1N36I

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n36I00
5FLXQ 3QT7A 1HNWI 1DARA 3PYGA 1HNXI 2HK3A 1Z0VA 2UU9I 4JI6I 2HHHI 1ZM9A 2WW4A 1Z0BA 4YHHI 3D4JA 4JI2I 2UUAE 4YY3E 3QT5A 4DR4E 1XMOE 4AQYI 1Z0TA 2V2ZA 2E1RA 4FWGA 5BR8I 4LF4E 1IBKE 4LFCE 2V8PA 1NHHA 1KIJA 4DR5E 4B3SI 4B3ME 4LFAE 1S16A 1H74A 4LFBI 4X65E 4DV6E 1N33I 4K0KI 4PU9A 2R42A 4NXNE 1XNRE 3PYFA 4JI8E 4MYTA 5L3JA 4DV2I 4LF8E 1UEKA 1J5EE 4JI4I 2HFSA 5GMEA 1FKAE 4JI1I 1Z5AA 2F4VI 4DPYA 4JV5I 2A2CA 4JI5I 4DV7I 1XNQE 2ZITA 1NHIA 4URLA 4LF9I 2UXDE 3J7AM 1KTVA 1Z59A 4NXME 4X64E 3WU6A 5IWAI 1B63A 2ZBKB 3LTOA 2VQEI 4FWHA 3QT8A 1XMQI 4UTGA 4JI0E 3WU4A 1HNXE 4JI6E 4JI7I 4DUZE 3ZZUA 2V2QA 2E5LI 1H7SA 4DR3E 4OX9E 2HKJA 1Z5BA 1HR0E 4DR1I 2X7IA 3K17A 4PRVA 3CWVA 4LF6I 4DR2I 1Z0WA 2BV3A 1KKHA 1IBME 2X36A 1IBLE 4DUYI 5BR8E 2AJ4A 1EA6A 4Z7CA 4DU8A 4RPFA 3QT6A 4DV5E 2UUBI 2HFUA 2J7KA 4DV3I 4R1FA 5LMNE 4DV0I 2DEIA 4X66I 4JYAI 1H73A 1N33E 3T1HE 1FWLA 4DV1I 3B82A 2EFGA 5LMUE 3J80C 1HNZE 4DV2E 4DR7I 1N34E 4DV4I 4GKJE 4HY1A 4B3RE 4FN5A 1ZXMA 4B3TI 1I94I 2UXBI 2ZM6E 2VQFE 3OTOI 1K47A 2BM1A 1N32E 2UXCI 1XHKA 2Q2EB 4HXZA 4LF5I 1FJGE 4DR6E 3LPSA 4LF7E 2GS8A 4KHPE 4FW9A 1N0UA 5A2QC 1N36E 1B62A 1NHJA 5IWAE 1S4EA 3PYDA 1RR9A 4JI3E 1ZM2A 1H72C 2UUAI 4YY3I 3F0NA 4EMDA 4GKKE 4DR4I 1XMOI 3ZKBA 4UT4A 1U2RA 4HACB 1EI1A 4LF4I 1IBKI 4LFCI 4PRXA 2V34A 4DPWA 1PVGA 2UUCE 4B3MI 2DEJA 2OI2A 4LFAI 1RREA 1PKPA 2R3VA 4DPUA 1FWKA 4X65I 1Z0EA 4DXLA 4DV6I 1HNWE 3WU5A 4HYMA 3HULA 2HKEA 4NXNI 1XNRI 3GONA 2XEXA 4P52A 4JI8I 2UU9E 4LF8I 2HHHE 3J80Q 3Q1QA 1MU5A 4XTJA 3JAMC 3T1YI 1NZ0A 4P7AA 4DPXA 4DV0E 4M1KA 2HK2A 4ED4A 4YHHE 5IT9C 4JI2E 1Z0GA 1A6FA 3PYEA 2V2VA 1XNQI 1FI4A 4AQYE 5GMDA 2UXDI 1D6TA 4B3SE 2UXBE 2LJPA 4HACA 4KQVA 3WU3A 5A2QQ 4LFBE 4NXMI 4X64I 1ELOA 4LF5E 3J7AG 4K0KE 4JI0I 4I3HA 4X62I 4DUZI 1ZM4A 4WUDA 4JI4E 1KVKA 4DR3I 1ZM3A 3J81C 3B8HA 4JI1E 4JG4A 4OX9I 2F4VE 1HR0I 4JV5E 4JI5E 4DV7E 4MYUA 1IBMI 1IBLI 1MG7A 4USKA 1FNMA 4LF9E 4WUCA 4DV5I 2A2DA 4FWDA 1N0VC 1BKNA 5FLXC 3ZZ0A 1PIEA 3JAMQ 3H4LA 5LMNI 4DPTA 2VQEE 3T1HI 1XMQE 5LMUI 1Z5CA 4DU7A 5IT9Q 1HNZI 4JI7E 1N34I 1Z0CA 1MX0A 3T1YE 5LL6R 4USMA 2E5LE 3LNUA 4GKJI 4ZVIA 4B3RI 1WUUA 4DR5I 2ZM6I 2VQFI 4DR1E 1N32I 2VF3A 4LF6E 4DR2E 1FJGI 1ZXNA 3V5RA 4DUYE 4DR6I 4LF7I 2CZ9A 3ZM7A 3ZKDA 3M6AA 4KHPI 4WUBA 2UUBE 1J5EI 1N36I 4DV3E 3B78A 4X66E 4JYAE 3V2UC 3J81Q 4DV1E 1QZRA 4JI3I 1H7UA 1OJ4A 4DR7E 4X62E 4GKKI 4Z7YA 4DV4E 3K1JA 3ZZTA 1VISA 2NPFA 4B3TE 1I94E 2BM0A 3OTOE 2UUCI 2UXCE
chains in the Genus database with same CATH superfamily
2CG9A 5FLXQ 3QT7A 5C0XC 5DRQA 1HNWI 1DARA 3PYGA 1HNXI 2O3ZA 2HK3A 1Z0VA 2C38B 2UU9I 3P3GA 4JI6I 2HHHI 1ZM9A 2JEBA 2WW4A 2F1DA 3PS2A 3Q6MA 4LPFA 2PO0A 1OYPA 1Z0BA 4YHHI 1Y4SA 3D4JA 2CGEA 4JI2I 2UUAE 4YY3E 3QT5A 4BA1B 4FW6A 5K36C 4DR4E 1XMOE 2JEAA 4AQYI 1Z0TA 2V2ZA 3U1YA 2E1RA 4FWGA 5BR8I 4IS9A 4LF4E 1IBKE 4LFCE 2V8PA 1OYRA 5DNXA 1NHHA 1KIJA 4DR5E 4B3SI 3U1KA 4B3ME 4LFAE 1S16A 1H74A 4LFBI 3DD6A 4X65E 4DV6E 1N33I 1USUA 5DRRA 4K0KI 5JEAA 4PU9A 1E3HA 3L7ZB 2R42A 4NXNE 1XNRE 3PYFA 4JI8E 2VESA 4MYTA 5L3JA 4DV2I 4LF8E 1UEKA 2BR2B 1J5EE 4IZKB 1E3PA 4JI4I 1UDNA 2HFSA 5GMEA 2C38A 5C0XE 1FKAE 4JI1I 1Z5AA 2F4VI 4ISAA 4DPYA 4JV5I 2A2CA 3P3CA 2NN6B 4JI5I 4DV7I 1XNQE 2O1WA 1Y6ZA 4AIMA 2ZITA 1NHIA 4URLA 4LF9I 4FW5A 2UXDE 3J7AM 1KTVA 1Z59A 2GQ0A 2PO0B 4AM3A 3Q6NA 4NXME 3WU6A 4X64E 2ZBKB 1B63A 5IWAI 3LTOA 2VQEI 4FWHA 3QT8A 1XMQI 4UTGA 4JI0E 1Y4UA 2NN6E 3WU4A 1HNXE 4JI6E 4JI7I 4IFDF 3L7ZA 4DUZE 3ZZUA 2V2QA 3PS1A 2E5LI 1H7SA 4DR3E 2BR2A 2IOQA 4OX9E 4BA2B 4IZKA 2HKJA 1Z5BA 1HR0E 4DR1I 2X7IA 1RHYA 3P76A 3K17A 4OKGA 4PRVA 3CWVA 4LF6I 4DR2I 1Z0WA 2BV3A 1KKHA 4LOMA 1IBME 4IFDD 2X36A 1IBLE 2NN6A 4DUYI 4MU3A 5BR8E 2AJ4A 1EA6A 4Z7CA 4DU8A 4RPFA 3QT6A 4DV5E 2PO1B 2UUBI 2PNLA 2HFUA 2J7KA 4DV3I 4R1FA 5LMNE 4DV0I 2DEIA 4X66I 4JYAI 3UHMA 1H73A 1N33E 3T1HE 1FWLA 4LCHA 4DV1I 3B82A 2EFGA 5LMUE 1UDSA 5JEAE 3J80C 1HNZE 4MQYA 4DV2E 4DR7I 1N34E 3CDJA 4DV4I 2IOPA 4GKJE 3M7NG 4HY1A 2NN6C 4B3RE 4FN5A 1ZXMA 4B3TI 1I94I 2UXBI 2ZM6E 3B4TA 2VQFE 3OTOI 1K47A 2BM1A 1N32E 2UXCI 1XHKA 2Q2EB 4HXZA 4LF5I 1FJGE 3P3EA 4BA2A 1Y60A 4DR6E 3LPSA 4LF7E 3PS3A 2GS8A 4U3BA 4FW4A 4KHPE 4FW9A 1N0UA 5A2QC 1N36E 3CDIA 3GMEA 2JE6B 1B62A 1NHJA 5IWAE 2PO1A 1S4EA 2PO2B 3PYDA 1RR9A 4JI3E 1ZM2A 2AE8A 1H72C 2UUAI 4YY3I 4FW3A 3F0NA 4OO1F 1USVA 4EMDA 4GKKE 4OZEA 4DR4I 1XMOI 2GO4A 3ZKBA 4IFDB 4UT4A 1U2RA 4HACB 1EI1A 1XXEA 2J65A 5C0XF 4LFCI 4PRXA 5JEAC 1IBKI 4LF4I 2V34A 4DPWA 1Y5YA 1PVGA 4MU4A 2UUCE 4B3MI 2DEJA 2OI2A 4LFAI 2Z5BB 4AIDA 1RREA 1PKPA 4OO1D 2C37B 2R3VA 2PNZA 4DPUA 1FWKA 2GO3A 4X65I 3H1CA 1Z0EA 4DXLA 4DV6I 1HNWE 3WU5A 4HYMA 3HULA 4QNKA 5C0XD 2HKEA 4NXNI 1XNRI 3GONA 2XEXA 4P52A 4JI8I 3M7ND 2UU9E 4LF8I 2HHHE 3J80Q 3Q1QA 1MU5A 4IFDE 4XTJA 3JAMC 3T1YI 5K36F 1NZ0A 4P7AA 4DPXA 4DV0E 1YHCA 4M1KA 3GCMA 4MU0A 2HK2A 4ED4A 5ELWA 4YHHE 1R6LA 2JE6A 5IT9C 4JI2E 2O1TA 1OYSA 1Z0GA 2PO2A 1A6FA 3PYEA 2V2VA 4IZJD 1XNQI 1FI4A 4AQYE 5GMDA 5K36D 1VI7A 2UXDI 1D6TA 4B3SE 2UXBE 4IFDA 2LJPA 4HACA 4KQVA 3WU3A 5A2QQ 4LFBE 3HKMA 4NXMI 4X64I 1ELOA 4LF5E 3J7AG 4K0KE 2Z5BA 3GLLA 4JI0I 2C37A 4I3HA 1P42A 4X62I 4MDTA 4DUZI 1ZM4A 4WUDA 2C39B 4JI4E 4MU1A 1KVKA 4DR3I 1ZM3A 3J81C 4QNJA 2PNZB 3B8HA 4JI1E 5DROA 4JG4A 4LCFA 4OX9I 2F4VE 5JEAF 1HR0I 4JV5E 5DRPA 2O1VA 4IFDC 3HJCA 4DV7E 4JI5E 4MYUA 1IBMI 4OO1B 3M85G 1IBLI 2WP8B 1MG7A 4USKA 1FNMA 4LF9E 2BA0G 5C0XB 4WUCA 4DV5I 5JEAD 2A2DA 4FWDA 1N0VC 1BKNA 2BA1D 5FLXC 4LCGA 2Z5CB 3ZZ0A 2O1UA 1PIEA 4N3OA 3JAMQ 3NZKA 3H4LA 5LMNI 4GQUA 3PRYA 4DPTA 2VQEE 1R6MA 3KRNA 3T1HI 1XMQE 5LMUI 1Z5CA 5DNLA 4DU7A 