1N36I

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n36I00
4JI1E 2DEJA 1B62A 4DV6I 4GKJE 2UU9I 2VQEI 4B3SI 2V2ZA 4LFBE 4X62I 1MG7A 2Q2EB 4LFAI 4YHHE 2VQFE 4HACA 1Z5AA 4DUYE 5GMEA 4DV2E 2ZBKB 4DR6I 3ZM7A 4JI1I 3GONA 4B3ME 4DR4E 2UXCE 4GKJI 1FNMA 4DV4E 3ZZ0A 4LF6E 4LFBI 2UXDI 2CZ9A 4FWGA 3JAMQ 2V2QA 4YHHI 1RREA 2VQFI 4DUYI 4DV2I 4EMDA 1N33I 4B3MI 3LPSA 2J7KA 4DR4I 1ZXMA 4DV4I 4LF6I 3B82A 1S16A 2UUCE 4DPWA 4GKKI 3HULA 2WW4A 1Z0CA 5IT9C 4MYTA 1K47A 1RR9A 3ZKBA 4PRXA 2ZM6E 1XNQE 4JI5E 3J80C 4HACB 1Z0TA 3WU6A 1HNZE 1FJGE 1HNWE 3LTOA 1N0VC 2HHHE 4DV7E 3PYDA 2UXBE 3ZKDA 4X66E 1BKNA 3OTOE 4JI7E 2UUAE 1Z0VA 1IBME 1XNQI 4P52A 2BM0A 4DR7E 1Z5BA 1HNZI 1FJGI 1HNWI 4URLA 1ZXNA 3B8HA 4DV3E 2HHHI 2UXBI 4X66I 2HKJA 1Z0BA 4HY1A 1ZM9A 1KVKA 2AJ4A 4DR1E 3OTOI 4USMA 1HNXI 2UUAI 2HFUA 3QT7A 1IBMI 1NHHA 2XEXA 4Z7CA 1MU5A 5LMUE 4DR7I 4LF4E 3QT6A 4DU8A 1Z0EA 2BV3A 4DV3I 4X65I 3ZZTA 3J81Q 4B3TE 4B3RE 4DXLA 4DR1I 3K1JA 3K17A 2E1RA 3T1HE 3WU5A 4LF4I 4YY3E 4USKA 4HYMA 3PYEA 4DPTA 4DU7A 4B3TI 4B3RI 1HR0E 1XHKA 2UUBE 4X64E 4JI2E 4YY3I 1IBLE 1XNRE 1VISA 5A2QQ 1PKPA 2UXCI 3Q1QA 5FLXQ 4DV5E 2HKEA 2X36A 3B78A 3T1YE 4DV0E 2E5LE 1HR0I 4DPUA 1XMOE 5BR8E 2UUBI 1QZRA 4DPYA 3JAMC 4JI2I 1DARA 1Z5CA 4DR5E 1IBLI 4MYUA 3H4LA 1XNRI 3QT8A 1H7UA 2GS8A 4WUDA 4JI6E 1FKAE 2V8PA 4JV5E 3QT5A 4DV5I 3T1YI 2R42A 4DV0I 1KIJA 2E5LI 1XMOI 1U2RA 1FI4A 2UUCI 1KKHA 1IBKE 4WUCA 1NHJA 5BR8I 3LNUA 1PIEA 1H7SA 1A6FA 4LF9E 1N36E 1S4EA 4DR5I 2ZM6I 4JI5I 4JI6I 1FWKA 3M6AA 4JI4E 5GMDA 2R3VA 2ZITA 4DV7I 2NPFA 3J7AM 4LF8E 4R1FA 1FWLA 5LMNE 3WU3A 4JI3E 4ZVIA 1N0UA 1N36I 4JI7I 3ZZUA 2HK2A 4DR2E 4WUBA 2HK3A 1KTVA 4JYAE 4OX9E 4LF7E 2EFGA 1NZ0A 2UU9E 4HXZA 4AQYE 4LF8I 5LMNI 4JI3I 4P7AA 3D4JA 4DR2I 4ED4A 5LMUI 4XTJA 2LJPA 4JYAI 3J7AG 4OX9I 4LF7I 4AQYI 1OJ4A 2X7IA 2UXDE 4DV1E 2F4VE 4NXNE 2V34A 3J81C 3T1HI 1Z59A 4M1KA 2OI2A 1N33E 4FW9A 4FN5A 4NXME 1ZM3A 4JG4A 4I3HA 3CWVA 1ZM2A 1EA6A 5IT9Q 1NHIA 4GKKE 4DV1I 2F4VI 4NXNI 4KHPE 1Z0GA 3J80Q 4X64I 1ELOA 1H72C 3F0NA 1UEKA 4NXMI 4UT4A 1I94E 4PU9A 4DR3E 3PYFA 3V2UC 4LF5E 1ZM4A 5A2QC 4FWHA 5FLXC 1N32E 4RPFA 4KHPI 4DPXA 4FWDA 5IWAE 2BM1A 4JI8E 2HFSA 4LFCE 4DUZE 1I94I 1MX0A 3V5RA 2V2VA 4DR3I 4JV5I 4LF5I 1D6TA 1N32I 4PRVA 4K0KE 1IBKI 2VF3A 1H73A 1Z0WA 4KQVA 1HNXE 1J5EE 5L3JA 5LL6R 1EI1A 1N34E 4LF9I 5IWAI 2A2CA 4JI8I 4JI0E 4Z7YA 1XMQE 4LFCI 4DUZI 1WUUA 3PYGA 4JI4I 1PVGA 4X65E 4DV6E 1B63A 2VQEE 4B3SE 4UTGA 4X62E 4K0KI 1H74A 4LFAE 2A2DA 3WU4A 1J5EI 1N34I 4JI0I 2DEIA 1XMQI 4DR6E
chains in the Genus database with same CATH superfamily
