5LL6R

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
NTEEKGWVPVTKLGRLVKAGKITTIEEIFLHSLPVKEFQIIDTLLPGLQDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTTGKCGSVTVRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFLTPNLWAEQPLPVSPLDIYSDEASAQKKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
R PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5ll6R01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5ll6R02
4DPXA 1XHKA 4B3TE 3B8HA 2BV3A 4PU9A 2GS8A 2ZBKB 4KHPI 2X7IA 2E1RA 4DV6I 3WU6A 1RREA 1XNQI 2UXDI 3ZZTA 1N34I 4LF4I 1KVKA 4LF9E 1KKHA 4Z7CA 5IT9C 2HHHI 4R1FA 4JI2E 2UUBE 2J7KA 3T1HI 4Z7YA 2UXBI 4DR2I 3ZZ0A 5LMUE 5IT9Q 4DV1E 4LFBE 4HXZA 3JAMQ 4WUBA 3H4LA 4X64I 1XMQE 5IWAE 1H7UA 4JI5I 4DU8A 2V2ZA 4DR3E 4LF8I 4JI6I 4JG4A 1XMOI 3T1YI 1IBKI 4ED4A 3D4JA 4M1KA 3ZKBA 3OTOE 5BR8E 4B3TI 2E5LE 2ZM6E 1FWKA 2R42A 1N36E 1NHHA 3V5RA 2XEXA 4OX9E 1Z0EA 1H72C 4LF9I 1Z0VA 1MG7A 4DR5E 4JI2I 2X36A 4FW9A 4DPTA 4XTJA 4DR7E 1NZ0A 1HR0E 4I3HA 2HKEA 4DR4E 4X64E 4LFAE 2V2QA 5LMUI 1K47A 4DV1I 5L3JA 4LFBI 3J81Q 4DPYA 1EA6A 3CWVA 4YY3E 1J5EE 1XMQI 2HFUA 5IWAI 2BM0A 1BKNA 4DUYE 4DR3I 4HYMA 3WU3A 1IBME 4FWHA 1Z0BA 5GMEA 1UEKA 3QT8A 4FN5A 2F4VI 4DR1E 4JI7E 4DPUA 3OTOI 5BR8I 5FLXQ 2E5LI 1N33E 2ZM6I 2HK2A 1QZRA 1N36I 4K0KE 1S4EA 4UTGA 4JV5E 4NXNE 4OX9I 3V2UC 3JAMC 3PYEA 3J7AG 5LMNE 4DR5I 4PRVA 1Z59A 3J80Q 4DR7I 1N32E 1FWLA 1HR0I 4DR4I 4DV3E 4LFAI 1HNXI 4NXME 2A2DA 1B62A 1D6TA 2DEJA 4JI1E 4JI8E 2UXCE 4YY3I 1FNMA 1J5EI 1N0VC 4DV2E 4MYTA 4GKKE 2ZITA 4DUYI 3J7AM 2A2CA 1PIEA 1I94E 1Z5AA 2F4VE 4DUZE 1IBMI 3HULA 2LJPA 1Z5CA 4DR1I 3WU4A 3PYDA 4JI7I 1Z0GA 1IBLE 3Q1QA 1N33I 1KIJA 3LTOA 2UU9E 4FWDA 2WW4A 4DV4E 3QT5A 4K0KI 4JV5I 4B3ME 4WUCA 4NXNI 5A2QQ 1PVGA 2EFGA 3J81C 2VQFE 1VISA 1KTVA 2BM1A 4DV5E 1MX0A 5LMNI 1NHIA 4AQYE 1ZM9A 4HACA 4LF7E 1ZM4A 4MYUA 4JYAE 1N32I 1FKAE 2HFSA 1HNXE 4DU7A 3K1JA 4UT4A 4DV3I 4NXMI 4DV7E 4HY1A 4JI1I 4JI8I 1ZM3A 4HACB 2UXCI 5FLXC 2V2VA 4DV2I 2UUAE 4LF5E 1FI4A 1N0UA 1NHJA 1MU5A 4GKKI 3ZM7A 4DR6E 1Z5BA 4B3SE 1Z0TA 1I94I 4X65E 4DUZI 4PRXA 5LL6R 2VF3A 1HNWE 4JI4E 1IBLI 4FWGA 3J80C 2AJ4A 4DXLA 4GKJE 1Z0CA 2UU9I 3LPSA 1H74A 4DV4I 1WUUA 3ZKDA 4LFCE 4JI3E 4B3MI 2UUCE 4DV0E 3M6AA 4USMA 2VQFI 2CZ9A 4DV5I 1OJ4A 2VQEE 2OI2A 4AQYI 4B3RE 1HNZE 4ZVIA 1S16A 3PYFA 3B78A 4LF7I 1FJGE 4JYAI 1EI1A 4X62E 1XNRI 2DEIA 4P52A 4RPFA 1A6FA 4DV7I 4YHHE 3QT7A 3LNUA 2UUAI 3QT6A 2V8PA 4LF5I 1U2RA 4DR6I 3ZZUA 4WUDA 4EMDA 4B3SI 4X66E 4X65I 2HKJA 3PYGA 4JI0E 5A2QC 4LF6E 1H73A 1RR9A 1HNWI 4JI4I 2NPFA 4KQVA 3B82A 4GKJI 2Q2EB 4KHPE 4DV6E 1PKPA 4LFCI 1ZM2A 4JI3I 1XNQE 2UXDE 2UUCI 4DV0I 5GMDA 1N34E 4LF4E 2V34A 2VQEI 3F0NA 4B3RI 1HNZI 1XNRE 2HHHE 3T1HE 1FJGI 4P7AA 4X62I 2UXBE 2UUBI 1Z0WA 4URLA 2HK3A 4DR2E 1DARA 4YHHI 3WU5A 2R3VA 4DPWA 3GONA 1H7SA 3K17A 1ELOA 1ZXMA 4JI5E 4USKA 4X66I 1ZXNA 4LF8E 4JI0I 4JI6E 4LF6I 1XMOE 3T1YE 1IBKE 1B63A
chains in the Genus database with same CATH superfamily
4FW4A 2FV4B 4DPXA 2EM3A 2EN6A 4B3TE 1XHKA 3L7ZA 3B8HA 2Z5EA 2CT1A 1T39A 2BV3A 3CDIA 1Y4UA 2BA0G 2GS8A 2ZBKB 3HJCA 4PU9A 2X7IA 2PO1A 4IFDC 4KHPI 4L8NA 2E1RA 1F2IG 4DV6I 2PO0A 3WU6A 4QNKA 2EMIA 3EPJA 2EE8A 2LMZA 3B4TA 1RREA 1XNQI 2RS6A 2UXDI 3ZZTA 2C38A 1N34I 4LF4I 5C0XA 1KVKA 1OYSA 2NUEA 2YT4A 2EOFA 3L7ZB 1WXRA 4LF9E 1KKHA 4MQYA 2EOEA 2C39B 1X5WA 2PO1B 4F54A 2GQ0A 4Z7CA 5IT9C 2PO0B 2ENAA 5TSEA 2LBSB 4FK5C 2HHHI 4R1FA 4JI2E 2YSOA 2UUBE 5JEAF 3BF2A 4BHCA 4BC9A 4X9JA 2J7KA 1IMUA 4FW5A 4O4KA 4WSGA 4Z7YA 3T1HI 2MDGA 5JEAD 2YTEA 2C38B 2M7QA 4R2QA 5C0XB 2UXBI 1TF3A 2BR2A 1RHYA 4NZVA 2EPRA 2LO3A 2YWQA 4BCAA 4DR2I 3ZZ0A 5LMUE 1NEIA 4DV1E 3KZZA 5IT9Q 4LFBE 2YRMA 4HTGA 4HXZA 3FIGA 2LE2A 3H4LA 4WUBA 2YTGA 3IWCA 3JAMQ 4X64I 2DRPA 1XMQE 4IZJD 5IWAE 2BR2B 2DGCA 1H7UA 4JI5I 4DU8A 2WBTA 3JTZA 2V2ZA 4DR3E 2D9HA 4LF8I 2PNLA 1R6LA 4JI6I 4JG4A 2NN6C 1XMOI 2M1SA 3T1YI 1IBKI 1YZ9A 2EQ1A 5A69A 4ED4A 2EMCA 2EPZA 3K85A 3D4JA 2EN2A 3MSWA 1A1KA 4M1KA 3HPSA 1UDOA 2B9DA 2PNZA 1RQ0A 3ZKBA 3OTOE 4I8OA 5BR8E 4B3TI 2E5LE 3C4TA 2ZM6E 2BA1G 2M4IA 5JEAE 4M0VA 4F9BB 1UDSA 3Q6NA 4U3BA 1FWKA 1IQOA 4KWYA 1L4SA 4ZYHA 1N36E 2R42A 1BBGA 2EOJA 2YZTA 1NHHA 3V5RA 2EQ3A 2XEXA 