2JT2A 2CVEA 5IT9Q 4U3DA 1HNZI 4JI7E 1N34I 4OO1E 2WNRB 1Z0CA 4IZJB 1MX0A 3T1YE 5LL6R 4USMA 2E5LE 2IERA 3LNUA 4GKJI 5K36B 4ZVIA 4FW7A 4B3RI 1WUUA 2Z5EA 4DR5I 2ZM6I 2VQFI 2C39A 4DR1E 1N32I 3P06A 1UDOA 2VF3A 4LF6E 4DR2E 1FJGI 1ZXNA 3V5RA 4DUYE 4NBQA 4DR6I 2JEBB 2CZ9A 3ZM7A 4LF7I 2IESA 3ZKDA 4OO1A 4BA1A 2PNMA 3M6AA 4KHPI 4WUBA 2UUBE 1J5EI 2WP8A 1N36I 5C0XA 4J3DA 4DV3E 3K85A 5K36E 3B78A 4X66E 4JYAE 3V2UC 3J81Q 2BA1G 4DV1E 1QZRA 5EKWA 2NN6F 3M85D 2Z5CA 4JI3I 2JEAB 1H7UA 5FWKA 2BA0D 1OJ4A 4DR7E 4X62E 4GKKI 4Z7YA 4DV4E 3K1JA 3ZZTA 1YH8A 1UDQA 1VISA 2NPFA 2WNRA 4B3TE 1HK7A 1I94E 2NN6D 4IZJA 5EL9A 2BM0A 3OTOE 2UUCI 4OO1C 5JEAB 2UXCE 5K36A
chains in the Genus database with same CATH topology
2CG9A 5FLXQ 3QT7A 1HNWI 1DARA 3PYGA 1HNXI 2HK3A 1Z0VA 2UU9I 4JI6I 2HHHI 1ZM9A 2WW4A 3Q6MA 1Z0BA 4YHHI 1Y4SA 3D4JA 2CGEA 4JI2I 2UUAE 4YY3E 3QT5A 4DR4E 1XMOE 4AQYI 1Z0TA 2V2ZA 2E1RA 4FWGA 5BR8I 4LF4E 1IBKE 4LFCE 2V8PA 1NHHA 1KIJA 4DR5E 4B3SI 4B3ME 4LFAE 1S16A 1H74A 4LFBI 4X65E 4DV6E 1N33I 1USUA 4K0KI 4PU9A 2R42A 4NXNE 1XNRE 3PYFA 4JI8E 4MYTA 5L3JA 4DV2I 4LF8E 1UEKA 1J5EE 4IZKB 4JI4I 2HFSA 5GMEA 1FKAE 4JI1I 1Z5AA 2F4VI 4DPYA 4JV5I 2A2CA 4JI5I 4DV7I 1XNQE 2O1WA 1Y6ZA 2ZITA 1NHIA 4URLA 4LF9I 2UXDE 3J7AM 1KTVA 1Z59A 2GQ0A 3Q6NA 4NXME 4X64E 3WU6A 5IWAI 1B63A 2ZBKB 3LTOA 2VQEI 4FWHA 3QT8A 1XMQI 4UTGA 4JI0E 1Y4UA 3WU4A 1HNXE 4JI6E 4JI7I 4DUZE 3ZZUA 2V2QA 2E5LI 1H7SA 4DR3E 2IOQA 4OX9E 2HKJA 1Z5BA 4IZKA 1HR0E 4DR1I 2X7IA 3K17A 4PRVA 3CWVA 4LF6I 4DR2I 1Z0WA 2BV3A 1KKHA 1IBME 2X36A 1IBLE 4DUYI 5BR8E 2AJ4A 1EA6A 4Z7CA 4DU8A 4RPFA 3QT6A 4DV5E 2UUBI 2PNLA 2HFUA 2J7KA 4DV3I 4R1FA 5LMNE 4DV0I 2DEIA 4X66I 4JYAI 1H73A 1N33E 3T1HE 1FWLA 4DV1I 3B82A 2EFGA 5LMUE 3J80C 1HNZE 4DV2E 4DR7I 1N34E 4DV4I 2IOPA 4GKJE 4HY1A 4B3RE 4FN5A 1ZXMA 4B3TI 1I94I 2UXBI 2ZM6E 2VQFE 3OTOI 1K47A 2BM1A 1N32E 2UXCI 1XHKA 2Q2EB 4HXZA 4LF5I 1FJGE 4DR6E 3LPSA 4LF7E 2GS8A 4KHPE 4FW9A 1N0UA 5A2QC 1N36E 1B62A 1NHJA 5IWAE 1S4EA 3PYDA 1RR9A 4JI3E 1ZM2A 1H72C 2UUAI 4YY3I 3F0NA 1USVA 4EMDA 4GKKE 4DR4I 1XMOI 3ZKBA 4UT4A 1U2RA 4HACB 1EI1A 4LF4I 1IBKI 4LFCI 4PRXA 2V34A 4DPWA 1PVGA 2UUCE 4B3MI 2DEJA 2OI2A 4LFAI 2Z5BB 1RREA 1PKPA 2R3VA 4DPUA 1FWKA 4X65I 1Z0EA 4DXLA 4DV6I 1HNWE 3WU5A 4HYMA 3HULA 2HKEA 4NXNI 1XNRI 3GONA 2XEXA 4P52A 4JI8I 2UU9E 4LF8I 2HHHE 3J80Q 3Q1QA 1MU5A 4XTJA 3JAMC 3T1YI 1NZ0A 4P7AA 4DPXA 4DV0E 4M1KA 2HK2A 4ED4A 4YHHE 5IT9C 4JI2E 2O1TA 1Z0GA 1A6FA 3PYEA 2V2VA 4IZJD 1XNQI 1FI4A 4AQYE 5GMDA 2UXDI 1D6TA 4B3SE 2UXBE 2LJPA 4HACA 4KQVA 3WU3A 5A2QQ 4LFBE 4NXMI 4X64I 1ELOA 4LF5E 3J7AG 4K0KE 2Z5BA 4JI0I 4I3HA 4X62I 4DUZI 1ZM4A 4WUDA 4JI4E 1KVKA 4DR3I 1ZM3A 3J81C 3B8HA 4JI1E 4JG4A 4OX9I 2F4VE 1HR0I 4JV5E 2O1VA 3HJCA 4DV7E 4JI5E 4MYUA 1IBMI 1IBLI 1MG7A 4USKA 1FNMA 4LF9E 4WUCA 4DV5I 2A2DA 4FWDA 