4JI1E 2NN6B 2DEJA 4QNKA 1OYSA 2CVEA 1B62A 5JEAC 4DV6I 4GKJE 2UU9I 2VQEI 4B3SI 2V2ZA 4LFBE 4X62I 1MG7A 2Q2EB 4LFAI 3L7ZA 2AE8A 4MU4A 4YHHE 2VQFE 4HACA 1Z5AA 1P42A 4DUYE 5GMEA 3M85D 4DV2E 2ZBKB 4DR6I 3ZM7A 5K36D 4JI1I 1VI7A 3GONA 3P76A 4B3ME 4DR4E 2UXCE 4GKJI 1FNMA 2BA0G 4DV4E 3ZZ0A 4LF6E 2CGEA 4LFBI 2UXDI 2CZ9A 4FWGA 4OKGA 2C39B 3JAMQ 3CDJA 3P3CA 2V2QA 4YHHI 1UDNA 1RREA 2VQFI 1HK7A 4DUYI 4DV2I 1OYRA 4EMDA 1N33I 3PS2A 4B3MI 4IS9A 3LPSA 2J7KA 4DR4I 1ZXMA 2WNRA 4DV4I 4LF6I 3GCMA 3B82A 2BR2A 1S16A 2UUCE 1UDQA 2C37A 3HULA 4DPWA 4GKKI 2WW4A 1Z0CA 2GO4A 5IT9C 4AIMA 1Y60A 4MYTA 4MQYA 2Z5BA 1K47A 4LCFA 1RR9A 3ZKBA 4PRXA 2NN6D 2ZM6E 1XNQE 4JI5E 3L7ZB 4OO1C 3J80C 5K36C 1R6LA 4HACB 1Z0TA 5DRQA 3WU6A 1HNZE 1FJGE 1HNWE 3LTOA 5JEAD 4IFDA 1N0VC 2HHHE 4DV7E 3PYDA 2UXBE 3ZKDA 4X66E 3CDIA 4NBQA 1BKNA 3OTOE 4JI7E 2UUAE 1Y5YA 1Z0VA 1IBME 1XNQI 3M85G 4LOMA 5DRRA 4P52A 4IFDE 2BM0A 4DR7E 1Z5BA 1HNZI 1FJGI 1HNWI 4BA1B 1ZXNA 3B8HA 4URLA 4DV3E 2HHHI 3PRYA 4BA2A 2UXBI 4OZEA 4X66I 1R6MA 4MU1A 1Y4SA 2HKJA 1Z0BA 4HY1A 4LCGA 1ZM9A 1KVKA 2AJ4A 2WNRB 4DR1E 3P3GA 3OTOI 4USMA 1HNXI 2UUAI 2Z5EA 2HFUA 3QT7A 2BR2B 2C37B 4GQUA 1IBMI 1NHHA 2NN6C 2VESA 2XEXA 4Z7CA 1MU5A 4IZKA 1RHYA 5LMUE 4DR7I 4LF4E 2Z5BB 3QT6A 4IZJA 4DU8A 1Z0EA 2JEAA 2BV3A 3HKMA 4DV3I 4X65I 3ZZTA 2BA1D 1Y6ZA 3J81Q 4B3TE 4B3RE 2IERA 3U1KA 4DXLA 2PO1A 4DR1I 2JT2A 3K1JA 3K17A 3NZKA 2E1RA 3T1HE 1USUA 3WU5A 3U1YA 3UHMA 2GQ0A 3K85A 4LF4I 4YY3E 4OO1D 4USKA 4HYMA 3PYEA 4DPTA 4DU7A 2JEBA 4B3TI 4B3RI 1XXEA 2O1VA 2CG9A 1HR0E 1XHKA 2UUBE 4BA2B 4X64E 5K36A 3PS1A 5C0XA 4JI2E 4YY3I 1IBLE 1XNRE 1VISA 5A2QQ 1PKPA 2UXCI 3Q1QA 4FW5A 5FLXQ 4DV5E 2HKEA 2X36A 4IZKB 3B78A 4LPFA 4DV0E 3T1YE 4MU3A 4IZJB 2E5LE 1HR0I 2JEAB 4DPUA 5DROA 1XMOE 5C0XE 5K36E 2GO3A 5BR8E 2UUBI 1QZRA 2IOQA 4DPYA 3JAMC 4JI2I 1DARA 1Z5CA 4N3OA 4DR5E 2PO1B 1IBLI 4MYUA 3H4LA 1XNRI 2WP8A 1H7UA 2GS8A 3QT8A 4WUDA 4JI6E 1FKAE 2V8PA 3B4TA 4JV5E 3QT5A 4DV5I 3T1YI 2R42A 4DV0I 1KIJA 2E5LI 1XMOI 1U2RA 1FI4A 2UUCI 1KKHA 1IBKE 4WUCA 1NHJA 5BR8I 3LNUA 2PNZA 1PIEA 2NN6A 2JEBB 1H7SA 5K36F 5C0XF 1A6FA 4LF9E 1N36E 1S4EA 4DR5I 2ZM6I 4JI5I 4JI6I 1FWKA 2PO0A 3M6AA 4JI4E 5JEAA 5C0XB 3DD6A 5GMDA 2R3VA 2ZITA 3HJCA 2PNMA 2NN6E 5EKWA 4DV7I 4J3DA 2NPFA 3H1CA 3J7AM 4LF8E 1USVA 4R1FA 1FWLA 2O1WA 5LMNE 3WU3A 4JI3E 4ZVIA 1N0UA 1N36I 4JI7I 5JEAE 3ZZUA 3Q6MA 2IESA 2HK2A 4DR2E 4WUBA 2HK3A 2IOPA 1KTVA 1Y4UA 4JYAE 4OX9E 4LF7E 2EFGA 1NZ0A 4IFDF 2UU9E 2WP8B 4HXZA 4AQYE 2JE6A 4LF8I 2PO2A 2NN6F 5LMNI 4JI3I 4AM3A 4IFDB 3Q6NA 5DNXA 4P7AA 3D4JA 4DR2I 2PNZB 4ED4A 5LMUI 4XTJA 2LJPA 5JEAF 4JYAI 3J7AG 4OX9I 2C38A 4LF7I 2O1TA 3M7ND 4AQYI 1OJ4A 2X7IA 2PO0B 2UXDE 1E3PA 5ELWA 5JEAB 4DV1E 2F4VE 4NXNE 2V34A 1OYPA 3J81C 3P3EA 3T1HI 4OO1A 1Z59A 4M1KA 2OI2A 1N33E 5C0XD 4FW9A 4FN5A 5FWKA 4NXME 1ZM3A 4JG4A 3PS3A 5DNLA 4I3HA 4MU0A 3CWVA 1ZM2A 1EA6A 5IT9Q 1NHIA 4GKKE 4DV1I 4OO1E 2F4VI 4NXNI 5EL9A 4FW6A 4ISAA 4FW3A 4KHPE 1Z0GA 1YH8A 3J80Q 4X64I 3GLLA 1ELOA 2JE6B 2PO2B 4BA1A 1H72C 2Z5CA 3F0NA 1UEKA 3P06A 4NXMI 4UT4A 1I94E 