1Z0GA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 56
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0gA00
3V5RA 1I94I 2GS8A 4DR4I 1KKHA 1VISA 2ZM6E 1N0VC 4LFAI 4DPUA 2NPFA 1H72C 1FJGI 4RPFA 2ZITA 3QT7A 3WU3A 1IBKE 5LMUE 4JI8I 2VQFE 4DV0I 1N32E 4PU9A 1KVKA 4JI7E 2VQEI 2HK2A 2UXBE 4Z7YA 1PIEA 2E5LI 4DV7E 2UU9E 3WU5A 4DV5E 1Z5BA 1Z5CA 4JYAE 4USKA 2ZM6I 1RREA 5IWAE 4M1KA 4WUCA 4X62E 3QT6A 2VQFI 4GKJE 1N32I 4JV5E 1H7SA 1KTVA 1NHJA 4JI7I 3HULA 2HKJA 1ZM4A 2UXBI 2XEXA 3T1YE 1FKAE 1N36E 2UU9I 3QT8A 4AQYE 4MYTA 4DV5I 4JI5E 4LF8E 3JAMQ 4JYAI 1XHKA 1XMOE 5GMEA 5IWAI 4X66E 1XNRE 5LL6R 4DU7A 4X62I 4FWGA 4GKJI 4JI4E 4FWHA 4JV5I 3J7AM 1WUUA 3ZKBA 2X36A 4YHHE 2A2DA 3T1YI 1J5EE 4DR1E 5IT9C 1N36I 4AQYI 1H7UA 3JAMC 4DV1E 4LF8I 4GKKE 1XMOI 1S4EA 1IBLE 4X66I 1ELOA 1XNRI 4DUYE 4B3ME 4JI4I 2HKEA 5LMNE 1OJ4A 4YY3E 1HNWE 4FWDA 4YHHI 2V2ZA 1J5EI 4NXNI 3K17A 2X7IA 4DR1I 2R3VA 1HR0E 3PYEA 4DV1I 4GKKI 4DR6E 4WUBA 1IBLI 4MYUA 1FI4A 1Z0WA 4DU8A 3OTOI 1A6FA 4DUYI 1Z0CA 4B3MI 1B63A 1K47A 3LNUA 5LMNI 1FWLA 4P52A 4YY3I 4LF7E 3B78A 4LF5E 2AJ4A 1HNWI 1D6TA 3ZM7A 2V2QA 1PVGA 2WW4A 1HR0I 4DR6I 4LF4I 4X65I 4HXZA 3D4JA 4WUDA 5A2QC 4JI0E 2HFUA 2BM1A 3ZKDA 4ED4A 4LF7I 4LF5I 1MU5A 2V34A 2VF3A 1NHHA 5IT9Q 1KIJA 5L3JA 3J80C 2F4VE 4PRXA 3T1HE 4HYMA 2UUBE 2J7KA 2BV3A 4UT4A 2ZBKB 4DV6I 4LF9E 1XNQE 4JI0I 2E1RA 1Z0BA 3LPSA 1H74A 1S16A 2UUAE 4NXME 4USMA 1N0UA 1NHIA 1Z5AA 4NXNE 1N34E 4DUZI 3B82A 4UTGA 1FNMA 4LF6E 1Z0TA 3PYDA 2F4VI 3QT5A 3T1HI 3ZZUA 2UUBI 1Z0VA 2UUCE 1EI1A 3OTOE 4DPTA 4DV2E 4DR5E 4LF9I 4HY1A 1XNQI 4B3SE 4OX9E 2UUAI 4DXLA 4NXMI 1ZXMA 2DEIA 4DR3E 2HFSA 3WU4A 1N34I 4HACA 4B3RE 2OI2A 3F0NA 2LJPA 3ZZTA 4LF6I 1XMQE 4P7AA 2DEJA 4URLA 2CZ9A 1HNZE 4LF4E 2UUCI 4X65E 5FLXQ 3Q1QA 1ZM9A 3GONA 1N33E 4JI2E 3ZZ0A 4DV2I 4X64E 4DR5I 5A2QQ 4DR7E 4B3SI 2UXCE 1BKNA 4OX9I 4JI1E 3V2UC 1HNXE 4I3HA 1FWKA 1ZM2A 3B8HA 4DR3I 4B3RI 3J80Q 1XMQI 3J81Q 4DPXA 5FLXC 1HNZI 4K0KE 4DV6E 1N33I 4JI2I 4X64I 4B3TE 4DR7I 2UXCI 4JG4A 4JI1I 1HNXI 1Z59A 4DR2E 1QZRA 4DUZE 1IBKI 4EMDA 4DV3E 2Q2EB 5LMUI 1ZXNA 3J81C 1RR9A 2HHHE 3J7AG 4K0KI 1B62A 1H73A 4LFBE 2V2VA 1ZM3A 4DV4E 3H4LA 1Z0GA 4JI3E 4B3TI 3PYGA 4DV7I 2BM0A 2UXDE 1DARA 4DR2I 4DPYA 5BR8E 4JI6E 4DV3I 1NZ0A 3K1JA 1IBME 4KQVA 2HHHI 1UEKA 5GMDA 1MG7A 4HACB 2R42A 2A2CA 1PKPA 1U2RA 4LFBI 4DV4I 4KHPE 4LFCE 4JI3I 1EA6A 4ZVIA 4DPWA 1I94E 4FW9A 4DR4E 4JI5I 2UXDI 4LFAE 1FJGE 3CWVA 3WU6A 4XTJA 4Z7CA 3M6AA 4JI8E 5BR8I 1Z0EA 4JI6I 4DV0E 2HK3A 3LTOA 4R1FA 2V8PA 1IBMI 2VQEE 2EFGA 4PRVA 1MX0A 2E5LE 4FN5A 3PYFA 4KHPI 4LFCI
chains in the Genus database with same CATH superfamily
