5LL6R

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
NTEEKGWVPVTKLGRLVKAGKITTIEEIFLHSLPVKEFQIIDTLLPGLQDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTTGKCGSVTVRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFLTPNLWAEQPLPVSPLDIYSDEASAQKKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
total genus 39
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
R PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5ll6R01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5ll6R02
4LF6I 2OI2A 1FJGI 1NHIA 2UXBI 1HNWI 4JI1I 2ZBKB 4USMA 2DEIA 4X64I 4Z7YA 1Z5AA 4DUYI 4LFBI 4DUYE 4P52A 1HNXE 2UXDE 1J5EI 4JI6I 3LTOA 5IT9C 2UU9E 5IWAI 3WU6A 2HFUA 1EI1A 2X36A 3OTOE 4JI4I 4OX9E 4JI3I 5L3JA 4X64E 2WW4A 1Z0TA 4B3MI 1MU5A 1ZM2A 4NXNE 3J80C 2LJPA 4X62E 1HR0I 4R1FA 4JI0I 4DPYA 2BM1A 5BR8E 1N0VC 1H73A 2V2QA 4DR3I 4URLA 3J81C 4K0KE 3PYFA 2UXDI 2UUAE 5LMNI 2UXCI 1FKAE 3ZZUA 4X65E 4DR7I 3ZZTA 3QT5A 3V5RA 4JI4E 3ZKBA 4DUZI 1N32E 2HK3A 5GMEA 4RPFA 4DR5I 4KHPI 4JI3E 3B8HA 1FJGE 5LMNE 4DPWA 3QT8A 2UUCE 4LF8I 3OTOI 4FN5A 2VQEI 4DV7I 4B3TE 1FI4A 4GKJI 1NHJA 4JI7E 4LF7E 5LMUE 4JI0E 3LPSA 1IBKE 3PYDA 1N32I 1H74A 4DV2I 2VQFI 3PYGA 4HY1A 1S4EA 2VF3A 4DPUA 4OX9I 1Z5CA 1B62A 3QT6A 1Z0GA 1OJ4A 4FWDA 1FNMA 2E1RA 1KTVA 1Z59A 2HFSA 4DR2E 3T1YE 4JI2E 4UTGA 4GKJE 2V34A 4LFAE 4JI8E 2VQEE 4B3TI 4WUCA 4DU8A 4DV1I 1Z5BA 1D6TA 4JI7I 3D4JA 2HKJA 1UEKA 1Z0CA 2DEJA 2R42A 4DR6I 4JG4A 2V8PA 4LFCI 2UUCI 4LF8E 1S16A 1I94E 1N33E 5FLXC 3T1HI 1I94I 1NHHA 3J7AG 4X66I 1BKNA 4PRVA 2X7IA 4LF9E 3WU4A 4X65I 1XMOI 2V2ZA 4B3SI 4NXME 3M6AA 3K17A 3B78A 1J5EE 2BM0A 1DARA 4USKA 1N0UA 4DR3E 1N34I 4M1KA 1A6FA 4DR4I 4LF9I 4DV5E 4GKKI 4EMDA 4JYAE 1N36I 4HYMA 4NXNI 4AQYE 2V2VA 1HNWE 1ELOA 2UXBE 4GKKE 2CZ9A 3ZM7A 1N33I 2UXCE 3LNUA 4DV6E 2HHHI 4DV3I 1IBLE 2F4VI 4LF4I 1XNQI 1IBME 1Z0WA 1NZ0A 1XNQE 1XMOE 2HK2A 1H72C 1WUUA 3K1JA 2R3VA 4JV5I 4DR1E 4LFBE 4B3SE 3Q1QA 5LL6R 2UUBI 1H7SA 4X66E 3PYEA 4DPXA 2HKEA 4HACA 3H4LA 4Z7CA 4DUZE 2GS8A 1N36E 4YHHE 2A2DA 1MX0A 2UUAI 2VQFE 1ZM4A 4JI1E 1ZXMA 1K47A 4DV5I 4DV1E 3B82A 4DV6I 3QT7A 2HHHE 5GMDA 4DV0I 3WU3A 4YHHI 2UU9I 1IBKI 4DV3E 4NXMI 1Z0BA 3F0NA 4LF5I 5LMUI 4P7AA 5FLXQ 4DXLA 3ZKDA 3CWVA 3J81Q 4JI5E 4B3ME 3JAMC 1Z0VA 2NPFA 4DV2E 1RR9A 1MG7A 2XEXA 4FWGA 4ZVIA 4JV5E 1ZM3A 4JYAI 2UUBE 1PIEA 4PRXA 4B3RE 1XMQE 4DV4I 4DR1I 1N34E 1QZRA 1IBMI 2J7KA 4FWHA 5BR8I 4I3HA 4B3RI 1ZM9A 4LF7I 4X62I 1HR0E 4UT4A 4LFCE 5A2QQ 4DR6E 1PKPA 3GONA 4AQYI 1PVGA 2Q2EB 2ZITA 1U2RA 4LF5E 1B63A 5A2QC 4HXZA 1KIJA 4DU7A 4DR4E 3HULA 1HNZI 2E5LI 4KQVA 4LFAI 3J7AM 3J80Q 4YY3E 2F4VE 1Z0EA 1XMQI 4DPTA 2AJ4A 1VISA 3JAMQ 1KVKA 4XTJA 4YY3I 3T1YI 4JI2I 4KHPE 3WU5A 1H7UA 4DV7E 5IT9Q 2E5LE 1FWKA 1XHKA 4DV4E 1HNZE 4PU9A 1KKHA 4ED4A 2ZM6E 3T1HE 1XNRI 1HNXI 2A2CA 4DR5E 4HACB 2ZM6I 1XNRE 4K0KI 4MYUA 2EFGA 4DR7E 4FW9A 4JI5I 4MYTA 4DV0E 1FWLA 1ZXNA 4LF4E 3V2UC 1EA6A 1IBLI 4WUBA 3ZZ0A 4JI8I 1RREA 4JI6E 5IWAE 4LF6E 4WUDA 2BV3A 4DR2I
chains in the Genus database with same CATH superfamily
1PDAA 4KZSA 2OI2A 4LF6I 4OO1A 1FJGI 2EN2A 2EOQA 3MHHC 4MLVA 1NHIA 2NN6B 4BBYA 5JEAA 3AUZA 2LUPB 2V83A 2UXBI 4RHBB 2GLIA 3HTXA 4IFDA 2LE2A 1Y60A 4JI1I 1HNWI 5K36A 2ZBKB 4USMA 3C6KA 2DEIA 1YSAC 2FGGA 4X64I 2IOQA 4DMIA 4Z7YA 2RSMA 1Z5AA 1PJSA 3L7ZA 5F3WA 2WBUA 4DUYI 2ODRD 2C38A 2NN6F 2B7TA 5A6JA 4LFBI 4DUYE 2IESA 2LCEA 4P52A 1DQ3A 2L2MA 2YZTA 3DF6A 4BA2B 4AIDA 2LVHA 4NHRA 1HNXE 2UXDE 5ELWA 5JEAB 2ENCA 2L6MA 2NN6A 2YRMA 4WSPA 1UBDC 1J5EI 4JI6I 2EM6A 2DRPA 3LTOA 3HPSA 5IT9C 4Q35B 2UU9E 2N3GA 2JVAA 2WP8A 4J8ZA 2Z5EA 2EQ1A 2ODRC 5IWAI 4M9VC 4FW4A 4HTGA 3WU6A 1RHYA 2CTDA 2CSHA 2CGEA 1EI1A 2HFUA 2X36A 2EQ3A 1BBOA 4ZYEA 3OTOE 4MU0A 4JI4I 2MC5A 3EPJA 2DB2A 5A6BD 2GQ0A 5C0XE 1JK2A 1X47A 4MQYA 4OX9E 4JI3I 3LLHA 5L3JA 2VESA 2NN6C 4X64E 1A1IA 2VRDA 2LTRA 5DRQA 2EMXA 3ADLA 2YPNA 3P76A 2LT7A 2EPZA 2WW4A 3CDJA 2MC6A 1Z0TA 2EM0A 3HKMA 4B3MI 1X3CA 2EMYA 2C37A 2EMGA 1MU5A 2JXPA 1ZM2A 3UK3C 2EPRA 5K36E 1JK1A 4IFDD 1USVA 2PO0A 4NXNE 3J80C 1T4NA 2LJPA 4X62E 1HR0I 2EN1A 2CPNA 2EPUA 1A1KA 4R1FA 4JI0I 4DPYA 1IQOA 1KJKA 1UDQA 2PO1A 4O4KA 4R2AA 4WYQB 4BA1A 4M30A 2NN6D 4WX9A 2BM1A 5JEAC 5BR8E 1BBGA 