1N36I

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n36I00
4DV0I 2HFSA 4JI8I 4X64I 1I94I 3QT8A 4LF7I 4DPYA 4DV6E 4LFCE 2X36A 2HHHE 2V34A 1HNXE 1FWKA 2V2VA 2DEJA 3J80C 1UEKA 1B62A 4XTJA 3ZZTA 4JI5I 1HNWI 1XNQI 3V2UC 4DR7E 2BM1A 2ZBKB 4R1FA 4DUYI 4LF5E 4K0KI 4DR5E 4JI8E 2NPFA 4JYAI 4DV7I 1NZ0A 1N32E 2E5LE 1D6TA 4B3SI 4DR4E 2ZM6I 5L3JA 3QT6A 2A2CA 4LF4E 2F4VI 1PKPA 1A6FA 1HNXI 1Z5BA 3T1HI 3H4LA 3J81Q 4JI5E 3PYGA 5A2QQ 1H7SA 4DV4I 4Z7YA 3QT5A 3GONA 3V5RA 4JI4E 2R3VA 4JI7E 2EFGA 4LF8I 3PYDA 4YHHI 4B3ME 4JYAE 1FJGE 4DUZE 2UU9E 4DR3I 3WU3A 4OX9E 2AJ4A 4JI1I 4FWHA 3T1HE 4URLA 4DV4E 1MG7A 2BV3A 4LF6E 3WU6A 4USKA 1H73A 4JI7I 3ZKDA 1NHJA 2J7KA 1HNZE 2UUAE 1ZM4A 3K1JA 1XMQI 3WU5A 4JI2I 4YY3I 4DPXA 1FWLA 3T1YI 5BR8I 4DV5E 1Z0TA 1FI4A 4UTGA 1J5EI 4DU7A 5LL6R 1ZM2A 3ZZUA 4LF9E 1EI1A 3JAMQ 1XNRE 2E1RA 4JG4A 2HKEA 2R42A 4DPUA 1XHKA 4RPFA 1H74A 4K0KE 2BM0A 3ZKBA 4PU9A 4DPTA 4NXMI 1N32I 1QZRA 4X62I 1Z0WA 4X65I 4GKKE 3J7AG 4JV5E 1Z5CA 4B3RI 1RR9A 1PVGA 1DARA 3CWVA 5BR8E 3T1YE 2ZITA 4NXNE 4B3SE 4X66I 1NHIA 1Z0GA 4LF9I 4DR1E 1U2RA 3HULA 4YHHE 5LMUE 1WUUA 4PRXA 1KTVA 4USMA 4DPWA 4M1KA 2UXCI 4DV1I 1HR0E 4GKJE 4UT4A 4WUBA 4JI1E 1H72C 1B63A 4LFBI 3OTOE 4DV6I 1FJGI 4DUZI 3LNUA 4DR3E 4JI6E 5GMEA 4AQYE 4LFAI 2UXDE 2UUAI 3M6AA 4KQVA 5LMUI 4P52A 1XMQE 5A2QC 2HKJA 4DXLA 3J81C 1IBLE 1EA6A 4HY1A 4EMDA 2UUBI 4DV1E 3B8HA 1N0VC 2LJPA 4DV5I 2HK2A 4WUCA 1J5EE 1S16A 4DR4I 1IBKE 4LF4I 1XNRI 1FNMA 1IBME 4LFAE 5IWAE 4JI3I 2UXDI 2V2QA 4HXZA 1VISA 4NXME 4FW9A 4JI4I 3J80Q 2UUCE 4WUDA 4B3TI 2UUBE 4DV0E 3B82A 4PRVA 3PYFA 4NXNI 4LF7E 4DR2I 4X66E 1MX0A 3J7AM 1Z0CA 4JV5I 2HHHI 4DR1I 3JAMC 2HFUA 1XMOE 4P7AA 1MU5A 5IWAI 4JI3E 4FWGA 1RREA 4LF6I 4DV2E 4DUYE 2UUCI 1HNZI 2X7IA 5LMNE 1OJ4A 4LFBE 3OTOI 2E5LI 4JI2E 5IT9Q 4YY3E 2ZM6E 1BKNA 2UXCE 1K47A 2GS8A 1ELOA 1N36E 4DV3E 1XMOI 2VQEE 2DEIA 1ZM9A 1N34I 4DR6I 4JI6I 2XEXA 1KVKA 1PIEA 4LF8E 3LPSA 1I94E 1ZM3A 4X62E 4X65E 1FKAE 4LFCI 1IBLI 2OI2A 1NHHA 3WU4A 1IBMI 3ZM7A 4DV3I 1Z59A 2VF3A 1IBKI 2A2DA 1H7UA 1Z0VA 1Z5AA 4HACA 2V2ZA 2WW4A 4JI0I 4DV7E 4DR7I 3QT7A 1N33I 3LTOA 4B3TE 4GKJI 2VQFE 3PYEA 4LF5I 4DR5I 5FLXC 4DR2E 4FWDA 3K17A 5FLXQ 1Z0BA 3B78A 2F4VE 4AQYI 4MYTA 2UXBI 5GMDA 4JI0E 4B3MI 3D4JA 5LMNI 1KIJA 4DV2I 4DU8A 2UU9I 1KKHA 4GKKI 1N33E 4KHPE 4B3RE 3Q1QA 5IT9C 2VQFI 4X64E 1ZXNA 2VQEI 1ZXMA 1Z0EA 4Z7CA 4HYMA 4MYUA 4ED4A 2HK3A 4FN5A 4HACB 1N36I 3ZZ0A 4OX9I 1HNWE 4I3HA 2UXBE 1XNQE 2Q2EB 4ZVIA 1N34E 4DR6E 2V8PA 3F0NA 1S4EA 2CZ9A 1N0UA 4KHPI 1HR0I
chains in the Genus database with same CATH superfamily
