1N32I

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n32I00
4DV2I 3V2UC 4JI4E 2NPFA 4K0KI 4DUZI 1MU5A 2VQEI 2HKEA 3F0NA 4JI2I 4X64E 1ZM3A 4Z7YA 1KIJA 1B63A 2UXCI 2XEXA 5A2QC 1IBKE 4P7AA 2BM1A 1Z0GA 4B3MI 4DV7I 5IT9Q 5BR8E 1BKNA 2Q2EB 5LMNE 3OTOE 4B3TE 2X7IA 3PYDA 1XNQI 1J5EE 4JI3I 4JI8E 1IBME 2VF3A 2UUCE 1EI1A 3B78A 4DV4E 2J7KA 4DPYA 3LPSA 3QT8A 4X66E 4LFBE 4JYAE 1I94I 5L3JA 1XHKA 4DR7E 4DV3I 4DV0I 4ED4A 3ZZ0A 1H72C 1N34I 1N32E 4DUYE 1Z0CA 1IBLI 3CWVA 1DARA 1OJ4A 4NXMI 2UXBE 2E5LI 2BM0A 1XNRI 1Z5CA 2DEIA 4B3RE 2UUBI 3K17A 4KHPI 1KTVA 3GONA 2HK2A 4LF4E 1H7SA 1ZXNA 1Z0TA 1XMQE 3WU5A 4JI0I 4HYMA 4DPUA 4LF5I 3QT6A 2GS8A 1NHIA 3JAMC 3T1HI 1HNXE 2UUAI 1ZM2A 1N33I 4DU8A 1N36E 4DV1E 2UXDE 3J7AG 1FJGE 4X65E 2UU9I 4LF7I 5FLXQ 2HK3A 4DR2I 1NHJA 4B3SI 4HXZA 3LTOA 4DR5I 4YY3I 4GKJI 2UXCE 1U2RA 3ZM7A 3T1YE 4UT4A 4DV7E 1ELOA 4DR1E 4NXNI 1B62A 4JI6E 4DV6E 2ZM6I 4JI3E 4LFAE 1VISA 1EA6A 2VQFI 3ZKBA 3J80C 1HNZI 4JI7I 1XMOE 1S4EA 3LNUA 4JI1I 3V5RA 4LF8I 2BV3A 1HNWE 4LF9E 4PRXA 3J81C 4RPFA 4OX9I 4YHHI 4XTJA 2V2ZA 4DV3E 1FNMA 3Q1QA 1Z5BA 1FKAE 1Z59A 4DR3E 4DR6I 4USKA 1Z0EA 4JV5E 2OI2A 2F4VE 4JI4I 2E5LE 4GKKI 1RR9A 2AJ4A 4I3HA 1KVKA 4P52A 4WUBA 4JI5E 4USMA 4DU7A 4MYUA 1D6TA 4M1KA 4LF5E 4AQYE 5BR8I 2LJPA 2DEJA 4FWGA 4UTGA 2HHHI 3PYEA 3OTOI 4B3TI 3PYFA 5LMUE 4HACA 2R3VA 1J5EI 4JI8I 1IBMI 2HKJA 5IWAE 2UUCI 1Z5AA 4KQVA 4DV5E 4DV4I 1S16A 4X66I 1HR0E 5IT9C 4LF6E 2ZBKB 3M6AA 4X62I 4LFBI 1MX0A 4JYAI 4YY3E 2HFSA 2E1RA 4HACB 1PIEA 4DR4I 3K1JA 5A2QQ 3J81Q 4DV2E 1N32I 4DUYI 4K0KE 2ZM6E 4DUZE 2VQEE 4JI2E 1N0UA 1ZM4A 3HULA 3H4LA 2UXBI 4B3RI 4B3ME 2V8PA 4DXLA 4LF4I 4R1FA 1XNQE 1XMQI 3ZKDA 1PVGA 4LFCI 4ZVIA 1N0VC 1HNXI 1Z0BA 1FWKA 2CZ9A 4EMDA 4GKKE 4HY1A 1I94E 1N36I 4WUCA 1FWLA 4DV1I 4DV0E 2UXDI 1FJGI 1RREA 1KKHA 4X65I 4JG4A 1N34E 1PKPA 2X36A 1IBLE 3ZZTA 3PYGA 3T1YI 2A2CA 4DPXA 4NXME 4DR1I 2HHHE 3WU6A 2V2QA 1MG7A 4JI6I 1XNRE 4DV6I 3JAMQ 2UUBE 4KHPE 5FLXC 4LFAI 4X64I 3B8HA 1XMOI 5LL6R 2HFUA 1H74A 4PU9A 1HNWI 1IBKI 4LF9I 4JI0E 2V2VA 4FN5A 5GMEA 4X62E 1Z0VA 1A6FA 4DPTA 3T1HE 5LMNI 4DR4E 1FI4A 2UUAE 4DR3I 1N33E 1NZ0A 2V34A 2EFGA 2ZITA 4JV5I 4LF7E 2UU9E 4FWHA 1H73A 2F4VI 4DR2E 4URLA 3J80Q 4B3SE 4DR5E 4GKJE 5GMDA 2WW4A 4DR7I 4Z7CA 1QZRA 4PRVA 4NXNE 4DPWA 1K47A 4JI5I 3QT7A 1UEKA 2VQFE 1HNZE 4JI7E 4FWDA 4AQYI 4LFCE 3ZZUA 4FW9A 3D4JA 4JI1E 4LF8E 4WUDA 5LMUI 1WUUA 5IWAI 4OX9E 4DV5I 2R42A 4YHHE 1Z0WA 3QT5A 4MYTA 1NHHA 1H7UA 1HR0I 3J7AM 4LF6I 3WU3A 1ZM9A 4DR6E 1ZXMA 3B82A 3WU4A 2A2DA
chains in the Genus database with same CATH superfamily
