1Z0GA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 56
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0gA00
4URLA 1N0VC 1Z0CA 5FLXQ 2VQFI 4LF8E 1IBKI 3ZKDA 1ZM2A 4NXNE 1IBLE 2HFUA 2R3VA 4DV0I 4JI2I 4DR5I 1NHJA 2HHHE 4LF7I 1XNRI 4DV4E 2GS8A 1XNQE 4DR4E 2A2CA 1Z5AA 4Z7CA 4LFAI 2J7KA 1U2RA 4YHHE 2VQEI 4JI3E 4JV5I 1EA6A 2DEIA 2V34A 4X65E 1Z0BA 1D6TA 1N32I 4DV6E 2ZM6I 1HNXI 4NXME 4DV1E 1I94I 4PRVA 4JI4I 3LNUA 4UT4A 4ZVIA 1HNZI 4PU9A 3ZKBA 1WUUA 2UUBE 4DR3E 4LF5I 2X7IA 3OTOE 1NZ0A 1DARA 3PYEA 5LMUI 2UXDE 4HY1A 1N0UA 4DV7E 4P52A 3LTOA 4OX9E 1FJGI 4LFCE 4B3RI 2DEJA 3T1YI 4DPUA 4FWDA 4DV3E 4KHPE 4LFBE 4JI5E 4DR1I 3J80C 3B8HA 3Q1QA 4DUZI 3T1HI 4B3TI 2X36A 4GKKE 2UUAI 3PYGA 1XMOI 2WW4A 1MX0A 4X64I 4B3ME 4DPTA 4JYAI 4LF9I 1Z59A 1J5EE 1Z0GA 3J81C 1KKHA 3J80Q 5LMNE 4B3SI 4JI1E 4WUDA 2VQFE 2F4VI 1IBKE 2UXBI 5GMDA 1RR9A 2UU9I 4DV0E 4JI2E 3WU6A 4DR5E 1ZXNA 4LF7E 3J81Q 1XNRE 1N33I 4DUYI 4DPXA 4DR6I 4DR7I 4MYTA 2AJ4A 1H7UA 4LFAE 3K17A 3ZZ0A 4UTGA 2NPFA 2VQEE 4JV5E 1FNMA 1N32E 1PIEA 2ZM6E 2VF3A 1HNXE 1FWKA 4DXLA 1I94E 4HXZA 4JI4E 1FWLA 4HYMA 1HNZE 2R42A 1H72C 2A2DA 4YY3E 4I3HA 2HKJA 5BR8I 4JI8I 4LF5E 3B82A 1HNWI 3ZM7A 5LMUE 1ZM4A 4DPYA 4WUCA 5IT9Q 4MYUA 4B3RE 2V8PA 4FN5A 3T1YE 1PVGA 2ZBKB 1N34I 1KVKA 1BKNA 1NHIA 4USKA 4DR1E 3H4LA 4DR2I 4DUZE 1XMQI 3T1HE 2EFGA 4B3TE 1UEKA 3F0NA 2UUAE 1Z0VA 3QT7A 5IWAE 1XMOE 4X64E 2UUCI 4Z7YA 5LL6R 4JI3I 3QT8A 4LF9E 1ZM9A 1S16A 4JI6I 4RPFA 4WUBA 2LJPA 2F4VE 2UXBE 2V2ZA 4PRXA 1Z5BA 2UU9E 2E5LI 2V2QA 4K0KE 3ZZTA 4P7AA 3V5RA 3OTOI 1HR0I 4X66I 1N33E 4DUYE 1ZM3A 4DR6E 4DR7E 5GMEA 4DV2I 4LFCI 4LF6I 1A6FA 1MG7A 3J7AM 1KTVA 3ZZUA 1IBMI 2BM1A 4JI0I 4X62I 1H7SA 4KQVA 2UXCI 5A2QC 4FWHA 4FW9A 1FKAE 4LF4I 5BR8E 4JI8E 2V2VA 2HK2A 2BM0A 4DV5I 2HK3A 1HNWE 3PYFA 1Z0WA 1MU5A 2Q2EB 3B78A 1OJ4A 5A2QQ 4USMA 5IT9C 4M1KA 4GKJI 1N36I 1FI4A 4AQYI 1N34E 3QT5A 3J7AG 4HACA 2ZITA 4XTJA 3M6AA 4DR2E 4DU8A 3GONA 1XMQE 4JI7I 3WU5A 1EI1A 3WU3A 1FJGE 3CWVA 4LF8I 1B63A 2UUCE 2HFSA 3JAMC 4NXNI 1IBLI 1S4EA 4R1FA 4JI6E 2HHHI 4DU7A 4FWGA 4DV4I 1RREA 1XNQI 4DR4I 2OI2A 4HACB 1KIJA 4YY3I 4EMDA 1K47A 1B62A 2E5LE 3JAMQ 4YHHI 4JYAE 1H73A 1H74A 3D4JA 4X65I 1HR0E 4X66E 3PYDA 4DV6I 1QZRA 2HKEA 1Z0EA 4B3SE 4NXMI 4DV1I 4DPWA 4DV2E 3QT6A 1Z5CA 2UUBI 4DR3I 4LF6E 1ELOA 1IBME 4JI0E 2XEXA 3LPSA 4X62E 2UXCE 2UXDI 3HULA 1Z0TA 4JG4A 3V2UC 4DV7I 1VISA 5L3JA 1PKPA 4LF4E 4OX9I 5IWAI 4DV5E 1ZXMA 4DV3I 4KHPI 4LFBI 1NHHA 4JI5I 3K1JA 4ED4A 5FLXC 1XHKA 4GKJE 4GKKI 1N36E 3WU4A 4AQYE 4K0KI 4B3MI 1J5EI 2CZ9A 5LMNI 4JI7E 2BV3A 4JI1I 2E1RA
chains in the Genus database with same CATH superfamily
