1Z0GA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 56
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0gA00
1KKHA 2ZM6I 3K1JA 4UT4A 4PU9A 4FN5A 3T1HE 2V2ZA 4GKJI 5LMUI 4X62I 4X65E 4JI4E 5LL6R 4LF8E 2UXCI 4LF4E 4JV5E 3ZZ0A 1HNXE 4DV2E 1HNZE 3B78A 1ZM3A 4JI0E 2DEJA 1BKNA 2HK3A 1H74A 4X64I 2V8PA 4DR6E 4NXNI 5GMDA 5IT9Q 4B3TI 2BV3A 4NXMI 3B82A 4HY1A 4DR3E 2VQEI 4B3RI 2OI2A 1Z0TA 5GMEA 2ZITA 1MX0A 1XNQE 4LFCE 1N33I 4LF6E 4PRVA 3T1YI 4DUYE 4DR1I 4ED4A 2VF3A 4K0KI 3LPSA 4JG4A 4HACA 4DUZI 4FWDA 1Z5CA 4DR4I 4DV0E 1H7SA 1XHKA 5IWAE 1ELOA 1N36E 1NHHA 2UXDE 1KTVA 4FW9A 4LFBI 3M6AA 4WUCA 4B3MI 1XMQI 2CZ9A 2UUBI 4YY3E 3LNUA 1XNRE 4JI3I 3B8HA 2HFSA 4MYUA 4JI7I 1KIJA 2VQFE 4DV6E 4DV1I 4USMA 4ZVIA 5LMNI 4AQYI 1D6TA 2V34A 4DR5E 1HR0I 3ZZUA 1IBKI 4DV4I 1XMOE 5FLXQ 4DPYA 4WUDA 4PRXA 3K17A 1N0UA 1OJ4A 4DXLA 3WU4A 4X66E 4HACB 4LF9E 1ZM9A 3CWVA 1NZ0A 1DARA 2UXBE 4B3SI 4M1KA 4JI8I 4JI2E 4FWGA 4JI1E 4OX9I 1N32I 4DPTA 4DR7E 1VISA 1WUUA 2R42A 1Z59A 1ZXMA 3JAMC 3PYFA 4YHHE 1NHIA 4JI6I 4KQVA 1B62A 2UXCE 3J80C 2V2QA 2X36A 2HHHI 4KHPI 4DPXA 3T1HI 2E5LE 4X65I 4JI4I 3QT6A 4I3HA 4JV5I 1Z0GA 4MYTA 4LFAE 1HNXI 5BR8E 3D4JA 4DV2I 1FKAE 1A6FA 2WW4A 2UUAI 4JI0I 1FI4A 1H73A 4EMDA 4NXME 4DU7A 4B3RE 4DR2E 3ZZTA 3LTOA 1RR9A 1J5EI 4DR3I 2V2VA 1XNQI 4DV3E 1HNWE 4HYMA 4DUZE 1FNMA 4DUYI 2DEIA 1H7UA 4DR4E 2F4VI 3ZKBA 3WU5A 4LF5E 3ZM7A 1U2RA 4Z7CA 4DV0I 3ZKDA 1N36I 2UXDI 4RPFA 4DV5I 2UUCE 1Z0CA 3PYEA 1ZM4A 4JI7E 3OTOE 3V5RA 4YY3I 1XNRI 2LJPA 4DV1E 1FWLA 1I94E 1MG7A 3J81C 4WUBA 4JI5E 1Z0WA 1Z5AA 2VQFI 4DV6I 1IBLE 1FJGE 3HULA 3QT5A 3WU3A 4LF7E 2UU9E 3Q1QA 4UTGA 1IBMI 4DR5I 1QZRA 1UEKA 1N34E 1KVKA 3QT7A 1NHJA 3QT8A 4URLA 3J7AM 1Z0VA 1Z5BA 2HKEA 4DV7I 1MU5A 4GKKE 4JYAI 4X66I 2HKJA 3H4LA 2ZM6E 4LF9I 1RREA 1K47A 2GS8A 2AJ4A 4GKJE 2UXBI 1Z0BA 5LMUE 4X62E 1ZXNA 1PIEA 1B63A 1EA6A 4JI2I 4DPUA 4JI1I 4JI6E 2NPFA 3JAMQ 4DR7I 2HHHE 4KHPE 4R1FA 2A2DA 4LF8I 4LF4I 3J80Q 4YHHI 3GONA 4X64E 1HNZI 4NXNE 2J7KA 4DU8A 4B3TE 2E5LI 2UUAE 2EFGA 5IT9C 4DR6I 2VQEE 4LFAI 5BR8I 4DPWA 1N33E 2R3VA 3T1YE 1ZM2A 2BM1A 4XTJA 1J5EE 4USKA 4P52A 2A2CA 4DR1E 4LFCI 4DR2I 4K0KE 4LF6I 3PYGA 2E1RA 4HXZA 2F4VE 4LFBE 1PKPA 4DV3I 5A2QC 1HNWI 4B3ME 1XMQE 2UUBE 5IWAI 3F0NA 3J7AG 5L3JA 1EI1A 4JI3E 5A2QQ 2HK2A 4LF5I 4DV5E 3PYDA 3WU6A 5LMNE 4AQYE 2UUCI 2BM0A 1Z0EA 2Q2EB 3OTOI 1HR0E 1IBKE 4DV4E 3J81Q 1FWKA 1I94I 4JI5I 5FLXC 4Z7YA 1XMOI 1IBLI 1IBME 1S16A 2HFUA 1FJGI 4P7AA 4LF7I 1N0VC 2UU9I 2XEXA 4DV7E 2X7IA 4B3SE 4JYAE 1N34I 4JI8E 2ZBKB 1PVGA 3V2UC 4OX9E 1N32E 4FWHA 1S4EA 4GKKI 1H72C
chains in the Genus database with same CATH superfamily
