1Z0GA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
198
structure length
195
Chain Sequence
b'KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 56
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0gA00
4LF4E 3CWVA 4B3ME 4JI0E 3J81Q 4X65E 1S4EA 3J7AM 1B63A 5LL6R 4B3SI 4R1FA 2V2ZA 2VQEI 4YHHE 1I94I 4X66E 2UU9E 1ZXNA 1N32I 4DR6E 1KTVA 4DR1E 5LMNI 1IBKE 4X65I 1IBLE 1Z0BA 1H74A 4JV5I 3PYEA 4GKJE 1N33E 1Z5CA 4DR2I 1J5EE 4B3TI 2UU9I 4DR6I 4K0KE 4DV6I 1IBLI 3QT5A 5IT9C 2NPFA 3B78A 1XNRI 1ZM2A 1Z0CA 2F4VE 4LF6I 3ZZ0A 1N33I 2CZ9A 1FKAE 3PYDA 4B3RE 2R42A 3D4JA 2E5LE 1Z0GA 4NXNE 4HXZA 4DV1I 2V34A 4JI1E 1XMQE 4PRXA 3K17A 2F4VI 1Z5AA 5IWAI 4DR4I 1ZM3A 1EI1A 1BKNA 1B62A 5FLXQ 3QT7A 1H73A 2HFUA 3J7AG 4NXNI 4KHPE 2A2DA 1OJ4A 1FI4A 2X7IA 4DV2E 4FWHA 4JI2E 4LF8I 1EA6A 1XNQE 5LMUE 4DV7E 4KHPI 3ZZTA 4LFBI 4JI8I 1N34E 1Z0WA 3QT8A 4JI5I 4PRVA 4DUYI 3J80C 1HNZI 1KKHA 1N36I 2HK2A 2LJPA 3V2UC 3WU5A 4DU8A 5LMUI 4DV5E 1PIEA 4RPFA 4JYAI 1HR0I 1NZ0A 3PYFA 2UXDE 1ZM4A 1NHHA 2OI2A 4NXME 2HFSA 1Z0EA 4UT4A 4PU9A 4MYUA 4URLA 4DV5I 4JI4I 4JI7E 2ZITA 4I3HA 2UXDI 2ZM6I 4LF4I 4JI0I 4B3MI 1PKPA 4AQYE 1U2RA 2A2CA 2R3VA 1FJGE 4DXLA 4WUDA 4YHHI 4DPUA 4X66I 4LF9E 2EFGA 3K1JA 1Z0TA 1H7UA 3B8HA 4LFCE 3JAMC 2UXCE 4DR1I 1IBKI 4XTJA 4M1KA 4ED4A 4GKJI 1J5EI 1HNWE 1PVGA 2UXCI 4K0KI 4EMDA 4FW9A 2V2VA 2BV3A 4LF7E 4DV3E 3H4LA 1HNXE 3OTOE 3F0NA 3T1YE 4HACA 1NHIA 4B3RI 4JI3E 2E5LI 4Z7CA 1QZRA 4HY1A 1UEKA 2HHHE 3T1HE 2E1RA 4WUBA 4DV3I 4JI1I 1XMQI 3J81C 2WW4A 4KQVA 4JI6E 1KVKA 4DUZE 5BR8E 4HACB 4LFAE 4P7AA 3ZZUA 2DEIA 1RR9A 3WU4A 4DV2I 4FWDA 5A2QQ 4JI2I 2HK3A 4DR3E 1D6TA 5IT9Q 2UUCE 1XNQI 5L3JA 3WU3A 1K47A 2UXBE 5BR8I 4DV7I 4LFAI 1N34I 4MYTA 3ZKDA 2BM1A 4DR7E 3LPSA 4X62E 1FWKA 3M6AA 4DV4E 2UUCI 1MX0A 4P52A 3LNUA 4B3SE 5GMEA 1VISA 1ZM9A 2Q2EB 2VQEE 4DR7I 1XMOE 2V8PA 3ZM7A 1N32E 4DPTA 4NXMI 4YY3E 4X64E 2BM0A 4DPWA 5LMNE 5FLXC 1H72C 1H7SA 3PYGA 4USMA 4JV5E 4JI7I 3V5RA 1FNMA 1N0VC 1MU5A 4DU7A 4DR2E 3HULA 4B3TE 1XMOI 4YY3I 4JG4A 4X64I 4AQYI 4OX9E 4DV6E 3J80Q 1XNRE 1FJGI 1ELOA 1RREA 4LF6E 2ZBKB 2UUBE 4DV0E 4LF9I 1FWLA 3QT6A 4LFCI 2AJ4A 4UTGA 4WUCA 4OX9I 5A2QC 4HYMA 4DV1E 2DEJA 1ZXMA 2XEXA 1WUUA 5IWAE 4DR4E 2UUBI 4DV0I 4GKKE 1HNWI 4DR5E 1IBME 5GMDA 4DPXA 4LF7I 1HNXI 1MG7A 3OTOI 1DARA 3T1YI 2J7KA 4USKA 1NHJA 4FWGA 4JI3I 1Z59A 4LF8E 3Q1QA 4GKKI 2UUAE 2V2QA 2GS8A 4DR5I 2HHHI 1S16A 1IBMI 3T1HI 4LFBE 3WU6A 4JI8E 3JAMQ 4JI5E 4DUYE 4DPYA 1HNZE 1N36E 1Z0VA 4JI6I 3LTOA 2UUAI 4FN5A 4DUZI 4LF5E 3GONA 2HKJA 4JYAE 1XHKA 1HR0E 3B82A 4DR3I 2VQFE 1A6FA 2VF3A 1N0UA 2UXBI 3ZKBA 4Z7YA 4LF5I 1KIJA 2HKEA 4JI4E 4ZVIA 1I94E 4X62I 2X36A 2ZM6E 1Z5BA 4DV4I 2VQFI
chains in the Genus database with same CATH superfamily