2B7VA 1H73A 1N0VC 1YYOA 2V2QA 2LO3A 2J65A 3J7Yp 4DR3I 4URLA 2R76A 1Y5YA 1YUJA 3IWCA 3J81C 2WBSA 2O1WA 2LBSB 1KYQA 1USUA 1Y4SA 4K0KE 2PO1B 2EOXA 3PYFA 2EOHA 2UXDI 2UUAE 5LMNI 2UXCI 2EQ0A 1FKAE 4X65E 3ZZUA 4DR7I 2IERA 3ZZTA 1MEYC 2EN3A 3QT5A 1UHZA 3V5RA 4JI4E 4F54A 1LLMC 4LOMA 3ZKBA 1YHCA 5KL7A 1N32E 4DUZI 2LV2A 2HK3A 5GMEA 4RPFA 4DR5I 3NZKA 4KHPI 4JI3E 1FJGE 3B8HA 3P3CA 3ZOQB 4O24A 4O43A 3EPKA 2ENAA 5LMNE 4DPWA 4IFDB 3TQMA 4ZYDA 3ADJA 3U1KA 2Z5CB 3IWDA 5JEAF 1T39A 3QT8A 4R2CA 1X48A 2UUCE 4LF8I 3OTOI 4FN5A 2AE8A 4J3DA 4B3TE 2VQEI 4DV7I 4KWYA 4OO1C 2L33A 2ENHA 5C0XB 1FI4A 2VF1A 4GKJI 3KRNA 4JI7E 1NHJA 1UDSA 3B4TA 2Z5BA 4AM3A 3M7ND 1RQ0A 4LF7E 5LMUE 2PNLA 1F2IG 2EPKX 2BB8A 2O3ZA 4JI0E 4F9AB 1EH6A 3LPSA 2EPLX 1IBKE 5DNXA 2EM4A 2EN8A 3BGHA 2K7IA 1WHNA 3H09A 1QNTA 3PYDA 2LJHA 4ZYGA 4IZKA 4OO1E 1H74A 1N32I 1R6MA 4IZJA 4BA2A 3M85D 2RS6A 3C6MA 2EN7A 2C39B 4DV2I 2MKNA 2VQFI 3PYGA 4HY1A 4OKGA 2YTIA 4IJDA 1S4EA 2VF3A 4DPUA 3L7ZB 1X6EA 4OX9I 2PNMA 1T4LB 1Z5CA 2EL4A 5EKWA 1B62A 3QT6A 5A6AA 4LCHA 3ECRA 1YFHA 3PRYA 5K36C 1Z0GA 2RTXA 1OJ4A 4FWDA 2PNZA 2N3HA 4M2ZA 3THNA 1FNMA 2E1RA 5EL9A 4NBQA 3JTZA 1KTVA 1Z59A 2HFSA 2JEAA 2O1VA 4TUGA 4DR2E 2DGCA 3T1YE 4JI2E 4L8NA 2IOPA 4UTGA 2ELYA 3EPLA 4GKJE 2V34A 2FV4B 4OO1B 1OYSA 2NUEA 2NUFA 4LFAE 5AC4A 3KZYA 2EZ6A 2JR1A 5C0XC 4NZVA 1Y6ZA 2BA1G 2EORA 4JI8E 2VQEE 4B3TI 4WUCA 4DU8A 4R03A 1OYPA 4DV1I 5ADZA 2JP9A 3VYYA 3P1XA 2EOMA 4IZJD 1J26A 4IFDE 2LRSA 1G2FC 1UN6B 3MHSC 1Z5BA 1UILA 3M7NG 3UHMA 1O0WA 2L2KB 2GHFA 3HJCA 2EL5A 1D6TA 4JI7I 2I13A 1PJQA 2JY9A 1OYRA 2HKJA 3D4JA 1NEIA 4X9JA 1UEKA 4N3OA 1HK7A 1VI7A 4WSGA 1Z0CA 3GMEA 2DEJA 1DI2A 2R42A 4DR6I 4JG4A 2V8PA 4LFCI 4LF8E 2UUCI 2YSOA 1N33E 1I94E 2WBTA 1S16A 3Q6NA 4OO1F 4MLQA 5FLXC 3U1YA 5K36F 3T1HI 1I94I 1NHHA 2EPAA 1GTKA 5JEAE 3J7AG 3HPZA 3HQ1A 2RSIA 2BV3A 4U3BA 4X66I 2K4VA 3HXLA 1BKNA 4PRVA 3THOB 2X7IA 4LF9E 2WZOA 3WU4A 5LLQA 1ZBQA 4X65I 2LJUA 3JU0A 2EJ4A 4BS9A 1XMOI 1STUA 2EOIA 2WCC3 2V2ZA 3BIDA 2CT1A 4B3SI 5A6KA 5DRRA 4NXME 3M6AA 2WP8B 2D9HA 3K17A 2RPCA 2BA0G 1J5EE 3B78A 2YTDA 2BM0A 5AASA 2YRKA 2EM9A 4GEQB 1DARA 4USKA 1N0UA 4DR3E 2EPMX 2PO2A 1N3GA 2YSPA 4DU7A 2EOFA 1N34I 2CG9A 4M1KA 1A6FA 4OZEA 4DR4I 2KONA 4LF9I 2JEAB 2JEBB 1T4OA 4OOGC 4DV5E 4GKKI 3C4TA 2BR2B 1E3PA 4RH8A 4JYAE 4EMDA 4R2RA 4BMJA 1N36I 2EM2A 4HYMA 4NXNI 4AQYE 2V2VA 1TF6A 1HNWE 4FW7A 3DJWA 2V89A 1Z1BA 1ELOA 2UXBE 5T6JA 4GKKE 3P3EA 2CZ9A 1A1FA 2EMKA 4F6MA 2E1MA 2EL6A 2MDRA 2HGHA 3AV0A 3ZM7A 2YTJA 1T38A 4ISAA 5C0XF 1N33I 2LUQA 2UXCE 2YTNA 4HEIA 3LNUA 2L3JA 1EH8A 2CVEA 2O1UA 2PO2B 4DV6E 2HHHI 4DV3I 1IBLE 2J7JA 5A69A 2F4VI 4LF4I 5FWKA 3P3GA 3PS2A 4MDTA 4BC9A 1XNQI 2MKDA 1IBME 1X6HA 1XXEA 2L92A 2YU8A 2NUGA 1Z0WA 1NZ0A 1EKZA 1XMOE 1XNQE 1IQSA 5TSEA 1H72C 1WUUA 2HK2A 2R3VA 3K1JA 2JE6A 4DR1E 4JV5I 4LFBE 4R2SA 4B3SE 4FK5C 5LL6R 3Q1QA 2UUBI 5KL5A 1H7SA 2WNRA 4X66E 1SR9A 4P78A 3PYEA 4DPXA 1A1GA 4IS9A 2Z5CA 4WPYA 1IMUA 2EOZA 2HKEA 1WHQA 4R2DA 2EMFA 2JOXA 4HACA 2EPPA 4WXCA 3H4LA 4Z7CA 2EOJA 4DUZE 1YPNA 2DIXA 4MU4A 2V87A 5IXMB 4WFTA 1YYKA 2EOEA 3VK6A 5DNYA 1E3HA 4R2PA 2GS8A 2F1DA 1WJPA 2EMAA 4BC7A 2M9AA 1N36E 4F9CB 4YHHE 1MX0A 2M1SA 1R6LA 2A2DA 5AE3A 2UUAI 1WXRA 5AE1A 2VQFE 1ZM4A 2YTPA 4JI1E 1K47A 1ZXMA 4DV5I 3BF2A 1PJTA 4DV1E 3CDIA 2RS7A 2HHHE 2EWLA 2N8XA 3FIGA 2Z5BB 3B82A 3QT7A 4DV6I 2EOYA 2EE8A 5GMDA 2FTXB 4BCAA 4M0VA 3GLLA 4LPFA 2ELZA 3WU3A 2EPNA 4YHHI 4DV0I 2YTQA 5IV8B 5AE2A 2UU9I 1IBKI 2EPCA 2EM3A 4FW6A 4DV3E 2A25A 4L5NC 3RMPA 4NXMI 2HJJA 1X6FA 1Z0BA 3F0NA 4LF5I 5DNLA 5LMUI 3LMLA 2EN4A 4P7AA 1TF3A 5FLXQ 4DXLA 1P47A 2NA2A 4R8OA 2PO0B 2EPOA 2JWOA 4X8WA 2E72A 1UDOA 3ZKDA 3F6HA 3KWRA 4JI5E 3CWVA 3J81Q 2G7HA 4B3ME 3JAMC 1Z0VA 2NPFA 4GQUA 2I9IA 4DV2E 4R2EA 2EOSA 1RR9A 1MG7A 2C39A 2XEXA 4FWGA 4JV5E 2ADRA 4ZVIA 3ADIA 1NCSA 4WXDA 2EM8A 1ZM3A 5A6BA 4IZKB 4IFDC 4JYAI 4F9BB 3ADGA 2BBGA 3F6GA 2UUBE 1SFEA 1PIEA 4PRXA 4B3RE 1XMQE 3EPHA 4DV4I 4DR1I 3K6QA 2YRHA 1N34E 1A1JA 2H36X 1QZRA 2DMYA 3EQ1A 3K85A 3M99B 2YTFA 4MU3A 5JEAD 5C0XD 2J7KA 4BA1B 1IBMI 4FWHA 1ZBTA 5AC5A 1P42A 5BR8I 2JPAA 4O5GA 4I3HA 2RQLA 4B3RI 4MU1A 1X49A 1ZM9A 2JT2A 1A1HA 4LF7I 3GCMA 2F8BA 3BBGA 4ZYHA 1HR0E 4X62I 2C37B 