1KKHA 2Z5CA 1XXEA 2C37B 2ZM6I 2PO0A 3K1JA 4UT4A 4PU9A 4FN5A 3T1HE 2V2ZA 4GKJI 4IFDF 5LMUI 4X62I 4X65E 4JI4E 5LL6R 4LF8E 2UXCI 4LF4E 4JV5E 3ZZ0A 1HNXE 4DV2E 5JEAC 1HNZE 4IFDD 3B78A 1ZM3A 4JI0E 2DEJA 2IERA 1BKNA 2HK3A 4MU4A 3U1KA 1H74A 4X64I 2V8PA 4DR6E 3P3EA 4NXNI 2GO4A 4LCFA 5GMDA 4QNJA 4BA1A 5IT9Q 4B3TI 2BV3A 2NN6D 4LCHA 4NXMI 3B82A 4HY1A 4U3DA 4DR3E 1Y60A 2VQEI 4B3RI 2OI2A 1Z0TA 5K36F 5GMEA 2ZITA 1MX0A 4ISAA 1XNQE 1HK7A 3GCMA 4MU3A 4LFCE 4IZJA 1N33I 4LF6E 4PRVA 3P06A 5C0XB 3T1YI 4DUYE 5K36C 3CDIA 4AM3A 2IOQA 4DR1I 4ED4A 2VF3A 2PO0B 4K0KI 5DROA 3LPSA 4JG4A 4HACA 4DUZI 4FWDA 1Z5CA 1YHCA 4DR4I 4DV0E 1H7SA 1XHKA 5IWAE 3GLLA 1ELOA 1N36E 2O3ZA 1NHHA 2UXDE 5JEAA 1KTVA 4FW9A 4LFBI 3M6AA 4WUCA 4B3MI 1XMQI 2CZ9A 2UUBI 4YY3E 3LNUA 1XNRE 3M85D 2GO3A 4JI3I 3B8HA 3PS3A 1Y6ZA 2HFSA 4MYUA 4JI7I 1KIJA 2VQFE 4DV6E 1UDQA 4DV1I 2C39A 2IOPA 4USMA 4ZVIA 5LMNI 4AQYI 1E3HA 3B4TA 5DRPA 4OO1F 1D6TA 2PO2A 2V34A 4FW6A 4DR5E 2PO1B 1HR0I 3ZZUA 1IBKI 4IZJB 4DV4I 1XMOE 2JEBB 5FLXQ 5K36A 4DPYA 3DD6A 2O1TA 4OO1C 4WUDA 4PRXA 3K17A 1N0UA 1OJ4A 4DXLA 5DRQA 3WU4A 4X66E 4HACB 4LF9E 2WP8B 4U3BA 1ZM9A 1USUA 3CWVA 2BA1G 1NZ0A 1DARA 5JEAB 2UXBE 4B3SI 4M1KA 4JI8I 2PNMA 4JI2E 4FWGA 4JI1E 4OX9I 1N32I 3NZKA 2Z5EA 4DPTA 4DR7E 1VISA 1WUUA 2R42A 1Z59A 1ZXMA 3JAMC 5JEAE 2CG9A 3PYFA 4YHHE 1NHIA 4JI6I 2PNZA 1RHYA 2BA1D 4KQVA 1B62A 4FW4A 2UXCE 3J80C 2C39B 2V2QA 2X36A 2HHHI 4KHPI 4IFDC 4DPXA 5DRRA 2JEAB 2J65A 3T1HI 2BR2A 2E5LE 2NN6F 5DNLA 4FW5A 4X65I 4JI4I 2PO2B 3QT6A 4I3HA 4JV5I 1Z0GA 4MYTA 4LFAE 3K85A 2O1UA 1HNXI 5BR8E 3D4JA 4DV2I 4OO1A 1FKAE 3L7ZA 5K36B 1A6FA 2WW4A 4AIMA 2UUAI 2NN6C 4JI0I 1FI4A 1H73A 4EMDA 4NXME 4NBQA 4DU7A 4B3RE 4FW3A 4DR2E 4IZKA 3ZZTA 5K36E 4LOMA 3LTOA 1Y5YA 1RR9A 1J5EI 2Z5CB 4DR3I 2V2VA 1XNQI 2VESA 4DV3E 1HNWE 4MU0A 4HYMA 4DUZE 1FNMA 4DUYI 2DEIA 2AE8A 1H7UA 4QNKA 3P3GA 4DR4E 2F4VI 3ZKBA 4IFDA 2PNZB 3WU5A 4LF5E 2IESA 1U2RA 4LCGA 3ZM7A 4AIDA 4Z7CA 5FWKA 2C38A 5C0XF 2O1WA 4IS9A 4DV0I 1YH8A 3ZKDA 4BA2A 1N36I 2UXDI 4RPFA 4DV5I 2UUCE 1Z0CA 3PYEA 1ZM4A 5C0XD 2NN6A 4JI7E 3L7ZB 4BA1B 3OTOE 3V5RA 4YY3I 1XNRI 2LJPA 4LPFA 3CDJA 4DV1E 1FWLA 1I94E 1MG7A 3J81C 4WUBA 4JI5E 1Z0WA 1Z5AA 2PNLA 2VQFI 4OO1E 4DV6I 1IBLE 4IZKB 1FJGE 1VI7A 2BA0G 5ELWA 3HULA 3QT5A 3WU3A 4LF7E 2UU9E 3Q1QA 4UTGA 1IBMI 4DR5I 1QZRA 1UEKA 1OYRA 1N34E 1KVKA 3QT7A 1NHJA 3QT8A 4URLA 3J7AM 3GMEA 1Z0VA 1Z5BA 2HKEA 4DV7I 2BA0D 1MU5A 3PRYA 4JYAI 4GKKE 5DNXA 4IFDB 4X66I 2HKJA 3H4LA 2ZM6E 4LF9I 2C38B 1RREA 1K47A 2O1VA 2GS8A 2AJ4A 1UDOA 4BA2B 4IZJD 5C0XA 4MU1A 4GKJE 2UXBI 1Z0BA 5LMUE 4X62E 4IFDE 1ZXNA 3HJCA 1PIEA 4OZEA 1B63A 1EA6A 4JI2I 4DPUA 4JI1I 4MQYA 4JI6E 2NPFA 3JAMQ 4DR7I 1Y4UA 2HHHE 4KHPE 4R1FA 2A2DA 5JEAF 3PS2A 4LF8I 4LF4I 3J80Q 4YHHI 3GONA 2NN6E 4X64E 1Y4SA 2JE6A 1UDNA 1HNZI 4NXNE 2J7KA 4DU8A 2Z5BA 5JEAD 3Q6MA 4B3TE 2E5LI 2UUAE 1UDSA 2EFGA 4J3DA 5IT9C 4DR6I 2VQEE 2JT2A 4LFAI 5BR8I 4DPWA 1N33E 2R3VA 2WNRA 3H1CA 3T1YE 1ZM2A 2BM1A 4XTJA 1J5EE 4USKA 4P52A 2A2CA 4DR1E 4LFCI 