1N0VC 1BKNA 5FLXC 2Z5CB 3ZZ0A 2O1UA 1PIEA 4N3OA 3JAMQ 3H4LA 5LMNI 3PRYA 4DPTA 2VQEE 3T1HI 1XMQE 5LMUI 1Z5CA 4DU7A 5IT9Q 1HNZI 4JI7E 1N34I 1Z0CA 4IZJB 1MX0A 3T1YE 5LL6R 4USMA 2E5LE 3LNUA 4GKJI 4ZVIA 4B3RI 1WUUA 2Z5EA 4DR5I 2ZM6I 2VQFI 4DR1E 1N32I 3P06A 2VF3A 4LF6E 4DR2E 1FJGI 1ZXNA 3V5RA 4DUYE 4DR6I 4LF7I 2CZ9A 3ZM7A 3ZKDA 2PNMA 3M6AA 4KHPI 4WUBA 2UUBE 1J5EI 1N36I 4DV3E 3K85A 3B78A 4X66E 4JYAE 3V2UC 3J81Q 4DV1E 1QZRA 2Z5CA 4JI3I 1H7UA 5FWKA 1OJ4A 4DR7E 4X62E 4GKKI 4Z7YA 4DV4E 3K1JA 3ZZTA 1VISA 2NPFA 4B3TE 1HK7A 1I94E 4IZJA 2BM0A 3OTOE 2UUCI 2UXCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX Q;  3QT7 A;  1HNW I;  1DAR A;  3PYG A;  1HNX I;  2HK3 A;  1Z0V A;  2UU9 I;  4JI6 I;  2HHH I;  1ZM9 A;  2WW4 A;  1Z0B A;  4YHH I;  3D4J A;  4JI2 I;  2UUA E;  4YY3 E;  3QT5 A;  4DR4 E;  1XMO E;  4AQY I;  1Z0T A;  2V2Z A;  2E1R A;  4FWG A;  5BR8 I;  4LF4 E;  1IBK E;  4LFC E;  2V8P A;  1NHH A;  1KIJ A;  4DR5 E;  4B3S I;  4B3M E;  4LFA E;  1S16 A;  1H74 A;  4LFB I;  4X65 E;  4DV6 E;  1N33 I;  4K0K I;  4PU9 A;  2R42 A;  4NXN E;  1XNR E;  3PYF A;  4JI8 E;  4MYT A;  5L3J A;  4DV2 I;  4LF8 E;  1UEK A;  1J5E E;  4JI4 I;  2HFS A;  5GME A;  1FKA E;  4JI1 I;  1Z5A A;  2F4V I;  4DPY A;  4JV5 I;  2A2C A;  4JI5 I;  4DV7 I;  1XNQ E;  2ZIT A;  1NHI A;  4URL A;  4LF9 I;  2UXD E;  3J7A M;  1KTV A;  1Z59 A;  4NXM E;  4X64 E;  3WU6 A;  5IWA I;  1B63 A;  2ZBK B;  3LTO A;  2VQE I;  4FWH A;  3QT8 A;  1XMQ I;  4UTG A;  4JI0 E;  3WU4 A;  1HNX E;  4JI6 E;  4JI7 I;  4DUZ E;  3ZZU A;  2V2Q A;  2E5L I;  1H7S A;  4DR3 E;  4OX9 E;  2HKJ A;  1Z5B A;  1HR0 E;  4DR1 I;  2X7I A;  3K17 A;  4PRV A;  3CWV A;  4LF6 I;  4DR2 I;  1Z0W A;  2BV3 A;  1KKH A;  1IBM E;  2X36 A;  1IBL E;  4DUY I;  5BR8 E;  2AJ4 A;  1EA6 A;  4Z7C A;  4DU8 A;  4RPF A;  3QT6 A;  4DV5 E;  2UUB I;  2HFU A;  2J7K A;  4DV3 I;  4R1F A;  5LMN E;  4DV0 I;  2DEI A;  4X66 I;  4JYA I;  1H73 A;  1N33 E;  3T1H E;  1FWL A;  4DV1 I;  3B82 A;  2EFG A;  5LMU E;  3J80 C;  1HNZ E;  4DV2 E;  4DR7 I;  1N34 E;  4DV4 I;  4GKJ E;  4HY1 A;  4B3R E;  4FN5 A;  1ZXM A;  4B3T I;  1I94 I;  2UXB I;  2ZM6 E;  2VQF E;  3OTO I;  1K47 A;  2BM1 A;  1N32 E;  2UXC I;  1XHK A;  2Q2E B;  4HXZ A;  4LF5 I;  1FJG E;  4DR6 E;  3LPS A;  4LF7 E;  2GS8 A;  4KHP E;  4FW9 A;  1N0U A;  5A2Q C;  1N36 E;  1B62 A;  1NHJ A;  5IWA E;  1S4E A;  3PYD A;  1RR9 A;  4JI3 E;  1ZM2 A;  1H72 C;  2UUA I;  4YY3 I;  3F0N A;  4EMD A;  4GKK E;  4DR4 I;  1XMO I;  3ZKB A;  4UT4 A;  1U2R A;  4HAC B;  1EI1 A;  4LF4 I;  1IBK I;  4LFC I;  4PRX A;  2V34 A;  4DPW A;  1PVG A;  2UUC E;  4B3M I;  2DEJ A;  2OI2 A;  4LFA I;  1RRE A;  1PKP A;  2R3V A;  4DPU A;  1FWK A;  4X65 I;  1Z0E A;  4DXL A;  4DV6 I;  1HNW E;  3WU5 A;  4HYM A;  3HUL A;  2HKE A;  4NXN I;  1XNR I;  