3GLLA 4DV2I 3V2UC 3P06A 4JI4E 2NPFA 1P42A 4K0KI 2JEAA 3KRNA 4DUZI 1MU5A 2VQEI 2HKEA 3F0NA 2PNLA 4X64E 4JI2I 1ZM3A 4ISAA 4MU1A 4IFDC 4Z7YA 1KIJA 1B63A 2UXCI 2XEXA 5A2QC 1IBKE 4P7AA 4NBQA 2BM1A 3M7ND 1Z0GA 3M85G 5K36D 2O1VA 4B3MI 4DV7I 5IT9Q 5BR8E 3NZKA 2O1UA 4BA2B 2JEAB 3P76A 1BKNA 2Q2EB 5LMNE 3OTOE 4B3TE 2X7IA 3PYDA 1XNQI 4BA1A 1J5EE 4JI3I 4JI8E 1VI7A 1IBME 4MDTA 2VF3A 2UUCE 1EI1A 3B78A 4DV4E 2J7KA 1Y4SA 2VESA 4DPYA 4GQUA 3LPSA 3QT8A 1UDQA 4OO1D 2BA1G 4X66E 4N3OA 4LFBE 4JYAE 1I94I 4AIMA 5JEAA 5L3JA 1XHKA 4DR7E 4DV3I 4DV0I 4ED4A 4BA1B 3ZZ0A 1H72C 2NN6B 1N34I 1N32E 4DUYE 1Z0CA 1IBLI 5K36A 2JEBB 2JT2A 3CWVA 5DRPA 1DARA 1USVA 2Z5CA 4IFDE 2BR2A 1OJ4A 1OYRA 5EL9A 4NXMI 2UXBE 4J3DA 2E5LI 2BM0A 1XNRI 1Z5CA 4LPFA 2DEIA 4B3RE 5ELWA 2UUBI 3K17A 4KHPI 2BA1D 1KTVA 3GONA 1OYPA 2HK2A 4LF4E 3Q6NA 4OO1A 5K36B 5C0XD 1H7SA 1ZXNA 4U3BA 1XXEA 1Z0TA 2Z5CB 1XMQE 2BR2B 3WU5A 4JI0I 4HYMA 4DPUA 4LF5I 4OKGA 4LCGA 3QT6A 2GS8A 1NHIA 3JAMC 3T1HI 1HNXE 2CVEA 1Y6ZA 2UUAI 4OO1B 2BA0G 5JEAC 1ZM2A 1N33I 4DU8A 1N36E 4DV1E 2UXDE 3J7AG 1FJGE 3CDJA 4X65E 2UU9I 4LF7I 5FLXQ 2HK3A 4DR2I 1NHJA 4B3SI 4HXZA 3LTOA 4DR5I 4YY3I 4GKJI 2UXCE 1U2RA 3ZM7A 5DNXA 3T1YE 5C0XA 2WNRB 4UT4A 1Y4UA 4LCHA 4DV7E 1ELOA 4DR1E 2C38A 1B62A 4NXNI 4BA2A 4JI6E 4DV6E 3K85A 2ZM6I 3P3EA 4IZJD 4JI3E 4LFAE 1VISA 2C39A 1EA6A 2CG9A 2VQFI 3ZKBA 3J80C 1HNZI 4JI7I 2AE8A 1XMOE 1S4EA 3LNUA 4JI1I 3V5RA 4LF8I 5C0XB 2BV3A 1HNWE 2PO1A 4LF9E 4PRXA 3J81C 2F1DA 1YHCA 2C38B 4RPFA 4OX9I 2PO0A 2CGEA 4YHHI 4XTJA 2IOQA 2V2ZA 4DV3E 3DD6A 1FNMA 3Q1QA 2C39B 1Z5BA 5JEAE 1FKAE 1Z59A 4DR3E 2NN6A 1OYSA 5DRQA 4DR6I 2PO1B 4USKA 1Z0EA 2GO4A 2JEBA 4LCFA 4JV5E 4U3DA 2O1TA 2OI2A 2F4VE 4IZJA 4JI4I 4FW7A 2PO0B 2E5LE 4GKKI 4QNKA 1RR9A 2AJ4A 3GCMA 2JE6B 4I3HA 2WP8A 5JEAF 3M85D 1Y60A 1KVKA 4P52A 4WUBA 4JI5E 5DNLA 4USMA 4DU7A 4MYUA 1D6TA 5K36F 4M1KA 4LF5E 4IFDD 4IZJB 4AQYE 5BR8I 2LJPA 2DEJA 4FWGA 4UTGA 2HHHI 3PYEA 3OTOI 4B3TI 3PYFA 2WP8B 5LMUE 4HACA 2R3VA 3P3GA 4JI8I 1J5EI 1IBMI 2HKJA 4MU4A 5IWAE 2UUCI 1Z5AA 4KQVA 4DV5E 4DV4I 1S16A 4OO1F 1Y5YA 2Z5EA 4X66I 1HR0E 5IT9C 4LF6E 2ZBKB 3M6AA 2NN6C 4X62I 4LFBI 1MX0A 4JYAI 4YY3E 2HFSA 2E1RA 3CDIA 4HACB 1PIEA 4DR4I 3K1JA 5A2QQ 3J81Q 2WNRA 4DV2E 1N32I 4DUYI 4K0KE 2PNZA 3PS3A 2ZM6E 4DUZE 1UDSA 2IERA 2VQEE 1USUA 4JI2E 1N0UA 1ZM4A 3HULA 2C37A 3H4LA 2UXBI 5K36C 2GQ0A 4B3RI 3PS1A 4B3ME 2V8PA 4DXLA 4LF4I 5C0XF 4IFDB 2PNZB 4AIDA 4R1FA 4MU3A 1XNQE 1XMQI 3B4TA 2C37B 3ZKDA 1PVGA 4OO1C 4LOMA 4LFCI 2BA0D 2PO2A 1N0VC 4ZVIA 1HNXI 3HKMA 1Z0BA 3PS2A 1FWKA 2J65A 