4DR2I 4K0KE 4LF6I 2PO1A 3PYGA 2JEBA 3Q6NA 2E1RA 4HXZA 5K36D 3HKMA 2F4VE 3M85G 4LFBE 1PKPA 4DV3I 5A2QC 1HNWI 4B3ME 1XMQE 2BR2B 2UUBE 5IWAI 2WP8A 3F0NA 3J7AG 5L3JA 5C0XE 1EI1A 4JI3E 4OO1B 5A2QQ 2HK2A 2C37A 2JE6B 5C0XC 4DV5E 4LF5I 1R6LA 3PYDA 2Z5BB 3KRNA 3WU6A 1P42A 5LMNE 4AQYE 3PS1A 5EKWA 2UUCI 3M7NG 2BM0A 1Z0EA 2Q2EB 4N3OA 3OTOI 1HR0E 1IBKE 4DV4E 3J81Q 1FWKA 5EL9A 3U1YA 4OKGA 2WNRB 1I94I 1USVA 4JI5I 5FLXC 2GQ0A 2F1DA 3P3CA 2JEAA 4Z7YA 1XMOI 1IBLI 1IBME 1S16A 2HFUA 1FJGI 2CGEA 4P7AA 1OYPA 3M7ND 3UHMA 4LF7I 1N0VC 1R6MA 2UU9I 4OO1D 2XEXA 1OYSA 4DV7E 2CVEA 2X7IA 4B3SE 4JYAE 4MDTA 1N34I 4JI8E 2ZBKB 1PVGA 3V2UC 4OX9E 1N32E 3P76A 4FW7A 1E3PA 4FWHA 4GQUA 1S4EA 4GKKI 2NN6B 1H72C
chains in the Genus database with same CATH topology
1KKHA 2Z5CA 2ZM6I 3K1JA 4UT4A 4PU9A 4FN5A 3T1HE 2V2ZA 4GKJI 5LMUI 4X62I 4X65E 4JI4E 5LL6R 4LF8E 2UXCI 4LF4E 4JV5E 3ZZ0A 1HNXE 4DV2E 1HNZE 3B78A 1ZM3A 4JI0E 2DEJA 1BKNA 2HK3A 1H74A 4X64I 2V8PA 4DR6E 4NXNI 5GMDA 5IT9Q 4B3TI 2BV3A 4NXMI 3B82A 4HY1A 4DR3E 2VQEI 4B3RI 2OI2A 1Z0TA 5GMEA 2ZITA 1MX0A 1XNQE 1HK7A 4LFCE 4IZJA 1N33I 4LF6E 4PRVA 3P06A 3T1YI 4DUYE 2IOQA 4DR1I 4ED4A 2VF3A 4K0KI 3LPSA 4JG4A 4HACA 4DUZI 4FWDA 1Z5CA 4DR4I 4DV0E 1H7SA 1XHKA 5IWAE 1ELOA 1N36E 1NHHA 2UXDE 1KTVA 4FW9A 4LFBI 3M6AA 4WUCA 4B3MI 1XMQI 2CZ9A 2UUBI 4YY3E 3LNUA 1XNRE 4JI3I 3B8HA 1Y6ZA 2HFSA 4MYUA 4JI7I 1KIJA 2VQFE 4DV6E 4DV1I 2IOPA 4USMA 4ZVIA 5LMNI 4AQYI 1D6TA 2V34A 4DR5E 1HR0I 3ZZUA 1IBKI 4IZJB 4DV4I 1XMOE 5FLXQ 4DPYA 2O1TA 4WUDA 4PRXA 3K17A 1N0UA 1OJ4A 4DXLA 3WU4A 4X66E 4HACB 4LF9E 1ZM9A 1USUA 3CWVA 1NZ0A 1DARA 2UXBE 4B3SI 4M1KA 4JI8I 2PNMA 4JI2E 4FWGA 4JI1E 4OX9I 1N32I 2Z5EA 4DPTA 4DR7E 1VISA 1WUUA 2R42A 1Z59A 1ZXMA 3JAMC 2CG9A 3PYFA 4YHHE 1NHIA 4JI6I 4KQVA 1B62A 2UXCE 3J80C 2V2QA 2X36A 2HHHI 4KHPI 4DPXA 3T1HI 2E5LE 4X65I 4JI4I 3QT6A 4I3HA 4JV5I 1Z0GA 4MYTA 4LFAE 3K85A 2O1UA 1HNXI 5BR8E 3D4JA 4DV2I 1FKAE 1A6FA 2WW4A 2UUAI 4JI0I 1FI4A 1H73A 4EMDA 4NXME 4DU7A 4B3RE 4DR2E 4IZKA 3ZZTA 3LTOA 1RR9A 1J5EI 2Z5CB 4DR3I 2V2VA 1XNQI 4DV3E 1HNWE 4HYMA 4DUZE 1FNMA 4DUYI 2DEIA 1H7UA 4DR4E 2F4VI 3ZKBA 3WU5A 4LF5E 3ZM7A 1U2RA 4Z7CA 5FWKA 2O1WA 4DV0I 3ZKDA 1N36I 2UXDI 4RPFA 4DV5I 2UUCE 1Z0CA 3PYEA 1ZM4A 4JI7E 3OTOE 3V5RA 4YY3I 1XNRI 2LJPA 4DV1E 1FWLA 1I94E 1MG7A 3J81C 4WUBA 4JI5E 1Z0WA 1Z5AA 2PNLA 2VQFI 4DV6I 1IBLE 4IZKB 1FJGE 3HULA 3QT5A 3WU3A 4LF7E 2UU9E 3Q1QA 4UTGA 1IBMI 4DR5I 1QZRA 1UEKA 1N34E 1KVKA 3QT7A 1NHJA 3QT8A 4URLA 3J7AM 1Z0VA 1Z5BA 2HKEA 4DV7I 1MU5A 3PRYA 4JYAI 4GKKE 4X66I 2HKJA 3H4LA 2ZM6E 4LF9I 1RREA 1K47A 2O1VA 2GS8A 2AJ4A 4IZJD 4GKJE 2UXBI 1Z0BA 5LMUE 4X62E 1ZXNA 3HJCA 1PIEA 1B63A 1EA6A 4JI2I 4DPUA 4JI1I 4JI6E 2NPFA 3JAMQ 4DR7I 1Y4UA 2HHHE 4KHPE 4R1FA 2A2DA 4LF8I 4LF4I 3J80Q 4YHHI 3GONA 4X64E 1Y4SA 1HNZI 4NXNE 2J7KA 4DU8A 2Z5BA 