1N32I

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n32I00
3ZZ0A 1HR0I 1H7SA 4DR5E 4DV0E 4JI5E 3CWVA 4DUYI 4LF9I 4JI6I 3QT5A 4B3RE 1N33E 4YHHE 1N34I 2UUCE 4FWHA 2VQEE 3V2UC 1XMQI 1MU5A 5LMUI 1HNXI 1EI1A 4PRVA 3J80Q 4JI4E 4DV7E 3QT8A 3PYDA 4JI0E 1HNWE 3ZKDA 4DPWA 1ZM9A 4LFCI 4JI8E 3JAMC 4DV2E 1DARA 1H72C 5A2QQ 4DU7A 1A6FA 4DV4I 4LF7E 4RPFA 3GONA 2BM1A 2VQFE 3WU5A 1QZRA 3ZZUA 4DR7E 1NHJA 4OX9E 4UT4A 1S16A 2HK3A 4LF6I 2E5LI 4ED4A 2UXDI 4DPXA 4JI7I 3B78A 2UXBE 4FN5A 1ZM4A 1I94I 1ZXMA 1Z0CA 1IBLI 1N36E 4B3SI 4LFBE 4GKJI 1RREA 3ZM7A 4JYAE 4LF5I 5GMDA 4Z7CA 3V5RA 3M6AA 2ZM6I 4DR5I 1H73A 4DV1I 4KHPE 1N0UA 4JV5E 2UU9E 3J7AM 4X66E 1IBMI 1N33I 2HFSA 4LF8E 2HK2A 4DV6E 2F4VE 1FNMA 2HHHE 4LFAE 5IWAE 4FW9A 5IT9C 4B3TE 4JI4I 1H7UA 2BV3A 4DPYA 4NXNI 4DPTA 4X62E 4JI0I 1HNWI 1XMOE 4HXZA 4JI8I 1XHKA 4WUBA 1VISA 4AQYE 1ELOA 1N32E 4X64E 2GS8A 4I3HA 1J5EE 3WU6A 4DR7I 4P7AA 4DR6I 4X65I 4DV5I 4DR3E 4DR4I 3T1YE 1XNRI 2HKEA 5GMEA 1Z0WA 1HNZE 5LMNE 1OJ4A 2UXCI 1KVKA 3T1HE 4B3ME 4DV3I 4R1FA 5FLXC 1Z0VA 1B62A 3J81C 2AJ4A 1XNQE 3WU3A 4M1KA 4DR2I 3OTOE 2J7KA 1MX0A 2BM0A 4PRXA 4LF9E 4ZVIA 1ZM3A 4K0KE 1BKNA 2DEJA 1N34E 1B63A 4KHPI 1S4EA 3K17A 4LF4I 4JV5I 2UUBI 4X66I 2HFUA 4JG4A 5LMUE 1Z0EA 1NZ0A 1PVGA 2ZITA 4LFAI 4YY3E 1EA6A 4LFCE 2CZ9A 4B3TI 5BR8E 3J7AG 2Q2EB 3F0NA 4X62I 5LL6R 2UUAI 4NXME 2NPFA 1IBKE 4HACB 3HULA 4DV0I 4JI5I 4AQYI 1FKAE 1FJGE 3JAMQ 4B3RI 1N0VC 4DR1E 2V8PA 4YHHI 2UUCI 2VQEI 3J80C 4WUDA 1FI4A 1J5EI 1NHIA 4DU8A 4FWGA 4JI3E 3H4LA 2E5LE 4MYUA 4URLA 2HKJA 2LJPA 4HY1A 4JI7E 5A2QC 4DV7I 1MG7A 1Z5CA 1ZXNA 3D4JA 3B8HA 2A2CA 4EMDA 4DV2I 2V2ZA 2DEIA 4HYMA 3B82A 3PYEA 1IBLE 4B3MI 4B3SE 3WU4A 1KKHA 4LF7I 2VQFI 2E1RA 1XNQI 3OTOI 4OX9I 5L3JA 2ZM6E 4DUZE 2EFGA 3PYFA 4DV1E 4K0KI 1IBME 2V2QA 4DPUA 4GKKE 2UXBI 2R42A 1K47A 1PIEA 4JI1E 4JI2E 2OI2A 2R3VA 4NXNE 1N36I 4YY3I 2V34A 1UEKA 1HR0E 4LFBI 1Z59A 4KQVA 5BR8I 5IT9Q 4DUYE 4JYAI 1U2RA 4HACA 4NXMI 4WUCA 4JI6E 1IBKI 2WW4A 4USKA 1XMQE 1WUUA 1FJGI 4FWDA 3QT6A 2ZBKB 4XTJA 2UU9I 3LNUA 4DR1I 1HNXE 4LF8I 2X36A 4DR6E 3LPSA 4DV6I 2F4VI 4X65E 2HHHI 4DV5E 1Z5AA 5IWAI 4DR4E 4JI3I 2X7IA 1XNRE 2A2DA 3Q1QA 2UXCE 2V2VA 3LTOA 1Z5BA 1XMOI 1FWKA 2XEXA 4DV3E 4P52A 4DV4E 1KIJA 1ZM2A 3K1JA 1NHHA 1N32I 4UTGA 4DR2E 4X64I 5FLXQ 1FWLA 1Z0GA 4Z7YA 4PU9A 4LF6E 3J81Q 1RR9A 2VF3A 2UXDE 4DUZI 4DR3I 3PYGA 3T1YI 4LF4E 2UUBE 1D6TA 3ZKBA 4DXLA 1HNZI 5LMNI 1I94E 4GKKI 4JI1I 3T1HI 4MYTA 3ZZTA 1Z0TA 1PKPA 4JI2I 1Z0BA 4GKJE 4USMA 1H74A 4LF5E 3QT7A 2UUAE 1KTVA
chains in the Genus database with same CATH superfamily