2CZ9A 4EMDA 1UDOA 4GKKE 1HK7A 4HY1A 1I94E 1N36I 4WUCA 1E3HA 1FWLA 4DV1I 4DV0E 2O3ZA 4MQYA 2UXDI 1FJGI 2JE6A 1RREA 1KKHA 5JEAD 4X65I 4JG4A 1N34E 2PO2B 3L7ZB 4AM3A 1PKPA 2X36A 1IBLE 3ZZTA 3PYGA 3T1YI 3P3CA 2A2CA 2NN6F 2Z5BA 4DPXA 5K36E 3HJCA 1R6LA 3U1KA 4NXME 4DR1I 2HHHE 3WU6A 2V2QA 1MG7A 4JI6I 5C0XC 1XNRE 4DV6I 3JAMQ 2UUBE 4KHPE 5FLXC 4LFAI 4X64I 5DROA 3B8HA 1XMOI 5LL6R 2HFUA 1H74A 4PU9A 1HNWI 1YH8A 2Z5BB 1IBKI 4LF9I 4OO1E 4JI0E 2V2VA 4FN5A 4MU0A 5GMEA 1RHYA 4X62E 1Z0VA 1A6FA 4FW5A 4DPTA 3T1HE 5LMNI 4DR4E 1FI4A 5DRRA 2UUAE 4DR3I 4FW3A 1N33E 1NZ0A 2V34A 2EFGA 2ZITA 4JV5I 4LF7E 2UU9E 4FWHA 1H73A 2F4VI 5JEAB 4DR2E 2GO3A 4URLA 3J80Q 4B3SE 1R6MA 4DR5E 4GKJE 5GMDA 2WW4A 4DR7I 4Z7CA 1QZRA 5EKWA 3U1YA 4FW6A 2IOPA 5C0XE 3PRYA 4PRVA 4NXNE 4DPWA 1K47A 4IFDA 4JI5I 4IZKA 3QT7A 1E3PA 4IFDF 1UEKA 2VQFE 1HNZE 4JI7E 4FWDA 4AQYI 4LFCE 3H1CA 3ZZUA 4FW9A 3D4JA 4JI1E 4LF8E 1UDNA 4WUDA 3Q6MA 5LMUI 5FWKA 4OZEA 4IS9A 1WUUA 5IWAI 4OX9E 2PNMA 4DV5I 2R42A 4IZKB 3UHMA 4YHHE 1Z0WA 2IESA 3QT5A 3M7NG 4MYTA 1NHHA 1H7UA 1HR0I 3GMEA 3J7AM 4LF6I 3WU3A 2O1WA 1ZM9A 4QNJA 4DR6E 3L7ZA 1ZXMA 4FW4A 3B82A 3WU4A 2NN6D 2NN6E 2A2DA
chains in the Genus database with same CATH topology
4DV2I 3V2UC 3P06A 4JI4E 2NPFA 4K0KI 4DUZI 1MU5A 2VQEI 2HKEA 3F0NA 2PNLA 4X64E 4JI2I 1ZM3A 4Z7YA 1KIJA 1B63A 2UXCI 2XEXA 5A2QC 1IBKE 4P7AA 2BM1A 1Z0GA 2O1VA 4B3MI 4DV7I 5IT9Q 5BR8E 2O1UA 1BKNA 2Q2EB 5LMNE 3OTOE 4B3TE 2X7IA 3PYDA 1XNQI 1J5EE 4JI3I 4JI8E 1IBME 2VF3A 2UUCE 1EI1A 3B78A 4DV4E 2J7KA 1Y4SA 4DPYA 3LPSA 3QT8A 4X66E 4N3OA 4LFBE 4JYAE 1I94I 5L3JA 1XHKA 4DR7E 4DV3I 4DV0I 4ED4A 3ZZ0A 1H72C 1N34I 1N32E 4DUYE 1Z0CA 1IBLI 3CWVA 1DARA 1USVA 2Z5CA 1OJ4A 4NXMI 2UXBE 2E5LI 2BM0A 1XNRI 1Z5CA 2DEIA 4B3RE 2UUBI 3K17A 4KHPI 1KTVA 3GONA 2HK2A 4LF4E 3Q6NA 1H7SA 1ZXNA 1Z0TA 2Z5CB 1XMQE 3WU5A 4JI0I 4HYMA 4DPUA 4LF5I 3QT6A 2GS8A 1NHIA 3JAMC 3T1HI 1HNXE 1Y6ZA 2UUAI 1ZM2A 1N33I 4DU8A 1N36E 4DV1E 2UXDE 3J7AG 1FJGE 4X65E 2UU9I 4LF7I 5FLXQ 2HK3A 4DR2I 1NHJA 4B3SI 4HXZA 3LTOA 4DR5I 4YY3I 4GKJI 2UXCE 1U2RA 3ZM7A 3T1YE 4UT4A 1Y4UA 4DV7E 1ELOA 4DR1E 4NXNI 1B62A 4JI6E 4DV6E 3K85A 2ZM6I 4IZJD 4JI3E 4LFAE 1VISA 2CG9A 1EA6A 2VQFI 3ZKBA 3J80C 1HNZI 4JI7I 1XMOE 1S4EA 3LNUA 4JI1I 3V5RA 4LF8I 2BV3A 1HNWE 4LF9E 4PRXA 3J81C 4RPFA 4OX9I 2CGEA 4YHHI 4XTJA 2IOQA 2V2ZA 4DV3E 1FNMA 3Q1QA 1Z5BA 1FKAE 1Z59A 4DR3E 4DR6I 4USKA 1Z0EA 4JV5E 2O1TA 2OI2A 2F4VE 4IZJA 4JI4I 2E5LE 4GKKI 1RR9A 2AJ4A 4I3HA 1KVKA 4P52A 4WUBA 4JI5E 4USMA 4DU7A 4MYUA 1D6TA 4M1KA 4LF5E 4IZJB 4AQYE 5BR8I 2LJPA 2DEJA 