5LL6R

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
b'NTEEKGWVPVTKLGRLVKAGKITTIEEIFLHSLPVKEFQIIDTLLPGLQDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTTGKCGSVTVRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFLTPNLWAEQPLPVSPLDIYSDEASAQKKRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
R PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5ll6R01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5ll6R02
2HHHE 2VQFE 4JI4E 1D6TA 5LMNE 5IT9Q 5LL6R 1I94E 4B3TE 1Z59A 4DXLA 1WUUA 3ZM7A 1Z0WA 4DR4E 3WU5A 4B3RE 4X64I 1RREA 4DR2E 3WU4A 4JI0E 3J81Q 1NHIA 2V2VA 2A2DA 3J7AG 4JV5I 3PYGA 4AQYI 2UUCE 4LFBI 4LFAI 4JI6I 4DV6I 3ZZTA 4Z7CA 2V34A 4JG4A 4MYUA 1U2RA 4LFCE 2DEJA 4LF5E 4UTGA 2UXBE 2E5LI 4DR3I 1MG7A 2HK2A 3LTOA 1IBMI 4JI1I 1FJGE 1H72C 1S16A 4DUYI 3H4LA 1PKPA 1N33I 4X66I 4DR6I 2NPFA 2V2ZA 1IBLI 4DV7I 4DV3I 4HYMA 1ZXMA 2X36A 1S4EA 4DPUA 1XMOI 1N34I 4HY1A 4DV1I 4X62I 3LNUA 4M1KA 4EMDA 1A6FA 4X64E 2BV3A 1QZRA 4JV5E 1DARA 4AQYE 1Z5CA 2UU9I 1KIJA 4LFBE 4JI6E 1NZ0A 3J80Q 4DV6E 4DPYA 2ZITA 3WU3A 2HKEA 3WU6A 3T1HE 1B62A 1UEKA 2E5LE 4GKKI 4DR3E 3J7AM 1Z0GA 1MX0A 2VF3A 4JI1E 4JI3I 1XNQI 2F4VI 1H74A 2HFUA 2VQEI 4FN5A 4HACB 4DV0I 4DUYE 3PYEA 1ZXNA 1N33E 4X66E 4DR6E 4DPXA 2CZ9A 4DR5I 2BM0A 1IBLE 1XNRE 4B3SE 4DV3E 1OJ4A 1KTVA 4JI8I 1KVKA 4LF9E 5L3JA 1N34E 2J7KA 4DV1E 4X62E 2EFGA 4NXMI 2UXDI 4DV4I 5IT9C 4LF8I 1BKNA 1FWLA 4WUBA 4FW9A 2HKJA 3JAMQ 1IBKI 1N0VC 4DPWA 5FLXQ 1N0UA 4NXNI 2UU9E 2HK3A 2Q2EB 1XHKA 1N32I 1ELOA 1N36I 1ZM4A 4GKKE 1FI4A 4JI2I 4DV5I 2UUBI 4JI3E 1XNQE 4WUDA 4OX9I 1B63A 3QT6A 2VQEE 2V2QA 4B3MI 1XMQI 4DV0E 2HFSA 2BM1A 3CWVA 2A2CA 3ZKDA 4YY3I 3ZZ0A 4JI5I 5A2QQ 4DR5E 3V5RA 2UUAI 5BR8I 1J5EI 4JI8E 4B3RI 1FWKA 1K47A 3B82A 4JI0I 3ZKBA 4LFAE 4NXME 2R3VA 2UXDE 4DV4E 1NHHA 1MU5A 4DPTA 1HNXI 4DUZI 4LF8E 2X7IA 2LJPA 4X65I 4YHHI 4NXNE 1HNWI 1ZM2A 4LFCI 4LF5I 1EA6A 4LF4I 1IBME 1HNZI 4R1FA 4JYAI 3OTOI 3PYFA 3K1JA 1N32E 2WW4A 1N36E 3ZZUA 3J80C 1PVGA 2R42A 4PRXA 4DV5E 2UUBE 4RPFA 4OX9E 4DV7E 3Q1QA 1Z5AA 4B3ME 1Z0EA 1XMQE 2ZM6I 4USMA 5LMUI 4YY3E 1XMOE 4HACA 1EI1A 4JI5E 4DR7I 4P52A 4JI7I 1PIEA 4DR1I 3T1YI 3HULA 2UUAE 1FNMA 1HR0I 5BR8E 1J5EE 4GKJI 1NHJA 4I3HA 2UXCI 2E1RA 2OI2A 1FKAE 1HNXE 4DUZE 4FWGA 3J81C 3D4JA 4X65E 4DV2I 4YHHE 4LF6I 4KHPI 3F0NA 1HNWE 3T1HI 4K0KI 1Z5BA 1Z0CA 4HXZA 4LF4E 5IWAI 2F4VE 3JAMC 1HNZE 5FLXC 4JYAE 3OTOE 3B78A 1RR9A 5GMEA 4LF7I 4FWHA 4ED4A 2HHHI 2VQFI 1Z0BA 4DU7A 4JI4I 4P7AA 5LMNI 2GS8A 1Z0TA 1H7UA 1I94I 4B3TI 3QT7A 4DU8A 1ZM3A 4ZVIA 2ZM6E 4DR4I 1XNRI 4B3SI 2ZBKB 2DEIA 3LPSA 4Z7YA 5LMUE 4DR2I 4PRVA 4DR7E 3PYDA 3QT8A 4JI7E 4DR1E 4KQVA 3QT5A 4LF9I 3GONA 2UUCI 3T1YE 1ZM9A 1HR0E 1VISA 4GKJE 1H7SA 3K17A 1IBKE 5A2QC 2UXCE 3V2UC 2AJ4A 3B8HA 1Z0VA 2UXBI 4WUCA 4URLA 3M6AA 5GMDA 4UT4A 4DV2E 4LF6E 4KHPE 1FJGI 2V8PA 4PU9A 4FWDA 4K0KE 4JI2E 4USKA 1KKHA 4XTJA 1H73A 5IWAE 4MYTA 2XEXA 4LF7E
chains in the Genus database with same CATH superfamily
2NABA 2HHHE 2VQFE 5C0XD 4JI4E 2JWOA 2EM2A 1L4SA 5DNXA 1D6TA 5LMNE 5IT9Q 5LL6R 1QU6A 4IFDE 4ZYGA 2CTDA 4WSGA 4KZSA 1I94E 4R2PA 2ODRC 4B3TE 2I9IA 1Z59A 3C6KA 1BBOA 2LUPB 4WX9A 2A25A 2EL4A 2GQ0A 1YZ9A 1WUUA 3HKMA 1X48A 4WXDA 2WP8A 3ZM7A 4DXLA 1Z0WA 2I13A 5ADZA 4DR4E 2L2KB 3WU5A 1STUA 2O1TA 4B3RE 4X64I 2EQ1A 3VK6A 4DR2E 1RREA 3WU4A 2B7TA 2PRTA 1KYQA 2YZTA 4JI0E 1Y5YA 2NN6B 3P3CA 3GCMA 3J81Q 2EN6A 2B7VA 1NHIA 2V2VA 2A2DA 2EORA 3J7AG 2PO1A 3PYGA 4JV5I 4AQYI 2NUGA 3MHHC 3M85D 2UUCE 1RMDA 2M7QA 2EMLA 4LFBI 1T4OA 2AE8A 1YHCA 2NN6F 4JI6I 4DV6I 2GO4A 4IZJD 3ZZTA 4LFAI 1YFHA 2HJJA 4MQYA 2EMCA 2EQ3A 4Z7CA 3IWDA 2V34A 4JG4A 3CDJA 4MYUA 2EWLA 1DQ3A 1U2RA 3BIDA 2RS6A 4LFCE 2DEJA 4MU4A 3NZKA 2DLQA 4WFTA 4LF5E 4BA1A 4UTGA 2UXBE 1AH5A 2E5LI 4R2QA 4DR3I 1EH6A 1MG7A 1PDAA 4L5NC 2HK2A 2LBSB 3LTOA 2WNRB 1IBMI 2YTOA 4AM3A 2B9DA 4JI1I 1VI7A 1FJGE 5CFFE 4IZKB 4LCGA 2N3GA 2EN8A 2EOMA 1OYSA 1SR9A 1H72C 4X9JA 4OOGC 1S16A 1UDQA 4M0VA 4DUYI 3H4LA 1PKPA 1X6FA 2PNZB 1A1KA 2YSOA 4X66I 1N33I 2RQLA 1UDOA 4DR6I 4OKGA 2ADRA 2LJUA 4LOMA 2M4IA 2NPFA 2V2ZA 2L6MA 2O1WA 1IBLI 2LTSA 5LLQA 4DV7I 2CVEA 5ELWA 5K36C 4OZEA 4DV3I 3IWCA 4HYMA 4TUIA 2YTGA 4FW4A 5A6BA 2YTEA 2EL6A 