3ZZ0A 1HR0I 1H7SA 4DR5E 4DV0E 4JI5E 3CWVA 1Y60A 4DUYI 4LCGA 4LCFA 4LF9I 4LPFA 4JI6I 3QT5A 4B3RE 3PS1A 1N33E 4YHHE 1N34I 2UUCE 4QNJA 4IFDC 4FWHA 2VQEE 3V2UC 1XMQI 2IOPA 1MU5A 5LMUI 3L7ZA 1HNXI 1EI1A 4FW7A 5K36D 4PRVA 3J80Q 5EL9A 4JI4E 3PRYA 4DV7E 3QT8A 2WNRA 3PYDA 5JEAB 4JI0E 1HNWE 3ZKDA 4FW4A 4DPWA 3M7ND 1ZM9A 4LFCI 4JI8E 4IZKA 3JAMC 1R6LA 4DV2E 1DARA 3DD6A 1H72C 5A2QQ 4DU7A 2O3ZA 1A6FA 3M7NG 4DV4I 1R6MA 4LF7E 4RPFA 3GONA 2BM1A 2VQFE 5K36C 2NN6D 3CDJA 3WU5A 2C38A 2Z5BB 1QZRA 3ZZUA 4DR7E 1NHJA 4OX9E 3H1CA 4UT4A 1S16A 2HK3A 5DRPA 4AIDA 1RHYA 2JEBA 3GCMA 4LF6I 4LCHA 4ISAA 2E5LI 2NN6B 4ED4A 2JE6B 4MQYA 2UXDI 4DPXA 4JI7I 1UDOA 2Z5CA 3B78A 2UXBE 2NN6C 1OYRA 4FN5A 3GMEA 1ZM4A 1I94I 1ZXMA 2C37B 1UDSA 4J3DA 5DRRA 1Z0CA 1IBLI 1N36E 5JEAE 4B3SI 4LFBE 4GKJI 1RREA 3ZM7A 4IZJB 2JEAB 4JYAE 4LF5I 5GMDA 4Z7CA 3V5RA 2O1WA 3M6AA 2ZM6I 4DR5I 1Y6ZA 1H73A 2O1UA 4DV1I 4NBQA 4MDTA 4U3DA 1N0UA 4KHPE 4JV5E 2UU9E 3J7AM 4X66E 1IBMI 1N33I 2HFSA 4LF8E 2HK2A 4DV6E 2F4VE 1FNMA 2HHHE 4LFAE 5IWAE 4FW9A 3PS2A 5IT9C 3Q6MA 5JEAF 2PO2A 4B3TE 4JI4I 1H7UA 2BV3A 4DPYA 4NXNI 5JEAA 4DPTA 4X62E 4JI0I 1HNWI 1XMOE 4IFDB 2Z5EA 4HXZA 1USUA 4JI8I 4BA1B 1XHKA 4WUBA 5C0XE 1VISA 4AQYE 1ELOA 1N32E 4X64E 2GS8A 1UDQA 4I3HA 2Z5BA 4QNKA 1J5EE 3WU6A 4DR7I 3U1KA 4P7AA 4DR6I 2CGEA 4X65I 2O1TA 3P3CA 2WP8B 1P42A 4DV5I 4OO1D 1Y4UA 4DR3E 4DR4I 2JE6A 3T1YE 1XNRI 2HKEA 5GMEA 1Z0WA 4U3BA 1HNZE 5LMNE 1OJ4A 2UXCI 5K36B 3M85G 3P3EA 2PNLA 1KVKA 1XXEA 4OO1B 3T1HE 5C0XF 4B3ME 2O1VA 4DV3I 4R1FA 5FLXC 5C0XA 4MU0A 2AE8A 1Z0VA 1B62A 3J81C 2AJ4A 1XNQE 3WU3A 4M1KA 4DR2I 3OTOE 4OO1C 2J7KA 4IZJA 4IFDE 1MX0A 2BM0A 2C39A 4IS9A 4PRXA 2PNMA 4LF9E 4ZVIA 3HJCA 1ZM3A 4K0KE 1BKNA 3UHMA 3PS3A 2DEJA 1N34E 1B63A 4KHPI 1S4EA 3K17A 4LF4I 2PO1B 2UUBI 4JV5I 5FWKA 4X66I 2HFUA 4JG4A 5LMUE 1Z0EA 1NZ0A 2GQ0A 3L7ZB 1PVGA 2ZITA 4LFAI 4YY3E 1EA6A 4LFCE 2CZ9A 4B3TI 5BR8E 3J7AG 3Q6NA 2IESA 2Q2EB 3F0NA 4IFDF 5EKWA 4X62I 5K36E 5LL6R 2UUAI 3P3GA 4NXME 2NPFA 4IFDA 1IBKE 4HACB 3HULA 4DV0I 4BA1A 4JI5I 4AQYI 1FKAE 1FJGE 3JAMQ 4B3RI 1N0VC 4DR1E 2V8PA 3U1YA 4YHHI 2UUCI 2VQEI 3J80C 4WUDA 3P06A 1FI4A 1J5EI 1NHIA 4MU3A 4DU8A 2JEBB 4FWGA 4FW5A 4JI3E 3H4LA 3GLLA 4BA2B 2E5LE 2NN6E 4MYUA 4URLA 2WP8A 2HKJA 2IOQA 2LJPA 4HY1A 4N3OA 4JI7E 5A2QC 4DV7I 3KRNA 1MG7A 2PNZB 1Z5CA 1ZXNA 5K36F 3D4JA 1OYSA 2JT2A 2J65A 3B8HA 5K36A 2A2CA 4EMDA 5DNXA 4DV2I 2V2ZA 2DEIA 5DNLA 4HYMA 3B82A 3PYEA 4GQUA 1IBLE 4B3MI 4B3SE 1YH8A 3WU4A 1KKHA 4LF7I 1USVA 5ELWA 2VQFI 2E1RA 1XNQI 2GO4A 3OTOI 4OX9I 5L3JA 2ZM6E 3M85D 2NN6F 4DUZE 2EFGA 3PYFA 4DV1E 2BA1D 2NN6A 4K0KI 1IBME 2V2QA 4FW3A 4LOMA 2BR2B 4DPUA 2CG9A 5JEAD 2PO1A 4GKKE 1Y5YA 2UXBI 2R42A 2BA1G 1K47A 1PIEA 4JI1E 4FW6A 4MU1A 2C37A 4JI2E 1Y4SA 2OI2A 2PO0B 2R3VA 2PO2B 4NXNE 1N36I 1E3HA 4YY3I 2V34A 1UEKA 4AIMA 1HR0E 4LFBI 1Z59A 2JEAA 1VI7A 4KQVA 5BR8I 5IT9Q 4DUYE 4JYAI 1U2RA 4HACA 4OZEA 4NXMI 4WUCA 4JI6E 1IBKI 1OYPA 2WW4A 5JEAC 3P76A 3HKMA 4USKA 1XMQE 1WUUA 2IERA 1FJGI 4FWDA 3QT6A 2GO3A 2ZBKB 4XTJA 2UU9I 3LNUA 4DR1I 5DRQA 1HNXE 3B4TA 