1N32I

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n32I00
4DR4E 2BM1A 4Z7CA 5A2QQ 4LFAE 2HKJA 1IBKE 4DUYI 2UXCI 4DR3E 1K47A 1N34I 4NXNI 3J81Q 2OI2A 4JI7I 4NXMI 3OTOE 4DXLA 3LPSA 2UXBE 4LFBI 5BR8I 4ED4A 4JI6I 4JI8E 1IBKI 1BKNA 2ZBKB 1Z0EA 1Z0WA 1H72C 4X62E 4DV0E 4K0KE 2VQEE 1N32E 1FJGE 5GMEA 3OTOI 1EI1A 5FLXC 2Q2EB 4P7AA 4DR1E 1HNWI 1XNRI 4Z7YA 4JI8I 3M6AA 1J5EE 4KQVA 4M1KA 2A2CA 1IBME 3ZKDA 1PIEA 4K0KI 1XHKA 4WUDA 2V2ZA 1ELOA 2VQEI 1N32I 4JI5E 1FJGI 3J80Q 1FWKA 4PRXA 4X64E 4DUZE 4DR1I 1MX0A 1NHJA 4B3TE 3ZM7A 1J5EI 1HR0E 1HNXE 4JI1E 1NZ0A 1IBMI 1QZRA 4URLA 1N0VC 1ZM3A 4DV6E 3Q1QA 4JYAI 5IWAE 2E1RA 2NPFA 3LTOA 4B3TI 1HR0I 4FW9A 4JI1I 4LF5E 4UTGA 2HHHI 3LNUA 1NHHA 3JAMC 3K17A 1H74A 3ZZUA 4NXNE 4JI7E 4NXME 1KIJA 3T1YE 5IWAI 4LFBE 5BR8E 4HACA 1MU5A 4JI6E 1A6FA 4LF5I 2BV3A 2VQFI 4PU9A 2X36A 4DPUA 1RREA 1XMOE 2XEXA 1Z0BA 2X7IA 4KHPE 2ZM6I 3T1YI 2UUAE 5IT9Q 1EA6A 1HNWE 1XNRE 1I94I 2DEJA 4MYTA 2V2QA 4B3SE 2GS8A 3QT6A 4WUBA 4USMA 4DR5I 1XMOI 4KHPI 2R42A 1FKAE 2UUAI 1U2RA 4FWHA 1MG7A 3B82A 1N0UA 1Z5CA 4B3SI 1RR9A 4DPWA 2HK2A 3WU6A 2EFGA 2HFUA 4JI4E 4RPFA 3F0NA 2R3VA 3T1HE 1XMQE 4JYAE 5LMUE 2A2DA 1PVGA 4YHHE 3ZZTA 1NHIA 4FWGA 4GKKE 3QT8A 1VISA 3ZZ0A 5A2QC 2ZITA 1B63A 2HHHE 5LMNE 3PYGA 4JI4I 4DV3I 4LF7E 1KKHA 4EMDA 4LF9E 3WU4A 1ZM2A 2HKEA 2UXDI 3T1HI 1XMQI 5LMUI 4DV7I 2F4VE 3J81C 4X66E 5L3JA 4JI2I 4YHHI 4DPXA 4YY3E 1Z5AA 2HFSA 4GKKI 4XTJA 2LJPA 1D6TA 4HY1A 4WUCA 1N36I 1Z0GA 5LMNI 2VQFE 5FLXQ 4R1FA 4LF7I 4LF9I 3PYDA 2ZM6E 4DV4E 2F4VI 4X66I 2AJ4A 3J7AM 2V2VA 1FI4A 2DEIA 4OX9I 1HNZI 4DV2I 4YY3I 4I3HA 1Z59A 1I94E 1FNMA 1Z5BA 1B62A 4DPTA 4DR6E 4DR7E 4GKJI 3PYFA 4DR5E 3B78A 4DV4I 1H7SA 3J80C 2J7KA 2HK3A 2UUCE 4LF8E 4HACB 1KTVA 1XNQE 2CZ9A 4USKA 2UU9E 1H7UA 4B3RE 4DR6I 1KVKA 1S16A 2V8PA 4DR7I 2WW4A 4DV5E 2VF3A 3B8HA 4LF6E 1N33E 4DR4I 1ZXNA 1ZXMA 4LFCE 4LFAI 4PRVA 4ZVIA 3WU5A 4DR3I 2UUCI 4LF8I 3GONA 3JAMQ 4FN5A 1XNQI 2UU9I 1PKPA 3V2UC 4B3RI 4JV5E 4DR2E 4DV5I 4LF6I 4DV3E 1N33I 2UXBI 2UXDE 4LFCI 3ZKBA 4DV7E 4JG4A 1IBLE 4JI2E 4HYMA 4HXZA 2E5LE 4X62I 3CWVA 4DV0I 1DARA 4JV5I 1N36E 4DR2I 3QT5A 4X65E 1Z0CA 3V5RA 3K1JA 4AQYE 4JI0E 4P52A 3WU3A 4DV1E 1Z0TA 5GMDA 1IBLI 4LF4E 2UUBE 4OX9E 1HNZE 4DV2E 1ZM4A 1S4EA 2E5LI 4B3ME 5IT9C 4DU8A 1ZM9A 4FWDA 5LL6R 4JI3E 1Z0VA 4JI5I 4X65I 3HULA 4AQYI 4X64I 4DUZI 4GKJE 4DU7A 4JI0I 4MYUA 4DV1I 4LF4I 1HNXI 2UUBI 3J7AG 3H4LA 4DUYE 4B3MI 2UXCE 2BM0A 1FWLA 3PYEA 4JI3I 3D4JA 1H73A 4UT4A 1WUUA 1UEKA 3QT7A 1OJ4A 1N34E 4DV6I 4DPYA 2V34A
chains in the Genus database with same CATH superfamily