4I8OA 2M4IA 2EMHA 5KL4A 4UT4A 3QG5C 5KL3A 4F6NA 4LFCE 4QNKA 3M85G 5KL2A 5A2QQ 4DR6E 1PKPA 2DLKA 2DSYA 2EM7A 2EMZA 1YH8A 2JOBA 3GONA 2V8QB 3DD6A 4R2QA 2L8TA 1AH5A 1UDNA 2C38B 4AQYI 2YU5A 1PVGA 2R1FA 4IS1C 2WNRB 2Q2EB 2ZITA 1U2RA 2V85A 4LF5E 1X5WA 2B9DA 1B63A 1MGTA 5A2QC 4HXZA 2EMCA 4DKKA 5KL6A 2EN6A 2VE7C 3VHTB 4DR4E 4BHCA 1KIJA 2BR2A 3Q6MA 3HULA 2EPXA 1A1LA 4TUIA 1HNZI 2E5LI 2YT4A 2L2NA 1YYWA 1QU6A 4KQVA 4OO1D 3MSWA 4LFAI 2EOOA 2GO4A 4GZNC 1EH7A 4F2JC 2YTEA 1ZAAC 3J7AM 5DRPA 3J80Q 4LTYA 4N4RB 4YY3E 1TN9A 1YUIA 2F4VE 2PRTA 1Z0EA 1XMQI 4DPTA 2AJ4A 1ZU1A 1VISA 1GZ6A 3JAMQ 2DMIA 1KVKA 1RC7A 4XTJA 4YY3I 1RMDA 2GO3A 4P7DA 1DGCA 2M7QA 1G2DC 3C4BA 3T1YI 4JI2I 5K36D 2PNZB 2EMBA 1B69A 4KHPE 4BHBA 3VYXA 3WU5A 1H7UA 2EMLA 4DV7E 5IT9Q 1HNZE 2E5LE 1FWKA 4DV4E 1XHKA 2O1TA 4FW3A 2DLQA 3KZZA 2NABA 2YWQA 1BB8A 3IWBA 1KKHA 2IHR1 4PU9A 2EP3A 3PS1A 2ZM6E 3T1HE 4ED4A 1XNRI 1HNXI 2V88A 2A2CA 3OMLA 2Q8UA 2NN6E 4DR5E 1GQEA 2LMZA 4HACB 4QNJA 2YTOA 3H1CA 4IZJB 2L3CA 1XNRE 2JEBA 2ZM6I 2MDGA 4K0KI 4MYUA 1AAYA 2EFGA 2V86A 2BA1D 2LTSA 2JYAA 2YTGA 1YZ9A 4DR7E 4U3DA 4LCGA 4FW9A 4JI5I 3PS3A 4IFDF 2EMIA 2GPIA 4FW5A 4MYTA 4DV0E 1L4SA 1FWLA 3L00A 2JE6B 2HC5A 1ZR9A 1ZXNA 4LF4E 3P06A 3V2UC 4LCFA 1EA6A 1WRJA 2B3TB 4WUBA 5DROA 3ZZ0A 1IBLI 5K36B 2BA0D 4JI8I 2EM5A 2EMWA 1RREA 4LU9A 4AIMA 4JI6E 5C0XA 5IWAE 2KHXA 4LF6E 4WUDA 1Y4UA 2KOUA 5CFFE 4Q28A 4DR2I
chains in the Genus database with same CATH topology
4LF6I 4KZSA 2OI2A 1FJGI 1NHIA 4BBYA 3AUZA 2LUPB 2V83A 2UXBI 3HTXA 2LE2A 1HNWI 4JI1I 2ZBKB 4USMA 2DEIA 2FGGA 4X64I 2IOQA 4DMIA 4Z7YA 2RSMA 1Z5AA 4DUYI 5F3WA 2ODRD 2B7TA 4LFBI 4DUYE 4P52A 1DQ3A 2L2MA 2YZTA 3DF6A 1HNXE 2UXDE 2L6MA 4WSPA 1J5EI 4JI6I 3LTOA 3HPSA 5IT9C 2UU9E 2N3GA 2JVAA 4J8ZA 2Z5EA 2ODRC 5IWAI 3WU6A 2CGEA 1EI1A 2HFUA 2X36A 3OTOE 4JI4I 2MC5A 2DB2A 2GQ0A 1X47A 4OX9E 4JI3I 3LLHA 5L3JA 4X64E 2LTRA 3ADLA 2WW4A 2MC6A 1Z0TA 4B3MI 1MU5A 1ZM2A 1USVA 4NXNE 3J80C 1T4NA 2LJPA 4X62E 1HR0I 2CPNA 4R1FA 4JI0I 4DPYA 4WYQB 4M30A 2BM1A 5BR8E 1H73A 2B7VA 1N0VC 1YYOA 2V2QA 3J7Yp 4DR3I 4URLA 3IWCA 3J81C 2O1WA 2LBSB 1USUA 1Y4SA 4K0KE 3PYFA 2UXDI 2UUAE 5LMNI 2UXCI 1FKAE 4X65E 3ZZUA 4DR7I 3ZZTA 3QT5A 1UHZA 3V5RA 4JI4E 4F54A 3ZKBA 4DUZI 1N32E 2HK3A 5GMEA 4RPFA 4DR5I 4KHPI 4JI3E 1FJGE 3B8HA 5LMNE 3ZOQB 4DPWA 3ADJA 2Z5CB 3IWDA 3QT8A 1X48A 2UUCE 4LF8I 3OTOI 4FN5A 4B3TE 2VQEI 4DV7I 2L33A 1FI4A 2VF1A 4GKJI 4JI7E 1NHJA 2Z5BA 1RQ0A 4LF7E 5LMUE 2PNLA 4JI0E 4F9AB 3LPSA 1IBKE 1WHNA 3H09A 3PYDA 2LJHA 4IZKA 1N32I 1H74A 4IZJA 2RS6A 4DV2I 2VQFI 3PYGA 4HY1A 1S4EA 2VF3A 4DPUA 4OX9I 2PNMA 1T4LB 1Z5CA 1B62A 3QT6A 3PRYA 1Z0GA 2RTXA 1OJ4A 4FWDA 2N3HA 4M2ZA 1FNMA 2E1RA 3JTZA 1KTVA 1Z59A 2HFSA 2O1VA 4TUGA 4DR2E 3T1YE 4JI2E 4L8NA 2IOPA 4UTGA 4GKJE 2V34A 2FV4B 2NUEA 2NUFA 4LFAE 2EZ6A 2JR1A 1Y6ZA 4JI8E 2VQEE 4B3TI 4WUCA 4DU8A 4R03A 4DV1I 5ADZA 3VYYA 3P1XA 4IZJD 1J26A 2LRSA 1Z5BA 1UILA 1O0WA 2L2KB 3HJCA 1D6TA 4JI7I 2JY9A 3D4JA 2HKJA 1UEKA 4N3OA 1HK7A 1Z0CA 2DEJA 1DI2A 2R42A 4DR6I 4JG4A 2V8PA 4LFCI 4LF8E 2UUCI 1N33E 1I94E 1S16A 3Q6NA 5FLXC 3T1HI 1I94I 1NHHA 3J7AG 3HPZA 3HQ1A 2BV3A 4X66I 2K4VA 3HXLA 1BKNA 4PRVA 2X7IA 4LF9E 2WZOA 3WU4A 1ZBQA 4X65I 3JU0A 4BS9A 1XMOI 1STUA 2V2ZA 4B3SI 4NXME 3M6AA 3K17A 1J5EE 3B78A 2BM0A 5AASA 4GEQB 1DARA 4USKA 1N0UA 4DR3E 1N34I 2CG9A 4M1KA 1A6FA 4DR4I 2KONA 4LF9I 1T4OA 4OOGC 4DV5E 4GKKI 3C4TA 4EMDA 4JYAE 4BMJA 1N36I 4HYMA 4NXNI 4AQYE 2V2VA 1HNWE 3DJWA 2V89A 1ELOA 2UXBE 5T6JA 4GKKE 2CZ9A 2E1MA 2MDRA 3ZM7A 3AV0A 1N33I 2LUQA 2UXCE 3LNUA 2L3JA 2O1UA 4DV6E 2HHHI 4DV3I 1IBLE 2F4VI 4LF4I 5FWKA 4BC9A 1XNQI 1IBME 2L92A 2NUGA 1Z0WA 1NZ0A 1EKZA 1XMOE 1XNQE 2HK2A 1H72C 1WUUA 3K1JA 2R3VA 4JV5I 4DR1E 4LFBE 4B3SE 3Q1QA 5LL6R 2UUBI 1H7SA 4X66E 1SR9A 4P78A 3PYEA 4DPXA 2Z5CA 4WPYA 2HKEA 1WHQA 2JOXA 4HACA 3H4LA 4Z7CA 4DUZE 2DIXA 2V87A 1YYKA 4WFTA 3VK6A 5DNYA 2GS8A 4BC7A 1N36E 4F9CB 4YHHE 1MX0A 2M1SA 2A2DA 5AE3A 2UUAI 1WXRA 5AE1A 2VQFE 1ZM4A 4JI1E 1K47A 1ZXMA 4DV5I 4DV1E 2RS7A 2HHHE 2EWLA 3FIGA 3B82A 2Z5BB 3QT7A 4DV6I 5GMDA 2FTXB 4BCAA 4M0VA 3WU3A 4DV0I 4YHHI 5AE2A 2UU9I 1IBKI 4DV3E 4L5NC 3RMPA 4NXMI 1Z0BA 3F0NA 4LF5I 5LMUI 3LMLA 4P7AA 5FLXQ 4DXLA 2NA2A 4R8OA 