2X36A 4LF8I 4DR6E 3LPSA 4DV6I 1HK7A 2F4VI 4X65E 2HHHI 4DV5E 1Z5AA 4OKGA 5IWAI 4BA2A 4DR4E 4JI3I 4MU4A 2WNRB 2X7IA 1XNRE 5C0XD 5DROA 4AM3A 2A2DA 3Q1QA 2UXCE 2PNZA 2V2VA 3LTOA 4IZKB 1Z5BA 2BA0D 1YHCA 4OO1E 1XMOI 1FWKA 2XEXA 4IZJD 4DV3E 4P52A 4DV4E 1KIJA 5C0XB 1ZM2A 3K1JA 1NHHA 1N32I 4UTGA 4DR2E 2C38B 2BA0G 4X64I 5FLXQ 1FWLA 1Z0GA 2F1DA 2C39B 4Z7YA 2VESA 4PU9A 5C0XC 4LF6E 3J81Q 1UDNA 1RR9A 2VF3A 2UXDE 4DUZI 4DR3I 3PYGA 3NZKA 3T1YI 4LF4E 2UUBE 1D6TA 3ZKBA 4DXLA 2Z5CB 2BR2A 3CDIA 1HNZI 4OO1F 5LMNI 1I94E 4OO1A 4GKKI 3K85A 4IFDD 4JI1I 3T1HI 4MYTA 3ZZTA 1Z0TA 1PKPA 4JI2I 1Z0BA 2PO0A 4GKJE 4USMA 1E3PA 1H74A 4LF5E 2CVEA 3QT7A 2UUAE 1KTVA
chains in the Genus database with same CATH topology
3ZZ0A 1HR0I 1H7SA 4DR5E 4DV0E 4JI5E 3CWVA 4DUYI 4LF9I 4JI6I 3QT5A 4B3RE 1N33E 4YHHE 1N34I 2UUCE 4FWHA 2VQEE 3V2UC 1XMQI 2IOPA 1MU5A 5LMUI 1HNXI 1EI1A 4PRVA 3J80Q 4JI4E 3PRYA 4DV7E 3QT8A 3PYDA 4JI0E 1HNWE 3ZKDA 4DPWA 1ZM9A 4LFCI 4JI8E 4IZKA 3JAMC 4DV2E 1DARA 1H72C 5A2QQ 4DU7A 1A6FA 4DV4I 4LF7E 4RPFA 3GONA 2BM1A 2VQFE 3WU5A 2Z5BB 1QZRA 3ZZUA 4DR7E 1NHJA 4OX9E 4UT4A 1S16A 2HK3A 4LF6I 2E5LI 4ED4A 2UXDI 4DPXA 4JI7I 2Z5CA 3B78A 2UXBE 4FN5A 1ZM4A 1I94I 1ZXMA 1Z0CA 1IBLI 1N36E 4B3SI 4LFBE 4GKJI 1RREA 3ZM7A 4IZJB 4JYAE 4LF5I 5GMDA 4Z7CA 3V5RA 2O1WA 3M6AA 2ZM6I 4DR5I 1Y6ZA 1H73A 2O1UA 4DV1I 4KHPE 1N0UA 4JV5E 2UU9E 3J7AM 4X66E 1IBMI 1N33I 2HFSA 4LF8E 2HK2A 4DV6E 2F4VE 1FNMA 2HHHE 4LFAE 5IWAE 4FW9A 5IT9C 3Q6MA 4B3TE 4JI4I 1H7UA 2BV3A 4DPYA 4NXNI 4DPTA 4X62E 4JI0I 1HNWI 1XMOE 2Z5EA 4HXZA 1USUA 4JI8I 1XHKA 4WUBA 4AQYE 1VISA 1ELOA 1N32E 4X64E 2GS8A 4I3HA 2Z5BA 1J5EE 3WU6A 4DR7I 4P7AA 4DR6I 2CGEA 4X65I 2O1TA 4DV5I 1Y4UA 4DR3E 4DR4I 3T1YE 1XNRI 2HKEA 5GMEA 1Z0WA 1HNZE 5LMNE 1OJ4A 2UXCI 2PNLA 1KVKA 3T1HE 4B3ME 2O1VA 4DV3I 4R1FA 5FLXC 1Z0VA 1B62A 3J81C 2AJ4A 1XNQE 3WU3A 4M1KA 4DR2I 3OTOE 2J7KA 4IZJA 1MX0A 2BM0A 4PRXA 2PNMA 4LF9E 4ZVIA 3HJCA 1ZM3A 4K0KE 1BKNA 2DEJA 1N34E 1B63A 4KHPI 1S4EA 3K17A 4LF4I 4JV5I 2UUBI 5FWKA 4X66I 2HFUA 4JG4A 5LMUE 1Z0EA 1NZ0A 2GQ0A 1PVGA 2ZITA 4LFAI 4YY3E 1EA6A 4LFCE 2CZ9A 4B3TI 5BR8E 3J7AG 3Q6NA 2Q2EB 3F0NA 4X62I 5LL6R 2UUAI 4NXME 2NPFA 1IBKE 4HACB 3HULA 4DV0I 4JI5I 4AQYI 1FKAE 1FJGE 3JAMQ 4B3RI 1N0VC 4DR1E 2V8PA 4YHHI 2UUCI 2VQEI 3J80C 4WUDA 3P06A 1FI4A 1J5EI 1NHIA 4DU8A 4FWGA 4JI3E 3H4LA 2E5LE 4MYUA 4URLA 2HKJA 2IOQA 2LJPA 4HY1A 4N3OA 4JI7E 5A2QC 4DV7I 1MG7A 1Z5CA 1ZXNA 3D4JA 3B8HA 2A2CA 4EMDA 4DV2I 2V2ZA 2DEIA 4HYMA 3B82A 3PYEA 1IBLE 4B3MI 4B3SE 3WU4A 1KKHA 4LF7I 1USVA 2VQFI 2E1RA 1XNQI 3OTOI 4OX9I 5L3JA 2ZM6E 4DUZE 2EFGA 3PYFA 4DV1E 4K0KI 1IBME 2V2QA 4DPUA 2CG9A 4GKKE 2UXBI 2R42A 1K47A 1PIEA 4JI1E 4JI2E 1Y4SA 2OI2A 2R3VA 4NXNE 1N36I 4YY3I 2V34A 1UEKA 1HR0E 4LFBI 1Z59A 4KQVA 5BR8I 5IT9Q 4DUYE 4JYAI 1U2RA 4HACA 4NXMI 4WUCA 4JI6E 