4HEIA 4LU9A 4BA2A 4BBYA 3OMLA 4OX9E 1Y4SA 1Z0EA 2GO3A 3THNA 4OO1F 1O0WA 4KZSA 1H72C 4LF9I 2WP8A 4X8WA 1Z0VA 4P78A 2DSYA 5KL7A 2EN3A 1EH8A 2G7HA 4OO1D 3F6HA 3LLHA 4O5GA 2YSPA 2EL6A 2EPOA 4DR5E 1MG7A 1P42A 2YTFA 1VI7A 2X36A 3P3GA 3H09A 4FW9A 4XTJA 4DPTA 1WHNA 2DB2A 2EP3A 2IOQA 4IZKA 2GHFA 3VHTB 4DR7E 1NZ0A 1YHCA 1T4OA 4BA1B 1HR0E 4BA2B 2EM9A 2J65A 1KYQA 2ODRD 4GEQB 2O1VA 3M85G 4F6MA 2WP8B 1E3PA 1Y60A 1ZR9A 4DR4E 2HKEA 2WCC3 4I3HA 5K36C 3K6QA 4X64E 1T38A 4LFAE 4NHRA 2GPIA 1JK1A 2LJHA 4FW7A 2V2QA 5LMUI 1R6MA 2E1MA 1K47A 2EM5A 4DV1I 1IQSA 4QNJA 4WX9A 5L3JA 3J81Q 4AQYI 4LFBI 4DPYA 3ADLA 1RC7A 1EA6A 4IZKB 3CWVA 4YY3E 2O3ZA 1J5EE 4WYQB 1XMQI 2VE7C 2EOZA 2L33A 2HFUA 5IWAI 2YTNA 2BM0A 3MHSC 4MU3A 1BKNA 2EM4A 2EN4A 2EPNA 4DUYE 2LT7A 4DR3I 4IFDF 2M9AA 4ZYDA 5LLQA 3GMEA 4HYMA 3ADGA 4IFDD 5JEAA 2F8BA 3BBGA 3J7Yp 3EPLA 1YSAC 4O24A 1A1LA 3WU3A 1IBME 1SFEA 2YU5A 4FWHA 2LCEA 2EQ0A 1Z0BA 5GMEA 2EM6A 1UEKA 3QT8A 1T4NA 4FN5A 4OO1E 2F4VI 4DR1E 2HGHA 4JI7E 4LOMA 2MC5A 2DLQA 4DPUA 3OTOI 5BR8I 5FLXQ 2EN7A 2CSHA 2E5LI 4M30A 2LV2A 1N33E 4MLQA 5JEAB 2ZM6I 1HK7A 2HK2A 1AH5A 1QZRA 4IZJA 1X47A 4R2RA 4WXCA 3TQMA 1UILA 2N8XA 2YRKA 4R2PA 2LRSA 1X48A 2GO4A 2EORA 3U1KA 5DROA 3HTXA 4K0KE 1S4EA 4UTGA 2EM0A 4JV5E 3GCMA 4MU0A 3M85D 2B7VA 2EMZA 4NXNE 2EMFA 4OX9I 2Z5BA 3M99B 2EM7A 3V2UC 3JAMC 2RQLA 1MEYC 3PYEA 2MDRA 2BBGA 1X49A 2PNMA 4R03A 3J7AG 2KHXA 3JU0A 2YTOA 3PS1A 4O43A 5LMNE 2V85A 2L2KB 2JWOA 4DR5I 4PRVA 1STUA 2WBSA 1Z59A 2EMHA 3J80Q 4DR7I 1N32E 2B3TB 1FWLA 1HR0I 1GTKA 4IFDE 1A1FA 5KL5A 2EMYA 4DR4I 3IWBA 4DV3E 4LFAI 2ELZA 4M9VC 2NN6F 1HNXI 4NXME 2A2DA 4TUIA 3AV0A 4LTYA 2N3HA 1J26A 1B62A 4OOGC 3ZOQB 4F2JC 4JI1E 1YYOA 4JI8E 2DEJA 5KL6A 2NN6D 2UXCE 3PRYA 1B69A 4MU4A 4Q35B 1BBOA 1MGTA 1FNMA 4YY3I 1J5EI 1N0VC 4DV2E 2L2NA 3NZKA 5DRPA 2VRDA 4MYTA 4OO1A 5CFFE 4GKKE 2NABA 4J8ZA 2L3JA 5AE2A 2ZITA 4WXDA 4DUYI 2CGEA 2ENCA 5A6BD 2EOIA 2YTJA 4L5NC 3J7AM 1P47A 2EOSA 2A2CA 1PIEA 1I94E 1GZ6A 1YUJA 2F4VE 1A1IA 2JXPA 4R2CA 3VYYA 4DUZE 1Z5AA 4GQUA 3U1YA 1IBMI 2EMGA 4NBQA 4GZNC 2WNRA 3HXLA 2EPUA 3C4BA 3HULA 2EMAA 2LJPA 1Z5CA 4DR1I 3WU4A 2JP9A 2MC6A 3PYDA 1OYPA 4JI7I 3VK6A 1Z0GA 2FGGA 4IS1C 2IOPA 1IBLE 5IV8B 1LLMC 1USUA 3Q1QA 4LCGA 1N33I 1KIJA 3LTOA 2UU9E 2EOXA 2WW4A 4FWDA 5C0XC 2PNZB 2WNRB 2L3CA 4DMIA 4DV4E 3QT5A 4OZEA 2L6MA 4FW6A 1A1HA 3VYXA 4K0KI 5DRQA 5K36F 2LJUA 4RH8A 4JV5I 1N3GA 4B3ME 1UDNA 4WUCA 4NXNI 1RMDA 1PVGA 2EFGA 3J81C 3ADIA 3EPHA 5A2QQ 2NN6E 1DQ3A 4IFDA 5K36D 2VQFE 2J7JA 4DKKA 1VISA 1KTVA 1Z1BA 4DV5E 2BM1A 2JPAA 1MX0A 4J3DA 1EH6A 2V87A 2Q8UA 1YUIA 2ENHA 3F6GA 2JR1A 5LMNI 4AQYE 1NHIA 3PS3A 1ZM9A 2JOBA 4HACA 1PJQA 2HC5A 2K4VA 5ADZA 4LF7E 4JYAE 1ZM4A 4MYUA 1N32I 3H1CA 1TF6A 1FKAE 2RSMA 1G2FC 3AUZA 1HNXE 2HFSA 4DU7A 3EPKA 2CTDA 3KZYA 3K1JA 4UT4A 4DV3I 1Y6ZA 2NA2A 4NXMI 1YFHA 5KL4A 4DV7E 5C0XE 1X3CA 2WBUA 4HY1A 4WSPA 2MKNA 4ISAA 4JI1I 4JI8I 2RTXA 1DGCA 1ZM3A 4HACB 2UXCI 1TN9A 2IHR1 2EZ6A 1WHQA 5FLXC 2V2VA 4BMJA 2IESA 4F6NA 2UUAE 5F3WA 2F1DA 1PJTA 2EM8A 4LF5E 2MKDA 1FI4A 4DV2I 2EPCA 1N0UA 2V83A 1NHJA 1MU5A 4GKKI 1YH8A 2RS7A 2O1TA 2V8QB 5KL2A 3ZM7A 4DR6E 1Z5BA 1YYWA 4B3SE 4B3SI 1Z0TA 1I94I 4LPFA 4X65E 2R1FA 2CPNA 1QNTA 4DUZI 5FWKA 2EM2A 4PRXA 5K36E 2ELYA 2VF1A 5LL6R 3P1XA 1UHZA 4M2ZA 3C6MA 4JI4E 1HNWE 2VF3A 4N3OA 3PS2A 5AE1A 1Y5YA 2NN6A 2VESA 1IBLI 4FWGA 3HQ1A 3J80C 2AJ4A 4DXLA 4GKJE 1Z0CA 2UU9I 2EOYA 2EOHA 3LPSA 2V88A 1H74A 2IERA 5AC5A 4DV4I 2JE6A 3HKMA 1WUUA 3ZKDA 4LFCE 2EMKA 2V86A 2C39A 5A6BA 4WPYA 2Z5CA 4JI3E 2HJJA 4IZJB 1T4LB 1X6EA 4B3MI 2UUCE 4DV0E 2NN6B 3M6AA 2YTDA 5EKWA 2CVEA 1EKZA 4USMA 2VQFI 2LUPB 2JYAA 2CZ9A 4DV5I 2EN1A 3MHHC 1OJ4A 4R8OA 2VQEE 2O1UA 5DNXA 2JE6B 2OI2A 2EL5A 2EMBA 2EWLA 2I9IA 2KONA 1HNZE 4B3RE 1S16A 1WRJA 2Z5BB 4ZVIA 2DMYA 4R2SA 2NUGA 2LTSA 2EPMX 3PYFA 2EOQA 3THOB 2JEBA 3GLLA 3L00A 5AE3A 2AE8A 2Z5CB 3B78A 4LF7I 1WJPA 1FJGE 1ZBTA 4LCHA 3ADJA 3IWDA 1EH7A 1EI1A 4JYAI 5KL3A 5IXMB 4X62E 5T6JA 4FW3A 5EL9A 1XNRI 3DJWA 4ZYGA 4ZYEA 2DEIA 2DMIA 4Q28A 3UK3C 4P52A 4RPFA 1A6FA 2JEAA 1DI2A 1ZBQA 3DD6A 4IS9A 4DV7I 1E3HA 1BB8A 4JI2I 1D6TA 4YHHE 2JEBB 1UDQA 3M7ND 3C6KA 1GQEA 1OYRA 3QT7A 3LNUA 1ZAAC 5K36A 2FTXB 1YYKA 2O1WA 