1XHKA

Crystal structure of m. jannaschii lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
185
structure length
185
Chain Sequence
b'EPKVGVIYGLAVLGAGGIGDVTKIIVQILESKNPGTHLLNISGDIAKHSITLASALSKKLVAEKKLPLPKKDIDLNNKEIYIQFSQSYSKIDGDSATAAVCLAIISALLDIPLKQDFAITGSLDLSGNVLAIGGVNEKIEAAKRYGFKRVIIPEANMIDVIETEGIEIIPVKTLDEIVPLVFDLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog
publication title The active site of a lon protease from Methanococcus jannaschii distinctly differs from the canonical catalytic Dyad of Lon proteases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
total genus 53
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2004-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xhkA00
3QT7A 4LFAE 4B3SI 3F0NA 4Z7YA 3K1JA 1XNRE 1KIJA 4DV0E 4LFBE 5BR8I 3K17A 1NHIA 5IWAE 3J80Q 1H74A 1ZM4A 4LF4I 4NXMI 2HFUA 4LF7I 5IT9C 3CWVA 1RR9A 4FWGA 2UXDE 2HKEA 1ELOA 2V2VA 1MX0A 4FWHA 2A2CA 4I3HA 4K0KE 4B3MI 4DU7A 2E5LE 1Z0GA 2UUBE 1HNWE 1IBLE 2HHHE 1N32E 2UU9I 4LF6E 5LMUI 3WU4A 4DR1E 4X62I 3HULA 4DV2E 1VISA 4JI7I 2F4VI 1XMQE 4DV4E 3QT8A 4JI0E 4X66E 4JI1E 1WUUA 3J7AM 4LF8E 2NPFA 4KHPE 2OI2A 2ZM6E 1MG7A 1FKAE 3WU5A 1IBKI 3PYEA 1IBME 1FI4A 4HACB 4DV1E 2UUCI 1NHJA 1XMOE 4JI3I 3T1HI 2HK3A 4XTJA 4HY1A 1FJGI 1I94E 1N0VC 1HR0I 3M6AA 1H7UA 1H72C 4DPTA 2VQFI 2UUAE 4JV5I 1N33E 4X64E 4KHPI 4DR6I 5GMDA 4MYTA 4UT4A 4NXNI 1HNXI 4DR4I 2A2DA 4DR5E 1Z0WA 4WUBA 2V2QA 4JI8I 4JYAI 4B3RI 4DV5E 4DPWA 4URLA 4YY3E 4JI4I 4DUZE 2ZITA 3OTOE 1FWLA 4GKKE 3B78A 1XNQE 4RPFA 3H4LA 4P7AA 4DR5I 2LJPA 4JI5E 1Z0EA 4DR7E 1HNZE 1ZM3A 1J5EE 4LF5I 4LFCE 4KQVA 4FW9A 4DR2E 5LL6R 3T1YI 4B3TE 4DV7I 4LF9E 1KVKA 5FLXC 2AJ4A 2XEXA 4DV6E 1Z5AA 4AQYE 2GS8A 1N36E 4JG4A 4LFAI 5A2QQ 4HACA 4DUYE 4JI6E 1XNRI 4DV0I 4LFBI 2V34A 5IWAI 1QZRA 3GONA 3PYDA 3B82A 4B3TI 4WUDA 4Z7CA 1NHHA 2UXBE 3Q1QA 1S16A 4DV6I 2UXDI 3ZZTA 1Z0VA 4PU9A 4DV3E 2X7IA 3J80C 2ZBKB 2EFGA 4X65E 4JI6I 2BV3A 4K0KI 2E5LI 1U2RA 4DXLA 2UUBI 1HNWI 1IBLI 4FWDA 4YHHE 3JAMQ 2HHHI 1N32I 3B8HA 3QT5A 4JI2E 4LF6I 1FNMA 2BM0A 1K47A 3WU6A 4MYUA 4DR1I 4DPXA 1H73A 5A2QC 1B63A 2UXCE 4DV2I 3LPSA 2VQEE 1XMQI 1UEKA 4DV4I 4JI0I 1NZ0A 4X66I 4JI1I 4LF8I 4YHHI 2ZM6I 1Z59A 4DU8A 1EI1A 5LMNE 4OX9E 1IBMI 3V5RA 4DV1I 1XMOI 5IT9Q 1N34E 1I94I 4EMDA 1Z0TA 2HK2A 2UUAI 1N33I 4X64I 4B3SE 2V2ZA 1S4EA 4GKJE 4PRVA 4LF4E 4NXME 3ZZUA 4LF7E 4WUCA 2BM1A 1OJ4A 1DARA 2HFSA 1KTVA 1PVGA 4DR3E 4DV5I 1D6TA 3WU3A 4YY3I 4DUZI 2VF3A 3J7AG 4R1FA 5GMEA 1ZM2A 3OTOI 4GKKI 4B3ME 1XNQI 4GKJI 1N0UA 4FN5A 1EA6A 4UTGA 4JI5I 1ZM9A 1Z5BA 2UU9E 4DR7I 1HNZI 3ZM7A 1J5EI 4LFCI 4DPYA 5LMUE 4DR2I 3LTOA 4LF9I 4DR3I 4X62E 4P52A 1PKPA 4JI7E 2F4VE 2R3VA 4AQYI 1N36I 2HKJA 4DUYI 1ZXMA 1MU5A 4HYMA 5L3JA 1B62A 1IBKE 3J81Q 3PYGA 2UUCE 4JI3E 2UXBI 1A6FA 3T1HE 4DPUA 1XHKA 1FJGE 1Z5CA 4USMA 1Z0CA 1HR0E 2V8PA 2X36A 2VQFE 1FWKA 4DV3I 4JV5E 4X65I 4DR6E 4ED4A 4M1KA 4NXNE 4PRXA 1HNXE 4DR4E 2WW4A 4JI2I 4USKA 4ZVIA 4JI8E 2J7KA 4JYAE 2DEIA 4B3RE 2DEJA 3V2UC 1Z0BA 2UXCI 1RREA 4JI4E 1ZXNA 2VQEI 3ZKDA 5FLXQ 3ZZ0A 3LNUA 2E1RA 3JAMC 3J81C 1BKNA 1KKHA 2CZ9A 5BR8E 1H7SA 1PIEA 4LF5E 5LMNI 4OX9I 3T1YE 4DV7E 3PYFA 3D4JA 1N34I 2R42A 3QT6A 4HXZA 2Q2EB 3ZKBA
