1N36I

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n36I00
1FJGI 2HFUA 4DV6E 4JYAI 3T1HI 4DU8A 4DR5E 4NXMI 4PU9A 1Z5BA 3B82A 2HK3A 1UEKA 4USMA 4JI7I 1S16A 4DV5I 3J80C 1ZM3A 1D6TA 4WUBA 1FWKA 4YY3E 1XNQE 1H74A 1A6FA 4GKKI 2UXDE 4DV1I 2VQFI 4X62E 4DR4I 1IBMI 4DV3I 2UUCI 4DU7A 2V2VA 1RR9A 5FLXC 2V2ZA 3WU6A 4DV7I 4LF6E 1ZM2A 3GONA 1KIJA 4YHHI 4FWDA 1N33E 1HNWI 4ZVIA 2HK2A 3D4JA 2HHHE 3QT7A 1N34E 2OI2A 2V2QA 4B3RI 4LFCI 1BKNA 2Q2EB 4X66E 4JI1E 2EFGA 4DV2I 1Z0WA 1U2RA 4FWGA 4JI2I 5IWAE 4P7AA 2UU9E 4P52A 2UXBE 4Z7CA 4DR6E 1IBKE 4LF5E 2E5LE 1B63A 2X36A 2ZM6I 1ZM4A 4LF7I 1IBLE 1HNXI 4OX9I 4JV5I 4LFBI 4HY1A 1KVKA 4XTJA 4EMDA 4DR7E 4X65E 3PYGA 5GMEA 4DPWA 3QT6A 1ZM9A 4GKJE 2DEJA 4DXLA 1Z59A 3K1JA 2F4VE 4NXNI 1OJ4A 4DV6I 5BR8I 4LF4I 1PIEA 2HKJA 4URLA 1N32E 3J81C 3H4LA 3Q1QA 4LF9I 1K47A 3J81Q 1H7UA 2R42A 4YY3I 4HXZA 2BV3A 4FW9A 4WUDA 4KQVA 4DR1I 4DR2E 2VQEE 2HFSA 2E1RA 3ZKBA 1HNZI 4JI6I 1H73A 4JI3E 1Z5CA 4DPYA 1FNMA 1Z5AA 2HKEA 1N33I 4LF8E 3OTOE 1N36E 5LMNE 4I3HA 1Z0EA 4UTGA 1XMOE 2UUAI 1ZXMA 3F0NA 4LFAI 4JI1I 4X66I 3JAMC 1ELOA 3ZZ0A 4DV0E 1PVGA 3JAMQ 1NHIA 4DUYI 4X64E 1H7SA 4HYMA 2UXCE 1XNRI 4B3ME 4JI8E 3K17A 1XMQE 1FJGE 1I94I 4JYAE 4B3TE 1J5EI 2UUBI 1HR0I 3V5RA 4AQYI 2F4VI 2AJ4A 3WU5A 4GKKE 1MX0A 4JI5I 4DV1E 4M1KA 2VQFE 3T1YI 4JI4I 2CZ9A 4DR4E 5LMUI 2A2DA 1IBME 3CWVA 5GMDA 4B3SI 4DV3E 3HULA 2UUCE 3ZZTA 3PYEA 1PKPA 4DV7E 1XHKA 4K0KE 4YHHE 4DV4I 4DPUA 4HACA 3J7AG 4MYTA 4DPXA 4UT4A 4B3RE 4KHPE 4LFCE 2DEIA 4DR5I 3M6AA 4JI2E 2BM1A 4DR3E 1XNQI 2UXDI 1VISA 4LF7E 1HNXE 4OX9E 4LFBE 4FN5A 4X62I 1Z0GA 2V8PA 2R3VA 1RREA 4DV0I 1FI4A 4R1FA 4JI0E 4X64I 4LF6I 3B78A 1Z0VA 4RPFA 4B3MI 4NXNE 2HHHI 1XMQI 3QT8A 1N34I 1FWLA 5BR8E 4LF4E 1H72C 2GS8A 5A2QQ 4B3TI 1KKHA 2VF3A 1FKAE 3WU4A 5IWAI 2UU9I 4LF9E 2BM0A 2UXBI 4PRVA 4DR6I 1IBKI 4LF5I 2E5LI 4Z7YA 1KTVA 3LPSA 1IBLI 2ZBKB 4DUZE 5IT9C 3ZKDA 3V2UC 4DR1E 3J80Q 4DR7I 4X65I 2XEXA 3T1HE 1HNZE 4JI6E 5IT9Q 3ZM7A 1Z0BA 4NXME 4GKJI 4USKA 2NPFA 4K0KI 1N0UA 4JI7E 4DV5E 5LL6R 2V34A 2A2CA 5FLXQ 1B62A 1N32I 2UUAE 4KHPI 3QT5A 4LFAE 1WUUA 3ZZUA 1S4EA 4DR3I 1EI1A 2ZITA 4PRXA 2J7KA 4DUYE 4ED4A 1NHJA 3LNUA 3WU3A 4WUCA 1MG7A 1XNRE 1HNWE 3B8HA 1QZRA 4DR2I 2VQEI 1I94E 3J7AM 1MU5A 4FWHA 4DV2E 4JI0I 1N0VC 4JI3I 1J5EE 4MYUA 2UUBE 1HR0E 5L3JA 4AQYE 4LF8I 3OTOI 2WW4A 5LMNI 1N36I 4JG4A 3LTOA 1XMOI 2ZM6E 1EA6A 4JV5E 4JI5E 1ZXNA 1NHHA 2LJPA 1DARA 3T1YE 4JI4E 2X7IA 5LMUE 1Z0CA 4DPTA 4B3SE 5A2QC 2UXCI 3PYFA 4HACB 4DUZI 1Z0TA 3PYDA 4JI8I 4DV4E 1NZ0A
chains in the Genus database with same CATH superfamily