2UUAI 2E72A 3QT6A 2JOXA 2JVAA 2V8PA 1U2RA 4LF5I 5JEAC 1UBDC 2YU8A 4DR6I 3ZZUA 2JEAB 2DIXA 4WUDA 1ZU1A 1YPNA 4X66E 1UN6B 4EMDA 5C0XF 2L92A 5DNYA 1PDAA 2RPCA 4X65I 4OO1B 2HKJA 4R2EA 3PYGA 4JI0E 5C0XD 5A2QC 4WFTA 2A25A 5K36B 4LF6E 1KJKA 1X6HA 1H73A 2EPLX 1RR9A 4OKGA 1XXEA 1PJSA 5A6JA 2BA0D 2EL4A 4N4RB 1HNWI 4JI4I 3P3EA 2NPFA 4KQVA 2EJ4A 4F9CB 1AAYA 3B82A 3P3CA 4GKJI 2YTIA 3P06A 5DNLA 2Q2EB 4KHPE 3BIDA 4DV6E 2DLKA 1PKPA 3KWRA 3Q6MA 2EMXA 2LVHA 5A6AA 2L8TA 4LFCI 2L2MA 4AIMA 1ZM2A 3KRNA 2EPPA 2YTQA 2H36X 2I13A 1XNQE 2B7TA 4JI3I 2UXDE 2UUCI 2LUQA 4DV0I 3DF6A 1N34E 5GMDA 4LF4E 2CG9A 2EMWA 2YPNA 2V34A 2EPXA 3EQ1A 2PO2A 3QG5C 2WZOA 3UHMA 2VQEI 3F0NA 4MLVA 5ELWA 4BA1A 4MU1A 4R2DA 4IFDB 4B3RI 1HNZI 1XNRE 2HHHE 4U3DA 2BB8A 2JT2A 3HPZA 4RHBB 3T1HE 1FJGI 4P7AA 2UXBE 4AIDA 4X62I 1A1GA 2UUBI 1SR9A 2PRTA 3CDJA 1A1JA 2PO2B 2EMLA 1Z0WA 4URLA 2N3GA 4BHBA 2HK3A 2KOUA 1QU6A 4DR2E 3P76A 1N36I 4OO1C 1G2DC 5A6KA 1DARA 2C37A 1NCSA 4YHHI 2R76A 2EOMA 4BC7A 2V89A 4AM3A 4P7DA 2R3VA 3WU5A 5AC4A 4DPWA 2JY9A 2YTPA 3GONA 4F9AB 2EPKX 2ADRA 1H7SA 4LCFA 2ODRC 4R2AA 2EOOA 1ELOA 4JI5E 2NUFA 1ZXMA 3K17A 3M7NG 4USKA 4X66I 2YRHA 2GLIA 1ZXNA 4LF8E 4IJDA 4TUGA 1USVA 2C37B 4JI6E 1X6FA 2EN8A 5AASA 4JI0I 4MDTA 3ECRA 4LF6I 1XMOE 5DRRA 3T1YE 1IBKE 2RSIA 2K7IA 2LTRA 3BGHA 2EPAA 4BS9A 2BA1D 1JK2A 3LMLA 3RMPA 1B63A
chains in the Genus database with same CATH topology
2FV4B 4DPXA 4B3TE 1XHKA 3B8HA 2Z5EA 2BV3A 1Y4UA 4PU9A 2GS8A 2ZBKB 3HJCA 4KHPI 2X7IA 4L8NA 2E1RA 4DV6I 3WU6A 2LMZA 1RREA 1XNQI 2RS6A 2UXDI 3ZZTA 1N34I 4LF4I 1KVKA 2NUEA 2YT4A 1WXRA 4LF9E 1KKHA 4F54A 2GQ0A 4Z7CA 5IT9C 2LBSB 2HHHI 4R1FA 4JI2E 2UUBE 4BC9A 2J7KA 3T1HI 4Z7YA 2M7QA 2UXBI 4BCAA 4DR2I 3ZZ0A 5LMUE 5IT9Q 4DV1E 4LFBE 4HXZA 3FIGA 2LE2A 3H4LA 4WUBA 3JAMQ 3IWCA 4X64I 1XMQE 4IZJD 5IWAE 1H7UA 4JI5I 4DU8A 3JTZA 2V2ZA 4DR3E 4LF8I 2PNLA 4JI6I 4JG4A 1XMOI 2M1SA 3T1YI 1IBKI 1YZ9A 4ED4A 3K85A 3D4JA 3MSWA 4M1KA 3HPSA 2B9DA 1RQ0A 3ZKBA 3OTOE 4I8OA 5BR8E 4B3TI 2E5LE 3C4TA 2ZM6E 2M4IA 4M0VA 4F9BB 3Q6NA 1FWKA 2R42A 1N36E 2YZTA 1NHHA 3V5RA 2XEXA 4LU9A 4BBYA 3OMLA 4OX9E 1Y4SA 1Z0EA 1O0WA 4KZSA 1H72C 4LF9I 4X8WA 1Z0VA 4P78A 2DSYA 2G7HA 3F6HA 3LLHA 1MG7A 4DR5E 4JI2I 2X36A 4FW9A 4DPTA 3H09A 4XTJA 1WHNA 2DB2A 2IOQA 4IZKA 4DR7E 1NZ0A 1T4OA 1HR0E 2ODRD 4GEQB 2O1VA 4I3HA 4DR4E 2HKEA 3K6QA 4X64E 4LFAE 2LJHA 2V2QA 5LMUI 2E1MA 1K47A 4DV1I 5L3JA 4LFBI 3J81Q 4DPYA 3ADLA 1RC7A 1EA6A 4IZKB 3CWVA 4YY3E 1J5EE 4WYQB 1XMQI 2VE7C 2HFUA 2L33A 5IWAI 2BM0A 1BKNA 4DUYE 4DR3I 4HYMA 3ADGA 2F8BA 3J7Yp 3WU3A 1IBME 4FWHA 1Z0BA 5GMEA 1UEKA 3QT8A 1T4NA 4FN5A 2F4VI 4DR1E 4JI7E 2MC5A 4DPUA 3OTOI 5BR8I 5FLXQ 2E5LI 4M30A 1N33E 2ZM6I 1HK7A 2HK2A 1QZRA 4IZJA 1X47A 1UILA 1N36I 2LRSA 1X48A 3HTXA 4K0KE 1S4EA 4UTGA 4JV5E 2B7VA 4NXNE 4OX9I 2Z5BA 3V2UC 3JAMC 3PYEA 2MDRA 2PNMA 1X49A 4R03A 3J7AG 2KHXA 3JU0A 5LMNE 2V85A 2L2KB 2JWOA 4DR5I 4PRVA 1STUA 1Z59A 3J80Q 4DR7I 1N32E 2B3TB 1FWLA 1HR0I 4DR4I 3IWBA 4DV3E 4LFAI 1HNXI 4NXME 2A2DA 4TUIA 3AV0A 1J26A 4LTYA 2N3HA 1B62A 4OOGC 3ZOQB 4JI1E 2DEJA 1YYOA 4JI8E 1D6TA 2UXCE 3PRYA 4YY3I 1FNMA 1J5EI 1N0VC 4DV2E 2L2NA 4MYTA 5CFFE 4GKKE 4J8ZA 2L3JA 5AE2A 2ZITA 4DUYI 2CGEA 4L5NC 3J7AM 2A2CA 1PIEA 1I94E 1GZ6A 2F4VE 1Z5AA 3VYYA 4DUZE 1IBMI 3HXLA 3HULA 3C4BA 2LJPA 1Z5CA 4DR1I 3WU4A 3PYDA 2MC6A 4JI7I 3VK6A 1Z0GA 2FGGA 2IOPA 1IBLE 1USUA 3Q1QA 1N33I 1KIJA 3LTOA 2UU9E 4FWDA 2WW4A 2L3CA 4DMIA 4DV4E 3QT5A 2L6MA 3VYXA 4K0KI 4JV5I 4B3ME 4WUCA 4NXNI 5A2QQ 1PVGA 2EFGA 3J81C 3ADIA 1DQ3A 2VQFE 4DKKA 1VISA 1KTVA 4DV5E 2BM1A 1MX0A 2V87A 3F6GA 2JR1A 5LMNI 4AQYE 1NHIA 1ZM9A 2JOBA 4HACA 5ADZA 4LF7E 2K4VA 1ZM4A 4JYAE 4MYUA 1N32I 1FKAE 2RSMA 3AUZA 1HNXE 2HFSA 4DU7A 3K1JA 4UT4A 4DV3I 1Y6ZA 2NA2A 4NXMI 4DV7E 4HY1A 4WSPA 4JI1I 4JI8I 2RTXA 1ZM3A 4HACB 2UXCI 2IHR1 2EZ6A 1WHQA 5FLXC 2V2VA 4BMJA 2UUAE 4DV2I 5F3WA 4LF5E 1FI4A 1N0UA 2V83A 1NHJA 1MU5A 4GKKI 2RS7A 2O1TA 2V8QB 3ZM7A 4DR6E 1Z5BA 1YYWA 4B3SE 1Z0TA 1I94I 4X65E 2CPNA 4DUZI 5FWKA 4PRXA 2VF1A 5LL6R 3P1XA 1UHZA 4M2ZA 4JI4E 1HNWE 2VF3A 4N3OA 5AE1A 1IBLI 4FWGA 3HQ1A 3J80C 2AJ4A 4DXLA 4GKJE 1Z0CA 2UU9I 3LPSA 2V88A 1H74A 4DV4I 1WUUA 3ZKDA 4LFCE 2V86A 4WPYA 2Z5CA 4JI3E 4IZJB 