4FWGA 4UTGA 2HHHI 3PYEA 3OTOI 4B3TI 3PYFA 5LMUE 4HACA 2R3VA 1J5EI 4JI8I 1IBMI 2HKJA 5IWAE 2UUCI 1Z5AA 4KQVA 4DV5E 4DV4I 1S16A 2Z5EA 4X66I 1HR0E 5IT9C 4LF6E 2ZBKB 3M6AA 4X62I 4LFBI 1MX0A 4JYAI 4YY3E 2HFSA 2E1RA 4HACB 1PIEA 4DR4I 3K1JA 5A2QQ 3J81Q 4DV2E 1N32I 4DUYI 4K0KE 2ZM6E 4DUZE 2VQEE 1USUA 4JI2E 1N0UA 1ZM4A 3HULA 3H4LA 2UXBI 2GQ0A 4B3RI 4B3ME 2V8PA 4DXLA 4LF4I 4R1FA 1XNQE 1XMQI 3ZKDA 1PVGA 4LFCI 4ZVIA 1N0VC 1HNXI 1Z0BA 1FWKA 2CZ9A 4EMDA 4GKKE 1HK7A 4HY1A 1I94E 1N36I 4WUCA 1FWLA 4DV1I 4DV0E 2UXDI 1FJGI 1RREA 1KKHA 4X65I 4JG4A 1N34E 1PKPA 2X36A 1IBLE 3ZZTA 3PYGA 3T1YI 2A2CA 2Z5BA 4DPXA 3HJCA 4NXME 4DR1I 2HHHE 3WU6A 2V2QA 1MG7A 4JI6I 1XNRE 4DV6I 3JAMQ 2UUBE 4KHPE 5FLXC 4LFAI 4X64I 3B8HA 1XMOI 5LL6R 2HFUA 1H74A 4PU9A 1HNWI 2Z5BB 1IBKI 4LF9I 4JI0E 2V2VA 4FN5A 5GMEA 4X62E 1Z0VA 1A6FA 4DPTA 3T1HE 5LMNI 4DR4E 1FI4A 2UUAE 4DR3I 1N33E 1NZ0A 2V34A 2EFGA 2ZITA 4JV5I 4LF7E 2UU9E 4FWHA 1H73A 2F4VI 4DR2E 4URLA 3J80Q 4B3SE 4DR5E 4GKJE 5GMDA 2WW4A 4DR7I 4Z7CA 1QZRA 2IOPA 3PRYA 4PRVA 4NXNE 4DPWA 1K47A 4JI5I 4IZKA 3QT7A 1UEKA 2VQFE 1HNZE 4JI7E 4FWDA 4AQYI 4LFCE 3ZZUA 4FW9A 3D4JA 4JI1E 4LF8E 4WUDA 3Q6MA 5LMUI 5FWKA 1WUUA 5IWAI 4OX9E 2PNMA 4DV5I 2R42A 4IZKB 4YHHE 1Z0WA 3QT5A 4MYTA 1NHHA 1H7UA 1HR0I 3J7AM 4LF6I 3WU3A 2O1WA 1ZM9A 4DR6E 1ZXMA 3B82A 3WU4A 2A2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 I;  3V2U C;  4JI4 E;  2NPF A;  4K0K I;  4DUZ I;  1MU5 A;  2VQE I;  2HKE A;  3F0N A;  4JI2 I;  4X64 E;  1ZM3 A;  4Z7Y A;  1KIJ A;  1B63 A;  2UXC I;  2XEX A;  5A2Q C;  1IBK E;  4P7A A;  2BM1 A;  1Z0G A;  4B3M I;  4DV7 I;  5IT9 Q;  5BR8 E;  1BKN A;  2Q2E B;  5LMN E;  3OTO E;  4B3T E;  2X7I A;  3PYD A;  1XNQ I;  1J5E E;  4JI3 I;  4JI8 E;  1IBM E;  2VF3 A;  2UUC E;  1EI1 A;  3B78 A;  4DV4 E;  2J7K A;  4DPY A;  3LPS A;  3QT8 A;  4X66 E;  4LFB E;  4JYA E;  1I94 I;  5L3J A;  1XHK A;  4DR7 E;  4DV3 I;  4DV0 I;  4ED4 A;  3ZZ0 A;  1H72 C;  1N34 I;  1N32 E;  4DUY E;  1Z0C A;  1IBL I;  3CWV A;  1DAR A;  1OJ4 A;  4NXM I;  2UXB E;  2E5L I;  2BM0 A;  1XNR I;  1Z5C A;  2DEI A;  4B3R E;  2UUB I;  3K17 A;  4KHP I;  1KTV A;  3GON A;  2HK2 A;  4LF4 E;  1H7S A;  1ZXN A;  1Z0T A;  1XMQ E;  3WU5 A;  4JI0 I;  4HYM A;  4DPU A;  4LF5 I;  3QT6 A;  2GS8 A;  1NHI A;  3JAM C;  3T1H I;  1HNX E;  2UUA I;  1ZM2 A;  1N33 I;  4DU8 A;  1N36 E;  4DV1 E;  2UXD E;  3J7A G;  1FJG E;  4X65 E;  2UU9 I;  4LF7 I;  5FLX Q;  2HK3 A;  4DR2 I;  1NHJ A;  4B3S I;  4HXZ A;  3LTO A;  4DR5 I;  4YY3 I;  4GKJ I;  2UXC E;  1U2R A;  3ZM7 A;  3T1Y E;  4UT4 A;  