1FJGI 2HFUA 5DRPA 4DV6E 4JYAI 3T1HI 5DRQA 4LCHA 1E3HA 2WNRB 3CDIA 4DU8A 5C0XC 4DR5E 4NXMI 4PU9A 2JT2A 1Z5BA 3B82A 2HK3A 1UEKA 2Z5CA 4USMA 5JEAA 2C39B 4JI7I 1S16A 4DV5I 4IFDA 3J80C 1ZM3A 1D6TA 3L7ZA 4WUBA 1FWKA 4MU4A 4YY3E 1H74A 1A6FA 1XNQE 4GKKI 2UXDE 4DV1I 2VQFI 4X62E 4DR4I 3Q6MA 2CGEA 1IBMI 1E3PA 5C0XB 5JEAC 4DV3I 3UHMA 2UUCI 4IFDC 4DU7A 3HKMA 1UDOA 1YHCA 2V2VA 1RR9A 5FLXC 2V2ZA 3WU6A 4DV7I 4LF6E 2BA1G 1ZM2A 5K36E 3GONA 1KIJA 4YHHI 4FWDA 1N33E 1HNWI 4ZVIA 4BA2A 2HK2A 3D4JA 2HHHE 2O1VA 2JEAB 3QT7A 1N34E 2OI2A 2V2QA 4B3RI 2JEBA 3P3GA 4LFCI 1BKNA 2O1TA 2BR2B 2Q2EB 4X66E 4JI1E 2EFGA 4DV2I 1Z0WA 1U2RA 4FWGA 4JI2I 5IWAE 4P7AA 2UU9E 4IS9A 4ISAA 4P52A 2UXBE 4Z7CA 4DR6E 1IBKE 4LF5E 2E5LE 1B63A 2X36A 5DNXA 2ZM6I 1ZM4A 4LF7I 1IBLE 1HNXI 4OX9I 4GQUA 4JV5I 3GLLA 4HY1A 4LFBI 2PO0A 1KVKA 4XTJA 4EMDA 4DR7E 4X65E 3PYGA 5GMEA 5DNLA 4AM3A 3PS2A 4DPWA 1R6MA 4U3BA 1P42A 2PO1A 3QT6A 4FW4A 1ZM9A 4GKJE 2DEJA 4DXLA 3U1KA 1Z59A 3K1JA 2F4VE 4NXNI 2JEBB 3PS3A 1OJ4A 4DV6I 5C0XE 5BR8I 4LF4I 1PIEA 2HKJA 1VI7A 4URLA 2GO4A 1N32E 3J81C 3H4LA 5ELWA 4LPFA 3Q1QA 4LF9I 3M85D 3P3CA 1UDSA 4AIDA 1K47A 2C37A 1XXEA 5EKWA 3J81Q 4FW6A 2PO0B 1H7UA 5C0XD 2R42A 3DD6A 4YY3I 4HXZA 2BV3A 4FW9A 4WUDA 1UDQA 4KQVA 4DR1I 4DR2E 1Y4SA 2VQEE 2HFSA 2E1RA 3ZKBA 1HNZI 4JI6I 1H73A 3K85A 4IZJA 4JI3E 1Z5CA 2O1WA 4DPYA 4MU1A 1FNMA 2WP8A 1Z5AA 5JEAD 2HKEA 4IFDD 1N33I 5DRRA 4LF8E 3OTOE 1N36E 5LMNE 2Z5EA 4I3HA 2PO2B 1Z0EA 4UTGA 1XMOE 2UUAI 1ZXMA 3F0NA 4LFAI 1UDNA 4JI1I 4X66I 2IOPA 3JAMC 2BA0D 1ELOA 1USUA 2JE6B 2C37B 3ZZ0A 4AIMA 1HK7A 4DV0E 4FW7A 1PVGA 4OKGA 3JAMQ 1NHIA 4DUYI 4X64E 1H7SA 4HYMA 2UXCE 1XNRI 4B3ME 2F1DA 4JI8E 3K17A 1XMQE 1FJGE 2Z5BA 5EL9A 2NN6F 1I94I 4MQYA 4B3TE 4JYAE 3M7ND 3U1YA 1J5EI 2Z5CB 5JEAB 4IFDB 2UUBI 3M85G 1HR0I 3L7ZB 4NBQA 3V5RA 4AQYI 2F4VI 4OO1F 4BA1A 2AJ4A 1USVA 5DROA 3WU5A 4GKKE 1MX0A 4JI5I 4DV1E 4QNJA 4M1KA 2VQFE 3T1YI 4JI4I 3H1CA 2CZ9A 2PNZA 4DR4E 5LMUI 2A2DA 1IBME 3CWVA 4MU0A 4IZKA 5GMDA 4B3SI 4DV3E 3HULA 2UUCE 3ZZTA 4BA2B 3PYEA 1PKPA 4DV7E 4U3DA 1XHKA 4K0KE 4YHHE 4DV4I 4DPUA 3Q6NA 4HACA 3J7AG 4MYTA 4DPXA 4UT4A 1RHYA 4B3RE 4KHPE 2BA0G 4LFCE 4FW3A 3GMEA 2DEIA 4DR5I 3M6AA 2O3ZA 4FW5A 4JI2E 2GO3A 2BM1A 3KRNA 4DR3E 2GQ0A 3GCMA 1XNQI 2UXDI 1VISA 2PNZB 2C38A 4LF7E 1HNXE 4OX9E 3P76A 4LFBE 5JEAE 2VESA 4FN5A 4X62I 4IFDE 5K36F 1Z0GA 4IZKB 2V8PA 2R3VA 1RREA 2PO1B 4DV0I 3P06A 3M7NG 4IZJD 1FI4A 4R1FA 4JI0E 2IERA 2NN6A 4X64I 4LF6I 3B78A 1Z0VA 4RPFA 4B3MI 3B4TA 4NXNE 3CDJA 2HHHI 1XMQI 3QT8A 1N34I 1FWLA 4N3OA 5BR8E 4LF4E 4OO1D 1H72C 2GS8A 5A2QQ 1OYRA 4OO1A 4B3TI 1KKHA 2VF3A 1FKAE 3WU4A 2JEAA 2NN6C 1YH8A 1OYPA 5IWAI 2UU9I 2BR2A 4LF9E 2BM0A 2UXBI 4PRVA 1Y6ZA 4DR6I 1IBKI 4LF5I 2C38B 2E5LI 4Z7YA 1KTVA 3LPSA 1IBLI 2ZBKB 4OO1C 4DUZE 5IT9C 3ZKDA 3V2UC 3PRYA 4DR1E 2O1UA 4IZJB 3J80Q 4DR7I 4X65I 2XEXA 2NN6B 4LOMA 3T1HE 1R6LA 3HJCA 5C0XF 1HNZE 4JI6E 2WP8B 5IT9Q 3ZM7A 1Y5YA 1Z0BA 4NXME 4J3DA 4GKJI 4USKA 2NPFA 4K0KI 1N0UA 4JI7E 4OO1B 4DV5E 4LCFA 5LL6R 2V34A 2A2CA 5FLXQ 1B62A 1N32I 2UUAE 4KHPI 3QT5A 