5K36A 4LF4E 5FWKA 2JEAB 4IFDE 3CWVA 4B3ME 4JI0E 2WNRB 3J81Q 4X65E 1USUA 1S4EA 1UDQA 3J7AM 1B63A 5LL6R 4B3SI 1P42A 4R1FA 2C39A 4IZJB 2V2ZA 3P3GA 3M85G 2VQEI 4YHHE 1I94I 4X66E 2UU9E 1ZXNA 3L7ZB 1N32I 5DRRA 5DRPA 4DR6E 2PO1B 1KTVA 4DR1E 4IZKB 5LMNI 1IBKE 4X65I 1IBLE 3GLLA 1Z0BA 5K36B 1H74A 1Y4SA 4JV5I 3NZKA 3PYEA 4GKJE 3PS1A 3PS2A 1N33E 1Z5CA 3K85A 4DR2I 2GQ0A 1J5EE 4B3TI 2C39B 2UU9I 1R6MA 4DR6I 4K0KE 4DV6I 1IBLI 4FW7A 4QNKA 2PO0A 3QT5A 4LPFA 2NPFA 3B78A 5IT9C 1XNRI 4IFDC 1ZM2A 1Z0CA 2F4VE 4LF6I 3ZZ0A 1RHYA 1N33I 2CZ9A 1FKAE 3PYDA 4B3RE 2R42A 3D4JA 2E5LE 1Z0GA 4NXNE 2NN6E 2VESA 5DRQA 4IFDA 4HXZA 1E3HA 4DV1I 2V34A 4AIDA 4JI1E 2IOQA 4PRXA 1XMQE 3K17A 2F4VI 1Z5AA 5IWAI 4DR4I 1ZM3A 1EI1A 2CG9A 1BKNA 1B62A 5FLXQ 3QT7A 5EL9A 1UDSA 1H73A 2HFUA 3J7AG 4NXNI 1Y6ZA 2JE6A 4KHPE 5JEAD 1Y5YA 2A2DA 4IFDB 4FW6A 1OJ4A 1FI4A 2X7IA 1XXEA 4DV2E 4FWHA 4JI2E 4BA1A 4LF8I 4OO1F 1EA6A 1XNQE 5LMUE 4DV7E 4KHPI 3U1YA 3ZZTA 4LFBI 4JI8I 2JEAA 1UDOA 2NN6C 1N34E 1Z0WA 3QT8A 1OYRA 4PRVA 4DUYI 2JE6B 4JI5I 3J80C 1HNZI 1KKHA 2Z5CA 1N36I 2HK2A 4MU1A 2LJPA 2NN6A 3V2UC 4IZJD 3WU5A 4BA1B 4DU8A 5LMUI 2PO2A 4DV5E 1PIEA 4RPFA 4FW4A 2CVEA 4JYAI 3HJCA 1NZ0A 1HR0I 3PYFA 2UXDE 1ZM4A 1NHHA 2OI2A 5C0XF 2PNMA 4NXME 2IOPA 2HFSA 5K36D 1VI7A 4LCHA 1Z0EA 4UT4A 5DROA 4PU9A 2Z5CB 4MYUA 4URLA 4DV5I 4JI4I 2NN6B 2O1UA 4JI7E 2ZITA 4I3HA 2JT2A 2AE8A 2PO2B 2ZM6I 2UXDI 2BA0D 1HK7A 4LF4I 4JI0I 4B3MI 1PKPA 4AQYE 1U2RA 4FW3A 3UHMA 2A2CA 2R3VA 1FJGE 4DXLA 2WP8A 3U1KA 4WUDA 4OKGA 1UDNA 4YHHI 3HKMA 4DPUA 4AIMA 4X66I 4LF9E 2EFGA 3K1JA 1OYSA 1Z0TA 1H7UA 3B8HA 4LFCE 3JAMC 2UXCE 4DR1I 1IBKI 4XTJA 4M1KA 4OO1E 4LCFA 4ED4A 4GKJI 5EKWA 1USVA 3Q6NA 1J5EI 1HNWE 1PVGA 2WP8B 2UXCI 4K0KI 4GKKI 3PS3A 4EMDA 4FW5A 4FW9A 4IFDD 2V2VA 2BV3A 4LF7E 4DV3E 2PNLA 3H4LA 1HNXE 2Z5EA 3OTOE 3F0NA 3T1YE 4HACA 1NHIA 4B3RI 4U3BA 4JI3E 4MDTA 2E5LI 4Z7CA 1QZRA 4HY1A 1UEKA 2HHHE 3T1HE 3KRNA 4U3DA 5C0XE 2C38A 4QNJA 2JEBA 2PNZA 4WUBA 2E1RA 4DV3I 4JI1I 1XMQI 3J81C 3P76A 5JEAF 4LCGA 2WW4A 5DNLA 2O1TA 2O3ZA 4OO1C 4KQVA 4JI6E 4BA2A 1KVKA 2GO4A 4DUZE 5BR8E 4HACB 4LFAE 4P7AA 3ZZUA 2DEIA 1RR9A 4OO1A 3WU4A 4DV2I 4FWDA 5A2QQ 2C38B 4JI2I 2HK3A 4LOMA 3GMEA 4DR3E 2JEBB 2PNZB 1D6TA 4MU4A 5IT9Q 2UUCE 1XNQI 5L3JA 3WU3A 1K47A 2UXBE 5BR8I 2NN6D 4IS9A 4DV7I 4LFAI 3Q6MA 3P06A 4BA2B 1N34I 4MYTA 3ZKDA 1Y4UA 2BM1A 2IESA 4DR7E 3LPSA 4X62E 1FWKA 4OZEA 3M6AA 5C0XC 4DV4E 2BA0G 4OO1B 2UUCI 1MX0A 4P52A 3LNUA 4B3SE 5GMEA 1VISA 1ZM9A 2Q2EB 5C0XA 5K36F 2VQEE 3PRYA 2BA1D 2O1VA 4DR7I 1XMOE 3P3EA 2V8PA 3ZM7A 4AM3A 1N32E 4DPTA 4NXMI 4YY3E 4X64E 2BM0A 4DPWA 5LMNE 5FLXC 1H72C 1H7SA 3PYGA 4USMA 3M7ND 4JV5E 4JI7I 3V5RA 3GCMA 1FNMA 1N0VC 1MU5A 4DU7A 4DR2E 3HULA 5C0XB 2BR2A 4B3TE 1XMOI 4YY3I 5JEAE 4JG4A 2CGEA 4X64I 4AQYI 4OX9E 4DV6E 5DNXA 3J80Q 1XNRE 3M85D 1FJGI 2IERA 1Y60A 1ELOA 1RREA 4LF6E 2ZBKB 2UUBE 4DV0E 4LF9I 1FWLA 3QT6A 4ISAA 4LFCI 2AJ4A 2Z5BA 4UTGA 4WUCA 4OX9I 