3Q6MA 4B3TE 2E5LI 2UUAE 2EFGA 5IT9C 4DR6I 2VQEE 4LFAI 5BR8I 4DPWA 1N33E 2R3VA 3T1YE 1ZM2A 2BM1A 4XTJA 1J5EE 4USKA 4P52A 2A2CA 4DR1E 4LFCI 4DR2I 4K0KE 4LF6I 3PYGA 3Q6NA 2E1RA 4HXZA 2F4VE 4LFBE 1PKPA 4DV3I 5A2QC 1HNWI 4B3ME 1XMQE 2UUBE 5IWAI 3F0NA 3J7AG 5L3JA 1EI1A 4JI3E 5A2QQ 2HK2A 4LF5I 4DV5E 3PYDA 2Z5BB 3WU6A 5LMNE 4AQYE 2UUCI 2BM0A 1Z0EA 2Q2EB 4N3OA 3OTOI 1HR0E 1IBKE 4DV4E 3J81Q 1FWKA 1I94I 1USVA 4JI5I 5FLXC 2GQ0A 4Z7YA 1XMOI 1IBLI 1IBME 1S16A 2HFUA 1FJGI 2CGEA 4P7AA 4LF7I 1N0VC 2UU9I 2XEXA 4DV7E 2X7IA 4B3SE 4JYAE 1N34I 4JI8E 2ZBKB 1PVGA 3V2UC 4OX9E 1N32E 4FWHA 1S4EA 4GKKI 1H72C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKH A;  2ZM6 I;  3K1J A;  4UT4 A;  4PU9 A;  4FN5 A;  3T1H E;  2V2Z A;  4GKJ I;  5LMU I;  4X62 I;  4X65 E;  4JI4 E;  5LL6 R;  4LF8 E;  2UXC I;  4LF4 E;  4JV5 E;  3ZZ0 A;  1HNX E;  4DV2 E;  1HNZ E;  3B78 A;  1ZM3 A;  4JI0 E;  2DEJ A;  1BKN A;  2HK3 A;  1H74 A;  4X64 I;  2V8P A;  4DR6 E;  4NXN I;  5GMD A;  5IT9 Q;  4B3T I;  2BV3 A;  4NXM I;  3B82 A;  4HY1 A;  4DR3 E;  2VQE I;  4B3R I;  2OI2 A;  1Z0T A;  5GME A;  2ZIT A;  1MX0 A;  1XNQ E;  4LFC E;  1N33 I;  4LF6 E;  4PRV A;  3T1Y I;  4DUY E;  4DR1 I;  4ED4 A;  2VF3 A;  4K0K I;  3LPS A;  4JG4 A;  4HAC A;  4DUZ I;  4FWD A;  1Z5C A;  4DR4 I;  4DV0 E;  1H7S A;  1XHK A;  5IWA E;  1ELO A;  1N36 E;  1NHH A;  2UXD E;  1KTV A;  4FW9 A;  4LFB I;  3M6A A;  4WUC A;  4B3M I;  1XMQ I;  2CZ9 A;  2UUB I;  4YY3 E;  3LNU A;  1XNR E;  4JI3 I;  3B8H A;  2HFS A;  4MYU A;  4JI7 I;  1KIJ A;  2VQF E;  4DV6 E;  4DV1 I;  4USM A;  4ZVI A;  5LMN I;  4AQY I;  1D6T A;  2V34 A;  4DR5 E;  1HR0 I;  3ZZU A;  1IBK I;  4DV4 I;  1XMO E;  5FLX Q;  4DPY A;  4WUD A;  4PRX A;  3K17 A;  1N0U A;  1OJ4 A;  4DXL A;  3WU4 A;  4X66 E;  4HAC B;  4LF9 E;  1ZM9 A;  3CWV A;  1NZ0 A;  1DAR A;  2UXB E;  4B3S I;  4M1K A;  4JI8 I;  4JI2 E;  4FWG A;  4JI1 E;  4OX9 I;  1N32 I;  4DPT A;  4DR7 E;  1VIS A;  1WUU A;  2R42 A;  1Z59 A;  1ZXM A;  3JAM C;  3PYF A;  4YHH E;  1NHI A;  4JI6 I;  4KQV A;  1B62 A;  2UXC E;  3J80 C;  2V2Q A;  2X36 A;  2HHH I;  4KHP I;  4DPX A;  3T1H I;  2E5L E;  4X65 I;  4JI4 I;  3QT6 A;  4I3H A;  4JV5 I;  1Z0G A;  4MYT A;  4LFA E;  1HNX I;  5BR8 E;  3D4J A;  4DV2 I;  1FKA E;  1A6F A;  2WW4 A;  2UUA I;  4JI0 I;  1FI4 A;  1H73 A;  4EMD A;  4NXM E;  4DU7 A;  4B3R E;  4DR2 E;  3ZZT A;  3LTO A;  1RR9 A;  1J5E I;  4DR3 I;  2V2V A;  1XNQ I;  4DV3 E;  1HNW E;  4HYM A;  4DUZ E;  1FNM A;  4DUY I;  2DEI A;  1H7U A;  4DR4 E;  2F4V I;  3ZKB A;  3WU5 A;  4LF5 E;  3ZM7 A;  1U2R A;  4Z7C A;  4DV0 I;  3ZKD A;  1N36 I;  2UXD I;  4RPF A;  4DV5 I;  2UUC E;  1Z0C A;  3PYE A;  1ZM4 A;  4JI7 E;  3OTO E;  3V5R A;  4YY3 I;  1XNR I;  2LJP A;  4DV1 E;  1FWL A;  1I94 E;  1MG7 A;  3J81 C;  4WUB A;  4JI5 E;  1Z0W