4DR4E 3M85D 2BM1A 2JE6B 3P76A 4Z7CA 5A2QQ 3U1YA 4LFAE 2HKJA 1IBKE 4DUYI 2UXCI 4DR3E 1K47A 2O1VA 1N34I 4NXNI 3J81Q 2OI2A 4JI7I 4NXMI 2PO2A 3OTOE 4DXLA 4IZKA 3LPSA 2UXBE 4LFBI 4GQUA 5BR8I 4MU3A 4ED4A 2BA0D 4JI6I 3HKMA 4MDTA 4IZJD 4JI8E 1IBKI 4MU0A 1BKNA 2ZBKB 1Z0EA 3DD6A 1Z0WA 2GO4A 1OYSA 5C0XE 1H72C 4X62E 4DV0E 4K0KE 2VQEE 1N32E 4AM3A 4U3DA 1FJGE 5GMEA 3OTOI 5EKWA 2BA1D 1EI1A 5FLXC 5DNXA 2NN6B 2Q2EB 4P7AA 4DR1E 1HNWI 1XNRI 4Z7YA 4JI8I 3M6AA 2NN6F 1J5EE 3HJCA 4KQVA 4M1KA 3P3CA 5DRRA 4QNKA 3GMEA 3L7ZB 2A2CA 1IBME 3ZKDA 4MQYA 1PIEA 4K0KI 1XHKA 4WUDA 2V2ZA 1ELOA 4OO1A 2VQEI 4JI5E 1N32I 1FJGI 3J80Q 1UDNA 1FWKA 4J3DA 4PRXA 4X64E 4DUZE 4DR1I 1MX0A 1NHJA 4B3TE 3ZM7A 3Q6NA 1J5EI 1HR0E 1HNXE 2C39A 2C37A 4JI1E 5C0XC 1NZ0A 1IBMI 4OKGA 2PO1A 1QZRA 2PNLA 4URLA 4AIDA 1N0VC 2JEBA 1ZM3A 4DV6E 2O1WA 5JEAB 3Q1QA 4JYAI 5IWAE 2E1RA 2NPFA 3LTOA 4B3TI 1HR0I 2CGEA 4FW9A 2Z5EA 4JI1I 4LF5E 4UTGA 4QNJA 2HHHI 3LNUA 1NHHA 3JAMC 3K17A 4MU1A 1H74A 2AE8A 3ZZUA 4JI7E 4NXNE 4NXME 1KIJA 3T1YE 5IWAI 3K85A 4LFBE 3P3GA 5C0XF 5BR8E 3PS3A 4HACA 1MU5A 3H1CA 4JI6E 1A6FA 2PO0B 4LF5I 4IZJB 4OO1E 2BV3A 1VI7A 2VQFI 4PU9A 2X36A 4DPUA 1RREA 2C38B 1XMOE 2XEXA 1USVA 2PNZB 3PS1A 5C0XD 2CG9A 1Z0BA 2X7IA 4KHPE 2ZM6I 3T1YI 2UUAE 5IT9Q 2WNRB 1EA6A 1XXEA 1HNWE 1XNRE 3P06A 1I94I 2DEJA 2BR2A 4MYTA 4NBQA 3M7NG 2CVEA 2V2QA 4B3SE 1YH8A 2GS8A 5K36E 3QT6A 4FW7A 4WUBA 4USMA 4DR5I 1XMOI 2PNMA 3PS2A 4BA1A 4KHPI 2R42A 1FKAE 2UUAI 1U2RA 1OYPA 3L7ZA 4IFDE 4FWHA 1MG7A 3B82A 1N0UA 4MU4A 4ISAA 4OO1C 1Z5CA 1UDOA 3NZKA 4B3SI 2VESA 1RR9A 1Y4SA 3GCMA 4DPWA 2HK2A 4N3OA 3WU6A 2EFGA 2HFUA 4JI4E 4RPFA 2Z5CA 3F0NA 4IS9A 2O1UA 2R3VA 3T1HE 1XMQE 4JYAE 2Z5BA 3KRNA 5LMUE 2A2DA 1PVGA 2JEAA 4YHHE 5DRQA 3ZZTA 1NHIA 4FWGA 1OYRA 4GKKE 3QT8A 1VISA 3ZZ0A 5A2QC 2ZITA 1B63A 5K36C 2HHHE 5LMNE 3PYGA 4JI4I 5JEAA 4DV3I 4LF7E 1KKHA 4EMDA 4LF9E 3WU4A 1ZM2A 2HKEA 2IOQA 2UXDI 5K36A 1RHYA 2WP8B 3T1HI 1XMQI 1HK7A 5LMUI 4DV7I 2F4VE 3J81C 4X66E 4OO1F 5L3JA 4JI2I 4IFDC 4YHHI 4DPXA 3CDJA 4YY3E 1Z5AA 2HFSA 4GKKI 4XTJA 2LJPA 1D6TA 4HY1A 2NN6E 4WUCA 1Z0GA 1N36I 4IFDA 2C37B 5LMNI 2VQFE 5FLXQ 4LCFA 4R1FA 1UDQA 4LF7I 4LF9I 4OO1D 4BA2A 1Y6ZA 5DRPA 3PYDA 2BA0G 2JE6A 5C0XB 2ZM6E 4DV4E 2F4VI 4X66I 2PO0A 2AJ4A 3J7AM 2V2VA 1FI4A 2DEIA 4OX9I 1HNZI 4DV2I 4YY3I 2O1TA 4LCHA 4I3HA 2IESA 1Z59A 1I94E 1FNMA 1Z5BA 2C38A 1B62A 2F1DA 4DPTA 4DR6E 4DR7E 4GKJI 3PYFA 4DR5E 3B78A 4DV4I 5K36D 1H7SA 4U3BA 3J80C 3Q6MA 2J7KA 2HK3A 5EL9A 2O3ZA 4FW5A 2UUCE 4LF8E 5JEAE 4HACB 1KTVA 1XNQE 2CZ9A 5DROA 2NN6C 4USKA 2UU9E 4IFDD 1H7UA 4B3RE 4DR6I 1KVKA 1S16A 2V8PA 4DR7I 2WW4A 4DV5E 2VF3A 3B8HA 4LF6E 2NN6A 4LCGA 1N33E 3CDIA 2J65A 4DR4I 1ZXNA 4FW6A 2PO2B 1ZXMA 4LFCE 4AIMA 4IZKB 4LFAI 4PRVA 4ZVIA 3WU5A 1E3PA 4DR3I 2UUCI 4LF8I 3GONA 3JAMQ 4FN5A 1XNQI 2UU9I 1PKPA 3V2UC 2BR2B 4B3RI 3P3EA 4JV5E 4DR2E 4DV5I 5ELWA 2JT2A 1YHCA 4OZEA 4LF6I 4DV3E 1Y60A 1N33I 2UXBI 5DNLA 2UXDE 4BA1B 4LFCI 3ZKBA 4DV7E 4JG4A 1IBLE 4JI2E 4HYMA 4HXZA 4LOMA 4FW3A 5FWKA 5JEAC 2E5LE 4X62I 1R6LA 1Y5YA 3CWVA 4DV0I 1DARA 