4DV0I 3P3CA 2HFSA 4JI8I 4X64I 1I94I 3QT8A 3GCMA 4LF7I 1R6MA 4DPYA 2PO0B 4DV6E 3P3GA 4FW5A 4LFCE 2X36A 2HHHE 3HJCA 2V34A 1HNXE 1FWKA 4LCGA 2V2VA 2Z5CA 2DEJA 3J80C 1UEKA 4OO1A 1B62A 4XTJA 3ZZTA 4JI5I 1HNWI 1XNQI 3V2UC 4DR7E 2BM1A 2ZBKB 4R1FA 2NN6D 4DUYI 4MU4A 1E3HA 1P42A 4LF5E 4K0KI 4DR5E 5K36C 4JI8E 2NPFA 4JYAI 4DV7I 1NZ0A 1N32E 2E5LE 1D6TA 4B3SI 4DR4E 4OO1E 2ZM6I 3UHMA 5L3JA 3QT6A 2BA0G 5DROA 2A2CA 4LF4E 2F4VI 1PKPA 1A6FA 1HNXI 1Z5BA 2O1UA 2GQ0A 3T1HI 3H4LA 4BA1B 3J81Q 5JEAB 4JI5E 3PYGA 5A2QQ 2IOPA 3H1CA 2PO1B 2BR2A 1H7SA 4DV4I 3NZKA 4Z7YA 3K85A 2PO1A 3QT5A 3GONA 3V5RA 5C0XF 4AIMA 4JI4E 2R3VA 3B4TA 4JI7E 2EFGA 1OYPA 4LF8I 5JEAE 2C39A 3PYDA 4YHHI 4IFDD 4B3ME 2O3ZA 4IZJB 5EKWA 4JYAE 1YHCA 2VESA 1FJGE 3GLLA 4DUZE 2UU9E 4DR3I 3WU3A 1Y4SA 4OX9E 2AJ4A 4JI1I 4FWHA 3T1HE 4URLA 5JEAF 4MQYA 4DV4E 1MG7A 2JEAA 2BV3A 4LF6E 3WU6A 2JEBB 4USKA 4ISAA 5C0XB 1H73A 4JI7I 3ZKDA 4OZEA 2Z5CB 5EL9A 1NHJA 2J7KA 4N3OA 1HNZE 2UUAE 2C37A 4IZJD 1ZM4A 3K1JA 4U3BA 4MU3A 3U1YA 2NN6B 2PO2B 1XMQI 2PNLA 3WU5A 4JI2I 4OO1F 4YY3I 5K36A 5DRRA 4DPXA 4IZKB 2O1TA 1FWLA 2CG9A 4FW7A 3T1YI 5BR8I 4DV5E 1Z0TA 3KRNA 1FI4A 4UTGA 1J5EI 2PNZB 4IFDE 3PRYA 4DU7A 5LL6R 3DD6A 2JE6B 1ZM2A 3M7ND 3ZZUA 4LF9E 1EI1A 3JAMQ 1Y4UA 1XNRE 2E1RA 4JG4A 2HKEA 2R42A 4DPUA 1XHKA 4RPFA 1H74A 1UDNA 4K0KE 2BM0A 2AE8A 2WP8B 3ZKBA 4PU9A 4DPTA 4NXMI 1N32I 1QZRA 4X62I 1Z0WA 2C37B 4X65I 4GKKE 3J7AG 4JV5E 1Z5CA 4B3RI 1RR9A 1PVGA 1DARA 3CWVA 2NN6C 5BR8E 3T1YE 2ZITA 4NXNE 4QNJA 4B3SE 4X66I 3P06A 1NHIA 5C0XC 1Z0GA 4LF9I 4DR1E 4BA2B 1U2RA 3HULA 4YHHE 5LMUE 1WUUA 4PRXA 1KTVA 4USMA 4DPWA 4IS9A 4M1KA 2UXCI 4DV1I 1HR0E 4IFDA 4AIDA 4UT4A 4WUBA 3P3EA 4GKJE 4JI1E 2IOQA 3CDIA 1H72C 3HKMA 4LOMA 1B63A 2Z5BA 3M85G 4LFBI 3OTOE 4LPFA 4DV6I 1FJGI 4DUZI 3LNUA 3Q6NA 4GQUA 4DR3E 4JI6E 4FW4A 5GMEA 4BA1A 4AQYE 2CVEA 2PNMA 2Z5EA 4LFAI 3L7ZB 2UXDE 2UUAI 5K36E 3M6AA 5JEAC 4KQVA 4MU0A 5LMUI 4P52A 1XMQE 5A2QC 3M85D 2HKJA 4DXLA 3J81C 1IBLE 1R6LA 1EA6A 4HY1A 4EMDA 2UUBI 4DV1E 3B8HA 1N0VC 4IZKA 2LJPA 4DV5I 2HK2A 4WUCA 1J5EE 1S16A 2PO2A 4DR4I 2NN6A 3Q6MA 1IBKE 4LF4I 1OYRA 1XNRI 1FNMA 1IBME 4LFAE 5IWAE 4JI3I 2UXDI 2JEBA 5C0XA 2V2QA 2NN6F 4HXZA 2PO0A 1VISA 4FW6A 4NXME 4FW9A 4JI4I 1USUA 3J80Q 2UUCE 4WUDA 3PS2A 4B3TI 2UUBE 3P76A 3B82A 4DV0E 2NN6E 4PRVA 3PYFA 4NXNI 4QNKA 4LF7E 4IFDC 4DR2I 4X66E 1MX0A 3J7AM 1Z0CA 4JV5I 2HHHI 3PS1A 4DR1I 3JAMC 2CGEA 2HFUA 1XMOE 4P7AA 3M7NG 1MU5A 2BA1D 5IWAI 4JI3E 4FWGA 1RREA 4LF6I 2Z5BB 4DV2E 2O1WA 2WNRA 4DUYE 5JEAA 1YH8A 2UUCI 4AM3A 1HNZI 5DRPA 2X7IA 2IERA 5K36F 5LMNE 1OJ4A 4LFBE 4LCFA 3OTOI 2E5LI 4JI2E 1OYSA 5IT9Q 4YY3E 2ZM6E 1XXEA 1BKNA 2UXCE 1K47A 2GS8A 1ELOA 1N36E 4BA2A 1USVA 2F1DA 4DV3E 1XMOI 2VQEE 2DEIA 1ZM9A 1N34I 4DR6I 4JI6I 3U1KA 2XEXA 1KVKA 1PIEA 1E3PA 4OO1B 1UDQA 4LF8E 3LPSA 1VI7A 5DNLA 1I94E 4FW3A 1ZM3A 4X62E 4X65E 1FKAE 4LFCI 1IBLI 2OI2A 4U3DA 1NHHA 3PS3A 2C38B 3WU4A 1IBMI 4NBQA 3ZM7A 4LCHA 4DV3I 4MDTA 1Z59A 2PNZA 2VF3A 1IBKI 4OO1D 2BA1G 2O1VA 3L7ZA 2A2DA 1H7UA 1Y6ZA 1Z0VA 1Z5AA 4HACA 2V2ZA 5K36B 2WW4A 