chains in the Genus database with same CATH superfamily
1E3PA 3QT7A 4LFAE 4B3SI 3F0NA 4Z7YA 3K1JA 1XNRE 1KIJA 4DV0E 4LFBE 3K17A 1NHIA 4FW5A 5IWAE 3J80Q 1H74A 1ZM4A 5BR8I 1XXEA 4LF4I 4NXMI 2HFUA 4LF7I 1Y4UA 5IT9C 2Z5CA 1VI7A 2C37B 3CWVA 4QNJA 1RR9A 4FWGA 2GQ0A 5K36C 2UXDE 4LCGA 2HKEA 1ELOA 2V2VA 1MX0A 4FWHA 4OO1C 5DROA 2A2CA 4I3HA 3UHMA 5C0XD 4K0KE 4B3MI 4DU7A 4OO1B 2E5LE 1Z0GA 2UUBE 1HNWE 3PS1A 1IBLE 1UDNA 2HHHE 1N32E 2WP8A 5DRRA 2PNMA 2UU9I 4IS9A 2NN6C 4MU4A 4LF6E 5LMUI 2O1TA 3WU4A 4IZJA 4DR1E 2JEAA 4X62I 3HULA 4DV2E 1VISA 4JI7I 2F4VI 1XMQE 4DV4E 4OKGA 3QT8A 4JI0E 3U1KA 4X66E 2AE8A 4JI1E 1WUUA 2Z5BB 3J7AM 4LF8E 2NPFA 4KHPE 4GQUA 2OI2A 4IFDD 1YHCA 2ZM6E 1MG7A 2VESA 1Y5YA 3M7NG 2PO0A 3H1CA 1FKAE 3WU5A 1IBKI 3PYEA 1IBME 1FI4A 4HACB 4DV1E 2UUCI 1NHJA 1XMOE 4JI3I 2BR2A 3T1HI 2HK3A 4XTJA 4HY1A 4BA1A 1FJGI 1I94E 1N0VC 1HR0I 3M6AA 3M85D 1H7UA 1H72C 4DPTA 5C0XA 2VQFI 2UUAE 1P42A 4JV5I 1N33E 2IERA 5DRPA 4X64E 4OO1E 3PS3A 4KHPI 4DR6I 5GMDA 4MYTA 4UT4A 4NXNI 3KRNA 1HNXI 4DR4I 2A2DA 3P3EA 4DR5E 1Z0WA 1YH8A 5C0XF 4NBQA 4WUBA 3GLLA 2PO2B 2C38A 2V2QA 5ELWA 4JI8I 4JYAI 4B3RI 4DV5E 2PO1A 3U1YA 4DPWA 3P3GA 4URLA 4YY3E 4JI4I 4DUZE 2ZITA 3OTOE 1FWLA 4GKKE 4LPFA 2O1VA 3B78A 1XNQE 4RPFA 3H4LA 2GO4A 2F1DA 4P7AA 5JEAC 4DR5I 2LJPA 4IZKB 4JI5E 1Z0EA 5JEAB 4DR7E 1HNZE 1ZM3A 1J5EE 4LF5I 4LFCE 4KQVA 4FW9A 4DR2E 5LL6R 3T1YI 4B3TE 4DV7I 4LF9E 4IFDF 1UDOA 2Z5BA 1KVKA 5FLXC 2AJ4A 3K85A 4U3DA 2XEXA 4DV6E 1Z5AA 5K36B 4AQYE 2GS8A 4FW3A 1N36E 4JG4A 4LFAI 5A2QQ 4HACA 4DUYE 4JI6E 1XNRI 4DV0I 4LFBI 2V34A 5IWAI 1QZRA 3GONA 4J3DA 1R6LA 3PYDA 3B82A 5EL9A 4B3TI 4WUDA 4Z7CA 1NHHA 2UXBE 3Q1QA 3HKMA 5DRQA 2NN6B 1S16A 4DV6I 4LCFA 2UXDI 2WNRA 3ZZTA 1Z0VA 4PU9A 3L7ZA 4DV3E 2X7IA 4MU3A 3J80C 3M85G 4OO1D 2ZBKB 2EFGA 4X65E 4JI6I 2JE6B 2PO2A 2BV3A 4K0KI 4IFDC 2E5LI 1U2RA 4DXLA 2UUBI 1HNWI 5JEAE 4FWDA 1IBLI 4YHHE 3JAMQ 2HHHI 1N32I 3B8HA 3QT5A 4JI2E 4LF6I 1FNMA 2BM0A 1K47A 3WU6A 4MYUA 4DR1I 4DPXA 1H73A 5A2QC 1B63A 2UXCE 1OYSA 4DV2I 2C39B 2GO3A 4IZKA 5K36E 3LPSA 2VQEE 1XMQI 1UEKA 4DV4I 4JI0I 1NZ0A 1Y6ZA 4X66I 4JI1I 4LF8I 2C37A 4YHHI 2BA0D 2ZM6I 1Z59A 4DU8A 3Q6MA 3DD6A 1EI1A 4BA2B 5LMNE 4OX9E 1IBMI 3V5RA 5K36A 4DV1I 1XMOI 2NN6E 5IT9Q 2CGEA 2WP8B 1N34E 3PRYA 2Z5EA 1HK7A 1I94I 4EMDA 4OO1A 2JEBB 3B4TA 4IZJB 3HJCA 2JEAB 1Z0TA 2HK2A 2UUAI 1N33I 5FWKA 4X64I 4B3SE 3M7ND 2V2ZA 1S4EA 1OYPA 4GKJE 4PRVA 4MQYA 2NN6A 2PNLA 4LF4E 2PNZB 3ZZUA 2O1WA 4LF7E 4NXME 4OO1F 4WUCA 2BM1A 1Y60A 2J65A 1OJ4A 1DARA 2HFSA 1KTVA 2BA1D 1USUA 1PVGA 4OZEA 2JE6A 2PO0B 4DR3E 4DV5I 4AM3A 1D6TA 3WU3A 