1R6MA 4JV5I 1N36E 3M7ND 4DR2I 3QT5A 4X65E 2WP8A 1UDSA 1Y4UA 1Z0CA 3V5RA 3K1JA 4AQYE 1USUA 4OO1B 2NN6D 2Z5CB 4JI0E 3M85G 4P52A 3WU3A 4DV1E 1Z0TA 5GMDA 1IBLI 4LF4E 2UUBE 2Z5BB 2GQ0A 4OX9E 1HNZE 4DV2E 2IOPA 1ZM4A 1S4EA 2E5LI 4B3ME 5IT9C 4DU8A 2JEAB 1ZM9A 4FWDA 5LL6R 4JI3E 1Z0VA 2C39B 4JI5I 4X65I 3HULA 5C0XA 2PO1B 4AQYI 3PRYA 4LPFA 4X64I 4DUZI 4GKJE 4DU7A 4JI0I 3B4TA 4MYUA 2JEBB 3UHMA 5JEAF 4DV1I 5K36B 4LF4I 4IZJA 1HNXI 2UUBI 3J7AG 3H4LA 1E3HA 4DUYE 4B3MI 2IERA 5K36F 2UXCE 2BM0A 1FWLA 3PYEA 4JI3I 3D4JA 1H73A 4UT4A 1WUUA 1UEKA 1P42A 1OJ4A 2PNZA 3QT7A 2BA1G 1N34E 4IFDB 4DV6I 2GO3A 5JEAD 3GLLA 4DPYA 4IFDF 2WNRA 4FW4A 2V34A 3U1KA 4BA2B
chains in the Genus database with same CATH topology
4DR4E 2BM1A 4Z7CA 5A2QQ 4LFAE 2HKJA 1IBKE 4DUYI 2UXCI 4DR3E 1K47A 2O1VA 1N34I 4NXNI 3J81Q 2OI2A 4JI7I 4NXMI 3OTOE 4DXLA 4IZKA 3LPSA 2UXBE 4LFBI 5BR8I 4ED4A 4JI6I 4IZJD 4JI8E 1IBKI 1BKNA 2ZBKB 1Z0EA 1Z0WA 1H72C 4X62E 4DV0E 4K0KE 2VQEE 1N32E 1FJGE 5GMEA 3OTOI 1EI1A 5FLXC 2Q2EB 4P7AA 4DR1E 1HNWI 1XNRI 4Z7YA 4JI8I 3M6AA 1J5EE 3HJCA 4KQVA 4M1KA 2A2CA 1IBME 3ZKDA 1PIEA 4K0KI 1XHKA 4WUDA 2V2ZA 1ELOA 2VQEI 1N32I 4JI5E 1FJGI 3J80Q 1FWKA 4PRXA 4X64E 4DUZE 4DR1I 1MX0A 1NHJA 4B3TE 3ZM7A 3Q6NA 1J5EI 1HR0E 1HNXE 4JI1E 1NZ0A 1IBMI 1QZRA 2PNLA 4URLA 1N0VC 1ZM3A 4DV6E 2O1WA 3Q1QA 4JYAI 5IWAE 2E1RA 2NPFA 3LTOA 4B3TI 1HR0I 2CGEA 4FW9A 2Z5EA 4JI1I 4LF5E 4UTGA 2HHHI 3LNUA 1NHHA 3JAMC 3K17A 1H74A 3ZZUA 4NXNE 4JI7E 4NXME 1KIJA 3T1YE 5IWAI 3K85A 4LFBE 5BR8E 4HACA 1MU5A 4JI6E 1A6FA 4LF5I 4IZJB 2BV3A 2VQFI 4PU9A 2X36A 4DPUA 1RREA 1XMOE 2XEXA 1USVA 2CG9A 1Z0BA 2X7IA 4KHPE 2ZM6I 3T1YI 2UUAE 5IT9Q 1EA6A 1HNWE 1XNRE 3P06A 1I94I 2DEJA 4MYTA 2V2QA 4B3SE 2GS8A 3QT6A 4WUBA 4USMA 4DR5I 1XMOI 2PNMA 4KHPI 2R42A 1FKAE 2UUAI 1U2RA 4FWHA 1MG7A 3B82A 1N0UA 1Z5CA 4B3SI 1RR9A 1Y4SA 4DPWA 2HK2A 4N3OA 3WU6A 2EFGA 2HFUA 4JI4E 4RPFA 2Z5CA 3F0NA 2O1UA 2R3VA 3T1HE 1XMQE 4JYAE 2Z5BA 5LMUE 2A2DA 1PVGA 4YHHE 3ZZTA 1NHIA 4FWGA 4GKKE 3QT8A 1VISA 3ZZ0A 5A2QC 2ZITA 1B63A 2HHHE 5LMNE 3PYGA 4JI4I 4DV3I 4LF7E 1KKHA 4EMDA 4LF9E 3WU4A 1ZM2A 2HKEA 2IOQA 2UXDI 3T1HI 1XMQI 1HK7A 5LMUI 4DV7I 2F4VE 3J81C 4X66E 5L3JA 4JI2I 4YHHI 4DPXA 4YY3E 1Z5AA 2HFSA 4GKKI 4XTJA 2LJPA 1D6TA 4HY1A 4WUCA 1N36I 1Z0GA 5LMNI 2VQFE 5FLXQ 4R1FA 4LF7I 4LF9I 1Y6ZA 3PYDA 2ZM6E 4DV4E 2F4VI 4X66I 2AJ4A 3J7AM 2V2VA 1FI4A 2DEIA 4OX9I 1HNZI 4DV2I 4YY3I 2O1TA 4I3HA 1Z59A 1I94E 1FNMA 1Z5BA 1B62A 4DPTA 4DR6E 4DR7E 4GKJI 3PYFA 4DR5E 3B78A 4DV4I 1H7SA 3J80C 3Q6MA 2J7KA 2HK3A 2UUCE 4LF8E 4HACB 1KTVA 1XNQE 2CZ9A 4USKA 2UU9E 1H7UA 4B3RE 4DR6I 1KVKA 1S16A 2V8PA 4DR7I 2WW4A 4DV5E 2VF3A 3B8HA 4LF6E 1N33E 4DR4I 1ZXNA 1ZXMA 4LFCE 4IZKB 4LFAI 4PRVA 4ZVIA 3WU5A 4DR3I 2UUCI 4LF8I 3GONA 3JAMQ 4FN5A 1XNQI 2UU9I 1PKPA 3V2UC 4B3RI 4JV5E 4DR2E 4DV5I 4LF6I 