2BA0D 4JI0I 4DV7E 1Y60A 4DR7I 1UDOA 3QT7A 1N33I 3LTOA 4B3TE 4IFDB 4GKJI 1RHYA 2VQFE 3PYEA 4J3DA 4LF5I 4DR5I 4MU1A 5FLXC 2JEAB 5DRQA 4OKGA 4DR2E 4FWDA 4OO1C 3K17A 5FLXQ 1Z0BA 3B78A 5ELWA 2F4VE 2J65A 4AQYI 5K36D 1HK7A 4MYTA 2UXBI 5GMDA 4JI0E 4B3MI 3D4JA 5LMNI 5C0XD 4IZJA 1KIJA 4DV2I 4DU8A 2GO3A 2UU9I 1KKHA 2C39B 4GKKI 1N33E 4KHPE 4B3RE 3Q1QA 2JT2A 4IFDF 5IT9C 2VQFI 4X64E 1ZXNA 2WNRB 2VQEI 1ZXMA 1Z0EA 4Z7CA 1Y5YA 2WP8A 2BR2B 5JEAD 4HYMA 4MYUA 3CDJA 4ED4A 1UDSA 3GMEA 2HK3A 4FN5A 4HACB 5FWKA 1N36I 3ZZ0A 4OX9I 2IESA 1HNWE 4I3HA 2JE6A 2UXBE 5DNXA 1XNQE 2Q2EB 4ZVIA 1N34E 4DR6E 2GO4A 2V8PA 3F0NA 1S4EA 2CZ9A 5C0XE 2C38A 1N0UA 4KHPI 1HR0I
chains in the Genus database with same CATH topology
4DV0I 2HFSA 4JI8I 4X64I 1I94I 3QT8A 4LF7I 4DPYA 4DV6E 4LFCE 2X36A 2HHHE 3HJCA 2V34A 1HNXE 1FWKA 2V2VA 2Z5CA 2DEJA 3J80C 1UEKA 1B62A 4XTJA 3ZZTA 4JI5I 1HNWI 1XNQI 3V2UC 4DR7E 2BM1A 2ZBKB 4R1FA 4DUYI 4LF5E 4K0KI 4DR5E 4JI8E 2NPFA 4JYAI 4DV7I 1NZ0A 1N32E 2E5LE 1D6TA 4B3SI 4DR4E 2ZM6I 5L3JA 3QT6A 2A2CA 4LF4E 2F4VI 1PKPA 1A6FA 1HNXI 1Z5BA 2O1UA 2GQ0A 3T1HI 3H4LA 3J81Q 4JI5E 3PYGA 5A2QQ 2IOPA 1H7SA 4DV4I 4Z7YA 3K85A 3QT5A 3GONA 3V5RA 4JI4E 2R3VA 4JI7E 2EFGA 4LF8I 3PYDA 4YHHI 4B3ME 4IZJB 4JYAE 1FJGE 4DUZE 2UU9E 4DR3I 3WU3A 1Y4SA 4OX9E 2AJ4A 4JI1I 4FWHA 3T1HE 4URLA 4DV4E 1MG7A 2BV3A 4LF6E 3WU6A 4USKA 1H73A 4JI7I 3ZKDA 2Z5CB 1NHJA 2J7KA 2UUAE 4N3OA 1HNZE 4IZJD 1ZM4A 3K1JA 1XMQI 2PNLA 3WU5A 4JI2I 4YY3I 4DPXA 4IZKB 2O1TA 1FWLA 2CG9A 3T1YI 5BR8I 4DV5E 1Z0TA 1FI4A 4UTGA 1J5EI 3PRYA 4DU7A 5LL6R 1ZM2A 3ZZUA 4LF9E 1EI1A 3JAMQ 1Y4UA 1XNRE 2E1RA 4JG4A 2HKEA 2R42A 4DPUA 1XHKA 4RPFA 1H74A 4K0KE 2BM0A 3ZKBA 4PU9A 4DPTA 4NXMI 1N32I 1QZRA 4X62I 1Z0WA 4X65I 4GKKE 3J7AG 4JV5E 1Z5CA 4B3RI 1RR9A 1PVGA 1DARA 3CWVA 5BR8E 3T1YE 2ZITA 4NXNE 4B3SE 4X66I 3P06A 1NHIA 1Z0GA 4LF9I 4DR1E 1U2RA 3HULA 4YHHE 5LMUE 1WUUA 4PRXA 1KTVA 4USMA 4DPWA 4M1KA 2UXCI 4DV1I 1HR0E 4GKJE 4UT4A 4WUBA 4JI1E 2IOQA 1H72C 1B63A 2Z5BA 4LFBI 3OTOE 4DV6I 1FJGI 4DUZI 3LNUA 3Q6NA 4DR3E 4JI6E 5GMEA 4AQYE 2PNMA 2Z5EA 4LFAI 2UXDE 2UUAI 3M6AA 4KQVA 5LMUI 4P52A 1XMQE 5A2QC 2HKJA 4DXLA 3J81C 1IBLE 1EA6A 4HY1A 4EMDA 2UUBI 4DV1E 3B8HA 1N0VC 4IZKA 2LJPA 4DV5I 2HK2A 4WUCA 1J5EE 1S16A 4DR4I 3Q6MA 1IBKE 4LF4I 1XNRI 1FNMA 1IBME 4LFAE 5IWAE 4JI3I 2UXDI 2V2QA 4HXZA 1VISA 4NXME 4FW9A 4JI4I 1USUA 3J80Q 2UUCE 4WUDA 4B3TI 2UUBE 4DV0E 3B82A 4PRVA 3PYFA 4NXNI 4LF7E 4DR2I 4X66E 1MX0A 3J7AM 1Z0CA 4JV5I 2HHHI 4DR1I 3JAMC 2HFUA 2CGEA 1XMOE 4P7AA 1MU5A 5IWAI 4JI3E 4FWGA 1RREA 4LF6I 2Z5BB 4DV2E 2O1WA 4DUYE 2UUCI 1HNZI 2X7IA 5LMNE 1OJ4A 4LFBE 3OTOI 2E5LI 4JI2E 5IT9Q 4YY3E 2ZM6E 1BKNA 2UXCE 1K47A 2GS8A 1ELOA 1N36E 1USVA 4DV3E 1XMOI 2VQEE 2DEIA 1ZM9A 1N34I 4DR6I 4JI6I 2XEXA 1KVKA 1PIEA 4LF8E 3LPSA 1I94E 1ZM3A 4X62E 4X65E 1FKAE 4LFCI 