2JE6B 2NN6D 2C38A 1ZXMA 2X36A 1P47A 1S4EA 4DPUA 2BR2B 2BA1D 2YRKA 2EOEA 2Z5BA 3K6QA 2EMIA 2CSHA 4R8OA 1XMOI 1N34I 1T39A 1TN9A 1UHZA 4HY1A 4DV1I 2FGGA 3LNUA 4X62I 4M1KA 3HPZA 4EMDA 1T38A 1A6FA 1YYOA 1E3PA 2VRDA 3VHTB 4X64E 1WJPA 2JEAB 2KONA 2EM4A 2BV3A 4R2AA 3P3GA 1QNTA 1Y6ZA 3H09A 2L92A 4IFDA 2C39A 4OO1E 4BCAA 3L7ZB 4FK5C 4RH8A 1QZRA 5C0XA 2O1UA 4JV5E 1DARA 4LU9A 5A6KA 2BBGA 4AQYE 1Z5CA 2UU9I 2JOBA 1KIJA 4LFBE 3U1KA 3BBGA 4QNKA 1SFEA 3C4BA 4JI6E 4DV6E 1NZ0A 3P3EA 2RSIA 4DPYA 3J80Q 3DF6A 2JPAA 2ZITA 3VYYA 1X49A 3WU3A 2RTXA 3M99B 4MLQA 3ADIA 1PJQA 2ODRD 3FIGA 2EPUA 2V8QB 1A1HA 2HKEA 2LMZA 3WU6A 2KHXA 3T1HE 4ZYHA 1B62A 2K7IA 2L8TA 1UEKA 4NHRA 4U3DA 3ADJA 2DRPA 5JEAE 2KOUA 3HQ1A 2E5LE 1N3GA 5A6JA 4GKKI 1X6HA 4DR3E 3J7AM 2DSYA 2EOJA 3EPJA 2YTPA 5K36B 5DRPA 1Z0GA 2LUQA 3QG5C 1MX0A 2VF3A 4JI1E 4JI3I 2H36X 1XNQI 1GQEA 2F4VI 1ZU1A 1NEIA 1H74A 2YTJA 5K36F 2RSMA 4O24A 2HFUA 2Z5EA 2ENAA 4IS1C 4J8ZA 2VQEI 4R2SA 4P78A 2IOPA 1OYPA 2EMXA 2YPNA 4FN5A 4HACB 5C0XE 4DV0I 4BA2A 4DUYE 2CG9A 5DRQA 2HGHA 3PYEA 2GHFA 1ZXNA 2DMIA 2BA0D 2EMBA 4X66E 2CT1A 4DR6E 1N33E 2WP8B 5EL9A 1USUA 4DPXA 1YUJA 2R76A 2EMKA 2CZ9A 4DR5I 5KL3A 1IBLE 2BM0A 1XNRE 4B3SE 3M7NG 2GO3A 4DV3E 2DB2A 1OJ4A 1KTVA 4F6MA 2EPPA 1BB8A 2EM3A 2F1DA 2DGCA 4JI8I 4O5GA 3H1CA 3THNA 4BBYA 3PRYA 2J7JA 1KVKA 4LF9E 2LE2A 1N34E 2JEBA 2J7KA 5L3JA 3CDIA 2V88A 4DV1E 2EM9A 4HTGA 4X62E 4Q28A 2PO2A 2VESA 2YTQA 2EFGA 4NXMI 4F54A 2UXDI 4DV4I 2LRSA 5IT9C 2EM0A 4FW5A 4LF8I 1LLMC 1BKNA 1FWLA 2MDRA 1XXEA 3BGHA 4BHCA 2PO0B 4WUBA 2L2NA 4FW9A 2HKJA 3JAMQ 1IBKI 2B3TB 1N0VC 2EPAA 4DPWA 3KWRA 5FLXQ 2ELYA 2HC5A 3C4TA 2YU5A 1N0UA 2MKDA 4NXNI 2UU9E 2RPCA 3K85A 5KL4A 5K36D 2HK3A 2EOHA 5DRRA 4IFDC 3HTXA 4FW3A 2YRHA 3M85G 1F2IG 2C37A 4BHBA 4NBQA 2LCEA 1E3HA 2Q2EB 1XHKA 4WPYA 1A1JA 2MKNA 1R6LA 2EN1A 2Z5CA 3F6GA 1N32I 2EM7A 4OO1A 1ELOA 1Y60A 1J26A 1N36I 4GKKE 1ZM4A 1FI4A 5FWKA 4JI2I 3ADLA 2EMAA 5AE3A 2EM8A 2CPNA 2M1SA 4DV5I 2UUBI 2IERA 4JI3E 1XNQE 1RQ0A 4WUDA 2DLKA 4OX9I 1B63A 3QT6A 4ZYEA 5AE2A 4F9BB 4QNJA 3P06A 4R03A 2WNRA 3HPSA 2VQEE 2EMWA 2ENHA 2V87A 2V2QA 1YPNA 2IHR1 1A1LA 4B3MI 2C38B 2YTFA 4F9AB 1XMQI 1WXRA 4DV0E 5JEAA 2EPZA 3THOB 3EQ1A 2HFSA 2BM1A 3ZOQB 3CWVA 4P7DA 2A2CA 2NN6E 3ZKDA 5AE1A 4YY3I 4BC7A 2IESA 3ZZ0A 3RMPA 4JI5I 4DKKA 2JP9A 5A2QQ 4DR5E 2EPNA 2EZ6A 2DIXA 4M30A 5A69A 4R2RA 1UBDC 2YRMA 3KRNA 3V5RA 2MC6A 1ZAAC 2UUAI 2MDGA 4BS9A 5T6JA 2EPCA 1AAYA 2C39B 2JT2A 4JI8E 5BR8I 1J5EI 4IFDB 4B3RI 2EOXA 1X3CA 1IQSA 4MLVA 1FWKA 1K47A 3B82A 2E72A 2BA1G 4O4KA 4ZYDA 2EE8A 2JVAA 1Y4SA 4JI0I 3ZKBA 4IFDF 4LFAE 2BB8A 4NXME 2R3VA 2UXDE 4DV4E 3JTZA 1NHHA 1MU5A 4DPTA 4GZNC 3PS2A 1HNXI 2JOXA 3GLLA 4DUZI 4GEQB 4LF8E 5TSEA 2X7IA 1YUIA 2LJPA 2NUFA 3UK3C 4X65I 4YHHI 3PS1A 2LO3A 2F8BA 4NXNE 1HNWI 3P76A 1ZM2A 2EM6A 4LFCI 5KL7A 1UN6B 4LF5I 1EA6A 5A6AA 2EPLX 2LTRA 1IBME 4LF4I 1EH7A 4BC9A 5KL2A 1HNZI 4R1FA 4JYAI 4IZJA 2O3ZA 4FW6A 4MU3A 3OTOI 2LVHA 3PYFA 3K1JA 5A6BD 2IOQA 2YU8A 1N32E 2WW4A 3Q6NA 4ISAA 4MU0A 2V86A 1N36E 3ZZUA 4BA2B 2LJHA 3J80C 1UILA 4TUGA 1ZBQA 4LCHA 1PVGA 2M9AA 2D9HA 3JU0A 4DV5E 2UUBE 2R42A 4MU1A 4PRXA 1MEYC 4RPFA 3ECRA 4OO1C 4R2EA 4F2JC 2L2MA 4LPFA 3HXLA 4OX9E 2K4VA 3GMEA 3VYXA 2ELZA 5K36A 3ADGA 1YYWA 4O43A 1X47A 2EMFA 4DV7E 3Q1QA 2EMHA 2WBUA 1UDSA 1G2FC 1Z5AA 4IS9A 5AASA 4B3ME 1Z0EA 4IFDD 1XMQE 2ZM6I 1WHNA 2N8XA 1EH8A 1EKZA 4USMA 2G7HA 3J7Yp 1JK1A 4Q35B 2PO1B 2JEBB 2WCC3 2NA2A 5LMUI 1R6MA 4YY3E 5IXMB 1XMOE 2EPKX 2LV2A 4JI5E 2YWQA 1EI1A 2BA0G 2PO2B 1BBGA 4IJDA 4HACA 4P52A 5JEAC 4JI7I 1UDNA 3EPHA 1PIEA 4DR1I 2CGEA 4RHBB 2EOFA 3T1YI 4HEIA 2UUAE 3HULA 1FNMA 1HR0I 5DROA 5BR8E 1J5EE 4J3DA 3F6HA 4GKJI 4MDTA 2V83A 4F9CB 5KL5A 1NHJA 4BA1B 1IQOA 1RC7A 4I3HA 3IWBA 1A1IA 2N3HA 2UXCI 3P1XA 2ENCA 2NN6A 2E1RA 4U3BA 3EPKA 2EN7A 4LTYA 1FKAE 1YSAC 2OI2A 5KL6A 2EOYA 2C37B 1DGCA 5C0XC 2EOOA 1HNXE 4DUZE 3UHMA 5K36E 2JXPA 4FWGA 2PNMA 3J81C 1A1FA 3D4JA 4X65E 5AC4A 2YT4A 2EOQA 4WYQB 4YHHE 1YH8A 2Z5CB 4DV2I 4LF6I 4KHPI 4OO1B 2EJ4A 3F0NA 1HNWE 1JK2A 1WHQA 2EPOA 3T1HI 2WZOA 2YTIA 3AV0A 1Z0CA 1Z5BA 3MHSC 2PO0A 4K0KI 3TQMA 2EPMX 4HXZA 1HK7A 1NCSA 1GZ6A 2WBTA 2L3CA 4LF4E 5F3WA 1GTKA 4OO1F 2L3JA 4M2ZA 4KWYA 