4PU9A 4DR3E 3PYFA 3V2UC 4LF5E 1ZM4A 5A2QC 4FWHA 2C38B 4IFDD 2BA1G 5FLXC 1N32E 2J65A 4RPFA 4AIDA 5DRPA 4KHPI 4DPXA 4FWDA 4OO1F 1YHCA 2BM1A 5IWAE 4JI8E 2HFSA 4LFCE 4DUZE 5C0XC 1I94I 1MX0A 4U3BA 2V2VA 3V5RA 4DR3I 4OO1B 2BA0D 5K36B 2O3ZA 4JV5I 4LF5I 2F1DA 1UDOA 3M7NG 1D6TA 4FW4A 1N32I 4PRVA 4K0KE 1IBKI 4FW7A 2VF3A 1H73A 1Z0WA 4KQVA 1UDSA 2PNLA 1HNXE 1J5EE 5L3JA 5LL6R 1EI1A 1N34E 4LF9I 5IWAI 4LCHA 2A2CA 4JI8I 4JI0E 4Z7YA 1XMQE 4LFCI 4DUZI 3GMEA 4QNJA 1WUUA 3PYGA 3KRNA 4JI4I 2C39A 2Z5CB 1PVGA 4IZJD 4X65E 4DV6E 1B63A 2VQEE 2O1UA 4B3SE 4UTGA 4X62E 4K0KI 4IFDC 1E3HA 1H74A 4LFAE 2A2DA 4MDTA 4U3DA 3WU4A 1J5EI 1N34I 4JI0I 2DEIA 1XMQI 4DR6E
chains in the Genus database with same CATH topology
4JI1E 2DEJA 1B62A 4DV6I 4GKJE 2UU9I 2VQEI 4B3SI 2V2ZA 4LFBE 4X62I 1MG7A 2Q2EB 4LFAI 4YHHE 2VQFE 4HACA 1Z5AA 4DUYE 5GMEA 4DV2E 2ZBKB 4DR6I 3ZM7A 4JI1I 3GONA 4B3ME 4DR4E 2UXCE 4GKJI 1FNMA 4DV4E 3ZZ0A 4LF6E 2CGEA 4LFBI 2UXDI 2CZ9A 4FWGA 3JAMQ 2V2QA 4YHHI 1RREA 2VQFI 1HK7A 4DUYI 4DV2I 4EMDA 1N33I 4B3MI 3LPSA 2J7KA 4DR4I 1ZXMA 4DV4I 4LF6I 3B82A 1S16A 2UUCE 4DPWA 4GKKI 3HULA 2WW4A 1Z0CA 5IT9C 4MYTA 2Z5BA 1K47A 1RR9A 3ZKBA 4PRXA 2ZM6E 1XNQE 4JI5E 3J80C 4HACB 1Z0TA 3WU6A 1HNZE 1FJGE 1HNWE 3LTOA 1N0VC 2HHHE 4DV7E 3PYDA 2UXBE 3ZKDA 4X66E 1BKNA 3OTOE 4JI7E 2UUAE 1Z0VA 1IBME 1XNQI 4P52A 2BM0A 4DR7E 1Z5BA 1HNZI 1FJGI 1HNWI 4URLA 1ZXNA 3B8HA 4DV3E 2HHHI 3PRYA 2UXBI 4X66I 1Y4SA 2HKJA 1Z0BA 4HY1A 1ZM9A 1KVKA 2AJ4A 4DR1E 3OTOI 4USMA 1HNXI 2UUAI 2Z5EA 2HFUA 3QT7A 1IBMI 1NHHA 2XEXA 4Z7CA 1MU5A 4IZKA 5LMUE 4DR7I 4LF4E 2Z5BB 3QT6A 4IZJA 4DU8A 1Z0EA 2BV3A 4DV3I 4X65I 3ZZTA 1Y6ZA 3J81Q 4B3TE 4B3RE 4DXLA 4DR1I 3K1JA 3K17A 2E1RA 3T1HE 1USUA 3WU5A 2GQ0A 3K85A 4LF4I 4YY3E 4USKA 4HYMA 3PYEA 4DPTA 4DU7A 4B3TI 4B3RI 2O1VA 2CG9A 1HR0E 1XHKA 2UUBE 4X64E 4JI2E 4YY3I 1IBLE 1XNRE 1VISA 5A2QQ 1PKPA 2UXCI 3Q1QA 5FLXQ 4DV5E 2HKEA 2X36A 4IZKB 3B78A 3T1YE 4DV0E 4IZJB 2E5LE 1HR0I 4DPUA 1XMOE 5BR8E 2UUBI 1QZRA 2IOQA 4DPYA 3JAMC 4JI2I 1DARA 1Z5CA 4N3OA 4DR5E 1IBLI 4MYUA 3H4LA 1XNRI 3QT8A 1H7UA 2GS8A 4WUDA 4JI6E 1FKAE 2V8PA 4JV5E 3QT5A 4DV5I 3T1YI 2R42A 4DV0I 1KIJA 2E5LI 1XMOI 1U2RA 1FI4A 2UUCI 1KKHA 1IBKE 4WUCA 1NHJA 5BR8I 3LNUA 1PIEA 1H7SA 1A6FA 4LF9E 1N36E 1S4EA 4DR5I 2ZM6I 4JI5I 4JI6I 1FWKA 3M6AA 4JI4E 5GMDA 2R3VA 2ZITA 3HJCA 2PNMA 4DV7I 2NPFA 3J7AM 4LF8E 1USVA 4R1FA 1FWLA 2O1WA 5LMNE 3WU3A 4JI3E 4ZVIA 1N0UA 1N36I 4JI7I 3ZZUA 3Q6MA 2HK2A 4DR2E 4WUBA 2HK3A 2IOPA 1KTVA 1Y4UA 4JYAE 4OX9E 4LF7E 2EFGA 1NZ0A 2UU9E 4HXZA 4AQYE 4LF8I 5LMNI 4JI3I 3Q6NA 4P7AA 3D4JA 4DR2I 4ED4A 5LMUI 4XTJA 2LJPA 4JYAI 3J7AG 4OX9I 4LF7I 2O1TA 4AQYI 1OJ4A 2X7IA 2UXDE 4DV1E 2F4VE 4NXNE 2V34A 3J81C 3T1HI 1Z59A 4M1KA 2OI2A 1N33E 5FWKA 4FW9A 4FN5A 4NXME 1ZM3A 4JG4A 4I3HA 3CWVA 1ZM2A 1EA6A 5IT9Q 1NHIA 4GKKE 4DV1I 