3GON A;  2XEX A;  4P52 A;  4JI8 I;  2UU9 E;  4LF8 I;  2HHH E;  3J80 Q;  3Q1Q A;  1MU5 A;  4XTJ A;  3JAM C;  3T1Y I;  1NZ0 A;  4P7A A;  4DPX A;  4DV0 E;  4M1K A;  2HK2 A;  4ED4 A;  4YHH E;  5IT9 C;  4JI2 E;  1Z0G A;  1A6F A;  3PYE A;  2V2V A;  1XNQ I;  1FI4 A;  4AQY E;  5GMD A;  2UXD I;  1D6T A;  4B3S E;  2UXB E;  2LJP A;  4HAC A;  4KQV A;  3WU3 A;  5A2Q Q;  4LFB E;  4NXM I;  4X64 I;  1ELO A;  4LF5 E;  3J7A G;  4K0K E;  4JI0 I;  4I3H A;  4X62 I;  4DUZ I;  1ZM4 A;  4WUD A;  4JI4 E;  1KVK A;  4DR3 I;  1ZM3 A;  3J81 C;  3B8H A;  4JI1 E;  4JG4 A;  4OX9 I;  2F4V E;  1HR0 I;  4JV5 E;  4JI5 E;  4DV7 E;  4MYU A;  1IBM I;  1IBL I;  1MG7 A;  4USK A;  1FNM A;  4LF9 E;  4WUC A;  4DV5 I;  2A2D A;  4FWD A;  1N0V C;  1BKN A;  5FLX C;  3ZZ0 A;  1PIE A;  3JAM Q;  3H4L A;  5LMN I;  4DPT A;  2VQE E;  3T1H I;  1XMQ E;  5LMU I;  1Z5C A;  4DU7 A;  5IT9 Q;  1HNZ I;  4JI7 E;  1N34 I;  1Z0C A;  1MX0 A;  3T1Y E;  5LL6 R;  4USM A;  2E5L E;  3LNU A;  4GKJ I;  4ZVI A;  4B3R I;  1WUU A;  4DR5 I;  2ZM6 I;  2VQF I;  4DR1 E;  1N32 I;  2VF3 A;  4LF6 E;  4DR2 E;  1FJG I;  1ZXN A;  3V5R A;  4DUY E;  4DR6 I;  4LF7 I;  2CZ9 A;  3ZM7 A;  3ZKD A;  3M6A A;  4KHP I;  4WUB A;  2UUB E;  1J5E I;  1N36 I;  4DV3 E;  3B78 A;  4X66 E;  4JYA E;  3V2U C;  3J81 Q;  4DV1 E;  1QZR A;  4JI3 I;  1H7U A;  1OJ4 A;  4DR7 E;  4X62 E;  4GKK I;  4Z7Y A;  4DV4 E;  3K1J A;  3ZZT A;  1VIS A;  2NPF A;  4B3T E;  1I94 E;  2BM0 A;  3OTO E;  2UUC I;  2UXC E; 
#chains in the Genus database with same CATH topology
 2CG9 A;  5FLX Q;  3QT7 A;  5C0X C;  5DRQ A;  1HNW I;  1DAR A;  3PYG A;  1HNX I;  2O3Z A;  2HK3 A;  1Z0V A;  2C38 B;  2UU9 I;  3P3G A;  4JI6 I;  2HHH I;  1ZM9 A;  2JEB A;  2WW4 A;  2F1D A;  3PS2 A;  3Q6M A;  4LPF A;  2PO0 A;  1OYP A;  1Z0B A;  4YHH I;  1Y4S A;  3D4J A;  2CGE A;  4JI2 I;  2UUA E;  4YY3 E;  3QT5 A;  4BA1 B;  4FW6 A;  5K36 C;  4DR4 E;  1XMO E;  2JEA A;  4AQY I;  1Z0T A;  2V2Z A;  3U1Y A;  2E1R A;  4FWG A;  5BR8 I;  4IS9 A;  4LF4 E;  1IBK E;  4LFC E;  2V8P A;  1OYR A;  5DNX A;  1NHH A;  1KIJ A;  4DR5 E;  4B3S I;  3U1K A;  4B3M E;  4LFA E;  1S16 A;  1H74 A;  4LFB I;  3DD6 A;  4X65 E;  4DV6 E;  1N33 I;  1USU A;  5DRR A;  4K0K I;  5JEA A;  4PU9 A;  1E3H A;  3L7Z B;  2R42 A;  4NXN E;  1XNR E;  3PYF A;  4JI8 E;  2VES A;  4MYT A;  5L3J A;  4DV2 I;  4LF8 E;  1UEK A;  2BR2 B;  1J5E E;  4IZK B;  1E3P A;  4JI4 I;  1UDN A;  2HFS A;  5GME A;  2C38 A;  5C0X E;  1FKA E;  4JI1 I;  1Z5A A;  2F4V I;  4ISA A;  4DPY A;  4JV5 I;  2A2C A;  3P3C A;  2NN6 B;  4JI5 I;  4DV7 I;  1XNQ E;  2O1W A;  1Y6Z A;  4AIM A;  2ZIT A;  1NHI A;  4URL A;  4LF9 I;  4FW5 A;  2UXD E;  3J7A M;  1KTV A;  1Z59 A;  2GQ0 A;  2PO0 B;  4AM3 A;  3Q6N A;  4NXM E;  3WU6 A;  4X64 E;  2ZBK B;  1B63 A;  5IWA I;  3LTO