1IBLI 2OI2A 1NHHA 3WU4A 1IBMI 3ZM7A 4DV3I 1Z59A 2VF3A 1IBKI 2O1VA 2A2DA 1H7UA 1Y6ZA 1Z0VA 1Z5AA 4HACA 2V2ZA 2WW4A 4JI0I 4DV7E 4DR7I 3QT7A 1N33I 3LTOA 4B3TE 4GKJI 2VQFE 3PYEA 4LF5I 4DR5I 5FLXC 4DR2E 4FWDA 3K17A 5FLXQ 1Z0BA 3B78A 2F4VE 4AQYI 1HK7A 4MYTA 2UXBI 5GMDA 4JI0E 4B3MI 3D4JA 5LMNI 4IZJA 1KIJA 4DV2I 4DU8A 2UU9I 1KKHA 4GKKI 1N33E 4KHPE 4B3RE 3Q1QA 5IT9C 2VQFI 4X64E 1ZXNA 2VQEI 1ZXMA 1Z0EA 4Z7CA 4HYMA 4MYUA 4ED4A 5FWKA 2HK3A 4FN5A 4HACB 1N36I 3ZZ0A 4OX9I 1HNWE 4I3HA 2UXBE 1XNQE 2Q2EB 4ZVIA 1N34E 4DR6E 2V8PA 3F0NA 1S4EA 2CZ9A 1N0UA 4KHPI 1HR0I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 I;  2HFS A;  4JI8 I;  4X64 I;  1I94 I;  3QT8 A;  4LF7 I;  4DPY A;  4DV6 E;  4LFC E;  2X36 A;  2HHH E;  2V34 A;  1HNX E;  1FWK A;  2V2V A;  2DEJ A;  3J80 C;  1UEK A;  1B62 A;  4XTJ A;  3ZZT A;  4JI5 I;  1HNW I;  1XNQ I;  3V2U C;  4DR7 E;  2BM1 A;  2ZBK B;  4R1F A;  4DUY I;  4LF5 E;  4K0K I;  4DR5 E;  4JI8 E;  2NPF A;  4JYA I;  4DV7 I;  1NZ0 A;  1N32 E;  2E5L E;  1D6T A;  4B3S I;  4DR4 E;  2ZM6 I;  5L3J A;  3QT6 A;  2A2C A;  4LF4 E;  2F4V I;  1PKP A;  1A6F A;  1HNX I;  1Z5B A;  3T1H I;  3H4L A;  3J81 Q;  4JI5 E;  3PYG A;  5A2Q Q;  1H7S A;  4DV4 I;  4Z7Y A;  3QT5 A;  3GON A;  3V5R A;  4JI4 E;  2R3V A;  4JI7 E;  2EFG A;  4LF8 I;  3PYD A;  4YHH I;  4B3M E;  4JYA E;  1FJG E;  4DUZ E;  2UU9 E;  4DR3 I;  3WU3 A;  4OX9 E;  2AJ4 A;  4JI1 I;  4FWH A;  3T1H E;  4URL A;  4DV4 E;  1MG7 A;  2BV3 A;  4LF6 E;  3WU6 A;  4USK A;  1H73 A;  4JI7 I;  3ZKD A;  1NHJ A;  2J7K A;  1HNZ E;  2UUA E;  1ZM4 A;  3K1J A;  1XMQ I;  3WU5 A;  4JI2 I;  4YY3 I;  4DPX A;  1FWL A;  3T1Y I;  5BR8 I;  4DV5 E;  1Z0T A;  1FI4 A;  4UTG A;  1J5E I;  4DU7 A;  5LL6 R;  1ZM2 A;  3ZZU A;  4LF9 E;  1EI1 A;  3JAM Q;  1XNR E;  2E1R A;  4JG4 A;  2HKE A;  2R42 A;  4DPU A;  1XHK A;  4RPF A;  1H74 A;  4K0K E;  2BM0 A;  3ZKB A;  4PU9 A;  4DPT A;  4NXM I;  1N32 I;  1QZR A;  4X62 I;  1Z0W A;  4X65 I;  4GKK E;  3J7A G;  4JV5 E;  1Z5C A;  4B3R I;  1RR9 A;  1PVG A;  1DAR A;  3CWV A;  5BR8 E;  3T1Y E;  2ZIT A;  4NXN E;  4B3S E;  4X66 I;  1NHI A;  1Z0G A;  4LF9 I;  4DR1 E;  1U2R A;  3HUL A;  4YHH E;  5LMU E;  1WUU A;  4PRX A;  1KTV A;  4USM A;  4DPW A;  4M1K A;  2UXC I;  4DV1 I;  1HR0 E;  4GKJ E;  4UT4 A;  4WUB A;  4JI1 E;  1H72 C;  1B63 A;  4LFB I;  3OTO E;  4DV6 I;  1FJG I;  4DUZ I;  3LNU A;  4DR3 E;  4JI6 E;  5GME A;  4AQY E;  4LFA I;  2UXD E;  2UUA I;  3M6A A;  4KQV A;  5LMU I;  4P52 A;  1XMQ E;  5A2Q C;  2HKJ A;  4DXL A;  3J81 C;  1IBL E;  1EA6 A;  4HY1 A;  4EMD A;  2UUB I;  4DV1 E;  3B8H A;  1N0V C;  2LJP A;  4DV5 I;  2HK2 A;  4WUC A;  1J5E E;  1S16 A;  4DR4 I;  1IBK E;  4LF4 I;  1XNR I;  1FNM A;  1IBM E;  4LFA E;  5IWA E;  4JI3 I;  2UXD I;  2V2Q A;  4HXZ A;  1VIS A;  4NXM E;  