4DV3E 1N33I 2UXBI 2UXDE 4LFCI 3ZKBA 4DV7E 4JG4A 1IBLE 4JI2E 4HYMA 4HXZA 5FWKA 2E5LE 4X62I 3CWVA 4DV0I 1DARA 4JV5I 1N36E 4DR2I 3QT5A 4X65E 1Y4UA 1Z0CA 3V5RA 3K1JA 4AQYE 1USUA 2Z5CB 4JI0E 4P52A 3WU3A 4DV1E 1Z0TA 5GMDA 1IBLI 4LF4E 2UUBE 2Z5BB 2GQ0A 4OX9E 1HNZE 4DV2E 2IOPA 1ZM4A 1S4EA 2E5LI 4B3ME 5IT9C 4DU8A 1ZM9A 4FWDA 5LL6R 4JI3E 1Z0VA 4JI5I 4X65I 3HULA 4AQYI 3PRYA 4X64I 4DUZI 4GKJE 4DU7A 4JI0I 4MYUA 4DV1I 4LF4I 4IZJA 1HNXI 2UUBI 3J7AG 3H4LA 4DUYE 4B3MI 2UXCE 2BM0A 1FWLA 3PYEA 4JI3I 3D4JA 1H73A 4UT4A 1WUUA 1UEKA 3QT7A 1OJ4A 1N34E 4DV6I 4DPYA 2V34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 E;  2BM1 A;  4Z7C A;  5A2Q Q;  4LFA E;  2HKJ A;  1IBK E;  4DUY I;  2UXC I;  4DR3 E;  1K47 A;  1N34 I;  4NXN I;  3J81 Q;  2OI2 A;  4JI7 I;  4NXM I;  3OTO E;  4DXL A;  3LPS A;  2UXB E;  4LFB I;  5BR8 I;  4ED4 A;  4JI6 I;  4JI8 E;  1IBK I;  1BKN A;  2ZBK B;  1Z0E A;  1Z0W A;  1H72 C;  4X62 E;  4DV0 E;  4K0K E;  2VQE E;  1N32 E;  1FJG E;  5GME A;  3OTO I;  1EI1 A;  5FLX C;  2Q2E B;  4P7A A;  4DR1 E;  1HNW I;  1XNR I;  4Z7Y A;  4JI8 I;  3M6A A;  1J5E E;  4KQV A;  4M1K A;  2A2C A;  1IBM E;  3ZKD A;  1PIE A;  4K0K I;  1XHK A;  4WUD A;  2V2Z A;  1ELO A;  2VQE I;  1N32 I;  4JI5 E;  1FJG I;  3J80 Q;  1FWK A;  4PRX A;  4X64 E;  4DUZ E;  4DR1 I;  1MX0 A;  1NHJ A;  4B3T E;  3ZM7 A;  1J5E I;  1HR0 E;  1HNX E;  4JI1 E;  1NZ0 A;  1IBM I;  1QZR A;  4URL A;  1N0V C;  1ZM3 A;  4DV6 E;  3Q1Q A;  4JYA I;  5IWA E;  2E1R A;  2NPF A;  3LTO A;  4B3T I;  1HR0 I;  4FW9 A;  4JI1 I;  4LF5 E;  4UTG A;  2HHH I;  3LNU A;  1NHH A;  3JAM C;  3K17 A;  1H74 A;  3ZZU A;  4NXN E;  4JI7 E;  4NXM E;  1KIJ A;  3T1Y E;  5IWA I;  4LFB E;  5BR8 E;  4HAC A;  1MU5 A;  4JI6 E;  1A6F A;  4LF5 I;  2BV3 A;  2VQF I;  4PU9 A;  2X36 A;  4DPU A;  1RRE A;  1XMO E;  2XEX A;  1Z0B A;  2X7I A;  4KHP E;  2ZM6 I;  3T1Y I;  2UUA E;  5IT9 Q;  1EA6 A;  1HNW E;  1XNR E;  1I94 I;  2DEJ A;  4MYT A;  2V2Q A;  4B3S E;  2GS8 A;  3QT6 A;  4WUB A;  4USM A;  4DR5 I;  1XMO I;  4KHP I;  2R42 A;  1FKA E;  2UUA I;  1U2R A;  4FWH A;  1MG7 A;  3B82 A;  1N0U A;  1Z5C A;  4B3S I;  1RR9 A;  4DPW A;  2HK2 A;  3WU6 A;  2EFG A;  2HFU A;  4JI4 E;  4RPF A;  3F0N A;  2R3V A;  3T1H E;  1XMQ E;  4JYA E;  5LMU E;  2A2D A;  1PVG A;  4YHH E;  3ZZT A;  1NHI A;  4FWG A;  4GKK E;  3QT8 A;  1VIS A;  3ZZ0 A;  5A2Q C;  2ZIT A;  1B63 A;  2HHH E;  5LMN E;  3PYG A;  4JI4 I;  4DV3 I;  4LF7 E;  1KKH A;  4EMD A;  4LF9 E;  3WU4 A;  1ZM2 A;  2HKE A;  2UXD I;  3T1H I;  1XMQ I;  5LMU I;  4DV7 I;  2F4V E;  3J81 C;  4X66 E;  5L3J A;  4JI2 I;  4YHH I;  4DPX A;  4YY3 E;  1Z5A A;  2HFS A;  4GKK I;  4XTJ A;  2LJP A;  1D6T A;  4HY1 A;  4WUC A;  1N36 I;  1Z0G A;  5LMN I;  2VQF E;  5FLX Q;  4R1F A;  4LF7 I;  4LF9 I;  3PYD A;  2ZM6 E;  