5A2QC 2BR2B 4HYMA 4DV1E 2DEJA 2F1DA 2GO3A 1ZXMA 2XEXA 4IFDF 1WUUA 5IWAE 4DR4E 3CDJA 4N3OA 3DD6A 4DV0I 2UUBI 4GKKE 1HNWI 4DR5E 5ELWA 1OYPA 4MU0A 1IBME 5GMDA 4DPXA 4LF7I 2Z5BB 5JEAC 2O1WA 1HNXI 4MQYA 1MG7A 1YH8A 3OTOI 1DARA 3T1YI 2J7KA 2PO0B 5K36E 3H1CA 4USKA 1NHJA 1E3PA 4FWGA 1Z59A 2C37A 4NBQA 4JI3I 4LF8E 2J65A 2UUAE 3Q1QA 2V2QA 3B4TA 2GS8A 4DR5I 2HHHI 1S16A 5JEAA 1IBMI 3T1HI 4GQUA 4LFBE 3WU6A 4JI8E 3JAMQ 4JI5E 4DUYE 4DPYA 4OO1D 1HNZE 3P3CA 1N36E 1Z0VA 4JI6I 3LTOA 4J3DA 2UUAI 4FN5A 4DUZI 1R6LA 2C37B 4LF5E 3GONA 2HKJA 4JYAE 2NN6F 5JEAB 1XHKA 2WNRA 1HR0E 3CDIA 2BA1G 3B82A 4DR3I 1YHCA 2VQFE 1A6FA 2VF3A 4IZJA 1N0UA 2UXBI 5K36C 3ZKBA 4Z7YA 4LF5I 1KIJA 3L7ZA 2HKEA 4JI4E 5C0XD 2PO1A 4ZVIA 1I94E 3M7NG 4IZKA 4X62I 2X36A 2ZM6E 4MU3A 1Z5BA 4DV4I 2VQFI
chains in the Genus database with same CATH topology
4LF4E 5FWKA 3CWVA 4B3ME 4JI0E 3J81Q 4X65E 1USUA 1S4EA 3J7AM 1B63A 5LL6R 4B3SI 4R1FA 4IZJB 2V2ZA 2VQEI 4YHHE 1I94I 4X66E 2UU9E 1ZXNA 1N32I 4DR6E 1KTVA 4DR1E 4IZKB 5LMNI 1IBKE 4X65I 1IBLE 1Z0BA 1H74A 1Y4SA 4JV5I 3PYEA 4GKJE 1N33E 1Z5CA 3K85A 4DR2I 2GQ0A 1J5EE 4B3TI 2UU9I 4DR6I 4K0KE 4DV6I 1IBLI 3QT5A 5IT9C 2NPFA 3B78A 1XNRI 1ZM2A 1Z0CA 2F4VE 4LF6I 3ZZ0A 1N33I 2CZ9A 1FKAE 3PYDA 4B3RE 2R42A 3D4JA 2E5LE 1Z0GA 4NXNE 4HXZA 4DV1I 2V34A 4JI1E 2IOQA 4PRXA 1XMQE 3K17A 2F4VI 1Z5AA 5IWAI 4DR4I 1ZM3A 1EI1A 2CG9A 1BKNA 1B62A 5FLXQ 3QT7A 1H73A 2HFUA 3J7AG 4NXNI 1Y6ZA 4KHPE 2A2DA 1OJ4A 1FI4A 2X7IA 4DV2E 4FWHA 4JI2E 4LF8I 1EA6A 1XNQE 5LMUE 4DV7E 4KHPI 3ZZTA 4LFBI 4JI8I 1N34E 1Z0WA 3QT8A 4JI5I 4PRVA 4DUYI 3J80C 1HNZI 1KKHA 2Z5CA 1N36I 2HK2A 2LJPA 3V2UC 4IZJD 3WU5A 4DU8A 5LMUI 4DV5E 1PIEA 4RPFA 4JYAI 3HJCA 1NZ0A 1HR0I 3PYFA 2UXDE 1ZM4A 1NHHA 2OI2A 2PNMA 4NXME 2IOPA 2HFSA 1Z0EA 4UT4A 4PU9A 2Z5CB 4MYUA 4URLA 4DV5I 4JI4I 2O1UA 4JI7E 2ZITA 4I3HA 2UXDI 2ZM6I 1HK7A 4LF4I 4JI0I 4B3MI 1PKPA 4AQYE 1U2RA 2A2CA 2R3VA 1FJGE 4DXLA 4WUDA 4YHHI 4DPUA 4X66I 4LF9E 2EFGA 3K1JA 1Z0TA 1H7UA 3B8HA 4LFCE 3JAMC 2UXCE 4DR1I 1IBKI 4XTJA 4M1KA 4ED4A 4GKJI 1USVA 3Q6NA 1J5EI 1HNWE 1PVGA 2UXCI 4K0KI 4EMDA 4FW9A 2V2VA 2BV3A 4LF7E 4DV3E 2PNLA 3H4LA 1HNXE 2Z5EA 3OTOE 3F0NA 3T1YE 4HACA 1NHIA 4B3RI 4JI3E 2E5LI 4Z7CA 1QZRA 4HY1A 1UEKA 2HHHE 3T1HE 2E1RA 4WUBA 4DV3I 4JI1I 1XMQI 3J81C 2WW4A 2O1TA 4KQVA 4JI6E 1KVKA 4DUZE 5BR8E 4HACB 4LFAE 4P7AA 3ZZUA 2DEIA 1RR9A 3WU4A 4DV2I 4FWDA 5A2QQ 4JI2I 2HK3A 4DR3E 1D6TA 5IT9Q 2UUCE 1XNQI 5L3JA 3WU3A 1K47A 2UXBE 5BR8I 4DV7I 4LFAI 3Q6MA 3P06A 1N34I 4MYTA 3ZKDA 1Y4UA 2BM1A 4DR7E 3LPSA 4X62E 1FWKA 3M6AA 4DV4E 2UUCI 1MX0A 4P52A 3LNUA 4B3SE 5GMEA 1VISA 1ZM9A 2Q2EB 2VQEE 3PRYA 2O1VA 4DR7I 1XMOE 2V8PA 3ZM7A 1N32E 4DPTA 4NXMI 4YY3E 4X64E 2BM0A 4DPWA 5LMNE 5FLXC 1H72C 1H7SA 3PYGA 4USMA 4JV5E 4JI7I 3V5RA 1FNMA 1N0VC 1MU5A 4DU7A 4DR2E 3HULA 4B3TE 1XMOI 4YY3I 4JG4A 2CGEA 4X64I 