2JWOA 4X8WA 3ZKDA 3F6HA 3KWRA 4JI5E 3CWVA 3J81Q 2G7HA 4B3ME 3JAMC 1Z0VA 2NPFA 4DV2E 1RR9A 1MG7A 2XEXA 4FWGA 4JV5E 4ZVIA 3ADIA 1ZM3A 4IZKB 4JYAI 4F9BB 3ADGA 2UUBE 3F6GA 1PIEA 4PRXA 4B3RE 1XMQE 4DV4I 4DR1I 3K6QA 1N34E 2H36X 1QZRA 2DMYA 3K85A 1IBMI 2J7KA 4FWHA 1ZBTA 5BR8I 4I3HA 4B3RI 1X49A 1ZM9A 4LF7I 2F8BA 1HR0E 4X62I 4I8OA 2M4IA 4UT4A 4LFCE 5A2QQ 4DR6E 1PKPA 2DSYA 2JOBA 3GONA 2V8QB 2L8TA 4AQYI 1PVGA 2Q2EB 2ZITA 1U2RA 2V85A 4LF5E 2B9DA 1B63A 5A2QC 4HXZA 4DKKA 1KIJA 3Q6MA 2VE7C 4DR4E 4DU7A 3HULA 4TUIA 1HNZI 2E5LI 2YT4A 2L2NA 1YYWA 1QU6A 4KQVA 3MSWA 4LFAI 3J7AM 3J80Q 4LTYA 4YY3E 2F4VE 1Z0EA 1XMQI 4DPTA 2AJ4A 1VISA 1GZ6A 3JAMQ 1KVKA 4XTJA 1RC7A 4YY3I 4P7DA 2M7QA 3C4BA 3T1YI 4JI2I 4KHPE 3VYXA 3WU5A 1H7UA 4DV7E 5IT9Q 1HNZE 2E5LE 1FWKA 4DV4E 1XHKA 2O1TA 3IWBA 1KKHA 2IHR1 4PU9A 4ED4A 2ZM6E 3T1HE 1XNRI 1HNXI 2V88A 2A2CA 3OMLA 4DR5E 1GQEA 2LMZA 4HACB 4IZJB 2L3CA 1XNRE 2ZM6I 4K0KI 4MYUA 2EFGA 2V86A 2LTSA 1YZ9A 4DR7E 4FW9A 4JI5I 4MYTA 4DV0E 1FWLA 1ZXNA 4LF4E 3P06A 3V2UC 1EA6A 1IBLI 2B3TB 4WUBA 3ZZ0A 4JI8I 1RREA 4LU9A 4JI6E 5IWAE 2KHXA 4LF6E 4WUDA 1Y4UA 2KOUA 5CFFE 4Q28A 4DR2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 I;  2OI2 A;  1FJG I;  1NHI A;  2UXB I;  1HNW I;  4JI1 I;  2ZBK B;  4USM A;  2DEI A;  4X64 I;  4Z7Y A;  1Z5A A;  4DUY I;  4LFB I;  4DUY E;  4P52 A;  1HNX E;  2UXD E;  1J5E I;  4JI6 I;  3LTO A;  5IT9 C;  2UU9 E;  5IWA I;  3WU6 A;  2HFU A;  1EI1 A;  2X36 A;  3OTO E;  4JI4 I;  4OX9 E;  4JI3 I;  5L3J A;  4X64 E;  2WW4 A;  1Z0T A;  4B3M I;  1MU5 A;  1ZM2 A;  4NXN E;  3J80 C;  2LJP A;  4X62 E;  1HR0 I;  4R1F A;  4JI0 I;  4DPY A;  2BM1 A;  5BR8 E;  1N0V C;  1H73 A;  2V2Q A;  4DR3 I;  4URL A;  3J81 C;  4K0K E;  3PYF A;  2UXD I;  2UUA E;  5LMN I;  2UXC I;  1FKA E;  3ZZU A;  4X65 E;  4DR7 I;  3ZZT A;  3QT5 A;  3V5R A;  4JI4 E;  3ZKB A;  4DUZ I;  1N32 E;  2HK3 A;  5GME A;  4RPF A;  4DR5 I;  4KHP I;  4JI3 E;  3B8H A;  1FJG E;  5LMN E;  4DPW A;  3QT8 A;  2UUC E;  4LF8 I;  3OTO I;  4FN5 A;  2VQE I;  4DV7 I;  4B3T E;  1FI4 A;  4GKJ I;  1NHJ A;  4JI7 E;  4LF7 E;  5LMU E;  4JI0 E;  3LPS A;  1IBK E;  3PYD A;  1N32 I;  1H74 A;  4DV2 I;  2VQF I;  3PYG A;  4HY1 A;  1S4E A;  2VF3 A;  4DPU A;  4OX9 I;  1Z5C A;  1B62 A;  3QT6 A;  1Z0G A;  1OJ4 A;  4FWD A;  1FNM A;  2E1R A;  1KTV A;  1Z59 A;  2HFS A;  4DR2 E;  3T1Y E;  4JI2 E;  4UTG A;  4GKJ E;  2V34 A;  4LFA E;  4JI8 E;  2VQE E;  4B3T I;  4WUC A;  4DU8 A;  4DV1 I;  1Z5B A;  1D6T A;  4JI7 I;  3D4J A;  2HKJ A;  1UEK A;  1Z0C A;  2DEJ A;  2R42 A;  4DR6 I;  4JG4 A;  2V8P A;  4LFC I;  2UUC I;  4LF8 E;  1S16 A;  1I94 E;  1N33 E;  5FLX C;  3T1H I;  1I94 I;  1NHH A;  3J7A G;  4X66 I;  1BKN A;  4PRV A;  2X7I A;  4LF9 E;  3WU4 A;  4X65 I;  1XMO I;  2V2Z A;  4B3S I;  4NXM E;  3M6A A;  3K17 A;  3B78 A;  1J5E E;  2BM0 A;  1DAR A;  4USK A;  1N0U A;  4DR3 E;  1N34 I;  4M1K A;  1A6F A;  4DR4 I;  4LF9 I;  4DV5 E;  4GKK I;  4EMD A;  4JYA E;  1N36 I;  4HYM A;  4NXN I;  4AQY E;  2V2V A;  1HNW E;  1ELO A;  2UXB E;  4GKK E;  2CZ9 A;  3ZM7 A;  1N33 I;  2UXC E;  3LNU A;  4DV6 E;  2HHH I;  4DV3 I;  1IBL E;  2F4V I;  4LF4 I;  1XNQ I;  1IBM E;  1Z0W A;  1NZ0 A;  1XNQ E;  1XMO E;  2HK2 A;  1H72 C;  1WUU A;  3K1J A;  2R3V A;  4JV5 I;  4DR1 E;  4LFB E;  4B3S E;  3Q1Q A;  5LL6 R;  2UUB I;  1H7S A;  4X66 E;  3PYE A;  4DPX A;  2HKE A;  4HAC A;  3H4L A;  4Z7C A;  4DUZ E;  2GS8 A;  1N36 E;  4YHH E;  2A2D A;  1MX0 A;  2UUA I;  2VQF E;  1ZM4 A;  4JI1 E;  1ZXM A;  1K47 A;  4DV5 I;  4DV1 E;  3B82 A;  4DV6 I;  3QT7 A;  2HHH E;  5GMD A;  4DV0 I;  3WU3 A;  4YHH I;  2UU9 I;  1IBK I;  4DV3 E;  4NXM I;  1Z0B A;  3F0N A;  4LF5 I;  5LMU I;  4P7A A;  5FLX Q;  4DXL A;  3ZKD A;  3CWV A;  3J81 Q;  4JI5 E;  4B3M E;  3JAM C;  1Z0V A;  2NPF A;  4DV2 E;  1RR9 A;  1MG7 A;  2XEX A;  4FWG A;  4ZVI A;  4JV5 E;  1ZM3 A;  4JYA I;  2UUB E;  1PIE A;  4PRX A;  4B3R E;  1XMQ E;  4DV4 I;  4DR1 I;  1N34 E;  1QZR A;  1IBM I;  2J7K A;  4FWH A;  5BR8 I;  4I3H A;  4B3R I;  1ZM9 A;  4LF7 I;  4X62 I;  1HR0 E;  4UT4 A;  4LFC E;  5A2Q Q;  4DR6 E;  1PKP A;  3GON A;  4AQY I;  1PVG A;  2Q2E B;  2ZIT A;  1U2R A;  4LF5 E;  1B63 A;  5A2Q