4DV7 E;  1ELO A;  4DR1 E;  4NXN I;  1B62 A;  4JI6 E;  4DV6 E;  2ZM6 I;  4JI3 E;  4LFA E;  1VIS A;  1EA6 A;  2VQF I;  3ZKB A;  3J80 C;  1HNZ I;  4JI7 I;  1XMO E;  1S4E A;  3LNU A;  4JI1 I;  3V5R A;  4LF8 I;  2BV3 A;  1HNW E;  4LF9 E;  4PRX A;  3J81 C;  4RPF A;  4OX9 I;  4YHH I;  4XTJ A;  2V2Z A;  4DV3 E;  1FNM A;  3Q1Q A;  1Z5B A;  1FKA E;  1Z59 A;  4DR3 E;  4DR6 I;  4USK A;  1Z0E A;  4JV5 E;  2OI2 A;  2F4V E;  4JI4 I;  2E5L E;  4GKK I;  1RR9 A;  2AJ4 A;  4I3H A;  1KVK A;  4P52 A;  4WUB A;  4JI5 E;  4USM A;  4DU7 A;  4MYU A;  1D6T A;  4M1K A;  4LF5 E;  4AQY E;  5BR8 I;  2LJP A;  2DEJ A;  4FWG A;  4UTG A;  2HHH I;  3PYE A;  3OTO I;  4B3T I;  3PYF A;  5LMU E;  4HAC A;  2R3V A;  1J5E I;  4JI8 I;  1IBM I;  2HKJ A;  5IWA E;  2UUC I;  1Z5A A;  4KQV A;  4DV5 E;  4DV4 I;  1S16 A;  4X66 I;  1HR0 E;  5IT9 C;  4LF6 E;  2ZBK B;  3M6A A;  4X62 I;  4LFB I;  1MX0 A;  4JYA I;  4YY3 E;  2HFS A;  2E1R A;  4HAC B;  1PIE A;  4DR4 I;  3K1J A;  5A2Q Q;  3J81 Q;  4DV2 E;  1N32 I;  4DUY I;  4K0K E;  2ZM6 E;  4DUZ E;  2VQE E;  4JI2 E;  1N0U A;  1ZM4 A;  3HUL A;  3H4L A;  2UXB I;  4B3R I;  4B3M E;  2V8P A;  4DXL A;  4LF4 I;  4R1F A;  1XNQ E;  1XMQ I;  3ZKD A;  1PVG A;  4LFC I;  4ZVI A;  1N0V C;  1HNX I;  1Z0B A;  1FWK A;  2CZ9 A;  4EMD A;  4GKK E;  4HY1 A;  1I94 E;  1N36 I;  4WUC A;  1FWL A;  4DV1 I;  4DV0 E;  2UXD I;  1FJG I;  1RRE A;  1KKH A;  4X65 I;  4JG4 A;  1N34 E;  1PKP A;  2X36 A;  1IBL E;  3ZZT A;  3PYG A;  3T1Y I;  2A2C A;  4DPX A;  4NXM E;  4DR1 I;  2HHH E;  3WU6 A;  2V2Q A;  1MG7 A;  4JI6 I;  1XNR E;  4DV6 I;  3JAM Q;  2UUB E;  4KHP E;  5FLX C;  4LFA I;  4X64 I;  3B8H A;  1XMO I;  5LL6 R;  2HFU A;  1H74 A;  4PU9 A;  1HNW I;  1IBK I;  4LF9 I;  4JI0 E;  2V2V A;  4FN5 A;  5GME A;  4X62 E;  1Z0V A;  1A6F A;  4DPT A;  3T1H E;  5LMN I;  4DR4 E;  1FI4 A;  2UUA E;  4DR3 I;  1N33 E;  1NZ0 A;  2V34 A;  2EFG A;  2ZIT A;  4JV5 I;  4LF7 E;  2UU9 E;  4FWH A;  1H73 A;  2F4V I;  4DR2 E;  4URL A;  3J80 Q;  4B3S E;  4DR5 E;  4GKJ E;  5GMD A;  2WW4 A;  4DR7 I;  4Z7C A;  1QZR A;  4PRV A;  4NXN E;  4DPW A;  1K47 A;  4JI5 I;  3QT7 A;  1UEK A;  2VQF E;  1HNZ E;  4JI7 E;  4FWD A;  4AQY I;  4LFC E;  3ZZU A;  4FW9 A;  3D4J A;  4JI1 E;  4LF8 E;  4WUD A;  5LMU I;  1WUU A;  5IWA I;  4OX9 E;  4DV5 I;  2R42 A;  4YHH E;  1Z0W A;  3QT5 A;  4MYT A;  1NHH A;  1H7U A;  1HR0 I;  3J7A M;  4LF6 I;  3WU3 A;  1ZM9 A;  4DR6 E;  1ZXM A;  3B82 A;  3WU4 A;  2A2D A; 
#chains in the Genus database with same CATH topology