4AQYI 4OX9E 4DV6E 3J80Q 1XNRE 1FJGI 1ELOA 1RREA 4LF6E 2ZBKB 2UUBE 4DV0E 4LF9I 1FWLA 3QT6A 4LFCI 2AJ4A 2Z5BA 4UTGA 4WUCA 4OX9I 5A2QC 4HYMA 4DV1E 2DEJA 1ZXMA 2XEXA 1WUUA 5IWAE 4DR4E 4N3OA 2UUBI 4DV0I 4GKKE 1HNWI 4DR5E 1IBME 5GMDA 4DPXA 4LF7I 2Z5BB 2O1WA 1HNXI 1MG7A 3OTOI 1DARA 3T1YI 2J7KA 4USKA 1NHJA 4FWGA 4JI3I 1Z59A 4LF8E 3Q1QA 4GKKI 2UUAE 2V2QA 2GS8A 4DR5I 2HHHI 1S16A 1IBMI 3T1HI 4LFBE 3WU6A 4JI8E 3JAMQ 4JI5E 4DUYE 4DPYA 1HNZE 1N36E 1Z0VA 4JI6I 3LTOA 2UUAI 4FN5A 4DUZI 4LF5E 3GONA 2HKJA 4JYAE 1XHKA 1HR0E 3B82A 4DR3I 2VQFE 1A6FA 2VF3A 4IZJA 1N0UA 2UXBI 3ZKBA 4Z7YA 4LF5I 1KIJA 2HKEA 4JI4E 4ZVIA 1I94E 4IZKA 4X62I 2X36A 2ZM6E 1Z5BA 4DV4I 2VQFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 E;  3CWV A;  4B3M E;  4JI0 E;  3J81 Q;  4X65 E;  1S4E A;  3J7A M;  1B63 A;  5LL6 R;  4B3S I;  4R1F A;  2V2Z A;  2VQE I;  4YHH E;  1I94 I;  4X66 E;  2UU9 E;  1ZXN A;  1N32 I;  4DR6 E;  1KTV A;  4DR1 E;  5LMN I;  1IBK E;  4X65 I;  1IBL E;  1Z0B A;  1H74 A;  4JV5 I;  3PYE A;  4GKJ E;  1N33 E;  1Z5C A;  4DR2 I;  1J5E E;  4B3T I;  2UU9 I;  4DR6 I;  4K0K E;  4DV6 I;  1IBL I;  3QT5 A;  5IT9 C;  2NPF A;  3B78 A;  1XNR I;  1ZM2 A;  1Z0C A;  2F4V E;  4LF6 I;  3ZZ0 A;  1N33 I;  2CZ9 A;  1FKA E;  3PYD A;  4B3R E;  2R42 A;  3D4J A;  2E5L E;  1Z0G A;  4NXN E;  4HXZ A;  4DV1 I;  2V34 A;  4JI1 E;  1XMQ E;  4PRX A;  3K17 A;  2F4V I;  1Z5A A;  5IWA I;  4DR4 I;  1ZM3 A;  1EI1 A;  1BKN A;  1B62 A;  5FLX Q;  3QT7 A;  1H73 A;  2HFU A;  3J7A G;  4NXN I;  4KHP E;  2A2D A;  1OJ4 A;  1FI4 A;  2X7I A;  4DV2 E;  4FWH A;  4JI2 E;  4LF8 I;  1EA6 A;  1XNQ E;  5LMU E;  4DV7 E;  4KHP I;  3ZZT A;  4LFB I;  4JI8 I;  1N34 E;  1Z0W A;  3QT8 A;  4JI5 I;  4PRV A;  4DUY I;  3J80 C;  1HNZ I;  1KKH A;  1N36 I;  2HK2 A;  2LJP A;  3V2U C;  3WU5 A;  4DU8 A;  5LMU I;  4DV5 E;  1PIE A;  4RPF A;  4JYA I;  1HR0 I;  1NZ0 A;  3PYF A;  2UXD E;  1ZM4 A;  1NHH A;  2OI2 A;  4NXM E;  2HFS A;  1Z0E A;  4UT4 A;  4PU9 A;  4MYU A;  4URL A;  4DV5 I;  4JI4 I;  4JI7 E;  2ZIT A;  4I3H A;  2UXD I;  2ZM6 I;  4LF4 I;  4JI0 I;  4B3M I;  1PKP A;  4AQY E;  1U2R A;  2A2C A;  2R3V A;  1FJG E;  4DXL A;  4WUD A;  4YHH I;  4DPU A;  4X66 I;  4LF9 E;  2EFG A;  3K1J A;  1Z0T A;  1H7U A;  3B8H A;  4LFC E;  3JAM C;  2UXC E;  4DR1 I;  1IBK I;  4XTJ A;  4M1K A;  4ED4 A;  4GKJ I;  1J5E I;  1HNW E;  1PVG A;  2UXC I;  4K0K I;  4EMD A;  4FW9 A;  2V2V A;  2BV3 A;  4LF7 E;  4DV3 E;  3H4L A;  1HNX E;  3OTO E;  3F0N A;  3T1Y E;  4HAC A;  1NHI A;  4B3R I;  4JI3 E;  2E5L I;  4Z7C A;  1QZR A;  4HY1 A;  1UEK A;  2HHH E;  3T1H E;  2E1R A;  4WUB A;  4DV3 I;  4JI1 I;  1XMQ I;  3J81 C;  2WW4 A;  4KQV A;  4JI6 E;  1KVK A;  4DUZ E;  5BR8 E;  4HAC B;  4LFA E;  4P7A A;  3ZZU A;  2DEI A;  1RR9 A;  3WU4 A;  4DV2 I;  4FWD A;  5A2Q Q;  4JI2 I;  2HK3 