A;  1Z5A A;  2VQF I;  4DV6 I;  1IBL E;  1FJG E;  3HUL A;  3QT5 A;  3WU3 A;  4LF7 E;  2UU9 E;  3Q1Q A;  4UTG A;  1IBM I;  4DR5 I;  1QZR A;  1UEK A;  1N34 E;  1KVK A;  3QT7 A;  1NHJ A;  3QT8 A;  4URL A;  3J7A M;  1Z0V A;  1Z5B A;  2HKE A;  4DV7 I;  1MU5 A;  4GKK E;  4JYA I;  4X66 I;  2HKJ A;  3H4L A;  2ZM6 E;  4LF9 I;  1RRE A;  1K47 A;  2GS8 A;  2AJ4 A;  4GKJ E;  2UXB I;  1Z0B A;  5LMU E;  4X62 E;  1ZXN A;  1PIE A;  1B63 A;  1EA6 A;  4JI2 I;  4DPU A;  4JI1 I;  4JI6 E;  2NPF A;  3JAM Q;  4DR7 I;  2HHH E;  4KHP E;  4R1F A;  2A2D A;  4LF8 I;  4LF4 I;  3J80 Q;  4YHH I;  3GON A;  4X64 E;  1HNZ I;  4NXN E;  2J7K A;  4DU8 A;  4B3T E;  2E5L I;  2UUA E;  2EFG A;  5IT9 C;  4DR6 I;  2VQE E;  4LFA I;  5BR8 I;  4DPW A;  1N33 E;  2R3V A;  3T1Y E;  1ZM2 A;  2BM1 A;  4XTJ A;  1J5E E;  4USK A;  4P52 A;  2A2C A;  4DR1 E;  4LFC I;  4DR2 I;  4K0K E;  4LF6 I;  3PYG A;  2E1R A;  4HXZ A;  2F4V E;  4LFB E;  1PKP A;  4DV3 I;  5A2Q C;  1HNW I;  4B3M E;  1XMQ E;  2UUB E;  5IWA I;  3F0N A;  3J7A G;  5L3J A;  1EI1 A;  4JI3 E;  5A2Q Q;  2HK2 A;  4LF5 I;  4DV5 E;  3PYD A;  3WU6 A;  5LMN E;  4AQY E;  2UUC I;  2BM0 A;  1Z0E A;  2Q2E B;  3OTO I;  1HR0 E;  1IBK E;  4DV4 E;  3J81 Q;  1FWK A;  1I94 I;  4JI5 I;  5FLX C;  4Z7Y A;  1XMO I;  1IBL I;  1IBM E;  1S16 A;  2HFU A;  1FJG I;  4P7A A;  4LF7 I;  1N0V C;  2UU9 I;  2XEX A;  4DV7 E;  2X7I A;  4B3S E;  4JYA E;  1N34 I;  4JI8 E;  2ZBK B;  1PVG A;  3V2U C;  4OX9 E;  1N32 E;  4FWH A;  1S4E A;  4GKK I;  1H72 C; 
#chains in the Genus database with same CATH topology
 1KKH A;  2Z5C A;  1XXE A;  2C37 B;  2ZM6 I;  2PO0 A;  3K1J A;  4UT4 A;  4PU9 A;  4FN5 A;  3T1H E;  2V2Z A;  4GKJ I;  4IFD F;  5LMU I;  4X62 I;  4X65 E;  4JI4 E;  5LL6 R;  4LF8 E;  2UXC I;  4LF4 E;  4JV5 E;  3ZZ0 A;  1HNX E;  4DV2 E;  5JEA C;  1HNZ E;  4IFD D;  3B78 A;  1ZM3 A;  4JI0 E;  2DEJ A;  2IER A;  1BKN A;  2HK3 A;  4MU4 A;  3U1K A;  1H74 A;  4X64 I;  2V8P A;  4DR6 E;  3P3E A;  4NXN I;  2GO4 A;  4LCF A;  5GMD A;  4QNJ A;  4BA1 A;  5IT9 Q;  4B3T I;  2BV3 A;  2NN6 D;  4LCH A;  4NXM I;  3B82 A;  4HY1 A;  4U3D A;  4DR3 E;  1Y60 A;  2VQE I;  4B3R I;  2OI2 A;  1Z0T A;  5K36 F;  5GME A;  2ZIT A;  1MX0 A;  4ISA A;  1XNQ E;  1HK7 A;  3GCM A;  4MU3 A;  4LFC E;  4IZJ A;  1N33 I;  4LF6 E;  4PRV A;  3P06 A;  5C0X B;  3T1Y I;  4DUY E;  5K36 C;  3CDI A;  4AM3 A;  2IOQ A;  4DR1 I;  4ED4 A;  2VF3 A;  2PO0 B;  4K0K I;  5DRO A;  3LPS A;  4JG4 A;  4HAC A;  4DUZ I;  4FWD A;  1Z5C A;  1YHC A;  4DR4 I;  4DV0 E;  1H7S A;  1XHK A;  5IWA E;  3GLL A;  1ELO A;  1N36 E;  2O3Z A;  1NHH A;  2UXD E;  5JEA A;  1KTV A;  4FW9 A;  4LFB I;  3M6A A;  4WUC A;  4B3M I;  1XMQ I;  2CZ9 A;  2UUB I;  4YY3 E;  3LNU A;  1XNR E;  3M85 D;  2GO3 A;  4JI3 I;  3B8H A;  3PS3 A;  1Y6Z A;  2HFS A;  