4DMIA 1YYKA 2F4VE 5IWAI 3JAMC 1HNZE 1KJKA 1MGTA 5FLXC 4JYAE 2JYAA 3LLHA 3OTOE 5IV8B 3B78A 3OMLA 2EOZA 3KZZA 1RR9A 5GMEA 4LF7I 2YTDA 4FWHA 4IZKA 2L33A 2WBSA 1PJTA 2EP3A 4ED4A 1Z0BA 5JEAB 4DU7A 2VQFI 2HHHI 4JI4I 3DD6A 1TF3A 4P7AA 5LMNI 2GS8A 1Z0TA 2MC5A 2Z5BB 2V89A 1H7UA 2EMZA 2FTXB 2YSPA 4M9VC 3B4TA 1G2DC 2NUEA 5JEAF 1I94I 2EQ0A 3KZYA 3QT7A 4DU8A 2EPRA 2GPIA 4B3TI 3PS3A 1B69A 2R1FA 2PNZA 3HJCA 4WSPA 5DNLA 3C6MA 1ZM3A 2J65A 4DR7I 1PJSA 4ZVIA 2ZM6E 4GQUA 4DR4I 1XNRI 4B3SI 4BMJA 2ZBKB 1WRJA 5C0XB 5EKWA 2DEIA 3LPSA 4Z7YA 2EM5A 4WXCA 4N3OA 3DJWA 4NZVA 5LMUE 4DR2I 4PRVA 2VE7C 1T4NA 2JE6A 4DR7E 2LT7A 2JY9A 3PYDA 2V85A 3QT8A 2DMYA 2E1MA 2EN3A 4JI7E 2BR2A 4DR1E 2GLIA 4FW7A 4KQVA 1T4LB 5C0XF 3QT5A 4LF9I 1ZBTA 3GONA 3LMLA 5DNYA 2UUCI 2YTNA 3T1YE 1ZM9A 2VF1A 2RS7A 4L8NA 1HR0E 1VISA 2O1VA 4I8OA 4GKJE 1H7SA 3MSWA 2EOIA 3K17A 3BF2A 4OO1D 2EN4A 1IBKE 4LCFA 2JEAA 5AC5A 5A2QC 2UXCE 3V2UC 1A1GA 1DI2A 2AJ4A 3L7ZA 1USVA 1Y4UA 3B8HA 1Z0VA 1O0WA 1X5WA 3U1YA 2UXBI 4WUCA 4URLA 3M6AA 2EMYA 5GMDA 2NN6C 1ZR9A 1X6EA 4IZJB 2EMGA 4DV2E 4LF6E 4KHPE 2Q8UA 1P42A 1RHYA 4UT4A 4N4RB 2EL5A 1FJGI 4AIDA 1TF6A 5JEAD 2V8PA 4PU9A 4FWDA 4K0KE 4JI2E 2JR1A 4USKA 3AUZA 1KKHA 1IMUA 3Q6MA 2EOSA 2FV4B 4R2DA 1Z1BA 4XTJA 4F6NA 1H73A 3EPLA 5IWAE 2EN2A 3L00A 4MYTA 2XEXA 4R2CA 1OYRA 2EPXA 2PNLA 4AIMA 4LF7E 3M7ND 4X8WA
chains in the Genus database with same CATH topology
2HHHE 2VQFE 4JI4E 2JWOA 1D6TA 5LMNE 5IT9Q 5LL6R 1QU6A 4KZSA 1I94E 4B3TE 2ODRC 1Z59A 2LUPB 4DXLA 2GQ0A 1YZ9A 1WUUA 1X48A 3ZM7A 1Z0WA 5ADZA 4DR4E 2L2KB 3WU5A 1STUA 2O1TA 4B3RE 4X64I 3VK6A 4DR2E 1RREA 3WU4A 2B7TA 2YZTA 4JI0E 3J81Q 1NHIA 2B7VA 2V2VA 2A2DA 3J7AG 4JV5I 3PYGA 4AQYI 2NUGA 2UUCE 2M7QA 4LFBI 1T4OA 4LFAI 4JI6I 4DV6I 4IZJD 3ZZTA 4Z7CA 3IWDA 2V34A 4JG4A 4MYUA 2EWLA 1DQ3A 1U2RA 2RS6A 4LFCE 2DEJA 4LF5E 4WFTA 4UTGA 2UXBE 2E5LI 4DR3I 1MG7A 4L5NC 2HK2A 2LBSB 3LTOA 1IBMI 2B9DA 4JI1I 1FJGE 5CFFE 4IZKB 2N3GA 1SR9A 1H72C 4OOGC 1S16A 4M0VA 4DUYI 3H4LA 1PKPA 1N33I 4X66I 4DR6I 2M4IA 2NPFA 2V2ZA 2L6MA 2O1WA 1IBLI 2LTSA 4DV7I 4DV3I 3IWCA 4HYMA 4TUIA 1ZXMA 2X36A 1S4EA 4DPUA 2Z5BA 3K6QA 1XMOI 4R8OA 1N34I 4HY1A 1UHZA 4DV1I 2FGGA 3LNUA 4X62I 4M1KA 3HPZA 4EMDA 1A6FA 1YYOA 4X64E 2KONA 2BV3A 1Y6ZA 3H09A 2L92A 4BCAA 1QZRA 2O1UA 4JV5E 1DARA 4LU9A 4AQYE 1Z5CA 2UU9I 2JOBA 1KIJA 4LFBE 3C4BA 4JI6E 4DV6E 1NZ0A 3J80Q 4DPYA 3DF6A 2ZITA 3VYYA 1X49A 3WU3A 2RTXA 3ADIA 2ODRD 3FIGA 2V8QB 2HKEA 2LMZA 3WU6A 2KHXA 3T1HE 1B62A 2L8TA 1UEKA 3ADJA 2KOUA 3HQ1A 2E5LE 4GKKI 4DR3E 3J7AM 2DSYA 1Z0GA 2LUQA 1MX0A 2VF3A 4JI1E 4JI3I 2H36X 1XNQI 1GQEA 2F4VI 1H74A 2RSMA 2HFUA 2Z5EA 4J8ZA 2VQEI 4P78A 2IOPA 4FN5A 4HACB 4DV0I 4DUYE 2CG9A 3PYEA 1ZXNA 1N33E 4X66E 4DR6E 1USUA 4DPXA 2CZ9A 4DR5I 1IBLE 2BM0A 1XNRE 4B3SE 4DV3E 2DB2A 1OJ4A 1KTVA 4JI8I 4BBYA 3PRYA 1KVKA 4LF9E 2LE2A 1N34E 5L3JA 2J7KA 2V88A 4DV1E 4X62E 4Q28A 2EFGA 4NXMI 4F54A 2UXDI 4DV4I 2LRSA 5IT9C 4LF8I 1BKNA 1FWLA 2MDRA 4WUBA 2L2NA 4FW9A 2HKJA 3JAMQ 1IBKI 2B3TB 1N0VC 4DPWA 5FLXQ 3KWRA 1N0UA 3C4TA 4NXNI 2UU9E 3K85A 2HK3A 3HTXA 2Q2EB 1XHKA 4WPYA 2Z5CA 3F6GA 1N32I 1ELOA 1J26A 1N36I 4GKKE 1ZM4A 1FI4A 5FWKA 4JI2I 3ADLA 5AE3A 2CPNA 2M1SA 4DV5I 2UUBI 4JI3E 1XNQE 1RQ0A 4WUDA 4OX9I 1B63A 3QT6A 5AE2A 4F9BB 3P06A 4R03A 3HPSA 2VQEE 2V87A 2V2QA 2IHR1 4B3MI 4F9AB 1XMQI 1WXRA 4DV0E 2HFSA 2BM1A 3ZOQB 3CWVA 4P7DA 2A2CA 3ZKDA 5AE1A 4YY3I 4BC7A 3ZZ0A 4JI5I 3RMPA 4DKKA 5A2QQ 4DR5E 2EZ6A 2DIXA 4M30A 3V5RA 2MC6A 2UUAI 4BS9A 5T6JA 5BR8I 1J5EI 4JI8E 4B3RI 1FWKA 1K47A 3B82A 1Y4SA 4JI0I 2JVAA 3ZKBA 4LFAE 4NXME 2R3VA 2UXDE 4DV4E 3JTZA 1NHHA 1MU5A 4DPTA 1HNXI 2JOXA 4DUZI 4GEQB 4LF8E 2X7IA 2LJPA 2NUFA 4X65I 4YHHI 2F8BA 4NXNE 1HNWI 1ZM2A 4LFCI 4LF5I 1EA6A 4LF4I 2LTRA 1IBME 4BC9A 1HNZI 4R1FA 4JYAI 4IZJA 3OTOI 3PYFA 3K1JA 2IOQA 1N32E 2WW4A 3Q6NA 2V86A 1N36E 3ZZUA 2LJHA 3J80C 1UILA 4TUGA 1ZBQA 1PVGA 3JU0A 4DV5E 2UUBE 2R42A 4PRXA 4RPFA 2L2MA 3HXLA 4OX9E 2K4VA 3VYXA 3ADGA 1YYWA 1X47A 4DV7E 3Q1QA 1Z5AA 5AASA 4B3ME 1Z0EA 1XMQE 2ZM6I 1WHNA 1EKZA 4USMA 2G7HA 3J7Yp 5LMUI 2NA2A 4YY3E 1XMOE 3HJCA 4JI5E 1EI1A 4HACA 4DR7I 4P52A 4JI7I 1PIEA 4DR1I 2CGEA 3T1YI 2UUAE 3HULA 1FNMA 1HR0I 5BR8E 1J5EE 3F6HA 4GKJI 