4AIMA 3P3CA 3P76A 1USVA 2IOPA 4YY3I 4DUZI 2VF3A 3J7AG 4R1FA 5GMEA 1ZM2A 3OTOI 2BR2B 4GKKI 1UDQA 4BA1B 5C0XC 2CG9A 4B3ME 1XNQI 4GKJI 1N0UA 5JEAD 5C0XB 2IESA 4FN5A 1EA6A 4UTGA 4JI5I 1ZM9A 1Z5BA 2UU9E 4DR7I 2C39A 1HNZI 3ZM7A 1J5EI 4LFCI 4LOMA 4DPYA 5LMUE 4DR2I 3LTOA 3GMEA 4LF9I 4DR3I 4X62E 4P52A 1PKPA 2C38B 5K36D 4JI7E 2F4VE 5DNXA 2R3VA 3GCMA 4QNKA 4AQYI 1N36I 2PO1B 4BA2A 2HKJA 3P06A 4DUYI 1ZXMA 1MU5A 4HYMA 5L3JA 1B62A 4IFDB 2BA0G 1IBKE 2JEBA 3J81Q 3PYGA 2UUCE 2NN6D 4JI3E 2UXBI 2CVEA 1A6FA 3T1HE 4DPUA 1XHKA 1Y4SA 1FJGE 1Z5CA 4USMA 1Z0CA 1HR0E 2Z5CB 2V8PA 2PNZA 2X36A 2VQFE 1FWKA 4DV3I 2O1UA 4JV5E 3Q6NA 3CDIA 4X65I 5JEAA 4ISAA 4DR6E 4ED4A 4M1KA 3PS2A 5EKWA 5C0XE 4NXNE 4PRXA 1HNXE 4DR4E 2IOQA 2WW4A 2O3ZA 4JI2I 1E3HA 4USKA 4ZVIA 5JEAF 4JI8E 2J7KA 4JYAE 4MU1A 2BA1G 2DEIA 4MDTA 4B3RE 2DEJA 4FW4A 3V2UC 1Z0BA 2JT2A 2UXCI 1RREA 4JI4E 4FW7A 1ZXNA 1OYRA 2VQEI 3ZKDA 5FLXQ 4MU0A 4FW6A 3ZZ0A 4LCHA 3LNUA 2E1RA 4AIDA 3JAMC 2WNRB 3J81C 1RHYA 5K36F 1BKNA 1KKHA 2CZ9A 4U3BA 3L7ZB 5BR8E 3CDJA 1H7SA 4IFDE 1PIEA 4LF5E 5LMNI 4OX9I 4N3OA 3T1YE 4DV7E 5DNLA 3PYFA 3D4JA 1N34I 3NZKA 2R42A 1UDSA 4IZJD 3QT6A 4HXZA 2NN6F 2Q2EB 3ZKBA 1R6MA 4IFDA
chains in the Genus database with same CATH topology
3QT7A 4LFAE 4B3SI 3F0NA 4Z7YA 3K1JA 1XNRE 1KIJA 4DV0E 4LFBE 5BR8I 3K17A 1NHIA 5IWAE 3J80Q 1H74A 1ZM4A 4LF4I 4NXMI 2HFUA 4LF7I 1Y4UA 5IT9C 2Z5CA 3CWVA 1RR9A 4FWGA 2GQ0A 2UXDE 2HKEA 1ELOA 2V2VA 1MX0A 4FWHA 2A2CA 4I3HA 4K0KE 4B3MI 4DU7A 2E5LE 1Z0GA 2UUBE 1HNWE 1IBLE 2HHHE 1N32E 2PNMA 2UU9I 4LF6E 5LMUI 2O1TA 3WU4A 4IZJA 4DR1E 4X62I 3HULA 4DV2E 1VISA 4JI7I 2F4VI 1XMQE 4DV4E 3QT8A 4JI0E 4X66E 4JI1E 1WUUA 2Z5BB 3J7AM 4LF8E 2NPFA 4KHPE 2OI2A 2ZM6E 1MG7A 1FKAE 3WU5A 1IBKI 3PYEA 1IBME 1FI4A 4HACB 4DV1E 2UUCI 1NHJA 1XMOE 4JI3I 3T1HI 2HK3A 4XTJA 4HY1A 1FJGI 1I94E 1N0VC 1HR0I 3M6AA 1H7UA 1H72C 4DPTA 2VQFI 2UUAE 4JV5I 1N33E 4X64E 4KHPI 4DR6I 5GMDA 4MYTA 4UT4A 4NXNI 1HNXI 4DR4I 2A2DA 4DR5E 1Z0WA 4WUBA 2V2QA 4JI8I 4JYAI 4B3RI 4DV5E 4DPWA 4URLA 4YY3E 4JI4I 4DUZE 2ZITA 3OTOE 1FWLA 4GKKE 2O1VA 3B78A 1XNQE 4RPFA 3H4LA 4P7AA 4DR5I 2LJPA 4IZKB 4JI5E 1Z0EA 4DR7E 1HNZE 1ZM3A 1J5EE 4LF5I 4LFCE 4KQVA 4FW9A 4DR2E 5LL6R 3T1YI 4B3TE 4DV7I 4LF9E 2Z5BA 1KVKA 5FLXC 2AJ4A 3K85A 2XEXA 4DV6E 1Z5AA 4AQYE 2GS8A 1N36E 4JG4A 4LFAI 5A2QQ 4HACA 4DUYE 4JI6E 1XNRI 4DV0I 4LFBI 2V34A 5IWAI 1QZRA 3GONA 3PYDA 3B82A 4B3TI 4WUDA 4Z7CA 1NHHA 2UXBE 3Q1QA 1S16A 4DV6I 2UXDI 3ZZTA 1Z0VA 4PU9A 4DV3E 2X7IA 3J80C 2ZBKB 2EFGA 4X65E 4JI6I 2BV3A 4K0KI 2E5LI 1U2RA 4DXLA 2UUBI 1HNWI 4FWDA 1IBLI 4YHHE 3JAMQ 2HHHI 1N32I 3B8HA 3QT5A 4JI2E 4LF6I 1FNMA 2BM0A 1K47A 3WU6A 4MYUA 4DR1I 4DPXA 1H73A 5A2QC 1B63A 2UXCE 4DV2I 4IZKA 3LPSA 2VQEE 1XMQI 1UEKA 4DV4I 4JI0I 1NZ0A 1Y6ZA 4X66I 4JI1I 4LF8I 4YHHI 2ZM6I 1Z59A 4DU8A 3Q6MA 1EI1A 5LMNE 4OX9E 1IBMI 3V5RA 4DV1I 1XMOI 5IT9Q 2CGEA 1N34E 3PRYA 2Z5EA 1HK7A 1I94I 4EMDA 