5LL6R

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
NTEEKGWVPVTKLGRLVKAGKITTIEEIFLHSLPVKEFQIIDTLLPGLQDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTTGKCGSVTVRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFLTPNLWAEQPLPVSPLDIYSDEASAQKKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
total genus 39
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
R PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5ll6R01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5ll6R02
4ZVIA 5A2QC 1N0UA 2UUCE 1NHIA 3J7AG 2V2QA 1H7SA 5GMDA 4LF6E 2XEXA 1N33I 1D6TA 1Z0GA 4DXLA 4XTJA 4NXMI 1XMOI 3K1JA 1N36I 2HHHI 4LF9E 1HNWE 4DUYI 4LF5E 5IWAE 2OI2A 4PU9A 5BR8E 3J81C 2F4VE 4DV0I 4M1KA 4DR2I 3T1HI 4USMA 2UXCI 1IBMI 1N34E 3J80Q 3WU5A 4URLA 2UUAI 2VF3A 4GKJI 4X65I 4Z7YA 1A6FA 3WU3A 3J7AM 4JI5I 2V2VA 1ZM9A 2DEJA 4JI3I 4WUCA 2V34A 3T1YE 1FJGE 1HNXE 4LF7E 2UXBE 4JV5I 4PRVA 2UUBI 2ZBKB 4KHPE 2HKEA 4B3TI 4DV2E 4DV4I 4LFAI 5A2QQ 3QT6A 1K47A 1XNQI 2HFSA 5LL6R 3B78A 2NPFA 4HACA 2UUCI 4NXNE 5LMUE 1Z0BA 1OJ4A 3ZM7A 1ELOA 3J81Q 2A2CA 1BKNA 1IBLI 4LF9I 1HNWI 4LF5I 5IWAI 4I3HA 5BR8I 4LFCE 4USKA 3WU6A 1RR9A 1Z0TA 1H73A 5L3JA 1N34I 4OX9E 3H4LA 4DR1E 4FW9A 2EFGA 3T1YI 4MYUA 1FJGI 4DV7E 3ZZUA 1HNXI 2UXDE 4LF7I 2UXBI 4DR5E 4JI6E 1ZXMA 4KHPI 4MYTA 4DV2I 4DPWA 1B62A 4UTGA 1QZRA 4YHHI 1HNZI 1ZM3A 4NXNI 1Z0CA 5FLXC 2UU9E 5LMUI 4FWDA 4DPYA 2HFUA 4R1FA 3B8HA 4DV1E 4HXZA 4JYAE 4FWGA 1RREA 1UEKA 1H7UA 4B3ME 2Q2EB 2X7IA 4YY3E 1ZM4A 2VQEE 3ZKDA 2R3VA 2VQFE 4OX9I 4JI8E 2WW4A 1HR0E 4JI2E 4DR1I 2BV3A 4GKKE 1XMQE 1N32E 4DPXA 1NHHA 1EA6A 1Z0EA 3OTOE 4DV7I 2UXDI 4DR6E 1WUUA 4DR5I 3B82A 4LF6I 3ZKBA 2BM0A 3D4JA 2E5LE 3HULA 1MX0A 3QT8A 3V5RA 1EI1A 5FLXQ 5LMNE 4LF4E 4LFBE 4X62E 1MG7A 1NHJA 1DARA 2F4VI 3WU4A 3V2UC 4DU7A 4DV6E 2V2ZA 1IBKE 1PKPA 4JI7E 4GKJE 4JI1E 1KIJA 4DV1I 1ZXNA 4X64E 4JYAI 1Z5AA 5IT9C 2X36A 1ZM2A 4K0KE 2A2DA 2CZ9A 2V8PA 4B3MI 4HYMA 3LNUA 4YY3I 3ZZ0A 3Q1QA 1FWLA 2ZM6E 3GONA 4DPTA 2VQFI 4AQYE 4JI8I 1HR0I 3LPSA 4JI2I 1KTVA 2HK3A 4DV3E 3PYDA 1FI4A 4DU8A 4GKKI 3PYFA 4DV5E 4JI4E 1PVGA 1J5EE 1XMQI 3JAMC 4LF8E 3OTOI 1Z0VA 4DR6I 4DUZE 4JI0E 1FKAE 4ED4A 3LTOA 3M6AA 4FWHA 2E5LI 4DR3E 3ZZTA 1IBLE 1H72C 4JG4A 2LJPA 1NZ0A 1H74A 2R42A 4KQVA 5LMNI 2HKJA 1I94E 4LF4I 1U2RA 4DR7E 4X62I 4LFBI 3F0NA 4LFCI 3PYGA 1FNMA 4PRXA 4B3RE 1Z59A 4Z7CA 4EMDA 4X66E 4B3SE 1XNRE 4DV6I 1IBKI 5IT9Q 4JI7I 4JI1I 4X64I 4DR4E 1Z0WA 4HACB 4UT4A 1N0VC 1FWKA 4K0KI 1N33E 1MU5A 3QT7A 2GS8A 4JI6I 2ZM6I 1Z5BA 2ZITA 4AQYI 4NXME 1XMOE 1KVKA 1N36E 2HHHE 3JAMQ 4DV3I 5GMEA 4DUYE 3QT5A 3K17A 1B63A 4DV5I 4JI4I 2BM1A 1J5EI 2HK2A 4P52A 4YHHE 1HNZE 4DV0E 4DR2E 3T1HE 4LF8I 2J7KA 2UXCE 1IBME 4DPUA 4JI0I 4DUZI 2AJ4A 3PYEA 2UU9I 2UUAE 4X65E 4DR3I 4JI5E 1S4EA 3J80C 4WUBA 4JI3E 4P7AA 1I94I 4DR7I 1S16A 4JV5E 2DEIA 4B3RI 2UUBE 4X66I 4FN5A 1PIEA 4B3SI 1XNRI 4RPFA 4B3TE 2VQEI 1Z5CA 4WUDA 4DV4E 4LFAE 1XHKA 4DR4I 3CWVA 1VISA 2E1RA 1KKHA 1XNQE 4HY1A 1N32I
chains in the Genus database with same CATH superfamily
2EPRA 5IV8B 2YTIA 3GCMA 4ZVIA 3JTZA 5A2QC 2UUCE 2EOFA 1N0UA 5KL7A 1NHIA 5DROA 3J7AG 2V2QA 1H7SA 5GMDA 4R2AA 2LCEA 4LF6E 2PO0A 2XEXA 4FK5C 1N33I 2JT2A 2WNRB 2EOIA 1D6TA 2CVEA 2EMCA 2NN6F 5KL2A 4FW6A 2GHFA 1Z0GA 3ECRA 2EMYA 3HKMA 4DXLA 2HC5A 4WSPA 2M9AA 4XTJA 2B7TA 4IFDD 4Q35B 4IFDB 4NXMI 1XMOI 3K1JA 1N36I 2K7IA 2HHHI 4LTYA 2GO3A 3THOB 4LF9E 1HNWE 4LF5E 2FTXB 4MU4A 4DUYI 3M7NG 2ODRD 1WHNA 5IWAE 5C0XA 2OI2A 5BR8E 4PU9A 3J7Yp 1P47A 3J81C 2F4VE 1JK1A 2EM2A 4P78A 3DF6A 2JWOA 1A1IA 1USUA 4DV0I 4M1KA 4DR2I 4IZJD 2EPMX 1IQSA 2YSPA 4IZJB 2L3CA 4U3DA 3T1HI 4USMA 2UXCI 1IBMI 2LMZA 4ZYGA 2EE8A 1N34E 3J80Q 1BBGA 2ELYA 2MDRA 1LLMC 3WU5A 2GLIA 2EOJA 4URLA 2YZTA 2M1SA 2EM9A 2LO3A 4IS9A 2UUAI 1YUIA 1E3PA 2VF3A 4GKJI 4NBQA 2HJJA 4X65I 2V8QB 4AM3A 2WNRA 4Z7YA 1A6FA 4J8ZA 3WU3A 1DI2A 3J7AM 2YRHA 3C4BA 4OO1C 4BA1A 4JI5I 5DNLA 2V2VA 1ZM9A 2JEBA 2JEAA 2YRKA 2DEJA 4JI3I 4WUCA 4RHBB 1EH6A 2V34A 3T1YE 2YTPA 1BBOA 1GZ6A 3P3EA 4HEIA 1FJGE 1X6EA 4WYQB 1YYOA 1HNXE 2YTNA 3LMLA 4R8OA 5CFFE 4LF7E 2UXBE 1TF6A 2PNZB 4GQUA 4JV5I 2J7JA 2V83A 3BGHA 2YTFA 2HGHA 4KZSA 4PRVA 2EN1A 2UUBI 2ZBKB 2EMGA 4KHPE 3H1CA 