2F4VI 4NXNI 4KHPE 1Z0GA 3J80Q 4X64I 1ELOA 1H72C 2Z5CA 3F0NA 1UEKA 3P06A 4NXMI 4UT4A 1I94E 4PU9A 4DR3E 3PYFA 3V2UC 4LF5E 1ZM4A 5A2QC 4FWHA 5FLXC 1N32E 4RPFA 4KHPI 4DPXA 4FWDA 5IWAE 2BM1A 4JI8E 2HFSA 4LFCE 4DUZE 1I94I 1MX0A 3V5RA 2V2VA 4DR3I 4JV5I 4LF5I 1D6TA 1N32I 4PRVA 4K0KE 1IBKI 2VF3A 1H73A 1Z0WA 4KQVA 2PNLA 1HNXE 1J5EE 5L3JA 5LL6R 1EI1A 1N34E 4LF9I 5IWAI 2A2CA 4JI8I 4JI0E 4Z7YA 1XMQE 4LFCI 4DUZI 1WUUA 3PYGA 4JI4I 2Z5CB 1PVGA 4IZJD 4X65E 4DV6E 1B63A 2VQEE 2O1UA 4B3SE 4UTGA 4X62E 4K0KI 1H74A 4LFAE 2A2DA 3WU4A 1J5EI 1N34I 4JI0I 2DEIA 1XMQI 4DR6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 E;  2DEJ A;  1B62 A;  4DV6 I;  4GKJ E;  2UU9 I;  2VQE I;  4B3S I;  2V2Z A;  4LFB E;  4X62 I;  1MG7 A;  2Q2E B;  4LFA I;  4YHH E;  2VQF E;  4HAC A;  1Z5A A;  4DUY E;  5GME A;  4DV2 E;  2ZBK B;  4DR6 I;  3ZM7 A;  4JI1 I;  3GON A;  4B3M E;  4DR4 E;  2UXC E;  4GKJ I;  1FNM A;  4DV4 E;  3ZZ0 A;  4LF6 E;  4LFB I;  2UXD I;  2CZ9 A;  4FWG A;  3JAM Q;  2V2Q A;  4YHH I;  1RRE A;  2VQF I;  4DUY I;  4DV2 I;  4EMD A;  1N33 I;  4B3M I;  3LPS A;  2J7K A;  4DR4 I;  1ZXM A;  4DV4 I;  4LF6 I;  3B82 A;  1S16 A;  2UUC E;  4DPW A;  4GKK I;  3HUL A;  2WW4 A;  1Z0C A;  5IT9 C;  4MYT A;  1K47 A;  1RR9 A;  3ZKB A;  4PRX A;  2ZM6 E;  1XNQ E;  4JI5 E;  3J80 C;  4HAC B;  1Z0T A;  3WU6 A;  1HNZ E;  1FJG E;  1HNW E;  3LTO A;  1N0V C;  2HHH E;  4DV7 E;  3PYD A;  2UXB E;  3ZKD A;  4X66 E;  1BKN A;  3OTO E;  4JI7 E;  2UUA E;  1Z0V A;  1IBM E;  1XNQ I;  4P52 A;  2BM0 A;  4DR7 E;  1Z5B A;  1HNZ I;  1FJG I;  1HNW I;  4URL A;  1ZXN A;  3B8H A;  4DV3 E;  2HHH I;  2UXB I;  4X66 I;  2HKJ A;  1Z0B A;  4HY1 A;  1ZM9 A;  1KVK A;  2AJ4 A;  4DR1 E;  3OTO I;  4USM A;  1HNX I;  2UUA I;  2HFU A;  3QT7 A;  1IBM I;  1NHH A;  2XEX A;  4Z7C A;  1MU5 A;  5LMU E;  4DR7 I;  4LF4 E;  3QT6 A;  4DU8 A;  1Z0E A;  2BV3 A;  4DV3 I;  4X65 I;  3ZZT A;  3J81 Q;  4B3T E;  4B3R E;  4DXL A;  4DR1 I;  3K1J A;  3K17 A;  2E1R A;  3T1H E;  3WU5 A;  4LF4 I;  4YY3 E;  4USK A;  4HYM A;  3PYE A;  4DPT A;  4DU7 A;  4B3T I;  4B3R I;  1HR0 E;  1XHK A;  2UUB E;  4X64 E;  4JI2 E;  4YY3 I;  1IBL E;  1XNR E;  1VIS A;  5A2Q Q;  1PKP A;  2UXC I;  3Q1Q A;  5FLX Q;  4DV5 E;  2HKE A;  2X36 A;  3B78 A;  3T1Y E;  4DV0 E;  2E5L E;  1HR0 I;  4DPU A;  1XMO E;  5BR8 E;  2UUB I;  1QZR A;  4DPY A;  3JAM C;  4JI2 I;  1DAR A;  1Z5C A;  4DR5 E;  1IBL I;  4MYU A;  3H4L A;  1XNR I;  3QT8 A;  1H7U A;  2GS8 A;  4WUD A;  4JI6 E;  1FKA E;  2V8P A;  4JV5 E;  3QT5 A;  4DV5 I;  3T1Y I;  2R42 A;  4DV0 I;  1KIJ A;  2E5L I;  1XMO I;  1U2R A;  1FI4 A;  2UUC I;  1KKH A;  1IBK E;  4WUC A;  1NHJ A;  5BR8 I;  3LNU A;  1PIE A;  1H7S A;  1A6F A;  4LF9 E;  1N36 E;  1S4E A;  4DR5 I;  2ZM6 I;  4JI5 I;  4JI6 I;  1FWK A;  3M6A A;  4JI4 E;  