4LFAE 1OYSA 3NZKA 3PS1A 5JEAF 1WUUA 4IFDF 3ZZUA 4MDTA 5FWKA 5K36D 1S4EA 5K36A 4DR3I 1EI1A 2ZITA 4PRXA 2J7KA 4DUYE 4MU3A 4ED4A 1NHJA 3LNUA 2PNLA 2IOQA 3WU3A 2Z5BB 4WUCA 1MG7A 1XNRE 1HNWE 3B8HA 1QZRA 4DR2I 2VQEI 5K36C 1I94E 3J7AM 1MU5A 4FWHA 4DV2E 4JI0I 1N0VC 4JI3I 1J5EE 4BA1B 4MYUA 2UUBE 1HR0E 5L3JA 4AQYE 2BA1D 4OZEA 4LF8I 3OTOI 2WNRA 2WW4A 5LMNI 1N36I 2J65A 4JG4A 3LTOA 2NN6E 1Y60A 1Y4UA 1XMOI 2ZM6E 1EA6A 2C39A 4JV5E 4JI5E 4LCGA 1ZXNA 1NHHA 2LJPA 1DARA 3T1YE 2PO2A 2CG9A 5K36B 4JI4E 2AE8A 2X7IA 5LMUE 1Z0CA 4OO1E 4QNKA 2IESA 4DPTA 2JE6A 4B3SE 2NN6D 2PNMA 5A2QC 5C0XA 2UXCI 3PYFA 4HACB 4DUZI 3P3EA 2CVEA 1Z0TA 3PYDA 4JI8I 4DV4E 1NZ0A
chains in the Genus database with same CATH topology
1FJGI 2HFUA 4DV6E 4JYAI 3T1HI 4DU8A 4DR5E 4NXMI 4PU9A 1Z5BA 3B82A 2HK3A 1UEKA 2Z5CA 4USMA 4JI7I 1S16A 4DV5I 3J80C 1ZM3A 1D6TA 4WUBA 1FWKA 4YY3E 1XNQE 1H74A 1A6FA 4GKKI 2UXDE 4DV1I 2VQFI 4X62E 4DR4I 3Q6MA 2CGEA 1IBMI 4DV3I 2UUCI 4DU7A 2V2VA 1RR9A 5FLXC 2V2ZA 3WU6A 4DV7I 4LF6E 1ZM2A 3GONA 1KIJA 4YHHI 4FWDA 1N33E 1HNWI 4ZVIA 2HK2A 3D4JA 2HHHE 2O1VA 3QT7A 1N34E 2OI2A 2V2QA 4B3RI 4LFCI 1BKNA 2O1TA 2Q2EB 4X66E 4JI1E 2EFGA 4DV2I 1Z0WA 1U2RA 4FWGA 4JI2I 5IWAE 4P7AA 2UU9E 4P52A 2UXBE 4Z7CA 4DR6E 1IBKE 4LF5E 2E5LE 1B63A 2X36A 2ZM6I 1ZM4A 4LF7I 1IBLE 1HNXI 4OX9I 4JV5I 4LFBI 4HY1A 1KVKA 4XTJA 4EMDA 4DR7E 4X65E 3PYGA 5GMEA 4DPWA 3QT6A 1ZM9A 4GKJE 2DEJA 4DXLA 1Z59A 3K1JA 2F4VE 4NXNI 1OJ4A 4DV6I 5BR8I 4LF4I 1PIEA 2HKJA 4URLA 1N32E 3J81C 3H4LA 3Q1QA 4LF9I 1K47A 3J81Q 1H7UA 2R42A 4YY3I 4HXZA 2BV3A 4FW9A 4WUDA 4KQVA 4DR1I 4DR2E 1Y4SA 2VQEE 2HFSA 2E1RA 3ZKBA 1HNZI 4JI6I 1H73A 3K85A 4IZJA 4JI3E 1Z5CA 2O1WA 4DPYA 1FNMA 1Z5AA 2HKEA 1N33I 4LF8E 3OTOE 1N36E 5LMNE 2Z5EA 4I3HA 1Z0EA 4UTGA 1XMOE 2UUAI 1ZXMA 3F0NA 4LFAI 4JI1I 4X66I 2IOPA 3JAMC 1ELOA 1USUA 3ZZ0A 1HK7A 4DV0E 1PVGA 3JAMQ 1NHIA 4DUYI 4X64E 1H7SA 4HYMA 2UXCE 1XNRI 4B3ME 4JI8E 3K17A 1XMQE 1FJGE 2Z5BA 1I94I 4JYAE 4B3TE 1J5EI 2Z5CB 2UUBI 1HR0I 3V5RA 4AQYI 2F4VI 2AJ4A 1USVA 3WU5A 4GKKE 1MX0A 4JI5I 4DV1E 4M1KA 2VQFE 3T1YI 4JI4I 2CZ9A 4DR4E 5LMUI 2A2DA 1IBME 3CWVA 5GMDA 4IZKA 4B3SI 4DV3E 3HULA 2UUCE 3ZZTA 3PYEA 1PKPA 4DV7E 1XHKA 4K0KE 4YHHE 4DV4I 4DPUA 3Q6NA 4HACA 3J7AG 4MYTA 4DPXA 4UT4A 4B3RE 4KHPE 4LFCE 2DEIA 4DR5I 3M6AA 4JI2E 2BM1A 4DR3E 2GQ0A 1XNQI 2UXDI 1VISA 4LF7E 1HNXE 4OX9E 4LFBE 4FN5A 4X62I 1Z0GA 4IZKB 2V8PA 2R3VA 1RREA 4DV0I 3P06A 4IZJD 1FI4A 4R1FA 4JI0E 4X64I 4LF6I 3B78A 1Z0VA 4RPFA 4B3MI 4NXNE 2HHHI 1XMQI 3QT8A 1N34I 1FWLA 4N3OA 5BR8E 4LF4E 1H72C 2GS8A 5A2QQ 4B3TI 1KKHA 2VF3A 1FKAE 3WU4A 5IWAI 2UU9I 4LF9E 2BM0A 2UXBI 4PRVA 1Y6ZA 4DR6I 1IBKI 4LF5I 2E5LI 4Z7YA 1KTVA 3LPSA 1IBLI 2ZBKB 4DUZE 5IT9C 3ZKDA 3V2UC 3PRYA 4DR1E 2O1UA 4IZJB 3J80Q 4DR7I 4X65I 2XEXA 3T1HE 3HJCA 1HNZE 4JI6E 5IT9Q 3ZM7A 1Z0BA 