4FW9 A;  4JI4 I;  3J80 Q;  2UUC E;  4WUD A;  4B3T I;  2UUB E;  4DV0 E;  3B82 A;  4PRV A;  3PYF A;  4NXN I;  4LF7 E;  4DR2 I;  4X66 E;  1MX0 A;  3J7A M;  1Z0C A;  4JV5 I;  2HHH I;  4DR1 I;  3JAM C;  2HFU A;  1XMO E;  4P7A A;  1MU5 A;  5IWA I;  4JI3 E;  4FWG A;  1RRE A;  4LF6 I;  4DV2 E;  4DUY E;  2UUC I;  1HNZ I;  2X7I A;  5LMN E;  1OJ4 A;  4LFB E;  3OTO I;  2E5L I;  4JI2 E;  5IT9 Q;  4YY3 E;  2ZM6 E;  1BKN A;  2UXC E;  1K47 A;  2GS8 A;  1ELO A;  1N36 E;  4DV3 E;  1XMO I;  2VQE E;  2DEI A;  1ZM9 A;  1N34 I;  4DR6 I;  4JI6 I;  2XEX A;  1KVK A;  1PIE A;  4LF8 E;  3LPS A;  1I94 E;  1ZM3 A;  4X62 E;  4X65 E;  1FKA E;  4LFC I;  1IBL I;  2OI2 A;  1NHH A;  3WU4 A;  1IBM I;  3ZM7 A;  4DV3 I;  1Z59 A;  2VF3 A;  1IBK I;  2A2D A;  1H7U A;  1Z0V A;  1Z5A A;  4HAC A;  2V2Z A;  2WW4 A;  4JI0 I;  4DV7 E;  4DR7 I;  3QT7 A;  1N33 I;  3LTO A;  4B3T E;  4GKJ I;  2VQF E;  3PYE A;  4LF5 I;  4DR5 I;  5FLX C;  4DR2 E;  4FWD A;  3K17 A;  5FLX Q;  1Z0B A;  3B78 A;  2F4V E;  4AQY I;  4MYT A;  2UXB I;  5GMD A;  4JI0 E;  4B3M I;  3D4J A;  5LMN I;  1KIJ A;  4DV2 I;  4DU8 A;  2UU9 I;  1KKH A;  4GKK I;  1N33 E;  4KHP E;  4B3R E;  3Q1Q A;  5IT9 C;  2VQF I;  4X64 E;  1ZXN A;  2VQE I;  1ZXM A;  1Z0E A;  4Z7C A;  4HYM A;  4MYU A;  4ED4 A;  2HK3 A;  4FN5 A;  4HAC B;  1N36 I;  3ZZ0 A;  4OX9 I;  1HNW E;  4I3H A;  2UXB E;  1XNQ E;  2Q2E B;  4ZVI A;  1N34 E;  4DR6 E;  2V8P A;  3F0N A;  1S4E A;  2CZ9 A;  1N0U A;  4KHP I;  1HR0 I; 
#chains in the Genus database with same CATH topology
 4DV0 I;  3P3C A;  2HFS A;  4JI8 I;  4X64 I;  1I94 I;  3QT8 A;  3GCM A;  4LF7 I;  1R6M A;  4DPY A;  2PO0 B;  4DV6 E;  3P3G A;  4FW5 A;  4LFC E;  2X36 A;  2HHH E;  3HJC A;  2V34 A;  1HNX E;  1FWK A;  4LCG A;  2V2V A;  2Z5C A;  2DEJ A;  3J80 C;  1UEK A;  4OO1 A;  1B62 A;  4XTJ A;  3ZZT A;  4JI5 I;  1HNW I;  1XNQ I;  3V2U C;  4DR7 E;  2BM1 A;  2ZBK B;  4R1F A;  2NN6 D;  4DUY I;  4MU4 A;  1E3H A;  1P42 A;  4LF5 E;  4K0K I;  4DR5 E;  5K36 C;  4JI8 E;  2NPF A;  4JYA I;  4DV7 I;  1NZ0 A;  1N32 E;  2E5L E;  1D6T A;  4B3S I;  4DR4 E;  4OO1 E;  2ZM6 I;  3UHM A;  5L3J A;  3QT6 A;  2BA0 G;  5DRO A;  2A2C A;  4LF4 E;  2F4V I;  1PKP A;  1A6F A;  1HNX I;  1Z5B A;  2O1U A;  2GQ0 A;  3T1H I;  3H4L A;  4BA1 B;  3J81 Q;  5JEA B;  4JI5 E;  3PYG A;  5A2Q Q;  2IOP A;  3H1C A;  2PO1 B;  2BR2 A;  1H7S A;  4DV4 I;  3NZK A;  4Z7Y A;  3K85 A;  2PO1 A;  3QT5 A;  3GON A;  3V5R A;  5C0X F;  4AIM A;  4JI4 E;  2R3V A;  3B4T A;  4JI7 E;  2EFG A;  1OYP A;  4LF8 I;  5JEA E;  2C39 A;  3PYD A;  4YHH I;  4IFD D;  4B3M E;  2O3Z A;  4IZJ B;  5EKW A;  4JYA E;  1YHC A;  2VES A;  1FJG E;  3GLL A;  4DUZ E;  2UU9 E;  4DR3 I;  3WU3 A;  1Y4S A;  4OX9 E;  2AJ4 A;  4JI1 I;  4FWH A;  3T1H E;  4URL A;  5JEA F;  4MQY A;  4DV4 