5GMD A;  2R3V A;  2ZIT A;  4DV7 I;  2NPF A;  3J7A M;  4LF8 E;  4R1F A;  1FWL A;  5LMN E;  3WU3 A;  4JI3 E;  4ZVI A;  1N0U A;  1N36 I;  4JI7 I;  3ZZU A;  2HK2 A;  4DR2 E;  4WUB A;  2HK3 A;  1KTV A;  4JYA E;  4OX9 E;  4LF7 E;  2EFG A;  1NZ0 A;  2UU9 E;  4HXZ A;  4AQY E;  4LF8 I;  5LMN I;  4JI3 I;  4P7A A;  3D4J A;  4DR2 I;  4ED4 A;  5LMU I;  4XTJ A;  2LJP A;  4JYA I;  3J7A G;  4OX9 I;  4LF7 I;  4AQY I;  1OJ4 A;  2X7I A;  2UXD E;  4DV1 E;  2F4V E;  4NXN E;  2V34 A;  3J81 C;  3T1H I;  1Z59 A;  4M1K A;  2OI2 A;  1N33 E;  4FW9 A;  4FN5 A;  4NXM E;  1ZM3 A;  4JG4 A;  4I3H A;  3CWV A;  1ZM2 A;  1EA6 A;  5IT9 Q;  1NHI A;  4GKK E;  4DV1 I;  2F4V I;  4NXN I;  4KHP E;  1Z0G A;  3J80 Q;  4X64 I;  1ELO A;  1H72 C;  3F0N A;  1UEK A;  4NXM I;  4UT4 A;  1I94 E;  4PU9 A;  4DR3 E;  3PYF A;  3V2U C;  4LF5 E;  1ZM4 A;  5A2Q C;  4FWH A;  5FLX C;  1N32 E;  4RPF A;  4KHP I;  4DPX A;  4FWD A;  5IWA E;  2BM1 A;  4JI8 E;  2HFS A;  4LFC E;  4DUZ E;  1I94 I;  1MX0 A;  3V5R A;  2V2V A;  4DR3 I;  4JV5 I;  4LF5 I;  1D6T A;  1N32 I;  4PRV A;  4K0K E;  1IBK I;  2VF3 A;  1H73 A;  1Z0W A;  4KQV A;  1HNX E;  1J5E E;  5L3J A;  5LL6 R;  1EI1 A;  1N34 E;  4LF9 I;  5IWA I;  2A2C A;  4JI8 I;  4JI0 E;  4Z7Y A;  1XMQ E;  4LFC I;  4DUZ I;  1WUU A;  3PYG A;  4JI4 I;  1PVG A;  4X65 E;  4DV6 E;  1B63 A;  2VQE E;  4B3S E;  4UTG A;  4X62 E;  4K0K I;  1H74 A;  4LFA E;  2A2D A;  3WU4 A;  1J5E I;  1N34 I;  4JI0 I;  2DEI A;  1XMQ I;  4DR6 E; 
#chains in the Genus database with same CATH topology
 4JI1 E;  2NN6 B;  2DEJ A;  4QNK A;  1OYS A;  2CVE A;  1B62 A;  5JEA C;  4DV6 I;  4GKJ E;  2UU9 I;  2VQE I;  4B3S I;  2V2Z A;  4LFB E;  4X62 I;  1MG7 A;  2Q2E B;  4LFA I;  3L7Z A;  2AE8 A;  4MU4 A;  4YHH E;  2VQF E;  4HAC A;  1Z5A A;  1P42 A;  4DUY E;  5GME A;  3M85 D;  4DV2 E;  2ZBK B;  4DR6 I;  3ZM7 A;  5K36 D;  4JI1 I;  1VI7 A;  3GON A;  3P76 A;  4B3M E;  4DR4 E;  2UXC E;  4GKJ I;  1FNM A;  2BA0 G;  4DV4 E;  3ZZ0 A;  4LF6 E;  2CGE A;  4LFB I;  2UXD I;  2CZ9 A;  4FWG A;  4OKG A;  2C39 B;  3JAM Q;  3CDJ A;  3P3C A;  2V2Q A;  4YHH I;  1UDN A;  1RRE A;  2VQF I;  1HK7 A;  4DUY I;  4DV2 I;  1OYR A;  4EMD A;  1N33 I;  3PS2 A;  4B3M I;  4IS9 A;  3LPS A;  2J7K A;  4DR4 I;  1ZXM A;  2WNR A;  4DV4 I;  4LF6 I;  3GCM A;  3B82 A;  2BR2 A;  1S16 A;  2UUC E;  1UDQ A;  2C37 A;  3HUL A;  4DPW A;  4GKK I;  2WW4 A;  1Z0C A;  2GO4 A;  5IT9 C;  4AIM A;  1Y60 A;  4MYT A;  4MQY A;  2Z5B A;  1K47 A;  4LCF A;  1RR9 A;  3ZKB A;  4PRX A;  2NN6 D;  2ZM6 E;  1XNQ E;  4JI5 E;  3L7Z B;  4OO1 C;  3J80 C;  5K36 C;  1R6L A;  4HAC B;  1Z0T A;  5DRQ A;  3WU6 A;  1HNZ E;  1FJG E;  1HNW E;  3LTO A;  5JEA D;  4IFD A;  1N0V C;  2HHH E;  4DV7 E;  3PYD A;  2UXB E;  3ZKD A;  4X66 E;  3CDI A;  4NBQ A;  1BKN A;  3OTO