C;  4HXZ A;  1KIJ A;  4DU7 A;  4DR4 E;  3HUL A;  1HNZ I;  2E5L I;  4KQV A;  4LFA I;  3J7A M;  3J80 Q;  4YY3 E;  2F4V E;  1Z0E A;  1XMQ I;  4DPT A;  2AJ4 A;  1VIS A;  3JAM Q;  1KVK A;  4XTJ A;  4YY3 I;  3T1Y I;  4JI2 I;  4KHP E;  3WU5 A;  1H7U A;  4DV7 E;  5IT9 Q;  2E5L E;  1FWK A;  1XHK A;  4DV4 E;  1HNZ E;  4PU9 A;  1KKH A;  4ED4 A;  2ZM6 E;  3T1H E;  1XNR I;  1HNX I;  2A2C A;  4DR5 E;  4HAC B;  2ZM6 I;  1XNR E;  4K0K I;  4MYU A;  2EFG A;  4DR7 E;  4FW9 A;  4JI5 I;  4MYT A;  4DV0 E;  1FWL A;  1ZXN A;  4LF4 E;  3V2U C;  1EA6 A;  1IBL I;  4WUB A;  3ZZ0 A;  4JI8 I;  1RRE A;  4JI6 E;  5IWA E;  4LF6 E;  4WUD A;  2BV3 A;  4DR2 I; 
#chains in the Genus database with same CATH topology
 1PDA A;  4KZS A;  2OI2 A;  4LF6 I;  4OO1 A;  1FJG I;  2EN2 A;  2EOQ A;  3MHH C;  4MLV A;  1NHI A;  2NN6 B;  4BBY A;  5JEA A;  3AUZ A;  2LUP B;  2V83 A;  2UXB I;  4RHB B;  2GLI A;  3HTX A;  4IFD A;  2LE2 A;  1Y60 A;  4JI1 I;  1HNW I;  5K36 A;  2ZBK B;  4USM A;  3C6K A;  2DEI A;  1YSA C;  2FGG A;  4X64 I;  2IOQ A;  4DMI A;  4Z7Y A;  2RSM A;  1Z5A A;  1PJS A;  3L7Z A;  5F3W A;  2WBU A;  4DUY I;  2ODR D;  2C38 A;  2NN6 F;  2B7T A;  5A6J A;  4LFB I;  4DUY E;  2IES A;  2LCE A;  4P52 A;  1DQ3 A;  2L2M A;  2YZT A;  3DF6 A;  4BA2 B;  4AID A;  2LVH A;  4NHR A;  1HNX E;  2UXD E;  5ELW A;  5JEA B;  2ENC A;  2L6M A;  2NN6 A;  2YRM A;  4WSP A;  1UBD C;  1J5E I;  4JI6 I;  2EM6 A;  2DRP A;  3LTO A;  3HPS A;  5IT9 C;  4Q35 B;  2UU9 E;  2N3G A;  2JVA A;  2WP8 A;  4J8Z A;  2Z5E A;  2EQ1 A;  2ODR C;  5IWA I;  4M9V C;  4FW4 A;  4HTG A;  3WU6 A;  1RHY A;  2CTD A;  2CSH A;  2CGE A;  1EI1 A;  2HFU A;  2X36 A;  2EQ3 A;  1BBO A;  4ZYE A;  3OTO E;  4MU0 A;  4JI4 I;  2MC5 A;  3EPJ A;  2DB2 A;  5A6B D;  2GQ0 A;  5C0X E;  1JK2 A;  1X47 A;  4MQY A;  4OX9 E;  4JI3 I;  3LLH A;  5L3J A;  2VES A;  2NN6 C;  4X64 E;  1A1I A;  2VRD A;  2LTR A;  5DRQ A;  2EMX A;  3ADL A;  2YPN A;  3P76 A;  2LT7 A;  2EPZ A;  2WW4 A;  3CDJ A;  2MC6 A;  1Z0T A;  2EM0 A;  3HKM A;  4B3M I;  1X3C A;  2EMY A;  2C37 A;  2EMG A;  1MU5 A;  2JXP A;  1ZM2 A;  3UK3 C;  2EPR A;  5K36 E;  1JK1 A;  4IFD D;  1USV A;  2PO0 A;  4NXN E;  3J80 C;  1T4N A;  2LJP A;  4X62 E;  1HR0 I;  2EN1 A;  2CPN A;  2EPU A;  1A1K A;  4R1F A;  4JI0 I;  4DPY A;  1IQO A;  1KJK A;  1UDQ A;  2PO1 A;  4O4K A;  4R2A A;  4WYQ B;  4BA1 A;  4M30 A;  2NN6 D;  4WX9 A;  2BM1 A;  5JEA C;  5BR8 E;  1BBG A;  2B7V A;  1H73 A;  1N0V C;  1YYO A;  2V2Q A;  2LO3 A;  2J65 A;  3J7Y p;  4DR3 I;  4URL A;  2R76 A;  1Y5Y A;  1YUJ A;  3IWC A;  3J81 C;  2WBS A;  2O1W A;  2LBS B;  1KYQ A;  1USU A;  1Y4S A;  4K0K E;  2PO1 B;  2EOX A;  3PYF A;  2EOH A;  2UXD I;  2UUA E;  5LMN I;  2UXC I;  2EQ0 A;  1FKA E;  4X65 E;  3ZZU A;  4DR7 I;  2IER A;  3ZZT A;  1MEY C;  2EN3 A;  3QT5 A;  1UHZ A;  3V5R A;  4JI4 E;  4F54 A;  1LLM C;  4LOM A;  3ZKB A;  1YHC A;  5KL7 A;  1N32 E;  4DUZ I;  2LV2 A;  2HK3 A;  5GME A;  4RPF A;  4DR5 I;  3NZK A;  4KHP I;  4JI3 E;  1FJG E;  3B8H A;  3P3C A;  3ZOQ B;  4O24 A;  4O43 A;  3EPK A;  2ENA A;  5LMN E;  4DPW A;  4IFD B;  3TQM A;  4ZYD A;  3ADJ A;  3U1K A;  2Z5C B;  3IWD A;  5JEA F;  1T39 A;  3QT8 A;  4R2C A;  1X48 A;  2UUC E;  4LF8 I;  3OTO I;  4FN5 A;  2AE8 A;  4J3D A;  4B3T E;  2VQE I;  4DV7 I;  4KWY A;  4OO1 C;  2L33 A;  2ENH A;  5C0X B;  1FI4 A;  2VF1 A;  4GKJ I;  3KRN A;  4JI7 E;  1NHJ A;  1UDS A;  3B4T A;  2Z5B A;  4AM3 A;  3M7N D;  1RQ0 A;  4LF7 E;  5LMU E;  2PNL A;  1F2I G;  2EPK X;  2BB8 A;  2O3Z A;  4JI0 E;  4F9A B;  1EH6 A;  3LPS A;  2EPL X;  1IBK E;  5DNX A;  2EM4 A;  2EN8 A;  3BGH A;  2K7I A;  1WHN A;  3H09 A;  1QNT A;  3PYD A;  2LJH A;  4ZYG A;  4IZK A;  4OO1 E;  1H74 A;  1N32 I;  1R6M A;  4IZJ A;  4BA2 A;  3M85 D;  2RS6 A;  3C6M A;  2EN7 A;  2C39 B;  4DV2 I;  2MKN A;  2VQF I;  3PYG A;  4HY1 A;  4OKG A;  2YTI A;  4IJD A;  1S4E A;  2VF3 A;  4DPU A;  3L7Z B;  1X6E A;  4OX9 I;  2PNM A;  1T4L B;  1Z5C A;  2EL4 A;  5EKW A;  1B62 A;  3QT6 A;  5A6A A;  4LCH A;  3ECR A;  1YFH A;  3PRY A;  5K36 C;  1Z0G A;  2RTX A;  1OJ4 A;  4FWD A;  2PNZ A;  2N3H A;  4M2Z A;  3THN A;  1FNM A;  2E1R A;  5EL9 A;  4NBQ A;  3JTZ A;  1KTV A;  1Z59 A;  2HFS A;  2JEA A;  2O1V A;  4TUG A;  4DR2 E;  2DGC A;  3T1Y E;  4JI2 E;  4L8N A;  2IOP A;  4UTG A;  2ELY A;  3EPL A;  4GKJ E;  2V34 A;  2FV4 B;  4OO1 B;  1OYS A;  2NUE A;  2NUF A;  4LFA E;  5AC4 A;  3KZY A;  2EZ6 A;  2JR1 A;  5C0X C;  4NZV A;  1Y6Z A;  2BA1 G;  2EOR A;  4JI8 E;  2VQE E;  4B3T I;  4WUC A;  4DU8 A;  4R03 A;  1OYP A;  4DV1 I;  5ADZ A;  2JP9 A;  3VYY A;  3P1X A;  2EOM A;  4IZJ D;  1J26 A;  4IFD E;  2LRS A;  1G2F C;  1UN6 B;  3MHS C;  1Z5B A;  1UIL A;  3M7N G;  3UHM A;  1O0W A;  2L2K B;  2GHF A;  3HJC A;  2EL5 A;  1D6T A;  4JI7 I;  2I13 A;  1PJQ A;  2JY9 A;  1OYR A;  2HKJ A;  3D4J A;  1NEI A;  4X9J A;  1UEK A;  4N3O A;  1HK7 A;  1VI7 A;  4WSG A;  1Z0C A;  3GME A;  2DEJ A;  1DI2 A;  2R42 A;  4DR6 I;  4JG4 A;  2V8P A;  4LFC I;  4LF8 E;  2UUC I;  2YSO A;  1N33 E;  1I94 E;  2WBT A;  1S16 A;  3Q6N A;  4OO1 F;  4MLQ A;  5FLX C;  3U1Y A;  5K36 F;  3T1H I;  1I94 I;  1NHH A;  2EPA A;  1GTK A;  5JEA E;  3J7A G;  3HPZ A;  3HQ1 A;  2RSI A;  2BV3 A;  4U3B A;  4X66 I;  2K4V A;  3HXL A;  1BKN A;  4PRV A;  3THO B;  2X7I A;  4LF9 E;  2WZO A;  3WU4 A;  5LLQ A;  1ZBQ A;  4X65 I;  2LJU A;  3JU0 A;  2EJ4 A;  4BS9 A;  1XMO I;  1STU A;  2EOI A;  2WCC 3;  2V2Z A;  3BID A;  2CT1 A;  4B3S I;  5A6K A;  5DRR A;  4NXM E;  3M6A A;  2WP8 B;  2D9H A;  3K17 A;  2RPC A;  2BA0 G;  1J5E E;  3B78 A;  2YTD A;  2BM0 A;  5AAS A;  2YRK A;  2EM9 A;  4GEQ B;  1DAR A;  4USK A;  1N0U A;  4DR3 E;  2EPM X;  2PO2 A;  1N3G A;  2YSP A;  4DU7 A;  2EOF A;  1N34 I;  2CG9 A;  4M1K A;  1A6F A;  4OZE A;  4DR4 I;  2KON A;  4LF9 I;  2JEA B;  2JEB B;  1T4O A;  4OOG C;  4DV5 E;  4GKK I;  3C4T A;  2BR2 B;  1E3P A;  4RH8 A;  4JYA E;  4EMD A;  4R2R A;  4BMJ A;  1N36 I;  2EM2 A;  4HYM A;  4NXN I;  4AQY E;  2V2V A;  1TF6 A;  1HNW E;  4FW7 A;  3DJW A;  2V89 A;  1Z1B A;  1ELO A;  2UXB E;  5T6J A;  4GKK E;  3P3E A;  2CZ9 A;  1A1F A;  2EMK A;  4F6M A;  2E1M A;  2EL6 A;  2MDR A;  2HGH A;  3AV0 A;  3ZM7 A;  2YTJ A;  1T38 A;  4ISA A;  5C0X F;  1N33 I;  2LUQ A;  2UXC E;  2YTN A;  4HEI A;  3LNU A;  2L3J A;  1EH8 A;  2CVE A;  2O1U A;  2PO2 B;  4DV6 E;  2HHH I;  4DV3 I;  1IBL E;  2J7J A;  5A69 A;  2F4V I;  4LF4 I;  5FWK A;  3P3G A;  3PS2 A;  4MDT A;  4BC9 A;  1XNQ I;  2MKD A;  1IBM E;  1X6H A;  1XXE A;  2L92 A;  2YU8 A;  2NUG A;  1Z0W A;  1NZ0 A;  1EKZ A;  1XMO E;  1XNQ E;  1IQS A;  5TSE A;  1H72 C;  1WUU A;  2HK2 A;  2R3V A;  3K1J A;  2JE6 A;  4DR1 E;  4JV5 I;  4LFB E;  4R2S A;  4B3S E;  4FK5 C;  5LL6 R;  3Q1Q A;  2UUB I;  5KL5 A;  1H7S A;  2WNR A;  4X66 E;  1SR9 A;  4P78 A;  3PYE A;  4DPX A;  1A1G A;  4IS9 A;  2Z5C A;  4WPY A;  1IMU A;  2EOZ A;  2HKE A;  1WHQ A;  4R2D A;  2EMF A;  2JOX A;  4HAC A;  2EPP A;  4WXC A;  3H4L A;  4Z7C A;  2EOJ A;  4DUZ E;  1YPN A;  2DIX A;  4MU4 A;  2V87 A;  5IXM B;  4WFT A;  1YYK A;  2EOE A;  3VK6 A;  5DNY A;  1E3H A;  4R2P A;  2GS8 A;  2F1D A;  1WJP A;  2EMA A;  4BC7 A;  2M9A A;  1N36 E;  4F9C B;  4YHH E;  1MX0 A;  2M1S A;  1R6L A;  2A2D A;  5AE3 A;  2UUA I;  1WXR A;  5AE1 A;  2VQF E;  1ZM4 A;  2YTP A;  4JI1 E;  1K47 A;  1ZXM A;  4DV5 I;  3BF2 A;  1PJT A;  4DV1 E;  3CDI A;  2RS7 A;  2HHH E;  2EWL A;  2N8X A;  3FIG A;  2Z5B B;  3B82 A;  3QT7 A;  4DV6 I;  2EOY A;  2EE8 A;  5GMD A;  2FTX B;  4BCA A;  4M0V A;  3GLL A;  4LPF A;  2ELZ A;  3WU3 A;  2EPN A;  4YHH I;  4DV0 I;  2YTQ A;  5IV8 B;  5AE2 A;  2UU9 I;  1IBK I;  2EPC A;  2EM3 A;  4FW6 A;  4DV3 E;  2A25 A;  4L5N C;  3RMP A;  4NXM I;  2HJJ A;  1X6F A;  1Z0B A;  3F0N A;  4LF5 I;  5DNL A;  5LMU I;  3LML A;  2EN4 A;  4P7A A;  1TF3 A;  5FLX Q;  4DXL A;  1P47 A;  2NA2 A;  4R8O A;  2PO0 B;  2EPO A;  2JWO A;  4X8W A;  2E72 A;  1UDO A;  3ZKD A;  3F6H A;  3KWR A;  4JI5 E;  3CWV A;  3J81 Q;  2G7H A;  4B3M E;  3JAM C;  1Z0V A;  2NPF A;  4GQU A;  2I9I A;  4DV2 E;  4R2E A;  2EOS A;  1RR9 A;  1MG7 A;  2C39 A;  2XEX A;  4FWG A;  4JV5 E;  2ADR A;  4ZVI A;  3ADI A;  1NCS A;  4WXD A;  2EM8 A;  1ZM3 A;  5A6B A;  4IZK B;  4IFD C;  4JYA I;  4F9B B;  3ADG A;  2BBG A;  3F6G A;  2UUB E;  1SFE A;  1PIE A;  4PRX A;  4B3R E;  1XMQ E;  3EPH A;  4DV4 I;  4DR1 I;  3K6Q A;  2YRH A;  