E;  1MG7 A;  2JEA A;  2BV3 A;  4LF6 E;  3WU6 A;  2JEB B;  4USK A;  4ISA A;  5C0X B;  1H73 A;  4JI7 I;  3ZKD A;  4OZE A;  2Z5C B;  5EL9 A;  1NHJ A;  2J7K A;  4N3O A;  1HNZ E;  2UUA E;  2C37 A;  4IZJ D;  1ZM4 A;  3K1J A;  4U3B A;  4MU3 A;  3U1Y A;  2NN6 B;  2PO2 B;  1XMQ I;  2PNL A;  3WU5 A;  4JI2 I;  4OO1 F;  4YY3 I;  5K36 A;  5DRR A;  4DPX A;  4IZK B;  2O1T A;  1FWL A;  2CG9 A;  4FW7 A;  3T1Y I;  5BR8 I;  4DV5 E;  1Z0T A;  3KRN A;  1FI4 A;  4UTG A;  1J5E I;  2PNZ B;  4IFD E;  3PRY A;  4DU7 A;  5LL6 R;  3DD6 A;  2JE6 B;  1ZM2 A;  3M7N D;  3ZZU A;  4LF9 E;  1EI1 A;  3JAM Q;  1Y4U A;  1XNR E;  2E1R A;  4JG4 A;  2HKE A;  2R42 A;  4DPU A;  1XHK A;  4RPF A;  1H74 A;  1UDN A;  4K0K E;  2BM0 A;  2AE8 A;  2WP8 B;  3ZKB A;  4PU9 A;  4DPT A;  4NXM I;  1N32 I;  1QZR A;  4X62 I;  1Z0W A;  2C37 B;  4X65 I;  4GKK E;  3J7A G;  4JV5 E;  1Z5C A;  4B3R I;  1RR9 A;  1PVG A;  1DAR A;  3CWV A;  2NN6 C;  5BR8 E;  3T1Y E;  2ZIT A;  4NXN E;  4QNJ A;  4B3S E;  4X66 I;  3P06 A;  1NHI A;  5C0X C;  1Z0G A;  4LF9 I;  4DR1 E;  4BA2 B;  1U2R A;  3HUL A;  4YHH E;  5LMU E;  1WUU A;  4PRX A;  1KTV A;  4USM A;  4DPW A;  4IS9 A;  4M1K A;  2UXC I;  4DV1 I;  1HR0 E;  4IFD A;  4AID A;  4UT4 A;  4WUB A;  3P3E A;  4GKJ E;  4JI1 E;  2IOQ A;  3CDI A;  1H72 C;  3HKM A;  4LOM A;  1B63 A;  2Z5B A;  3M85 G;  4LFB I;  3OTO E;  4LPF A;  4DV6 I;  1FJG I;  4DUZ I;  3LNU A;  3Q6N A;  4GQU A;  4DR3 E;  4JI6 E;  4FW4 A;  5GME A;  4BA1 A;  4AQY E;  2CVE A;  2PNM A;  2Z5E A;  4LFA I;  3L7Z B;  2UXD E;  2UUA I;  5K36 E;  3M6A A;  5JEA C;  4KQV A;  4MU0 A;  5LMU I;  4P52 A;  1XMQ E;  5A2Q C;  3M85 D;  2HKJ A;  4DXL A;  3J81 C;  1IBL E;  1R6L A;  1EA6 A;  4HY1 A;  4EMD A;  2UUB I;  4DV1 E;  3B8H A;  1N0V C;  4IZK A;  2LJP A;  4DV5 I;  2HK2 A;  4WUC A;  1J5E E;  1S16 A;  2PO2 A;  4DR4 I;  2NN6 A;  3Q6M A;  1IBK E;  4LF4 I;  1OYR A;  1XNR I;  1FNM A;  1IBM E;  4LFA E;  5IWA E;  4JI3 I;  2UXD I;  2JEB A;  5C0X A;  2V2Q A;  2NN6 F;  4HXZ A;  2PO0 A;  1VIS A;  4FW6 A;  4NXM E;  4FW9 A;  4JI4 I;  1USU A;  3J80 Q;  2UUC E;  4WUD A;  3PS2 A;  4B3T I;  2UUB E;  3P76 A;  3B82 A;  4DV0 E;  2NN6 E;  4PRV A;  3PYF A;  4NXN I;  4QNK A;  4LF7 E;  4IFD C;  4DR2 I;  4X66 E;  1MX0 A;  3J7A M;  1Z0C A;  4JV5 I;  2HHH I;  3PS1 A;  4DR1 I;  3JAM C;  2CGE A;  2HFU A;  1XMO E;  4P7A A;  3M7N G;  1MU5 A;  2BA1 D;  5IWA I;  4JI3 E;  4FWG A;  1RRE A;  4LF6 I;  2Z5B B;  4DV2 E;  2O1W A;  2WNR A;  4DUY E;  5JEA A;  1YH8 A;  2UUC I;  4AM3 A;  1HNZ I;  5DRP A;  2X7I A;  2IER A;  5K36 F;  5LMN E;  1OJ4 A;  4LFB E;  4LCF A;  3OTO I;  2E5L I;  4JI2 E;  1OYS A;  5IT9 Q;  4YY3 E;  2ZM6 E;  1XXE A;  1BKN A;  2UXC E;  1K47 A;  2GS8 A;  1ELO A;  1N36 E;  4BA2 A;  1USV A;  2F1D A;  4DV3 E;  1XMO I;  2VQE E;  2DEI