E;  4JI7 E;  2UUA E;  1Y5Y A;  1Z0V A;  1IBM E;  1XNQ I;  3M85 G;  4LOM A;  5DRR A;  4P52 A;  4IFD E;  2BM0 A;  4DR7 E;  1Z5B A;  1HNZ I;  1FJG I;  1HNW I;  4BA1 B;  1ZXN A;  3B8H A;  4URL A;  4DV3 E;  2HHH I;  3PRY A;  4BA2 A;  2UXB I;  4OZE A;  4X66 I;  1R6M A;  4MU1 A;  1Y4S A;  2HKJ A;  1Z0B A;  4HY1 A;  4LCG A;  1ZM9 A;  1KVK A;  2AJ4 A;  2WNR B;  4DR1 E;  3P3G A;  3OTO I;  4USM A;  1HNX I;  2UUA I;  2Z5E A;  2HFU A;  3QT7 A;  2BR2 B;  2C37 B;  4GQU A;  1IBM I;  1NHH A;  2NN6 C;  2VES A;  2XEX A;  4Z7C A;  1MU5 A;  4IZK A;  1RHY A;  5LMU E;  4DR7 I;  4LF4 E;  2Z5B B;  3QT6 A;  4IZJ A;  4DU8 A;  1Z0E A;  2JEA A;  2BV3 A;  3HKM A;  4DV3 I;  4X65 I;  3ZZT A;  2BA1 D;  1Y6Z A;  3J81 Q;  4B3T E;  4B3R E;  2IER A;  3U1K A;  4DXL A;  2PO1 A;  4DR1 I;  2JT2 A;  3K1J A;  3K17 A;  3NZK A;  2E1R A;  3T1H E;  1USU A;  3WU5 A;  3U1Y A;  3UHM A;  2GQ0 A;  3K85 A;  4LF4 I;  4YY3 E;  4OO1 D;  4USK A;  4HYM A;  3PYE A;  4DPT A;  4DU7 A;  2JEB A;  4B3T I;  4B3R I;  1XXE A;  2O1V A;  2CG9 A;  1HR0 E;  1XHK A;  2UUB E;  4BA2 B;  4X64 E;  5K36 A;  3PS1 A;  5C0X A;  4JI2 E;  4YY3 I;  1IBL E;  1XNR E;  1VIS A;  5A2Q Q;  1PKP A;  2UXC I;  3Q1Q A;  4FW5 A;  5FLX Q;  4DV5 E;  2HKE A;  2X36 A;  4IZK B;  3B78 A;  4LPF A;  4DV0 E;  3T1Y E;  4MU3 A;  4IZJ B;  2E5L E;  1HR0 I;  2JEA B;  4DPU A;  5DRO A;  1XMO E;  5C0X E;  5K36 E;  2GO3 A;  5BR8 E;  2UUB I;  1QZR A;  2IOQ A;  4DPY A;  3JAM C;  4JI2 I;  1DAR A;  1Z5C A;  4N3O A;  4DR5 E;  2PO1 B;  1IBL I;  4MYU A;  3H4L A;  1XNR I;  2WP8 A;  1H7U A;  2GS8 A;  3QT8 A;  4WUD A;  4JI6 E;  1FKA E;  2V8P A;  3B4T A;  4JV5 E;  3QT5 A;  4DV5 I;  3T1Y I;  2R42 A;  4DV0 I;  1KIJ A;  2E5L I;  1XMO I;  1U2R A;  1FI4 A;  2UUC I;  1KKH A;  1IBK E;  4WUC A;  1NHJ A;  5BR8 I;  3LNU A;  2PNZ A;  1PIE A;  2NN6 A;  2JEB B;  1H7S A;  5K36 F;  5C0X F;  1A6F A;  4LF9 E;  1N36 E;  1S4E A;  4DR5 I;  2ZM6 I;  4JI5 I;  4JI6 I;  1FWK A;  2PO0 A;  3M6A A;  4JI4 E;  5JEA A;  5C0X B;  3DD6 A;  5GMD A;  2R3V A;  2ZIT A;  3HJC A;  2PNM A;  2NN6 E;  5EKW A;  4DV7 I;  4J3D A;  2NPF A;  3H1C A;  3J7A M;  4LF8 E;  1USV A;  4R1F A;  1FWL A;  2O1W A;  5LMN E;  3WU3 A;  4JI3 E;  4ZVI A;  1N0U A;  1N36 I;  4JI7 I;  5JEA E;  3ZZU A;  3Q6M A;  2IES A;  2HK2 A;  4DR2 E;  4WUB A;  2HK3 A;  2IOP A;  1KTV A;  1Y4U A;  4JYA E;  4OX9 E;  4LF7 E;  2EFG A;  1NZ0 A;  4IFD F;  2UU9 E;  2WP8 B;  4HXZ A;  4AQY E;  2JE6 A;  4LF8 I;  2PO2 A;  2NN6 F;  5LMN I;  4JI3 I;  4AM3 A;  4IFD B;  3Q6N A;  5DNX A;  4P7A A;  3D4J A;  4DR2 I;  2PNZ B;  4ED4 A;  5LMU I;  4XTJ A;  2LJP A;  5JEA F;  4JYA I;  3J7A G;  4OX9 I;  2C38 A;  4LF7 I;  2O1T A;  3M7N D;  4AQY I;  1OJ4 A;  2X7I A;  2PO0 B;  2UXD E;  1E3P A;  5ELW A;  5JEA B;  4DV1 E;  2F4V E;  4NXN E;  