A;  2VQE I;  4FWH A;  3QT8 A;  1XMQ I;  4UTG A;  4JI0 E;  1Y4U A;  2NN6 E;  3WU4 A;  1HNX E;  4JI6 E;  4JI7 I;  4IFD F;  3L7Z A;  4DUZ E;  3ZZU A;  2V2Q A;  3PS1 A;  2E5L I;  1H7S A;  4DR3 E;  2BR2 A;  2IOQ A;  4OX9 E;  4BA2 B;  4IZK A;  2HKJ A;  1Z5B A;  1HR0 E;  4DR1 I;  2X7I A;  1RHY A;  3P76 A;  3K17 A;  4OKG A;  4PRV A;  3CWV A;  4LF6 I;  4DR2 I;  1Z0W A;  2BV3 A;  1KKH A;  4LOM A;  1IBM E;  4IFD D;  2X36 A;  1IBL E;  2NN6 A;  4DUY I;  4MU3 A;  5BR8 E;  2AJ4 A;  1EA6 A;  4Z7C A;  4DU8 A;  4RPF A;  3QT6 A;  4DV5 E;  2PO1 B;  2UUB I;  2PNL A;  2HFU A;  2J7K A;  4DV3 I;  4R1F A;  5LMN E;  4DV0 I;  2DEI A;  4X66 I;  4JYA I;  3UHM A;  1H73 A;  1N33 E;  3T1H E;  1FWL A;  4LCH A;  4DV1 I;  3B82 A;  2EFG A;  5LMU E;  1UDS A;  5JEA E;  3J80 C;  1HNZ E;  4MQY A;  4DV2 E;  4DR7 I;  1N34 E;  3CDJ A;  4DV4 I;  2IOP A;  4GKJ E;  3M7N G;  4HY1 A;  2NN6 C;  4B3R E;  4FN5 A;  1ZXM A;  4B3T I;  1I94 I;  2UXB I;  2ZM6 E;  3B4T A;  2VQF E;  3OTO I;  1K47 A;  2BM1 A;  1N32 E;  2UXC I;  1XHK A;  2Q2E B;  4HXZ A;  4LF5 I;  1FJG E;  3P3E A;  4BA2 A;  1Y60 A;  4DR6 E;  3LPS A;  4LF7 E;  3PS3 A;  2GS8 A;  4U3B A;  4FW4 A;  4KHP E;  4FW9 A;  1N0U A;  5A2Q C;  1N36 E;  3CDI A;  3GME A;  2JE6 B;  1B62 A;  1NHJ A;  5IWA E;  2PO1 A;  1S4E A;  2PO2 B;  3PYD A;  1RR9 A;  4JI3 E;  1ZM2 A;  2AE8 A;  1H72 C;  2UUA I;  4YY3 I;  4FW3 A;  3F0N A;  4OO1 F;  1USV A;  4EMD A;  4GKK E;  4OZE A;  4DR4 I;  1XMO I;  2GO4 A;  3ZKB A;  4IFD B;  4UT4 A;  1U2R A;  4HAC B;  1EI1 A;  1XXE A;  2J65 A;  5C0X F;  4LFC I;  4PRX A;  5JEA C;  1IBK I;  4LF4 I;  2V34 A;  4DPW A;  1Y5Y A;  1PVG A;  4MU4 A;  2UUC E;  4B3M I;  2DEJ A;  2OI2 A;  4LFA I;  2Z5B B;  4AID A;  1RRE A;  1PKP A;  4OO1 D;  2C37 B;  2R3V A;  2PNZ A;  4DPU A;  1FWK A;  2GO3 A;  4X65 I;  3H1C A;  1Z0E A;  4DXL A;  4DV6 I;  1HNW E;  3WU5 A;  4HYM A;  3HUL A;  4QNK A;  5C0X D;  2HKE A;  4NXN I;  1XNR I;  3GON A;  2XEX A;  4P52 A;  4JI8 I;  3M7N D;  2UU9 E;  4LF8 I;  2HHH E;  3J80 Q;  3Q1Q A;  1MU5 A;  4IFD E;  4XTJ A;  3JAM C;  3T1Y I;  5K36 F;  1NZ0 A;  4P7A A;  4DPX A;  4DV0 E;  1YHC A;  4M1K A;  3GCM A;  4MU0 A;  2HK2 A;  4ED4 A;  5ELW A;  4YHH E;  1R6L A;  2JE6 A;  5IT9 C;  4JI2 E;  2O1T A;  1OYS A;  1Z0G A;  2PO2 A;  1A6F A;  3PYE A;  2V2V A;  4IZJ D;  1XNQ I;  1FI4 A;  4AQY E;  5GMD A;  5K36 D;  1VI7 A;  2UXD I;  1D6T A;  4B3S E;  2UXB E;  4IFD A;  2LJP A;  4HAC A;  4KQV A;  3WU3 A;  5A2Q Q;  4LFB E;  3HKM A;  4NXM I;  4X64 I;  1ELO A;  4LF5 E;  3J7A G;  4K0K E;  2Z5B A;  3GLL A;  4JI0 I;  2C37 A;  4I3H A;  1P42 A;  4X62 I;  4MDT A;  4DUZ I;  1ZM4 A;  4WUD A;  2C39 B;  4JI4 E;  4MU1 A;  1KVK A;  4DR3 I;  1ZM3 A;  3J81 C;  4QNJ A;  2PNZ B;  3B8H A;  4JI1 E;  5DRO A;  4JG4 A;  4LCF A;  4OX9 I;  