A;  1ZM9 A;  1N34 I;  4DR6 I;  4JI6 I;  3U1K A;  2XEX A;  1KVK A;  1PIE A;  1E3P A;  4OO1 B;  1UDQ A;  4LF8 E;  3LPS A;  1VI7 A;  5DNL A;  1I94 E;  4FW3 A;  1ZM3 A;  4X62 E;  4X65 E;  1FKA E;  4LFC I;  1IBL I;  2OI2 A;  4U3D A;  1NHH A;  3PS3 A;  2C38 B;  3WU4 A;  1IBM I;  4NBQ A;  3ZM7 A;  4LCH A;  4DV3 I;  4MDT A;  1Z59 A;  2PNZ A;  2VF3 A;  1IBK I;  4OO1 D;  2BA1 G;  2O1V A;  3L7Z A;  2A2D A;  1H7U A;  1Y6Z A;  1Z0V A;  1Z5A A;  4HAC A;  2V2Z A;  5K36 B;  2WW4 A;  2BA0 D;  4JI0 I;  4DV7 E;  1Y60 A;  4DR7 I;  1UDO A;  3QT7 A;  1N33 I;  3LTO A;  4B3T E;  4IFD B;  4GKJ I;  1RHY A;  2VQF E;  3PYE A;  4J3D A;  4LF5 I;  4DR5 I;  4MU1 A;  5FLX C;  2JEA B;  5DRQ A;  4OKG A;  4DR2 E;  4FWD A;  4OO1 C;  3K17 A;  5FLX Q;  1Z0B A;  3B78 A;  5ELW A;  2F4V E;  2J65 A;  4AQY I;  5K36 D;  1HK7 A;  4MYT A;  2UXB I;  5GMD A;  4JI0 E;  4B3M I;  3D4J A;  5LMN I;  5C0X D;  4IZJ A;  1KIJ A;  4DV2 I;  4DU8 A;  2GO3 A;  2UU9 I;  1KKH A;  2C39 B;  4GKK I;  1N33 E;  4KHP E;  4B3R E;  3Q1Q A;  2JT2 A;  4IFD F;  5IT9 C;  2VQF I;  4X64 E;  1ZXN A;  2WNR B;  2VQE I;  1ZXM A;  1Z0E A;  4Z7C A;  1Y5Y A;  2WP8 A;  2BR2 B;  5JEA D;  4HYM A;  4MYU A;  3CDJ A;  4ED4 A;  1UDS A;  3GME A;  2HK3 A;  4FN5 A;  4HAC B;  5FWK A;  1N36 I;  3ZZ0 A;  4OX9 I;  2IES A;  1HNW E;  4I3H A;  2JE6 A;  2UXB E;  5DNX A;  1XNQ E;  2Q2E B;  4ZVI A;  1N34 E;  4DR6 E;  2GO4 A;  2V8P A;  3F0N A;  1S4E A;  2CZ9 A;  5C0X E;  2C38 A;  1N0U A;  4KHP I;  1HR0 I; 
#chains in the Genus database with same CATH homology
 4DV0 I;  2HFS A;  4JI8 I;  4X64 I;  1I94 I;  3QT8 A;  4LF7 I;  4DPY A;  4DV6 E;  4LFC E;  2X36 A;  2HHH E;  3HJC A;  2V34 A;  1HNX E;  1FWK A;  2V2V A;  2Z5C A;  2DEJ A;  3J80 C;  1UEK A;  1B62 A;  4XTJ A;  3ZZT A;  4JI5 I;  1HNW I;  1XNQ I;  3V2U C;  4DR7 E;  2BM1 A;  2ZBK B;  4R1F A;  4DUY I;  4LF5 E;  4K0K I;  4DR5 E;  4JI8 E;  2NPF A;  4JYA I;  4DV7 I;  1NZ0 A;  1N32 E;  2E5L E;  1D6T A;  4B3S I;  4DR4 E;  2ZM6 I;  5L3J A;  3QT6 A;  2A2C A;  4LF4 E;  2F4V I;  1PKP A;  1A6F A;  1HNX I;  1Z5B A;  2O1U A;  2GQ0 A;  3T1H I;  3H4L A;  3J81 Q;  4JI5 E;  3PYG A;  5A2Q Q;  2IOP A;  1H7S A;  4DV4 I;  4Z7Y A;  3K85 A;  3QT5 A;  3GON A;  3V5R A;  4JI4 E;  2R3V A;  4JI7 E;  2EFG A;  4LF8 I;  3PYD A;  4YHH I;  4B3M E;  4IZJ B;  4JYA E;  1FJG E;  4DUZ E;  2UU9 E;  4DR3 I;  3WU3 A;  1Y4S A;  4OX9 E;  2AJ4 A;  4JI1 I;  4FWH A;  3T1H E;  4URL A;  4DV4 E;  1MG7 A;  2BV3 A;  4LF6 E;  3WU6 A;  4USK A;  1H73 A;  4JI7 I;  3ZKD A;  2Z5C B;  1NHJ A;  2J7K A;  2UUA E;  4N3O A;  1HNZ E;  4IZJ D;  1ZM4 A;  3K1J A;  1XMQ I;  2PNL A;  3WU5 A;  4JI2 I;  4YY3 I;  4DPX A;  4IZK B;  2O1T A;  1FWL A;  2CG9 A;  3T1Y I;  5BR8 I;  4DV5 E;  1Z0T A;  1FI4 A;  4UTG A;  1J5E I;  3PRY A;  4DU7 A;  