4NXME 4GKJI 4USKA 2NPFA 4K0KI 1N0UA 4JI7E 4DV5E 5LL6R 2V34A 2A2CA 5FLXQ 1B62A 1N32I 2UUAE 4KHPI 3QT5A 4LFAE 1WUUA 3ZZUA 5FWKA 1S4EA 4DR3I 1EI1A 2ZITA 4PRXA 2J7KA 4DUYE 4ED4A 1NHJA 3LNUA 2PNLA 2IOQA 3WU3A 2Z5BB 4WUCA 1MG7A 1XNRE 1HNWE 3B8HA 1QZRA 4DR2I 2VQEI 1I94E 3J7AM 1MU5A 4FWHA 4DV2E 4JI0I 1N0VC 4JI3I 1J5EE 4MYUA 2UUBE 1HR0E 5L3JA 4AQYE 4LF8I 3OTOI 2WW4A 5LMNI 1N36I 4JG4A 3LTOA 1Y4UA 1XMOI 2ZM6E 1EA6A 4JV5E 4JI5E 1ZXNA 1NHHA 2LJPA 1DARA 3T1YE 2CG9A 4JI4E 2X7IA 5LMUE 1Z0CA 4DPTA 4B3SE 2PNMA 5A2QC 2UXCI 3PYFA 4HACB 4DUZI 1Z0TA 3PYDA 4JI8I 4DV4E 1NZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG I;  2HFU A;  4DV6 E;  4JYA I;  3T1H I;  4DU8 A;  4DR5 E;  4NXM I;  4PU9 A;  1Z5B A;  3B82 A;  2HK3 A;  1UEK A;  4USM A;  4JI7 I;  1S16 A;  4DV5 I;  3J80 C;  1ZM3 A;  1D6T A;  4WUB A;  1FWK A;  4YY3 E;  1XNQ E;  1H74 A;  1A6F A;  4GKK I;  2UXD E;  4DV1 I;  2VQF I;  4X62 E;  4DR4 I;  1IBM I;  4DV3 I;  2UUC I;  4DU7 A;  2V2V A;  1RR9 A;  5FLX C;  2V2Z A;  3WU6 A;  4DV7 I;  4LF6 E;  1ZM2 A;  3GON A;  1KIJ A;  4YHH I;  4FWD A;  1N33 E;  1HNW I;  4ZVI A;  2HK2 A;  3D4J A;  2HHH E;  3QT7 A;  1N34 E;  2OI2 A;  2V2Q A;  4B3R I;  4LFC I;  1BKN A;  2Q2E B;  4X66 E;  4JI1 E;  2EFG A;  4DV2 I;  1Z0W A;  1U2R A;  4FWG A;  4JI2 I;  5IWA E;  4P7A A;  2UU9 E;  4P52 A;  2UXB E;  4Z7C A;  4DR6 E;  1IBK E;  4LF5 E;  2E5L E;  1B63 A;  2X36 A;  2ZM6 I;  1ZM4 A;  4LF7 I;  1IBL E;  1HNX I;  4OX9 I;  4JV5 I;  4LFB I;  4HY1 A;  1KVK A;  4XTJ A;  4EMD A;  4DR7 E;  4X65 E;  3PYG A;  5GME A;  4DPW A;  3QT6 A;  1ZM9 A;  4GKJ E;  2DEJ A;  4DXL A;  1Z59 A;  3K1J A;  2F4V E;  4NXN I;  1OJ4 A;  4DV6 I;  5BR8 I;  4LF4 I;  1PIE A;  2HKJ A;  4URL A;  1N32 E;  3J81 C;  3H4L A;  3Q1Q A;  4LF9 I;  1K47 A;  3J81 Q;  1H7U A;  2R42 A;  4YY3 I;  4HXZ A;  2BV3 A;  4FW9 A;  4WUD A;  4KQV A;  4DR1 I;  4DR2 E;  2VQE E;  2HFS A;  2E1R A;  3ZKB A;  1HNZ I;  4JI6 I;  1H73 A;  4JI3 E;  1Z5C A;  4DPY A;  1FNM A;  1Z5A A;  2HKE A;  1N33 I;  4LF8 E;  3OTO E;  1N36 E;  5LMN E;  4I3H A;  1Z0E A;  4UTG A;  1XMO E;  2UUA I;  1ZXM A;  3F0N A;  4LFA I;  4JI1 I;  4X66 I;  3JAM C;  1ELO A;  3ZZ0 A;  4DV0 E;  1PVG A;  3JAM Q;  1NHI A;  4DUY I;  4X64 E;  1H7S A;  4HYM A;  2UXC E;  1XNR I;  4B3M E;  4JI8 E;  3K17 A;  1XMQ E;  1FJG E;  1I94 I;  4JYA E;  4B3T E;  1J5E I;  2UUB I;  1HR0 I;  3V5R A;  4AQY I;  2F4V I;  2AJ4 A;  3WU5 A;  4GKK E;  1MX0 A;  4JI5 I;  4DV1 E;  4M1K A;  2VQF E;  3T1Y I;  4JI4 I;  2CZ9 A;  4DR4 E;  5LMU I;  2A2D A;  1IBM E;  3CWV A;  5GMD A;  4B3S I;  4DV3 E;  3HUL A;  2UUC E;  3ZZT A;  3PYE A;  1PKP A;  4DV7 E;  1XHK A;  4K0K E;  4YHH E;  4DV4 I;  4DPU A;  4HAC A;  3J7A G;  4MYT A;  4DPX A;  4UT4 A;  4B3R E;  4KHP E;  4LFC E;  2DEI A;  4DR5 I;  3M6A A;  4JI2 E;  