1T4LB 4B3MI 2UUCE 4DV0E 3M6AA 4USMA 1EKZA 2VQFI 2LUPB 2CZ9A 4DV5I 1OJ4A 4R8OA 2VQEE 2O1UA 2OI2A 2EWLA 2KONA 4B3RE 1HNZE 2Z5BB 1S16A 4ZVIA 4AQYI 2DMYA 2NUGA 2LTSA 3PYFA 2Z5CB 5AE3A 3B78A 4LF7I 1FJGE 4JYAI 1ZBTA 3IWDA 3ADJA 1EI1A 4X62E 5T6JA 1XNRI 3DJWA 2DEIA 4Q28A 4P52A 4RPFA 1A6FA 1DI2A 1ZBQA 4DV7I 4YHHE 1GQEA 3QT7A 3LNUA 2FTXB 1YYKA 2O1WA 2UUAI 3QT6A 2JOXA 2JVAA 2V8PA 1U2RA 4LF5I 4DR6I 3ZZUA 2DIXA 4WUDA 4EMDA 4B3SI 4X66E 2L92A 5DNYA 4X65I 2HKJA 3PYGA 4JI0E 5A2QC 4WFTA 4LF6E 1H73A 1RR9A 1HNWI 4JI4I 2NPFA 4KQVA 4F9CB 3B82A 4GKJI 3P06A 2Q2EB 4KHPE 4DV6E 1PKPA 3KWRA 3Q6MA 4LFCI 2L8TA 2L2MA 1ZM2A 2H36X 1XNQE 4JI3I 2B7TA 2UXDE 2UUCI 2LUQA 4DV0I 3DF6A 1N34E 5GMDA 4LF4E 2CG9A 2V34A 2WZOA 2VQEI 3F0NA 4B3RI 1HNZI 1XNRE 2HHHE 3HPZA 3T1HE 1FJGI 4P7AA 2UXBE 4X62I 2UUBI 1SR9A 1Z0WA 4URLA 2N3GA 2HK3A 2KOUA 1QU6A 4DR2E 1DARA 4YHHI 4BC7A 2V89A 4P7DA 2R3VA 3WU5A 4DPWA 2JY9A 3GONA 4F9AB 1H7SA 2ODRC 3K17A 1ELOA 4JI5E 2NUFA 1ZXMA 4USKA 4X66I 1ZXNA 4LF8E 4TUGA 1USVA 4JI6E 5AASA 4JI0I 4LF6I 1XMOE 3T1YE 1IBKE 2LTRA 4BS9A 3LMLA 3RMPA 1B63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPX A;  1XHK A;  4B3T E;  3B8H A;  2BV3 A;  4PU9 A;  2GS8 A;  2ZBK B;  4KHP I;  2X7I A;  2E1R A;  4DV6 I;  3WU6 A;  1RRE A;  1XNQ I;  2UXD I;  3ZZT A;  1N34 I;  4LF4 I;  1KVK A;  4LF9 E;  1KKH A;  4Z7C A;  5IT9 C;  2HHH I;  4R1F A;  4JI2 E;  2UUB E;  2J7K A;  3T1H I;  4Z7Y A;  2UXB I;  4DR2 I;  3ZZ0 A;  5LMU E;  5IT9 Q;  4DV1 E;  4LFB E;  4HXZ A;  3JAM Q;  4WUB A;  3H4L A;  4X64 I;  1XMQ E;  5IWA E;  1H7U A;  4JI5 I;  4DU8 A;  2V2Z A;  4DR3 E;  4LF8 I;  4JI6 I;  4JG4 A;  1XMO I;  3T1Y I;  1IBK I;  4ED4 A;  3D4J A;  4M1K A;  3ZKB A;  3OTO E;  5BR8 E;  4B3T I;  2E5L E;  2ZM6 E;  1FWK A;  2R42 A;  1N36 E;  1NHH A;  3V5R A;  2XEX A;  4OX9 E;  1Z0E A;  1H72 C;  4LF9 I;  1Z0V A;  1MG7 A;  4DR5 E;  4JI2 I;  2X36 A;  4FW9 A;  4DPT A;  4XTJ A;  4DR7 E;  1NZ0 A;  1HR0 E;  4I3H A;  2HKE A;  4DR4 E;  4X64 E;  4LFA E;  2V2Q A;  5LMU I;  1K47 A;  4DV1 I;  5L3J A;  4LFB I;  3J81 Q;  4DPY A;  1EA6 A;  3CWV A;  4YY3 E;  1J5E E;  1XMQ I;  2HFU A;  5IWA I;  2BM0 A;  1BKN A;  4DUY E;  4DR3 I;  4HYM A;  3WU3 A;  1IBM E;  4FWH A;  1Z0B A;  5GME A;  1UEK A;  3QT8 A;  4FN5 A;  2F4V I;  4DR1 E;  4JI7 E;  4DPU A;  3OTO I;  5BR8 I;  5FLX Q;  2E5L I;  1N33 E;  2ZM6 I;  2HK2 A;  1QZR A;  1N36 I;  4K0K E;  1S4E A;  4UTG A;  4JV5 E;  4NXN E;  4OX9 I;  3V2U C;  3JAM C;  3PYE A;  3J7A G;  5LMN E;  4DR5 I;  4PRV A;  1Z59 A;  3J80 Q;  4DR7 I;  1N32 E;  1FWL A;  1HR0 I;  4DR4 I;  4DV3 E;  4LFA I;  1HNX I;  4NXM E;  2A2D A;  1B62 A;  1D6T A;  2DEJ A;  4JI1 E;  4JI8 E;  2UXC E;  4YY3 I;  1FNM A;  1J5E I;  1N0V C;  4DV2 E;  4MYT A;  4GKK E;  2ZIT A;  4DUY I;  3J7A M;  2A2C A;  1PIE A;  1I94 E;  1Z5A A;  2F4V E;  4DUZ E;  1IBM I;  3HUL A;  2LJP A;  1Z5C A;  4DR1 I;  3WU4 A;  3PYD A;  4JI7 I;  1Z0G A;  1IBL E;  3Q1Q A;  1N33 I;  1KIJ A;  3LTO A;  2UU9 E;  4FWD A;  2WW4 A;  4DV4 E;  3QT5 A;  4K0K I;  4JV5 I;  4B3M E;  4WUC A;  4NXN I;  5A2Q Q;  1PVG A;  2EFG A;  3J81 C;  2VQF E;  1VIS A;  1KTV A;  2BM1 A;  4DV5 E;  1MX0 A;  5LMN I;  1NHI A;  4AQY E;  1ZM9 A;  4HAC A;  4LF7 E;  1ZM4 A;  4MYU A;  4JYA E;  1N32 I;  1FKA E;  2HFS A;  1HNX E;  4DU7 A;  3K1J A;  4UT4 A;  4DV3 I;  4NXM I;  4DV7 E;  4HY1 A;  4JI1 I;  4JI8 I;  1ZM3 A;  4HAC B;  2UXC I;  5FLX C;  2V2V A;  4DV2 I;  2UUA E;  4LF5 E;  1FI4 A;  1N0U A;  1NHJ A;  1MU5 A;  4GKK I;  3ZM7 A;  4DR6 E;  1Z5B A;  4B3S E;  1Z0T A;  1I94 I;  4X65 E;  4DUZ I;  4PRX A;  5LL6 R;  2VF3 A;  1HNW E;  4JI4 E;  1IBL I;  4FWG A;  3J80 C;  2AJ4 A;  4DXL A;  4GKJ E;  1Z0C A;  2UU9 I;  3LPS A;  1H74 A;  4DV4 I;  1WUU A;  3ZKD A;  4LFC E;  4JI3 E;  4B3M I;  2UUC E;  4DV0 E;  3M6A A;  4USM A;  2VQF I;  2CZ9 A;  4DV5 I;  1OJ4 A;  2VQE E;  2OI2 A;  4AQY I;  4B3R E;  1HNZ E;  4ZVI A;  1S16 A;  3PYF A;  3B78 A;  4LF7 I;  1FJG E;  4JYA I;  1EI1 A;  4X62 E;  1XNR I;  2DEI A;  4P52 A;  4RPF A;  1A6F A;  4DV7 I;  4YHH E;  3QT7 A;  3LNU A;  2UUA I;  3QT6 A;  2V8P A;  4LF5 I;  1U2R A;  4DR6 I;  3ZZU A;  4WUD A;  4EMD A;  4B3S I;  4X66 E;  