4DV4 E;  2F4V I;  4X66 I;  2AJ4 A;  3J7A M;  2V2V A;  1FI4 A;  2DEI A;  4OX9 I;  1HNZ I;  4DV2 I;  4YY3 I;  4I3H A;  1Z59 A;  1I94 E;  1FNM A;  1Z5B A;  1B62 A;  4DPT A;  4DR6 E;  4DR7 E;  4GKJ I;  3PYF A;  4DR5 E;  3B78 A;  4DV4 I;  1H7S A;  3J80 C;  2J7K A;  2HK3 A;  2UUC E;  4LF8 E;  4HAC B;  1KTV A;  1XNQ E;  2CZ9 A;  4USK A;  2UU9 E;  1H7U A;  4B3R E;  4DR6 I;  1KVK A;  1S16 A;  2V8P A;  4DR7 I;  2WW4 A;  4DV5 E;  2VF3 A;  3B8H A;  4LF6 E;  1N33 E;  4DR4 I;  1ZXN A;  1ZXM A;  4LFC E;  4LFA I;  4PRV A;  4ZVI A;  3WU5 A;  4DR3 I;  2UUC I;  4LF8 I;  3GON A;  3JAM Q;  4FN5 A;  1XNQ I;  2UU9 I;  1PKP A;  3V2U C;  4B3R I;  4JV5 E;  4DR2 E;  4DV5 I;  4LF6 I;  4DV3 E;  1N33 I;  2UXB I;  2UXD E;  4LFC I;  3ZKB A;  4DV7 E;  4JG4 A;  1IBL E;  4JI2 E;  4HYM A;  4HXZ A;  2E5L E;  4X62 I;  3CWV A;  4DV0 I;  1DAR A;  4JV5 I;  1N36 E;  4DR2 I;  3QT5 A;  4X65 E;  1Z0C A;  3V5R A;  3K1J A;  4AQY E;  4JI0 E;  4P52 A;  3WU3 A;  4DV1 E;  1Z0T A;  5GMD A;  1IBL I;  4LF4 E;  2UUB E;  4OX9 E;  1HNZ E;  4DV2 E;  1ZM4 A;  1S4E A;  2E5L I;  4B3M E;  5IT9 C;  4DU8 A;  1ZM9 A;  4FWD A;  5LL6 R;  4JI3 E;  1Z0V A;  4JI5 I;  4X65 I;  3HUL A;  4AQY I;  4X64 I;  4DUZ I;  4GKJ E;  4DU7 A;  4JI0 I;  4MYU A;  4DV1 I;  4LF4 I;  1HNX I;  2UUB I;  3J7A G;  3H4L A;  4DUY E;  4B3M I;  2UXC E;  2BM0 A;  1FWL A;  3PYE A;  4JI3 I;  3D4J A;  1H73 A;  4UT4 A;  1WUU A;  1UEK A;  3QT7 A;  1OJ4 A;  1N34 E;  4DV6 I;  4DPY A;  2V34 A; 
#chains in the Genus database with same CATH topology
 4DR4 E;  3M85 D;  2BM1 A;  2JE6 B;  3P76 A;  4Z7C A;  5A2Q Q;  3U1Y A;  4LFA E;  2HKJ A;  1IBK E;  4DUY I;  2UXC I;  4DR3 E;  1K47 A;  2O1V A;  1N34 I;  4NXN I;  3J81 Q;  2OI2 A;  4JI7 I;  4NXM I;  2PO2 A;  3OTO E;  4DXL A;  4IZK A;  3LPS A;  2UXB E;  4LFB I;  4GQU A;  5BR8 I;  4MU3 A;  4ED4 A;  2BA0 D;  4JI6 I;  3HKM A;  4MDT A;  4IZJ D;  4JI8 E;  1IBK I;  4MU0 A;  1BKN A;  2ZBK B;  1Z0E A;  3DD6 A;  1Z0W A;  2GO4 A;  1OYS A;  5C0X E;  1H72 C;  4X62 E;  4DV0 E;  4K0K E;  2VQE E;  1N32 E;  4AM3 A;  4U3D A;  1FJG E;  5GME A;  3OTO I;  5EKW A;  2BA1 D;  1EI1 A;  5FLX C;  5DNX A;  2NN6 B;  2Q2E B;  4P7A A;  4DR1 E;  1HNW I;  1XNR I;  4Z7Y A;  4JI8 I;  3M6A A;  2NN6 F;  1J5E E;  3HJC A;  4KQV A;  4M1K A;  3P3C A;  5DRR A;  4QNK A;  3GME A;  3L7Z B;  2A2C A;  1IBM E;  3ZKD A;  4MQY A;  1PIE A;  4K0K I;  1XHK A;  4WUD A;  2V2Z A;  1ELO A;  4OO1 A;  2VQE I;  4JI5 E;  1N32 I;  1FJG I;  3J80 Q;  1UDN A;  1FWK A;  4J3D A;  4PRX A;  4X64 E;  4DUZ E;  4DR1 I;  1MX0 A;  1NHJ A;  4B3T E;  3ZM7 A;  3Q6N A;  1J5E I;  1HR0 E;  1HNX E;  2C39 A;  2C37 A;  4JI1 E;  5C0X C;  1NZ0 A;  1IBM I;  4OKG A;  2PO1 A;  1QZR A;  2PNL A;  4URL A;  4AID A;  1N0V C;  2JEB A;  1ZM3 A;  4DV6 E;  2O1W A;  5JEA