2BM1 A;  4DR3 E;  1XNQ I;  2UXD I;  1VIS A;  4LF7 E;  1HNX E;  4OX9 E;  4LFB E;  4FN5 A;  4X62 I;  1Z0G A;  2V8P A;  2R3V A;  1RRE A;  4DV0 I;  1FI4 A;  4R1F A;  4JI0 E;  4X64 I;  4LF6 I;  3B78 A;  1Z0V A;  4RPF A;  4B3M I;  4NXN E;  2HHH I;  1XMQ I;  3QT8 A;  1N34 I;  1FWL A;  5BR8 E;  4LF4 E;  1H72 C;  2GS8 A;  5A2Q Q;  4B3T I;  1KKH A;  2VF3 A;  1FKA E;  3WU4 A;  5IWA I;  2UU9 I;  4LF9 E;  2BM0 A;  2UXB I;  4PRV A;  4DR6 I;  1IBK I;  4LF5 I;  2E5L I;  4Z7Y A;  1KTV A;  3LPS A;  1IBL I;  2ZBK B;  4DUZ E;  5IT9 C;  3ZKD A;  3V2U C;  4DR1 E;  3J80 Q;  4DR7 I;  4X65 I;  2XEX A;  3T1H E;  1HNZ E;  4JI6 E;  5IT9 Q;  3ZM7 A;  1Z0B A;  4NXM E;  4GKJ I;  4USK A;  2NPF A;  4K0K I;  1N0U A;  4JI7 E;  4DV5 E;  5LL6 R;  2V34 A;  2A2C A;  5FLX Q;  1B62 A;  1N32 I;  2UUA E;  4KHP I;  3QT5 A;  4LFA E;  1WUU A;  3ZZU A;  1S4E A;  4DR3 I;  1EI1 A;  2ZIT A;  4PRX A;  2J7K A;  4DUY E;  4ED4 A;  1NHJ A;  3LNU A;  3WU3 A;  4WUC A;  1MG7 A;  1XNR E;  1HNW E;  3B8H A;  1QZR A;  4DR2 I;  2VQE I;  1I94 E;  3J7A M;  1MU5 A;  4FWH A;  4DV2 E;  4JI0 I;  1N0V C;  4JI3 I;  1J5E E;  4MYU A;  2UUB E;  1HR0 E;  5L3J A;  4AQY E;  4LF8 I;  3OTO I;  2WW4 A;  5LMN I;  1N36 I;  4JG4 A;  3LTO A;  1XMO I;  2ZM6 E;  1EA6 A;  4JV5 E;  4JI5 E;  1ZXN A;  1NHH A;  2LJP A;  1DAR A;  3T1Y E;  4JI4 E;  2X7I A;  5LMU E;  1Z0C A;  4DPT A;  4B3S E;  5A2Q C;  2UXC I;  3PYF A;  4HAC B;  4DUZ I;  1Z0T A;  3PYD A;  4JI8 I;  4DV4 E;  1NZ0 A; 
#chains in the Genus database with same CATH topology
 1FJG I;  2HFU A;  5DRP A;  4DV6 E;  4JYA I;  3T1H I;  5DRQ A;  4LCH A;  1E3H A;  2WNR B;  3CDI A;  4DU8 A;  5C0X C;  4DR5 E;  4NXM I;  4PU9 A;  2JT2 A;  1Z5B A;  3B82 A;  2HK3 A;  1UEK A;  2Z5C A;  4USM A;  5JEA A;  2C39 B;  4JI7 I;  1S16 A;  4DV5 I;  4IFD A;  3J80 C;  1ZM3 A;  1D6T A;  3L7Z A;  4WUB A;  1FWK A;  4MU4 A;  4YY3 E;  1H74 A;  1A6F A;  1XNQ E;  4GKK I;  2UXD E;  4DV1 I;  2VQF I;  4X62 E;  4DR4 I;  3Q6M A;  2CGE A;  1IBM I;  1E3P A;  5C0X B;  5JEA C;  4DV3 I;  3UHM A;  2UUC I;  4IFD C;  4DU7 A;  3HKM A;  1UDO A;  1YHC A;  2V2V A;  1RR9 A;  5FLX C;  2V2Z A;  3WU6 A;  4DV7 I;  4LF6 E;  2BA1 G;  1ZM2 A;  5K36 E;  3GON A;  1KIJ A;  4YHH I;  4FWD A;  1N33 E;  1HNW I;  4ZVI A;  4BA2 A;  2HK2 A;  3D4J A;  2HHH E;  2O1V A;  2JEA B;  3QT7 A;  1N34 E;  2OI2 A;  2V2Q A;  4B3R I;  2JEB A;  3P3G A;  4LFC I;  1BKN A;  2O1T A;  2BR2 B;  2Q2E B;  4X66 E;  4JI1 E;  2EFG A;  4DV2 I;  1Z0W A;  1U2R A;  4FWG A;  4JI2 I;  5IWA E;  4P7A A;  2UU9 E;  4IS9 A;  4ISA A;  4P52 A;  2UXB E;  4Z7C A;  4DR6 E;  1IBK E;  4LF5 E;  2E5L E;  1B63 A;  2X36 A;  5DNX A;  2ZM6 I;  1ZM4 A;  4LF7 I;  1IBL E;  1HNX I;  4OX9 I;  4GQU A;  4JV5 I;  3GLL A;  4HY1 A;  4LFB I;  2PO0 A;  1KVK A;  4XTJ A;  4EMD