4URLA 1N0VC 1Z0CA 2IOPA 5FLXQ 4IFDD 2VQFI 4FW5A 4LF8E 1IBKI 1E3PA 3B4TA 3ZKDA 2O1TA 1ZM2A 4NXNE 1IBLE 2HFUA 2R3VA 4IFDA 5K36B 4DV0I 4JI2I 4DR5I 1NHJA 2HHHE 4LF7I 1XNRI 4DV4E 2GS8A 1XNQE 4DR4E 3GCMA 2A2CA 5C0XF 2WP8A 1UDSA 1Z5AA 4FW7A 4Z7CA 4LFAI 3Q6MA 5JEAF 2J7KA 1U2RA 4YHHE 2VQEI 4JI3E 1USVA 3M7ND 4JV5I 1EA6A 2DEIA 2V34A 4X65E 1Z0BA 1D6TA 5EKWA 1N32I 4DV6E 2ZM6I 1HNXI 4NXME 5K36E 4DV1E 1I94I 3H1CA 4PRVA 4JI4I 3LNUA 4UT4A 4IFDB 4ZVIA 1HNZI 4LOMA 4PU9A 3ZKBA 4OO1D 1WUUA 4LCGA 2UUBE 4DR3E 2NN6A 4LF5I 4FW4A 2O1UA 2X7IA 2WP8B 3OTOE 1NZ0A 4OO1A 1DARA 1OYRA 2BA1D 2CGEA 3PYEA 5LMUI 2UXDE 4HY1A 2GO3A 2BA1G 1N0UA 4DV7E 4P52A 3LTOA 4IZKA 4OX9E 1FJGI 4LFCE 2IOQA 4B3RI 2DEJA 4MQYA 3T1YI 1XXEA 4IFDE 4DPUA 4FWDA 4DV3E 4KHPE 1UDQA 4LFBE 4JI5E 4DR1I 4IFDC 1P42A 2CVEA 3J80C 3B8HA 2NN6B 3Q1QA 4DUZI 4AIMA 2VESA 3T1HI 4B3TI 2X36A 4GKKE 3L7ZA 2UUAI 4OO1B 3PYGA 1XMOI 2WW4A 1MX0A 4QNJA 4X64I 4DPTA 4B3ME 4JYAI 4LF9I 1Z59A 1J5EE 1Z0GA 2C37A 3J81C 4IZKB 1Y5YA 1KKHA 2JE6A 3J80Q 5LMNE 4B3SI 4JI1E 5DRPA 4NBQA 5DRRA 4WUDA 2VQFE 2F4VI 1IBKE 2UXBI 3P76A 2NN6E 5GMDA 1RR9A 2UU9I 2C38A 4FW6A 2BR2A 4DV0E 4JI2E 4OO1E 2O1VA 3WU6A 3U1YA 4DR5E 1ZXNA 4LF7E 3J81Q 1YH8A 4J3DA 1XNRE 4DUYI 1N33I 3L7ZB 2PO2A 4DPXA 4DR6I 4DR7I 4MYTA 5K36F 2AJ4A 4IS9A 4OO1C 1H7UA 4LFAE 3HKMA 3K17A 3CDIA 4UTGA 2NPFA 3ZZ0A 2C37B 2VQEE 2JE6B 4JV5E 1FNMA 1N32E 1PIEA 2ZM6E 2VF3A 1HNXE 2PO0A 1FWKA 5JEAD 4DXLA 1I94E 4HXZA 4JI4E 2C38B 2C39A 3P3CA 2BR2B 1FWLA 3KRNA 4U3DA 4HYMA 1HNZE 2R42A 1H72C 2A2DA 4YY3E 5FWKA 4BA1A 4I3HA 2HKJA 5BR8I 4JI8I 4LF5E 4IFDF 2Z5EA 2PO2B 3B82A 4ISAA 3M7NG 1HNWI 3ZM7A 5LMUE 1ZM4A 2AE8A 4DPYA 4WUCA 4MU4A 3UHMA 5IT9Q 2O1WA 4MYUA 4B3RE 2V8PA 4FN5A 3T1YE 1PVGA 4FW3A 2ZBKB 2PO0B 4OKGA 1N34I 1KVKA 2PNLA 2C39B 1BKNA 3DD6A 1NHIA 4USKA 4DR1E 3H4LA 4DR2I 4BA1B 4DUZE 1XMQI 1Y4SA 2CG9A 3T1HE 2EFGA 3Q6NA 1UEKA 4B3TE 3F0NA 1Y60A 2UUAE 3PS2A 2NN6F 1Z0VA 3QT7A 2JEBA 5DNXA 5IWAE 1XMOE 4X64E 5LL6R 4Z7YA 2IERA 5DROA 2UUCI 4JI3I 2PNMA 3QT8A 4LF9E 1ZM9A 4OO1F 1S16A 3P3GA 4JI6I 4RPFA 4WUBA 2JEAA 2LJPA 2F4VE 3GMEA 2UXBE 2V2ZA 4PRXA 1Z5BA 2UU9E 2E5LI 2V2QA 4K0KE 3ZZTA 4OZEA 4P7AA 3V5RA 3OTOI 1HR0I 4X66I 3P3EA 1N33E 4DUYE 4IZJD 1ZM3A 4DR6E 4DR7E 2JEBB 5GMEA 4DV2I 1UDNA 4IZJA 4LFCI 4LF6I 1A6FA 1MG7A 5K36D 3J7AM 1KTVA 3ZZUA 1IBMI 2BM1A 2JEAB 4JI0I 4QNKA 1Y6ZA 4X62I 1H7SA 2PO1A 4KQVA 2UXCI 5A2QC 2BA0D 2F1DA 4FWHA 4FW9A 2PNZA 1FKAE 4LF4I 2BA0G 5BR8E 4JI8E 2V2VA 3M85D 2HK2A 4MDTA 2BM0A 3CDJA 5C0XD 4DV5I 2HK3A 1HNWE 3PYFA 1Z0WA 1MU5A 2Q2EB 4IZJB 3B78A 1OJ4A 3K85A 2JT2A 5C0XA 5A2QQ 4USMA 3PS3A 5IT9C 4M1KA 4GKJI 5JEAA 1N36I 1FI4A 3U1KA 4AQYI 2PO1B 1N34E 3QT5A 3J7AG 1HK7A 4HACA 2ZITA 4XTJA 3M6AA 4DR2E 2PNZB 4DU8A 3GONA 1XMQE 4JI7I 3WU5A 1EI1A 5DNLA 3WU3A 1FJGE 2O3ZA 3CWVA 1OYSA 4LF8I 2GO4A 1VI7A 1B63A 1R6LA 2UUCE 2HFSA 3JAMC 4NXNI 1IBLI 3PRYA 4MU1A 5C0XB 4BA2A 1S4EA 4R1FA 4JI6E 2HHHI 4DU7A 2IESA 5JEAB 4FWGA 4GQUA 4DV4I 1RREA 1XNQI 4DR4I 2NN6D 2OI2A 1R6MA 1E3HA 4HACB 1KIJA 