B;  3Q1Q A;  4JYA I;  5IWA E;  2E1R A;  2NPF A;  3LTO A;  4B3T I;  1HR0 I;  2CGE A;  4FW9 A;  2Z5E A;  4JI1 I;  4LF5 E;  4UTG A;  4QNJ A;  2HHH I;  3LNU A;  1NHH A;  3JAM C;  3K17 A;  4MU1 A;  1H74 A;  2AE8 A;  3ZZU A;  4JI7 E;  4NXN E;  4NXM E;  1KIJ A;  3T1Y E;  5IWA I;  3K85 A;  4LFB E;  3P3G A;  5C0X F;  5BR8 E;  3PS3 A;  4HAC A;  1MU5 A;  3H1C A;  4JI6 E;  1A6F A;  2PO0 B;  4LF5 I;  4IZJ B;  4OO1 E;  2BV3 A;  1VI7 A;  2VQF I;  4PU9 A;  2X36 A;  4DPU A;  1RRE A;  2C38 B;  1XMO E;  2XEX A;  1USV A;  2PNZ B;  3PS1 A;  5C0X D;  2CG9 A;  1Z0B A;  2X7I A;  4KHP E;  2ZM6 I;  3T1Y I;  2UUA E;  5IT9 Q;  2WNR B;  1EA6 A;  1XXE A;  1HNW E;  1XNR E;  3P06 A;  1I94 I;  2DEJ A;  2BR2 A;  4MYT A;  4NBQ A;  3M7N G;  2CVE A;  2V2Q A;  4B3S E;  1YH8 A;  2GS8 A;  5K36 E;  3QT6 A;  4FW7 A;  4WUB A;  4USM A;  4DR5 I;  1XMO I;  2PNM A;  3PS2 A;  4BA1 A;  4KHP I;  2R42 A;  1FKA E;  2UUA I;  1U2R A;  1OYP A;  3L7Z A;  4IFD E;  4FWH A;  1MG7 A;  3B82 A;  1N0U A;  4MU4 A;  4ISA A;  4OO1 C;  1Z5C A;  1UDO A;  3NZK A;  4B3S I;  2VES A;  1RR9 A;  1Y4S A;  3GCM A;  4DPW A;  2HK2 A;  4N3O A;  3WU6 A;  2EFG A;  2HFU A;  4JI4 E;  4RPF A;  2Z5C A;  3F0N A;  4IS9 A;  2O1U A;  2R3V A;  3T1H E;  1XMQ E;  4JYA E;  2Z5B A;  3KRN A;  5LMU E;  2A2D A;  1PVG A;  2JEA A;  4YHH E;  5DRQ A;  3ZZT A;  1NHI A;  4FWG A;  1OYR A;  4GKK E;  3QT8 A;  1VIS A;  3ZZ0 A;  5A2Q C;  2ZIT A;  1B63 A;  5K36 C;  2HHH E;  5LMN E;  3PYG A;  4JI4 I;  5JEA A;  4DV3 I;  4LF7 E;  1KKH A;  4EMD A;  4LF9 E;  3WU4 A;  1ZM2 A;  2HKE A;  2IOQ A;  2UXD I;  5K36 A;  1RHY A;  2WP8 B;  3T1H I;  1XMQ I;  1HK7 A;  5LMU I;  4DV7 I;  2F4V E;  3J81 C;  4X66 E;  4OO1 F;  5L3J A;  4JI2 I;  4IFD C;  4YHH I;  4DPX A;  3CDJ A;  4YY3 E;  1Z5A A;  2HFS A;  4GKK I;  4XTJ A;  2LJP A;  1D6T A;  4HY1 A;  2NN6 E;  4WUC A;  1Z0G A;  1N36 I;  4IFD A;  2C37 B;  5LMN I;  2VQF E;  5FLX Q;  4LCF A;  4R1F A;  1UDQ A;  4LF7 I;  4LF9 I;  4OO1 D;  4BA2 A;  1Y6Z A;  5DRP A;  3PYD A;  2BA0 G;  2JE6 A;  5C0X B;  2ZM6 E;  4DV4 E;  2F4V I;  4X66 I;  2PO0 A;  2AJ4 A;  3J7A M;  2V2V A;  1FI4 A;  2DEI A;  4OX9 I;  1HNZ I;  4DV2 I;  4YY3 I;  2O1T A;  4LCH A;  4I3H A;  2IES A;  1Z59 A;  1I94 E;  1FNM A;  1Z5B A;  2C38 A;  1B62 A;  2F1D A;  4DPT A;  4DR6 E;  4DR7 E;  4GKJ I;  3PYF A;  4DR5 E;  3B78 A;  4DV4 I;  5K36 D;  1H7S A;  4U3B A;  3J80 C;  3Q6M A;  2J7K A;  2HK3 A;  5EL9 A;  2O3Z A;  4FW5 A;  2UUC E;  4LF8 E;  5JEA E;  4HAC B;  1KTV A;  1XNQ E;  2CZ9 A;  5DRO A;  2NN6 C;  4USK A;  2UU9 E;  4IFD D;  1H7U A;  4B3R E;  4DR6 I;  1KVK A;  1S16 A;  2V8P A;  4DR7 I;  2WW4 A;  4DV5 E;  2VF3 A;  3B8H A;  4LF6 E;  2NN6 A;  4LCG A;  1N33 E;  3CDI A;  2J65 A;  4DR4 I;  1ZXN A;  4FW6 A;  2PO2 B;  1ZXM A;  4LFC E;  4AIM A;  