5DRRA 1OYSA 2CVEA 4NBQA 3V5RA 1I94I 2GS8A 4DR4I 1KKHA 1VISA 2ZM6E 1N0VC 4LFAI 4DPUA 2NPFA 1H72C 1FJGI 2NN6C 4RPFA 2ZITA 1XXEA 3QT7A 3WU3A 1IBKE 1UDNA 3HKMA 5LMUE 4JI8I 2PO1B 3PS1A 2VQFE 4DV0I 1N32E 4PU9A 1KVKA 4JI7E 4OO1D 2VQEI 2HK2A 2PO2B 3P76A 2O1UA 4FW5A 2UXBE 4Z7YA 1E3PA 1PIEA 2E5LI 4DV7E 1Y60A 2UU9E 4IZJA 3WU5A 1UDSA 4DV5E 1Z5BA 1Z5CA 4JYAE 4FW4A 4USKA 2ZM6I 1RREA 1UDOA 5IWAE 4M1KA 4QNKA 4BA2B 4WUCA 5C0XD 4X62E 3QT6A 2VQFI 4GKJE 1N32I 3P06A 4JV5E 4FW6A 1H7SA 1KTVA 1NHJA 4JI7I 3HULA 2O1TA 2HKJA 1VI7A 1ZM4A 2UXBI 2XEXA 1UDQA 4IFDE 3T1YE 5DRQA 2WP8A 4LCGA 1FKAE 1N36E 2NN6D 2UU9I 4OO1F 3QT8A 4AQYE 4MYTA 3M7NG 4DV5I 5K36A 4JI5E 4LF8E 3JAMQ 4OKGA 1XHKA 1XMOE 4JYAI 2PNMA 5GMEA 5IWAI 4X66E 2PO0B 1XNRE 5LL6R 4DU7A 4X62I 4MU1A 4FWGA 4GKJI 4JI4E 4FWHA 3L7ZB 2O3ZA 2PNLA 3PRYA 4JV5I 3J7AM 4J3DA 1WUUA 3ZKBA 2X36A 4YHHE 2A2DA 5JEAF 3T1YI 1J5EE 2C37B 4DR1E 5IT9C 4MDTA 1N36I 3GMEA 4AQYI 1H7UA 3JAMC 2IESA 1Y5YA 4DV1E 4LF8I 4GKKE 2JE6B 1XMOI 1YHCA 1S4EA 2WNRB 1IBLE 4IFDA 2JEAA 4X66I 2CG9A 2Z5CA 1ELOA 1XNRI 4DUYE 4B3ME 2IOQA 4JI4I 2HKEA 3GLLA 3P3EA 5LMNE 1OJ4A 2PNZA 4YY3E 5JEAC 1HNWE 5DNXA 4FWDA 4MU3A 4YHHI 1Y6ZA 2V2ZA 1J5EI 4NXNI 3K17A 2X7IA 4DR1I 2R3VA 5C0XA 2C39B 1HR0E 3PYEA 4DV1I 2AE8A 4GKKI 4IS9A 4IZKA 4DR6E 4WUBA 4IZJB 1IBLI 4MYUA 1FI4A 1Z0WA 4DU8A 2Z5EA 1A6FA 3OTOI 2JT2A 4DUYI 1Z0CA 4B3MI 5K36E 1B63A 3U1YA 1K47A 3LNUA 5LMNI 1FWLA 4P52A 4YY3I 2C39A 4LF7E 3B78A 4LF5E 2AJ4A 1HNWI 2F1DA 1D6TA 3ZM7A 2V2QA 1PVGA 2WW4A 2Z5BA 2JEBB 1E3HA 1Y4UA 1HR0I 4DR6I 2IOPA 2WP8B 2J65A 4LF4I 4X65I 4KHPI 4HXZA 5K36B 1OYRA 3D4JA 5ELWA 5DROA 4WUDA 5A2QC 4JI0E 3PS2A 2BR2A 2HFUA 5JEAD 2BA0G 2BM1A 3ZKDA 4MU4A 4ED4A 2JEBA 4ISAA 4LF7I 4LF5I 3M7ND 1MU5A 4OO1E 4QNJA 4AIMA 2V34A 1P42A 2VF3A 1NHHA 5IT9Q 1KIJA 3U1KA 5L3JA 3J80C 2F4VE 3Q6MA 4PRXA 3T1HE 4HYMA 2UUBE 2J7KA 2BV3A 4UT4A 2ZBKB 4DV6I 4LF9E 1XNQE 4JI0I 2E1RA 1Z0BA 3HJCA 3LPSA 1H74A 1S16A 5C0XE 4IFDF 2UUAE 4IFDB 4FW7A 2JEAB 2Z5CB 4NXME 4AM3A 4USMA 1N0UA 1NHIA 3K85A 4LCHA 1Z5AA 4NXNE 1N34E 4IZJD 4DUZI 3B82A 4UTGA 2PNZB 1FNMA 4LF6E 1Z0TA 3PYDA 2F4VI 3QT5A 2NN6E 2IERA 3T1HI 3ZZUA 2UUBI 1USVA 1Z0VA 2UUCE 4OO1A 1EI1A 3OTOE 4DPTA 4DV2E 5C0XB 4DR5E 3H1CA 3KRNA 4IZKB 4LF9I 4HY1A 1XNQI 4IFDC 4B3SE 2BA1G 3B4TA 3M85G 4LCFA 4OX9E 2UUAI 4DXLA 4NXMI 5EL9A 1ZXMA 2DEIA 4DR3E 2HFSA 3WU4A 1N34I 4HACA 4B3RE 2OI2A 2O1WA 3F0NA 2LJPA 3ZZTA 4LF6I 1XMQE 4P7AA 2DEJA 2O1VA 4URLA 2CZ9A 5JEAA 5C0XC 1HNZE 4LF4E 4X65E 5FLXQ 2UUCI 3Q1QA 1ZM9A 2GQ0A 3GONA 1N33E 4JI2E 2Z5BB 3ZZ0A 4DV2I 4X64E 4AIDA 4DR5I 1YH8A 5A2QQ 3CDIA 4DR7E 4BA1A 4B3SI 2UXCE 1BKNA 2NN6A 4OX9I 4JI1E 3V2UC 1HNXE 4I3HA 2BR2B 1R6MA 1FWKA 1ZM2A 3B8HA 4DR3I 4B3RI 2C38A 3J80Q 1XMQI 3J81Q 1R6LA 4DPXA 5FLXC 1HNZI 4IFDD 5K36F 4K0KE 2BA0D 4GQUA 4DV6E 1N33I 4JI2I 4X64I 4LOMA 4B3TE 4DR7I 2UXCI 4JG4A 3P3GA 2PO1A 4JI1I 1HNXI 2GO4A 1Z59A 3PS3A 4DR2E 4MQYA 1QZRA 4DUZE 1IBKI 5DNLA 4EMDA 4DV3E 3UHMA 2Q2EB 2PO2A 5LMUI 1ZXNA 3J81C 1RR9A 2HHHE 3J7AG 5K36C 1OYPA 