4X65 I;  2HKJ A;  3PYG A;  4JI0 E;  5A2Q C;  4LF6 E;  1H73 A;  1RR9 A;  1HNW I;  4JI4 I;  2NPF A;  4KQV A;  3B82 A;  4GKJ I;  2Q2E B;  4KHP E;  4DV6 E;  1PKP A;  4LFC I;  1ZM2 A;  4JI3 I;  1XNQ E;  2UXD E;  2UUC I;  4DV0 I;  5GMD A;  1N34 E;  4LF4 E;  2V34 A;  2VQE I;  3F0N A;  4B3R I;  1HNZ I;  1XNR E;  2HHH E;  3T1H E;  1FJG I;  4P7A A;  4X62 I;  2UXB E;  2UUB I;  1Z0W A;  4URL A;  2HK3 A;  4DR2 E;  1DAR A;  4YHH I;  3WU5 A;  2R3V A;  4DPW A;  3GON A;  1H7S A;  3K17 A;  1ELO A;  1ZXM A;  4JI5 E;  4USK A;  4X66 I;  1ZXN A;  4LF8 E;  4JI0 I;  4JI6 E;  4LF6 I;  1XMO E;  3T1Y E;  1IBK E;  1B63 A; 
#chains in the Genus database with same CATH topology
 4FW4 A;  2FV4 B;  4DPX A;  2EM3 A;  2EN6 A;  4B3T E;  1XHK A;  3L7Z A;  3B8H A;  2Z5E A;  2CT1 A;  1T39 A;  2BV3 A;  3CDI A;  1Y4U A;  2BA0 G;  2GS8 A;  2ZBK B;  3HJC A;  4PU9 A;  2X7I A;  2PO1 A;  4IFD C;  4KHP I;  4L8N A;  2E1R A;  1F2I G;  4DV6 I;  2PO0 A;  3WU6 A;  4QNK A;  2EMI A;  3EPJ A;  2EE8 A;  2LMZ A;  3B4T A;  1RRE A;  1XNQ I;  2RS6 A;  2UXD I;  3ZZT A;  2C38 A;  1N34 I;  4LF4 I;  5C0X A;  1KVK A;  1OYS A;  2NUE A;  2YT4 A;  2EOF A;  3L7Z B;  1WXR A;  4LF9 E;  1KKH A;  4MQY A;  2EOE A;  2C39 B;  1X5W A;  2PO1 B;  4F54 A;  2GQ0 A;  4Z7C A;  5IT9 C;  2PO0 B;  2ENA A;  5TSE A;  2LBS B;  4FK5 C;  2HHH I;  4R1F A;  4JI2 E;  2YSO A;  2UUB E;  5JEA F;  3BF2 A;  4BHC A;  4BC9 A;  4X9J A;  2J7K A;  1IMU A;  4FW5 A;  4O4K A;  4WSG A;  4Z7Y A;  3T1H I;  2MDG A;  5JEA D;  2YTE A;  2C38 B;  2M7Q A;  4R2Q A;  5C0X B;  2UXB I;  1TF3 A;  2BR2 A;  1RHY A;  4NZV A;  2EPR A;  2LO3 A;  2YWQ A;  4BCA A;  4DR2 I;  3ZZ0 A;  5LMU E;  1NEI A;  4DV1 E;  3KZZ A;  5IT9 Q;  4LFB E;  2YRM A;  4HTG A;  4HXZ A;  3FIG A;  2LE2 A;  3H4L A;  4WUB A;  2YTG A;  3IWC A;  3JAM Q;  4X64 I;  2DRP A;  1XMQ E;  4IZJ D;  5IWA E;  2BR2 B;  2DGC A;  1H7U A;  4JI5 I;  4DU8 A;  2WBT A;  3JTZ A;  2V2Z A;  4DR3 E;  2D9H A;  4LF8 I;  2PNL A;  1R6L A;  4JI6 I;  4JG4 A;  2NN6 C;  1XMO I;  2M1S A;  3T1Y I;  1IBK I;  1YZ9 A;  2EQ1 A;  5A69 A;  4ED4 A;  2EMC A;  2EPZ A;  3K85 A;  3D4J A;  2EN2 A;  3MSW A;  1A1K A;  4M1K A;  3HPS A;  1UDO A;  2B9D A;  2PNZ A;  1RQ0 A;  3ZKB A;  3OTO E;  4I8O A;  5BR8 E;  4B3T I;  2E5L E;  3C4T A;  2ZM6 E;  2BA1 G;  2M4I A;  5JEA E;  4M0V A;  4F9B B;  1UDS A;  3Q6N A;  4U3B A;  1FWK A;  1IQO A;  4KWY A;  1L4S A;  4ZYH A;  1N36 E;  2R42 A;  1BBG A;  2EOJ A;  2YZT A;  1NHH A;  3V5R A;  2EQ3 A;  2XEX A;  4HEI A;  4LU9 A;  4BA2 A;  4BBY A;  3OML A;  4OX9 E;  1Y4S A;  1Z0E A;  2GO3 A;  3THN A;  4OO1 F;  1O0W A;  4KZS A;  1H72 C;  4LF9 I;  2WP8 A;  4X8W A;  1Z0V A;  4P78 A;  2DSY A;  5KL7 A;  2EN3 A;  1EH8 A;  2G7H A;  4OO1 D;  3F6H A;  3LLH A;  4O5G A;  2YSP A;  2EL6 A;  2EPO A;  4DR5 E;  1MG7 A;  1P42 A;  2YTF A;  1VI7 A;  2X36 A;  3P3G A;  3H09 A;  4FW9 A;  4XTJ A;  4DPT A;  1WHN A;  2DB2 A;  2EP3 A;  2IOQ A;  4IZK A;  2GHF A;  3VHT B;  4DR7 E;  1NZ0 A;  1YHC A;  1T4O A;  4BA1 B;  1HR0 E;  4BA2 B;  2EM9 A;  2J65 A;  1KYQ A;  2ODR D;  4GEQ B;  2O1V A;  3M85 G;  4F6M A;  2WP8 B;  1E3P A;  1Y60 A;  1ZR9 A;  4DR4 E;  2HKE A;  2WCC 3;  4I3H A;  5K36 C;  3K6Q A;  4X64 E;  1T38 A;  4LFA E;  4NHR A;  2GPI A;  1JK1 A;  2LJH A;  4FW7 A;  2V2Q A;  5LMU I;  1R6M A;  2E1M A;  1K47 A;  2EM5 A;  4DV1 I;  1IQS A;  4QNJ A;  4WX9 A;  5L3J A;  3J81 Q;  4AQY I;  4LFB I;  4DPY A;  3ADL A;  1RC7 A;  1EA6 A;  4IZK B;  3CWV A;  4YY3 E;  2O3Z A;  1J5E E;  4WYQ B;  1XMQ I;  2VE7 C;  2EOZ A;  2L33 A;  2HFU A;  5IWA I;  2YTN A;  2BM0 A;  3MHS C;  4MU3 A;  1BKN A;  2EM4 A;  2EN4 A;  2EPN A;  4DUY E;  2LT7 A;  4DR3 I;  4IFD F;  2M9A A;  4ZYD A;  5LLQ A;  3GME A;  4HYM A;  3ADG A;  4IFD D;  5JEA A;  2F8B A;  3BBG A;  3J7Y p;  3EPL A;  1YSA C;  4O24 A;  1A1L A;  3WU3 A;  1IBM E;  1SFE A;  2YU5 A;  4FWH A;  2LCE A;  2EQ0 A;  1Z0B A;  5GME A;  2EM6 A;  1UEK A;  3QT8 A;  1T4N A;  4FN5 A;  4OO1 E;  2F4V I;  4DR1 E;  2HGH A;  4JI7 E;  4LOM A;  2MC5 A;  2DLQ A;  4DPU A;  3OTO I;  5BR8 I;  5FLX Q;  2EN7 A;  2CSH A;  2E5L I;  4M30 A;  2LV2 A;  1N33 E;  4MLQ A;  5JEA B;  2ZM6 I;  1HK7 A;  2HK2 