1HK7A 2HKEA 3P06A 4IFDF 2VESA 1WXRA 4B3TI 2EPLX 4IZJA 4DV2E 4WXDA 4F6NA 2IESA 4DV4I 4LFAI 2V88A 5A2QQ 2GQ0A 2ENHA 2EMHA 4BS9A 3QT6A 1VI7A 2YTQA 1K47A 4BC7A 4O24A 1UDNA 2WCC3 2RS7A 2F1DA 5A6JA 1XNQI 1YHCA 5DRQA 1X6FA 2KONA 2HFSA 5LL6R 2PO2A 3B78A 2NPFA 2EPZA 4R2DA 4HACA 2UUCI 4NXNE 1MGTA 4LCGA 2NN6E 2F8BA 2MC6A 5LMUE 1Z0BA 4R2SA 1X48A 4R2CA 1N3GA 5C0XC 5T6JA 3HJCA 1ZBQA 2Z5EA 1OJ4A 2CT1A 2C38B 3ZM7A 1ELOA 3J81Q 2YPNA 2A2CA 4AQYI 2EOYA 2JEAB 2DLKA 2JE6A 4WX9A 1TF3A 4DKKA 1G2DC 1BKNA 1IBLI 4LF9I 1HNWI 4LF5I 5IWAI 2N3HA 4I3HA 5F3WA 5BR8I 4LFCE 2G7HA 2EOOA 3B4TA 5EKWA 4USKA 3WU6A 2EOSA 4MQYA 1RR9A 1UHZA 1B69A 1EKZA 1H73A 1IMUA 1Z0TA 3M85G 5L3JA 1KYQA 1R6LA 1N34I 4F2JC 4U3BA 3ADLA 4OX9E 1X6HA 2E1MA 2EM7A 3OMLA 2ENAA 4OZEA 3H4LA 5ELWA 4M0VA 4DR1E 1YYKA 2I9IA 1WHQA 4FW9A 2R76A 2BA0G 5A6BA 3KRNA 1RQ0A 2ODRC 2RSIA 2FGGA 2I13A 2LUQA 2JP9A 4O43A 4LCHA 2C38A 2EFGA 2BB8A 2RTXA 3GMEA 1YH8A 4L5NC 1OYSA 3T1YI 1J26A 1X47A 4MYUA 1KJKA 1FJGI 4DV7E 5JEAB 1L4SA 5TSEA 2EPPA 2V87A 2UXDE 2LTSA 3ZZUA 1HNXI 4LF7I 2UXBI 2YT4A 4DR5E 4R2EA 5DRPA 2EL5A 5K36B 3H09A 4JI6E 3VK6A 3ADIA 4IFDE 1ZXMA 1NCSA 4KHPI 4M9VC 4MYTA 5A69A 3PS1A 4FW7A 4DV2I 3HXLA 3U1KA 2O1VA 5AASA 4O5GA 4LU9A 3F6HA 4MU1A 2EOHA 4DPWA 1B62A 2CTDA 4UTGA 2EM4A 2YRMA 4KWYA 4GZNC 1UDSA 1QZRA 4WPYA 2CSHA 2LJHA 2JVAA 1A1GA 4YHHI 1HNZI 1ZM3A 3MHHC 4NXNI 1Z0CA 1SFEA 5FLXC 4X8WA 5DRRA 2YTEA 2UU9E 4FWDA 4DPYA 5LMUI 2HFUA 4R1FA 3VHTB 3B8HA 4DV1E 4HXZA 2C39B 1E3HA 3BF2A 3MHSC 4JYAE 2FV4B 1YSAC 4FW5A 2DMIA 2EQ3A 4FWGA 2MKDA 1UBDC 1RREA 2EMKA 1EH7A 2L33A 1UEKA 3THNA 1H7UA 1T4NA 4IFDA 1UDOA 2EPOA 4B3ME 2Q2EB 2X7IA 3PS2A 2VF1A 4YY3E 3FIGA 2RQLA 2DSYA 1MEYC 2Z5BB 1ZM4A 2YU5A 5KL5A 2WBTA 2EN6A 1Y60A 2VQEE 3ZKDA 2BBGA 2EMBA 3VYYA 2VQFE 2R3VA 1A1FA 2PO1B 2NN6C 4OX9I 3QG5C 4JI8E 1HR0E 2WW4A 4J3DA 4JI2E 2DIXA 1GTKA 4M2ZA 1P42A 2B9DA 4DR1I 2C37B 2LBSB 4L8NA 4GKKE 4ZYHA 2BV3A 1O0WA 2DMYA 1EH8A 3KZZA 2YSOA 3U1YA 2BR2B 1X49A 2M7QA 2KOUA 1X3CA 1XMQE 1N32E 1SR9A 3ZOQB 5AC4A 4LOMA 2NUGA 2WBUA 3C4TA 1WRJA 4DPXA 2Q8UA 1NHHA 1EA6A 5DNYA 1Z0EA 4F6MA 3OTOE 1PJTA 3M99B 4WSGA 1RHYA 4DV7I 1Z1BA 3L7ZB 2UXDI 2EL6A 2EPUA 4DR6E 4NZVA 1WUUA 4ZYEA 4DR5I 2RPCA 3B82A 4LF6I 3ZKBA 4F9AB 2BM0A 3D4JA 1ZR9A 2E5LE 2O1TA 5AE1A 1A1HA 2PNLA 2Z5BA 2PNZA 3HULA 1IQOA 3C6MA 1MX0A 2NUFA 2O1UA 3QT8A 1T4OA 2B7VA 2IOPA 3V5RA 1EI1A 4OO1B 5IXMB 4TUIA 5FLXQ 5LMNE 2ELZA 2RS6A 4LF4E 1ZU1A 2JOBA 1AAYA 1YFHA 1PJSA 4LFBE 2EMZA 4X62E 2EORA 1MG7A 1NHJA 2M4IA 4NHRA 1DARA 2F4VI 2BR2A 4BCAA 4R2RA 3WU4A 4MLQA 2EMIA 3C6KA 1RC7A 3V2UC 4DU7A 4F9CB 4DV6E 3K85A 3M7ND 1G2FC 2V2ZA 1IBKE 1GQEA 3NZKA 1PKPA 4JI7E 1X5WA 2L92A 4BMJA 4JI1E 4GKJE 1KIJA 4QNKA 4DV1I 4IFDC 3IWCA 2L6MA 1ZXNA 2B3TB 4X64E 2NABA 4IJDA 4R03A 4JYAI 2BA1G 1Z5AA 2EN2A 4MU0A 2O1WA 2PO0B 5IT9C 2E72A 4AIDA 1UILA 4GEQB 5JEAE 2X36A 2EOXA 4BBYA 2EPNA 5KL4A 1ZM2A 5FWKA 4K0KE 2WP8B 4BC9A 5KL6A 2A2DA 2CZ9A 5AC5A 2V8PA 1WJPA 2EPAA 1T4LB 4B3MI 5K36E 5K36C 2ENCA 3P1XA 3DJWA 4HYMA 3LNUA 4YY3I 5JEAD 1NEIA 3ZZ0A 1USVA 2N3GA 2Z5CB 5K36D 3Q1QA 4FW3A 4QNJA 1OYRA 2EPCA 2YTJA 2PRTA 1FWLA 1F2IG 2ZM6E 2L3JA 4F54A 3GONA 5DNXA 4DPTA 2EQ0A 5C0XD 5C0XB 1ZAAC 4AQYE 2VQFI 4BA2B 3TQMA 4DMIA 4JI8I 1HR0I 3LPSA 4JI2I 4OO1F 3CDIA 2EN3A 1KTVA 4DV3E 2HK3A 3PYDA 1FI4A 5AE3A 4DU8A 4GKKI 2L8TA 3PYFA 4DV5E 4JI4E 1PVGA 5LLQA 3ADGA 2EN7A 1J5EE 1XMQI 1RMDA 4X9JA 4R2QA 2JY9A 1PJQA 2WZOA 2DGCA 5EL9A 2J65A 3HPZA 2R1FA 3JAMC 4LF8E 2EM5A 2L2MA 3BIDA 1Z0VA 3OTOI 3EQ1A 4DR6I 2MC5A 4DUZE 4JI0E 2LVHA 1FKAE 2WP8A 2WBSA 4BA1B 4ED4A 2DRPA 3LTOA 5ADZA 2YTDA 3M6AA 2JEBB 1ZBTA 4ZYDA 2V89A 4FWHA 2EPKX 2N8XA 1Y4UA 4N3OA 5JEAA 2E5LI 4Q28A 4DR3E 2EMAA 3ZZTA 2Z5CA 2EOEA 5K36A 1QNTA 1DGCA 1IBLE 1H72C 4IZKB 4JG4A 3HPSA 2LJPA 1NZ0A 1H74A 2RSMA 2R42A 2IOQA 4LPFA 4WXCA 4BA2A 2EMWA 4KQVA 5LMNI 2HKJA 1I94E 3UHMA 2EM6A 4LF4I 1TN9A 1U2RA 2H36X 5JEAF 4DR7E 4X62I 2EM8A 4LFBI 3F0NA 2CGEA 2EP3A 4FW4A 4LFCI 3PYGA 1FNMA 5K36F 4PRXA 1DQ3A 4B3RE 1Z59A 4Z7CA 4EMDA 4X66E 1T38A 5C0XF 3EPKA 5KL3A 4B3SE 1XNRE 3P3GA 4I8OA 4DV6I 3RMPA 1A1KA 1IBKI 5IT9Q 3ADJA 3EPLA 2L2NA 2A25A 2VE7C 3F6GA 1UN6B 4JI7I 2EQ1A 3VYXA 3DD6A 4JI1I 2LUPB 1YZ9A 2GPIA 2EOMA 2PO2B 4DR4E 