 3GLL A;  4DV2 I;  3V2U C;  3P06 A;  4JI4 E;  2NPF A;  1P42 A;  4K0K I;  2JEA A;  3KRN A;  4DUZ I;  1MU5 A;  2VQE I;  2HKE A;  3F0N A;  2PNL A;  4X64 E;  4JI2 I;  1ZM3 A;  4ISA A;  4MU1 A;  4IFD C;  4Z7Y A;  1KIJ A;  1B63 A;  2UXC I;  2XEX A;  5A2Q C;  1IBK E;  4P7A A;  4NBQ A;  2BM1 A;  3M7N D;  1Z0G A;  3M85 G;  5K36 D;  2O1V A;  4B3M I;  4DV7 I;  5IT9 Q;  5BR8 E;  3NZK A;  2O1U A;  4BA2 B;  2JEA B;  3P76 A;  1BKN A;  2Q2E B;  5LMN E;  3OTO E;  4B3T E;  2X7I A;  3PYD A;  1XNQ I;  4BA1 A;  1J5E E;  4JI3 I;  4JI8 E;  1VI7 A;  1IBM E;  4MDT A;  2VF3 A;  2UUC E;  1EI1 A;  3B78 A;  4DV4 E;  2J7K A;  1Y4S A;  2VES A;  4DPY A;  4GQU A;  3LPS A;  3QT8 A;  1UDQ A;  4OO1 D;  2BA1 G;  4X66 E;  4N3O A;  4LFB E;  4JYA E;  1I94 I;  4AIM A;  5JEA A;  5L3J A;  1XHK A;  4DR7 E;  4DV3 I;  4DV0 I;  4ED4 A;  4BA1 B;  3ZZ0 A;  1H72 C;  2NN6 B;  1N34 I;  1N32 E;  4DUY E;  1Z0C A;  1IBL I;  5K36 A;  2JEB B;  2JT2 A;  3CWV A;  5DRP A;  1DAR A;  1USV A;  2Z5C A;  4IFD E;  2BR2 A;  1OJ4 A;  1OYR A;  5EL9 A;  4NXM I;  2UXB E;  4J3D A;  2E5L I;  2BM0 A;  1XNR I;  1Z5C A;  4LPF A;  2DEI A;  4B3R E;  5ELW A;  2UUB I;  3K17 A;  4KHP I;  2BA1 D;  1KTV A;  3GON A;  1OYP A;  2HK2 A;  4LF4 E;  3Q6N A;  4OO1 A;  5K36 B;  5C0X D;  1H7S A;  1ZXN A;  4U3B A;  1XXE A;  1Z0T A;  2Z5C B;  1XMQ E;  2BR2 B;  3WU5 A;  4JI0 I;  4HYM A;  4DPU A;  4LF5 I;  4OKG A;  4LCG A;  3QT6 A;  2GS8 A;  1NHI A;  3JAM C;  3T1H I;  1HNX E;  2CVE A;  1Y6Z A;  2UUA I;  4OO1 B;  2BA0 G;  5JEA C;  1ZM2 A;  1N33 I;  4DU8 A;  1N36 E;  4DV1 E;  2UXD E;  3J7A G;  1FJG E;  3CDJ A;  4X65 E;  2UU9 I;  4LF7 I;  5FLX Q;  2HK3 A;  4DR2 I;  1NHJ A;  4B3S I;  4HXZ A;  3LTO A;  4DR5 I;  4YY3 I;  4GKJ I;  2UXC E;  1U2R A;  3ZM7 A;  5DNX A;  3T1Y E;  5C0X A;  2WNR B;  4UT4 A;  1Y4U A;  4LCH A;  4DV7 E;  1ELO A;  4DR1 E;  2C38 A;  1B62 A;  4NXN I;  4BA2 A;  4JI6 E;  4DV6 E;  3K85 A;  2ZM6 I;  3P3E A;  4IZJ D;  4JI3 E;  4LFA E;  1VIS A;  2C39 A;  1EA6 A;  2CG9 A;  2VQF I;  3ZKB A;  3J80 C;  1HNZ I;  4JI7 I;  2AE8 A;  1XMO E;  1S4E A;  3LNU A;  4JI1 I;  3V5R A;  4LF8 I;  5C0X B;  2BV3 A;  1HNW E;  2PO1 A;  4LF9 E;  4PRX A;  3J81 C;  2F1D A;  1YHC A;  2C38 B;  4RPF A;  4OX9 I;  2PO0 A;  2CGE A;  4YHH I;  4XTJ A;  2IOQ A;  2V2Z A;  4DV3 E;  3DD6 A;  1FNM A;  3Q1Q A;  2C39 B;  1Z5B A;  5JEA E;  1FKA E;  1Z59 A;  4DR3 E;  2NN6 A;  1OYS A;  5DRQ A;  4DR6 I;  2PO1 B;  4USK A;  1Z0E A;  2GO4 A;  2JEB A;  4LCF A;  4JV5 E;  4U3D A;  2O1T A;  2OI2 A;  2F4V E;  4IZJ A;  4JI4 I;  4FW7 A;  2PO0 B;  2E5L