A;  1AH5 A;  1QZR A;  4IZJ A;  1X47 A;  4R2R A;  4WXC A;  3TQM A;  1UIL A;  2N8X A;  2YRK A;  4R2P A;  2LRS A;  1X48 A;  2GO4 A;  2EOR A;  3U1K A;  5DRO A;  3HTX A;  4K0K E;  1S4E A;  4UTG A;  2EM0 A;  4JV5 E;  3GCM A;  4MU0 A;  3M85 D;  2B7V A;  2EMZ A;  4NXN E;  2EMF A;  4OX9 I;  2Z5B A;  3M99 B;  2EM7 A;  3V2U C;  3JAM C;  2RQL A;  1MEY C;  3PYE A;  2MDR A;  2BBG A;  1X49 A;  2PNM A;  4R03 A;  3J7A G;  2KHX A;  3JU0 A;  2YTO A;  3PS1 A;  4O43 A;  5LMN E;  2V85 A;  2L2K B;  2JWO A;  4DR5 I;  4PRV A;  1STU A;  2WBS A;  1Z59 A;  2EMH A;  3J80 Q;  4DR7 I;  1N32 E;  2B3T B;  1FWL A;  1HR0 I;  1GTK A;  4IFD E;  1A1F A;  5KL5 A;  2EMY A;  4DR4 I;  3IWB A;  4DV3 E;  4LFA I;  2ELZ A;  4M9V C;  2NN6 F;  1HNX I;  4NXM E;  2A2D A;  4TUI A;  3AV0 A;  4LTY A;  2N3H A;  1J26 A;  1B62 A;  4OOG C;  3ZOQ B;  4F2J C;  4JI1 E;  1YYO A;  4JI8 E;  2DEJ A;  5KL6 A;  2NN6 D;  2UXC E;  3PRY A;  1B69 A;  4MU4 A;  4Q35 B;  1BBO A;  1MGT A;  1FNM A;  4YY3 I;  1J5E I;  1N0V C;  4DV2 E;  2L2N A;  3NZK A;  5DRP A;  2VRD A;  4MYT A;  4OO1 A;  5CFF E;  4GKK E;  2NAB A;  4J8Z A;  2L3J A;  5AE2 A;  2ZIT A;  4WXD A;  4DUY I;  2CGE A;  2ENC A;  5A6B D;  2EOI A;  2YTJ A;  4L5N C;  3J7A M;  1P47 A;  2EOS A;  2A2C A;  1PIE A;  1I94 E;  1GZ6 A;  1YUJ A;  2F4V E;  1A1I A;  2JXP A;  4R2C A;  3VYY A;  4DUZ E;  1Z5A A;  4GQU A;  3U1Y A;  1IBM I;  2EMG A;  4NBQ A;  4GZN C;  2WNR A;  3HXL A;  2EPU A;  3C4B A;  3HUL A;  2EMA A;  2LJP A;  1Z5C A;  4DR1 I;  3WU4 A;  2JP9 A;  2MC6 A;  3PYD A;  1OYP A;  4JI7 I;  3VK6 A;  1Z0G A;  2FGG A;  4IS1 C;  2IOP A;  1IBL E;  5IV8 B;  1LLM C;  1USU A;  3Q1Q A;  4LCG A;  1N33 I;  1KIJ A;  3LTO A;  2UU9 E;  2EOX A;  2WW4 A;  4FWD A;  5C0X C;  2PNZ B;  2WNR B;  2L3C A;  4DMI A;  4DV4 E;  3QT5 A;  4OZE A;  2L6M A;  4FW6 A;  1A1H A;  3VYX A;  4K0K I;  5DRQ A;  5K36 F;  2LJU A;  4RH8 A;  4JV5 I;  1N3G A;  4B3M E;  1UDN A;  4WUC A;  4NXN I;  1RMD A;  1PVG A;  2EFG A;  3J81 C;  3ADI A;  3EPH A;  5A2Q Q;  2NN6 E;  1DQ3 A;  4IFD A;  5K36 D;  2VQF E;  2J7J A;  4DKK A;  1VIS A;  1KTV A;  1Z1B A;  4DV5 E;  2BM1 A;  2JPA A;  1MX0 A;  4J3D A;  1EH6 A;  2V87 A;  2Q8U A;  1YUI A;  2ENH A;  3F6G A;  2JR1 A;  5LMN I;  4AQY E;  1NHI A;  3PS3 A;  1ZM9 A;  2JOB A;  4HAC A;  1PJQ A;  2HC5 A;  2K4V A;  5ADZ A;  4LF7 E;  4JYA E;  1ZM4 A;  4MYU A;  1N32 I;  3H1C A;  1TF6 A;  1FKA E;  2RSM A;  1G2F C;  3AUZ A;  1HNX E;  2HFS A;  4DU7 A;  3EPK A;  2CTD A;  3KZY A;  3K1J A;  4UT4 A;  4DV3 I;  1Y6Z A;  2NA2 A;  4NXM I;  1YFH A;  5KL4 A;  4DV7 E;  5C0X E;  1X3C A;  2WBU A;  4HY1 A;  4WSP A;  2MKN A;  4ISA A;  4JI1 I;  4JI8 I;  2RTX A;  1DGC A;  1ZM3 A;  4HAC B;  2UXC I;  1TN9 A;  2IHR 1;  2EZ6 A;  1WHQ A;  5FLX C;  2V2V A;  4BMJ A;  2IES A;  4F6N A;  2UUA E;  5F3W A;  2F1D A;  1PJT A;  2EM8 A;  4LF5 E;  2MKD A;  1FI4 A;  4DV2 I;  2EPC A;  1N0U A;  2V83 A;  1NHJ A;  1MU5 A;  4GKK I;  1YH8 A;  2RS7 A;  2O1T A;  2V8Q B;  5KL2 A;  3ZM7 A;  4DR6 E;  1Z5B A;  1YYW A;  4B3S E;  4B3S I;  1Z0T A;  1I94 I;  4LPF A;  4X65 E;  2R1F A;  2CPN A;  1QNT A;  4DUZ I;  5FWK A;  2EM2 A;  4PRX A;  5K36 E;  2ELY A;  2VF1 A;  5LL6 R;  3P1X A;  1UHZ A;  4M2Z A;  3C6M A;  4JI4 E;  1HNW E;  2VF3 A;  4N3O A;  3PS2 A;  5AE1 A;  1Y5Y A;  2NN6 A;  2VES A;  1IBL I;  4FWG A;  3HQ1 A;  3J80 C;  2AJ4 A;  4DXL A;  4GKJ E;  1Z0C A;  2UU9 I;  2EOY A;  2EOH A;  3LPS A;  2V88 A;  1H74 A;  2IER A;  5AC5 A;  4DV4 I;  2JE6 A;  3HKM A;  1WUU A;  3ZKD A;  4LFC E;  2EMK A;  2V86 A;  2C39 A;  5A6B A;  4WPY A;  2Z5C A;  4JI3 E;  2HJJ A;  4IZJ B;  1T4L B;  1X6E A;  4B3M I;  2UUC E;  4DV0 E;  2NN6 B;  3M6A A;  2YTD A;  5EKW A;  2CVE A;  1EKZ A;  4USM A;  2VQF I;  2LUP B;  2JYA A;  2CZ9 A;  4DV5 I;  2EN1 A;  3MHH C;  1OJ4 A;  4R8O A;  2VQE E;  2O1U A;  5DNX A;  2JE6 B;  2OI2 A;  2EL5 A;  2EMB A;  2EWL A;  2I9I A;  2KON A;  1HNZ E;  4B3R E;  1S16 A;  1WRJ A;  2Z5B B;  4ZVI A;  2DMY A;  4R2S A;  2NUG A;  2LTS A;  2EPM X;  3PYF A;  2EOQ A;  3THO B;  2JEB A;  3GLL A;  3L00 A;  5AE3 A;  2AE8 A;  2Z5C B;  3B78 A;  4LF7 I;  1WJP A;  1FJG E;  1ZBT A;  4LCH A;  3ADJ A;  3IWD A;  