2F4V E;  5JEA F;  1HR0 I;  4JV5 E;  5DRP A;  2O1V A;  4IFD C;  3HJC A;  4DV7 E;  4JI5 E;  4MYU A;  1IBM I;  4OO1 B;  3M85 G;  1IBL I;  2WP8 B;  1MG7 A;  4USK A;  1FNM A;  4LF9 E;  2BA0 G;  5C0X B;  4WUC A;  4DV5 I;  5JEA D;  2A2D A;  4FWD A;  1N0V C;  1BKN A;  2BA1 D;  5FLX C;  4LCG A;  2Z5C B;  3ZZ0 A;  2O1U A;  1PIE A;  4N3O A;  3JAM Q;  3NZK A;  3H4L A;  5LMN I;  4GQU A;  3PRY A;  4DPT A;  2VQE E;  1R6M A;  3KRN A;  3T1H I;  1XMQ E;  5LMU I;  1Z5C A;  5DNL A;  4DU7 A;  2JT2 A;  2CVE A;  5IT9 Q;  4U3D A;  1HNZ I;  4JI7 E;  1N34 I;  4OO1 E;  2WNR B;  1Z0C A;  4IZJ B;  1MX0 A;  3T1Y E;  5LL6 R;  4USM A;  2E5L E;  2IER A;  3LNU A;  4GKJ I;  5K36 B;  4ZVI A;  4FW7 A;  4B3R I;  1WUU A;  2Z5E A;  4DR5 I;  2ZM6 I;  2VQF I;  2C39 A;  4DR1 E;  1N32 I;  3P06 A;  1UDO A;  2VF3 A;  4LF6 E;  4DR2 E;  1FJG I;  1ZXN A;  3V5R A;  4DUY E;  4NBQ A;  4DR6 I;  2JEB B;  2CZ9 A;  3ZM7 A;  4LF7 I;  2IES A;  3ZKD A;  4OO1 A;  4BA1 A;  2PNM A;  3M6A A;  4KHP I;  4WUB A;  2UUB E;  1J5E I;  2WP8 A;  1N36 I;  5C0X A;  4J3D A;  4DV3 E;  3K85 A;  5K36 E;  3B78 A;  4X66 E;  4JYA E;  3V2U C;  3J81 Q;  2BA1 G;  4DV1 E;  1QZR A;  5EKW A;  2NN6 F;  3M85 D;  2Z5C A;  4JI3 I;  2JEA B;  1H7U A;  5FWK A;  2BA0 D;  1OJ4 A;  4DR7 E;  4X62 E;  4GKK I;  4Z7Y A;  4DV4 E;  3K1J A;  3ZZT A;  1YH8 A;  1UDQ A;  1VIS A;  2NPF A;  2WNR A;  4B3T E;  1HK7 A;  1I94 E;  2NN6 D;  4IZJ A;  5EL9 A;  2BM0 A;  3OTO E;  2UUC I;  4OO1 C;  5JEA B;  2UXC E;  5K36 A; 
#chains in the Genus database with same CATH homology
 2CG9 A;  5FLX Q;  3QT7 A;  1HNW I;  1DAR A;  3PYG A;  1HNX I;  2HK3 A;  1Z0V A;  2UU9 I;  4JI6 I;  2HHH I;  1ZM9 A;  2WW4 A;  3Q6M A;  1Z0B A;  4YHH I;  1Y4S A;  3D4J A;  2CGE A;  4JI2 I;  2UUA E;  4YY3 E;  3QT5 A;  4DR4 E;  1XMO E;  4AQY I;  1Z0T A;  2V2Z A;  2E1R A;  4FWG A;  5BR8 I;  4LF4 E;  1IBK E;  4LFC E;  2V8P A;  1NHH A;  1KIJ A;  4DR5 E;  4B3S I;  4B3M E;  4LFA E;  1S16 A;  1H74 A;  4LFB I;  4X65 E;  4DV6 E;  1N33 I;  1USU A;  4K0K I;  4PU9 A;  2R42 A;  4NXN E;  1XNR E;  3PYF A;  4JI8 E;  4MYT A;  5L3J A;  4DV2 I;  4LF8 E;  1UEK A;  1J5E E;  4IZK B;  4JI4 I;  2HFS A;  5GME A;  1FKA E;  4JI1 I;  1Z5A A;  2F4V I;  4DPY A;  4JV5 I;  2A2C A;  4JI5 I;  4DV7 I;  1XNQ E;  2O1W A;  1Y6Z A;  2ZIT A;  1NHI A;  4URL A;  4LF9 I;  2UXD E;  3J7A M;  1KTV A;  1Z59 A;  2GQ0 A;  3Q6N A;  4NXM E;  4X64 E;  3WU6 A;  5IWA I;  1B63 A;  2ZBK B;  3LTO A;  2VQE I;  4FWH A;  3QT8 A;  1XMQ I;  4UTG A;  4JI0 E;  1Y4U A;  3WU4 A;  1HNX E;  4JI6 E;  4JI7 I;  4DUZ E;  3ZZU A;  2V2Q A;  2E5L I;  1H7S A;  4DR3 E;  2IOQ A;  4OX9 E;  2HKJ A;  1Z5B A;  4IZK A;  1HR0 E;  4DR1 I;  2X7I A;  3K17 A;  4PRV A;  3CWV A;  4LF6 I;  4DR2 I;  1Z0W A;  2BV3 A;  1KKH A;  1IBM E;  2X36 A;  1IBL E;  