A;  4DR3 E;  1D6T A;  5IT9 Q;  2UUC E;  1XNQ I;  5L3J A;  3WU3 A;  1K47 A;  2UXB E;  5BR8 I;  4DV7 I;  4LFA I;  1N34 I;  4MYT A;  3ZKD A;  2BM1 A;  4DR7 E;  3LPS A;  4X62 E;  1FWK A;  3M6A A;  4DV4 E;  2UUC I;  1MX0 A;  4P52 A;  3LNU A;  4B3S E;  5GME A;  1VIS A;  1ZM9 A;  2Q2E B;  2VQE E;  4DR7 I;  1XMO E;  2V8P A;  3ZM7 A;  1N32 E;  4DPT A;  4NXM I;  4YY3 E;  4X64 E;  2BM0 A;  4DPW A;  5LMN E;  5FLX C;  1H72 C;  1H7S A;  3PYG A;  4USM A;  4JV5 E;  4JI7 I;  3V5R A;  1FNM A;  1N0V C;  1MU5 A;  4DU7 A;  4DR2 E;  3HUL A;  4B3T E;  1XMO I;  4YY3 I;  4JG4 A;  4X64 I;  4AQY I;  4OX9 E;  4DV6 E;  3J80 Q;  1XNR E;  1FJG I;  1ELO A;  1RRE A;  4LF6 E;  2ZBK B;  2UUB E;  4DV0 E;  4LF9 I;  1FWL A;  3QT6 A;  4LFC I;  2AJ4 A;  4UTG A;  4WUC A;  4OX9 I;  5A2Q C;  4HYM A;  4DV1 E;  2DEJ A;  1ZXM A;  2XEX A;  1WUU A;  5IWA E;  4DR4 E;  2UUB I;  4DV0 I;  4GKK E;  1HNW I;  4DR5 E;  1IBM E;  5GMD A;  4DPX A;  4LF7 I;  1HNX I;  1MG7 A;  3OTO I;  1DAR A;  3T1Y I;  2J7K A;  4USK A;  1NHJ A;  4FWG A;  4JI3 I;  1Z59 A;  4LF8 E;  3Q1Q A;  4GKK I;  2UUA E;  2V2Q A;  2GS8 A;  4DR5 I;  2HHH I;  1S16 A;  1IBM I;  3T1H I;  4LFB E;  3WU6 A;  4JI8 E;  3JAM Q;  4JI5 E;  4DUY E;  4DPY A;  1HNZ E;  1N36 E;  1Z0V A;  4JI6 I;  3LTO A;  2UUA I;  4FN5 A;  4DUZ I;  4LF5 E;  3GON A;  2HKJ A;  4JYA E;  1XHK A;  1HR0 E;  3B82 A;  4DR3 I;  2VQF E;  1A6F A;  2VF3 A;  1N0U A;  2UXB I;  3ZKB A;  4Z7Y A;  4LF5 I;  1KIJ A;  2HKE A;  4JI4 E;  4ZVI A;  1I94 E;  4X62 I;  2X36 A;  2ZM6 E;  1Z5B A;  4DV4 I;  2VQF I; 
#chains in the Genus database with same CATH topology
 5K36 A;  4LF4 E;  5FWK A;  2JEA B;  4IFD E;  3CWV A;  4B3M E;  4JI0 E;  2WNR B;  3J81 Q;  4X65 E;  1USU A;  1S4E A;  1UDQ A;  3J7A M;  1B63 A;  5LL6 R;  4B3S I;  1P42 A;  4R1F A;  2C39 A;  4IZJ B;  2V2Z A;  3P3G A;  3M85 G;  2VQE I;  4YHH E;  1I94 I;  4X66 E;  2UU9 E;  1ZXN A;  3L7Z B;  1N32 I;  5DRR A;  5DRP A;  4DR6 E;  2PO1 B;  1KTV A;  4DR1 E;  4IZK B;  5LMN I;  1IBK E;  4X65 I;  1IBL E;  3GLL A;  1Z0B A;  5K36 B;  1H74 A;  1Y4S A;  4JV5 I;  3NZK A;  3PYE A;  4GKJ E;  3PS1 A;  3PS2 A;  1N33 E;  1Z5C A;  3K85 A;  4DR2 I;  2GQ0 A;  1J5E E;  4B3T I;  2C39 B;  2UU9 I;  1R6M A;  4DR6 I;  4K0K E;  4DV6 I;  1IBL I;  4FW7 A;  4QNK A;  2PO0 A;  3QT5 A;  4LPF A;  2NPF A;  3B78 A;  5IT9 C;  1XNR I;  4IFD C;  1ZM2 A;  1Z0C A;  2F4V E;  4LF6 I;  3ZZ0 A;  1RHY A;  1N33 I;  2CZ9 A;  1FKA E;  3PYD A;  4B3R E;  2R42 A;  3D4J A;  2E5L E;  1Z0G A;  4NXN E;  2NN6 E;  2VES A;  5DRQ A;  4IFD A;  4HXZ A;  1E3H A;  4DV1 I;  2V34 A;  4AID A;  4JI1 E;  2IOQ A;  4PRX A;  1XMQ E;  3K17 A;  2F4V I;  1Z5A A;  5IWA I;  4DR4 I;  1ZM3 A;  1EI1 A;  2CG9 A;  1BKN A;  1B62 A;  5FLX Q;  3QT7 A;  5EL9 A;  1UDS A;  1H73 A;  2HFU A;  3J7A G;  4NXN I;  