5K36C 5ELWA 4YY3I 4EMDA 1K47A 1B62A 2E5LE 3JAMQ 4YHHI 4JYAE 2Z5CA 1H73A 1H74A 3D4JA 5DRQA 4X65I 4AM3A 1HR0E 2WNRA 4X66E 3PYDA 4DV6I 1QZRA 2HKEA 5EL9A 1Z0EA 4B3SE 4NXMI 1RHYA 4DV1I 4DPWA 5C0XE 4DV2E 3P06A 3QT6A 5JEAE 1Z5CA 2Z5BA 3HJCA 5C0XC 2UUBI 4BA2B 4DR3I 4LF6E 1ELOA 3NZKA 4LCHA 5JEAC 1Y4UA 1IBME 4LCFA 4JI0E 3GLLA 2XEXA 3LPSA 4X62E 4LPFA 4MU3A 1USUA 2UXCE 2UXDI 3HULA 1Z0TA 1YHCA 4JG4A 4U3BA 3V2UC 4DV7I 2GQ0A 2Z5CB 1VISA 5L3JA 1PKPA 4LF4E 4OX9I 2WNRB 4MU0A 5IWAI 4DV5E 1ZXMA 4DV3I 4KHPI 4LFBI 4N3OA 1NHHA 4JI5I 3K1JA 2Z5BB 5K36A 4ED4A 5FLXC 3PS1A 1XHKA 4AIDA 4GKJE 4GKKI 1N36E 3WU4A 4AQYE 4K0KI 4B3MI 1UDOA 2NN6C 3M85G 1J5EI 2CZ9A 2J65A 5LMNI 4JI7E 2BV3A 4JI1I 2E1RA 1OYPA
chains in the Genus database with same CATH topology
4URLA 1N0VC 1Z0CA 2IOPA 5FLXQ 2VQFI 4LF8E 1IBKI 3ZKDA 2O1TA 1ZM2A 4NXNE 1IBLE 2HFUA 2R3VA 4DV0I 4JI2I 4DR5I 1NHJA 2HHHE 4LF7I 1XNRI 4DV4E 2GS8A 1XNQE 4DR4E 2A2CA 1Z5AA 4Z7CA 4LFAI 3Q6MA 2J7KA 1U2RA 4YHHE 2VQEI 4JI3E 1USVA 4JV5I 1EA6A 2DEIA 2V34A 4X65E 1Z0BA 1D6TA 1N32I 4DV6E 2ZM6I 1HNXI 4NXME 4DV1E 1I94I 4PRVA 4JI4I 3LNUA 4UT4A 4ZVIA 1HNZI 4PU9A 3ZKBA 1WUUA 2UUBE 4DR3E 4LF5I 2O1UA 2X7IA 3OTOE 1NZ0A 1DARA 2CGEA 3PYEA 5LMUI 2UXDE 4HY1A 1N0UA 4DV7E 4P52A 3LTOA 4IZKA 4OX9E 1FJGI 4LFCE 2IOQA 4B3RI 2DEJA 3T1YI 4DPUA 4FWDA 4DV3E 4KHPE 4LFBE 4JI5E 4DR1I 3J80C 3B8HA 3Q1QA 4DUZI 3T1HI 4B3TI 2X36A 4GKKE 2UUAI 3PYGA 1XMOI 2WW4A 1MX0A 4X64I 4B3ME 4DPTA 4JYAI 4LF9I 1Z59A 1J5EE 1Z0GA 3J81C 4IZKB 1KKHA 3J80Q 5LMNE 4B3SI 4JI1E 4WUDA 2VQFE 2F4VI 1IBKE 2UXBI 5GMDA 1RR9A 2UU9I 4DV0E 4JI2E 2O1VA 3WU6A 4DR5E 1ZXNA 4LF7E 3J81Q 1XNRE 1N33I 4DUYI 4DPXA 4DR6I 4DR7I 4MYTA 2AJ4A 1H7UA 4LFAE 3K17A 3ZZ0A 4UTGA 2NPFA 2VQEE 4JV5E 1FNMA 1N32E 1PIEA 2ZM6E 2VF3A 1HNXE 1FWKA 4DXLA 1I94E 4HXZA 4JI4E 1FWLA 4HYMA 1HNZE 2R42A 1H72C 2A2DA 4YY3E 5FWKA 4I3HA 2HKJA 5BR8I 4JI8I 4LF5E 2Z5EA 3B82A 1HNWI 3ZM7A 5LMUE 1ZM4A 4DPYA 4WUCA 5IT9Q 2O1WA 4MYUA 4B3RE 2V8PA 4FN5A 3T1YE 1PVGA 2ZBKB 1N34I 1KVKA 2PNLA 1BKNA 1NHIA 4USKA 4DR1E 3H4LA 4DR2I 4DUZE 1XMQI 1Y4SA 2CG9A 3T1HE 2EFGA 3Q6NA 1UEKA 4B3TE 3F0NA 2UUAE 1Z0VA 3QT7A 5IWAE 1XMOE 4X64E 5LL6R 4Z7YA 2UUCI 4JI3I 3QT8A 2PNMA 4LF9E 1ZM9A 1S16A 4JI6I 4RPFA 4WUBA 2LJPA 2F4VE 2UXBE 2V2ZA 4PRXA 1Z5BA 2UU9E 2E5LI 2V2QA 4K0KE 3ZZTA 4P7AA 3V5RA 3OTOI 1HR0I 4X66I 1N33E 4DUYE 4IZJD 1ZM3A 4DR6E 4DR7E 5GMEA 4DV2I 4IZJA 4LFCI 4LF6I 1A6FA 1MG7A 3J7AM 1KTVA 3ZZUA 1IBMI 2BM1A 4JI0I 1Y6ZA 4X62I 1H7SA 4KQVA 2UXCI 5A2QC 4FWHA 4FW9A 1FKAE 4LF4I 5BR8E 4JI8E 2V2VA 2HK2A 2BM0A 4DV5I 2HK3A 1HNWE 3PYFA 1Z0WA 1MU5A 2Q2EB 4IZJB 3B78A 1OJ4A 3K85A 5A2QQ 4USMA 5IT9C 4M1KA 4GKJI 1N36I 1FI4A 4AQYI 1N34E 3QT5A 3J7AG 1HK7A 4HACA 2ZITA 4XTJA 3M6AA 4DR2E 4DU8A 3GONA 1XMQE 4JI7I 3WU5A 1EI1A 3WU3A 1FJGE 3CWVA 4LF8I 1B63A 2UUCE 2HFSA 3JAMC 4NXNI 