4K0KI 1B62A 1H73A 4LFBE 2V2VA 1ZM3A 5EKWA 4DV4E 3H4LA 1Z0GA 4JI3E 1Y4SA 3DD6A 4BA2A 4FW3A 4B3TI 3PYGA 4DV7I 2BM0A 4OO1B 2UXDE 3Q6NA 5JEAE 3CDJA 4U3BA 1DARA 4DR2I 4OZEA 4DPYA 5BR8E 4JI6E 1RHYA 4DV3I 4MU0A 2GO3A 3GCMA 1NZ0A 3K1JA 1IBME 4KQVA 2HHHI 4U3DA 1USUA 1UEKA 5GMDA 1MG7A 4HACB 2R42A 5C0XF 4N3OA 2BA1D 3M85D 2A2CA 1PKPA 1U2RA 4LFBI 4DV4I 4LPFA 4KHPE 4OO1C 4LFCE 4JI3I 1EA6A 5JEAB 4ZVIA 4DPWA 2PO0A 1I94E 4FW9A 4DR4E 4JI5I 2UXDI 4LFAE 1FJGE 3P3CA 2VESA 5FWKA 3CWVA 3WU6A 3L7ZA 4XTJA 2NN6F 4BA1B 2NN6B 4Z7CA 3M6AA 4JI8E 5BR8I 1Z0EA 4JI6I 5K36D 4DV0E 2HK3A 3LTOA 5DRPA 4R1FA 2V8PA 1HK7A 1IBMI 2C37A 2CGEA 2VQEE 2EFGA 2C38B 4PRVA 2JE6A 1MX0A 2E5LE 2WNRA 4FN5A 3PYFA 3NZKA 4LFCI
chains in the Genus database with same CATH topology
3V5RA 1I94I 2GS8A 4DR4I 1KKHA 1VISA 2ZM6E 1N0VC 4LFAI 4DPUA 2NPFA 1H72C 1FJGI 4RPFA 2ZITA 3QT7A 3WU3A 1IBKE 5LMUE 4JI8I 2VQFE 4DV0I 1N32E 4PU9A 1KVKA 4JI7E 2VQEI 2HK2A 2O1UA 2UXBE 4Z7YA 1PIEA 2E5LI 4DV7E 2UU9E 4IZJA 3WU5A 4DV5E 1Z5BA 1Z5CA 4JYAE 4USKA 2ZM6I 1RREA 5IWAE 4M1KA 4WUCA 4X62E 3QT6A 2VQFI 4GKJE 1N32I 3P06A 4JV5E 1H7SA 1KTVA 1NHJA 4JI7I 3HULA 2O1TA 2HKJA 1ZM4A 2UXBI 2XEXA 3T1YE 1FKAE 1N36E 2UU9I 3QT8A 4AQYE 4MYTA 4DV5I 4JI5E 4LF8E 3JAMQ 4JYAI 1XHKA 1XMOE 2PNMA 5GMEA 5IWAI 4X66E 1XNRE 5LL6R 4DU7A 4X62I 4FWGA 4GKJI 4JI4E 4FWHA 2PNLA 3PRYA 4JV5I 3J7AM 1WUUA 3ZKBA 2X36A 4YHHE 2A2DA 3T1YI 1J5EE 4DR1E 5IT9C 1N36I 4AQYI 1H7UA 3JAMC 4DV1E 4LF8I 4GKKE 1XMOI 1S4EA 1IBLE 4X66I 2CG9A 2Z5CA 1ELOA 1XNRI 4DUYE 4B3ME 2IOQA 4JI4I 2HKEA 5LMNE 1OJ4A 4YY3E 1HNWE 4FWDA 4YHHI 1Y6ZA 2V2ZA 1J5EI 4NXNI 3K17A 2X7IA 4DR1I 2R3VA 1HR0E 3PYEA 4DV1I 4GKKI 4IZKA 4DR6E 4WUBA 4IZJB 1IBLI 4MYUA 1FI4A 1Z0WA 4DU8A 2Z5EA 1A6FA 3OTOI 4DUYI 1Z0CA 4B3MI 1B63A 1K47A 3LNUA 5LMNI 1FWLA 4P52A 4YY3I 4LF7E 3B78A 4LF5E 2AJ4A 1HNWI 1D6TA 3ZM7A 2V2QA 1PVGA 2WW4A 2Z5BA 1Y4UA 1HR0I 4DR6I 2IOPA 4LF4I 4X65I 4HXZA 3D4JA 4WUDA 5A2QC 4JI0E 2HFUA 2BM1A 3ZKDA 4ED4A 4LF7I 4LF5I 1MU5A 2V34A 2VF3A 1NHHA 5IT9Q 1KIJA 5L3JA 3J80C 2F4VE 3Q6MA 4PRXA 3T1HE 4HYMA 2UUBE 2J7KA 2BV3A 4UT4A 2ZBKB 4DV6I 4LF9E 1XNQE 4JI0I 2E1RA 1Z0BA 3HJCA 3LPSA 1H74A 1S16A 2UUAE 2Z5CB 4NXME 4USMA 1N0UA 1NHIA 3K85A 1Z5AA 4NXNE 1N34E 4IZJD 4DUZI 3B82A 4UTGA 1FNMA 4LF6E 1Z0TA 3PYDA 2F4VI 3QT5A 3T1HI 3ZZUA 2UUBI 1USVA 1Z0VA 2UUCE 1EI1A 3OTOE 4DPTA 4DV2E 4DR5E 4IZKB 4LF9I 4HY1A 1XNQI 4B3SE 4OX9E 2UUAI 4DXLA 4NXMI 1ZXMA 2DEIA 4DR3E 2HFSA 3WU4A 1N34I 4HACA 4B3RE 2OI2A 2O1WA 3F0NA 2LJPA 3ZZTA 4LF6I 1XMQE 4P7AA 2DEJA 2O1VA 4URLA 2CZ9A 1HNZE 4LF4E 4X65E 5FLXQ 2UUCI 3Q1QA 1ZM9A 2GQ0A 3GONA 1N33E 4JI2E 2Z5BB 3ZZ0A 4DV2I 4X64E 4DR5I 5A2QQ 4DR7E 4B3SI 2UXCE 1BKNA 4OX9I 4JI1E 3V2UC 1HNXE 4I3HA 1FWKA 1ZM2A 3B8HA 4DR3I 4B3RI 3J80Q 1XMQI 3J81Q 4DPXA 5FLXC 1HNZI 4K0KE 4DV6E 1N33I 4JI2I 4X64I 4B3TE 4DR7I 