4MYU A;  4JI7 I;  1KIJ A;  2VQF E;  4DV6 E;  1UDQ A;  4DV1 I;  2C39 A;  2IOP A;  4USM A;  4ZVI A;  5LMN I;  4AQY I;  1E3H A;  3B4T A;  5DRP A;  4OO1 F;  1D6T A;  2PO2 A;  2V34 A;  4FW6 A;  4DR5 E;  2PO1 B;  1HR0 I;  3ZZU A;  1IBK I;  4IZJ B;  4DV4 I;  1XMO E;  2JEB B;  5FLX Q;  5K36 A;  4DPY A;  3DD6 A;  2O1T A;  4OO1 C;  4WUD A;  4PRX A;  3K17 A;  1N0U A;  1OJ4 A;  4DXL A;  5DRQ A;  3WU4 A;  4X66 E;  4HAC B;  4LF9 E;  2WP8 B;  4U3B A;  1ZM9 A;  1USU A;  3CWV A;  2BA1 G;  1NZ0 A;  1DAR A;  5JEA B;  2UXB E;  4B3S I;  4M1K A;  4JI8 I;  2PNM A;  4JI2 E;  4FWG A;  4JI1 E;  4OX9 I;  1N32 I;  3NZK A;  2Z5E A;  4DPT A;  4DR7 E;  1VIS A;  1WUU A;  2R42 A;  1Z59 A;  1ZXM A;  3JAM C;  5JEA E;  2CG9 A;  3PYF A;  4YHH E;  1NHI A;  4JI6 I;  2PNZ A;  1RHY A;  2BA1 D;  4KQV A;  1B62 A;  4FW4 A;  2UXC E;  3J80 C;  2C39 B;  2V2Q A;  2X36 A;  2HHH I;  4KHP I;  4IFD C;  4DPX A;  5DRR A;  2JEA B;  2J65 A;  3T1H I;  2BR2 A;  2E5L E;  2NN6 F;  5DNL A;  4FW5 A;  4X65 I;  4JI4 I;  2PO2 B;  3QT6 A;  4I3H A;  4JV5 I;  1Z0G A;  4MYT A;  4LFA E;  3K85 A;  2O1U A;  1HNX I;  5BR8 E;  3D4J A;  4DV2 I;  4OO1 A;  1FKA E;  3L7Z A;  5K36 B;  1A6F A;  2WW4 A;  4AIM A;  2UUA I;  2NN6 C;  4JI0 I;  1FI4 A;  1H73 A;  4EMD A;  4NXM E;  4NBQ A;  4DU7 A;  4B3R E;  4FW3 A;  4DR2 E;  4IZK A;  3ZZT A;  5K36 E;  4LOM A;  3LTO A;  1Y5Y A;  1RR9 A;  1J5E I;  2Z5C B;  4DR3 I;  2V2V A;  1XNQ I;  2VES A;  4DV3 E;  1HNW E;  4MU0 A;  4HYM A;  4DUZ E;  1FNM A;  4DUY I;  2DEI A;  2AE8 A;  1H7U A;  4QNK A;  3P3G A;  4DR4 E;  2F4V I;  3ZKB A;  4IFD A;  2PNZ B;  3WU5 A;  4LF5 E;  2IES A;  1U2R A;  4LCG A;  3ZM7 A;  4AID A;  4Z7C A;  5FWK A;  2C38 A;  5C0X F;  2O1W A;  4IS9 A;  4DV0 I;  1YH8 A;  3ZKD A;  4BA2 A;  1N36 I;  2UXD I;  4RPF A;  4DV5 I;  2UUC E;  1Z0C A;  3PYE A;  1ZM4 A;  5C0X D;  2NN6 A;  4JI7 E;  3L7Z B;  4BA1 B;  3OTO E;  3V5R A;  4YY3 I;  1XNR I;  2LJP A;  4LPF A;  3CDJ A;  4DV1 E;  1FWL A;  1I94 E;  1MG7 A;  3J81 C;  4WUB A;  4JI5 E;  1Z0W A;  1Z5A A;  2PNL A;  2VQF I;  4OO1 E;  4DV6 I;  1IBL E;  4IZK B;  1FJG E;  1VI7 A;  2BA0 G;  5ELW A;  3HUL A;  3QT5 A;  3WU3 A;  4LF7 E;  2UU9 E;  3Q1Q A;  4UTG A;  1IBM I;  4DR5 I;  1QZR A;  1UEK A;  1OYR A;  1N34 E;  1KVK A;  3QT7 A;  1NHJ A;  3QT8 A;  4URL A;  3J7A M;  3GME A;  1Z0V A;  1Z5B A;  2HKE A;  4DV7 I;  2BA0 D;  1MU5 A;  3PRY A;  4JYA I;  4GKK E;  5DNX A;  4IFD B;  4X66 I;  2HKJ A;  3H4L A;  2ZM6 E;  4LF9 I;  2C38 B;  1RRE A;  1K47 A;  2O1V A;  2GS8 A;  2AJ4 A;  1UDO A;  4BA2 B;  4IZJ D;  5C0X A;  4MU1 A;  4GKJ E;  2UXB I;  1Z0B A;  5LMU E;  4X62 E;  4IFD E;  1ZXN A;  3HJC A;  1PIE A;  4OZE A;  1B63 A;  1EA6 A;  4JI2 I;  4DPU A;  4JI1 I;  4MQY A;  4JI6 E;  2NPF A;  3JAM Q;  4DR7 I;  1Y4U A;  2HHH E;  4KHP E;  4R1F