  2HKE A;  4GKJ E;  4OO1 D;  5LMN I;  4ISA A;  4LCG A;  4N3O A;  2VQF E;  2UUC I;  4JV5 E;  1Z5B A;  4OX9 I;  2NPF A;  4DR2 I;  4B3M E;  4FW9 A;  2Z5B A;  4P7A A;  5C0X C;  1IBL E;  3J80 C;  4BA2 A;  2EFG A;  4DPU A;  1H73 A;  4X62 E;  4DR1 E;  1HNZ E;  1EA6 A;  4B3S E;  2GO3 A;  4WUC A;  1DAR A;  4DR6 E;  1Z0V A;  1FJG E;  1S16 A;  4DR3 E;  1OYR A;  4LF9 E;  1HNW E;  4EMD A;  3B8H A;  4JYA E;  2BA1 G;  1NHJ A;  3T1Y I;  4LPF A;  4LF8 E;  4U3B A;  1PVG A;  2NN6 E;  4B3T I;  2BA0 G;  3P06 A;  5LMU I;  4OO1 F;  3PYD A;  2ZM6 E;  2C37 B;  2UXB I;  1S4E A;  3NZK A;  1H72 C;  4MU3 A;  4X65 E;  1WUU A;  4YHH E;  4GQU A;  4LF5 I;  4DV5 E;  1J5E I;  1RR9 A;  1Z0T A;  3JAM C;  2BM1 A;  1XNQ I;  4JI6 E;  4KQV A;  3J7A G;  4HAC A;  1H7S A;  3GCM A;  3K17 A;  2JEB A;  2UXD I;  3KRN A;  3M7N G;  2UU9 E;  5JEA B;  1XNR E;  2JEA A;  3U1Y A;  3Q1Q A;  3U1K A;  1UDO A;  3PS2 A;  1IBK I;  1VIS A;  3QT6 A;  4PRX A;  1BKN A;  4DV1 E;  4AQY I;  4K0K E;  1XMO E;  1ZM2 A;  3WU5 A;  2HFS A;  4NXM E;  4GKK I;  4FWG A;  5DRP A;  2VQE I;  1FI4 A;  1Y5Y A;  2PNZ B;  1HR0 I;  4X66 I;  1UEK A;  4DV4 E;  4QNJ A;  5K36 B;  4ED4 A;  4JI4 I;  1N0U A;  2X7I A;  3M7N D;  4LFC E;  4DV2 E;  4NXN E;  4ZVI A;  2HK3 A;  4JI3 E;  4DR5 E;  2F1D A;  2PNM A;  4IFD A;  1E3P A;  1NHH A;  4JI0 I;  4DV3 E;  4MQY A;  4DU7 A;  2WW4 A;  4FN5 A;  5JEA E;  4IFD D;  2O3Z A;  4FW3 A;  2XEX A;  1UDS A;  4LFB I;  1YHC A;  2CGE A;  2DEJ A;  1N33 E;  1P42 A;  4DPT A;  2CVE A;  1XMQ I;  3P3G A;  2E5L I;  4YY3 E;  2UUB E;  1Z0G A;  2WP8 B;  5FLX C;  4DPY A;  4OO1 B;  1IBM I;  4RPF A;  2Z5C A;  2E1R A;  5K36 E;  4JI2 E;  2UUA I;  3M6A A;  1NHI A;  1OYS A;  5ELW A;  4I3H A;  3CDI A;  4JI5 I;  5IWA E;  3P3C A;  1XHK A;  4IFD F;  1N36 I;  2UXC E;  1I94 I;  3PYF A;  1Y60 A;  3Q6M A;  4DUY I;  3WU3 A;  4WUB A;  4DU8 A;  2VQE E;  4DR7 I;  2JE6 A;  2Z5B B;  3PS3 A;  1N32 E;  2GS8 A;  4BA2 B;  4B3R I;  1ZM4 A;  4JI8 I;  1ZXN A;  1Z0B A;  2X36 A;  3H4L A;  2HHH I;  2F4V E;  1U2R A;  3K85 A;  5C0X A;  1B62 A;  2DEI A;  1KVK A;  3T1H I;  5JEA C;  2R42 A;  4P52 A;  2PO1 A;  3D4J A;  4PRV A;  1N34 I;  1Y4U A;  1K47 A;  5C0X D;  3LNU A;  4OZE A;  4DV6 I;  4DV7 I;  2JT2 A;  1KKH A; 