1N34 E;  1A1J A;  2H36 X;  1QZR A;  2DMY A;  3EQ1 A;  3K85 A;  3M99 B;  2YTF A;  4MU3 A;  5JEA D;  5C0X D;  2J7K A;  4BA1 B;  1IBM I;  4FWH A;  1ZBT A;  5AC5 A;  1P42 A;  5BR8 I;  2JPA A;  4O5G A;  4I3H A;  2RQL A;  4B3R I;  4MU1 A;  1X49 A;  1ZM9 A;  2JT2 A;  1A1H A;  4LF7 I;  3GCM A;  2F8B A;  3BBG A;  4ZYH A;  1HR0 E;  4X62 I;  2C37 B;  4I8O A;  2M4I A;  2EMH A;  5KL4 A;  4UT4 A;  3QG5 C;  5KL3 A;  4F6N A;  4LFC E;  4QNK A;  3M85 G;  5KL2 A;  5A2Q Q;  4DR6 E;  1PKP A;  2DLK A;  2DSY A;  2EM7 A;  2EMZ A;  1YH8 A;  2JOB A;  3GON A;  2V8Q B;  3DD6 A;  4R2Q A;  2L8T A;  1AH5 A;  1UDN A;  2C38 B;  4AQY I;  2YU5 A;  1PVG A;  2R1F A;  4IS1 C;  2WNR B;  2Q2E B;  2ZIT A;  1U2R A;  2V85 A;  4LF5 E;  1X5W A;  2B9D A;  1B63 A;  1MGT A;  5A2Q C;  4HXZ A;  2EMC A;  4DKK A;  5KL6 A;  2EN6 A;  2VE7 C;  3VHT B;  4DR4 E;  4BHC A;  1KIJ A;  2BR2 A;  3Q6M A;  3HUL A;  2EPX A;  1A1L A;  4TUI A;  1HNZ I;  2E5L I;  2YT4 A;  2L2N A;  1YYW A;  1QU6 A;  4KQV A;  4OO1 D;  3MSW A;  4LFA I;  2EOO A;  2GO4 A;  4GZN C;  1EH7 A;  4F2J C;  2YTE A;  1ZAA C;  3J7A M;  5DRP A;  3J80 Q;  4LTY A;  4N4R B;  4YY3 E;  1TN9 A;  1YUI A;  2F4V E;  2PRT A;  1Z0E A;  1XMQ I;  4DPT A;  2AJ4 A;  1ZU1 A;  1VIS A;  1GZ6 A;  3JAM Q;  2DMI A;  1KVK A;  1RC7 A;  4XTJ A;  4YY3 I;  1RMD A;  2GO3 A;  4P7D A;  1DGC A;  2M7Q A;  1G2D C;  3C4B A;  3T1Y I;  4JI2 I;  5K36 D;  2PNZ B;  2EMB A;  1B69 A;  4KHP E;  4BHB A;  3VYX A;  3WU5 A;  1H7U A;  2EML A;  4DV7 E;  5IT9 Q;  1HNZ E;  2E5L E;  1FWK A;  4DV4 E;  1XHK A;  2O1T A;  4FW3 A;  2DLQ A;  3KZZ A;  2NAB A;  2YWQ A;  1BB8 A;  3IWB A;  1KKH A;  2IHR 1;  4PU9 A;  2EP3 A;  3PS1 A;  2ZM6 E;  3T1H E;  4ED4 A;  1XNR I;  1HNX I;  2V88 A;  2A2C A;  3OML A;  2Q8U A;  2NN6 E;  4DR5 E;  1GQE A;  2LMZ A;  4HAC B;  4QNJ A;  2YTO A;  3H1C A;  4IZJ B;  2L3C A;  1XNR E;  2JEB A;  2ZM6 I;  2MDG A;  4K0K I;  4MYU A;  1AAY A;  2EFG A;  2V86 A;  2BA1 D;  2LTS A;  2JYA A;  2YTG A;  1YZ9 A;  4DR7 E;  4U3D A;  4LCG A;  4FW9 A;  4JI5 I;  3PS3 A;  4IFD F;  2EMI A;  2GPI A;  4FW5 A;  4MYT A;  4DV0 E;  1L4S A;  1FWL A;  3L00 A;  2JE6 B;  2HC5 A;  1ZR9 A;  1ZXN A;  4LF4 E;  3P06 A;  3V2U C;  4LCF A;  1EA6 A;  1WRJ A;  2B3T B;  4WUB A;  5DRO A;  3ZZ0 A;  1IBL I;  5K36 B;  2BA0 D;  4JI8 I;  2EM5 A;  2EMW A;  1RRE A;  4LU9 A;  4AIM A;  4JI6 E;  5C0X A;  5IWA E;  2KHX A;  4LF6 E;  4WUD A;  1Y4U A;  2KOU A;  5CFF E;  4Q28 A;  4DR2 I; 
#chains in the Genus database with same CATH homology
 4LF6 I;  4KZS A;  2OI2 A;  1FJG I;  1NHI A;  4BBY A;  3AUZ A;  2LUP B;  2V83 A;  2UXB I;  3HTX A;  2LE2 A;  1HNW I;  4JI1 I;  2ZBK B;  4USM A;  2DEI A;  2FGG A;  4X64 I;  2IOQ A;  4DMI A;  4Z7Y A;  2RSM A;  1Z5A A;  4DUY I;  5F3W A;  2ODR D;  2B7T A;  4LFB I;  4DUY E;  4P52 A;  1DQ3 A;  2L2M A;  2YZT A;  3DF6 A;  1HNX E;  2UXD E;  2L6M A;  4WSP A;  1J5E I;  4JI6 I;  3LTO A;  3HPS A;  5IT9 C;  2UU9 E;  2N3G A;  2JVA A;  4J8Z A;  2Z5E A;  2ODR C;  5IWA I;  3WU6 A;  2CGE A;  1EI1 A;  2HFU A;  2X36 A;  3OTO E;  4JI4 I;  2MC5 A;  2DB2 A;  2GQ0 A;  1X47 A;  4OX9 E;  4JI3 I;  3LLH A;  5L3J A;  4X64 E;  2LTR A;  3ADL A;  2WW4 A;  2MC6 A;  1Z0T A;  4B3M I;  1MU5 A;  1ZM2 A;  1USV A;  4NXN E;  3J80 C;  1T4N A;  2LJP A;  4X62 E;  1HR0 I;  2CPN A;  4R1F A;  4JI0 I;  4DPY A;  4WYQ B;  4M30 A;  2BM1 A;  5BR8 E;  1H73 A;  2B7V A;  1N0V C;  1YYO A;  2V2Q A;  3J7Y p;  4DR3 I;  4URL A;  3IWC A;  3J81 C;  2O1W A;  2LBS B;  1USU A;  1Y4S A;  4K0K E;  3PYF A;  2UXD I;  2UUA E;  5LMN I;  2UXC I;  1FKA E;  4X65 E;  3ZZU A;  4DR7 I;  3ZZT A;  3QT5 A;  1UHZ A;  3V5R A;  4JI4 E;  4F54 A;  3ZKB A;  4DUZ I;  1N32 E;  2HK3 A;  5GME A;  4RPF A;  4DR5 I;  4KHP I;  4JI3 E;  1FJG E;  3B8H A;  5LMN E;  3ZOQ B;  4DPW A;  3ADJ A;  2Z5C B;  3IWD A;  3QT8 A;  1X48 A;  2UUC E;  4LF8 I;  3OTO I;  4FN5 A;  4B3T E;  2VQE I;  4DV7 I;  2L33 A;  1FI4 A;  2VF1 A;  4GKJ I;  4JI7 E;  1NHJ A;  2Z5B A;  1RQ0 A;  4LF7 E;  5LMU E;  2PNL A;  4JI0 E;  4F9A B;  3LPS A;  1IBK E;  1WHN A;  3H09 A;  3PYD A;  2LJH A;  4IZK A;  1N32 I;  1H74 A;  4IZJ A;  2RS6 A;  4DV2 I;  2VQF I;  3PYG A;  4HY1 A;  1S4E