1IBKI 2WW4A 4USKA 1XMQE 1WUUA 1FJGI 4FWDA 3QT6A 2ZBKB 4XTJA 2UU9I 3LNUA 4DR1I 1HNXE 4LF8I 2X36A 4DR6E 3LPSA 4DV6I 1HK7A 2F4VI 4X65E 2HHHI 4DV5E 1Z5AA 5IWAI 4DR4E 4JI3I 2X7IA 1XNRE 2A2DA 3Q1QA 2UXCE 2V2VA 3LTOA 4IZKB 1Z5BA 1XMOI 1FWKA 2XEXA 4IZJD 4DV3E 4P52A 4DV4E 1KIJA 1ZM2A 3K1JA 1NHHA 1N32I 4UTGA 4DR2E 4X64I 5FLXQ 1FWLA 1Z0GA 4Z7YA 4PU9A 4LF6E 3J81Q 1RR9A 2VF3A 2UXDE 4DUZI 4DR3I 3PYGA 3T1YI 4LF4E 2UUBE 1D6TA 3ZKBA 4DXLA 2Z5CB 1HNZI 5LMNI 1I94E 4GKKI 3K85A 4JI1I 3T1HI 4MYTA 3ZZTA 1Z0TA 1PKPA 4JI2I 1Z0BA 4GKJE 4USMA 1H74A 4LF5E 3QT7A 2UUAE 1KTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZ0 A;  1HR0 I;  1H7S A;  4DR5 E;  4DV0 E;  4JI5 E;  3CWV A;  4DUY I;  4LF9 I;  4JI6 I;  3QT5 A;  4B3R E;  1N33 E;  4YHH E;  1N34 I;  2UUC E;  4FWH A;  2VQE E;  3V2U C;  1XMQ I;  1MU5 A;  5LMU I;  1HNX I;  1EI1 A;  4PRV A;  3J80 Q;  4JI4 E;  4DV7 E;  3QT8 A;  3PYD A;  4JI0 E;  1HNW E;  3ZKD A;  4DPW A;  1ZM9 A;  4LFC I;  4JI8 E;  3JAM C;  4DV2 E;  1DAR A;  1H72 C;  5A2Q Q;  4DU7 A;  1A6F A;  4DV4 I;  4LF7 E;  4RPF A;  3GON A;  2BM1 A;  2VQF E;  3WU5 A;  1QZR A;  3ZZU A;  4DR7 E;  1NHJ A;  4OX9 E;  4UT4 A;  1S16 A;  2HK3 A;  4LF6 I;  2E5L I;  4ED4 A;  2UXD I;  4DPX A;  4JI7 I;  3B78 A;  2UXB E;  4FN5 A;  1ZM4 A;  1I94 I;  1ZXM A;  1Z0C A;  1IBL I;  1N36 E;  4B3S I;  4LFB E;  4GKJ I;  1RRE A;  3ZM7 A;  4JYA E;  4LF5 I;  5GMD A;  4Z7C A;  3V5R A;  3M6A A;  2ZM6 I;  4DR5 I;  1H73 A;  4DV1 I;  4KHP E;  1N0U A;  4JV5 E;  2UU9 E;  3J7A M;  4X66 E;  1IBM I;  1N33 I;  2HFS A;  4LF8 E;  2HK2 A;  4DV6 E;  2F4V E;  1FNM A;  2HHH E;  4LFA E;  5IWA E;  4FW9 A;  5IT9 C;  4B3T E;  4JI4 I;  1H7U A;  2BV3 A;  4DPY A;  4NXN I;  4DPT A;  4X62 E;  4JI0 I;  1HNW I;  1XMO E;  4HXZ A;  4JI8 I;  1XHK A;  4WUB A;  1VIS A;  4AQY E;  1ELO A;  1N32 E;  4X64 E;  2GS8 A;  4I3H A;  1J5E E;  3WU6 A;  4DR7 I;  4P7A A;  4DR6 I;  4X65 I;  4DV5 I;  4DR3 E;  4DR4 I;  3T1Y E;  1XNR I;  2HKE A;  5GME A;  1Z0W A;  1HNZ E;  5LMN E;  1OJ4 A;  2UXC I;  1KVK A;  3T1H E;  4B3M E;  4DV3 I;  4R1F A;  5FLX C;  1Z0V A;  1B62 A;  3J81 C;  2AJ4 A;  1XNQ E;  3WU3 A;  4M1K A;  4DR2 I;  3OTO E;  2J7K A;  1MX0 A;  2BM0 A;  4PRX A;  4LF9 E;  4ZVI A;  1ZM3 A;  4K0K E;  1BKN A;  2DEJ A;  1N34 E;  1B63 A;  4KHP I;  1S4E A;  3K17 A;  4LF4 I;  4JV5 I;  2UUB I;  4X66 I;  2HFU A;  4JG4 A;  5LMU E;  1Z0E A;  1NZ0 A;  1PVG A;  2ZIT A;  4LFA I;  4YY3 E;  1EA6 A;  4LFC E;  2CZ9 A;  4B3T I;  5BR8 E;  3J7A G;  2Q2E B;  3F0N A;  4X62 I;  5LL6 R;  2UUA I;  4NXM E;  2NPF A;  1IBK E;  4HAC B;  3HUL A;  4DV0 I;  4JI5 I;  4AQY I;  1FKA E;  1FJG E;  3JAM Q;  4B3R I;  1N0V C;  4DR1 E;  2V8P A;  4YHH I;  2UUC I;  2VQE I;  3J80 C;  4WUD A;  1FI4 A;  1J5E I;  1NHI A;  4DU8 A;  4FWG A;  4JI3 E;  3H4L