2V34 A;  1OYP A;  3J81 C;  3P3E A;  3T1H I;  4OO1 A;  1Z59 A;  4M1K A;  2OI2 A;  1N33 E;  5C0X D;  4FW9 A;  4FN5 A;  5FWK A;  4NXM E;  1ZM3 A;  4JG4 A;  3PS3 A;  5DNL A;  4I3H A;  4MU0 A;  3CWV A;  1ZM2 A;  1EA6 A;  5IT9 Q;  1NHI A;  4GKK E;  4DV1 I;  4OO1 E;  2F4V I;  4NXN I;  5EL9 A;  4FW6 A;  4ISA A;  4FW3 A;  4KHP E;  1Z0G A;  1YH8 A;  3J80 Q;  4X64 I;  3GLL A;  1ELO A;  2JE6 B;  2PO2 B;  4BA1 A;  1H72 C;  2Z5C A;  3F0N A;  1UEK A;  3P06 A;  4NXM I;  4UT4 A;  1I94 E;  4PU9 A;  4DR3 E;  3PYF A;  3V2U C;  4LF5 E;  1ZM4 A;  5A2Q C;  4FWH A;  2C38 B;  4IFD D;  2BA1 G;  5FLX C;  1N32 E;  2J65 A;  4RPF A;  4AID A;  5DRP A;  4KHP I;  4DPX A;  4FWD A;  4OO1 F;  1YHC A;  2BM1 A;  5IWA E;  4JI8 E;  2HFS A;  4LFC E;  4DUZ E;  5C0X C;  1I94 I;  1MX0 A;  4U3B A;  2V2V A;  3V5R A;  4DR3 I;  4OO1 B;  2BA0 D;  5K36 B;  2O3Z A;  4JV5 I;  4LF5 I;  2F1D A;  1UDO A;  3M7N G;  1D6T A;  4FW4 A;  1N32 I;  4PRV A;  4K0K E;  1IBK I;  4FW7 A;  2VF3 A;  1H73 A;  1Z0W A;  4KQV A;  1UDS A;  2PNL A;  1HNX E;  1J5E E;  5L3J A;  5LL6 R;  1EI1 A;  1N34 E;  4LF9 I;  5IWA I;  4LCH A;  2A2C A;  4JI8 I;  4JI0 E;  4Z7Y A;  1XMQ E;  4LFC I;  4DUZ I;  3GME A;  4QNJ A;  1WUU A;  3PYG A;  3KRN A;  4JI4 I;  2C39 A;  2Z5C B;  1PVG A;  4IZJ D;  4X65 E;  4DV6 E;  1B63 A;  2VQE E;  2O1U A;  4B3S E;  4UTG A;  4X62 E;  4K0K I;  4IFD C;  1E3H A;  1H74 A;  4LFA E;  2A2D A;  4MDT A;  4U3D A;  3WU4 A;  1J5E I;  1N34 I;  4JI0 I;  2DEI A;  1XMQ I;  4DR6 E; 
#chains in the Genus database with same CATH homology
 4JI1 E;  2DEJ A;  1B62 A;  4DV6 I;  4GKJ E;  2UU9 I;  2VQE I;  4B3S I;  2V2Z A;  4LFB E;  4X62 I;  1MG7 A;  2Q2E B;  4LFA I;  4YHH E;  2VQF E;  4HAC A;  1Z5A A;  4DUY E;  5GME A;  4DV2 E;  2ZBK B;  4DR6 I;  3ZM7 A;  4JI1 I;  3GON A;  4B3M E;  4DR4 E;  2UXC E;  4GKJ I;  1FNM A;  4DV4 E;  3ZZ0 A;  4LF6 E;  2CGE A;  4LFB I;  2UXD I;  2CZ9 A;  4FWG A;  3JAM Q;  2V2Q A;  4YHH I;  1RRE A;  2VQF I;  1HK7 A;  4DUY I;  4DV2 I;  4EMD A;  1N33 I;  4B3M I;  3LPS A;  2J7K A;  4DR4 I;  1ZXM A;  4DV4 I;  4LF6 I;  3B82 A;  1S16 A;  2UUC E;  4DPW A;  4GKK I;  3HUL A;  2WW4 A;  1Z0C A;  5IT9 C;  4MYT A;  2Z5B A;  1K47 A;  1RR9 A;  3ZKB A;  4PRX A;  2ZM6 E;  1XNQ E;  4JI5 E;  3J80 C;  4HAC B;  1Z0T A;  3WU6 A;  1HNZ E;  1FJG E;  1HNW E;  3LTO A;  1N0V C;  2HHH E;  4DV7 E;  3PYD A;  2UXB E;  3ZKD A;  4X66 E;  1BKN A;  3OTO E;  4JI7 E;  2UUA E;  1Z0V A;  1IBM E;  1XNQ I;  4P52 A;  2BM0 A;  4DR7 E;  1Z5B A;  1HNZ I;  1FJG I;  1HNW I;  4URL A;  1ZXN A;  3B8H A;  4DV3 E;  2HHH I;  3PRY A;  2UXB I;  4X66 I;  1Y4S A;  2HKJ A;  1Z0B A;  4HY1 A;  1ZM9 A;  1KVK A;  2AJ4 A;  4DR1 E;  3OTO I;  4USM A;  1HNX I;  2UUA I;  2Z5E A;  2HFU A;  3QT7 A;  1IBM I;  1NHH A;  2XEX A;  4Z7C A;  1MU5 A;  