4X64I 3CDJA 1Z0WA 4HACB 1BB8A 4UT4A 3M85D 1N0VC 1FWKA 2L2KB 3LLHA 2LT7A 1A1LA 2V86A 2C39A 3EPHA 4OOGC 4BHBA 4K0KI 4IZKA 4R2PA 4WFTA 2IHR1 1Y4SA 2BA0D 2BA1D 2YTGA 2DB2A 2V85A 3JU0A 1XXEA 1N33E 2DLQA 5AE2A 2YTOA 1MU5A 1UDQA 2CG9A 3QT7A 3AV0A 2JR1A 2EOQA 2JE6B 1R6MA 2GS8A 2EM0A 4JI6I 2ZM6I 1Z5BA 3Q6MA 2ZITA 4F9BB 4NXME 2IERA 1XMOE 2D9HA 2CPNA 4IS1C 1N36E 2HHHE 1KVKA 3PS3A 4OO1E 1JK2A 3MSWA 2O3ZA 4O4KA 3JAMQ 4DV3I 4TUGA 4DUYE 1PDAA 5GMEA 3QT5A 3K17A 3K6QA 2PO1A 1B63A 2EMFA 3L00A 2NUEA 2PNMA 4OO1D 2EN4A 4HTGA 4DV5I 4JI4I 3AUZA 2GO4A 2BM1A 1J5EI 2NA2A 2LE2A 2HK2A 4P52A 4YHHE 2VRDA 1HNZE 4ISAA 4DV0E 2C37A 4DR2E 4N4RB 5JEAC 2K4VA 3T1HE 4LF8I 2J7KA 1QU6A 1A1JA 4P7DA 1STUA 3HQ1A 1IBME 2EM3A 5A6BD 1YYWA 2UXCE 4DPUA 2AE8A 2ADRA 4JI0I 4DUZI 5A6AA 2KHXA 2LTRA 2EJ4A 1Y5YA 2EPXA 2AJ4A 3PYEA 2UUAE 2NN6D 2NN6B 2UU9I 4MU3A 2JPAA 3L7ZA 3P76A 4X65E 4DR3I 1OYPA 1AH5A 4AIMA 4OKGA 4JI5E 3KWRA 3UK3C 1S4EA 3PRYA 3J80C 1T39A 4WUBA 4JI3E 5A6KA 4P7AA 2EWLA 2JYAA 3IWBA 2JOXA 2LV2A 4MLVA 1I94I 3Q6NA 3EPJA 4DR7I 4LCFA 3P3CA 4JV5E 1S16A 2DEIA 4MDTA 2EZ6A 4M30A 4OO1A 5C0XE 2YWQA 4B3RI 3HTXA 2UUBE 2JXPA 4X66I 2EOZA 4RH8A 4FN5A 2YU8A 1PIEA 4B3SI 1XNRI 3IWDA 4B3TE 1Y6ZA 4RPFA 2VQEI 2EMLA 1YPNA 1Z5CA 2EL4A 4WUDA 4DV4E 4LFAE 1XHKA 2MDGA 4DR4I 3CWVA 1VISA 1YUJA 2MKNA 2E1RA 4BHCA 3GLLA 2LRSA 3KZYA 2EMXA 1KKHA 1XNQE 2NN6A 4HY1A 2EN8A 3BBGA 2LJUA 1N32I
chains in the Genus database with same CATH topology
4ZVIA 3JTZA 5A2QC 2UUCE 1N0UA 1NHIA 3J7AG 2V2QA 1H7SA 5GMDA 4LF6E 2XEXA 1N33I 1D6TA 1Z0GA 4DXLA 4WSPA 4XTJA 2B7TA 4NXMI 1XMOI 3K1JA 1N36I 2HHHI 4LTYA 4LF9E 1HNWE 4LF5E 2FTXB 4DUYI 2ODRD 1WHNA 5IWAE 2OI2A 5BR8E 4PU9A 3J7Yp 3J81C 2F4VE 4P78A 3DF6A 2JWOA 1USUA 4DV0I 4M1KA 4DR2I 4IZJD 4IZJB 3T1HI 2L3CA 4USMA 2UXCI 1IBMI 2LMZA 1N34E 3J80Q 2MDRA 3WU5A 4URLA 2YZTA 2M1SA 2UUAI 2VF3A 4GKJI 4X65I 2V8QB 4Z7YA 1A6FA 4J8ZA 3WU3A 1DI2A 3J7AM 3C4BA 4JI5I 2V2VA 1ZM9A 2DEJA 4JI3I 4WUCA 2V34A 3T1YE 1GZ6A 1FJGE 4WYQB 1YYOA 1HNXE 3LMLA 4R8OA 5CFFE 4LF7E 2UXBE 4JV5I 2V83A 4KZSA 4PRVA 2UUBI 2ZBKB 4KHPE 1HK7A 2HKEA 3P06A 1WXRA 4B3TI 4IZJA 4DV2E 4DV4I 4LFAI 2V88A 5A2QQ 2GQ0A 4BS9A 3QT6A 1K47A 4BC7A 2RS7A 1XNQI 2HFSA 2KONA 5LL6R 3B78A 2NPFA 4HACA 2UUCI 4NXNE 2F8BA 2MC6A 5LMUE 1Z0BA 1X48A 5T6JA 3HJCA 1ZBQA 2Z5EA 1OJ4A 3ZM7A 1ELOA 3J81Q 2A2CA 1BKNA 4DKKA 1IBLI 4LF9I 1HNWI 4LF5I 5IWAI 2N3HA 4I3HA 5F3WA 5BR8I 4LFCE 2G7HA 4USKA 3WU6A 1RR9A 1UHZA 1EKZA 1H73A 1Z0TA 5L3JA 1N34I 3ADLA 4OX9E 2E1MA 3OMLA 3H4LA 4M0VA 4DR1E 1YYKA 1WHQA 4FW9A 1RQ0A 2ODRC 2FGGA 2LUQA 2EFGA 2RTXA 4L5NC 3T1YI 1J26A 1X47A 4MYUA 1FJGI 4DV7E 2UXDE 2V87A 3ZZUA 1HNXI 2LTSA 4LF7I 2UXBI 2YT4A 4DR5E 3H09A 4JI6E 3VK6A 3ADIA 1ZXMA 4KHPI 4MYTA 4DV2I 3HXLA 2O1VA 5AASA 4LU9A 3F6HA 4DPWA 1B62A 4UTGA 1QZRA 4WPYA 2LJHA 2JVAA 4YHHI 1HNZI 1ZM3A 4NXNI 1Z0CA 5FLXC 4X8WA 2UU9E 4FWDA 4DPYA 5LMUI 2HFUA 4R1FA 3B8HA 4DV1E 4HXZA 4JYAE 2FV4B 4FWGA 1RREA 1UEKA 2L33A 1H7UA 1T4NA 4B3ME 2Q2EB 2X7IA 2VF1A 4YY3E 3FIGA 2DSYA 2Z5BB 1ZM4A 2VQEE 3ZKDA 3VYYA 2R3VA 2VQFE 4OX9I 4JI8E 2WW4A 1HR0E 4JI2E 2DIXA 4M2ZA 4DR1I 2B9DA 2LBSB 4L8NA 4GKKE 2BV3A 1O0WA 2DMYA 1X49A 2M7QA 2KOUA 1XMQE 1N32E 1SR9A 3ZOQB 2NUGA 3C4TA 4DPXA 1NHHA 1EA6A 5DNYA 1Z0EA 3OTOE 4DV7I 2UXDI 4DR6E 1WUUA 4DR5I 3B82A 4LF6I 3ZKBA 4F9AB 2BM0A 3D4JA 2E5LE 2O1TA 5AE1A 2PNLA 2Z5BA 3HULA 1MX0A 2NUFA 2O1UA 3QT8A 1T4OA 2B7VA 2IOPA 3V5RA 1EI1A 4TUIA 5FLXQ 5LMNE 2RS6A 4LF4E 2JOBA 4LFBE 4X62E 1MG7A 1NHJA 2M4IA 1DARA 2F4VI 4BCAA 3WU4A 1RC7A 3V2UC 4DU7A 4F9CB 4DV6E 3K85A 2V2ZA 1IBKE 1GQEA 1PKPA 4JI7E 4GKJE 2L92A 4BMJA 4JI1E 1KIJA 4DV1I 3IWCA 2L6MA 1ZXNA 2B3TB 4X64E 4R03A 4JYAI 1Z5AA 2O1WA 5IT9C 1UILA 4GEQB 2X36A 4BBYA 1ZM2A 5FWKA 4K0KE 4BC9A 2A2DA 2CZ9A 2V8PA 1T4LB 4B3MI 3P1XA 3DJWA 4HYMA 3LNUA 4YY3I 3ZZ0A 1USVA 2N3GA 2Z5CB 3Q1QA 1FWLA 2ZM6E 2L3JA 4F54A 3GONA 4DPTA 4AQYE 2VQFI 4DMIA 4JI8I 1HR0I 3LPSA 4JI2I 1KTVA 4DV3E 2HK3A 3PYDA 1FI4A 5AE3A 4DU8A 4GKKI 2L8TA 3PYFA 4DV5E 4JI4E 1PVGA 3ADGA 1J5EE 1XMQI 2JY9A 2WZOA 3HPZA 3JAMC 4LF8E 2L2MA 3OTOI 1Z0VA 4DR6I 2MC5A 4DUZE 4JI0E 1FKAE 4ED4A 3LTOA 5ADZA 3M6AA 4FWHA 1ZBTA 4N3OA 2V89A 2E5LI 1Y4UA 4Q28A 4DR3E 3ZZTA 2Z5CA 1IBLE 1H72C 4IZKB 