A;  4DR7 E;  4X65 E;  3PYG A;  5GME A;  5DNL A;  4AM3 A;  3PS2 A;  4DPW A;  1R6M A;  4U3B A;  1P42 A;  2PO1 A;  3QT6 A;  4FW4 A;  1ZM9 A;  4GKJ E;  2DEJ A;  4DXL A;  3U1K A;  1Z59 A;  3K1J A;  2F4V E;  4NXN I;  2JEB B;  3PS3 A;  1OJ4 A;  4DV6 I;  5C0X E;  5BR8 I;  4LF4 I;  1PIE A;  2HKJ A;  1VI7 A;  4URL A;  2GO4 A;  1N32 E;  3J81 C;  3H4L A;  5ELW A;  4LPF A;  3Q1Q A;  4LF9 I;  3M85 D;  3P3C A;  1UDS A;  4AID A;  1K47 A;  2C37 A;  1XXE A;  5EKW A;  3J81 Q;  4FW6 A;  2PO0 B;  1H7U A;  5C0X D;  2R42 A;  3DD6 A;  4YY3 I;  4HXZ A;  2BV3 A;  4FW9 A;  4WUD A;  1UDQ A;  4KQV A;  4DR1 I;  4DR2 E;  1Y4S A;  2VQE E;  2HFS A;  2E1R A;  3ZKB A;  1HNZ I;  4JI6 I;  1H73 A;  3K85 A;  4IZJ A;  4JI3 E;  1Z5C A;  2O1W A;  4DPY A;  4MU1 A;  1FNM A;  2WP8 A;  1Z5A A;  5JEA D;  2HKE A;  4IFD D;  1N33 I;  5DRR A;  4LF8 E;  3OTO E;  1N36 E;  5LMN E;  2Z5E A;  4I3H A;  2PO2 B;  1Z0E A;  4UTG A;  1XMO E;  2UUA I;  1ZXM A;  3F0N A;  4LFA I;  1UDN A;  4JI1 I;  4X66 I;  2IOP A;  3JAM C;  2BA0 D;  1ELO A;  1USU A;  2JE6 B;  2C37 B;  3ZZ0 A;  4AIM A;  1HK7 A;  4DV0 E;  4FW7 A;  1PVG A;  4OKG A;  3JAM Q;  1NHI A;  4DUY I;  4X64 E;  1H7S A;  4HYM A;  2UXC E;  1XNR I;  4B3M E;  2F1D A;  4JI8 E;  3K17 A;  1XMQ E;  1FJG E;  2Z5B A;  5EL9 A;  2NN6 F;  1I94 I;  4MQY A;  4B3T E;  4JYA E;  3M7N D;  3U1Y A;  1J5E I;  2Z5C B;  5JEA B;  4IFD B;  2UUB I;  3M85 G;  1HR0 I;  3L7Z B;  4NBQ A;  3V5R A;  4AQY I;  2F4V I;  4OO1 F;  4BA1 A;  2AJ4 A;  1USV A;  5DRO A;  3WU5 A;  4GKK E;  1MX0 A;  4JI5 I;  4DV1 E;  4QNJ A;  4M1K A;  2VQF E;  3T1Y I;  4JI4 I;  3H1C A;  2CZ9 A;  2PNZ A;  4DR4 E;  5LMU I;  2A2D A;  1IBM E;  3CWV A;  4MU0 A;  4IZK A;  5GMD A;  4B3S I;  4DV3 E;  3HUL A;  2UUC E;  3ZZT A;  4BA2 B;  3PYE A;  1PKP A;  4DV7 E;  4U3D A;  1XHK A;  4K0K E;  4YHH E;  4DV4 I;  4DPU A;  3Q6N A;  4HAC A;  3J7A G;  4MYT A;  4DPX A;  4UT4 A;  1RHY A;  4B3R E;  4KHP E;  2BA0 G;  4LFC E;  4FW3 A;  3GME A;  2DEI A;  4DR5 I;  3M6A A;  2O3Z A;  4FW5 A;  4JI2 E;  2GO3 A;  2BM1 A;  3KRN A;  4DR3 E;  2GQ0 A;  3GCM A;  1XNQ I;  2UXD I;  1VIS A;  2PNZ B;  2C38 A;  4LF7 E;  1HNX E;  4OX9 E;  3P76 A;  4LFB E;  5JEA E;  2VES A;  4FN5 A;  4X62 I;  4IFD E;  5K36 F;  1Z0G A;  4IZK B;  2V8P A;  2R3V A;  1RRE A;  2PO1 B;  4DV0 I;  3P06 A;  3M7N G;  4IZJ D;  1FI4 A;  4R1F A;  4JI0 E;  2IER A;  2NN6 A;  4X64 I;  4LF6 I;  3B78 A;  1Z0V A;  4RPF A;  4B3M I;  3B4T A;  4NXN E;  3CDJ A;  2HHH I;  1XMQ I;  3QT8 A;  1N34 I;  1FWL A;  4N3O A;  5BR8 E;  4LF4 E;  4OO1 D;  1H72 C;  2GS8 A;  5A2Q Q;  1OYR A;  4OO1 A;  4B3T I;  1KKH A;  2VF3 A;  1FKA E;  3WU4 A;  2JEA A;  2NN6 C;  1YH8 A;  1OYP A;  5IWA I;  2UU9 I;  2BR2 A;  4LF9 E;  2BM0 A;  2UXB I;  4PRV A;  1Y6Z A;  4DR6 I;  1IBK I;  4LF5 I;  