1EH7 A;  1EI1 A;  4JYA I;  5KL3 A;  5IXM B;  4X62 E;  5T6J A;  4FW3 A;  5EL9 A;  1XNR I;  3DJW A;  4ZYG A;  4ZYE A;  2DEI A;  2DMI A;  4Q28 A;  3UK3 C;  4P52 A;  4RPF A;  1A6F A;  2JEA A;  1DI2 A;  1ZBQ A;  3DD6 A;  4IS9 A;  4DV7 I;  1E3H A;  1BB8 A;  4JI2 I;  1D6T A;  4YHH E;  2JEB B;  1UDQ A;  3M7N D;  3C6K A;  1GQE A;  1OYR A;  3QT7 A;  3LNU A;  1ZAA C;  5K36 A;  2FTX B;  1YYK A;  2O1W A;  2UUA I;  2E72 A;  3QT6 A;  2JOX A;  2JVA A;  2V8P A;  1U2R A;  4LF5 I;  5JEA C;  1UBD C;  2YU8 A;  4DR6 I;  3ZZU A;  2JEA B;  2DIX A;  4WUD A;  1ZU1 A;  1YPN A;  4X66 E;  1UN6 B;  4EMD A;  5C0X F;  2L92 A;  5DNY A;  1PDA A;  2RPC A;  4X65 I;  4OO1 B;  2HKJ A;  4R2E A;  3PYG A;  4JI0 E;  5C0X D;  5A2Q C;  4WFT A;  2A25 A;  5K36 B;  4LF6 E;  1KJK A;  1X6H A;  1H73 A;  2EPL X;  1RR9 A;  4OKG A;  1XXE A;  1PJS A;  5A6J A;  2BA0 D;  2EL4 A;  4N4R B;  1HNW I;  4JI4 I;  3P3E A;  2NPF A;  4KQV A;  2EJ4 A;  4F9C B;  1AAY A;  3B82 A;  3P3C A;  4GKJ I;  2YTI A;  3P06 A;  5DNL A;  2Q2E B;  4KHP E;  3BID A;  4DV6 E;  2DLK A;  1PKP A;  3KWR A;  3Q6M A;  2EMX A;  2LVH A;  5A6A A;  2L8T A;  4LFC I;  2L2M A;  4AIM A;  1ZM2 A;  3KRN A;  2EPP A;  2YTQ A;  2H36 X;  2I13 A;  1XNQ E;  2B7T A;  4JI3 I;  2UXD E;  2UUC I;  2LUQ A;  4DV0 I;  3DF6 A;  1N34 E;  5GMD A;  4LF4 E;  2CG9 A;  2EMW A;  2YPN A;  2V34 A;  2EPX A;  3EQ1 A;  2PO2 A;  3QG5 C;  2WZO A;  3UHM A;  2VQE I;  3F0N A;  4MLV A;  5ELW A;  4BA1 A;  4MU1 A;  4R2D A;  4IFD B;  4B3R I;  1HNZ I;  1XNR E;  2HHH E;  4U3D A;  2BB8 A;  2JT2 A;  3HPZ A;  4RHB B;  3T1H E;  1FJG I;  4P7A A;  2UXB E;  4AID A;  4X62 I;  1A1G A;  2UUB I;  1SR9 A;  2PRT A;  3CDJ A;  1A1J A;  2PO2 B;  2EML A;  1Z0W A;  4URL A;  2N3G A;  4BHB A;  2HK3 A;  2KOU A;  1QU6 A;  4DR2 E;  3P76 A;  1N36 I;  4OO1 C;  1G2D C;  5A6K A;  1DAR A;  2C37 A;  1NCS A;  4YHH I;  2R76 A;  2EOM A;  4BC7 A;  2V89 A;  4AM3 A;  4P7D A;  2R3V A;  3WU5 A;  5AC4 A;  4DPW A;  2JY9 A;  2YTP A;  3GON A;  4F9A B;  2EPK X;  2ADR A;  1H7S A;  4LCF A;  2ODR C;  4R2A A;  2EOO A;  1ELO A;  4JI5 E;  2NUF A;  1ZXM A;  3K17 A;  3M7N G;  4USK A;  4X66 I;  2YRH A;  2GLI A;  1ZXN A;  4LF8 E;  4IJD A;  4TUG A;  1USV A;  2C37 B;  4JI6 E;  1X6F A;  2EN8 A;  5AAS A;  4JI0 I;  4MDT A;  3ECR A;  4LF6 I;  1XMO E;  5DRR A;  3T1Y E;  1IBK E;  2RSI A;  2K7I A;  2LTR A;  3BGH A;  2EPA A;  4BS9 A;  2BA1 D;  1JK2 A;  3LML A;  3RMP A;  1B63 A; 
#chains in the Genus database with same CATH homology
 2FV4 B;  4DPX A;  4B3T E;  1XHK A;  3B8H A;  2Z5E A;  2BV3 A;  1Y4U A;  4PU9 A;  2GS8 A;  2ZBK B;  3HJC A;  4KHP I;  2X7I A;  4L8N A;  2E1R A;  4DV6 I;  3WU6 A;  2LMZ A;  1RRE A;  1XNQ I;  2RS6 A;  2UXD I;  3ZZT A;  1N34 I;  4LF4 I;  1KVK A;  2NUE A;  2YT4 A;  1WXR A;  4LF9 E;  1KKH A;  4F54 A;  2GQ0 A;  4Z7C A;  5IT9 C;  2LBS B;  2HHH I;  4R1F A;  4JI2 E;  2UUB E;  4BC9 A;  2J7K A;  3T1H I;  4Z7Y A;  2M7Q A;  2UXB I;  4BCA A;  4DR2 I;  3ZZ0 A;  5LMU E;  5IT9 Q;  4DV1 E;  4LFB E;  4HXZ A;  3FIG A;  2LE2 A;  3H4L A;  4WUB A;  3JAM Q;  3IWC A;  4X64 I;  1XMQ E;  4IZJ D;  5IWA E;  1H7U A;  4JI5 I;  4DU8 A;  3JTZ A;  2V2Z A;  4DR3 E;  4LF8 I;  2PNL A;  4JI6 I;  4JG4 A;  1XMO I;  2M1S A;  3T1Y I;  1IBK I;  1YZ9 A;  4ED4 A;  3K85 A;  3D4J A;  3MSW A;  4M1K A;  3HPS A;  2B9D A;  1RQ0 A;  3ZKB A;  3OTO E;  4I8O A;  5BR8 E;  4B3T I;  2E5L E;  3C4T A;  2ZM6 E;  2M4I A;  4M0V A;  4F9B B;  3Q6N A;  1FWK A;  2R42 A;  1N36 E;  2YZT A;  1NHH A;  3V5R A;  2XEX A;  4LU9 A;  4BBY A;  3OML A;  4OX9 E;  1Y4S A;  1Z0E A;  1O0W A;  4KZS A;  1H72 C;  4LF9 I;  4X8W A;  1Z0V A;  4P78 A;  2DSY A;  2G7H A;  3F6H A;  3LLH A;  1MG7 A;  4DR5 E;  4JI2 I;  2X36 A;  4FW9 A;  4DPT A;  3H09 A;  4XTJ A;  1WHN A;  2DB2 A;  2IOQ A;  4IZK A;  4DR7 E;  1NZ0 A;  1T4O A;  1HR0 E;  2ODR D;  4GEQ B;  2O1V A;  4I3H A;  4DR4 E;  2HKE A;  3K6Q A;  4X64 E;  4LFA E;  2LJH A;  2V2Q A;  5LMU I;  2E1M A;  1K47 A;  4DV1 I;  5L3J A;  4LFB I;  3J81 Q;  4DPY A;  3ADL A;  1RC7 A;  1EA6 A;  4IZK B;  3CWV A;  4YY3 E;  1J5E E;  4WYQ B;  1XMQ I;  2VE7 C;  2HFU A;  2L33 A;  5IWA I;  2BM0 A;  1BKN A;  4DUY E;  