2UXCI 4JG4A 4JI1I 1HNXI 1Z59A 4DR2E 1QZRA 4DUZE 1IBKI 4EMDA 4DV3E 2Q2EB 5LMUI 1ZXNA 3J81C 1RR9A 2HHHE 3J7AG 4K0KI 1B62A 1H73A 4LFBE 2V2VA 1ZM3A 4DV4E 3H4LA 1Z0GA 4JI3E 1Y4SA 4B3TI 3PYGA 4DV7I 2BM0A 2UXDE 3Q6NA 1DARA 4DR2I 4DPYA 5BR8E 4JI6E 4DV3I 1NZ0A 3K1JA 1IBME 4KQVA 2HHHI 1USUA 1UEKA 5GMDA 1MG7A 4HACB 2R42A 4N3OA 2A2CA 1PKPA 1U2RA 4LFBI 4DV4I 4KHPE 4LFCE 4JI3I 1EA6A 4ZVIA 4DPWA 1I94E 4FW9A 4DR4E 4JI5I 2UXDI 4LFAE 1FJGE 5FWKA 3CWVA 3WU6A 4XTJA 4Z7CA 3M6AA 4JI8E 5BR8I 1Z0EA 4JI6I 4DV0E 2HK3A 3LTOA 4R1FA 2V8PA 1HK7A 1IBMI 2CGEA 2VQEE 2EFGA 4PRVA 1MX0A 2E5LE 4FN5A 3PYFA 4KHPI 4LFCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5R A;  1I94 I;  2GS8 A;  4DR4 I;  1KKH A;  1VIS A;  2ZM6 E;  1N0V C;  4LFA I;  4DPU A;  2NPF A;  1H72 C;  1FJG I;  4RPF A;  2ZIT A;  3QT7 A;  3WU3 A;  1IBK E;  5LMU E;  4JI8 I;  2VQF E;  4DV0 I;  1N32 E;  4PU9 A;  1KVK A;  4JI7 E;  2VQE I;  2HK2 A;  2UXB E;  4Z7Y A;  1PIE A;  2E5L I;  4DV7 E;  2UU9 E;  3WU5 A;  4DV5 E;  1Z5B A;  1Z5C A;  4JYA E;  4USK A;  2ZM6 I;  1RRE A;  5IWA E;  4M1K A;  4WUC A;  4X62 E;  3QT6 A;  2VQF I;  4GKJ E;  1N32 I;  4JV5 E;  1H7S A;  1KTV A;  1NHJ A;  4JI7 I;  3HUL A;  2HKJ A;  1ZM4 A;  2UXB I;  2XEX A;  3T1Y E;  1FKA E;  1N36 E;  2UU9 I;  3QT8 A;  4AQY E;  4MYT A;  4DV5 I;  4JI5 E;  4LF8 E;  3JAM Q;  4JYA I;  1XHK A;  1XMO E;  5GME A;  5IWA I;  4X66 E;  1XNR E;  5LL6 R;  4DU7 A;  4X62 I;  4FWG A;  4GKJ I;  4JI4 E;  4FWH A;  4JV5 I;  3J7A M;  1WUU A;  3ZKB A;  2X36 A;  4YHH E;  2A2D A;  3T1Y I;  1J5E E;  4DR1 E;  5IT9 C;  1N36 I;  4AQY I;  1H7U A;  3JAM C;  4DV1 E;  4LF8 I;  4GKK E;  1XMO I;  1S4E A;  1IBL E;  4X66 I;  1ELO A;  1XNR I;  4DUY E;  4B3M E;  4JI4 I;  2HKE A;  5LMN E;  1OJ4 A;  4YY3 E;  1HNW E;  4FWD A;  4YHH I;  2V2Z A;  1J5E I;  4NXN I;  3K17 A;  2X7I A;  4DR1 I;  2R3V A;  1HR0 E;  3PYE A;  4DV1 I;  4GKK I;  4DR6 E;  4WUB A;  1IBL I;  4MYU A;  1FI4 A;  1Z0W A;  4DU8 A;  3OTO I;  1A6F A;  4DUY I;  1Z0C A;  4B3M I;  1B63 A;  1K47 A;  3LNU A;  5LMN I;  1FWL A;  4P52 A;  4YY3 I;  4LF7 E;  3B78 A;  4LF5 E;  2AJ4 A;  1HNW I;  1D6T A;  3ZM7 A;  2V2Q A;  1PVG A;  2WW4 A;  1HR0 I;  4DR6 I;  4LF4 I;  4X65 I;  4HXZ A;  3D4J A;  4WUD A;  5A2Q C;  4JI0 E;  2HFU A;  2BM1 A;  3ZKD A;  4ED4 A;  4LF7 I;  4LF5 I;  1MU5 A;  2V34 A;  2VF3 A;  1NHH A;  5IT9 Q;  1KIJ A;  5L3J A;  3J80 C;  2F4V E;  4PRX A;  3T1H E;  4HYM A;  2UUB E;  2J7K A;  2BV3 A;  4UT4 A;  2ZBK B;  4DV6 I;  4LF9 E;  1XNQ E;  4JI0 I;  2E1R A;  1Z0B A;  3LPS A;  1H74 A;  1S16 A;  2UUA E;  4NXM E;  4USM A;  1N0U A;  1NHI A;  1Z5A A;  4NXN E;  1N34 E;  4DUZ I;  3B82 A;  4UTG A;  1FNM A;  4LF6 E;  1Z0T A;  3PYD A;  2F4V I;  3QT5 A;  3T1H I;  3ZZU A;  2UUB I;  1Z0V A;  2UUC E;  1EI1 A;  3OTO E;  4DPT A;  4DV2 