4JG4A 3HPSA 2LJPA 1NZ0A 1H74A 2RSMA 2R42A 2IOQA 4KQVA 5LMNI 2HKJA 1I94E 4LF4I 1U2RA 2H36X 4DR7E 4X62I 4LFBI 3F0NA 2CGEA 4LFCI 3PYGA 1FNMA 4PRXA 1DQ3A 4B3RE 1Z59A 4Z7CA 4EMDA 4X66E 4B3SE 1XNRE 4DV6I 4I8OA 3RMPA 1IBKI 5IT9Q 3ADJA 2L2NA 3F6GA 2VE7C 4JI7I 3VYXA 4JI1I 2LUPB 1YZ9A 4DR4E 4X64I 1Z0WA 4HACB 4UT4A 1N0VC 1FWKA 2L2KB 3LLHA 2V86A 4OOGC 4K0KI 4IZKA 4WFTA 2IHR1 1Y4SA 2DB2A 2V85A 3JU0A 1N33E 5AE2A 1MU5A 2CG9A 3QT7A 3AV0A 2JR1A 2GS8A 4JI6I 2ZM6I 1Z5BA 3Q6MA 2ZITA 4F9BB 4NXME 4AQYI 1XMOE 1KVKA 2CPNA 1N36E 2HHHE 3MSWA 3JAMQ 4DV3I 4TUGA 4DUYE 5GMEA 3QT5A 3K17A 3K6QA 1B63A 2PNMA 2NUEA 4DV5I 4JI4I 3AUZA 2BM1A 1J5EI 2NA2A 2LE2A 2HK2A 4P52A 4YHHE 1HNZE 4DV0E 4DR2E 2K4VA 3T1HE 4LF8I 2J7KA 1QU6A 2UXCE 4P7DA 1STUA 3HQ1A 1IBME 1YYWA 4DPUA 4JI0I 4DUZI 2KHXA 2LTRA 2AJ4A 3PYEA 2UUAE 2UU9I 4X65E 4DR3I 4JI5E 3KWRA 1S4EA 3PRYA 3J80C 4WUBA 4JI3E 4P7AA 2EWLA 3IWBA 2JOXA 1I94I 3Q6NA 4DR7I 4JV5E 1S16A 2DEIA 2EZ6A 4M30A 4B3RI 3HTXA 2UUBE 4X66I 4FN5A 1PIEA 4B3SI 1XNRI 3IWDA 4B3TE 1Y6ZA 4RPFA 2VQEI 1Z5CA 4WUDA 4DV4E 4LFAE 1XHKA 4DR4I 3CWVA 1VISA 2E1RA 2LRSA 1KKHA 1XNQE 4HY1A 1N32I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVI A;  5A2Q C;  1N0U A;  2UUC E;  1NHI A;  3J7A G;  2V2Q A;  1H7S A;  5GMD A;  4LF6 E;  2XEX A;  1N33 I;  1D6T A;  1Z0G A;  4DXL A;  4XTJ A;  4NXM I;  1XMO I;  3K1J A;  1N36 I;  2HHH I;  4LF9 E;  1HNW E;  4DUY I;  4LF5 E;  5IWA E;  2OI2 A;  4PU9 A;  5BR8 E;  3J81 C;  2F4V E;  4DV0 I;  4M1K A;  4DR2 I;  3T1H I;  4USM A;  2UXC I;  1IBM I;  1N34 E;  3J80 Q;  3WU5 A;  4URL A;  2UUA I;  2VF3 A;  4GKJ I;  4X65 I;  4Z7Y A;  1A6F A;  3WU3 A;  3J7A M;  4JI5 I;  2V2V A;  1ZM9 A;  2DEJ A;  4JI3 I;  4WUC A;  2V34 A;  3T1Y E;  1FJG E;  1HNX E;  4LF7 E;  2UXB E;  4JV5 I;  4PRV A;  2UUB I;  2ZBK B;  4KHP E;  2HKE A;  4B3T I;  4DV2 E;  4DV4 I;  4LFA I;  5A2Q Q;  3QT6 A;  1K47 A;  1XNQ I;  2HFS A;  5LL6 R;  3B78 A;  2NPF A;  4HAC A;  2UUC I;  4NXN E;  5LMU E;  1Z0B A;  1OJ4 A;  3ZM7 A;  1ELO A;  3J81 Q;  2A2C A;  1BKN A;  1IBL I;  4LF9 I;  1HNW I;  4LF5 I;  5IWA I;  4I3H A;  5BR8 I;  4LFC E;  4USK A;  3WU6 A;  1RR9 A;  1Z0T A;  1H73 A;  5L3J A;  1N34 I;  4OX9 E;  3H4L A;  4DR1 E;  4FW9 A;  2EFG A;  3T1Y I;  4MYU A;  1FJG I;  4DV7 E;  3ZZU A;  1HNX I;  2UXD E;  4LF7 I;  2UXB I;  4DR5 E;  4JI6 E;  1ZXM A;  4KHP I;  4MYT A;  4DV2 I;  4DPW A;  1B62 A;  4UTG A;  1QZR A;  4YHH I;  1HNZ I;  1ZM3 A;  4NXN I;  1Z0C A;  5FLX C;  2UU9 E;  5LMU I;  4FWD A;  4DPY A;  2HFU A;  4R1F A;  3B8H A;  4DV1 E;  4HXZ A;  4JYA E;  4FWG A;  1RRE A;  1UEK A;  1H7U A;  4B3M E;  2Q2E B;  2X7I A;  4YY3 E;  1ZM4 A;  2VQE E;  3ZKD A;  2R3V A;  2VQF E;  4OX9 I;  4JI8 E;  2WW4 A;  1HR0 E;  4JI2 E;  4DR1 I;  2BV3 A;  4GKK E;  1XMQ E;  1N32 E;  4DPX A;  1NHH A;  1EA6 A;  1Z0E A;  3OTO E;  4DV7 I;  2UXD I;  4DR6 E;  1WUU A;  4DR5 I;  3B82 A;  4LF6 I;  3ZKB A;  2BM0 A;  3D4J A;  2E5L E;  3HUL A;  1MX0 A;  3QT8 A;  3V5R A;  1EI1 A;  5FLX Q;  5LMN E;  4LF4 E;  4LFB E;  4X62 E;  1MG7 A;  1NHJ A;  1DAR A;  2F4V I;  3WU4 A;  3V2U C;  4DU7 A;  4DV6 E;  2V2Z A;  1IBK E;  1PKP A;  4JI7 E;  4GKJ E;  4JI1 E;  1KIJ A;  4DV1 I;  1ZXN A;  4X64 E;  4JYA I;  1Z5A A;  5IT9 C;  2X36 A;  1ZM2 A;  4K0K E;  2A2D A;  2CZ9 A;  2V8P A;  4B3M I;  4HYM A;  3LNU A;  4YY3 I;  3ZZ0 A;  3Q1Q A;  1FWL A;  2ZM6 E;  3GON A;  4DPT A;  2VQF I;  4AQY E;  4JI8 I;  1HR0 I;  3LPS A;  4JI2 I;  1KTV A;  2HK3 A;  4DV3 E;  3PYD A;  1FI4 A;  4DU8 A;  4GKK I;  3PYF A;  4DV5 E;  4JI4 E;  1PVG A;  1J5E E;  1XMQ I;  3JAM C;  4LF8 E;  3OTO I;  1Z0V A;  4DR6 I;  4DUZ E;  4JI0 E;  1FKA E;  4ED4 A;  3LTO A;  3M6A A;  4FWH A;  2E5L I;  4DR3 E;  3ZZT A;  1IBL E;  1H72 C;  4JG4 A;  2LJP A;  1NZ0 A;  1H74 A;  2R42 A;  4KQV A;  5LMN I;  2HKJ A;  1I94 E;  4LF4 I;  1U2R A;  4DR7 E;  4X62 I;  4LFB I;  3F0N A;  4LFC I;  3PYG A;  1FNM A;  4PRX A;  4B3R E;  1Z59 A;  4Z7C A;  4EMD A;  4X66 E;  4B3S E;  1XNR E;  4DV6 I;  1IBK I;  5IT9 Q;  4JI7 I;  4JI1 I;  4X64 I;  4DR4 E;  1Z0W A;  4HAC B;  4UT4 A;  1N0V C;  1FWK A;  4K0K I;  1N33 E;  1MU5 A;  3QT7 A;  2GS8 A;  4JI6 I;  2ZM6 I;  1Z5B A;  2ZIT A;  4AQY