2V83A 4F9CB 1NHJA 1RC7A 4I3HA 3IWBA 2N3HA 2UXCI 3P1XA 2E1RA 4LTYA 1FKAE 2OI2A 1HNXE 4DUZE 4FWGA 2PNMA 3J81C 3D4JA 4X65E 4DV2I 2YT4A 4WYQB 4YHHE 2Z5CB 4LF6I 4KHPI 3F0NA 1HNWE 1WHQA 3T1HI 2WZOA 3AV0A 1Z5BA 1Z0CA 4K0KI 4HXZA 1HK7A 1GZ6A 2L3CA 4LF4E 5F3WA 2L3JA 4M2ZA 4DMIA 2F4VE 1YYKA 5IWAI 3JAMC 1HNZE 5FLXC 4JYAE 3LLHA 3OTOE 3B78A 3OMLA 1RR9A 5GMEA 4LF7I 4FWHA 4IZKA 2L33A 4ED4A 2HHHI 2VQFI 1Z0BA 4DU7A 4JI4I 4P7AA 5LMNI 2GS8A 1Z0TA 2MC5A 2Z5BB 2V89A 1H7UA 2FTXB 2NUEA 1I94I 4B3TI 3QT7A 4DU8A 4WSPA 1ZM3A 4ZVIA 2ZM6E 4DR4I 1XNRI 4B3SI 4BMJA 2ZBKB 2DEIA 3LPSA 4Z7YA 4N3OA 3DJWA 5LMUE 4DR2I 4PRVA 2VE7C 1T4NA 4DR7E 2JY9A 3PYDA 2V85A 3QT8A 2DMYA 2E1MA 4JI7E 4DR1E 4KQVA 1T4LB 3QT5A 4LF9I 1ZBTA 3GONA 3LMLA 5DNYA 2UUCI 3T1YE 1ZM9A 2VF1A 2RS7A 4L8NA 1HR0E 1VISA 2O1VA 4I8OA 4GKJE 1H7SA 3MSWA 3K17A 1IBKE 5A2QC 2UXCE 3V2UC 1DI2A 2AJ4A 1USVA 1Y4UA 3B8HA 1Z0VA 1O0WA 2UXBI 4WUCA 4URLA 3M6AA 5GMDA 4UT4A 4IZJB 4DV2E 4LF6E 4KHPE 1FJGI 2V8PA 4PU9A 4FWDA 4K0KE 4JI2E 2JR1A 4USKA 3AUZA 1KKHA 3Q6MA 2FV4B 4XTJA 1H73A 5IWAE 4MYTA 2XEXA 2PNLA 4LF7E 4X8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH E;  2VQF E;  4JI4 E;  1D6T A;  5LMN E;  5IT9 Q;  5LL6 R;  1I94 E;  4B3T E;  1Z59 A;  4DXL A;  1WUU A;  3ZM7 A;  1Z0W A;  4DR4 E;  3WU5 A;  4B3R E;  4X64 I;  1RRE A;  4DR2 E;  3WU4 A;  4JI0 E;  3J81 Q;  1NHI A;  2V2V A;  2A2D A;  3J7A G;  4JV5 I;  3PYG A;  4AQY I;  2UUC E;  4LFB I;  4LFA I;  4JI6 I;  4DV6 I;  3ZZT A;  4Z7C A;  2V34 A;  4JG4 A;  4MYU A;  1U2R A;  4LFC E;  2DEJ A;  4LF5 E;  4UTG A;  2UXB E;  2E5L I;  4DR3 I;  1MG7 A;  2HK2 A;  3LTO A;  1IBM I;  4JI1 I;  1FJG E;  1H72 C;  1S16 A;  4DUY I;  3H4L A;  1PKP A;  1N33 I;  4X66 I;  4DR6 I;  2NPF A;  2V2Z A;  1IBL I;  4DV7 I;  4DV3 I;  4HYM A;  1ZXM A;  2X36 A;  1S4E A;  4DPU A;  1XMO I;  1N34 I;  4HY1 A;  4DV1 I;  4X62 I;  3LNU A;  4M1K A;  4EMD A;  1A6F A;  4X64 E;  2BV3 A;  1QZR A;  4JV5 E;  1DAR A;  4AQY E;  1Z5C A;  2UU9 I;  1KIJ A;  4LFB E;  4JI6 E;  1NZ0 A;  3J80 Q;  4DV6 E;  4DPY A;  2ZIT A;  3WU3 A;  2HKE A;  3WU6 A;  3T1H E;  1B62 A;  1UEK A;  2E5L E;  4GKK I;  4DR3 E;  3J7A M;  1Z0G A;  1MX0 A;  2VF3 A;  4JI1 E;  4JI3 I;  1XNQ I;  2F4V I;  1H74 A;  2HFU A;  2VQE I;  4FN5 A;  4HAC B;  4DV0 I;  4DUY E;  3PYE A;  1ZXN A;  1N33 E;  4X66 E;  4DR6 E;  4DPX A;  2CZ9 A;  4DR5 I;  2BM0 A;  1IBL E;  1XNR E;  4B3S E;  4DV3 E;  1OJ4 A;  1KTV A;  4JI8 I;  1KVK A;  4LF9 E;  5L3J A;  1N34 E;  2J7K A;  4DV1 E;  4X62 E;  2EFG A;  4NXM I;  2UXD I;  4DV4 I;  5IT9 C;  4LF8 I;  1BKN A;  1FWL A;  4WUB A;  4FW9 A;  2HKJ A;  3JAM Q;  1IBK I;  1N0V C;  4DPW A;  5FLX Q;  1N0U A;  4NXN I;  2UU9 E;  2HK3 A;  2Q2E B;  1XHK A;  1N32 I;  1ELO A;  1N36 I;  1ZM4 A;  4GKK E;  1FI4 A;  4JI2 I;  4DV5 I;  2UUB I;  4JI3 E;  1XNQ E;  4WUD A;  4OX9 I;  1B63 A;  3QT6 A;  2VQE E;  2V2Q A;  4B3M I;  1XMQ I;  4DV0 E;  2HFS A;  2BM1 A;  3CWV A;  2A2C A;  3ZKD A;  4YY3 I;  3ZZ0 A;  4JI5 I;  5A2Q Q;  4DR5 E;  3V5R A;  2UUA I;  5BR8 I;  1J5E I;  4JI8 E;  4B3R I;  1FWK A;  1K47 A;  3B82 A;  4JI0 I;  3ZKB A;  4LFA E;  4NXM E;  2R3V A;  2UXD E;  4DV4 E;  1NHH A;  1MU5 A;  4DPT A;  1HNX I;  4DUZ I;  4LF8 E;  2X7I A;  2LJP A;  4X65 I;  4YHH I;  4NXN E;  1HNW I;  1ZM2 A;  4LFC I;  4LF5 I;  1EA6 A;  4LF4 I;  1IBM E;  1HNZ I;  4R1F A;  4JYA I;  3OTO I;  3PYF A;  3K1J A;  1N32 E;  2WW4 A;  1N36 E;  3ZZU A;  3J80 C;  1PVG A;  2R42 A;  4PRX A;  4DV5 E;  2UUB E;  4RPF A;  4OX9 E;  4DV7 E;  3Q1Q A;  1Z5A A;  4B3M E;  1Z0E A;  1XMQ E;  2ZM6 I;  4USM A;  5LMU I;  4YY3 E;  1XMO E;  4HAC A;  1EI1 A;  4JI5 E;  4DR7 I;  4P52 A;  4JI7 I;  1PIE A;  4DR1 I;  3T1Y I;  3HUL A;  2UUA E;  1FNM A;  1HR0 I;  5BR8 E;  1J5E E;  4GKJ I;  1NHJ A;  4I3H A;  2UXC I;  2E1R A;  2OI2 A;  1FKA E;  1HNX E;  4DUZ E;  4FWG A;  3J81 C;  3D4J A;  4X65 E;  4DV2 I;  4YHH E;  4LF6 I;  4KHP I;  3F0N A;  1HNW E;  3T1H I;  4K0K I;  1Z5B A;  1Z0C A;  4HXZ A;  4LF4 E;  5IWA I;  2F4V E;  3JAM C;  1HNZ E;  5FLX C;  4JYA E;  3OTO E;  3B78 A;  1RR9 A;  5GME A;  4LF7 I;  4FWH A;  4ED4 A;  2HHH I;  2VQF I;  1Z0B A;  4DU7 A;  4JI4 I;  4P7A A;  5LMN I;  