4IZK B;  4LFA I;  4PRV A;  4ZVI A;  3WU5 A;  1E3P A;  4DR3 I;  2UUC I;  4LF8 I;  3GON A;  3JAM Q;  4FN5 A;  1XNQ I;  2UU9 I;  1PKP A;  3V2U C;  2BR2 B;  4B3R I;  3P3E A;  4JV5 E;  4DR2 E;  4DV5 I;  5ELW A;  2JT2 A;  1YHC A;  4OZE A;  4LF6 I;  4DV3 E;  1Y60 A;  1N33 I;  2UXB I;  5DNL A;  2UXD E;  4BA1 B;  4LFC I;  3ZKB A;  4DV7 E;  4JG4 A;  1IBL E;  4JI2 E;  4HYM A;  4HXZ A;  4LOM A;  4FW3 A;  5FWK A;  5JEA C;  2E5L E;  4X62 I;  1R6L A;  1Y5Y A;  3CWV A;  4DV0 I;  1DAR A;  1R6M A;  4JV5 I;  1N36 E;  3M7N D;  4DR2 I;  3QT5 A;  4X65 E;  2WP8 A;  1UDS A;  1Y4U A;  1Z0C A;  3V5R A;  3K1J A;  4AQY E;  1USU A;  4OO1 B;  2NN6 D;  2Z5C B;  4JI0 E;  3M85 G;  4P52 A;  3WU3 A;  4DV1 E;  1Z0T A;  5GMD A;  1IBL I;  4LF4 E;  2UUB E;  2Z5B B;  2GQ0 A;  4OX9 E;  1HNZ E;  4DV2 E;  2IOP A;  1ZM4 A;  1S4E A;  2E5L I;  4B3M E;  5IT9 C;  4DU8 A;  2JEA B;  1ZM9 A;  4FWD A;  5LL6 R;  4JI3 E;  1Z0V A;  2C39 B;  4JI5 I;  4X65 I;  3HUL A;  5C0X A;  2PO1 B;  4AQY I;  3PRY A;  4LPF A;  4X64 I;  4DUZ I;  4GKJ E;  4DU7 A;  4JI0 I;  3B4T A;  4MYU A;  2JEB B;  3UHM A;  5JEA F;  4DV1 I;  5K36 B;  4LF4 I;  4IZJ A;  1HNX I;  2UUB I;  3J7A G;  3H4L A;  1E3H A;  4DUY E;  4B3M I;  2IER A;  5K36 F;  2UXC E;  2BM0 A;  1FWL A;  3PYE A;  4JI3 I;  3D4J A;  1H73 A;  4UT4 A;  1WUU A;  1UEK A;  1P42 A;  1OJ4 A;  2PNZ A;  3QT7 A;  2BA1 G;  1N34 E;  4IFD B;  4DV6 I;  2GO3 A;  5JEA D;  3GLL A;  4DPY A;  4IFD F;  2WNR A;  4FW4 A;  2V34 A;  3U1K A;  4BA2 B; 
#chains in the Genus database with same CATH homology
 4DR4 E;  2BM1 A;  4Z7C A;  5A2Q Q;  4LFA E;  2HKJ A;  1IBK E;  4DUY I;  2UXC I;  4DR3 E;  1K47 A;  2O1V A;  1N34 I;  4NXN I;  3J81 Q;  2OI2 A;  4JI7 I;  4NXM I;  3OTO E;  4DXL A;  4IZK A;  3LPS A;  2UXB E;  4LFB I;  5BR8 I;  4ED4 A;  4JI6 I;  4IZJ D;  4JI8 E;  1IBK I;  1BKN A;  2ZBK B;  1Z0E A;  1Z0W A;  1H72 C;  4X62 E;  4DV0 E;  4K0K E;  2VQE E;  1N32 E;  1FJG E;  5GME A;  3OTO I;  1EI1 A;  5FLX C;  2Q2E B;  4P7A A;  4DR1 E;  1HNW I;  1XNR I;  4Z7Y A;  4JI8 I;  3M6A A;  1J5E E;  3HJC A;  4KQV A;  4M1K A;  2A2C A;  1IBM E;  3ZKD A;  1PIE A;  4K0K I;  1XHK A;  4WUD A;  2V2Z A;  1ELO A;  2VQE I;  1N32 I;  4JI5 E;  1FJG I;  3J80 Q;  1FWK A;  4PRX A;  4X64 E;  4DUZ E;  4DR1 I;  1MX0 A;  1NHJ A;  4B3T E;  3ZM7 A;  3Q6N A;  1J5E I;  1HR0 E;  1HNX E;  4JI1 E;  1NZ0 A;  1IBM I;  1QZR A;  2PNL A;  4URL A;  1N0V C;  1ZM3 A;  4DV6 E;  2O1W A;  3Q1Q A;  4JYA I;  5IWA E;  2E1R A;  2NPF A;  3LTO A;  4B3T I;  1HR0 I;  2CGE A;  4FW9 A;  2Z5E A;  4JI1 I;  4LF5 E;  4UTG A;  2HHH I;  3LNU A;  1NHH A;  3JAM C;  3K17 A;  1H74 A;  3ZZU A;  4NXN E;  4JI7 E;  4NXM E;  1KIJ A;  3T1Y E;  5IWA I;  3K85 A;  4LFB E;  5BR8 E;  4HAC A;  1MU5 A;  4JI6 E;  1A6F A;  4LF5 I;  4IZJ B;  2BV3 A;  