1IBLI 3PRYA 1S4EA 4R1FA 4JI6E 2HHHI 4DU7A 4FWGA 4DV4I 1RREA 1XNQI 4DR4I 2OI2A 4HACB 1KIJA 4YY3I 4EMDA 1K47A 1B62A 2E5LE 3JAMQ 4YHHI 4JYAE 2Z5CA 1H73A 1H74A 3D4JA 4X65I 1HR0E 4X66E 3PYDA 4DV6I 1QZRA 2HKEA 1Z0EA 4B3SE 4NXMI 4DV1I 4DPWA 4DV2E 3P06A 3QT6A 1Z5CA 2Z5BA 3HJCA 2UUBI 4DR3I 4LF6E 1ELOA 1Y4UA 1IBME 4JI0E 2XEXA 3LPSA 4X62E 1USUA 2UXCE 2UXDI 3HULA 1Z0TA 4JG4A 3V2UC 4DV7I 2GQ0A 2Z5CB 1VISA 5L3JA 1PKPA 4LF4E 4OX9I 5IWAI 4DV5E 1ZXMA 4DV3I 4KHPI 4LFBI 4N3OA 1NHHA 4JI5I 3K1JA 2Z5BB 4ED4A 5FLXC 1XHKA 4GKJE 4GKKI 1N36E 3WU4A 4AQYE 4K0KI 4B3MI 1J5EI 2CZ9A 5LMNI 4JI7E 2BV3A 4JI1I 2E1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4URL A;  1N0V C;  1Z0C A;  5FLX Q;  2VQF I;  4LF8 E;  1IBK I;  3ZKD A;  1ZM2 A;  4NXN E;  1IBL E;  2HFU A;  2R3V A;  4DV0 I;  4JI2 I;  4DR5 I;  1NHJ A;  2HHH E;  4LF7 I;  1XNR I;  4DV4 E;  2GS8 A;  1XNQ E;  4DR4 E;  2A2C A;  1Z5A A;  4Z7C A;  4LFA I;  2J7K A;  1U2R A;  4YHH E;  2VQE I;  4JI3 E;  4JV5 I;  1EA6 A;  2DEI A;  2V34 A;  4X65 E;  1Z0B A;  1D6T A;  1N32 I;  4DV6 E;  2ZM6 I;  1HNX I;  4NXM E;  4DV1 E;  1I94 I;  4PRV A;  4JI4 I;  3LNU A;  4UT4 A;  4ZVI A;  1HNZ I;  4PU9 A;  3ZKB A;  1WUU A;  2UUB E;  4DR3 E;  4LF5 I;  2X7I A;  3OTO E;  1NZ0 A;  1DAR A;  3PYE A;  5LMU I;  2UXD E;  4HY1 A;  1N0U A;  4DV7 E;  4P52 A;  3LTO A;  4OX9 E;  1FJG I;  4LFC E;  4B3R I;  2DEJ A;  3T1Y I;  4DPU A;  4FWD A;  4DV3 E;  4KHP E;  4LFB E;  4JI5 E;  4DR1 I;  3J80 C;  3B8H A;  3Q1Q A;  4DUZ I;  3T1H I;  4B3T I;  2X36 A;  4GKK E;  2UUA I;  3PYG A;  1XMO I;  2WW4 A;  1MX0 A;  4X64 I;  4B3M E;  4DPT A;  4JYA I;  4LF9 I;  1Z59 A;  1J5E E;  1Z0G A;  3J81 C;  1KKH A;  3J80 Q;  5LMN E;  4B3S I;  4JI1 E;  4WUD A;  2VQF E;  2F4V I;  1IBK E;  2UXB I;  5GMD A;  1RR9 A;  2UU9 I;  4DV0 E;  4JI2 E;  3WU6 A;  4DR5 E;  1ZXN A;  4LF7 E;  3J81 Q;  1XNR E;  1N33 I;  4DUY I;  4DPX A;  4DR6 I;  4DR7 I;  4MYT A;  2AJ4 A;  1H7U A;  4LFA E;  3K17 A;  3ZZ0 A;  4UTG A;  2NPF A;  2VQE E;  4JV5 E;  1FNM A;  1N32 E;  1PIE A;  2ZM6 E;  2VF3 A;  1HNX E;  1FWK A;  4DXL A;  1I94 E;  4HXZ A;  4JI4 E;  1FWL A;  4HYM A;  1HNZ E;  2R42 A;  1H72 C;  2A2D A;  4YY3 E;  4I3H A;  2HKJ A;  5BR8 I;  4JI8 I;  4LF5 E;  3B82 A;  1HNW I;  3ZM7 A;  5LMU E;  1ZM4 A;  4DPY A;  4WUC A;  5IT9 Q;  4MYU A;  4B3R E;  2V8P A;  4FN5 A;  3T1Y E;  1PVG A;  2ZBK B;  1N34 I;  1KVK A;  1BKN A;  1NHI A;  4USK A;  4DR1 E;  3H4L A;  4DR2 I;  4DUZ E;  1XMQ I;  3T1H E;  2EFG A;  4B3T E;  1UEK A;  3F0N A;  2UUA E;  1Z0V A;  3QT7 A;  5IWA E;  1XMO E;  4X64 E;  2UUC I;  4Z7Y A;  5LL6 R;  4JI3 I;  3QT8 A;  4LF9 E;  1ZM9 A;  1S16 A;  4JI6 I;  4RPF A;  4WUB A;  2LJP A;  2F4V E;  2UXB E;  2V2Z A;  4PRX A;  1Z5B A;  2UU9 E;  2E5L I;  2V2Q A;  4K0K E;  3ZZT A;  4P7A A;  3V5R A;  3OTO