2GS8 A;  1Z0T A;  1H7U A;  1I94 I;  4B3T I;  3QT7 A;  4DU8 A;  1ZM3 A;  4ZVI A;  2ZM6 E;  4DR4 I;  1XNR I;  4B3S I;  2ZBK B;  2DEI A;  3LPS A;  4Z7Y A;  5LMU E;  4DR2 I;  4PRV A;  4DR7 E;  3PYD A;  3QT8 A;  4JI7 E;  4DR1 E;  4KQV A;  3QT5 A;  4LF9 I;  3GON A;  2UUC I;  3T1Y E;  1ZM9 A;  1HR0 E;  1VIS A;  4GKJ E;  1H7S A;  3K17 A;  1IBK E;  5A2Q C;  2UXC E;  3V2U C;  2AJ4 A;  3B8H A;  1Z0V A;  2UXB I;  4WUC A;  4URL A;  3M6A A;  5GMD A;  4UT4 A;  4DV2 E;  4LF6 E;  4KHP E;  1FJG I;  2V8P A;  4PU9 A;  4FWD A;  4K0K E;  4JI2 E;  4USK A;  1KKH A;  4XTJ A;  1H73 A;  5IWA E;  4MYT A;  2XEX A;  4LF7 E; 
#chains in the Genus database with same CATH topology
 2NAB A;  2HHH E;  2VQF E;  5C0X D;  4JI4 E;  2JWO A;  2EM2 A;  1L4S A;  5DNX A;  1D6T A;  5LMN E;  5IT9 Q;  5LL6 R;  1QU6 A;  4IFD E;  4ZYG A;  2CTD A;  4WSG A;  4KZS A;  1I94 E;  4R2P A;  2ODR C;  4B3T E;  2I9I A;  1Z59 A;  3C6K A;  1BBO A;  2LUP B;  4WX9 A;  2A25 A;  2EL4 A;  2GQ0 A;  1YZ9 A;  1WUU A;  3HKM A;  1X48 A;  4WXD A;  2WP8 A;  3ZM7 A;  4DXL A;  1Z0W A;  2I13 A;  5ADZ A;  4DR4 E;  2L2K B;  3WU5 A;  1STU A;  2O1T A;  4B3R E;  4X64 I;  2EQ1 A;  3VK6 A;  4DR2 E;  1RRE A;  3WU4 A;  2B7T A;  2PRT A;  1KYQ A;  2YZT A;  4JI0 E;  1Y5Y A;  2NN6 B;  3P3C A;  3GCM A;  3J81 Q;  2EN6 A;  2B7V A;  1NHI A;  2V2V A;  2A2D A;  2EOR A;  3J7A G;  2PO1 A;  3PYG A;  4JV5 I;  4AQY I;  2NUG A;  3MHH C;  3M85 D;  2UUC E;  1RMD A;  2M7Q A;  2EML A;  4LFB I;  1T4O A;  2AE8 A;  1YHC A;  2NN6 F;  4JI6 I;  4DV6 I;  2GO4 A;  4IZJ D;  3ZZT A;  4LFA I;  1YFH A;  2HJJ A;  4MQY A;  2EMC A;  2EQ3 A;  4Z7C A;  3IWD A;  2V34 A;  4JG4 A;  3CDJ A;  4MYU A;  2EWL A;  1DQ3 A;  1U2R A;  3BID A;  2RS6 A;  4LFC E;  2DEJ A;  4MU4 A;  3NZK A;  2DLQ A;  4WFT A;  4LF5 E;  4BA1 A;  4UTG A;  2UXB E;  1AH5 A;  2E5L I;  4R2Q A;  4DR3 I;  1EH6 A;  1MG7 A;  1PDA A;  4L5N C;  2HK2 A;  2LBS B;  3LTO A;  2WNR B;  1IBM I;  2YTO A;  4AM3 A;  2B9D A;  4JI1 I;  1VI7 A;  1FJG E;  5CFF E;  4IZK B;  4LCG A;  2N3G A;  2EN8 A;  2EOM A;  1OYS A;  1SR9 A;  1H72 C;  4X9J A;  4OOG C;  1S16 A;  1UDQ A;  4M0V A;  4DUY I;  3H4L A;  1PKP A;  1X6F A;  2PNZ B;  1A1K A;  2YSO A;  4X66 I;  1N33 I;  2RQL A;  1UDO A;  4DR6 I;  4OKG A;  2ADR A;  2LJU A;  4LOM A;  2M4I A;  2NPF A;  2V2Z A;  2L6M A;  2O1W A;  1IBL I;  2LTS A;  5LLQ A;  4DV7 I;  2CVE A;  5ELW A;  5K36 C;  4OZE A;  4DV3 I;  3IWC A;  4HYM A;  4TUI A;  2YTG A;  4FW4 A;  5A6B A;  2YTE A;  2EL6 A;  2JE6 B;  2NN6 D;  2C38 A;  1ZXM A;  2X36 A;  1P47 A;  1S4E A;  4DPU A;  2BR2 B;  2BA1 D;  2YRK A;  2EOE A;  2Z5B A;  3K6Q A;  2EMI A;  2CSH A;  4R8O A;  1XMO I;  1N34 I;  1T39 A;  1TN9 A;  1UHZ A;  4HY1 A;  4DV1 I;  2FGG A;  3LNU A;  4X62 I;  4M1K A;  3HPZ A;  4EMD A;  1T38 A;  1A6F A;  1YYO A;  1E3P A;  2VRD A;  3VHT B;  4X64 E;  1WJP A;  2JEA B;  2KON A;  2EM4 A;  2BV3 A;  4R2A A;  3P3G A;  1QNT A;  1Y6Z A;  3H09 A;  2L92 A;  4IFD A;  2C39 A;  4OO1 E;  4BCA A;  3L7Z B;  4FK5 C;  4RH8 A;  1QZR A;  5C0X A;  2O1U A;  4JV5 E;  1DAR A;  4LU9 A;  5A6K A;  2BBG A;  4AQY E;  1Z5C A;  2UU9 I;  2JOB A;  1KIJ A;  4LFB E;  3U1K A;  3BBG A;  4QNK A;  1SFE A;  3C4B A;  4JI6 E;  4DV6 E;  1NZ0 A;  3P3E A;  2RSI A;  4DPY A;  3J80 Q;  3DF6 A;  2JPA A;  2ZIT A;  3VYY A;  1X49 A;  3WU3 A;  2RTX A;  3M99 B;  4MLQ A;  3ADI A;  1PJQ A;  2ODR D;  3FIG A;  2EPU A;  2V8Q B;  1A1H A;  2HKE A;  2LMZ A;  3WU6 A;  2KHX A;  3T1H E;  4ZYH A;  1B62 A;  2K7I A;  2L8T A;  1UEK A;  4NHR A;  4U3D A;  3ADJ A;  2DRP A;  5JEA E;  2KOU A;  3HQ1 A;  2E5L E;  1N3G A;  5A6J A;  4GKK I;  1X6H A;  4DR3 E;  3J7A M;  2DSY A;  2EOJ A;  3EPJ A;  2YTP A;  5K36 B;  5DRP A;  1Z0G A;  2LUQ A;  3QG5 C;  1MX0 A;  2VF3 A;  4JI1 E;  4JI3 I;  2H36 X;  1XNQ I;  1GQE A;  2F4V I;  1ZU1 A;  1NEI A;  1H74 A;  2YTJ A;  5K36 F;  2RSM A;  4O24 A;  2HFU A;  2Z5E A;  2ENA A;  4IS1 C;  4J8Z A;  2VQE I;  4R2S A;  4P78 A;  2IOP A;  1OYP A;  2EMX A;  2YPN A;  4FN5 A;  4HAC B;  5C0X E;  4DV0 I;  4BA2 A;  4DUY E;  2CG9 A;  5DRQ A;  2HGH A;  3PYE A;  2GHF A;  1ZXN A;  2DMI A;  2BA0 D;  2EMB A;  4X66 E;  2CT1 A;  4DR6 E;  1N33 