E;  4DR5 E;  4LF9 I;  4HY1 A;  1XNQ I;  4B3S E;  4OX9 E;  2UUA I;  4DXL A;  4NXM I;  1ZXM A;  2DEI A;  4DR3 E;  2HFS A;  3WU4 A;  1N34 I;  4HAC A;  4B3R E;  2OI2 A;  3F0N A;  2LJP A;  3ZZT A;  4LF6 I;  1XMQ E;  4P7A A;  2DEJ A;  4URL A;  2CZ9 A;  1HNZ E;  4LF4 E;  2UUC I;  4X65 E;  5FLX Q;  3Q1Q A;  1ZM9 A;  3GON A;  1N33 E;  4JI2 E;  3ZZ0 A;  4DV2 I;  4X64 E;  4DR5 I;  5A2Q Q;  4DR7 E;  4B3S I;  2UXC E;  1BKN A;  4OX9 I;  4JI1 E;  3V2U C;  1HNX E;  4I3H A;  1FWK A;  1ZM2 A;  3B8H A;  4DR3 I;  4B3R I;  3J80 Q;  1XMQ I;  3J81 Q;  4DPX A;  5FLX C;  1HNZ I;  4K0K E;  4DV6 E;  1N33 I;  4JI2 I;  4X64 I;  4B3T E;  4DR7 I;  2UXC I;  4JG4 A;  4JI1 I;  1HNX I;  1Z59 A;  4DR2 E;  1QZR A;  4DUZ E;  1IBK I;  4EMD A;  4DV3 E;  2Q2E B;  5LMU I;  1ZXN A;  3J81 C;  1RR9 A;  2HHH E;  3J7A G;  4K0K I;  1B62 A;  1H73 A;  4LFB E;  2V2V A;  1ZM3 A;  4DV4 E;  3H4L A;  1Z0G A;  4JI3 E;  4B3T I;  3PYG A;  4DV7 I;  2BM0 A;  2UXD E;  1DAR A;  4DR2 I;  4DPY A;  5BR8 E;  4JI6 E;  4DV3 I;  1NZ0 A;  3K1J A;  1IBM E;  4KQV A;  2HHH I;  1UEK A;  5GMD A;  1MG7 A;  4HAC B;  2R42 A;  2A2C A;  1PKP A;  1U2R A;  4LFB I;  4DV4 I;  4KHP E;  4LFC E;  4JI3 I;  1EA6 A;  4ZVI A;  4DPW A;  1I94 E;  4FW9 A;  4DR4 E;  4JI5 I;  2UXD I;  4LFA E;  1FJG E;  3CWV A;  3WU6 A;  4XTJ A;  4Z7C A;  3M6A A;  4JI8 E;  5BR8 I;  1Z0E A;  4JI6 I;  4DV0 E;  2HK3 A;  3LTO A;  4R1F A;  2V8P A;  1IBM I;  2VQE E;  2EFG A;  4PRV A;  1MX0 A;  2E5L E;  4FN5 A;  3PYF A;  4KHP I;  4LFC I; 
#chains in the Genus database with same CATH topology
 5DRR A;  1OYS A;  2CVE A;  4NBQ A;  3V5R A;  1I94 I;  2GS8 A;  4DR4 I;  1KKH A;  1VIS A;  2ZM6 E;  1N0V C;  4LFA I;  4DPU A;  2NPF A;  1H72 C;  1FJG I;  2NN6 C;  4RPF A;  2ZIT A;  1XXE A;  3QT7 A;  3WU3 A;  1IBK E;  1UDN A;  3HKM A;  5LMU E;  4JI8 I;  2PO1 B;  3PS1 A;  2VQF E;  4DV0 I;  1N32 E;  4PU9 A;  1KVK A;  4JI7 E;  4OO1 D;  2VQE I;  2HK2 A;  2PO2 B;  3P76 A;  2O1U A;  4FW5 A;  2UXB E;  4Z7Y A;  1E3P A;  1PIE A;  2E5L I;  4DV7 E;  1Y60 A;  2UU9 E;  4IZJ A;  3WU5 A;  1UDS A;  4DV5 E;  1Z5B A;  1Z5C A;  4JYA E;  4FW4 A;  4USK A;  2ZM6 I;  1RRE A;  1UDO A;  5IWA E;  4M1K A;  4QNK A;  4BA2 B;  4WUC A;  5C0X D;  4X62 E;  3QT6 A;  2VQF I;  4GKJ E;  1N32 I;  3P06 A;  4JV5 E;  4FW6 A;  1H7S A;  1KTV A;  1NHJ A;  4JI7 I;  3HUL A;  2O1T A;  2HKJ A;  1VI7 A;  1ZM4 A;  2UXB I;  2XEX A;  1UDQ A;  4IFD E;  3T1Y E;  5DRQ A;  2WP8 A;  4LCG A;  1FKA E;  1N36 E;  2NN6 D;  2UU9 I;  4OO1 F;  3QT8 A;  4AQY E;  4MYT A;  3M7N G;  4DV5 I;  5K36 A;  4JI5 E;  4LF8 E;  3JAM Q;  4OKG A;  1XHK A;  1XMO E;  4JYA I;  2PNM A;  5GME A;  5IWA I;  4X66 E;  2PO0 B;  1XNR E;  5LL6 R;  4DU7 A;  4X62 I;  4MU1 A;  4FWG A;  4GKJ I;  4JI4 E;  4FWH A;  3L7Z B;  2O3Z A;  2PNL A;  3PRY A;  