4IZK A;  5LMU E;  4DR7 I;  4LF4 E;  2Z5B B;  3QT6 A;  4IZJ A;  4DU8 A;  1Z0E A;  2BV3 A;  4DV3 I;  4X65 I;  3ZZT A;  1Y6Z A;  3J81 Q;  4B3T E;  4B3R E;  4DXL A;  4DR1 I;  3K1J A;  3K17 A;  2E1R A;  3T1H E;  1USU A;  3WU5 A;  2GQ0 A;  3K85 A;  4LF4 I;  4YY3 E;  4USK A;  4HYM A;  3PYE A;  4DPT A;  4DU7 A;  4B3T I;  4B3R I;  2O1V A;  2CG9 A;  1HR0 E;  1XHK A;  2UUB E;  4X64 E;  4JI2 E;  4YY3 I;  1IBL E;  1XNR E;  1VIS A;  5A2Q Q;  1PKP A;  2UXC I;  3Q1Q A;  5FLX Q;  4DV5 E;  2HKE A;  2X36 A;  4IZK B;  3B78 A;  3T1Y E;  4DV0 E;  4IZJ B;  2E5L E;  1HR0 I;  4DPU A;  1XMO E;  5BR8 E;  2UUB I;  1QZR A;  2IOQ A;  4DPY A;  3JAM C;  4JI2 I;  1DAR A;  1Z5C A;  4N3O A;  4DR5 E;  1IBL I;  4MYU A;  3H4L A;  1XNR I;  3QT8 A;  1H7U A;  2GS8 A;  4WUD A;  4JI6 E;  1FKA E;  2V8P A;  4JV5 E;  3QT5 A;  4DV5 I;  3T1Y I;  2R42 A;  4DV0 I;  1KIJ A;  2E5L I;  1XMO I;  1U2R A;  1FI4 A;  2UUC I;  1KKH A;  1IBK E;  4WUC A;  1NHJ A;  5BR8 I;  3LNU A;  1PIE A;  1H7S A;  1A6F A;  4LF9 E;  1N36 E;  1S4E A;  4DR5 I;  2ZM6 I;  4JI5 I;  4JI6 I;  1FWK A;  3M6A A;  4JI4 E;  5GMD A;  2R3V A;  2ZIT A;  3HJC A;  2PNM A;  4DV7 I;  2NPF A;  3J7A M;  4LF8 E;  1USV A;  4R1F A;  1FWL A;  2O1W A;  5LMN E;  3WU3 A;  4JI3 E;  4ZVI A;  1N0U A;  1N36 I;  4JI7 I;  3ZZU A;  3Q6M A;  2HK2 A;  4DR2 E;  4WUB A;  2HK3 A;  2IOP A;  1KTV A;  1Y4U A;  4JYA E;  4OX9 E;  4LF7 E;  2EFG A;  1NZ0 A;  2UU9 E;  4HXZ A;  4AQY E;  4LF8 I;  5LMN I;  4JI3 I;  3Q6N A;  4P7A A;  3D4J A;  4DR2 I;  4ED4 A;  5LMU I;  4XTJ A;  2LJP A;  4JYA I;  3J7A G;  4OX9 I;  4LF7 I;  2O1T A;  4AQY I;  1OJ4 A;  2X7I A;  2UXD E;  4DV1 E;  2F4V E;  4NXN E;  2V34 A;  3J81 C;  3T1H I;  1Z59 A;  4M1K A;  2OI2 A;  1N33 E;  5FWK A;  4FW9 A;  4FN5 A;  4NXM E;  1ZM3 A;  4JG4 A;  4I3H A;  3CWV A;  1ZM2 A;  1EA6 A;  5IT9 Q;  1NHI A;  4GKK E;  4DV1 I;  2F4V I;  4NXN I;  4KHP E;  1Z0G A;  3J80 Q;  4X64 I;  1ELO A;  1H72 C;  2Z5C A;  3F0N A;  1UEK A;  3P06 A;  4NXM I;  4UT4 A;  1I94 E;  4PU9 A;  4DR3 E;  3PYF A;  3V2U C;  4LF5 E;  1ZM4 A;  5A2Q C;  4FWH A;  5FLX C;  1N32 E;  4RPF A;  4KHP I;  4DPX A;  4FWD A;  5IWA E;  2BM1 A;  4JI8 E;  2HFS A;  4LFC E;  4DUZ E;  1I94 I;  1MX0 A;  3V5R A;  2V2V A;  4DR3 I;  4JV5 I;  4LF5 I;  1D6T A;  1N32 I;  4PRV A;  4K0K E;  1IBK I;  2VF3 A;  1H73 A;  1Z0W A;  4KQV A;  2PNL A;  1HNX E;  1J5E E;  5L3J A;  5LL6 R;  1EI1 A;  1N34 E;  4LF9 I;  5IWA I;  2A2C A;  4JI8 I;  4JI0 E;  4Z7Y A;  1XMQ E;  4LFC I;  4DUZ I;  1WUU A;  3PYG A;  4JI4 I;  2Z5C B;  1PVG A;  4IZJ D;  4X65 E;  4DV6 E;  1B63 A;  2VQE E;  2O1U A;  4B3S E;  4UTG A;  4X62 E;  4K0K I;  1H74 A;  4LFA E;  2A2D A;  3WU4 A;  1J5E I;  1N34 I;  4JI0 I;  2DEI A;  1XMQ I;  4DR6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...