E;  2WP8 B;  5EL9 A;  1USU A;  4DPX A;  1YUJ A;  2R76 A;  2EMK A;  2CZ9 A;  4DR5 I;  5KL3 A;  1IBL E;  2BM0 A;  1XNR E;  4B3S E;  3M7N G;  2GO3 A;  4DV3 E;  2DB2 A;  1OJ4 A;  1KTV A;  4F6M A;  2EPP A;  1BB8 A;  2EM3 A;  2F1D A;  2DGC A;  4JI8 I;  4O5G A;  3H1C A;  3THN A;  4BBY A;  3PRY A;  2J7J A;  1KVK A;  4LF9 E;  2LE2 A;  1N34 E;  2JEB A;  2J7K A;  5L3J A;  3CDI A;  2V88 A;  4DV1 E;  2EM9 A;  4HTG A;  4X62 E;  4Q28 A;  2PO2 A;  2VES A;  2YTQ A;  2EFG A;  4NXM I;  4F54 A;  2UXD I;  4DV4 I;  2LRS A;  5IT9 C;  2EM0 A;  4FW5 A;  4LF8 I;  1LLM C;  1BKN A;  1FWL A;  2MDR A;  1XXE A;  3BGH A;  4BHC A;  2PO0 B;  4WUB A;  2L2N A;  4FW9 A;  2HKJ A;  3JAM Q;  1IBK I;  2B3T B;  1N0V C;  2EPA A;  4DPW A;  3KWR A;  5FLX Q;  2ELY A;  2HC5 A;  3C4T A;  2YU5 A;  1N0U A;  2MKD A;  4NXN I;  2UU9 E;  2RPC A;  3K85 A;  5KL4 A;  5K36 D;  2HK3 A;  2EOH A;  5DRR A;  4IFD C;  3HTX A;  4FW3 A;  2YRH A;  3M85 G;  1F2I G;  2C37 A;  4BHB A;  4NBQ A;  2LCE A;  1E3H A;  2Q2E B;  1XHK A;  4WPY A;  1A1J A;  2MKN A;  1R6L A;  2EN1 A;  2Z5C A;  3F6G A;  1N32 I;  2EM7 A;  4OO1 A;  1ELO A;  1Y60 A;  1J26 A;  1N36 I;  4GKK E;  1ZM4 A;  1FI4 A;  5FWK A;  4JI2 I;  3ADL A;  2EMA A;  5AE3 A;  2EM8 A;  2CPN A;  2M1S A;  4DV5 I;  2UUB I;  2IER A;  4JI3 E;  1XNQ E;  1RQ0 A;  4WUD A;  2DLK A;  4OX9 I;  1B63 A;  3QT6 A;  4ZYE A;  5AE2 A;  4F9B B;  4QNJ A;  3P06 A;  4R03 A;  2WNR A;  3HPS A;  2VQE E;  2EMW A;  2ENH A;  2V87 A;  2V2Q A;  1YPN A;  2IHR 1;  1A1L A;  4B3M I;  2C38 B;  2YTF A;  4F9A B;  1XMQ I;  1WXR A;  4DV0 E;  5JEA A;  2EPZ A;  3THO B;  3EQ1 A;  2HFS A;  2BM1 A;  3ZOQ B;  3CWV A;  4P7D A;  2A2C A;  2NN6 E;  3ZKD A;  5AE1 A;  4YY3 I;  4BC7 A;  2IES A;  3ZZ0 A;  3RMP A;  4JI5 I;  4DKK A;  2JP9 A;  5A2Q Q;  4DR5 E;  2EPN A;  2EZ6 A;  2DIX A;  4M30 A;  5A69 A;  4R2R A;  1UBD C;  2YRM A;  3KRN A;  3V5R A;  2MC6 A;  1ZAA C;  2UUA I;  2MDG A;  4BS9 A;  5T6J A;  2EPC A;  1AAY A;  2C39 B;  2JT2 A;  4JI8 E;  5BR8 I;  1J5E I;  4IFD B;  4B3R I;  2EOX A;  1X3C A;  1IQS A;  4MLV A;  1FWK A;  1K47 A;  3B82 A;  2E72 A;  2BA1 G;  4O4K A;  4ZYD A;  2EE8 A;  2JVA A;  1Y4S A;  4JI0 I;  3ZKB A;  4IFD F;  4LFA E;  2BB8 A;  4NXM E;  2R3V A;  2UXD E;  4DV4 E;  3JTZ A;  1NHH A;  1MU5 A;  4DPT A;  4GZN C;  3PS2 A;  1HNX I;  2JOX A;  3GLL A;  4DUZ I;  4GEQ B;  4LF8 E;  5TSE A;  2X7I A;  1YUI A;  2LJP A;  2NUF A;  3UK3 C;  4X65 I;  4YHH I;  3PS1 A;  2LO3 A;  2F8B A;  4NXN E;  1HNW I;  3P76 A;  1ZM2 A;  2EM6 A;  4LFC I;  5KL7 A;  1UN6 B;  4LF5 I;  1EA6 A;  5A6A A;  2EPL X;  2LTR A;  1IBM E;  4LF4 I;  1EH7 A;  4BC9 A;  5KL2 A;  1HNZ I;  4R1F A;  4JYA I;  4IZJ A;  2O3Z A;  4FW6 A;  4MU3 A;  3OTO I;  2LVH A;  3PYF A;  3K1J A;  5A6B D;  2IOQ A;  2YU8 A;  1N32 E;  2WW4 A;  3Q6N A;  4ISA A;  4MU0 A;  2V86 A;  1N36 E;  3ZZU A;  4BA2 B;  2LJH A;  3J80 C;  1UIL A;  4TUG A;  1ZBQ A;  4LCH A;  1PVG A;  2M9A A;  2D9H A;  3JU0 A;  4DV5 E;  2UUB E;  2R42 A;  4MU1 A;  4PRX A;  1MEY C;  4RPF A;  3ECR A;  4OO1 C;  4R2E A;  4F2J C;  2L2M A;  4LPF A;  3HXL A;  4OX9 E;  2K4V A;  3GME A;  3VYX A;  2ELZ A;  5K36 A;  3ADG A;  1YYW A;  4O43 A;  1X47 A;  2EMF A;  4DV7 E;  3Q1Q A;  2EMH A;  2WBU A;  1UDS A;  1G2F C;  1Z5A A;  4IS9 A;  5AAS A;  4B3M E;  1Z0E A;  4IFD D;  1XMQ E;  2ZM6 I;  1WHN A;  2N8X A;  1EH8 A;  1EKZ A;  4USM A;  2G7H A;  3J7Y p;  1JK1 A;  4Q35 B;  2PO1 B;  2JEB B;  2WCC 3;  2NA2 A;  5LMU I;  1R6M A;  4YY3 E;  5IXM B;  1XMO E;  2EPK X;  2LV2 A;  4JI5 E;  2YWQ A;  1EI1 A;  2BA0 G;  2PO2 B;  1BBG A;  4IJD A;  4HAC A;  4P52 A;  5JEA C;  4JI7 I;  1UDN A;  3EPH A;  1PIE A;  4DR1 I;  2CGE A;  4RHB B;  2EOF A;  3T1Y I;  4HEI A;  2UUA E;  3HUL A;  1FNM A;  1HR0 I;  5DRO A;  5BR8 E;  1J5E E;  4J3D A;  3F6H A;  4GKJ I;  4MDT A;  2V83 A;  4F9C B;  5KL5 A;  1NHJ A;  4BA1 B;  1IQO A;  1RC7 A;  4I3H A;  3IWB A;  1A1I A;  2N3H A;  2UXC I;  3P1X A;  2ENC A;  2NN6 A;  2E1R A;  4U3B A;  3EPK A;  2EN7 A;  4LTY A;  1FKA E;  1YSA C;  2OI2 A;  5KL6 A;  2EOY A;  2C37 B;  1DGC A;  5C0X C;  2EOO A;  1HNX E;  4DUZ E;  3UHM A;  5K36 E;  2JXP A;  4FWG A;  2PNM A;  3J81 C;  