A;  2E5L E;  4MYU A;  4URL A;  2HKJ A;  2LJP A;  4HY1 A;  4JI7 E;  5A2Q C;  4DV7 I;  1MG7 A;  1Z5C A;  1ZXN A;  3D4J A;  3B8H A;  2A2C A;  4EMD A;  4DV2 I;  2V2Z A;  2DEI A;  4HYM A;  3B82 A;  3PYE A;  1IBL E;  4B3M I;  4B3S E;  3WU4 A;  1KKH A;  4LF7 I;  2VQF I;  2E1R A;  1XNQ I;  3OTO I;  4OX9 I;  5L3J A;  2ZM6 E;  4DUZ E;  2EFG A;  3PYF A;  4DV1 E;  4K0K I;  1IBM E;  2V2Q A;  4DPU A;  4GKK E;  2UXB I;  2R42 A;  1K47 A;  1PIE A;  4JI1 E;  4JI2 E;  2OI2 A;  2R3V A;  4NXN E;  1N36 I;  4YY3 I;  2V34 A;  1UEK A;  1HR0 E;  4LFB I;  1Z59 A;  4KQV A;  5BR8 I;  5IT9 Q;  4DUY E;  4JYA I;  1U2R A;  4HAC A;  4NXM I;  4WUC A;  4JI6 E;  1IBK I;  2WW4 A;  4USK A;  1XMQ E;  1WUU A;  1FJG I;  4FWD A;  3QT6 A;  2ZBK B;  4XTJ A;  2UU9 I;  3LNU A;  4DR1 I;  1HNX E;  4LF8 I;  2X36 A;  4DR6 E;  3LPS A;  4DV6 I;  2F4V I;  4X65 E;  2HHH I;  4DV5 E;  1Z5A A;  5IWA I;  4DR4 E;  4JI3 I;  2X7I A;  1XNR E;  2A2D A;  3Q1Q A;  2UXC E;  2V2V A;  3LTO A;  1Z5B A;  1XMO I;  1FWK A;  2XEX A;  4DV3 E;  4P52 A;  4DV4 E;  1KIJ A;  1ZM2 A;  3K1J A;  1NHH A;  1N32 I;  4UTG A;  4DR2 E;  4X64 I;  5FLX Q;  1FWL A;  1Z0G A;  4Z7Y A;  4PU9 A;  4LF6 E;  3J81 Q;  1RR9 A;  2VF3 A;  2UXD E;  4DUZ I;  4DR3 I;  3PYG A;  3T1Y I;  4LF4 E;  2UUB E;  1D6T A;  3ZKB A;  4DXL A;  1HNZ I;  5LMN I;  1I94 E;  4GKK I;  4JI1 I;  3T1H I;  4MYT A;  3ZZT A;  1Z0T A;  1PKP A;  4JI2 I;  1Z0B A;  4GKJ E;  4USM A;  1H74 A;  4LF5 E;  3QT7 A;  2UUA E;  1KTV A; 
#chains in the Genus database with same CATH topology
 3ZZ0 A;  1HR0 I;  1H7S A;  4DR5 E;  4DV0 E;  4JI5 E;  3CWV A;  1Y60 A;  4DUY I;  4LCG A;  4LCF A;  4LF9 I;  4LPF A;  4JI6 I;  3QT5 A;  4B3R E;  3PS1 A;  1N33 E;  4YHH E;  1N34 I;  2UUC E;  4QNJ A;  4IFD C;  4FWH A;  2VQE E;  3V2U C;  1XMQ I;  2IOP A;  1MU5 A;  5LMU I;  3L7Z A;  1HNX I;  1EI1 A;  4FW7 A;  5K36 D;  4PRV A;  3J80 Q;  5EL9 A;  4JI4 E;  3PRY A;  4DV7 E;  3QT8 A;  2WNR A;  3PYD A;  5JEA B;  4JI0 E;  1HNW E;  3ZKD A;  4FW4 A;  4DPW A;  3M7N D;  1ZM9 A;  4LFC I;  4JI8 E;  4IZK A;  3JAM C;  1R6L A;  4DV2 E;  1DAR A;  3DD6 A;  1H72 C;  5A2Q Q;  4DU7 A;  2O3Z A;  1A6F A;  3M7N G;  4DV4 I;  1R6M A;  4LF7 E;  4RPF A;  3GON A;  2BM1 A;  2VQF E;  5K36 C;  2NN6 D;  3CDJ A;  3WU5 A;  2C38 A;  2Z5B B;  1QZR A;  3ZZU A;  4DR7 E;  1NHJ A;  4OX9 E;  3H1C A;  4UT4 A;  1S16 A;  2HK3 A;  5DRP A;  4AID A;  1RHY A;  2JEB A;  3GCM A;  4LF6 I;  4LCH A;  4ISA A;  2E5L I;  2NN6 B;  4ED4 A;  2JE6 B;  4MQY A;  2UXD I;  4DPX A;  4JI7 I;  1UDO A;  2Z5C A;  3B78 A;  2UXB E;  2NN6 C;  1OYR A;  4FN5 A;  3GME A;  1ZM4 A;  1I94 I;  1ZXM A;  2C37 B;  1UDS A;  4J3D A;  5DRR A;  1Z0C A;  1IBL I;  1N36 E;  5JEA E;  4B3S I;  4LFB E;  4GKJ I;  1RRE A;  3ZM7 A;  4IZJ B;  2JEA B;  4JYA E;  4LF5 I;  5GMD