A;  2VF3 A;  4DPU A;  4OX9 I;  2PNM A;  1T4L B;  1Z5C A;  1B62 A;  3QT6 A;  3PRY A;  1Z0G A;  2RTX A;  1OJ4 A;  4FWD A;  2N3H A;  4M2Z A;  1FNM A;  2E1R A;  3JTZ A;  1KTV A;  1Z59 A;  2HFS A;  2O1V A;  4TUG A;  4DR2 E;  3T1Y E;  4JI2 E;  4L8N A;  2IOP A;  4UTG A;  4GKJ E;  2V34 A;  2FV4 B;  2NUE A;  2NUF A;  4LFA E;  2EZ6 A;  2JR1 A;  1Y6Z A;  4JI8 E;  2VQE E;  4B3T I;  4WUC A;  4DU8 A;  4R03 A;  4DV1 I;  5ADZ A;  3VYY A;  3P1X A;  4IZJ D;  1J26 A;  2LRS A;  1Z5B A;  1UIL A;  1O0W A;  2L2K B;  3HJC A;  1D6T A;  4JI7 I;  2JY9 A;  3D4J A;  2HKJ A;  1UEK A;  4N3O A;  1HK7 A;  1Z0C A;  2DEJ A;  1DI2 A;  2R42 A;  4DR6 I;  4JG4 A;  2V8P A;  4LFC I;  4LF8 E;  2UUC I;  1N33 E;  1I94 E;  1S16 A;  3Q6N A;  5FLX C;  3T1H I;  1I94 I;  1NHH A;  3J7A G;  3HPZ A;  3HQ1 A;  2BV3 A;  4X66 I;  2K4V A;  3HXL A;  1BKN A;  4PRV A;  2X7I A;  4LF9 E;  2WZO A;  3WU4 A;  1ZBQ A;  4X65 I;  3JU0 A;  4BS9 A;  1XMO I;  1STU A;  2V2Z A;  4B3S I;  4NXM E;  3M6A A;  3K17 A;  1J5E E;  3B78 A;  2BM0 A;  5AAS A;  4GEQ B;  1DAR A;  4USK A;  1N0U A;  4DR3 E;  1N34 I;  2CG9 A;  4M1K A;  1A6F A;  4DR4 I;  2KON A;  4LF9 I;  1T4O A;  4OOG C;  4DV5 E;  4GKK I;  3C4T A;  4EMD A;  4JYA E;  4BMJ A;  1N36 I;  4HYM A;  4NXN I;  4AQY E;  2V2V A;  1HNW E;  3DJW A;  2V89 A;  1ELO A;  2UXB E;  5T6J A;  4GKK E;  2CZ9 A;  2E1M A;  2MDR A;  3ZM7 A;  3AV0 A;  1N33 I;  2LUQ A;  2UXC E;  3LNU A;  2L3J A;  2O1U A;  4DV6 E;  2HHH I;  4DV3 I;  1IBL E;  2F4V I;  4LF4 I;  5FWK A;  4BC9 A;  1XNQ I;  1IBM E;  2L92 A;  2NUG A;  1Z0W A;  1NZ0 A;  1EKZ A;  1XMO E;  1XNQ E;  2HK2 A;  1H72 C;  1WUU A;  3K1J A;  2R3V A;  4JV5 I;  4DR1 E;  4LFB E;  4B3S E;  3Q1Q A;  5LL6 R;  2UUB I;  1H7S A;  4X66 E;  1SR9 A;  4P78 A;  3PYE A;  4DPX A;  2Z5C A;  4WPY A;  2HKE A;  1WHQ A;  2JOX A;  4HAC A;  3H4L A;  4Z7C A;  4DUZ E;  2DIX A;  2V87 A;  1YYK A;  4WFT A;  3VK6 A;  5DNY A;  2GS8 A;  4BC7 A;  1N36 E;  4F9C B;  4YHH E;  1MX0 A;  2M1S A;  2A2D A;  5AE3 A;  2UUA I;  1WXR A;  5AE1 A;  2VQF E;  1ZM4 A;  4JI1 E;  1K47 A;  1ZXM A;  4DV5 I;  4DV1 E;  2RS7 A;  2HHH E;  2EWL A;  3FIG A;  3B82 A;  2Z5B B;  3QT7 A;  4DV6 I;  5GMD A;  2FTX B;  4BCA A;  4M0V A;  3WU3 A;  4DV0 I;  4YHH I;  5AE2 A;  2UU9 I;  1IBK I;  4DV3 E;  4L5N C;  3RMP A;  4NXM I;  1Z0B A;  3F0N A;  4LF5 I;  5LMU I;  3LML A;  4P7A A;  5FLX Q;  4DXL A;  2NA2 A;  4R8O A;  2JWO A;  4X8W A;  3ZKD A;  3F6H A;  3KWR A;  4JI5 E;  3CWV A;  3J81 Q;  2G7H A;  4B3M E;  3JAM C;  1Z0V A;  2NPF A;  4DV2 E;  1RR9 A;  1MG7 A;  2XEX A;  4FWG A;  4JV5 E;  4ZVI A;  3ADI A;  1ZM3 A;  4IZK B;  4JYA I;  4F9B B;  3ADG A;  2UUB E;  3F6G A;  1PIE A;  4PRX A;  4B3R E;  1XMQ E;  4DV4 I;  4DR1 I;  3K6Q A;  1N34 E;  2H36 X;  1QZR A;  2DMY A;  3K85 A;  1IBM I;  2J7K A;  4FWH A;  1ZBT A;  5BR8 I;  4I3H A;  4B3R I;  1X49 A;  1ZM9 A;  4LF7 I;  2F8B A;  1HR0 E;  4X62 I;  4I8O A;  2M4I A;  4UT4 A;  4LFC E;  5A2Q Q;  4DR6 E;  1PKP A;  2DSY A;  2JOB A;  3GON A;  2V8Q B;  2L8T A;  4AQY I;  1PVG A;  2Q2E B;  2ZIT A;  1U2R A;  2V85 A;  4LF5 E;  2B9D A;  1B63 A;  5A2Q C;  4HXZ A;  4DKK A;  1KIJ A;  3Q6M A;  2VE7 C;  4DR4 E;  4DU7 A;  3HUL A;  4TUI A;  1HNZ I;  2E5L I;  2YT4 A;  2L2N A;  1YYW A;  1QU6 A;  4KQV A;  3MSW A;  4LFA I;  3J7A M;  3J80 Q;  4LTY A;  4YY3 E;  2F4V E;  1Z0E A;  1XMQ I;  4DPT A;  2AJ4 A;  1VIS A;  1GZ6 A;  3JAM Q;  1KVK A;  4XTJ A;  1RC7 A;  4YY3 I;  4P7D A;  2M7Q A;  3C4B A;  3T1Y I;  4JI2 I;  4KHP E;  3VYX A;  3WU5 A;  1H7U A;  4DV7 E;  5IT9 Q;  1HNZ E;  2E5L E;  1FWK A;  4DV4 E;  1XHK A;  2O1T A;  3IWB A;  1KKH A;  2IHR 1;  4PU9 A;  4ED4 A;  2ZM6 E;  3T1H E;  1XNR I;  1HNX I;  2V88 A;  2A2C A;  3OML A;  4DR5 E;  1GQE A;  2LMZ A;  4HAC B;  4IZJ B;  2L3C A;  1XNR E;  2ZM6 I;  4K0K I;  4MYU A;  2EFG A;  2V86 A;  2LTS A;  1YZ9 A;  4DR7 E;  4FW9 A;  4JI5 I;  4MYT A;  4DV0 E;  1FWL A;  1ZXN A;  4LF4 E;  3P06 A;  3V2U C;  1EA6 A;  1IBL I;  2B3T B;  4WUB A;  3ZZ0 A;  4JI8 I;  1RRE A;  4LU9 A;  4JI6 E;  5IWA E;  2KHX A;  4LF6 E;  4WUD A;  1Y4U A;  2KOU A;  5CFF E;  4Q28 A;  4DR2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...