I;  1HR0 I;  4X66 I;  1N33 E;  4DUY E;  1ZM3 A;  4DR6 E;  4DR7 E;  5GME A;  4DV2 I;  4LFC I;  4LF6 I;  1A6F A;  1MG7 A;  3J7A M;  1KTV A;  3ZZU A;  1IBM I;  2BM1 A;  4JI0 I;  4X62 I;  1H7S A;  4KQV A;  2UXC I;  5A2Q C;  4FWH A;  4FW9 A;  1FKA E;  4LF4 I;  5BR8 E;  4JI8 E;  2V2V A;  2HK2 A;  2BM0 A;  4DV5 I;  2HK3 A;  1HNW E;  3PYF A;  1Z0W A;  1MU5 A;  2Q2E B;  3B78 A;  1OJ4 A;  5A2Q Q;  4USM A;  5IT9 C;  4M1K A;  4GKJ I;  1N36 I;  1FI4 A;  4AQY I;  1N34 E;  3QT5 A;  3J7A G;  4HAC A;  2ZIT A;  4XTJ A;  3M6A A;  4DR2 E;  4DU8 A;  3GON A;  1XMQ E;  4JI7 I;  3WU5 A;  1EI1 A;  3WU3 A;  1FJG E;  3CWV A;  4LF8 I;  1B63 A;  2UUC E;  2HFS A;  3JAM C;  4NXN I;  1IBL I;  1S4E A;  4R1F A;  4JI6 E;  2HHH I;  4DU7 A;  4FWG A;  4DV4 I;  1RRE A;  1XNQ I;  4DR4 I;  2OI2 A;  4HAC B;  1KIJ A;  4YY3 I;  4EMD A;  1K47 A;  1B62 A;  2E5L E;  3JAM Q;  4YHH I;  4JYA E;  1H73 A;  1H74 A;  3D4J A;  4X65 I;  1HR0 E;  4X66 E;  3PYD A;  4DV6 I;  1QZR A;  2HKE A;  1Z0E A;  4B3S E;  4NXM I;  4DV1 I;  4DPW A;  4DV2 E;  3QT6 A;  1Z5C A;  2UUB I;  4DR3 I;  4LF6 E;  1ELO A;  1IBM E;  4JI0 E;  2XEX A;  3LPS A;  4X62 E;  2UXC E;  2UXD I;  3HUL A;  1Z0T A;  4JG4 A;  3V2U C;  4DV7 I;  1VIS A;  5L3J A;  1PKP A;  4LF4 E;  4OX9 I;  5IWA I;  4DV5 E;  1ZXM A;  4DV3 I;  4KHP I;  4LFB I;  1NHH A;  4JI5 I;  3K1J A;  4ED4 A;  5FLX C;  1XHK A;  4GKJ E;  4GKK I;  1N36 E;  3WU4 A;  4AQY E;  4K0K I;  4B3M I;  1J5E I;  2CZ9 A;  5LMN I;  4JI7 E;  2BV3 A;  4JI1 I;  2E1R A; 
#chains in the Genus database with same CATH topology
 4URL A;  1N0V C;  1Z0C A;  2IOP A;  5FLX Q;  4IFD D;  2VQF I;  4FW5 A;  4LF8 E;  1IBK I;  1E3P A;  3B4T A;  3ZKD A;  2O1T A;  1ZM2 A;  4NXN E;  1IBL E;  2HFU A;  2R3V A;  4IFD A;  5K36 B;  4DV0 I;  4JI2 I;  4DR5 I;  1NHJ A;  2HHH E;  4LF7 I;  1XNR I;  4DV4 E;  2GS8 A;  1XNQ E;  4DR4 E;  3GCM A;  2A2C A;  5C0X F;  2WP8 A;  1UDS A;  1Z5A A;  4FW7 A;  4Z7C A;  4LFA I;  3Q6M A;  5JEA F;  2J7K A;  1U2R A;  4YHH E;  2VQE I;  4JI3 E;  1USV A;  3M7N D;  4JV5 I;  1EA6 A;  2DEI A;  2V34 A;  4X65 E;  1Z0B A;  1D6T A;  5EKW A;  1N32 I;  4DV6 E;  2ZM6 I;  1HNX I;  4NXM E;  5K36 E;  4DV1 E;  1I94 I;  3H1C A;  4PRV A;  4JI4 I;  3LNU A;  4UT4 A;  4IFD B;  4ZVI A;  1HNZ I;  4LOM A;  4PU9 A;  3ZKB A;  4OO1 D;  1WUU A;  4LCG A;  2UUB E;  4DR3 E;  2NN6 A;  4LF5 I;  4FW4 A;  2O1U A;  2X7I A;  2WP8 B;  3OTO E;  1NZ0 A;  4OO1 A;  1DAR A;  1OYR A;  2BA1 D;  2CGE A;  3PYE A;  5LMU I;  2UXD E;  4HY1 A;  2GO3 A;  2BA1 G;  1N0U A;  4DV7 E;  4P52 A;  3LTO A;  4IZK A;  4OX9 E;  1FJG I;  4LFC E;  2IOQ A;  4B3R I;  2DEJ A;  4MQY A;  3T1Y I;  1XXE A;  4IFD E;  4DPU A;  4FWD A;  4DV3 E;  4KHP E;  1UDQ A;  4LFB E;  4JI5 E;  4DR1 I;  4IFD C;  1P42 A;  2CVE A;  3J80 C;  3B8H A;  2NN6 B;  