2C38 B;  2E5L I;  4Z7Y A;  1KTV A;  3LPS A;  1IBL I;  2ZBK B;  4OO1 C;  4DUZ E;  5IT9 C;  3ZKD A;  3V2U C;  3PRY A;  4DR1 E;  2O1U A;  4IZJ B;  3J80 Q;  4DR7 I;  4X65 I;  2XEX A;  2NN6 B;  4LOM A;  3T1H E;  1R6L A;  3HJC A;  5C0X F;  1HNZ E;  4JI6 E;  2WP8 B;  5IT9 Q;  3ZM7 A;  1Y5Y A;  1Z0B A;  4NXM E;  4J3D A;  4GKJ I;  4USK A;  2NPF A;  4K0K I;  1N0U A;  4JI7 E;  4OO1 B;  4DV5 E;  4LCF A;  5LL6 R;  2V34 A;  2A2C A;  5FLX Q;  1B62 A;  1N32 I;  2UUA E;  4KHP I;  3QT5 A;  4LFA E;  1OYS A;  3NZK A;  3PS1 A;  5JEA F;  1WUU A;  4IFD F;  3ZZU A;  4MDT A;  5FWK A;  5K36 D;  1S4E A;  5K36 A;  4DR3 I;  1EI1 A;  2ZIT A;  4PRX A;  2J7K A;  4DUY E;  4MU3 A;  4ED4 A;  1NHJ A;  3LNU A;  2PNL A;  2IOQ A;  3WU3 A;  2Z5B B;  4WUC A;  1MG7 A;  1XNR E;  1HNW E;  3B8H A;  1QZR A;  4DR2 I;  2VQE I;  5K36 C;  1I94 E;  3J7A M;  1MU5 A;  4FWH A;  4DV2 E;  4JI0 I;  1N0V C;  4JI3 I;  1J5E E;  4BA1 B;  4MYU A;  2UUB E;  1HR0 E;  5L3J A;  4AQY E;  2BA1 D;  4OZE A;  4LF8 I;  3OTO I;  2WNR A;  2WW4 A;  5LMN I;  1N36 I;  2J65 A;  4JG4 A;  3LTO A;  2NN6 E;  1Y60 A;  1Y4U A;  1XMO I;  2ZM6 E;  1EA6 A;  2C39 A;  4JV5 E;  4JI5 E;  4LCG A;  1ZXN A;  1NHH A;  2LJP A;  1DAR A;  3T1Y E;  2PO2 A;  2CG9 A;  5K36 B;  4JI4 E;  2AE8 A;  2X7I A;  5LMU E;  1Z0C A;  4OO1 E;  4QNK A;  2IES A;  4DPT A;  2JE6 A;  4B3S E;  2NN6 D;  2PNM A;  5A2Q C;  5C0X A;  2UXC I;  3PYF A;  4HAC B;  4DUZ I;  3P3E A;  2CVE A;  1Z0T A;  3PYD A;  4JI8 I;  4DV4 E;  1NZ0 A; 
#chains in the Genus database with same CATH homology
 1FJG I;  2HFU A;  4DV6 E;  4JYA I;  3T1H I;  4DU8 A;  4DR5 E;  4NXM I;  4PU9 A;  1Z5B A;  3B82 A;  2HK3 A;  1UEK A;  2Z5C A;  4USM A;  4JI7 I;  1S16 A;  4DV5 I;  3J80 C;  1ZM3 A;  1D6T A;  4WUB A;  1FWK A;  4YY3 E;  1XNQ E;  1H74 A;  1A6F A;  4GKK I;  2UXD E;  4DV1 I;  2VQF I;  4X62 E;  4DR4 I;  3Q6M A;  2CGE A;  1IBM I;  4DV3 I;  2UUC I;  4DU7 A;  2V2V A;  1RR9 A;  5FLX C;  2V2Z A;  3WU6 A;  4DV7 I;  4LF6 E;  1ZM2 A;  3GON A;  1KIJ A;  4YHH I;  4FWD A;  1N33 E;  1HNW I;  4ZVI A;  2HK2 A;  3D4J A;  2HHH E;  2O1V A;  3QT7 A;  1N34 E;  2OI2 A;  2V2Q A;  4B3R I;  4LFC I;  1BKN A;  2O1T A;  2Q2E B;  4X66 E;  4JI1 E;  2EFG A;  4DV2 I;  1Z0W A;  1U2R A;  4FWG A;  4JI2 I;  5IWA E;  4P7A A;  2UU9 E;  4P52 A;  2UXB E;  4Z7C A;  4DR6 E;  1IBK E;  4LF5 E;  2E5L E;  1B63 A;  2X36 A;  2ZM6 I;  1ZM4 A;  4LF7 I;  1IBL E;  1HNX I;  4OX9 I;  4JV5 I;  4LFB I;  4HY1 A;  1KVK A;  4XTJ A;  4EMD A;  4DR7 E;  4X65 E;  3PYG A;  5GME A;  4DPW A;  3QT6 A;  1ZM9 A;  4GKJ E;  2DEJ A;  4DXL A;  1Z59 A;  3K1J A;  2F4V E;  4NXN I;  1OJ4 A;  4DV6 I;  5BR8 I;  4LF4 I;  1PIE A;  2HKJ A;  4URL A;  1N32 E;  3J81 C;  3H4L A;  3Q1Q A;  4LF9 I;  1K47 A;  3J81 Q;  1H7U A;  2R42 A;  4YY3 I;  4HXZ A;  