I;  4NXM E;  1XMO E;  1KVK A;  1N36 E;  2HHH E;  3JAM Q;  4DV3 I;  5GME A;  4DUY E;  3QT5 A;  3K17 A;  1B63 A;  4DV5 I;  4JI4 I;  2BM1 A;  1J5E I;  2HK2 A;  4P52 A;  4YHH E;  1HNZ E;  4DV0 E;  4DR2 E;  3T1H E;  4LF8 I;  2J7K A;  2UXC E;  1IBM E;  4DPU A;  4JI0 I;  4DUZ I;  2AJ4 A;  3PYE A;  2UU9 I;  2UUA E;  4X65 E;  4DR3 I;  4JI5 E;  1S4E A;  3J80 C;  4WUB A;  4JI3 E;  4P7A A;  1I94 I;  4DR7 I;  1S16 A;  4JV5 E;  2DEI A;  4B3R I;  2UUB E;  4X66 I;  4FN5 A;  1PIE A;  4B3S I;  1XNR I;  4RPF A;  4B3T E;  2VQE I;  1Z5C A;  4WUD A;  4DV4 E;  4LFA E;  1XHK A;  4DR4 I;  3CWV A;  1VIS A;  2E1R A;  1KKH A;  1XNQ E;  4HY1 A;  1N32 I; 
#chains in the Genus database with same CATH topology
 2EPR A;  5IV8 B;  2YTI A;  3GCM A;  4ZVI A;  3JTZ A;  5A2Q C;  2UUC E;  2EOF A;  1N0U A;  5KL7 A;  1NHI A;  5DRO A;  3J7A G;  2V2Q A;  1H7S A;  5GMD A;  4R2A A;  2LCE A;  4LF6 E;  2PO0 A;  2XEX A;  4FK5 C;  1N33 I;  2JT2 A;  2WNR B;  2EOI A;  1D6T A;  2CVE A;  2EMC A;  2NN6 F;  5KL2 A;  4FW6 A;  2GHF A;  1Z0G A;  3ECR A;  2EMY A;  3HKM A;  4DXL A;  2HC5 A;  4WSP A;  2M9A A;  4XTJ A;  2B7T A;  4IFD D;  4Q35 B;  4IFD B;  4NXM I;  1XMO I;  3K1J A;  1N36 I;  2K7I A;  2HHH I;  4LTY A;  2GO3 A;  3THO B;  4LF9 E;  1HNW E;  4LF5 E;  2FTX B;  4MU4 A;  4DUY I;  3M7N G;  2ODR D;  1WHN A;  5IWA E;  5C0X A;  2OI2 A;  5BR8 E;  4PU9 A;  3J7Y p;  1P47 A;  3J81 C;  2F4V E;  1JK1 A;  2EM2 A;  4P78 A;  3DF6 A;  2JWO A;  1A1I A;  1USU A;  4DV0 I;  4M1K A;  4DR2 I;  4IZJ D;  2EPM X;  1IQS A;  2YSP A;  4IZJ B;  2L3C A;  4U3D A;  3T1H I;  4USM A;  2UXC I;  1IBM I;  2LMZ A;  4ZYG A;  2EE8 A;  1N34 E;  3J80 Q;  1BBG A;  2ELY A;  2MDR A;  1LLM C;  3WU5 A;  2GLI A;  2EOJ A;  4URL A;  2YZT A;  2M1S A;  2EM9 A;  2LO3 A;  4IS9 A;  2UUA I;  1YUI A;  1E3P A;  2VF3 A;  4GKJ I;  4NBQ A;  2HJJ A;  4X65 I;  2V8Q B;  4AM3 A;  2WNR A;  4Z7Y A;  1A6F A;  4J8Z A;  3WU3 A;  1DI2 A;  3J7A M;  2YRH A;  3C4B A;  4OO1 C;  4BA1 A;  4JI5 I;  5DNL A;  2V2V A;  1ZM9 A;  2JEB A;  2JEA A;  2YRK A;  2DEJ A;  4JI3 I;  4WUC A;  4RHB B;  1EH6 A;  2V34 A;  3T1Y E;  2YTP A;  1BBO A;  1GZ6 A;  3P3E A;  4HEI A;  1FJG E;  1X6E A;  4WYQ B;  1YYO A;  1HNX E;  2YTN A;  3LML A;  4R8O A;  5CFF E;  4LF7 E;  2UXB E;  1TF6 A;  2PNZ B;  4GQU A;  4JV5 I;  2J7J A;  2V83 A;  3BGH A;  2YTF A;  2HGH A;  4KZS A;  4PRV A;  2EN1 A;  2UUB I;  2ZBK B;  2EMG A;  4KHP E;  3H1C A;  1HK7 A;  2HKE A;  3P06 A;  4IFD F;  2VES A;  1WXR A;  4B3T I;  2EPL X;  4IZJ A;  4DV2 E;  4WXD A;  4F6N A;  2IES A;  4DV4 I;  4LFA I;  2V88 A;  5A2Q Q;  2GQ0 A;  2ENH A;  2EMH A;  4BS9 A;  3QT6 A;  1VI7 A;  2YTQ A;  1K47 A;  4BC7 A;  4O24 A;  1UDN A;  2WCC 3;  2RS7 A;  2F1D A;  5A6J A;  1XNQ I;  1YHC A;  5DRQ A;  1X6F A;  2KON A;  2HFS A;  5LL6 R;  2PO2 A;  3B78 A;  2NPF A;  2EPZ A;  4R2D A;  4HAC A;  2UUC I;  4NXN E;  1MGT A;  4LCG A;  2NN6 E;  2F8B A;  2MC6 A;  5LMU E;  1Z0B A;  4R2S A;  1X48 A;  4R2C A;  1N3G A;  5C0X C;  5T6J A;  3HJC A;  1ZBQ A;  2Z5E A;  1OJ4 A;  2CT1 A;  2C38 B;  3ZM7 A;  1ELO A;  3J81 Q;  2YPN A;  2A2C A;  4AQY I;  2EOY A;  2JEA B;  2DLK A;  2JE6 A;  4WX9 A;  1TF3 A;  4DKK A;  1G2D C;  1BKN A;  1IBL I;  4LF9 I;  1HNW I;  4LF5 I;  5IWA I;  2N3H A;  4I3H A;  5F3W A;  5BR8 I;  4LFC E;  2G7H A;  2EOO A;  3B4T A;  5EKW A;  4USK A;  3WU6 A;  2EOS A;  4MQY A;  1RR9 A;  1UHZ A;  1B69 A;  1EKZ A;  1H73 A;  1IMU A;  1Z0T A;  3M85 G;  5L3J A;  1KYQ A;  1R6L A;  1N34 I;  4F2J C;  4U3B A;  3ADL A;  4OX9 E;  1X6H A;  2E1M A;  2EM7 A;  3OML A;  2ENA A;  4OZE A;  3H4L A;  5ELW A;  4M0V A;  4DR1 E;  1YYK A;  2I9I A;  1WHQ A;  4FW9 A;  2R76 A;  2BA0 G;  5A6B A;  3KRN A;  1RQ0 A;  2ODR C;  2RSI A;  2FGG A;  2I13 A;  2LUQ A;  2JP9 A;  4O43 A;  4LCH A;  2C38 A;  2EFG A;  2BB8 A;  2RTX A;  3GME A;  1YH8 A;  4L5N C;  1OYS A;  3T1Y I;  1J26 A;  1X47 A;  4MYU A;  1KJK A;  1FJG I;  4DV7 E;  5JEA B;  1L4S A;  5TSE A;  2EPP A;  2V87 A;  2UXD E;  2LTS A;  3ZZU A;  1HNX I;  4LF7 I;  2UXB I;  2YT4 A;  4DR5 E;  4R2E A;  5DRP A;  2EL5 A;  5K36 B;  3H09 A;  4JI6 E;  3VK6 A;  3ADI A;  4IFD E;  1ZXM A;  1NCS A;  4KHP I;  4M9V