1Y6Z A;  2JE6 A;  4KHP E;  5JEA D;  1Y5Y A;  2A2D A;  4IFD B;  4FW6 A;  1OJ4 A;  1FI4 A;  2X7I A;  1XXE A;  4DV2 E;  4FWH A;  4JI2 E;  4BA1 A;  4LF8 I;  4OO1 F;  1EA6 A;  1XNQ E;  5LMU E;  4DV7 E;  4KHP I;  3U1Y A;  3ZZT A;  4LFB I;  4JI8 I;  2JEA A;  1UDO A;  2NN6 C;  1N34 E;  1Z0W A;  3QT8 A;  1OYR A;  4PRV A;  4DUY I;  2JE6 B;  4JI5 I;  3J80 C;  1HNZ I;  1KKH A;  2Z5C A;  1N36 I;  2HK2 A;  4MU1 A;  2LJP A;  2NN6 A;  3V2U C;  4IZJ D;  3WU5 A;  4BA1 B;  4DU8 A;  5LMU I;  2PO2 A;  4DV5 E;  1PIE A;  4RPF A;  4FW4 A;  2CVE A;  4JYA I;  3HJC A;  1NZ0 A;  1HR0 I;  3PYF A;  2UXD E;  1ZM4 A;  1NHH A;  2OI2 A;  5C0X F;  2PNM A;  4NXM E;  2IOP A;  2HFS A;  5K36 D;  1VI7 A;  4LCH A;  1Z0E A;  4UT4 A;  5DRO A;  4PU9 A;  2Z5C B;  4MYU A;  4URL A;  4DV5 I;  4JI4 I;  2NN6 B;  2O1U A;  4JI7 E;  2ZIT A;  4I3H A;  2JT2 A;  2AE8 A;  2PO2 B;  2ZM6 I;  2UXD I;  2BA0 D;  1HK7 A;  4LF4 I;  4JI0 I;  4B3M I;  1PKP A;  4AQY E;  1U2R A;  4FW3 A;  3UHM A;  2A2C A;  2R3V A;  1FJG E;  4DXL A;  2WP8 A;  3U1K A;  4WUD A;  4OKG A;  1UDN A;  4YHH I;  3HKM A;  4DPU A;  4AIM A;  4X66 I;  4LF9 E;  2EFG A;  3K1J A;  1OYS A;  1Z0T A;  1H7U A;  3B8H A;  4LFC E;  3JAM C;  2UXC E;  4DR1 I;  1IBK I;  4XTJ A;  4M1K A;  4OO1 E;  4LCF A;  4ED4 A;  4GKJ I;  5EKW A;  1USV A;  3Q6N A;  1J5E I;  1HNW E;  1PVG A;  2WP8 B;  2UXC I;  4K0K I;  4GKK I;  3PS3 A;  4EMD A;  4FW5 A;  4FW9 A;  4IFD D;  2V2V A;  2BV3 A;  4LF7 E;  4DV3 E;  2PNL A;  3H4L A;  1HNX E;  2Z5E A;  3OTO E;  3F0N A;  3T1Y E;  4HAC A;  1NHI A;  4B3R I;  4U3B A;  4JI3 E;  4MDT A;  2E5L I;  4Z7C A;  1QZR A;  4HY1 A;  1UEK A;  2HHH E;  3T1H E;  3KRN A;  4U3D A;  5C0X E;  2C38 A;  4QNJ A;  2JEB A;  2PNZ A;  4WUB A;  2E1R A;  4DV3 I;  4JI1 I;  1XMQ I;  3J81 C;  3P76 A;  5JEA F;  4LCG A;  2WW4 A;  5DNL A;  2O1T A;  2O3Z A;  4OO1 C;  4KQV A;  4JI6 E;  4BA2 A;  1KVK A;  2GO4 A;  4DUZ E;  5BR8 E;  4HAC B;  4LFA E;  4P7A A;  3ZZU A;  2DEI A;  1RR9 A;  4OO1 A;  3WU4 A;  4DV2 I;  4FWD A;  5A2Q Q;  2C38 B;  4JI2 I;  2HK3 A;  4LOM A;  3GME A;  4DR3 E;  2JEB B;  2PNZ B;  1D6T A;  4MU4 A;  5IT9 Q;  2UUC E;  1XNQ I;  5L3J A;  3WU3 A;  1K47 A;  2UXB E;  5BR8 I;  2NN6 D;  4IS9 A;  4DV7 I;  4LFA I;  3Q6M A;  3P06 A;  4BA2 B;  1N34 I;  4MYT A;  3ZKD A;  1Y4U A;  2BM1 A;  2IES A;  4DR7 E;  3LPS A;  4X62 E;  1FWK A;  4OZE A;  3M6A A;  5C0X C;  4DV4 E;  2BA0 G;  4OO1 B;  2UUC I;  1MX0 A;  4P52 A;  3LNU A;  4B3S E;  5GME A;  1VIS A;  1ZM9 A;  2Q2E B;  5C0X A;  5K36 F;  2VQE E;  3PRY A;  2BA1 D;  2O1V A;  4DR7 I;  1XMO E;  3P3E A;  2V8P A;  3ZM7 A;  4AM3 A;  1N32 E;  4DPT A;  4NXM I;  4YY3 E;  4X64 E;  2BM0 A;  4DPW A;  5LMN E;  5FLX C;  1H72 C;  1H7S A;  3PYG A;  4USM A;  3M7N D;  4JV5 E;  4JI7 I;  3V5R A;  3GCM A;  1FNM A;  1N0V C;  1MU5 A;  