4DUY I;  5BR8 E;  2AJ4 A;  1EA6 A;  4Z7C A;  4DU8 A;  4RPF A;  3QT6 A;  4DV5 E;  2UUB I;  2PNL A;  2HFU A;  2J7K A;  4DV3 I;  4R1F A;  5LMN E;  4DV0 I;  2DEI A;  4X66 I;  4JYA I;  1H73 A;  1N33 E;  3T1H E;  1FWL A;  4DV1 I;  3B82 A;  2EFG A;  5LMU E;  3J80 C;  1HNZ E;  4DV2 E;  4DR7 I;  1N34 E;  4DV4 I;  2IOP A;  4GKJ E;  4HY1 A;  4B3R E;  4FN5 A;  1ZXM A;  4B3T I;  1I94 I;  2UXB I;  2ZM6 E;  2VQF E;  3OTO I;  1K47 A;  2BM1 A;  1N32 E;  2UXC I;  1XHK A;  2Q2E B;  4HXZ A;  4LF5 I;  1FJG E;  4DR6 E;  3LPS A;  4LF7 E;  2GS8 A;  4KHP E;  4FW9 A;  1N0U A;  5A2Q C;  1N36 E;  1B62 A;  1NHJ A;  5IWA E;  1S4E A;  3PYD A;  1RR9 A;  4JI3 E;  1ZM2 A;  1H72 C;  2UUA I;  4YY3 I;  3F0N A;  1USV A;  4EMD A;  4GKK E;  4DR4 I;  1XMO I;  3ZKB A;  4UT4 A;  1U2R A;  4HAC B;  1EI1 A;  4LF4 I;  1IBK I;  4LFC I;  4PRX A;  2V34 A;  4DPW A;  1PVG A;  2UUC E;  4B3M I;  2DEJ A;  2OI2 A;  4LFA I;  2Z5B B;  1RRE A;  1PKP A;  2R3V A;  4DPU A;  1FWK A;  4X65 I;  1Z0E A;  4DXL A;  4DV6 I;  1HNW E;  3WU5 A;  4HYM A;  3HUL A;  2HKE A;  4NXN I;  1XNR I;  3GON A;  2XEX A;  4P52 A;  4JI8 I;  2UU9 E;  4LF8 I;  2HHH E;  3J80 Q;  3Q1Q A;  1MU5 A;  4XTJ A;  3JAM C;  3T1Y I;  1NZ0 A;  4P7A A;  4DPX A;  4DV0 E;  4M1K A;  2HK2 A;  4ED4 A;  4YHH E;  5IT9 C;  4JI2 E;  2O1T A;  1Z0G A;  1A6F A;  3PYE A;  2V2V A;  4IZJ D;  1XNQ I;  1FI4 A;  4AQY E;  5GMD A;  2UXD I;  1D6T A;  4B3S E;  2UXB E;  2LJP A;  4HAC A;  4KQV A;  3WU3 A;  5A2Q Q;  4LFB E;  4NXM I;  4X64 I;  1ELO A;  4LF5 E;  3J7A G;  4K0K E;  2Z5B A;  4JI0 I;  4I3H A;  4X62 I;  4DUZ I;  1ZM4 A;  4WUD A;  4JI4 E;  1KVK A;  4DR3 I;  1ZM3 A;  3J81 C;  3B8H A;  4JI1 E;  4JG4 A;  4OX9 I;  2F4V E;  1HR0 I;  4JV5 E;  2O1V A;  3HJC A;  4DV7 E;  4JI5 E;  4MYU A;  1IBM I;  1IBL I;  1MG7 A;  4USK A;  1FNM A;  4LF9 E;  4WUC A;  4DV5 I;  2A2D A;  4FWD A;  1N0V C;  1BKN A;  5FLX C;  2Z5C B;  3ZZ0 A;  2O1U A;  1PIE A;  4N3O A;  3JAM Q;  3H4L A;  5LMN I;  3PRY A;  4DPT A;  2VQE E;  3T1H I;  1XMQ E;  5LMU I;  1Z5C A;  4DU7 A;  5IT9 Q;  1HNZ I;  4JI7 E;  1N34 I;  1Z0C A;  4IZJ B;  1MX0 A;  3T1Y E;  5LL6 R;  4USM A;  2E5L E;  3LNU A;  4GKJ I;  4ZVI A;  4B3R I;  1WUU A;  2Z5E A;  4DR5 I;  2ZM6 I;  2VQF I;  4DR1 E;  1N32 I;  3P06 A;  2VF3 A;  4LF6 E;  4DR2 E;  1FJG I;  1ZXN A;  3V5R A;  4DUY E;  4DR6 I;  4LF7 I;  2CZ9 A;  3ZM7 A;  3ZKD A;  2PNM A;  3M6A A;  4KHP I;  4WUB A;  2UUB E;  1J5E I;  1N36 I;  4DV3 E;  3K85 A;  3B78 A;  4X66 E;  4JYA E;  3V2U C;  3J81 Q;  4DV1 E;  1QZR A;  2Z5C A;  4JI3 I;  1H7U A;  5FWK A;  1OJ4 A;  4DR7 E;  4X62 E;  4GKK I;  4Z7Y A;  4DV4 E;  3K1J A;  3ZZT A;  1VIS A;  2NPF A;  4B3T E;  1HK7 A;  1I94 E;  4IZJ A;  2BM0 A;  3OTO E;  2UUC I;  2UXC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...