C;  4MYT A;  5A69 A;  3PS1 A;  4FW7 A;  4DV2 I;  3HXL A;  3U1K A;  2O1V A;  5AAS A;  4O5G A;  4LU9 A;  3F6H A;  4MU1 A;  2EOH A;  4DPW A;  1B62 A;  2CTD A;  4UTG A;  2EM4 A;  2YRM A;  4KWY A;  4GZN C;  1UDS A;  1QZR A;  4WPY A;  2CSH A;  2LJH A;  2JVA A;  1A1G A;  4YHH I;  1HNZ I;  1ZM3 A;  3MHH C;  4NXN I;  1Z0C A;  1SFE A;  5FLX C;  4X8W A;  5DRR A;  2YTE A;  2UU9 E;  4FWD A;  4DPY A;  5LMU I;  2HFU A;  4R1F A;  3VHT B;  3B8H A;  4DV1 E;  4HXZ A;  2C39 B;  1E3H A;  3BF2 A;  3MHS C;  4JYA E;  2FV4 B;  1YSA C;  4FW5 A;  2DMI A;  2EQ3 A;  4FWG A;  2MKD A;  1UBD C;  1RRE A;  2EMK A;  1EH7 A;  2L33 A;  1UEK A;  3THN A;  1H7U A;  1T4N A;  4IFD A;  1UDO A;  2EPO A;  4B3M E;  2Q2E B;  2X7I A;  3PS2 A;  2VF1 A;  4YY3 E;  3FIG A;  2RQL A;  2DSY A;  1MEY C;  2Z5B B;  1ZM4 A;  2YU5 A;  5KL5 A;  2WBT A;  2EN6 A;  1Y60 A;  2VQE E;  3ZKD A;  2BBG A;  2EMB A;  3VYY A;  2VQF E;  2R3V A;  1A1F A;  2PO1 B;  2NN6 C;  4OX9 I;  3QG5 C;  4JI8 E;  1HR0 E;  2WW4 A;  4J3D A;  4JI2 E;  2DIX A;  1GTK A;  4M2Z A;  1P42 A;  2B9D A;  4DR1 I;  2C37 B;  2LBS B;  4L8N A;  4GKK E;  4ZYH A;  2BV3 A;  1O0W A;  2DMY A;  1EH8 A;  3KZZ A;  2YSO A;  3U1Y A;  2BR2 B;  1X49 A;  2M7Q A;  2KOU A;  1X3C A;  1XMQ E;  1N32 E;  1SR9 A;  3ZOQ B;  5AC4 A;  4LOM A;  2NUG A;  2WBU A;  3C4T A;  1WRJ A;  4DPX A;  2Q8U A;  1NHH A;  1EA6 A;  5DNY A;  1Z0E A;  4F6M A;  3OTO E;  1PJT A;  3M99 B;  4WSG A;  1RHY A;  4DV7 I;  1Z1B A;  3L7Z B;  2UXD I;  2EL6 A;  2EPU A;  4DR6 E;  4NZV A;  1WUU A;  4ZYE A;  4DR5 I;  2RPC A;  3B82 A;  4LF6 I;  3ZKB A;  4F9A B;  2BM0 A;  3D4J A;  1ZR9 A;  2E5L E;  2O1T A;  5AE1 A;  1A1H A;  2PNL A;  2Z5B A;  2PNZ A;  3HUL A;  1IQO A;  3C6M A;  1MX0 A;  2NUF A;  2O1U A;  3QT8 A;  1T4O A;  2B7V A;  2IOP A;  3V5R A;  1EI1 A;  4OO1 B;  5IXM B;  4TUI A;  5FLX Q;  5LMN E;  2ELZ A;  2RS6 A;  4LF4 E;  1ZU1 A;  2JOB A;  1AAY A;  1YFH A;  1PJS A;  4LFB E;  2EMZ A;  4X62 E;  2EOR A;  1MG7 A;  1NHJ A;  2M4I A;  4NHR A;  1DAR A;  2F4V I;  2BR2 A;  4BCA A;  4R2R A;  3WU4 A;  4MLQ A;  2EMI A;  3C6K A;  1RC7 A;  3V2U C;  4DU7 A;  4F9C B;  4DV6 E;  3K85 A;  3M7N D;  1G2F C;  2V2Z A;  1IBK E;  1GQE A;  3NZK A;  1PKP A;  4JI7 E;  1X5W A;  2L92 A;  4BMJ A;  4JI1 E;  4GKJ E;  1KIJ A;  4QNK A;  4DV1 I;  4IFD C;  3IWC A;  2L6M A;  1ZXN A;  2B3T B;  4X64 E;  2NAB A;  4IJD A;  4R03 A;  4JYA I;  2BA1 G;  1Z5A A;  2EN2 A;  4MU0 A;  2O1W A;  2PO0 B;  5IT9 C;  2E72 A;  4AID A;  1UIL A;  4GEQ B;  5JEA E;  2X36 A;  2EOX A;  4BBY A;  2EPN A;  5KL4 A;  1ZM2 A;  5FWK A;  4K0K E;  2WP8 B;  4BC9 A;  5KL6 A;  2A2D A;  2CZ9 A;  5AC5 A;  2V8P A;  1WJP A;  2EPA A;  1T4L B;  4B3M I;  5K36 E;  5K36 C;  2ENC A;  3P1X A;  3DJW A;  4HYM A;  3LNU A;  4YY3 I;  5JEA D;  1NEI A;  3ZZ0 A;  1USV A;  2N3G A;  2Z5C B;  5K36 D;  3Q1Q A;  4FW3 A;  4QNJ A;  1OYR A;  2EPC A;  2YTJ A;  2PRT A;  1FWL A;  1F2I G;  2ZM6 E;  2L3J A;  4F54 A;  3GON A;  5DNX A;  4DPT A;  2EQ0 A;  5C0X D;  5C0X B;  1ZAA C;  4AQY E;  2VQF I;  4BA2 B;  3TQM A;  4DMI A;  4JI8 I;  1HR0 I;  3LPS A;  4JI2 I;  4OO1 F;  3CDI A;  2EN3 A;  1KTV A;  4DV3 E;  2HK3 A;  3PYD A;  1FI4 A;  5AE3 A;  4DU8 A;  4GKK I;  2L8T A;  3PYF A;  4DV5 E;  4JI4 E;  1PVG A;  5LLQ A;  3ADG A;  2EN7 A;  1J5E E;  1XMQ I;  1RMD A;  4X9J A;  4R2Q A;  2JY9 A;  1PJQ A;  2WZO A;  2DGC A;  5EL9 A;  2J65 A;  3HPZ A;  2R1F A;  3JAM C;  4LF8 E;  2EM5 A;  2L2M A;  3BID A;  1Z0V A;  3OTO I;  3EQ1 A;  4DR6 I;  2MC5 A;  4DUZ E;  4JI0 E;  2LVH A;  1FKA E;  2WP8 A;  2WBS A;  4BA1 B;  4ED4 A;  2DRP A;  3LTO A;  5ADZ A;  2YTD A;  3M6A A;  2JEB B;  1ZBT A;  4ZYD A;  2V89 A;  4FWH A;  2EPK X;  2N8X A;  1Y4U A;  4N3O A;  5JEA A;  2E5L I;  4Q28 A;  4DR3 E;  2EMA A;  3ZZT A;  2Z5C A;  2EOE A;  5K36 A;  1QNT A;  1DGC A;  1IBL E;  1H72 C;  4IZK B;  4JG4 A;  3HPS A;  2LJP A;  1NZ0 A;  1H74 A;  2RSM A;  2R42 A;  2IOQ A;  4LPF A;  4WXC A;  4BA2 A;  2EMW A;  4KQV A;  5LMN I;  2HKJ A;  1I94 E;  3UHM A;  2EM6 A;  4LF4 I;  1TN9 A;  1U2R A;  2H36 X;  5JEA F;  4DR7 E;  4X62 I;  2EM8 A;  4LFB I;  3F0N A;  2CGE A;  2EP3 A;  4FW4 A;  4LFC I;  3PYG A;  1FNM A;  5K36 F;  