4DR3 I;  4HYM A;  3ADG A;  2F8B A;  3J7Y p;  3WU3 A;  1IBM E;  4FWH A;  1Z0B A;  5GME A;  1UEK A;  3QT8 A;  1T4N A;  4FN5 A;  2F4V I;  4DR1 E;  4JI7 E;  2MC5 A;  4DPU A;  3OTO I;  5BR8 I;  5FLX Q;  2E5L I;  4M30 A;  1N33 E;  2ZM6 I;  1HK7 A;  2HK2 A;  1QZR A;  4IZJ A;  1X47 A;  1UIL A;  1N36 I;  2LRS A;  1X48 A;  3HTX A;  4K0K E;  1S4E A;  4UTG A;  4JV5 E;  2B7V A;  4NXN E;  4OX9 I;  2Z5B A;  3V2U C;  3JAM C;  3PYE A;  2MDR A;  2PNM A;  1X49 A;  4R03 A;  3J7A G;  2KHX A;  3JU0 A;  5LMN E;  2V85 A;  2L2K B;  2JWO A;  4DR5 I;  4PRV A;  1STU A;  1Z59 A;  3J80 Q;  4DR7 I;  1N32 E;  2B3T B;  1FWL A;  1HR0 I;  4DR4 I;  3IWB A;  4DV3 E;  4LFA I;  1HNX I;  4NXM E;  2A2D A;  4TUI A;  3AV0 A;  1J26 A;  4LTY A;  2N3H A;  1B62 A;  4OOG C;  3ZOQ B;  4JI1 E;  2DEJ A;  1YYO A;  4JI8 E;  1D6T A;  2UXC E;  3PRY A;  4YY3 I;  1FNM A;  1J5E I;  1N0V C;  4DV2 E;  2L2N A;  4MYT A;  5CFF E;  4GKK E;  4J8Z A;  2L3J A;  5AE2 A;  2ZIT A;  4DUY I;  2CGE A;  4L5N C;  3J7A M;  2A2C A;  1PIE A;  1I94 E;  1GZ6 A;  2F4V E;  1Z5A A;  3VYY A;  4DUZ E;  1IBM I;  3HXL A;  3HUL A;  3C4B A;  2LJP A;  1Z5C A;  4DR1 I;  3WU4 A;  3PYD A;  2MC6 A;  4JI7 I;  3VK6 A;  1Z0G A;  2FGG A;  2IOP A;  1IBL E;  1USU A;  3Q1Q A;  1N33 I;  1KIJ A;  3LTO A;  2UU9 E;  4FWD A;  2WW4 A;  2L3C A;  4DMI A;  4DV4 E;  3QT5 A;  2L6M A;  3VYX A;  4K0K I;  4JV5 I;  4B3M E;  4WUC A;  4NXN I;  5A2Q Q;  1PVG A;  2EFG A;  3J81 C;  3ADI A;  1DQ3 A;  2VQF E;  4DKK A;  1VIS A;  1KTV A;  4DV5 E;  2BM1 A;  1MX0 A;  2V87 A;  3F6G A;  2JR1 A;  5LMN I;  4AQY E;  1NHI A;  1ZM9 A;  2JOB A;  4HAC A;  5ADZ A;  4LF7 E;  2K4V A;  1ZM4 A;  4JYA E;  4MYU A;  1N32 I;  1FKA E;  2RSM A;  3AUZ A;  1HNX E;  2HFS A;  4DU7 A;  3K1J A;  4UT4 A;  4DV3 I;  1Y6Z A;  2NA2 A;  4NXM I;  4DV7 E;  4HY1 A;  4WSP A;  4JI1 I;  4JI8 I;  2RTX A;  1ZM3 A;  4HAC B;  2UXC I;  2IHR 1;  2EZ6 A;  1WHQ A;  5FLX C;  2V2V A;  4BMJ A;  2UUA E;  4DV2 I;  5F3W A;  4LF5 E;  1FI4 A;  1N0U A;  2V83 A;  1NHJ A;  1MU5 A;  4GKK I;  2RS7 A;  2O1T A;  2V8Q B;  3ZM7 A;  4DR6 E;  1Z5B A;  1YYW A;  4B3S E;  1Z0T A;  1I94 I;  4X65 E;  2CPN A;  4DUZ I;  5FWK A;  4PRX A;  2VF1 A;  5LL6 R;  3P1X A;  1UHZ A;  4M2Z A;  4JI4 E;  1HNW E;  2VF3 A;  4N3O A;  5AE1 A;  1IBL I;  4FWG A;  3HQ1 A;  3J80 C;  2AJ4 A;  4DXL A;  4GKJ E;  1Z0C A;  2UU9 I;  3LPS A;  2V88 A;  1H74 A;  4DV4 I;  1WUU A;  3ZKD A;  4LFC E;  2V86 A;  4WPY A;  2Z5C A;  4JI3 E;  4IZJ B;  1T4L B;  4B3M I;  2UUC E;  4DV0 E;  3M6A A;  4USM A;  1EKZ A;  2VQF I;  2LUP B;  2CZ9 A;  4DV5 I;  1OJ4 A;  4R8O A;  2VQE E;  2O1U A;  2OI2 A;  2EWL A;  2KON A;  4B3R E;  1HNZ E;  2Z5B B;  1S16 A;  4ZVI A;  4AQY I;  2DMY A;  2NUG A;  2LTS A;  3PYF A;  2Z5C B;  5AE3 A;  3B78 A;  4LF7 I;  1FJG E;  4JYA I;  1ZBT A;  3IWD A;  3ADJ A;  1EI1 A;  4X62 E;  5T6J A;  1XNR I;  3DJW A;  2DEI A;  4Q28 A;  4P52 A;  4RPF A;  1A6F A;  1DI2 A;  1ZBQ A;  4DV7 I;  4YHH E;  1GQE A;  3QT7 A;  3LNU A;  2FTX B;  1YYK A;  2O1W A;  2UUA I;  3QT6 A;  2JOX A;  2JVA A;  2V8P A;  1U2R A;  4LF5 I;  4DR6 I;  3ZZU A;  2DIX A;  4WUD A;  4EMD A;  4B3S I;  4X66 E;  2L92 A;  5DNY A;  4X65 I;  2HKJ A;  3PYG A;  4JI0 E;  5A2Q C;  4WFT A;  4LF6 E;  1H73 A;  1RR9 A;  1HNW I;  4JI4 I;  2NPF A;  4KQV A;  4F9C B;  3B82 A;  4GKJ I;  3P06 A;  2Q2E B;  4KHP E;  4DV6 E;  1PKP A;  3KWR A;  3Q6M A;  4LFC I;  2L8T A;  2L2M A;  1ZM2 A;  2H36 X;  1XNQ E;  4JI3 I;  2B7T A;  2UXD E;  2UUC I;  2LUQ A;  4DV0 I;  3DF6 A;  1N34 E;  5GMD A;  4LF4 E;  2CG9 A;  2V34 A;  2WZO A;  2VQE I;  3F0N A;  4B3R I;  1HNZ I;  1XNR E;  2HHH E;  3HPZ A;  3T1H E;  1FJG I;  4P7A A;  2UXB E;  4X62 I;  2UUB I;  1SR9 A;  1Z0W A;  4URL A;  2N3G A;  2HK3 A;  2KOU A;  1QU6 A;  4DR2 E;  1DAR A;  4YHH I;  4BC7 A;  2V89 A;  4P7D A;  2R3V A;  3WU5 A;  4DPW A;  2JY9 A;  3GON A;  4F9A B;  1H7S A;  2ODR C;  3K17 A;  1ELO A;  4JI5 E;  2NUF A;  1ZXM A;  4USK A;  4X66 I;  1ZXN A;  4LF8 E;  4TUG A;  1USV A;  4JI6 E;  5AAS A;  4JI0 I;  4LF6 I;  1XMO E;  3T1Y E;  1IBK E;  2LTR A;  4BS9 A;  3LML A;  3RMP A;  1B63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...