4IZJB 3HJCA 1Z0TA 2HK2A 2UUAI 1N33I 5FWKA 4X64I 4B3SE 2V2ZA 1S4EA 4GKJE 4PRVA 2PNLA 4LF4E 4NXME 3ZZUA 2O1WA 4LF7E 4WUCA 2BM1A 1OJ4A 1DARA 2HFSA 1KTVA 1USUA 1PVGA 4DR3E 4DV5I 1D6TA 3WU3A 1USVA 2IOPA 4YY3I 4DUZI 2VF3A 3J7AG 4R1FA 5GMEA 1ZM2A 3OTOI 4GKKI 2CG9A 4B3ME 1XNQI 4GKJI 1N0UA 4FN5A 1EA6A 4UTGA 4JI5I 1ZM9A 1Z5BA 2UU9E 4DR7I 1HNZI 3ZM7A 1J5EI 4LFCI 4DPYA 5LMUE 4DR2I 3LTOA 4LF9I 4DR3I 4X62E 4P52A 1PKPA 4JI7E 2F4VE 2R3VA 4AQYI 1N36I 2HKJA 3P06A 4DUYI 1ZXMA 1MU5A 4HYMA 5L3JA 1B62A 1IBKE 3J81Q 3PYGA 2UUCE 4JI3E 2UXBI 1A6FA 3T1HE 4DPUA 1XHKA 1Y4SA 1FJGE 1Z5CA 4USMA 1Z0CA 1HR0E 2Z5CB 2V8PA 2X36A 2VQFE 1FWKA 4DV3I 2O1UA 4JV5E 3Q6NA 4X65I 4DR6E 4ED4A 4M1KA 4NXNE 4PRXA 1HNXE 4DR4E 2IOQA 2WW4A 4JI2I 4USKA 4ZVIA 4JI8E 2J7KA 4JYAE 2DEIA 4B3RE 2DEJA 3V2UC 1Z0BA 2UXCI 1RREA 4JI4E 1ZXNA 2VQEI 3ZKDA 5FLXQ 3ZZ0A 3LNUA 2E1RA 3JAMC 3J81C 1BKNA 1KKHA 2CZ9A 5BR8E 1H7SA 1PIEA 4LF5E 5LMNI 4OX9I 4N3OA 3T1YE 4DV7E 3PYFA 3D4JA 1N34I 2R42A 4IZJD 3QT6A 4HXZA 2Q2EB 3ZKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT7 A;  4LFA E;  4B3S I;  3F0N A;  4Z7Y A;  3K1J A;  1XNR E;  1KIJ A;  4DV0 E;  4LFB E;  5BR8 I;  3K17 A;  1NHI A;  5IWA E;  3J80 Q;  1H74 A;  1ZM4 A;  4LF4 I;  4NXM I;  2HFU A;  4LF7 I;  5IT9 C;  3CWV A;  1RR9 A;  4FWG A;  2UXD E;  2HKE A;  1ELO A;  2V2V A;  1MX0 A;  4FWH A;  2A2C A;  4I3H A;  4K0K E;  4B3M I;  4DU7 A;  2E5L E;  1Z0G A;  2UUB E;  1HNW E;  1IBL E;  2HHH E;  1N32 E;  2UU9 I;  4LF6 E;  5LMU I;  3WU4 A;  4DR1 E;  4X62 I;  3HUL A;  4DV2 E;  1VIS A;  4JI7 I;  2F4V I;  1XMQ E;  4DV4 E;  3QT8 A;  4JI0 E;  4X66 E;  4JI1 E;  1WUU A;  3J7A M;  4LF8 E;  2NPF A;  4KHP E;  2OI2 A;  2ZM6 E;  1MG7 A;  1FKA E;  3WU5 A;  1IBK I;  3PYE A;  1IBM E;  1FI4 A;  4HAC B;  4DV1 E;  2UUC I;  1NHJ A;  1XMO E;  4JI3 I;  3T1H I;  2HK3 A;  4XTJ A;  4HY1 A;  1FJG I;  1I94 E;  1N0V C;  1HR0 I;  3M6A A;  1H7U A;  1H72 C;  4DPT A;  2VQF I;  2UUA E;  4JV5 I;  1N33 E;  4X64 E;  4KHP I;  4DR6 I;  5GMD A;  4MYT A;  4UT4 A;  4NXN I;  1HNX I;  4DR4 I;  2A2D A;  4DR5 E;  1Z0W A;  4WUB A;  2V2Q A;  4JI8 I;  4JYA I;  4B3R I;  4DV5 E;  4DPW A;  4URL A;  4YY3 E;  4JI4 I;  4DUZ E;  2ZIT A;  3OTO E;  1FWL A;  4GKK E;  3B78 A;  1XNQ E;  4RPF A;  3H4L A;  4P7A A;  4DR5 I;  2LJP A;  4JI5 E;  1Z0E A;  4DR7 E;  1HNZ E;  1ZM3 A;  1J5E E;  4LF5 I;  4LFC E;  4KQV A;  4FW9 A;  4DR2 E;  5LL6 R;  3T1Y I;  4B3T E;  4DV7 I;  4LF9 E;  1KVK A;  5FLX C;  2AJ4 A;  2XEX A;  4DV6 E;  1Z5A A;  4AQY E;  2GS8 A;  1N36 E;  4JG4 A;  4LFA I;  5A2Q Q;  4HAC A;  4DUY E;  4JI6 E;  1XNR I;  4DV0 I;  4LFB I;  2V34 A;  5IWA I;  1QZR A;  3GON A;  3PYD A;  3B82 A;  4B3T I;  4WUD A;  4Z7C A;  1NHH A;  2UXB E;  3Q1Q A;  1S16 A;  4DV6 I;  2UXD I;  3ZZT A;  1Z0V A;  4PU9 A;  4DV3 E;  2X7I A;  3J80 C;  2ZBK B;  2EFG A;  4X65 E;  4JI6 I;  2BV3 A;  4K0K I;  2E5L I;  1U2R