A;  4Z7C A;  3V5R A;  2O1W A;  3M6A A;  2ZM6 I;  4DR5 I;  1Y6Z A;  1H73 A;  2O1U A;  4DV1 I;  4NBQ A;  4MDT A;  4U3D A;  1N0U A;  4KHP E;  4JV5 E;  2UU9 E;  3J7A M;  4X66 E;  1IBM I;  1N33 I;  2HFS A;  4LF8 E;  2HK2 A;  4DV6 E;  2F4V E;  1FNM A;  2HHH E;  4LFA E;  5IWA E;  4FW9 A;  3PS2 A;  5IT9 C;  3Q6M A;  5JEA F;  2PO2 A;  4B3T E;  4JI4 I;  1H7U A;  2BV3 A;  4DPY A;  4NXN I;  5JEA A;  4DPT A;  4X62 E;  4JI0 I;  1HNW I;  1XMO E;  4IFD B;  2Z5E A;  4HXZ A;  1USU A;  4JI8 I;  4BA1 B;  1XHK A;  4WUB A;  5C0X E;  1VIS A;  4AQY E;  1ELO A;  1N32 E;  4X64 E;  2GS8 A;  1UDQ A;  4I3H A;  2Z5B A;  4QNK A;  1J5E E;  3WU6 A;  4DR7 I;  3U1K A;  4P7A A;  4DR6 I;  2CGE A;  4X65 I;  2O1T A;  3P3C A;  2WP8 B;  1P42 A;  4DV5 I;  4OO1 D;  1Y4U A;  4DR3 E;  4DR4 I;  2JE6 A;  3T1Y E;  1XNR I;  2HKE A;  5GME A;  1Z0W A;  4U3B A;  1HNZ E;  5LMN E;  1OJ4 A;  2UXC I;  5K36 B;  3M85 G;  3P3E A;  2PNL A;  1KVK A;  1XXE A;  4OO1 B;  3T1H E;  5C0X F;  4B3M E;  2O1V A;  4DV3 I;  4R1F A;  5FLX C;  5C0X A;  4MU0 A;  2AE8 A;  1Z0V A;  1B62 A;  3J81 C;  2AJ4 A;  1XNQ E;  3WU3 A;  4M1K A;  4DR2 I;  3OTO E;  4OO1 C;  2J7K A;  4IZJ A;  4IFD E;  1MX0 A;  2BM0 A;  2C39 A;  4IS9 A;  4PRX A;  2PNM A;  4LF9 E;  4ZVI A;  3HJC A;  1ZM3 A;  4K0K E;  1BKN A;  3UHM A;  3PS3 A;  2DEJ A;  1N34 E;  1B63 A;  4KHP I;  1S4E A;  3K17 A;  4LF4 I;  2PO1 B;  2UUB I;  4JV5 I;  5FWK A;  4X66 I;  2HFU A;  4JG4 A;  5LMU E;  1Z0E A;  1NZ0 A;  2GQ0 A;  3L7Z B;  1PVG A;  2ZIT A;  4LFA I;  4YY3 E;  1EA6 A;  4LFC E;  2CZ9 A;  4B3T I;  5BR8 E;  3J7A G;  3Q6N A;  2IES A;  2Q2E B;  3F0N A;  4IFD F;  5EKW A;  4X62 I;  5K36 E;  5LL6 R;  2UUA I;  3P3G A;  4NXM E;  2NPF A;  4IFD A;  1IBK E;  4HAC B;  3HUL A;  4DV0 I;  4BA1 A;  4JI5 I;  4AQY I;  1FKA E;  1FJG E;  3JAM Q;  4B3R I;  1N0V C;  4DR1 E;  2V8P A;  3U1Y A;  4YHH I;  2UUC I;  2VQE I;  3J80 C;  4WUD A;  3P06 A;  1FI4 A;  1J5E I;  1NHI A;  4MU3 A;  4DU8 A;  2JEB B;  4FWG A;  4FW5 A;  4JI3 E;  3H4L A;  3GLL A;  4BA2 B;  2E5L E;  2NN6 E;  4MYU A;  4URL A;  2WP8 A;  2HKJ A;  2IOQ A;  2LJP A;  4HY1 A;  4N3O A;  4JI7 E;  5A2Q C;  4DV7 I;  3KRN A;  1MG7 A;  2PNZ B;  1Z5C A;  1ZXN A;  5K36 F;  3D4J A;  1OYS A;  2JT2 A;  2J65 A;  3B8H A;  5K36 A;  2A2C A;  4EMD A;  5DNX A;  4DV2 I;  2V2Z A;  2DEI A;  5DNL A;  4HYM A;  3B82 A;  3PYE A;  4GQU A;  1IBL E;  4B3M I;  4B3S E;  1YH8 A;  3WU4 A;  1KKH A;  4LF7 I;  1USV A;  5ELW A;  2VQF I;  2E1R A;  1XNQ I;  2GO4 A;  3OTO I;  4OX9 I;  5L3J A;  2ZM6 E;  3M85 D;  2NN6 F;  4DUZ E;  2EFG A;  3PYF A;  4DV1 E;  2BA1 D;  2NN6 A;  4K0K I;  1IBM E;  2V2Q A;  4FW3 A;  4LOM A;  2BR2 B;  4DPU A;  2CG9 A;  5JEA D;  2PO1 A;  4GKK E;  1Y5Y A;  2UXB I;  2R42 A;  2BA1 G;  1K47 A;  1PIE A;  4JI1 E;  4FW6 A;  