5LL6 R;  1ZM2 A;  3ZZU A;  4LF9 E;  1EI1 A;  3JAM Q;  1Y4U A;  1XNR E;  2E1R A;  4JG4 A;  2HKE A;  2R42 A;  4DPU A;  1XHK A;  4RPF A;  1H74 A;  4K0K E;  2BM0 A;  3ZKB A;  4PU9 A;  4DPT A;  4NXM I;  1N32 I;  1QZR A;  4X62 I;  1Z0W A;  4X65 I;  4GKK E;  3J7A G;  4JV5 E;  1Z5C A;  4B3R I;  1RR9 A;  1PVG A;  1DAR A;  3CWV A;  5BR8 E;  3T1Y E;  2ZIT A;  4NXN E;  4B3S E;  4X66 I;  3P06 A;  1NHI A;  1Z0G A;  4LF9 I;  4DR1 E;  1U2R A;  3HUL A;  4YHH E;  5LMU E;  1WUU A;  4PRX A;  1KTV A;  4USM A;  4DPW A;  4M1K A;  2UXC I;  4DV1 I;  1HR0 E;  4GKJ E;  4UT4 A;  4WUB A;  4JI1 E;  2IOQ A;  1H72 C;  1B63 A;  2Z5B A;  4LFB I;  3OTO E;  4DV6 I;  1FJG I;  4DUZ I;  3LNU A;  3Q6N A;  4DR3 E;  4JI6 E;  5GME A;  4AQY E;  2PNM A;  2Z5E A;  4LFA I;  2UXD E;  2UUA I;  3M6A A;  4KQV A;  5LMU I;  4P52 A;  1XMQ E;  5A2Q C;  2HKJ A;  4DXL A;  3J81 C;  1IBL E;  1EA6 A;  4HY1 A;  4EMD A;  2UUB I;  4DV1 E;  3B8H A;  1N0V C;  4IZK A;  2LJP A;  4DV5 I;  2HK2 A;  4WUC A;  1J5E E;  1S16 A;  4DR4 I;  3Q6M A;  1IBK E;  4LF4 I;  1XNR I;  1FNM A;  1IBM E;  4LFA E;  5IWA E;  4JI3 I;  2UXD I;  2V2Q A;  4HXZ A;  1VIS A;  4NXM E;  4FW9 A;  4JI4 I;  1USU A;  3J80 Q;  2UUC E;  4WUD A;  4B3T I;  2UUB E;  4DV0 E;  3B82 A;  4PRV A;  3PYF A;  4NXN I;  4LF7 E;  4DR2 I;  4X66 E;  1MX0 A;  3J7A M;  1Z0C A;  4JV5 I;  2HHH I;  4DR1 I;  3JAM C;  2HFU A;  2CGE A;  1XMO E;  4P7A A;  1MU5 A;  5IWA I;  4JI3 E;  4FWG A;  1RRE A;  4LF6 I;  2Z5B B;  4DV2 E;  2O1W A;  4DUY E;  2UUC I;  1HNZ I;  2X7I A;  5LMN E;  1OJ4 A;  4LFB E;  3OTO I;  2E5L I;  4JI2 E;  5IT9 Q;  4YY3 E;  2ZM6 E;  1BKN A;  2UXC E;  1K47 A;  2GS8 A;  1ELO A;  1N36 E;  1USV A;  4DV3 E;  1XMO I;  2VQE E;  2DEI A;  1ZM9 A;  1N34 I;  4DR6 I;  4JI6 I;  2XEX A;  1KVK A;  1PIE A;  4LF8 E;  3LPS A;  1I94 E;  1ZM3 A;  4X62 E;  4X65 E;  1FKA E;  4LFC I;  1IBL I;  2OI2 A;  1NHH A;  3WU4 A;  1IBM I;  3ZM7 A;  4DV3 I;  1Z59 A;  2VF3 A;  1IBK I;  2O1V A;  2A2D A;  1H7U A;  1Y6Z A;  1Z0V A;  1Z5A A;  4HAC A;  2V2Z A;  2WW4 A;  4JI0 I;  4DV7 E;  4DR7 I;  3QT7 A;  1N33 I;  3LTO A;  4B3T E;  4GKJ I;  2VQF E;  3PYE A;  4LF5 I;  4DR5 I;  5FLX C;  4DR2 E;  4FWD A;  3K17 A;  5FLX Q;  1Z0B A;  3B78 A;  2F4V E;  4AQY I;  1HK7 A;  4MYT A;  2UXB I;  5GMD A;  4JI0 E;  4B3M I;  3D4J A;  5LMN I;  4IZJ A;  1KIJ A;  4DV2 I;  4DU8 A;  2UU9 I;  1KKH A;  4GKK I;  1N33 E;  4KHP E;  4B3R E;  3Q1Q A;  5IT9 C;  2VQF I;  4X64 E;  1ZXN A;  2VQE I;  1ZXM A;  1Z0E A;  4Z7C A;  4HYM A;  4MYU A;  4ED4 A;  5FWK A;  2HK3 A;  4FN5 A;  4HAC B;  1N36 I;  3ZZ0 A;  4OX9 I;  1HNW E;  4I3H A;  2UXB E;  1XNQ E;  2Q2E B;  4ZVI A;  1N34 E;  4DR6 E;  2V8P A;  3F0N A;  1S4E A;  2CZ9 A;  1N0U A;  4KHP I;  1HR0 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...