3Q1Q A;  4DUZ I;  4AIM A;  2VES A;  3T1H I;  4B3T I;  2X36 A;  4GKK E;  3L7Z A;  2UUA I;  4OO1 B;  3PYG A;  1XMO I;  2WW4 A;  1MX0 A;  4QNJ A;  4X64 I;  4DPT A;  4B3M E;  4JYA I;  4LF9 I;  1Z59 A;  1J5E E;  1Z0G A;  2C37 A;  3J81 C;  4IZK B;  1Y5Y A;  1KKH A;  2JE6 A;  3J80 Q;  5LMN E;  4B3S I;  4JI1 E;  5DRP A;  4NBQ A;  5DRR A;  4WUD A;  2VQF E;  2F4V I;  1IBK E;  2UXB I;  3P76 A;  2NN6 E;  5GMD A;  1RR9 A;  2UU9 I;  2C38 A;  4FW6 A;  2BR2 A;  4DV0 E;  4JI2 E;  4OO1 E;  2O1V A;  3WU6 A;  3U1Y A;  4DR5 E;  1ZXN A;  4LF7 E;  3J81 Q;  1YH8 A;  4J3D A;  1XNR E;  4DUY I;  1N33 I;  3L7Z B;  2PO2 A;  4DPX A;  4DR6 I;  4DR7 I;  4MYT A;  5K36 F;  2AJ4 A;  4IS9 A;  4OO1 C;  1H7U A;  4LFA E;  3HKM A;  3K17 A;  3CDI A;  4UTG A;  2NPF A;  3ZZ0 A;  2C37 B;  2VQE E;  2JE6 B;  4JV5 E;  1FNM A;  1N32 E;  1PIE A;  2ZM6 E;  2VF3 A;  1HNX E;  2PO0 A;  1FWK A;  5JEA D;  4DXL A;  1I94 E;  4HXZ A;  4JI4 E;  2C38 B;  2C39 A;  3P3C A;  2BR2 B;  1FWL A;  3KRN A;  4U3D A;  4HYM A;  1HNZ E;  2R42 A;  1H72 C;  2A2D A;  4YY3 E;  5FWK A;  4BA1 A;  4I3H A;  2HKJ A;  5BR8 I;  4JI8 I;  4LF5 E;  4IFD F;  2Z5E A;  2PO2 B;  3B82 A;  4ISA A;  3M7N G;  1HNW I;  3ZM7 A;  5LMU E;  1ZM4 A;  2AE8 A;  4DPY A;  4WUC A;  4MU4 A;  3UHM A;  5IT9 Q;  2O1W A;  4MYU A;  4B3R E;  2V8P A;  4FN5 A;  3T1Y E;  1PVG A;  4FW3 A;  2ZBK B;  2PO0 B;  4OKG A;  1N34 I;  1KVK A;  2PNL A;  2C39 B;  1BKN A;  3DD6 A;  1NHI A;  4USK A;  4DR1 E;  3H4L A;  4DR2 I;  4BA1 B;  4DUZ E;  1XMQ I;  1Y4S A;  2CG9 A;  3T1H E;  2EFG A;  3Q6N A;  1UEK A;  4B3T E;  3F0N A;  1Y60 A;  2UUA E;  3PS2 A;  2NN6 F;  1Z0V A;  3QT7 A;  2JEB A;  5DNX A;  5IWA E;  1XMO E;  4X64 E;  5LL6 R;  4Z7Y A;  2IER A;  5DRO A;  2UUC I;  4JI3 I;  2PNM A;  3QT8 A;  4LF9 E;  1ZM9 A;  4OO1 F;  1S16 A;  3P3G A;  4JI6 I;  4RPF A;  4WUB A;  2JEA A;  2LJP A;  2F4V E;  3GME A;  2UXB E;  2V2Z A;  4PRX A;  1Z5B A;  2UU9 E;  2E5L I;  2V2Q A;  4K0K E;  3ZZT A;  4OZE A;  4P7A A;  3V5R A;  3OTO I;  1HR0 I;  4X66 I;  3P3E A;  1N33 E;  4DUY E;  4IZJ D;  1ZM3 A;  4DR6 E;  4DR7 E;  2JEB B;  5GME A;  4DV2 I;  1UDN A;  4IZJ A;  4LFC I;  4LF6 I;  1A6F A;  1MG7 A;  5K36 D;  3J7A M;  1KTV A;  3ZZU A;  1IBM I;  2BM1 A;  2JEA B;  4JI0 I;  4QNK A;  1Y6Z A;  4X62 I;  1H7S A;  2PO1 A;  4KQV A;  2UXC I;  5A2Q C;  2BA0 D;  2F1D A;  4FWH A;  4FW9 A;  2PNZ A;  1FKA E;  4LF4 I;  2BA0 G;  5BR8 E;  4JI8 E;  2V2V A;  3M85 D;  2HK2 A;  4MDT A;  2BM0 A;  3CDJ A;  5C0X D;  4DV5 I;  2HK3 A;  1HNW E;  3PYF A;  1Z0W A;  1MU5 A;  2Q2E B;  4IZJ B;  3B78 A;  1OJ4 A;  3K85 A;  2JT2 A;  5C0X A;  5A2Q Q;  4USM A;  3PS3 A;  5IT9 C;  4M1K A;  4GKJ I;  5JEA A;  1N36 I;  1FI4 A;  3U1K A;  4AQY I;  2PO1 B;  1N34 E;  3QT5 A;  3J7A G;  1HK7 A;  4HAC A;  2ZIT A;  4XTJ A;  3M6A