4DU7 A;  4DR2 E;  3HUL A;  5C0X B;  2BR2 A;  4B3T E;  1XMO I;  4YY3 I;  5JEA E;  4JG4 A;  2CGE A;  4X64 I;  4AQY I;  4OX9 E;  4DV6 E;  5DNX A;  3J80 Q;  1XNR E;  3M85 D;  1FJG I;  2IER A;  1Y60 A;  1ELO A;  1RRE A;  4LF6 E;  2ZBK B;  2UUB E;  4DV0 E;  4LF9 I;  1FWL A;  3QT6 A;  4ISA A;  4LFC I;  2AJ4 A;  2Z5B A;  4UTG A;  4WUC A;  4OX9 I;  5A2Q C;  2BR2 B;  4HYM A;  4DV1 E;  2DEJ A;  2F1D A;  2GO3 A;  1ZXM A;  2XEX A;  4IFD F;  1WUU A;  5IWA E;  4DR4 E;  3CDJ A;  4N3O A;  3DD6 A;  4DV0 I;  2UUB I;  4GKK E;  1HNW I;  4DR5 E;  5ELW A;  1OYP A;  4MU0 A;  1IBM E;  5GMD A;  4DPX A;  4LF7 I;  2Z5B B;  5JEA C;  2O1W A;  1HNX I;  4MQY A;  1MG7 A;  1YH8 A;  3OTO I;  1DAR A;  3T1Y I;  2J7K A;  2PO0 B;  5K36 E;  3H1C A;  4USK A;  1NHJ A;  1E3P A;  4FWG A;  1Z59 A;  2C37 A;  4NBQ A;  4JI3 I;  4LF8 E;  2J65 A;  2UUA E;  3Q1Q A;  2V2Q A;  3B4T A;  2GS8 A;  4DR5 I;  2HHH I;  1S16 A;  5JEA A;  1IBM I;  3T1H I;  4GQU A;  4LFB E;  3WU6 A;  4JI8 E;  3JAM Q;  4JI5 E;  4DUY E;  4DPY A;  4OO1 D;  1HNZ E;  3P3C A;  1N36 E;  1Z0V A;  4JI6 I;  3LTO A;  4J3D A;  2UUA I;  4FN5 A;  4DUZ I;  1R6L A;  2C37 B;  4LF5 E;  3GON A;  2HKJ A;  4JYA E;  2NN6 F;  5JEA B;  1XHK A;  2WNR A;  1HR0 E;  3CDI A;  2BA1 G;  3B82 A;  4DR3 I;  1YHC A;  2VQF E;  1A6F A;  2VF3 A;  4IZJ A;  1N0U A;  2UXB I;  5K36 C;  3ZKB A;  4Z7Y A;  4LF5 I;  1KIJ A;  3L7Z A;  2HKE A;  4JI4 E;  5C0X D;  2PO1 A;  4ZVI A;  1I94 E;  3M7N G;  4IZK A;  4X62 I;  2X36 A;  2ZM6 E;  4MU3 A;  1Z5B A;  4DV4 I;  2VQF I; 
#chains in the Genus database with same CATH homology
 4LF4 E;  5FWK A;  3CWV A;  4B3M E;  4JI0 E;  3J81 Q;  4X65 E;  1USU A;  1S4E A;  3J7A M;  1B63 A;  5LL6 R;  4B3S I;  4R1F A;  4IZJ B;  2V2Z A;  2VQE I;  4YHH E;  1I94 I;  4X66 E;  2UU9 E;  1ZXN A;  1N32 I;  4DR6 E;  1KTV A;  4DR1 E;  4IZK B;  5LMN I;  1IBK E;  4X65 I;  1IBL E;  1Z0B A;  1H74 A;  1Y4S A;  4JV5 I;  3PYE A;  4GKJ E;  1N33 E;  1Z5C A;  3K85 A;  4DR2 I;  2GQ0 A;  1J5E E;  4B3T I;  2UU9 I;  4DR6 I;  4K0K E;  4DV6 I;  1IBL I;  3QT5 A;  5IT9 C;  2NPF A;  3B78 A;  1XNR I;  1ZM2 A;  1Z0C A;  2F4V E;  4LF6 I;  3ZZ0 A;  1N33 I;  2CZ9 A;  1FKA E;  3PYD A;  4B3R E;  2R42 A;  3D4J A;  2E5L E;  1Z0G A;  4NXN E;  4HXZ A;  4DV1 I;  2V34 A;  4JI1 E;  2IOQ A;  4PRX A;  1XMQ E;  3K17 A;  2F4V I;  1Z5A A;  5IWA I;  4DR4 I;  1ZM3 A;  1EI1 A;  2CG9 A;  1BKN A;  1B62 A;  5FLX Q;  3QT7 A;  1H73 A;  2HFU A;  3J7A G;  4NXN I;  1Y6Z A;  4KHP E;  2A2D A;  1OJ4 A;  1FI4 A;  2X7I A;  4DV2 E;  4FWH A;  4JI2 E;  4LF8 I;  1EA6 A;  1XNQ E;  5LMU E;  4DV7 E;  4KHP I;  3ZZT A;  4LFB I;  4JI8 I;  1N34 E;  1Z0W A;  3QT8 A;  4JI5 I;  4PRV A;  4DUY I;  3J80 C;  1HNZ I;  1KKH A;  2Z5C A;  1N36 I;  2HK2 A;  2LJP A;  3V2U C;  4IZJ D;  3WU5 A;  4DU8 A;  5LMU I;  4DV5 E;  