E;  4GKK I;  4QNK A;  1RR9 A;  2AJ4 A;  3GCM A;  2JE6 B;  4I3H A;  2WP8 A;  5JEA F;  3M85 D;  1Y60 A;  1KVK A;  4P52 A;  4WUB A;  4JI5 E;  5DNL A;  4USM A;  4DU7 A;  4MYU A;  1D6T A;  5K36 F;  4M1K A;  4LF5 E;  4IFD D;  4IZJ B;  4AQY E;  5BR8 I;  2LJP A;  2DEJ A;  4FWG A;  4UTG A;  2HHH I;  3PYE A;  3OTO I;  4B3T I;  3PYF A;  2WP8 B;  5LMU E;  4HAC A;  2R3V A;  3P3G A;  4JI8 I;  1J5E I;  1IBM I;  2HKJ A;  4MU4 A;  5IWA E;  2UUC I;  1Z5A A;  4KQV A;  4DV5 E;  4DV4 I;  1S16 A;  4OO1 F;  1Y5Y A;  2Z5E A;  4X66 I;  1HR0 E;  5IT9 C;  4LF6 E;  2ZBK B;  3M6A A;  2NN6 C;  4X62 I;  4LFB I;  1MX0 A;  4JYA I;  4YY3 E;  2HFS A;  2E1R A;  3CDI A;  4HAC B;  1PIE A;  4DR4 I;  3K1J A;  5A2Q Q;  3J81 Q;  2WNR A;  4DV2 E;  1N32 I;  4DUY I;  4K0K E;  2PNZ A;  3PS3 A;  2ZM6 E;  4DUZ E;  1UDS A;  2IER A;  2VQE E;  1USU A;  4JI2 E;  1N0U A;  1ZM4 A;  3HUL A;  2C37 A;  3H4L A;  2UXB I;  5K36 C;  2GQ0 A;  4B3R I;  3PS1 A;  4B3M E;  2V8P A;  4DXL A;  4LF4 I;  5C0X F;  4IFD B;  2PNZ B;  4AID A;  4R1F A;  4MU3 A;  1XNQ E;  1XMQ I;  3B4T A;  2C37 B;  3ZKD A;  1PVG A;  4OO1 C;  4LOM A;  4LFC I;  2BA0 D;  2PO2 A;  1N0V C;  4ZVI A;  1HNX I;  3HKM A;  1Z0B A;  3PS2 A;  1FWK A;  2J65 A;  2CZ9 A;  4EMD A;  1UDO A;  4GKK E;  1HK7 A;  4HY1 A;  1I94 E;  1N36 I;  4WUC A;  1E3H A;  1FWL A;  4DV1 I;  4DV0 E;  2O3Z A;  4MQY A;  2UXD I;  1FJG I;  2JE6 A;  1RRE A;  1KKH A;  5JEA D;  4X65 I;  4JG4 A;  1N34 E;  2PO2 B;  3L7Z B;  4AM3 A;  1PKP A;  2X36 A;  1IBL E;  3ZZT A;  3PYG A;  3T1Y I;  3P3C A;  2A2C A;  2NN6 F;  2Z5B A;  4DPX A;  5K36 E;  3HJC A;  1R6L A;  3U1K A;  4NXM E;  4DR1 I;  2HHH E;  3WU6 A;  2V2Q A;  1MG7 A;  4JI6 I;  5C0X C;  1XNR E;  4DV6 I;  3JAM Q;  2UUB E;  4KHP E;  5FLX C;  4LFA I;  4X64 I;  5DRO A;  3B8H A;  1XMO I;  5LL6 R;  2HFU A;  1H74 A;  4PU9 A;  1HNW I;  1YH8 A;  2Z5B B;  1IBK I;  4LF9 I;  4OO1 E;  4JI0 E;  2V2V A;  4FN5 A;  4MU0 A;  5GME A;  1RHY A;  4X62 E;  1Z0V A;  1A6F A;  4FW5 A;  4DPT A;  3T1H E;  5LMN I;  4DR4 E;  1FI4 A;  5DRR A;  2UUA E;  4DR3 I;  4FW3 A;  1N33 E;  1NZ0 A;  2V34 A;  2EFG A;  2ZIT A;  4JV5 I;  4LF7 E;  2UU9 E;  4FWH A;  1H73 A;  2F4V I;  5JEA B;  4DR2 E;  2GO3 A;  4URL A;  3J80 Q;  4B3S E;  1R6M A;  4DR5 E;  4GKJ E;  5GMD A;  2WW4 A;  4DR7 I;  4Z7C A;  1QZR A;  5EKW A;  3U1Y A;  4FW6 A;  2IOP A;  5C0X E;  3PRY A;  4PRV A;  4NXN E;  4DPW A;  1K47 A;  4IFD A;  4JI5 I;  4IZK A;  3QT7 A;  1E3P A;  4IFD F;  1UEK A;  2VQF E;  1HNZ E;  4JI7 E;  4FWD A;  4AQY I;  4LFC E;  3H1C A;  