4JV5 I;  3J7A M;  4J3D A;  1WUU A;  3ZKB A;  2X36 A;  4YHH E;  2A2D A;  5JEA F;  3T1Y I;  1J5E E;  2C37 B;  4DR1 E;  5IT9 C;  4MDT A;  1N36 I;  3GME A;  4AQY I;  1H7U A;  3JAM C;  2IES A;  1Y5Y A;  4DV1 E;  4LF8 I;  4GKK E;  2JE6 B;  1XMO I;  1YHC A;  1S4E A;  2WNR B;  1IBL E;  4IFD A;  2JEA A;  4X66 I;  2CG9 A;  2Z5C A;  1ELO A;  1XNR I;  4DUY E;  4B3M E;  2IOQ A;  4JI4 I;  2HKE A;  3GLL A;  3P3E A;  5LMN E;  1OJ4 A;  2PNZ A;  4YY3 E;  5JEA C;  1HNW E;  5DNX A;  4FWD A;  4MU3 A;  4YHH I;  1Y6Z A;  2V2Z A;  1J5E I;  4NXN I;  3K17 A;  2X7I A;  4DR1 I;  2R3V A;  5C0X A;  2C39 B;  1HR0 E;  3PYE A;  4DV1 I;  2AE8 A;  4GKK I;  4IS9 A;  4IZK A;  4DR6 E;  4WUB A;  4IZJ B;  1IBL I;  4MYU A;  1FI4 A;  1Z0W A;  4DU8 A;  2Z5E A;  1A6F A;  3OTO I;  2JT2 A;  4DUY I;  1Z0C A;  4B3M I;  5K36 E;  1B63 A;  3U1Y A;  1K47 A;  3LNU A;  5LMN I;  1FWL A;  4P52 A;  4YY3 I;  2C39 A;  4LF7 E;  3B78 A;  4LF5 E;  2AJ4 A;  1HNW I;  2F1D A;  1D6T A;  3ZM7 A;  2V2Q A;  1PVG A;  2WW4 A;  2Z5B A;  2JEB B;  1E3H A;  1Y4U A;  1HR0 I;  4DR6 I;  2IOP A;  2WP8 B;  2J65 A;  4LF4 I;  4X65 I;  4KHP I;  4HXZ A;  5K36 B;  1OYR A;  3D4J A;  5ELW A;  5DRO A;  4WUD A;  5A2Q C;  4JI0 E;  3PS2 A;  2BR2 A;  2HFU A;  5JEA D;  2BA0 G;  2BM1 A;  3ZKD A;  4MU4 A;  4ED4 A;  2JEB A;  4ISA A;  4LF7 I;  4LF5 I;  3M7N D;  1MU5 A;  4OO1 E;  4QNJ A;  4AIM A;  2V34 A;  1P42 A;  2VF3 A;  1NHH A;  5IT9 Q;  1KIJ A;  3U1K A;  5L3J A;  3J80 C;  2F4V E;  3Q6M A;  4PRX A;  3T1H E;  4HYM A;  2UUB E;  2J7K A;  2BV3 A;  4UT4 A;  2ZBK B;  4DV6 I;  4LF9 E;  1XNQ E;  4JI0 I;  2E1R A;  1Z0B A;  3HJC A;  3LPS A;  1H74 A;  1S16 A;  5C0X E;  4IFD F;  2UUA E;  4IFD B;  4FW7 A;  2JEA B;  2Z5C B;  4NXM E;  4AM3 A;  4USM A;  1N0U A;  1NHI A;  3K85 A;  4LCH A;  1Z5A A;  4NXN E;  1N34 E;  4IZJ D;  4DUZ I;  3B82 A;  4UTG A;  2PNZ B;  1FNM A;  4LF6 E;  1Z0T A;  3PYD A;  2F4V I;  3QT5 A;  2NN6 E;  2IER A;  3T1H I;  3ZZU A;  2UUB I;  1USV A;  1Z0V A;  2UUC E;  4OO1 A;  1EI1 A;  3OTO E;  4DPT A;  4DV2 E;  5C0X B;  4DR5 E;  3H1C A;  3KRN A;  4IZK B;  4LF9 I;  4HY1 A;  1XNQ I;  4IFD C;  4B3S E;  2BA1 G;  3B4T A;  3M85 G;  4LCF A;  4OX9 E;  2UUA I;  4DXL A;  4NXM I;  5EL9 A;  1ZXM A;  2DEI A;  4DR3 E;  2HFS A;  3WU4 A;  1N34 I;  4HAC A;  4B3R E;  2OI2 A;  2O1W A;  3F0N A;  2LJP A;  3ZZT A;  4LF6 I;  1XMQ E;  4P7A A;  2DEJ A;  2O1V A;  4URL A;  2CZ9 A;  5JEA A;  5C0X C;  1HNZ E;  4LF4 E;  4X65 E;  5FLX Q;  2UUC I;  3Q1Q A;  1ZM9 A;  2GQ0 A;  3GON A;  1N33 E;  4JI2 E;  2Z5B B;  3ZZ0 A;  4DV2 I;  4X64 E;  4AID A;  4DR5 I;  1YH8 A;  5A2Q Q;  3CDI A;  4DR7 E;  4BA1 A;  4B3S I;  2UXC E;  1BKN A;  2NN6 A;  4OX9 I;  4JI1 E;  3V2U C;  1HNX E;  4I3H A;  2BR2 B;  1R6M A;  1FWK A;  1ZM2 A;  3B8H A;  4DR3 I;  4B3R I;  2C38 