2VQF I;  4PU9 A;  2X36 A;  4DPU A;  1RRE A;  1XMO E;  2XEX A;  1USV A;  2CG9 A;  1Z0B A;  2X7I A;  4KHP E;  2ZM6 I;  3T1Y I;  2UUA E;  5IT9 Q;  1EA6 A;  1HNW E;  1XNR E;  3P06 A;  1I94 I;  2DEJ A;  4MYT A;  2V2Q A;  4B3S E;  2GS8 A;  3QT6 A;  4WUB A;  4USM A;  4DR5 I;  1XMO I;  2PNM A;  4KHP I;  2R42 A;  1FKA E;  2UUA I;  1U2R A;  4FWH A;  1MG7 A;  3B82 A;  1N0U A;  1Z5C A;  4B3S I;  1RR9 A;  1Y4S A;  4DPW A;  2HK2 A;  4N3O A;  3WU6 A;  2EFG A;  2HFU A;  4JI4 E;  4RPF A;  2Z5C A;  3F0N A;  2O1U A;  2R3V A;  3T1H E;  1XMQ E;  4JYA E;  2Z5B A;  5LMU E;  2A2D A;  1PVG A;  4YHH E;  3ZZT A;  1NHI A;  4FWG A;  4GKK E;  3QT8 A;  1VIS A;  3ZZ0 A;  5A2Q C;  2ZIT A;  1B63 A;  2HHH E;  5LMN E;  3PYG A;  4JI4 I;  4DV3 I;  4LF7 E;  1KKH A;  4EMD A;  4LF9 E;  3WU4 A;  1ZM2 A;  2HKE A;  2IOQ A;  2UXD I;  3T1H I;  1XMQ I;  1HK7 A;  5LMU I;  4DV7 I;  2F4V E;  3J81 C;  4X66 E;  5L3J A;  4JI2 I;  4YHH I;  4DPX A;  4YY3 E;  1Z5A A;  2HFS A;  4GKK I;  4XTJ A;  2LJP A;  1D6T A;  4HY1 A;  4WUC A;  1N36 I;  1Z0G A;  5LMN I;  2VQF E;  5FLX Q;  4R1F A;  4LF7 I;  4LF9 I;  1Y6Z A;  3PYD A;  2ZM6 E;  4DV4 E;  2F4V I;  4X66 I;  2AJ4 A;  3J7A M;  2V2V A;  1FI4 A;  2DEI A;  4OX9 I;  1HNZ I;  4DV2 I;  4YY3 I;  2O1T A;  4I3H A;  1Z59 A;  1I94 E;  1FNM A;  1Z5B A;  1B62 A;  4DPT A;  4DR6 E;  4DR7 E;  4GKJ I;  3PYF A;  4DR5 E;  3B78 A;  4DV4 I;  1H7S A;  3J80 C;  3Q6M A;  2J7K A;  2HK3 A;  2UUC E;  4LF8 E;  4HAC B;  1KTV A;  1XNQ E;  2CZ9 A;  4USK A;  2UU9 E;  1H7U A;  4B3R E;  4DR6 I;  1KVK A;  1S16 A;  2V8P A;  4DR7 I;  2WW4 A;  4DV5 E;  2VF3 A;  3B8H A;  4LF6 E;  1N33 E;  4DR4 I;  1ZXN A;  1ZXM A;  4LFC E;  4IZK B;  4LFA I;  4PRV A;  4ZVI A;  3WU5 A;  4DR3 I;  2UUC I;  4LF8 I;  3GON A;  3JAM Q;  4FN5 A;  1XNQ I;  2UU9 I;  1PKP A;  3V2U C;  4B3R I;  4JV5 E;  4DR2 E;  4DV5 I;  4LF6 I;  4DV3 E;  1N33 I;  2UXB I;  2UXD E;  4LFC I;  3ZKB A;  4DV7 E;  4JG4 A;  1IBL E;  4JI2 E;  4HYM A;  4HXZ A;  5FWK A;  2E5L E;  4X62 I;  3CWV A;  4DV0 I;  1DAR A;  4JV5 I;  1N36 E;  4DR2 I;  3QT5 A;  4X65 E;  1Y4U A;  1Z0C A;  3V5R A;  3K1J A;  4AQY E;  1USU A;  2Z5C B;  4JI0 E;  4P52 A;  3WU3 A;  4DV1 E;  1Z0T A;  5GMD A;  1IBL I;  4LF4 E;  2UUB E;  2Z5B B;  2GQ0 A;  4OX9 E;  1HNZ E;  4DV2 E;  2IOP A;  1ZM4 A;  1S4E A;  2E5L I;  4B3M E;  5IT9 C;  4DU8 A;  1ZM9 A;  4FWD A;  5LL6 R;  4JI3 E;  1Z0V A;  4JI5 I;  4X65 I;  3HUL A;  4AQY I;  3PRY A;  4X64 I;  4DUZ I;  4GKJ E;  4DU7 A;  4JI0 I;  4MYU A;  4DV1 I;  4LF4 I;  4IZJ A;  1HNX I;  2UUB I;  3J7A G;  3H4L A;  4DUY E;  4B3M I;  2UXC E;  2BM0 A;  1FWL A;  3PYE A;  4JI3 I;  3D4J A;  1H73 A;  4UT4 A;  1WUU A;  1UEK A;  3QT7 A;  1OJ4 A;  1N34 E;  4DV6 I;  4DPY A;  2V34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...