1PIE A;  4RPF A;  4JYA I;  3HJC A;  1NZ0 A;  1HR0 I;  3PYF A;  2UXD E;  1ZM4 A;  1NHH A;  2OI2 A;  2PNM A;  4NXM E;  2IOP A;  2HFS A;  1Z0E A;  4UT4 A;  4PU9 A;  2Z5C B;  4MYU A;  4URL A;  4DV5 I;  4JI4 I;  2O1U A;  4JI7 E;  2ZIT A;  4I3H A;  2UXD I;  2ZM6 I;  1HK7 A;  4LF4 I;  4JI0 I;  4B3M I;  1PKP A;  4AQY E;  1U2R A;  2A2C A;  2R3V A;  1FJG E;  4DXL A;  4WUD A;  4YHH I;  4DPU A;  4X66 I;  4LF9 E;  2EFG A;  3K1J A;  1Z0T A;  1H7U A;  3B8H A;  4LFC E;  3JAM C;  2UXC E;  4DR1 I;  1IBK I;  4XTJ A;  4M1K A;  4ED4 A;  4GKJ I;  1USV A;  3Q6N A;  1J5E I;  1HNW E;  1PVG A;  2UXC I;  4K0K I;  4EMD A;  4FW9 A;  2V2V A;  2BV3 A;  4LF7 E;  4DV3 E;  2PNL A;  3H4L A;  1HNX E;  2Z5E A;  3OTO E;  3F0N A;  3T1Y E;  4HAC A;  1NHI A;  4B3R I;  4JI3 E;  2E5L I;  4Z7C A;  1QZR A;  4HY1 A;  1UEK A;  2HHH E;  3T1H E;  2E1R A;  4WUB A;  4DV3 I;  4JI1 I;  1XMQ I;  3J81 C;  2WW4 A;  2O1T A;  4KQV A;  4JI6 E;  1KVK A;  4DUZ E;  5BR8 E;  4HAC B;  4LFA E;  4P7A A;  3ZZU A;  2DEI A;  1RR9 A;  3WU4 A;  4DV2 I;  4FWD A;  5A2Q Q;  4JI2 I;  2HK3 A;  4DR3 E;  1D6T A;  5IT9 Q;  2UUC E;  1XNQ I;  5L3J A;  3WU3 A;  1K47 A;  2UXB E;  5BR8 I;  4DV7 I;  4LFA I;  3Q6M A;  3P06 A;  1N34 I;  4MYT A;  3ZKD A;  1Y4U A;  2BM1 A;  4DR7 E;  3LPS A;  4X62 E;  1FWK A;  3M6A A;  4DV4 E;  2UUC I;  1MX0 A;  4P52 A;  3LNU A;  4B3S E;  5GME A;  1VIS A;  1ZM9 A;  2Q2E B;  2VQE E;  3PRY A;  2O1V A;  4DR7 I;  1XMO E;  2V8P A;  3ZM7 A;  1N32 E;  4DPT A;  4NXM I;  4YY3 E;  4X64 E;  2BM0 A;  4DPW A;  5LMN E;  5FLX C;  1H72 C;  1H7S A;  3PYG A;  4USM A;  4JV5 E;  4JI7 I;  3V5R A;  1FNM A;  1N0V C;  1MU5 A;  4DU7 A;  4DR2 E;  3HUL A;  4B3T E;  1XMO I;  4YY3 I;  4JG4 A;  2CGE A;  4X64 I;  4AQY I;  4OX9 E;  4DV6 E;  3J80 Q;  1XNR E;  1FJG I;  1ELO A;  1RRE A;  4LF6 E;  2ZBK B;  2UUB E;  4DV0 E;  4LF9 I;  1FWL A;  3QT6 A;  4LFC I;  2AJ4 A;  2Z5B A;  4UTG A;  4WUC A;  4OX9 I;  5A2Q C;  4HYM A;  4DV1 E;  2DEJ A;  1ZXM A;  2XEX A;  1WUU A;  5IWA E;  4DR4 E;  4N3O A;  2UUB I;  4DV0 I;  4GKK E;  1HNW I;  4DR5 E;  1IBM E;  5GMD A;  4DPX A;  4LF7 I;  2Z5B B;  2O1W A;  1HNX I;  1MG7 A;  3OTO I;  1DAR A;  3T1Y I;  2J7K A;  4USK A;  1NHJ A;  4FWG A;  4JI3 I;  1Z59 A;  4LF8 E;  3Q1Q A;  4GKK I;  2UUA E;  2V2Q A;  2GS8 A;  4DR5 I;  2HHH I;  1S16 A;  1IBM I;  3T1H I;  4LFB E;  3WU6 A;  4JI8 E;  3JAM Q;  4JI5 E;  4DUY E;  4DPY A;  1HNZ E;  1N36 E;  1Z0V A;  4JI6 I;  3LTO A;  2UUA I;  4FN5 A;  4DUZ I;  4LF5 E;  3GON A;  2HKJ A;  4JYA E;  1XHK A;  1HR0 E;  3B82 A;  4DR3 I;  2VQF E;  1A6F A;  2VF3 A;  4IZJ A;  1N0U A;  2UXB I;  3ZKB A;  4Z7Y A;  4LF5 I;  1KIJ A;  2HKE A;  4JI4 E;  4ZVI A;  1I94 E;  4IZK A;  4X62 I;  2X36 A;  2ZM6 E;  1Z5B A;  4DV4 I;  2VQF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...