4PRX A;  1DQ3 A;  4B3R E;  1Z59 A;  4Z7C A;  4EMD A;  4X66 E;  1T38 A;  5C0X F;  3EPK A;  5KL3 A;  4B3S E;  1XNR E;  3P3G A;  4I8O A;  4DV6 I;  3RMP A;  1A1K A;  1IBK I;  5IT9 Q;  3ADJ A;  3EPL A;  2L2N A;  2A25 A;  2VE7 C;  3F6G A;  1UN6 B;  4JI7 I;  2EQ1 A;  3VYX A;  3DD6 A;  4JI1 I;  2LUP B;  1YZ9 A;  2GPI A;  2EOM A;  2PO2 B;  4DR4 E;  4X64 I;  3CDJ A;  1Z0W A;  4HAC B;  1BB8 A;  4UT4 A;  3M85 D;  1N0V C;  1FWK A;  2L2K B;  3LLH A;  2LT7 A;  1A1L A;  2V86 A;  2C39 A;  3EPH A;  4OOG C;  4BHB A;  4K0K I;  4IZK A;  4R2P A;  4WFT A;  2IHR 1;  1Y4S A;  2BA0 D;  2BA1 D;  2YTG A;  2DB2 A;  2V85 A;  3JU0 A;  1XXE A;  1N33 E;  2DLQ A;  5AE2 A;  2YTO A;  1MU5 A;  1UDQ A;  2CG9 A;  3QT7 A;  3AV0 A;  2JR1 A;  2EOQ A;  2JE6 B;  1R6M A;  2GS8 A;  2EM0 A;  4JI6 I;  2ZM6 I;  1Z5B A;  3Q6M A;  2ZIT A;  4F9B B;  4NXM E;  2IER A;  1XMO E;  2D9H A;  2CPN A;  4IS1 C;  1N36 E;  2HHH E;  1KVK A;  3PS3 A;  4OO1 E;  1JK2 A;  3MSW A;  2O3Z A;  4O4K A;  3JAM Q;  4DV3 I;  4TUG A;  4DUY E;  1PDA A;  5GME A;  3QT5 A;  3K17 A;  3K6Q A;  2PO1 A;  1B63 A;  2EMF A;  3L00 A;  2NUE A;  2PNM A;  4OO1 D;  2EN4 A;  4HTG A;  4DV5 I;  4JI4 I;  3AUZ A;  2GO4 A;  2BM1 A;  1J5E I;  2NA2 A;  2LE2 A;  2HK2 A;  4P52 A;  4YHH E;  2VRD A;  1HNZ E;  4ISA A;  4DV0 E;  2C37 A;  4DR2 E;  4N4R B;  5JEA C;  2K4V A;  3T1H E;  4LF8 I;  2J7K A;  1QU6 A;  1A1J A;  4P7D A;  1STU A;  3HQ1 A;  1IBM E;  2EM3 A;  5A6B D;  1YYW A;  2UXC E;  4DPU A;  2AE8 A;  2ADR A;  4JI0 I;  4DUZ I;  5A6A A;  2KHX A;  2LTR A;  2EJ4 A;  1Y5Y A;  2EPX A;  2AJ4 A;  3PYE A;  2UUA E;  2NN6 D;  2NN6 B;  2UU9 I;  4MU3 A;  2JPA A;  3L7Z A;  3P76 A;  4X65 E;  4DR3 I;  1OYP A;  1AH5 A;  4AIM A;  4OKG A;  4JI5 E;  3KWR A;  3UK3 C;  1S4E A;  3PRY A;  3J80 C;  1T39 A;  4WUB A;  4JI3 E;  5A6K A;  4P7A A;  2EWL A;  2JYA A;  3IWB A;  2JOX A;  2LV2 A;  4MLV A;  1I94 I;  3Q6N A;  3EPJ A;  4DR7 I;  4LCF A;  3P3C A;  4JV5 E;  1S16 A;  2DEI A;  4MDT A;  2EZ6 A;  4M30 A;  4OO1 A;  5C0X E;  2YWQ A;  4B3R I;  3HTX A;  2UUB E;  2JXP A;  4X66 I;  2EOZ A;  4RH8 A;  4FN5 A;  2YU8 A;  1PIE A;  4B3S I;  1XNR I;  3IWD A;  4B3T E;  1Y6Z A;  4RPF A;  2VQE I;  2EML A;  1YPN A;  1Z5C A;  2EL4 A;  4WUD A;  4DV4 E;  4LFA E;  1XHK A;  2MDG A;  4DR4 I;  3CWV A;  1VIS A;  1YUJ A;  2MKN A;  2E1R A;  4BHC A;  3GLL A;  2LRS A;  3KZY A;  2EMX A;  1KKH A;  1XNQ E;  2NN6 A;  4HY1 A;  2EN8 A;  3BBG A;  2LJU A;  1N32 I; 
#chains in the Genus database with same CATH homology
 4ZVI A;  3JTZ A;  5A2Q C;  2UUC E;  1N0U A;  1NHI A;  3J7A G;  2V2Q A;  1H7S A;  5GMD A;  4LF6 E;  2XEX A;  1N33 I;  1D6T A;  1Z0G A;  4DXL A;  4WSP A;  4XTJ A;  2B7T A;  4NXM I;  1XMO I;  3K1J A;  1N36 I;  2HHH I;  4LTY A;  4LF9 E;  1HNW E;  4LF5 E;  2FTX B;  4DUY I;  2ODR D;  1WHN A;  5IWA E;  2OI2 A;  5BR8 E;  4PU9 A;  3J7Y p;  3J81 C;  2F4V E;  4P78 A;  3DF6 A;  2JWO A;  1USU A;  4DV0 I;  4M1K A;  4DR2 I;  4IZJ D;  4IZJ B;  3T1H I;  2L3C A;  4USM A;  2UXC I;  1IBM I;  2LMZ A;  1N34 E;  3J80 Q;  2MDR A;  3WU5 A;  4URL A;  2YZT A;  2M1S A;  2UUA I;  2VF3 A;  4GKJ I;  4X65 I;  2V8Q B;  4Z7Y A;  1A6F A;  4J8Z A;  3WU3 A;  1DI2 A;  3J7A M;  3C4B A;  4JI5 I;  2V2V A;  1ZM9 A;  2DEJ A;  4JI3 I;  4WUC A;  2V34 A;  3T1Y E;  1GZ6 A;  1FJG E;  4WYQ B;  1YYO A;  1HNX E;  3LML A;  4R8O A;  5CFF E;  4LF7 E;  2UXB E;  4JV5 I;  2V83 A;  4KZS A;  4PRV A;  2UUB I;  2ZBK B;  4KHP E;  1HK7 A;  2HKE A;  3P06 A;  1WXR A;  4B3T I;  4IZJ A;  4DV2 E;  4DV4 I;  4LFA I;  2V88 A;  5A2Q Q;  2GQ0 A;  4BS9 A;  3QT6 A;  1K47 A;  4BC7 A;  2RS7 A;  1XNQ I;  2HFS A;  2KON A;  5LL6 R;  3B78 A;  2NPF A;  4HAC A;  2UUC I;  4NXN E;  2F8B A;  2MC6 A;  5LMU E;  1Z0B A;  1X48 A;  5T6J A;  3HJC A;  1ZBQ A;  2Z5E A;  1OJ4 A;  3ZM7 A;  1ELO A;  3J81 Q;  2A2C A;  1BKN A;  4DKK A;  1IBL I;  4LF9 I;  1HNW I;  4LF5 I;  5IWA I;  2N3H A;  4I3H A;  5F3W A;  5BR8 I;  4LFC E;  2G7H A;  4USK A;  3WU6 A;  1RR9 A;  1UHZ A;  1EKZ A;  1H73 A;  1Z0T A;  5L3J A;  1N34 I;  3ADL A;  4OX9 E;  2E1M A;  3OML A;  3H4L A;  4M0V A;  4DR1 E;  1YYK A;  1WHQ A;  4FW9 A;  1RQ0 A;  2ODR C;  2FGG A;  2LUQ A;  2EFG