1A1F A;  3D4J A;  4X65 E;  5AC4 A;  2YT4 A;  2EOQ A;  4WYQ B;  4YHH E;  1YH8 A;  2Z5C B;  4DV2 I;  4LF6 I;  4KHP I;  4OO1 B;  2EJ4 A;  3F0N A;  1HNW E;  1JK2 A;  1WHQ A;  2EPO A;  3T1H I;  2WZO A;  2YTI A;  3AV0 A;  1Z0C A;  1Z5B A;  3MHS C;  2PO0 A;  4K0K I;  3TQM A;  2EPM X;  4HXZ A;  1HK7 A;  1NCS A;  1GZ6 A;  2WBT A;  2L3C A;  4LF4 E;  5F3W A;  1GTK A;  4OO1 F;  2L3J A;  4M2Z A;  4KWY A;  4DMI A;  1YYK A;  2F4V E;  5IWA I;  3JAM C;  1HNZ E;  1KJK A;  1MGT A;  5FLX C;  4JYA E;  2JYA A;  3LLH A;  3OTO E;  5IV8 B;  3B78 A;  3OML A;  2EOZ A;  3KZZ A;  1RR9 A;  5GME A;  4LF7 I;  2YTD A;  4FWH A;  4IZK A;  2L33 A;  2WBS A;  1PJT A;  2EP3 A;  4ED4 A;  1Z0B A;  5JEA B;  4DU7 A;  2VQF I;  2HHH I;  4JI4 I;  3DD6 A;  1TF3 A;  4P7A A;  5LMN I;  2GS8 A;  1Z0T A;  2MC5 A;  2Z5B B;  2V89 A;  1H7U A;  2EMZ A;  2FTX B;  2YSP A;  4M9V C;  3B4T A;  1G2D C;  2NUE A;  5JEA F;  1I94 I;  2EQ0 A;  3KZY A;  3QT7 A;  4DU8 A;  2EPR A;  2GPI A;  4B3T I;  3PS3 A;  1B69 A;  2R1F A;  2PNZ A;  3HJC A;  4WSP A;  5DNL A;  3C6M A;  1ZM3 A;  2J65 A;  4DR7 I;  1PJS A;  4ZVI A;  2ZM6 E;  4GQU A;  4DR4 I;  1XNR I;  4B3S I;  4BMJ A;  2ZBK B;  1WRJ A;  5C0X B;  5EKW A;  2DEI A;  3LPS A;  4Z7Y A;  2EM5 A;  4WXC A;  4N3O A;  3DJW A;  4NZV A;  5LMU E;  4DR2 I;  4PRV A;  2VE7 C;  1T4N A;  2JE6 A;  4DR7 E;  2LT7 A;  2JY9 A;  3PYD A;  2V85 A;  3QT8 A;  2DMY A;  2E1M A;  2EN3 A;  4JI7 E;  2BR2 A;  4DR1 E;  2GLI A;  4FW7 A;  4KQV A;  1T4L B;  5C0X F;  3QT5 A;  4LF9 I;  1ZBT A;  3GON A;  3LML A;  5DNY A;  2UUC I;  2YTN A;  3T1Y E;  1ZM9 A;  2VF1 A;  2RS7 A;  4L8N A;  1HR0 E;  1VIS A;  2O1V A;  4I8O A;  4GKJ E;  1H7S A;  3MSW A;  2EOI A;  3K17 A;  3BF2 A;  4OO1 D;  2EN4 A;  1IBK E;  4LCF A;  2JEA A;  5AC5 A;  5A2Q C;  2UXC E;  3V2U C;  1A1G A;  1DI2 A;  2AJ4 A;  3L7Z A;  1USV A;  1Y4U A;  3B8H A;  1Z0V A;  1O0W A;  1X5W A;  3U1Y A;  2UXB I;  4WUC A;  4URL A;  3M6A A;  2EMY A;  5GMD A;  2NN6 C;  1ZR9 A;  1X6E A;  4IZJ B;  2EMG A;  4DV2 E;  4LF6 E;  4KHP E;  2Q8U A;  1P42 A;  1RHY A;  4UT4 A;  4N4R B;  2EL5 A;  1FJG I;  4AID A;  1TF6 A;  5JEA D;  2V8P A;  4PU9 A;  4FWD A;  4K0K E;  4JI2 E;  2JR1 A;  4USK A;  3AUZ A;  1KKH A;  1IMU A;  3Q6M A;  2EOS A;  2FV4 B;  4R2D A;  1Z1B A;  4XTJ A;  4F6N A;  1H73 A;  3EPL A;  5IWA E;  2EN2 A;  3L00 A;  4MYT A;  2XEX A;  4R2C A;  1OYR A;  2EPX A;  2PNL A;  4AIM A;  4LF7 E;  3M7N D;  4X8W A; 
#chains in the Genus database with same CATH homology
 2HHH E;  2VQF E;  4JI4 E;  2JWO A;  1D6T A;  5LMN E;  5IT9 Q;  5LL6 R;  1QU6 A;  4KZS A;  1I94 E;  4B3T E;  2ODR C;  1Z59 A;  2LUP B;  4DXL A;  2GQ0 A;  1YZ9 A;  1WUU A;  1X48 A;  3ZM7 A;  1Z0W A;  5ADZ A;  4DR4 E;  2L2K B;  3WU5 A;  1STU A;  2O1T A;  4B3R E;  4X64 I;  3VK6 A;  4DR2 E;  1RRE A;  3WU4 A;  2B7T A;  2YZT A;  4JI0 E;  3J81 Q;  1NHI A;  2B7V A;  2V2V A;  2A2D A;  3J7A G;  4JV5 I;  3PYG A;  4AQY I;  2NUG A;  2UUC E;  2M7Q A;  4LFB I;  1T4O A;  4LFA I;  4JI6 I;  4DV6 I;  4IZJ D;  3ZZT A;  4Z7C A;  3IWD A;  2V34 A;  4JG4 A;  4MYU A;  2EWL A;  1DQ3 A;  1U2R A;  2RS6 A;  4LFC E;  2DEJ A;  4LF5 E;  4WFT A;  4UTG A;  2UXB E;  2E5L I;  4DR3 I;  1MG7 A;  4L5N C;  2HK2 A;  2LBS B;  3LTO A;  1IBM I;  2B9D A;  4JI1 I;  1FJG E;  5CFF E;  4IZK B;  2N3G A;  1SR9 A;  1H72 C;  4OOG C;  1S16 A;  4M0V A;  4DUY I;  3H4L A;  1PKP A;  1N33 I;  4X66 I;  4DR6 I;  2M4I A;  2NPF A;  2V2Z A;  2L6M A;  2O1W A;  1IBL I;  2LTS A;  4DV7 I;  4DV3 I;  3IWC A;  4HYM A;  4TUI A;  1ZXM A;  2X36 A;  1S4E A;  4DPU A;  2Z5B A;  3K6Q A;  1XMO I;  4R8O A;  1N34 I;  4HY1 A;  1UHZ A;  4DV1 I;  2FGG A;  3LNU A;  4X62 I;  4M1K A;  3HPZ A;  4EMD A;  1A6F A;  1YYO A;  4X64 E;  2KON A;  2BV3 A;  1Y6Z A;  3H09 A;  2L92 A;  4BCA A;  1QZR A;  2O1U A;  4JV5 E;  1DAR A;  4LU9 A;  4AQY E;  1Z5C A;  2UU9 I;  2JOB A;  1KIJ A;  4LFB E;  3C4B A;  4JI6 E;  4DV6 E;  1NZ0 A;  3J80 Q;  4DPY A;  3DF6 A;  2ZIT A;  3VYY A;  1X49 A;  3WU3 A;  2RTX A;  3ADI A;  2ODR D;  3FIG A;  2V8Q B;  2HKE A;  2LMZ A;  3WU6 A;  2KHX A;  3T1H E;  1B62 A;  2L8T A;  1UEK A;  3ADJ A;  2KOU A;  3HQ1 A;  2E5L E;  4GKK I;  