A;  3J80 Q;  1XMQ I;  3J81 Q;  1R6L A;  4DPX A;  5FLX C;  1HNZ I;  4IFD D;  5K36 F;  4K0K E;  2BA0 D;  4GQU A;  4DV6 E;  1N33 I;  4JI2 I;  4X64 I;  4LOM A;  4B3T E;  4DR7 I;  2UXC I;  4JG4 A;  3P3G A;  2PO1 A;  4JI1 I;  1HNX I;  2GO4 A;  1Z59 A;  3PS3 A;  4DR2 E;  4MQY A;  1QZR A;  4DUZ E;  1IBK I;  5DNL A;  4EMD A;  4DV3 E;  3UHM A;  2Q2E B;  2PO2 A;  5LMU I;  1ZXN A;  3J81 C;  1RR9 A;  2HHH E;  3J7A G;  5K36 C;  1OYP A;  4K0K I;  1B62 A;  1H73 A;  4LFB E;  2V2V A;  1ZM3 A;  5EKW A;  4DV4 E;  3H4L A;  1Z0G A;  4JI3 E;  1Y4S A;  3DD6 A;  4BA2 A;  4FW3 A;  4B3T I;  3PYG A;  4DV7 I;  2BM0 A;  4OO1 B;  2UXD E;  3Q6N A;  5JEA E;  3CDJ A;  4U3B A;  1DAR A;  4DR2 I;  4OZE A;  4DPY A;  5BR8 E;  4JI6 E;  1RHY A;  4DV3 I;  4MU0 A;  2GO3 A;  3GCM A;  1NZ0 A;  3K1J A;  1IBM E;  4KQV A;  2HHH I;  4U3D A;  1USU A;  1UEK A;  5GMD A;  1MG7 A;  4HAC B;  2R42 A;  5C0X F;  4N3O A;  2BA1 D;  3M85 D;  2A2C A;  1PKP A;  1U2R A;  4LFB I;  4DV4 I;  4LPF A;  4KHP E;  4OO1 C;  4LFC E;  4JI3 I;  1EA6 A;  5JEA B;  4ZVI A;  4DPW A;  2PO0 A;  1I94 E;  4FW9 A;  4DR4 E;  4JI5 I;  2UXD I;  4LFA E;  1FJG E;  3P3C A;  2VES A;  5FWK A;  3CWV A;  3WU6 A;  3L7Z A;  4XTJ A;  2NN6 F;  4BA1 B;  2NN6 B;  4Z7C A;  3M6A A;  4JI8 E;  5BR8 I;  1Z0E A;  4JI6 I;  5K36 D;  4DV0 E;  2HK3 A;  3LTO A;  5DRP A;  4R1F A;  2V8P A;  1HK7 A;  1IBM I;  2C37 A;  2CGE A;  2VQE E;  2EFG A;  2C38 B;  4PRV A;  2JE6 A;  1MX0 A;  2E5L E;  2WNR A;  4FN5 A;  3PYF A;  3NZK A;  4LFC I; 
#chains in the Genus database with same CATH homology
 3V5R A;  1I94 I;  2GS8 A;  4DR4 I;  1KKH A;  1VIS A;  2ZM6 E;  1N0V C;  4LFA I;  4DPU A;  2NPF A;  1H72 C;  1FJG I;  4RPF A;  2ZIT A;  3QT7 A;  3WU3 A;  1IBK E;  5LMU E;  4JI8 I;  2VQF E;  4DV0 I;  1N32 E;  4PU9 A;  1KVK A;  4JI7 E;  2VQE I;  2HK2 A;  2O1U A;  2UXB E;  4Z7Y A;  1PIE A;  2E5L I;  4DV7 E;  2UU9 E;  4IZJ A;  3WU5 A;  4DV5 E;  1Z5B A;  1Z5C A;  4JYA E;  4USK A;  2ZM6 I;  1RRE A;  5IWA E;  4M1K A;  4WUC A;  4X62 E;  3QT6 A;  2VQF I;  4GKJ E;  1N32 I;  3P06 A;  4JV5 E;  1H7S A;  1KTV A;  1NHJ A;  4JI7 I;  3HUL A;  2O1T A;  2HKJ A;  1ZM4 A;  2UXB I;  2XEX A;  3T1Y E;  1FKA E;  1N36 E;  2UU9 I;  3QT8 A;  4AQY E;  4MYT A;  4DV5 I;  4JI5 E;  4LF8 E;  3JAM Q;  4JYA I;  1XHK A;  1XMO E;  2PNM A;  5GME A;  5IWA I;  4X66 E;  1XNR E;  5LL6 R;  4DU7 A;  4X62 I;  4FWG A;  4GKJ I;  4JI4 E;  4FWH A;  2PNL A;  3PRY A;  4JV5 I;  3J7A M;  1WUU A;  3ZKB A;  2X36 A;  4YHH E;  2A2D A;  3T1Y I;  1J5E E;  4DR1 E;  5IT9 C;  1N36 I;  4AQY I;  1H7U A;  3JAM C;  4DV1 E;  4LF8 I;  4GKK E;  1XMO I;  1S4E A;  1IBL E;  4X66 I;  2CG9 A;  2Z5C A;  1ELO A;  1XNR I;  4DUY E;  4B3M E;  2IOQ A;  4JI4 I;  2HKE A;  5LMN E;  1OJ4 A;  4YY3 E;  1HNW E;  4FWD A;  4YHH I;  1Y6Z A;  