A;  4DXL A;  2UUB I;  1HNW I;  1IBL I;  4FWD A;  4YHH E;  3JAM Q;  2HHH I;  1N32 I;  3B8H A;  3QT5 A;  4JI2 E;  4LF6 I;  1FNM A;  2BM0 A;  1K47 A;  3WU6 A;  4MYU A;  4DR1 I;  4DPX A;  1H73 A;  5A2Q C;  1B63 A;  2UXC E;  4DV2 I;  3LPS A;  2VQE E;  1XMQ I;  1UEK A;  4DV4 I;  4JI0 I;  1NZ0 A;  4X66 I;  4JI1 I;  4LF8 I;  4YHH I;  2ZM6 I;  1Z59 A;  4DU8 A;  1EI1 A;  5LMN E;  4OX9 E;  1IBM I;  3V5R A;  4DV1 I;  1XMO I;  5IT9 Q;  1N34 E;  1I94 I;  4EMD A;  1Z0T A;  2HK2 A;  2UUA I;  1N33 I;  4X64 I;  4B3S E;  2V2Z A;  1S4E A;  4GKJ E;  4PRV A;  4LF4 E;  4NXM E;  3ZZU A;  4LF7 E;  4WUC A;  2BM1 A;  1OJ4 A;  1DAR A;  2HFS A;  1KTV A;  1PVG A;  4DR3 E;  4DV5 I;  1D6T A;  3WU3 A;  4YY3 I;  4DUZ I;  2VF3 A;  3J7A G;  4R1F A;  5GME A;  1ZM2 A;  3OTO I;  4GKK I;  4B3M E;  1XNQ I;  4GKJ I;  1N0U A;  4FN5 A;  1EA6 A;  4UTG A;  4JI5 I;  1ZM9 A;  1Z5B A;  2UU9 E;  4DR7 I;  1HNZ I;  3ZM7 A;  1J5E I;  4LFC I;  4DPY A;  5LMU E;  4DR2 I;  3LTO A;  4LF9 I;  4DR3 I;  4X62 E;  4P52 A;  1PKP A;  4JI7 E;  2F4V E;  2R3V A;  4AQY I;  1N36 I;  2HKJ A;  4DUY I;  1ZXM A;  1MU5 A;  4HYM A;  5L3J A;  1B62 A;  1IBK E;  3J81 Q;  3PYG A;  2UUC E;  4JI3 E;  2UXB I;  1A6F A;  3T1H E;  4DPU A;  1XHK A;  1FJG E;  1Z5C A;  4USM A;  1Z0C A;  1HR0 E;  2V8P A;  2X36 A;  2VQF E;  1FWK A;  4DV3 I;  4JV5 E;  4X65 I;  4DR6 E;  4ED4 A;  4M1K A;  4NXN E;  4PRX A;  1HNX E;  4DR4 E;  2WW4 A;  4JI2 I;  4USK A;  4ZVI A;  4JI8 E;  2J7K A;  4JYA E;  2DEI A;  4B3R E;  2DEJ A;  3V2U C;  1Z0B A;  2UXC I;  1RRE A;  4JI4 E;  1ZXN A;  2VQE I;  3ZKD A;  5FLX Q;  3ZZ0 A;  3LNU A;  2E1R A;  3JAM C;  3J81 C;  1BKN A;  1KKH A;  2CZ9 A;  5BR8 E;  1H7S A;  1PIE A;  4LF5 E;  5LMN I;  4OX9 I;  3T1Y E;  4DV7 E;  3PYF A;  3D4J A;  1N34 I;  2R42 A;  3QT6 A;  4HXZ A;  2Q2E B;  3ZKB A; 
#chains in the Genus database with same CATH topology
 1E3P A;  3QT7 A;  4LFA E;  4B3S I;  3F0N A;  4Z7Y A;  3K1J A;  1XNR E;  1KIJ A;  4DV0 E;  4LFB E;  3K17 A;  1NHI A;  4FW5 A;  5IWA E;  3J80 Q;  1H74 A;  1ZM4 A;  5BR8 I;  1XXE A;  4LF4 I;  4NXM I;  2HFU A;  4LF7 I;  1Y4U A;  5IT9 C;  2Z5C A;  1VI7 A;  2C37 B;  3CWV A;  4QNJ A;  1RR9 A;  4FWG A;  2GQ0 A;  5K36 C;  2UXD E;  4LCG A;  2HKE A;  1ELO A;  2V2V A;  1MX0 A;  4FWH A;  4OO1 C;  5DRO A;  2A2C A;  4I3H A;  3UHM A;  5C0X D;  4K0K E;  4B3M I;  4DU7 A;  4OO1 B;  2E5L E;  1Z0G A;  2UUB E;  1HNW E;  3PS1 A;  1IBL E;  1UDN A;  2HHH E;  1N32 E;  2WP8 A;  5DRR A;  2PNM A;  2UU9 I;  4IS9 A;  2NN6 C;  4MU4 A;  4LF6 E;  5LMU I;  2O1T A;  3WU4 A;  4IZJ A;  4DR1 E;  2JEA A;  4X62 I;  3HUL A;  4DV2 E;  1VIS A;  4JI7 I;  2F4V I;  1XMQ E;  4DV4 E;  4OKG A;  3QT8 A;  4JI0 E;  3U1K A;  4X66 E;  2AE8 A;  4JI1 E;  1WUU A;  2Z5B B;  3J7A M;  4LF8 E;  2NPF A;  4KHP E;  4GQU A;  2OI2 A;  4IFD D;  1YHC A;  2ZM6 E;  1MG7 A;  2VES A;  1Y5Y A;  3M7N G;  2PO0 