#chains in the Genus database with same CATH homology
 4IZJ A;  4DV0 I;  5BR8 E;  4DUZ E;  3B78 A;  5A2Q Q;  4URL A;  1MX0 A;  4JI7 I;  4LF6 I;  4PU9 A;  4X64 E;  2Z5E A;  4IZJ D;  2LJP A;  1HNX E;  4HAC B;  3WU4 A;  2V2V A;  5LMN E;  3OTO I;  2UUC E;  4OX9 E;  4GKJ I;  4DR2 E;  2VQF I;  4JV5 I;  2GQ0 A;  1Y4S A;  4B3M I;  1IBL I;  4JI5 E;  2PNL A;  4X62 I;  4HYM A;  4DR1 I;  1HNZ I;  1FKA E;  4B3S I;  1KTV A;  3V2U C;  2A2D A;  3T1Y E;  2O1W A;  3ZM7 A;  4DR6 I;  4DR3 I;  4LF9 I;  1HNW I;  2AJ4 A;  3PYG A;  4JYA I;  4IZK A;  3ZZU A;  4B3T E;  4LF8 I;  2J7K A;  4KHP I;  5LMU E;  1EI1 A;  2R3V A;  2UXB E;  4FWD A;  4DR4 I;  3LTO A;  1N0V C;  2ZM6 I;  5IT9 Q;  4JI1 I;  4DXL A;  1Y6Z A;  3HJC A;  2BM0 A;  4X65 I;  4LF5 E;  1J5E E;  3CWV A;  1XNQ E;  4YHH I;  4DV5 I;  1MU5 A;  2V2Q A;  4USM A;  3F0N A;  4JI6 I;  2UXD E;  3ZZT A;  1Z0C A;  4XTJ A;  1OJ4 A;  3GON A;  1IBK E;  1XNR I;  3J81 Q;  4AQY E;  4LF7 I;  1D6T A;  1Z0W A;  3J80 Q;  2CZ9 A;  2IOQ A;  4DV1 I;  4M1K A;  3V5R A;  1XMO I;  4GKK E;  4K0K I;  4FWH A;  2Z5C B;  4MYU A;  4R1F A;  1NZ0 A;  3J81 C;  4NXM I;  5L3J A;  1HR0 E;  2VF3 A;  5GME A;  4X66 E;  3ZKD A;  2ZIT A;  4MYT A;  4JI4 E;  4JG4 A;  4LFA I;  4DPX A;  4DV4 I;  2V2Z A;  1ZXM A;  1PIE A;  2HK2 A;  4LFC I;  4DV2 I;  4NXN I;  2IOP A;  5LL6 R;  4JI3 I;  1HK7 A;  4DR5 I;  4KHP E;  3HUL A;  4JI0 E;  1Z5C A;  1A6F A;  2O1U A;  3J7A M;  2O1T A;  4DR4 E;  1FWL A;  4DV3 I;  1QZR A;  2HFU A;  5FWK A;  3JAM Q;  1Z59 A;  4JI1 E;  3Q6N A;  4LFB E;  3B82 A;  1XMQ E;  4Z7Y A;  3K1J A;  2E5L E;  4LF4 I;  1FWK A;  3ZKB A;  1N33 I;  4HY1 A;  2V34 A;  4Z7C A;  4IZJ B;  5A2Q C;  4YY3 I;  4HXZ A;  2A2C A;  2UUB I;  1USV A;  3LPS A;  1IBM E;  2BV3 A;  2V8P A;  2Q2E B;  2UUA E;  1MG7 A;  4LF7 E;  5GMD A;  4JI2 I;  1N36 E;  1I94 E;  4DUY E;  1Z5A A;  4DPW A;  5IWA I;  4DR7 E;  1PKP A;  2UXC I;  1FJG I;  4B3R E;  3QT5 A;  4JI8 E;  3QT7 A;  2O1V A;  1N32 I;  