A;  2RTX A;  4L5N C;  3T1Y I;  1J26 A;  1X47 A;  4MYU A;  1FJG I;  4DV7 E;  2UXD E;  2V87 A;  3ZZU A;  1HNX I;  2LTS A;  4LF7 I;  2UXB I;  2YT4 A;  4DR5 E;  3H09 A;  4JI6 E;  3VK6 A;  3ADI A;  1ZXM A;  4KHP I;  4MYT A;  4DV2 I;  3HXL A;  2O1V A;  5AAS A;  4LU9 A;  3F6H A;  4DPW A;  1B62 A;  4UTG A;  1QZR A;  4WPY A;  2LJH A;  2JVA A;  4YHH I;  1HNZ I;  1ZM3 A;  4NXN I;  1Z0C A;  5FLX C;  4X8W A;  2UU9 E;  4FWD A;  4DPY A;  5LMU I;  2HFU A;  4R1F A;  3B8H A;  4DV1 E;  4HXZ A;  4JYA E;  2FV4 B;  4FWG A;  1RRE A;  1UEK A;  2L33 A;  1H7U A;  1T4N A;  4B3M E;  2Q2E B;  2X7I A;  2VF1 A;  4YY3 E;  3FIG A;  2DSY A;  2Z5B B;  1ZM4 A;  2VQE E;  3ZKD A;  3VYY A;  2R3V A;  2VQF E;  4OX9 I;  4JI8 E;  2WW4 A;  1HR0 E;  4JI2 E;  2DIX A;  4M2Z A;  4DR1 I;  2B9D A;  2LBS B;  4L8N A;  4GKK E;  2BV3 A;  1O0W A;  2DMY A;  1X49 A;  2M7Q A;  2KOU A;  1XMQ E;  1N32 E;  1SR9 A;  3ZOQ B;  2NUG A;  3C4T A;  4DPX A;  1NHH A;  1EA6 A;  5DNY A;  1Z0E A;  3OTO E;  4DV7 I;  2UXD I;  4DR6 E;  1WUU A;  4DR5 I;  3B82 A;  4LF6 I;  3ZKB A;  4F9A B;  2BM0 A;  3D4J A;  2E5L E;  2O1T A;  5AE1 A;  2PNL A;  2Z5B A;  3HUL A;  1MX0 A;  2NUF A;  2O1U A;  3QT8 A;  1T4O A;  2B7V A;  2IOP A;  3V5R A;  1EI1 A;  4TUI A;  5FLX Q;  5LMN E;  2RS6 A;  4LF4 E;  2JOB A;  4LFB E;  4X62 E;  1MG7 A;  1NHJ A;  2M4I A;  1DAR A;  2F4V I;  4BCA A;  3WU4 A;  1RC7 A;  3V2U C;  4DU7 A;  4F9C B;  4DV6 E;  3K85 A;  2V2Z A;  1IBK E;  1GQE A;  1PKP A;  4JI7 E;  4GKJ E;  2L92 A;  4BMJ A;  4JI1 E;  1KIJ A;  4DV1 I;  3IWC A;  2L6M A;  1ZXN A;  2B3T B;  4X64 E;  4R03 A;  4JYA I;  1Z5A A;  2O1W A;  5IT9 C;  1UIL A;  4GEQ B;  2X36 A;  4BBY A;  1ZM2 A;  5FWK A;  4K0K E;  4BC9 A;  2A2D A;  2CZ9 A;  2V8P A;  1T4L B;  4B3M I;  3P1X A;  3DJW A;  4HYM A;  3LNU A;  4YY3 I;  3ZZ0 A;  1USV A;  2N3G A;  2Z5C B;  3Q1Q A;  1FWL A;  2ZM6 E;  2L3J A;  4F54 A;  3GON A;  4DPT A;  4AQY E;  2VQF I;  4DMI A;  4JI8 I;  1HR0 I;  3LPS A;  4JI2 I;  1KTV A;  4DV3 E;  2HK3 A;  3PYD A;  1FI4 A;  5AE3 A;  4DU8 A;  4GKK I;  2L8T A;  3PYF A;  4DV5 E;  4JI4 E;  1PVG A;  3ADG A;  1J5E E;  1XMQ I;  2JY9 A;  2WZO A;  3HPZ A;  3JAM C;  4LF8 E;  2L2M A;  3OTO I;  1Z0V A;  4DR6 I;  2MC5 A;  4DUZ E;  4JI0 E;  1FKA E;  4ED4 A;  3LTO A;  5ADZ A;  3M6A A;  4FWH A;  1ZBT A;  4N3O A;  2V89 A;  2E5L I;  1Y4U A;  4Q28 A;  4DR3 E;  3ZZT A;  2Z5C A;  1IBL E;  1H72 C;  4IZK B;  4JG4 A;  3HPS A;  2LJP A;  1NZ0 A;  1H74 A;  2RSM A;  2R42 A;  2IOQ A;  4KQV A;  5LMN I;  2HKJ A;  1I94 E;  4LF4 I;  1U2R A;  2H36 X;  4DR7 E;  4X62 I;  4LFB I;  3F0N A;  2CGE A;  4LFC I;  3PYG A;  1FNM A;  4PRX A;  1DQ3 A;  4B3R E;  1Z59 A;  4Z7C A;  4EMD A;  4X66 E;  4B3S E;  1XNR E;  4DV6 I;  4I8O A;  3RMP A;  1IBK I;  5IT9 Q;  3ADJ A;  2L2N A;  3F6G A;  2VE7 C;  4JI7 I;  3VYX A;  4JI1 I;  2LUP B;  1YZ9 A;  4DR4 E;  4X64 I;  1Z0W A;  4HAC B;  4UT4 A;  1N0V C;  1FWK A;  2L2K B;  3LLH A;  2V86 A;  4OOG C;  4K0K I;  4IZK A;  4WFT A;  2IHR 1;  1Y4S A;  2DB2 A;  2V85 A;  3JU0 A;  1N33 E;  5AE2 A;  1MU5 A;  2CG9 A;  3QT7 A;  3AV0 A;  2JR1 A;  2GS8 A;  4JI6 I;  2ZM6 I;  1Z5B A;  3Q6M A;  2ZIT A;  4F9B B;  4NXM E;  4AQY I;  1XMO E;  1KVK A;  2CPN A;  1N36 E;  2HHH E;  3MSW A;  3JAM Q;  4DV3 I;  4TUG A;  4DUY E;  5GME A;  3QT5 A;  3K17 A;  3K6Q A;  1B63 A;  2PNM A;  2NUE A;  4DV5 I;  4JI4 I;  3AUZ A;  2BM1 A;  1J5E I;  2NA2 A;  2LE2 A;  2HK2 A;  4P52 A;  4YHH E;  1HNZ E;  4DV0 E;  4DR2 E;  2K4V A;  3T1H E;  4LF8 I;  2J7K A;  1QU6 A;  2UXC E;  4P7D A;  1STU A;  3HQ1 A;  1IBM E;  1YYW A;  4DPU A;  4JI0 I;  4DUZ I;  2KHX A;  2LTR A;  2AJ4 A;  3PYE A;  2UUA E;  2UU9 I;  4X65 E;  4DR3 I;  4JI5 E;  3KWR A;  1S4E A;  3PRY A;  3J80 C;  4WUB A;  4JI3 E;  4P7A A;  2EWL A;  3IWB A;  2JOX A;  1I94 I;  3Q6N A;  4DR7 I;  4JV5 E;  1S16 A;  2DEI A;  2EZ6 A;  4M30 A;  4B3R I;  3HTX A;  2UUB E;  4X66 I;  4FN5 A;  1PIE A;  4B3S I;  1XNR I;  3IWD A;  4B3T E;  1Y6Z A;  4RPF A;  2VQE I;  1Z5C A;  4WUD A;  4DV4 E;  4LFA E;  1XHK A;  4DR4 I;  3CWV A;  1VIS A;  2E1R A;  2LRS A;  1KKH A;  1XNQ E;  4HY1 A;  1N32 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...