4MU1 A;  2C37 A;  4JI2 E;  1Y4S A;  2OI2 A;  2PO0 B;  2R3V A;  2PO2 B;  4NXN E;  1N36 I;  1E3H A;  4YY3 I;  2V34 A;  1UEK A;  4AIM A;  1HR0 E;  4LFB I;  1Z59 A;  2JEA A;  1VI7 A;  4KQV A;  5BR8 I;  5IT9 Q;  4DUY E;  4JYA I;  1U2R A;  4HAC A;  4OZE A;  4NXM I;  4WUC A;  4JI6 E;  1IBK I;  1OYP A;  2WW4 A;  5JEA C;  3P76 A;  3HKM A;  4USK A;  1XMQ E;  1WUU A;  2IER A;  1FJG I;  4FWD A;  3QT6 A;  2GO3 A;  2ZBK B;  4XTJ A;  2UU9 I;  3LNU A;  4DR1 I;  5DRQ A;  1HNX E;  3B4T A;  2X36 A;  4LF8 I;  4DR6 E;  3LPS A;  4DV6 I;  1HK7 A;  2F4V I;  4X65 E;  2HHH I;  4DV5 E;  1Z5A A;  4OKG A;  5IWA I;  4BA2 A;  4DR4 E;  4JI3 I;  4MU4 A;  2WNR B;  2X7I A;  1XNR E;  5C0X D;  5DRO A;  4AM3 A;  2A2D A;  3Q1Q A;  2UXC E;  2PNZ A;  2V2V A;  3LTO A;  4IZK B;  1Z5B A;  2BA0 D;  1YHC A;  4OO1 E;  1XMO I;  1FWK A;  2XEX A;  4IZJ D;  4DV3 E;  4P52 A;  4DV4 E;  1KIJ A;  5C0X B;  1ZM2 A;  3K1J A;  1NHH A;  1N32 I;  4UTG A;  4DR2 E;  2C38 B;  2BA0 G;  4X64 I;  5FLX Q;  1FWL A;  1Z0G A;  2F1D A;  2C39 B;  4Z7Y A;  2VES A;  4PU9 A;  5C0X C;  4LF6 E;  3J81 Q;  1UDN A;  1RR9 A;  2VF3 A;  2UXD E;  4DUZ I;  4DR3 I;  3PYG A;  3NZK A;  3T1Y I;  4LF4 E;  2UUB E;  1D6T A;  3ZKB A;  4DXL A;  2Z5C B;  2BR2 A;  3CDI A;  1HNZ I;  4OO1 F;  5LMN I;  1I94 E;  4OO1 A;  4GKK I;  3K85 A;  4IFD D;  4JI1 I;  3T1H I;  4MYT A;  3ZZT A;  1Z0T A;  1PKP A;  4JI2 I;  1Z0B A;  2PO0 A;  4GKJ E;  4USM A;  1E3P A;  1H74 A;  4LF5 E;  2CVE A;  3QT7 A;  2UUA E;  1KTV A; 
#chains in the Genus database with same CATH homology
 3ZZ0 A;  1HR0 I;  1H7S A;  4DR5 E;  4DV0 E;  4JI5 E;  3CWV A;  4DUY I;  4LF9 I;  4JI6 I;  3QT5 A;  4B3R E;  1N33 E;  4YHH E;  1N34 I;  2UUC E;  4FWH A;  2VQE E;  3V2U C;  1XMQ I;  2IOP A;  1MU5 A;  5LMU I;  1HNX I;  1EI1 A;  4PRV A;  3J80 Q;  4JI4 E;  3PRY A;  4DV7 E;  3QT8 A;  3PYD A;  4JI0 E;  1HNW E;  3ZKD A;  4DPW A;  1ZM9 A;  4LFC I;  4JI8 E;  4IZK A;  3JAM C;  4DV2 E;  1DAR A;  1H72 C;  5A2Q Q;  4DU7 A;  1A6F A;  4DV4 I;  4LF7 E;  4RPF A;  3GON A;  2BM1 A;  2VQF E;  3WU5 A;  2Z5B B;  1QZR A;  3ZZU A;  4DR7 E;  1NHJ A;  4OX9 E;  4UT4 A;  1S16 A;  2HK3 A;  4LF6 I;  2E5L I;  4ED4 A;  2UXD I;  4DPX A;  4JI7 I;  2Z5C A;  3B78 A;  2UXB E;  4FN5 A;  1ZM4 A;  1I94 I;  1ZXM A;  1Z0C A;  1IBL I;  1N36 E;  4B3S I;  4LFB E;  4GKJ I;  1RRE A;  3ZM7 A;  4IZJ B;  4JYA E;  4LF5 I;  5GMD A;  4Z7C A;  3V5R A;  2O1W A;  3M6A A;  2ZM6 I;  4DR5 I;  1Y6Z A;  1H73 A;  2O1U A;  4DV1 I;  4KHP E;  1N0U A;  4JV5 E;  2UU9 E;  3J7A M;  4X66 E;  1IBM I;  1N33 I;  2HFS A;  4LF8 E;  2HK2 A;  4DV6 E;  2F4V E;  1FNM A;  2HHH E;  4LFA E;  5IWA E;  4FW9 A;  5IT9 C;  3Q6M A;  4B3T E;  4JI4 I;  1H7U A;  2BV3 A;  4DPY A;  4NXN I;  4DPT A;  4X62 E;  4JI0 I;  1HNW I;  1XMO E;  2Z5E A;  4HXZ A;  