4DR3 E;  3J7A M;  2DSY A;  1Z0G A;  2LUQ A;  1MX0 A;  2VF3 A;  4JI1 E;  4JI3 I;  2H36 X;  1XNQ I;  1GQE A;  2F4V I;  1H74 A;  2RSM A;  2HFU A;  2Z5E A;  4J8Z A;  2VQE I;  4P78 A;  2IOP A;  4FN5 A;  4HAC B;  4DV0 I;  4DUY E;  2CG9 A;  3PYE A;  1ZXN A;  1N33 E;  4X66 E;  4DR6 E;  1USU A;  4DPX A;  2CZ9 A;  4DR5 I;  1IBL E;  2BM0 A;  1XNR E;  4B3S E;  4DV3 E;  2DB2 A;  1OJ4 A;  1KTV A;  4JI8 I;  4BBY A;  3PRY A;  1KVK A;  4LF9 E;  2LE2 A;  1N34 E;  5L3J A;  2J7K A;  2V88 A;  4DV1 E;  4X62 E;  4Q28 A;  2EFG A;  4NXM I;  4F54 A;  2UXD I;  4DV4 I;  2LRS A;  5IT9 C;  4LF8 I;  1BKN A;  1FWL A;  2MDR A;  4WUB A;  2L2N A;  4FW9 A;  2HKJ A;  3JAM Q;  1IBK I;  2B3T B;  1N0V C;  4DPW A;  5FLX Q;  3KWR A;  1N0U A;  3C4T A;  4NXN I;  2UU9 E;  3K85 A;  2HK3 A;  3HTX A;  2Q2E B;  1XHK A;  4WPY A;  2Z5C A;  3F6G A;  1N32 I;  1ELO A;  1J26 A;  1N36 I;  4GKK E;  1ZM4 A;  1FI4 A;  5FWK A;  4JI2 I;  3ADL A;  5AE3 A;  2CPN A;  2M1S A;  4DV5 I;  2UUB I;  4JI3 E;  1XNQ E;  1RQ0 A;  4WUD A;  4OX9 I;  1B63 A;  3QT6 A;  5AE2 A;  4F9B B;  3P06 A;  4R03 A;  3HPS A;  2VQE E;  2V87 A;  2V2Q A;  2IHR 1;  4B3M I;  4F9A B;  1XMQ I;  1WXR A;  4DV0 E;  2HFS A;  2BM1 A;  3ZOQ B;  3CWV A;  4P7D A;  2A2C A;  3ZKD A;  5AE1 A;  4YY3 I;  4BC7 A;  3ZZ0 A;  4JI5 I;  3RMP A;  4DKK A;  5A2Q Q;  4DR5 E;  2EZ6 A;  2DIX A;  4M30 A;  3V5R A;  2MC6 A;  2UUA I;  4BS9 A;  5T6J A;  5BR8 I;  1J5E I;  4JI8 E;  4B3R I;  1FWK A;  1K47 A;  3B82 A;  1Y4S A;  4JI0 I;  2JVA A;  3ZKB A;  4LFA E;  4NXM E;  2R3V A;  2UXD E;  4DV4 E;  3JTZ A;  1NHH A;  1MU5 A;  4DPT A;  1HNX I;  2JOX A;  4DUZ I;  4GEQ B;  4LF8 E;  2X7I A;  2LJP A;  2NUF A;  4X65 I;  4YHH I;  2F8B A;  4NXN E;  1HNW I;  1ZM2 A;  4LFC I;  4LF5 I;  1EA6 A;  4LF4 I;  2LTR A;  1IBM E;  4BC9 A;  1HNZ I;  4R1F A;  4JYA I;  4IZJ A;  3OTO I;  3PYF A;  3K1J A;  2IOQ A;  1N32 E;  2WW4 A;  3Q6N A;  2V86 A;  1N36 E;  3ZZU A;  2LJH A;  3J80 C;  1UIL A;  4TUG A;  1ZBQ A;  1PVG A;  3JU0 A;  4DV5 E;  2UUB E;  2R42 A;  4PRX A;  4RPF A;  2L2M A;  3HXL A;  4OX9 E;  2K4V A;  3VYX A;  3ADG A;  1YYW A;  1X47 A;  4DV7 E;  3Q1Q A;  1Z5A A;  5AAS A;  4B3M E;  1Z0E A;  1XMQ E;  2ZM6 I;  1WHN A;  1EKZ A;  4USM A;  2G7H A;  3J7Y p;  5LMU I;  2NA2 A;  4YY3 E;  1XMO E;  3HJC A;  4JI5 E;  1EI1 A;  4HAC A;  4DR7 I;  4P52 A;  4JI7 I;  1PIE A;  4DR1 I;  2CGE A;  3T1Y I;  2UUA E;  3HUL A;  1FNM A;  1HR0 I;  5BR8 E;  1J5E E;  3F6H A;  4GKJ I;  2V83 A;  4F9C B;  1NHJ A;  1RC7 A;  4I3H A;  3IWB A;  2N3H A;  2UXC I;  3P1X A;  2E1R A;  4LTY A;  1FKA E;  2OI2 A;  1HNX E;  4DUZ E;  4FWG A;  2PNM A;  3J81 C;  3D4J A;  4X65 E;  4DV2 I;  2YT4 A;  4WYQ B;  4YHH E;  2Z5C B;  4LF6 I;  4KHP I;  3F0N A;  1HNW E;  1WHQ A;  3T1H I;  2WZO A;  3AV0 A;  1Z5B A;  1Z0C A;  4K0K I;  4HXZ A;  1HK7 A;  1GZ6 A;  2L3C A;  4LF4 E;  5F3W A;  2L3J A;  4M2Z A;  4DMI A;  2F4V E;  1YYK A;  5IWA I;  3JAM C;  1HNZ E;  5FLX C;  4JYA E;  3LLH A;  3OTO E;  3B78 A;  3OML A;  1RR9 A;  5GME A;  4LF7 I;  4FWH A;  4IZK A;  2L33 A;  4ED4 A;  2HHH I;  2VQF I;  1Z0B A;  4DU7 A;  4JI4 I;  4P7A A;  5LMN I;  2GS8 A;  1Z0T A;  2MC5 A;  2Z5B B;  2V89 A;  1H7U A;  2FTX B;  2NUE A;  1I94 I;  4B3T I;  3QT7 A;  4DU8 A;  4WSP A;  1ZM3 A;  4ZVI A;  2ZM6 E;  4DR4 I;  1XNR I;  4B3S I;  4BMJ A;  2ZBK B;  2DEI A;  3LPS A;  4Z7Y A;  4N3O A;  3DJW A;  5LMU E;  4DR2 I;  4PRV A;  2VE7 C;  1T4N A;  4DR7 E;  2JY9 A;  3PYD A;  2V85 A;  3QT8 A;  2DMY A;  2E1M A;  4JI7 E;  4DR1 E;  4KQV A;  1T4L B;  3QT5 A;  4LF9 I;  1ZBT A;  3GON A;  3LML A;  5DNY A;  2UUC I;  3T1Y E;  1ZM9 A;  2VF1 A;  2RS7 A;  4L8N A;  1HR0 E;  1VIS A;  2O1V A;  4I8O A;  4GKJ E;  1H7S A;  3MSW A;  3K17 A;  1IBK E;  5A2Q C;  2UXC E;  3V2U C;  1DI2 A;  2AJ4 A;  1USV A;  1Y4U A;  3B8H A;  1Z0V A;  1O0W A;  2UXB I;  4WUC A;  4URL A;  3M6A A;  5GMD A;  4UT4 A;  4IZJ B;  4DV2 E;  4LF6 E;  4KHP E;  1FJG I;  2V8P A;  4PU9 A;  4FWD A;  4K0K E;  4JI2 E;  2JR1 A;  4USK A;  3AUZ A;  1KKH A;  3Q6M A;  2FV4 B;  4XTJ A;  1H73 A;  5IWA E;  4MYT A;  2XEX A;  2PNL A;  4LF7 E;  4X8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...