A;  4DR2 E;  2PNZ B;  4DU8 A;  3GON A;  1XMQ E;  4JI7 I;  3WU5 A;  1EI1 A;  5DNL A;  3WU3 A;  1FJG E;  2O3Z A;  3CWV A;  1OYS A;  4LF8 I;  2GO4 A;  1VI7 A;  1B63 A;  1R6L A;  2UUC E;  2HFS A;  3JAM C;  4NXN I;  1IBL I;  3PRY A;  4MU1 A;  5C0X B;  4BA2 A;  1S4E A;  4R1F A;  4JI6 E;  2HHH I;  4DU7 A;  2IES A;  5JEA B;  4FWG A;  4GQU A;  4DV4 I;  1RRE A;  1XNQ I;  4DR4 I;  2NN6 D;  2OI2 A;  1R6M A;  1E3H A;  4HAC B;  1KIJ A;  5K36 C;  5ELW A;  4YY3 I;  4EMD A;  1K47 A;  1B62 A;  2E5L E;  3JAM Q;  4YHH I;  4JYA E;  2Z5C A;  1H73 A;  1H74 A;  3D4J A;  5DRQ A;  4X65 I;  4AM3 A;  1HR0 E;  2WNR A;  4X66 E;  3PYD A;  4DV6 I;  1QZR A;  2HKE A;  5EL9 A;  1Z0E A;  4B3S E;  4NXM I;  1RHY A;  4DV1 I;  4DPW A;  5C0X E;  4DV2 E;  3P06 A;  3QT6 A;  5JEA E;  1Z5C A;  2Z5B A;  3HJC A;  5C0X C;  2UUB I;  4BA2 B;  4DR3 I;  4LF6 E;  1ELO A;  3NZK A;  4LCH A;  5JEA C;  1Y4U A;  1IBM E;  4LCF A;  4JI0 E;  3GLL A;  2XEX A;  3LPS A;  4X62 E;  4LPF A;  4MU3 A;  1USU A;  2UXC E;  2UXD I;  3HUL A;  1Z0T A;  1YHC A;  4JG4 A;  4U3B A;  3V2U C;  4DV7 I;  2GQ0 A;  2Z5C B;  1VIS A;  5L3J A;  1PKP A;  4LF4 E;  4OX9 I;  2WNR B;  4MU0 A;  5IWA I;  4DV5 E;  1ZXM A;  4DV3 I;  4KHP I;  4LFB I;  4N3O A;  1NHH A;  4JI5 I;  3K1J A;  2Z5B B;  5K36 A;  4ED4 A;  5FLX C;  3PS1 A;  1XHK A;  4AID A;  4GKJ E;  4GKK I;  1N36 E;  3WU4 A;  4AQY E;  4K0K I;  4B3M I;  1UDO A;  2NN6 C;  3M85 G;  1J5E I;  2CZ9 A;  2J65 A;  5LMN I;  4JI7 E;  2BV3 A;  4JI1 I;  2E1R A;  1OYP A; 
#chains in the Genus database with same CATH homology
 4URL A;  1N0V C;  1Z0C A;  2IOP A;  5FLX Q;  2VQF I;  4LF8 E;  1IBK I;  3ZKD A;  2O1T A;  1ZM2 A;  4NXN E;  1IBL E;  2HFU A;  2R3V A;  4DV0 I;  4JI2 I;  4DR5 I;  1NHJ A;  2HHH E;  4LF7 I;  1XNR I;  4DV4 E;  2GS8 A;  1XNQ E;  4DR4 E;  2A2C A;  1Z5A A;  4Z7C A;  4LFA I;  3Q6M A;  2J7K A;  1U2R A;  4YHH E;  2VQE I;  4JI3 E;  1USV A;  4JV5 I;  1EA6 A;  2DEI A;  2V34 A;  4X65 E;  1Z0B A;  1D6T A;  1N32 I;  4DV6 E;  2ZM6 I;  1HNX I;  4NXM E;  4DV1 E;  1I94 I;  4PRV A;  4JI4 I;  3LNU A;  4UT4 A;  4ZVI A;  1HNZ I;  4PU9 A;  3ZKB A;  1WUU A;  2UUB E;  4DR3 E;  4LF5 I;  2O1U A;  2X7I A;  3OTO E;  1NZ0 A;  1DAR A;  2CGE A;  3PYE A;  5LMU I;  2UXD E;  4HY1 A;  1N0U A;  4DV7 E;  4P52 A;  3LTO A;  4IZK A;  4OX9 E;  1FJG I;  4LFC E;  2IOQ A;  4B3R I;  2DEJ A;  3T1Y I;  4DPU A;  4FWD A;  4DV3 E;  4KHP E;  4LFB E;  4JI5 E;  4DR1 I;  3J80 C;  3B8H A;  3Q1Q A;  4DUZ I;  3T1H I;  4B3T I;  2X36 A;  4GKK E;  2UUA I;  3PYG A;  1XMO I;  2WW4 A;  1MX0 A;  4X64 I;  4B3M E;  4DPT A;  4JYA I;  4LF9 I;  1Z59 A;  1J5E E;  1Z0G A;  3J81 C;  4IZK B;  1KKH A;  3J80 Q;  5LMN E;  4B3S I;  4JI1 E;  4WUD A;  2VQF E;  2F4V I;  1IBK E;  2UXB I;  5GMD A;  1RR9 A;  2UU9 I;  4DV0 E;  4JI2 E;  