4WUD A;  2HHH E;  1ELO A;  4LFA E;  3WU6 A;  2ZBK B;  3T1H E;  1H7U A;  2F4V I;  1ZM9 A;  4UTG A;  1KIJ A;  2HKJ A;  4USK A;  1N34 E;  4IZK B;  2CG9 A;  1Z0E A;  4DV6 E;  1B63 A;  4DV7 E;  5IT9 C;  2OI2 A;  4DV0 E;  1ZM3 A;  4JI7 E;  4LF6 E;  5BR8 I;  4DUZ I;  3PYE A;  1H74 A;  5FLX Q;  2UU9 I;  4LF4 E;  1USU A;  4X64 I;  3PRY A;  3ZZ0 A;  3QT8 A;  3OTO E;  1RRE A;  1FNM A;  4UT4 A;  1HNX I;  2HKE A;  4GKJ E;  5LMN I;  4N3O A;  2VQF E;  2UUC I;  4JV5 E;  1Z5B A;  4OX9 I;  2NPF A;  4DR2 I;  4B3M E;  4FW9 A;  2Z5B A;  4P7A A;  1IBL E;  3J80 C;  2EFG A;  4DPU A;  1H73 A;  4X62 E;  4DR1 E;  1HNZ E;  1EA6 A;  4B3S E;  4WUC A;  1DAR A;  4DR6 E;  1Z0V A;  1FJG E;  1S16 A;  4DR3 E;  4LF9 E;  1HNW E;  4EMD A;  3B8H A;  4JYA E;  1NHJ A;  3T1Y I;  4LF8 E;  1PVG A;  4B3T I;  3P06 A;  5LMU I;  3PYD A;  2ZM6 E;  2UXB I;  1S4E A;  1H72 C;  4X65 E;  1WUU A;  4YHH E;  4LF5 I;  4DV5 E;  1J5E I;  1RR9 A;  1Z0T A;  3JAM C;  2BM1 A;  1XNQ I;  4JI6 E;  4KQV A;  3J7A G;  4HAC A;  1H7S A;  3K17 A;  2UXD I;  2UU9 E;  1XNR E;  3Q1Q A;  1IBK I;  1VIS A;  3QT6 A;  4PRX A;  1BKN A;  4DV1 E;  4AQY I;  4K0K E;  1XMO E;  1ZM2 A;  3WU5 A;  2HFS A;  4NXM E;  4GKK I;  4FWG A;  2VQE I;  1FI4 A;  1HR0 I;  4X66 I;  1UEK A;  4DV4 E;  4ED4 A;  4JI4 I;  1N0U A;  2X7I A;  4LFC E;  4DV2 E;  4NXN E;  4ZVI A;  2HK3 A;  4JI3 E;  4DR5 E;  2PNM A;  1NHH A;  4JI0 I;  4DV3 E;  4DU7 A;  2WW4 A;  4FN5 A;  2XEX A;  4LFB I;  2CGE A;  2DEJ A;  1N33 E;  4DPT A;  1XMQ I;  2E5L I;  4YY3 E;  2UUB E;  1Z0G A;  5FLX C;  4DPY A;  1IBM I;  4RPF A;  2Z5C A;  2E1R A;  4JI2 E;  2UUA I;  3M6A A;  1NHI A;  4I3H A;  4JI5 I;  5IWA E;  1XHK A;  1N36 I;  2UXC E;  1I94 I;  3PYF A;  4DUY I;  3Q6M A;  3WU3 A;  4WUB A;  4DU8 A;  2VQE E;  4DR7 I;  2Z5B B;  1N32 E;  2GS8 A;  4B3R I;  1ZM4 A;  4JI8 I;  1ZXN A;  1Z0B A;  2X36 A;  3H4L A;  2HHH I;  2F4V E;  1U2R A;  3K85 A;  1B62 A;  2DEI A;  1KVK A;  3T1H I;  2R42 A;  4P52 A;  3D4J A;  4PRV A;  1N34 I;  1Y4U A;  1K47 A;  3LNU A;  4DV6 I;  4DV7 I;  1KKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...