A;  2A2D A;  5JEA F;  3PS2 A;  4LF8 I;  4LF4 I;  3J80 Q;  4YHH I;  3GON A;  2NN6 E;  4X64 E;  1Y4S A;  2JE6 A;  1UDN A;  1HNZ I;  4NXN E;  2J7K A;  4DU8 A;  2Z5B A;  5JEA D;  3Q6M A;  4B3T E;  2E5L I;  2UUA E;  1UDS A;  2EFG A;  4J3D A;  5IT9 C;  4DR6 I;  2VQE E;  2JT2 A;  4LFA I;  5BR8 I;  4DPW A;  1N33 E;  2R3V A;  2WNR A;  3H1C A;  3T1Y E;  1ZM2 A;  2BM1 A;  4XTJ A;  1J5E E;  4USK A;  4P52 A;  2A2C A;  4DR1 E;  4LFC I;  4DR2 I;  4K0K E;  4LF6 I;  2PO1 A;  3PYG A;  2JEB A;  3Q6N A;  2E1R A;  4HXZ A;  5K36 D;  3HKM A;  2F4V E;  3M85 G;  4LFB E;  1PKP A;  4DV3 I;  5A2Q C;  1HNW I;  4B3M E;  1XMQ E;  2BR2 B;  2UUB E;  5IWA I;  2WP8 A;  3F0N A;  3J7A G;  5L3J A;  5C0X E;  1EI1 A;  4JI3 E;  4OO1 B;  5A2Q Q;  2HK2 A;  2C37 A;  2JE6 B;  5C0X C;  4DV5 E;  4LF5 I;  1R6L A;  3PYD A;  2Z5B B;  3KRN A;  3WU6 A;  1P42 A;  5LMN E;  4AQY E;  3PS1 A;  5EKW A;  2UUC I;  3M7N G;  2BM0 A;  1Z0E A;  2Q2E B;  4N3O A;  3OTO I;  1HR0 E;  1IBK E;  4DV4 E;  3J81 Q;  1FWK A;  5EL9 A;  3U1Y A;  4OKG A;  2WNR B;  1I94 I;  1USV A;  4JI5 I;  5FLX C;  2GQ0 A;  2F1D A;  3P3C A;  2JEA A;  4Z7Y A;  1XMO I;  1IBL I;  1IBM E;  1S16 A;  2HFU A;  1FJG I;  2CGE A;  4P7A A;  1OYP A;  3M7N D;  3UHM A;  4LF7 I;  1N0V C;  1R6M A;  2UU9 I;  4OO1 D;  2XEX A;  1OYS A;  4DV7 E;  2CVE A;  2X7I A;  4B3S E;  4JYA E;  4MDT A;  1N34 I;  4JI8 E;  2ZBK B;  1PVG A;  3V2U C;  4OX9 E;  1N32 E;  3P76 A;  4FW7 A;  1E3P A;  4FWH A;  4GQU A;  1S4E A;  4GKK I;  2NN6 B;  1H72 C; 
#chains in the Genus database with same CATH homology
 1KKH A;  2Z5C A;  2ZM6 I;  3K1J A;  4UT4 A;  4PU9 A;  4FN5 A;  3T1H E;  2V2Z A;  4GKJ I;  5LMU I;  4X62 I;  4X65 E;  4JI4 E;  5LL6 R;  4LF8 E;  2UXC I;  4LF4 E;  4JV5 E;  3ZZ0 A;  1HNX E;  4DV2 E;  1HNZ E;  3B78 A;  1ZM3 A;  4JI0 E;  2DEJ A;  1BKN A;  2HK3 A;  1H74 A;  4X64 I;  2V8P A;  4DR6 E;  4NXN I;  5GMD A;  5IT9 Q;  4B3T I;  2BV3 A;  4NXM I;  3B82 A;  4HY1 A;  4DR3 E;  2VQE I;  4B3R I;  2OI2 A;  1Z0T A;  5GME A;  2ZIT A;  1MX0 A;  1XNQ E;  1HK7 A;  4LFC E;  4IZJ A;  1N33 I;  4LF6 E;  4PRV A;  3P06 A;  3T1Y I;  4DUY E;  2IOQ A;  4DR1 I;  4ED4 A;  2VF3 A;  4K0K I;  3LPS A;  4JG4 A;  4HAC A;  4DUZ I;  4FWD A;  1Z5C A;  4DR4 I;  4DV0 E;  1H7S A;  1XHK A;  5IWA E;  1ELO A;  1N36 E;  1NHH A;  2UXD E;  1KTV A;  4FW9 A;  4LFB I;  3M6A A;  4WUC A;  4B3M I;  1XMQ I;  2CZ9 A;  2UUB I;  4YY3 E;  3LNU A;  1XNR E;  4JI3 I;  3B8H A;  1Y6Z A;  2HFS A;  4MYU A;  4JI7 I;  1KIJ A;  2VQF E;  4DV6 E;  4DV1 I;  2IOP A;  4USM A;  4ZVI A;  5LMN I;  4AQY I;  1D6T A;  2V34 A;  4DR5 E;  1HR0 I;  3ZZU A;  1IBK I;  4IZJ B;  4DV4 I;  1XMO E;  5FLX Q;  4DPY A;  2O1T A;  4WUD A;  4PRX A;  3K17 A;  1N0U A;  1OJ4 A;  4DXL A;  3WU4 A;  4X66 E;  4HAC B;  4LF9 E;  1ZM9 A;  1USU A;  