2BV3 A;  4FW9 A;  4WUD A;  4KQV A;  4DR1 I;  4DR2 E;  1Y4S A;  2VQE E;  2HFS A;  2E1R A;  3ZKB A;  1HNZ I;  4JI6 I;  1H73 A;  3K85 A;  4IZJ A;  4JI3 E;  1Z5C A;  2O1W A;  4DPY A;  1FNM A;  1Z5A A;  2HKE A;  1N33 I;  4LF8 E;  3OTO E;  1N36 E;  5LMN E;  2Z5E A;  4I3H A;  1Z0E A;  4UTG A;  1XMO E;  2UUA I;  1ZXM A;  3F0N A;  4LFA I;  4JI1 I;  4X66 I;  2IOP A;  3JAM C;  1ELO A;  1USU A;  3ZZ0 A;  1HK7 A;  4DV0 E;  1PVG A;  3JAM Q;  1NHI A;  4DUY I;  4X64 E;  1H7S A;  4HYM A;  2UXC E;  1XNR I;  4B3M E;  4JI8 E;  3K17 A;  1XMQ E;  1FJG E;  2Z5B A;  1I94 I;  4JYA E;  4B3T E;  1J5E I;  2Z5C B;  2UUB I;  1HR0 I;  3V5R A;  4AQY I;  2F4V I;  2AJ4 A;  1USV A;  3WU5 A;  4GKK E;  1MX0 A;  4JI5 I;  4DV1 E;  4M1K A;  2VQF E;  3T1Y I;  4JI4 I;  2CZ9 A;  4DR4 E;  5LMU I;  2A2D A;  1IBM E;  3CWV A;  5GMD A;  4IZK A;  4B3S I;  4DV3 E;  3HUL A;  2UUC E;  3ZZT A;  3PYE A;  1PKP A;  4DV7 E;  1XHK A;  4K0K E;  4YHH E;  4DV4 I;  4DPU A;  3Q6N A;  4HAC A;  3J7A G;  4MYT A;  4DPX A;  4UT4 A;  4B3R E;  4KHP E;  4LFC E;  2DEI A;  4DR5 I;  3M6A A;  4JI2 E;  2BM1 A;  4DR3 E;  2GQ0 A;  1XNQ I;  2UXD I;  1VIS A;  4LF7 E;  1HNX E;  4OX9 E;  4LFB E;  4FN5 A;  4X62 I;  1Z0G A;  4IZK B;  2V8P A;  2R3V A;  1RRE A;  4DV0 I;  3P06 A;  4IZJ D;  1FI4 A;  4R1F A;  4JI0 E;  4X64 I;  4LF6 I;  3B78 A;  1Z0V A;  4RPF A;  4B3M I;  4NXN E;  2HHH I;  1XMQ I;  3QT8 A;  1N34 I;  1FWL A;  4N3O A;  5BR8 E;  4LF4 E;  1H72 C;  2GS8 A;  5A2Q Q;  4B3T I;  1KKH A;  2VF3 A;  1FKA E;  3WU4 A;  5IWA I;  2UU9 I;  4LF9 E;  2BM0 A;  2UXB I;  4PRV A;  1Y6Z A;  4DR6 I;  1IBK I;  4LF5 I;  2E5L I;  4Z7Y A;  1KTV A;  3LPS A;  1IBL I;  2ZBK B;  4DUZ E;  5IT9 C;  3ZKD A;  3V2U C;  3PRY A;  4DR1 E;  2O1U A;  4IZJ B;  3J80 Q;  4DR7 I;  4X65 I;  2XEX A;  3T1H E;  3HJC A;  1HNZ E;  4JI6 E;  5IT9 Q;  3ZM7 A;  1Z0B A;  4NXM E;  4GKJ I;  4USK A;  2NPF A;  4K0K I;  1N0U A;  4JI7 E;  4DV5 E;  5LL6 R;  2V34 A;  2A2C A;  5FLX Q;  1B62 A;  1N32 I;  2UUA E;  4KHP I;  3QT5 A;  4LFA E;  1WUU A;  3ZZU A;  5FWK A;  1S4E A;  4DR3 I;  1EI1 A;  2ZIT A;  4PRX A;  2J7K A;  4DUY E;  4ED4 A;  1NHJ A;  3LNU A;  2PNL A;  2IOQ A;  3WU3 A;  2Z5B B;  4WUC A;  1MG7 A;  1XNR E;  1HNW E;  3B8H A;  1QZR A;  4DR2 I;  2VQE I;  1I94 E;  3J7A M;  1MU5 A;  4FWH A;  4DV2 E;  4JI0 I;  1N0V C;  4JI3 I;  1J5E E;  4MYU A;  2UUB E;  1HR0 E;  5L3J A;  4AQY E;  4LF8 I;  3OTO I;  2WW4 A;  5LMN I;  1N36 I;  4JG4 A;  3LTO A;  1Y4U A;  1XMO I;  2ZM6 E;  1EA6 A;  4JV5 E;  4JI5 E;  1ZXN A;  1NHH A;  2LJP A;  1DAR A;  3T1Y E;  2CG9 A;  4JI4 E;  2X7I A;  5LMU E;  1Z0C A;  4DPT A;  4B3S E;  2PNM A;  5A2Q C;  2UXC I;  3PYF A;  4HAC B;  4DUZ I;  1Z0T A;  3PYD A;  4JI8 I;  4DV4 E;  1NZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...