A;  3H1C A;  1FKA E;  3WU5 A;  1IBK I;  3PYE A;  1IBM E;  1FI4 A;  4HAC B;  4DV1 E;  2UUC I;  1NHJ A;  1XMO E;  4JI3 I;  2BR2 A;  3T1H I;  2HK3 A;  4XTJ A;  4HY1 A;  4BA1 A;  1FJG I;  1I94 E;  1N0V C;  1HR0 I;  3M6A A;  3M85 D;  1H7U A;  1H72 C;  4DPT A;  5C0X A;  2VQF I;  2UUA E;  1P42 A;  4JV5 I;  1N33 E;  2IER A;  5DRP A;  4X64 E;  4OO1 E;  3PS3 A;  4KHP I;  4DR6 I;  5GMD A;  4MYT A;  4UT4 A;  4NXN I;  3KRN A;  1HNX I;  4DR4 I;  2A2D A;  3P3E A;  4DR5 E;  1Z0W A;  1YH8 A;  5C0X F;  4NBQ A;  4WUB A;  3GLL A;  2PO2 B;  2C38 A;  2V2Q A;  5ELW A;  4JI8 I;  4JYA I;  4B3R I;  4DV5 E;  2PO1 A;  3U1Y A;  4DPW A;  3P3G A;  4URL A;  4YY3 E;  4JI4 I;  4DUZ E;  2ZIT A;  3OTO E;  1FWL A;  4GKK E;  4LPF A;  2O1V A;  3B78 A;  1XNQ E;  4RPF A;  3H4L A;  2GO4 A;  2F1D A;  4P7A A;  5JEA C;  4DR5 I;  2LJP A;  4IZK B;  4JI5 E;  1Z0E A;  5JEA B;  4DR7 E;  1HNZ E;  1ZM3 A;  1J5E E;  4LF5 I;  4LFC E;  4KQV A;  4FW9 A;  4DR2 E;  5LL6 R;  3T1Y I;  4B3T E;  4DV7 I;  4LF9 E;  4IFD F;  1UDO A;  2Z5B A;  1KVK A;  5FLX C;  2AJ4 A;  3K85 A;  4U3D A;  2XEX A;  4DV6 E;  1Z5A A;  5K36 B;  4AQY E;  2GS8 A;  4FW3 A;  1N36 E;  4JG4 A;  4LFA I;  5A2Q Q;  4HAC A;  4DUY E;  4JI6 E;  1XNR I;  4DV0 I;  4LFB I;  2V34 A;  5IWA I;  1QZR A;  3GON A;  4J3D A;  1R6L A;  3PYD A;  3B82 A;  5EL9 A;  4B3T I;  4WUD A;  4Z7C A;  1NHH A;  2UXB E;  3Q1Q A;  3HKM A;  5DRQ A;  2NN6 B;  1S16 A;  4DV6 I;  4LCF A;  2UXD I;  2WNR A;  3ZZT A;  1Z0V A;  4PU9 A;  3L7Z A;  4DV3 E;  2X7I A;  4MU3 A;  3J80 C;  3M85 G;  4OO1 D;  2ZBK B;  2EFG A;  4X65 E;  4JI6 I;  2JE6 B;  2PO2 A;  2BV3 A;  4K0K I;  4IFD C;  2E5L I;  1U2R A;  4DXL A;  2UUB I;  1HNW I;  5JEA E;  4FWD A;  1IBL I;  4YHH E;  3JAM Q;  2HHH I;  1N32 I;  3B8H A;  3QT5 A;  4JI2 E;  4LF6 I;  1FNM A;  2BM0 A;  1K47 A;  3WU6 A;  4MYU A;  4DR1 I;  4DPX A;  1H73 A;  5A2Q C;  1B63 A;  2UXC E;  1OYS A;  4DV2 I;  2C39 B;  2GO3 A;  4IZK A;  5K36 E;  3LPS A;  2VQE E;  1XMQ I;  1UEK A;  4DV4 I;  4JI0 I;  1NZ0 A;  1Y6Z A;  4X66 I;  4JI1 I;  4LF8 I;  2C37 A;  4YHH I;  2BA0 D;  2ZM6 I;  1Z59 A;  4DU8 A;  3Q6M A;  3DD6 A;  1EI1 A;  4BA2 B;  5LMN E;  4OX9 E;  1IBM I;  3V5R A;  5K36 A;  4DV1 I;  1XMO I;  2NN6 E;  5IT9 Q;  2CGE A;  2WP8 B;  1N34 E;  3PRY A;  2Z5E A;  1HK7 A;  1I94 I;  4EMD A;  4OO1 A;  2JEB B;  3B4T A;  4IZJ B;  3HJC A;  2JEA B;  1Z0T A;  2HK2 A;  2UUA I;  1N33 I;  5FWK A;  4X64 I;  4B3S E;  3M7N D;  2V2Z A;  1S4E A;  1OYP A;  4GKJ E;  4PRV A;  4MQY A;  2NN6 A;  2PNL A;  4LF4 E;  2PNZ B;  3ZZU A;  2O1W A;  4LF7 E;  4NXM E;  4OO1 F;  4WUC A;  2BM1 A;  1Y60 A;  2J65 A;  1OJ4 A;  1DAR A;  2HFS A;  1KTV A;  2BA1 D;  1USU A;  1PVG A;  4OZE A;  2JE6 A;  2PO0 B;  4DR3 E;  4DV5 I;  4AM3 A;  1D6T A;  3WU3 A;  4AIM A;  3P3C A;  3P76 A;  1USV A;  2IOP A;  4YY3 I;  4DUZ I;  2VF3 A;  3J7A G;  4R1F A;  5GME A;  