3CWV A;  1NZ0 A;  1DAR A;  2UXB E;  4B3S I;  4M1K A;  4JI8 I;  2PNM A;  4JI2 E;  4FWG A;  4JI1 E;  4OX9 I;  1N32 I;  2Z5E A;  4DPT A;  4DR7 E;  1VIS A;  1WUU A;  2R42 A;  1Z59 A;  1ZXM A;  3JAM C;  2CG9 A;  3PYF A;  4YHH E;  1NHI A;  4JI6 I;  4KQV A;  1B62 A;  2UXC E;  3J80 C;  2V2Q A;  2X36 A;  2HHH I;  4KHP I;  4DPX A;  3T1H I;  2E5L E;  4X65 I;  4JI4 I;  3QT6 A;  4I3H A;  4JV5 I;  1Z0G A;  4MYT A;  4LFA E;  3K85 A;  2O1U A;  1HNX I;  5BR8 E;  3D4J A;  4DV2 I;  1FKA E;  1A6F A;  2WW4 A;  2UUA I;  4JI0 I;  1FI4 A;  1H73 A;  4EMD A;  4NXM E;  4DU7 A;  4B3R E;  4DR2 E;  4IZK A;  3ZZT A;  3LTO A;  1RR9 A;  1J5E I;  2Z5C B;  4DR3 I;  2V2V A;  1XNQ I;  4DV3 E;  1HNW E;  4HYM A;  4DUZ E;  1FNM A;  4DUY I;  2DEI A;  1H7U A;  4DR4 E;  2F4V I;  3ZKB A;  3WU5 A;  4LF5 E;  3ZM7 A;  1U2R A;  4Z7C A;  5FWK A;  2O1W A;  4DV0 I;  3ZKD A;  1N36 I;  2UXD I;  4RPF A;  4DV5 I;  2UUC E;  1Z0C A;  3PYE A;  1ZM4 A;  4JI7 E;  3OTO E;  3V5R A;  4YY3 I;  1XNR I;  2LJP A;  4DV1 E;  1FWL A;  1I94 E;  1MG7 A;  3J81 C;  4WUB A;  4JI5 E;  1Z0W A;  1Z5A A;  2PNL A;  2VQF I;  4DV6 I;  1IBL E;  4IZK B;  1FJG E;  3HUL A;  3QT5 A;  3WU3 A;  4LF7 E;  2UU9 E;  3Q1Q A;  4UTG A;  1IBM I;  4DR5 I;  1QZR A;  1UEK A;  1N34 E;  1KVK A;  3QT7 A;  1NHJ A;  3QT8 A;  4URL A;  3J7A M;  1Z0V A;  1Z5B A;  2HKE A;  4DV7 I;  1MU5 A;  3PRY A;  4JYA I;  4GKK E;  4X66 I;  2HKJ A;  3H4L A;  2ZM6 E;  4LF9 I;  1RRE A;  1K47 A;  2O1V A;  2GS8 A;  2AJ4 A;  4IZJ D;  4GKJ E;  2UXB I;  1Z0B A;  5LMU E;  4X62 E;  1ZXN A;  3HJC A;  1PIE A;  1B63 A;  1EA6 A;  4JI2 I;  4DPU A;  4JI1 I;  4JI6 E;  2NPF A;  3JAM Q;  4DR7 I;  1Y4U A;  2HHH E;  4KHP E;  4R1F A;  2A2D A;  4LF8 I;  4LF4 I;  3J80 Q;  4YHH I;  3GON A;  4X64 E;  1Y4S A;  1HNZ I;  4NXN E;  2J7K A;  4DU8 A;  2Z5B A;  3Q6M A;  4B3T E;  2E5L I;  2UUA E;  2EFG A;  5IT9 C;  4DR6 I;  2VQE E;  4LFA I;  5BR8 I;  4DPW A;  1N33 E;  2R3V A;  3T1Y E;  1ZM2 A;  2BM1 A;  4XTJ A;  1J5E E;  4USK A;  4P52 A;  2A2C A;  4DR1 E;  4LFC I;  4DR2 I;  4K0K E;  4LF6 I;  3PYG A;  3Q6N A;  2E1R A;  4HXZ A;  2F4V E;  4LFB E;  1PKP A;  4DV3 I;  5A2Q C;  1HNW I;  4B3M E;  1XMQ E;  2UUB E;  5IWA I;  3F0N A;  3J7A G;  5L3J A;  1EI1 A;  4JI3 E;  5A2Q Q;  2HK2 A;  4LF5 I;  4DV5 E;  3PYD A;  2Z5B B;  3WU6 A;  5LMN E;  4AQY E;  2UUC I;  2BM0 A;  1Z0E A;  2Q2E B;  4N3O A;  3OTO I;  1HR0 E;  1IBK E;  4DV4 E;  3J81 Q;  1FWK A;  1I94 I;  1USV A;  4JI5 I;  5FLX C;  2GQ0 A;  4Z7Y A;  1XMO I;  1IBL I;  1IBM E;  1S16 A;  2HFU A;  1FJG I;  2CGE A;  4P7A A;  4LF7 I;  1N0V C;  2UU9 I;  2XEX A;  4DV7 E;  2X7I A;  4B3S E;  4JYA E;  1N34 I;  4JI8 E;  2ZBK B;  1PVG A;  3V2U C;  4OX9 E;  1N32 E;  4FWH A;  1S4E A;  4GKK I;  1H72 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...