1USU A;  4JI8 I;  1XHK A;  4WUB A;  4AQY E;  1VIS A;  1ELO A;  1N32 E;  4X64 E;  2GS8 A;  4I3H A;  2Z5B A;  1J5E E;  3WU6 A;  4DR7 I;  4P7A A;  4DR6 I;  2CGE A;  4X65 I;  2O1T A;  4DV5 I;  1Y4U A;  4DR3 E;  4DR4 I;  3T1Y E;  1XNR I;  2HKE A;  5GME A;  1Z0W A;  1HNZ E;  5LMN E;  1OJ4 A;  2UXC I;  2PNL A;  1KVK A;  3T1H E;  4B3M E;  2O1V A;  4DV3 I;  4R1F A;  5FLX C;  1Z0V A;  1B62 A;  3J81 C;  2AJ4 A;  1XNQ E;  3WU3 A;  4M1K A;  4DR2 I;  3OTO E;  2J7K A;  4IZJ A;  1MX0 A;  2BM0 A;  4PRX A;  2PNM A;  4LF9 E;  4ZVI A;  3HJC A;  1ZM3 A;  4K0K E;  1BKN A;  2DEJ A;  1N34 E;  1B63 A;  4KHP I;  1S4E A;  3K17 A;  4LF4 I;  4JV5 I;  2UUB I;  5FWK A;  4X66 I;  2HFU A;  4JG4 A;  5LMU E;  1Z0E A;  1NZ0 A;  2GQ0 A;  1PVG A;  2ZIT A;  4LFA I;  4YY3 E;  1EA6 A;  4LFC E;  2CZ9 A;  4B3T I;  5BR8 E;  3J7A G;  3Q6N A;  2Q2E B;  3F0N A;  4X62 I;  5LL6 R;  2UUA I;  4NXM E;  2NPF A;  1IBK E;  4HAC B;  3HUL A;  4DV0 I;  4JI5 I;  4AQY I;  1FKA E;  1FJG E;  3JAM Q;  4B3R I;  1N0V C;  4DR1 E;  2V8P A;  4YHH I;  2UUC I;  2VQE I;  3J80 C;  4WUD A;  3P06 A;  1FI4 A;  1J5E I;  1NHI A;  4DU8 A;  4FWG A;  4JI3 E;  3H4L A;  2E5L E;  4MYU A;  4URL A;  2HKJ A;  2IOQ A;  2LJP A;  4HY1 A;  4N3O A;  4JI7 E;  5A2Q C;  4DV7 I;  1MG7 A;  1Z5C A;  1ZXN A;  3D4J A;  3B8H A;  2A2C A;  4EMD A;  4DV2 I;  2V2Z A;  2DEI A;  4HYM A;  3B82 A;  3PYE A;  1IBL E;  4B3M I;  4B3S E;  3WU4 A;  1KKH A;  4LF7 I;  1USV A;  2VQF I;  2E1R A;  1XNQ I;  3OTO I;  4OX9 I;  5L3J A;  2ZM6 E;  4DUZ E;  2EFG A;  3PYF A;  4DV1 E;  4K0K I;  1IBM E;  2V2Q A;  4DPU A;  2CG9 A;  4GKK E;  2UXB I;  2R42 A;  1K47 A;  1PIE A;  4JI1 E;  4JI2 E;  1Y4S A;  2OI2 A;  2R3V A;  4NXN E;  1N36 I;  4YY3 I;  2V34 A;  1UEK A;  1HR0 E;  4LFB I;  1Z59 A;  4KQV A;  5BR8 I;  5IT9 Q;  4DUY E;  4JYA I;  1U2R A;  4HAC A;  4NXM I;  4WUC A;  4JI6 E;  1IBK I;  2WW4 A;  4USK A;  1XMQ E;  1WUU A;  1FJG I;  4FWD A;  3QT6 A;  2ZBK B;  4XTJ A;  2UU9 I;  3LNU A;  4DR1 I;  1HNX E;  4LF8 I;  2X36 A;  4DR6 E;  3LPS A;  4DV6 I;  1HK7 A;  2F4V I;  4X65 E;  2HHH I;  4DV5 E;  1Z5A A;  5IWA I;  4DR4 E;  4JI3 I;  2X7I A;  1XNR E;  2A2D A;  3Q1Q A;  2UXC E;  2V2V A;  3LTO A;  4IZK B;  1Z5B A;  1XMO I;  1FWK A;  2XEX A;  4IZJ D;  4DV3 E;  4P52 A;  4DV4 E;  1KIJ A;  1ZM2 A;  3K1J A;  1NHH A;  1N32 I;  4UTG A;  4DR2 E;  4X64 I;  5FLX Q;  1FWL A;  1Z0G A;  4Z7Y A;  4PU9 A;  4LF6 E;  3J81 Q;  1RR9 A;  2VF3 A;  2UXD E;  4DUZ I;  4DR3 I;  3PYG A;  3T1Y I;  4LF4 E;  2UUB E;  1D6T A;  3ZKB A;  4DXL A;  2Z5C B;  1HNZ I;  5LMN I;  1I94 E;  4GKK I;  3K85 A;  4JI1 I;  3T1H I;  4MYT A;  3ZZT A;  1Z0T A;  1PKP A;  4JI2 I;  1Z0B A;  4GKJ E;  4USM A;  1H74 A;  4LF5 E;  3QT7 A;  2UUA E;  1KTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...