1ZM2 A;  3OTO I;  2BR2 B;  4GKK I;  1UDQ A;  4BA1 B;  5C0X C;  2CG9 A;  4B3M E;  1XNQ I;  4GKJ I;  1N0U A;  5JEA D;  5C0X B;  2IES A;  4FN5 A;  1EA6 A;  4UTG A;  4JI5 I;  1ZM9 A;  1Z5B A;  2UU9 E;  4DR7 I;  2C39 A;  1HNZ I;  3ZM7 A;  1J5E I;  4LFC I;  4LOM A;  4DPY A;  5LMU E;  4DR2 I;  3LTO A;  3GME A;  4LF9 I;  4DR3 I;  4X62 E;  4P52 A;  1PKP A;  2C38 B;  5K36 D;  4JI7 E;  2F4V E;  5DNX A;  2R3V A;  3GCM A;  4QNK A;  4AQY I;  1N36 I;  2PO1 B;  4BA2 A;  2HKJ A;  3P06 A;  4DUY I;  1ZXM A;  1MU5 A;  4HYM A;  5L3J A;  1B62 A;  4IFD B;  2BA0 G;  1IBK E;  2JEB A;  3J81 Q;  3PYG A;  2UUC E;  2NN6 D;  4JI3 E;  2UXB I;  2CVE A;  1A6F A;  3T1H E;  4DPU A;  1XHK A;  1Y4S A;  1FJG E;  1Z5C A;  4USM A;  1Z0C A;  1HR0 E;  2Z5C B;  2V8P A;  2PNZ A;  2X36 A;  2VQF E;  1FWK A;  4DV3 I;  2O1U A;  4JV5 E;  3Q6N A;  3CDI A;  4X65 I;  5JEA A;  4ISA A;  4DR6 E;  4ED4 A;  4M1K A;  3PS2 A;  5EKW A;  5C0X E;  4NXN E;  4PRX A;  1HNX E;  4DR4 E;  2IOQ A;  2WW4 A;  2O3Z A;  4JI2 I;  1E3H A;  4USK A;  4ZVI A;  5JEA F;  4JI8 E;  2J7K A;  4JYA E;  4MU1 A;  2BA1 G;  2DEI A;  4MDT A;  4B3R E;  2DEJ A;  4FW4 A;  3V2U C;  1Z0B A;  2JT2 A;  2UXC I;  1RRE A;  4JI4 E;  4FW7 A;  1ZXN A;  1OYR A;  2VQE I;  3ZKD A;  5FLX Q;  4MU0 A;  4FW6 A;  3ZZ0 A;  4LCH A;  3LNU A;  2E1R A;  4AID A;  3JAM C;  2WNR B;  3J81 C;  1RHY A;  5K36 F;  1BKN A;  1KKH A;  2CZ9 A;  4U3B A;  3L7Z B;  5BR8 E;  3CDJ A;  1H7S A;  4IFD E;  1PIE A;  4LF5 E;  5LMN I;  4OX9 I;  4N3O A;  3T1Y E;  4DV7 E;  5DNL A;  3PYF A;  3D4J A;  1N34 I;  3NZK A;  2R42 A;  1UDS A;  4IZJ D;  3QT6 A;  4HXZ A;  2NN6 F;  2Q2E B;  3ZKB A;  1R6M A;  4IFD A; 
#chains in the Genus database with same CATH homology
 3QT7 A;  4LFA E;  4B3S I;  3F0N A;  4Z7Y A;  3K1J A;  1XNR E;  1KIJ A;  4DV0 E;  4LFB E;  5BR8 I;  3K17 A;  1NHI A;  5IWA E;  3J80 Q;  1H74 A;  1ZM4 A;  4LF4 I;  4NXM I;  2HFU A;  4LF7 I;  1Y4U A;  5IT9 C;  2Z5C A;  3CWV A;  1RR9 A;  4FWG A;  2GQ0 A;  2UXD E;  2HKE A;  1ELO A;  2V2V A;  1MX0 A;  4FWH A;  2A2C A;  4I3H A;  4K0K E;  4B3M I;  4DU7 A;  2E5L E;  1Z0G A;  2UUB E;  1HNW E;  1IBL E;  2HHH E;  1N32 E;  2PNM A;  2UU9 I;  4LF6 E;  5LMU I;  2O1T A;  3WU4 A;  4IZJ A;  4DR1 E;  4X62 I;  3HUL A;  4DV2 E;  1VIS A;  4JI7 I;  2F4V I;  1XMQ E;  4DV4 E;  3QT8 A;  4JI0 E;  4X66 E;  4JI1 E;  1WUU A;  2Z5B B;  3J7A M;  4LF8 E;  2NPF A;  4KHP E;  2OI2 A;  2ZM6 E;  1MG7 A;  1FKA E;  3WU5 A;  1IBK I;  3PYE A;  1IBM E;  1FI4 A;  4HAC B;  4DV1 E;  2UUC I;  1NHJ A;  1XMO E;  4JI3 I;  3T1H I;  2HK3 A;  4XTJ A;  4HY1 A;  1FJG I;  1I94 E;  1N0V C;  1HR0 I;  3M6A A;  1H7U A;  1H72 C;  4DPT A;  2VQF I;  2UUA E;  4JV5 I;  1N33 E;  4X64 E;  4KHP I;  4DR6 I;  5GMD A;  4MYT A;  4UT4 A;  4NXN I;  1HNX I;  4DR4 I;  2A2D A;  4DR5 E;  1Z0W A;  4WUB A;  2V2Q A;  4JI8 I;  4JYA I;  4B3R I;  4DV5 E;  4DPW