2V2Z A;  1J5E I;  4NXN I;  3K17 A;  2X7I A;  4DR1 I;  2R3V A;  1HR0 E;  3PYE A;  4DV1 I;  4GKK I;  4IZK A;  4DR6 E;  4WUB A;  4IZJ B;  1IBL I;  4MYU A;  1FI4 A;  1Z0W A;  4DU8 A;  2Z5E A;  1A6F A;  3OTO I;  4DUY I;  1Z0C A;  4B3M I;  1B63 A;  1K47 A;  3LNU A;  5LMN I;  1FWL A;  4P52 A;  4YY3 I;  4LF7 E;  3B78 A;  4LF5 E;  2AJ4 A;  1HNW I;  1D6T A;  3ZM7 A;  2V2Q A;  1PVG A;  2WW4 A;  2Z5B A;  1Y4U A;  1HR0 I;  4DR6 I;  2IOP A;  4LF4 I;  4X65 I;  4HXZ A;  3D4J A;  4WUD A;  5A2Q C;  4JI0 E;  2HFU A;  2BM1 A;  3ZKD A;  4ED4 A;  4LF7 I;  4LF5 I;  1MU5 A;  2V34 A;  2VF3 A;  1NHH A;  5IT9 Q;  1KIJ A;  5L3J A;  3J80 C;  2F4V E;  3Q6M A;  4PRX A;  3T1H E;  4HYM A;  2UUB E;  2J7K A;  2BV3 A;  4UT4 A;  2ZBK B;  4DV6 I;  4LF9 E;  1XNQ E;  4JI0 I;  2E1R A;  1Z0B A;  3HJC A;  3LPS A;  1H74 A;  1S16 A;  2UUA E;  2Z5C B;  4NXM E;  4USM A;  1N0U A;  1NHI A;  3K85 A;  1Z5A A;  4NXN E;  1N34 E;  4IZJ D;  4DUZ I;  3B82 A;  4UTG A;  1FNM A;  4LF6 E;  1Z0T A;  3PYD A;  2F4V I;  3QT5 A;  3T1H I;  3ZZU A;  2UUB I;  1USV A;  1Z0V A;  2UUC E;  1EI1 A;  3OTO E;  4DPT A;  4DV2 E;  4DR5 E;  4IZK B;  4LF9 I;  4HY1 A;  1XNQ I;  4B3S E;  4OX9 E;  2UUA I;  4DXL A;  4NXM I;  1ZXM A;  2DEI A;  4DR3 E;  2HFS A;  3WU4 A;  1N34 I;  4HAC A;  4B3R E;  2OI2 A;  2O1W A;  3F0N A;  2LJP A;  3ZZT A;  4LF6 I;  1XMQ E;  4P7A A;  2DEJ A;  2O1V A;  4URL A;  2CZ9 A;  1HNZ E;  4LF4 E;  4X65 E;  5FLX Q;  2UUC I;  3Q1Q A;  1ZM9 A;  2GQ0 A;  3GON A;  1N33 E;  4JI2 E;  2Z5B B;  3ZZ0 A;  4DV2 I;  4X64 E;  4DR5 I;  5A2Q Q;  4DR7 E;  4B3S I;  2UXC E;  1BKN A;  4OX9 I;  4JI1 E;  3V2U C;  1HNX E;  4I3H A;  1FWK A;  1ZM2 A;  3B8H A;  4DR3 I;  4B3R I;  3J80 Q;  1XMQ I;  3J81 Q;  4DPX A;  5FLX C;  1HNZ I;  4K0K E;  4DV6 E;  1N33 I;  4JI2 I;  4X64 I;  4B3T E;  4DR7 I;  2UXC I;  4JG4 A;  4JI1 I;  1HNX I;  1Z59 A;  4DR2 E;  1QZR A;  4DUZ E;  1IBK I;  4EMD A;  4DV3 E;  2Q2E B;  5LMU I;  1ZXN A;  3J81 C;  1RR9 A;  2HHH E;  3J7A G;  4K0K I;  1B62 A;  1H73 A;  4LFB E;  2V2V A;  1ZM3 A;  4DV4 E;  3H4L A;  1Z0G A;  4JI3 E;  1Y4S A;  4B3T I;  3PYG A;  4DV7 I;  2BM0 A;  2UXD E;  3Q6N A;  1DAR A;  4DR2 I;  4DPY A;  5BR8 E;  4JI6 E;  4DV3 I;  1NZ0 A;  3K1J A;  1IBM E;  4KQV A;  2HHH I;  1USU A;  1UEK A;  5GMD A;  1MG7 A;  4HAC B;  2R42 A;  4N3O A;  2A2C A;  1PKP A;  1U2R A;  4LFB I;  4DV4 I;  4KHP E;  4LFC E;  4JI3 I;  1EA6 A;  4ZVI A;  4DPW A;  1I94 E;  4FW9 A;  4DR4 E;  4JI5 I;  2UXD I;  4LFA E;  1FJG E;  5FWK A;  3CWV A;  3WU6 A;  4XTJ A;  4Z7C A;  3M6A A;  4JI8 E;  5BR8 I;  1Z0E A;  4JI6 I;  4DV0 E;  2HK3 A;  3LTO A;  4R1F A;  2V8P A;  1HK7 A;  1IBM I;  2CGE A;  2VQE E;  2EFG A;  4PRV A;  1MX0 A;  2E5L E;  4FN5 A;  3PYF A;  4KHP I;  4LFC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...