2O1V A;  3WU6 A;  4DR5 E;  1ZXN A;  4LF7 E;  3J81 Q;  1XNR E;  1N33 I;  4DUY I;  4DPX A;  4DR6 I;  4DR7 I;  4MYT A;  2AJ4 A;  1H7U A;  4LFA E;  3K17 A;  3ZZ0 A;  4UTG A;  2NPF A;  2VQE E;  4JV5 E;  1FNM A;  1N32 E;  1PIE A;  2ZM6 E;  2VF3 A;  1HNX E;  1FWK A;  4DXL A;  1I94 E;  4HXZ A;  4JI4 E;  1FWL A;  4HYM A;  1HNZ E;  2R42 A;  1H72 C;  2A2D A;  4YY3 E;  5FWK A;  4I3H A;  2HKJ A;  5BR8 I;  4JI8 I;  4LF5 E;  2Z5E A;  3B82 A;  1HNW I;  3ZM7 A;  5LMU E;  1ZM4 A;  4DPY A;  4WUC A;  5IT9 Q;  2O1W A;  4MYU A;  4B3R E;  2V8P A;  4FN5 A;  3T1Y E;  1PVG A;  2ZBK B;  1N34 I;  1KVK A;  2PNL A;  1BKN A;  1NHI A;  4USK A;  4DR1 E;  3H4L A;  4DR2 I;  4DUZ E;  1XMQ I;  1Y4S A;  2CG9 A;  3T1H E;  2EFG A;  3Q6N A;  1UEK A;  4B3T E;  3F0N A;  2UUA E;  1Z0V A;  3QT7 A;  5IWA E;  1XMO E;  4X64 E;  5LL6 R;  4Z7Y A;  2UUC I;  4JI3 I;  3QT8 A;  2PNM A;  4LF9 E;  1ZM9 A;  1S16 A;  4JI6 I;  4RPF A;  4WUB A;  2LJP A;  2F4V E;  2UXB E;  2V2Z A;  4PRX A;  1Z5B A;  2UU9 E;  2E5L I;  2V2Q A;  4K0K E;  3ZZT A;  4P7A A;  3V5R A;  3OTO I;  1HR0 I;  4X66 I;  1N33 E;  4DUY E;  4IZJ D;  1ZM3 A;  4DR6 E;  4DR7 E;  5GME A;  4DV2 I;  4IZJ A;  4LFC I;  4LF6 I;  1A6F A;  1MG7 A;  3J7A M;  1KTV A;  3ZZU A;  1IBM I;  2BM1 A;  4JI0 I;  1Y6Z A;  4X62 I;  1H7S A;  4KQV A;  2UXC I;  5A2Q C;  4FWH A;  4FW9 A;  1FKA E;  4LF4 I;  5BR8 E;  4JI8 E;  2V2V A;  2HK2 A;  2BM0 A;  4DV5 I;  2HK3 A;  1HNW E;  3PYF A;  1Z0W A;  1MU5 A;  2Q2E B;  4IZJ B;  3B78 A;  1OJ4 A;  3K85 A;  5A2Q Q;  4USM A;  5IT9 C;  4M1K A;  4GKJ I;  1N36 I;  1FI4 A;  4AQY I;  1N34 E;  3QT5 A;  3J7A G;  1HK7 A;  4HAC A;  2ZIT A;  4XTJ A;  3M6A A;  4DR2 E;  4DU8 A;  3GON A;  1XMQ E;  4JI7 I;  3WU5 A;  1EI1 A;  3WU3 A;  1FJG E;  3CWV A;  4LF8 I;  1B63 A;  2UUC E;  2HFS A;  3JAM C;  4NXN I;  1IBL I;  3PRY A;  1S4E A;  4R1F A;  4JI6 E;  2HHH I;  4DU7 A;  4FWG A;  4DV4 I;  1RRE A;  1XNQ I;  4DR4 I;  2OI2 A;  4HAC B;  1KIJ A;  4YY3 I;  4EMD A;  1K47 A;  1B62 A;  2E5L E;  3JAM Q;  4YHH I;  4JYA E;  2Z5C A;  1H73 A;  1H74 A;  3D4J A;  4X65 I;  1HR0 E;  4X66 E;  3PYD A;  4DV6 I;  1QZR A;  2HKE A;  1Z0E A;  4B3S E;  4NXM I;  4DV1 I;  4DPW A;  4DV2 E;  3P06 A;  3QT6 A;  1Z5C A;  2Z5B A;  3HJC A;  2UUB I;  4DR3 I;  4LF6 E;  1ELO A;  1Y4U A;  1IBM E;  4JI0 E;  2XEX A;  3LPS A;  4X62 E;  1USU A;  2UXC E;  2UXD I;  3HUL A;  1Z0T A;  4JG4 A;  3V2U C;  4DV7 I;  2GQ0 A;  2Z5C B;  1VIS A;  5L3J A;  1PKP A;  4LF4 E;  4OX9 I;  5IWA I;  4DV5 E;  1ZXM A;  4DV3 I;  4KHP I;  4LFB I;  4N3O A;  1NHH A;  4JI5 I;  3K1J A;  2Z5B B;  4ED4 A;  5FLX C;  1XHK A;  4GKJ E;  4GKK I;  1N36 E;  3WU4 A;  4AQY E;  4K0K I;  4B3M I;  1J5E I;  2CZ9 A;  5LMN I;  4JI7 E;  2BV3 A;  4JI1 I;  2E1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...