A;  4URL A;  4YY3 E;  4JI4 I;  4DUZ E;  2ZIT A;  3OTO E;  1FWL A;  4GKK E;  2O1V A;  3B78 A;  1XNQ E;  4RPF A;  3H4L A;  4P7A A;  4DR5 I;  2LJP A;  4IZK B;  4JI5 E;  1Z0E A;  4DR7 E;  1HNZ E;  1ZM3 A;  1J5E E;  4LF5 I;  4LFC E;  4KQV A;  4FW9 A;  4DR2 E;  5LL6 R;  3T1Y I;  4B3T E;  4DV7 I;  4LF9 E;  2Z5B A;  1KVK A;  5FLX C;  2AJ4 A;  3K85 A;  2XEX A;  4DV6 E;  1Z5A A;  4AQY E;  2GS8 A;  1N36 E;  4JG4 A;  4LFA I;  5A2Q Q;  4HAC A;  4DUY E;  4JI6 E;  1XNR I;  4DV0 I;  4LFB I;  2V34 A;  5IWA I;  1QZR A;  3GON A;  3PYD A;  3B82 A;  4B3T I;  4WUD A;  4Z7C A;  1NHH A;  2UXB E;  3Q1Q A;  1S16 A;  4DV6 I;  2UXD I;  3ZZT A;  1Z0V A;  4PU9 A;  4DV3 E;  2X7I A;  3J80 C;  2ZBK B;  2EFG A;  4X65 E;  4JI6 I;  2BV3 A;  4K0K I;  2E5L I;  1U2R A;  4DXL A;  2UUB I;  1HNW I;  4FWD A;  1IBL I;  4YHH E;  3JAM Q;  2HHH I;  1N32 I;  3B8H A;  3QT5 A;  4JI2 E;  4LF6 I;  1FNM A;  2BM0 A;  1K47 A;  3WU6 A;  4MYU A;  4DR1 I;  4DPX A;  1H73 A;  5A2Q C;  1B63 A;  2UXC E;  4DV2 I;  4IZK A;  3LPS A;  2VQE E;  1XMQ I;  1UEK A;  4DV4 I;  4JI0 I;  1NZ0 A;  1Y6Z A;  4X66 I;  4JI1 I;  4LF8 I;  4YHH I;  2ZM6 I;  1Z59 A;  4DU8 A;  3Q6M A;  1EI1 A;  5LMN E;  4OX9 E;  1IBM I;  3V5R A;  4DV1 I;  1XMO I;  5IT9 Q;  2CGE A;  1N34 E;  3PRY A;  2Z5E A;  1HK7 A;  1I94 I;  4EMD A;  4IZJ B;  3HJC A;  1Z0T A;  2HK2 A;  2UUA I;  1N33 I;  5FWK A;  4X64 I;  4B3S E;  2V2Z A;  1S4E A;  4GKJ E;  4PRV A;  2PNL A;  4LF4 E;  4NXM E;  3ZZU A;  2O1W A;  4LF7 E;  4WUC A;  2BM1 A;  1OJ4 A;  1DAR A;  2HFS A;  1KTV A;  1USU A;  1PVG A;  4DR3 E;  4DV5 I;  1D6T A;  3WU3 A;  1USV A;  2IOP A;  4YY3 I;  4DUZ I;  2VF3 A;  3J7A G;  4R1F A;  5GME A;  1ZM2 A;  3OTO I;  4GKK I;  2CG9 A;  4B3M E;  1XNQ I;  4GKJ I;  1N0U A;  4FN5 A;  1EA6 A;  4UTG A;  4JI5 I;  1ZM9 A;  1Z5B A;  2UU9 E;  4DR7 I;  1HNZ I;  3ZM7 A;  1J5E I;  4LFC I;  4DPY A;  5LMU E;  4DR2 I;  3LTO A;  4LF9 I;  4DR3 I;  4X62 E;  4P52 A;  1PKP A;  4JI7 E;  2F4V E;  2R3V A;  4AQY I;  1N36 I;  2HKJ A;  3P06 A;  4DUY I;  1ZXM A;  1MU5 A;  4HYM A;  5L3J A;  1B62 A;  1IBK E;  3J81 Q;  3PYG A;  2UUC E;  4JI3 E;  2UXB I;  1A6F A;  3T1H E;  4DPU A;  1XHK A;  1Y4S A;  1FJG E;  1Z5C A;  4USM A;  1Z0C A;  1HR0 E;  2Z5C B;  2V8P A;  2X36 A;  2VQF E;  1FWK A;  4DV3 I;  2O1U A;  4JV5 E;  3Q6N A;  4X65 I;  4DR6 E;  4ED4 A;  4M1K A;  4NXN E;  4PRX A;  1HNX E;  4DR4 E;  2IOQ A;  2WW4 A;  4JI2 I;  4USK A;  4ZVI A;  4JI8 E;  2J7K A;  4JYA E;  2DEI A;  4B3R E;  2DEJ A;  3V2U C;  1Z0B A;  2UXC I;  1RRE A;  4JI4 E;  1ZXN A;  2VQE I;  3ZKD A;  5FLX Q;  3ZZ0 A;  3LNU A;  2E1R A;  3JAM C;  3J81 C;  1BKN A;  1KKH A;  2CZ9 A;  5BR8 E;  1H7S A;  1PIE A;  4LF5 E;  5LMN I;  4OX9 I;  4N3O A;  3T1Y E;  4DV7 E;  3PYF A;  3D4J A;  1N34 I;  2R42 A;  4IZJ D;  3QT6 A;  4HXZ A;  2Q2E B;  3ZKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...