3ZZU A;  4FW9 A;  3D4J A;  4JI1 E;  4LF8 E;  1UDN A;  4WUD A;  3Q6M A;  5LMU I;  5FWK A;  4OZE A;  4IS9 A;  1WUU A;  5IWA I;  4OX9 E;  2PNM A;  4DV5 I;  2R42 A;  4IZK B;  3UHM A;  4YHH E;  1Z0W A;  2IES A;  3QT5 A;  3M7N G;  4MYT A;  1NHH A;  1H7U A;  1HR0 I;  3GME A;  3J7A M;  4LF6 I;  3WU3 A;  2O1W A;  1ZM9 A;  4QNJ A;  4DR6 E;  3L7Z A;  1ZXM A;  4FW4 A;  3B82 A;  3WU4 A;  2NN6 D;  2NN6 E;  2A2D A; 
#chains in the Genus database with same CATH homology
 4DV2 I;  3V2U C;  3P06 A;  4JI4 E;  2NPF A;  4K0K I;  4DUZ I;  1MU5 A;  2VQE I;  2HKE A;  3F0N A;  2PNL A;  4X64 E;  4JI2 I;  1ZM3 A;  4Z7Y A;  1KIJ A;  1B63 A;  2UXC I;  2XEX A;  5A2Q C;  1IBK E;  4P7A A;  2BM1 A;  1Z0G A;  2O1V A;  4B3M I;  4DV7 I;  5IT9 Q;  5BR8 E;  2O1U A;  1BKN A;  2Q2E B;  5LMN E;  3OTO E;  4B3T E;  2X7I A;  3PYD A;  1XNQ I;  1J5E E;  4JI3 I;  4JI8 E;  1IBM E;  2VF3 A;  2UUC E;  1EI1 A;  3B78 A;  4DV4 E;  2J7K A;  1Y4S A;  4DPY A;  3LPS A;  3QT8 A;  4X66 E;  4N3O A;  4LFB E;  4JYA E;  1I94 I;  5L3J A;  1XHK A;  4DR7 E;  4DV3 I;  4DV0 I;  4ED4 A;  3ZZ0 A;  1H72 C;  1N34 I;  1N32 E;  4DUY E;  1Z0C A;  1IBL I;  3CWV A;  1DAR A;  1USV A;  2Z5C A;  1OJ4 A;  4NXM I;  2UXB E;  2E5L I;  2BM0 A;  1XNR I;  1Z5C A;  2DEI A;  4B3R E;  2UUB I;  3K17 A;  4KHP I;  1KTV A;  3GON A;  2HK2 A;  4LF4 E;  3Q6N A;  1H7S A;  1ZXN A;  1Z0T A;  2Z5C B;  1XMQ E;  3WU5 A;  4JI0 I;  4HYM A;  4DPU A;  4LF5 I;  3QT6 A;  2GS8 A;  1NHI A;  3JAM C;  3T1H I;  1HNX E;  1Y6Z A;  2UUA I;  1ZM2 A;  1N33 I;  4DU8 A;  1N36 E;  4DV1 E;  2UXD E;  3J7A G;  1FJG E;  4X65 E;  2UU9 I;  4LF7 I;  5FLX Q;  2HK3 A;  4DR2 I;  1NHJ A;  4B3S I;  4HXZ A;  3LTO A;  4DR5 I;  4YY3 I;  4GKJ I;  2UXC E;  1U2R A;  3ZM7 A;  3T1Y E;  4UT4 A;  1Y4U A;  4DV7 E;  1ELO A;  4DR1 E;  4NXN I;  1B62 A;  4JI6 E;  4DV6 E;  3K85 A;  2ZM6 I;  4IZJ D;  4JI3 E;  4LFA E;  1VIS A;  2CG9 A;  1EA6 A;  2VQF I;  3ZKB A;  3J80 C;  1HNZ I;  4JI7 I;  1XMO E;  1S4E A;  3LNU A;  4JI1 I;  3V5R A;  4LF8 I;  2BV3 A;  1HNW E;  4LF9 E;  4PRX A;  3J81 C;  4RPF A;  4OX9 I;  2CGE A;  4YHH I;  4XTJ A;  2IOQ A;  2V2Z A;  4DV3 E;  1FNM A;  3Q1Q A;  1Z5B A;  1FKA E;  1Z59 A;  4DR3 E;  4DR6 I;  4USK A;  1Z0E A;  4JV5 E;  2O1T A;  2OI2 A;  2F4V E;  4IZJ A;  4JI4 I;  2E5L E;  4GKK I;  1RR9 A;  2AJ4 A;  4I3H A;  1KVK A;  4P52 A;  4WUB A;  4JI5 E;  4USM A;  4DU7 A;  4MYU A;  1D6T A;  4M1K A;  4LF5 E;  4IZJ B;  4AQY E;  5BR8 I;  2LJP A;  2DEJ A;  4FWG A;  4UTG A;  2HHH I;  3PYE A;  3OTO I;  4B3T I;  3PYF A;  5LMU E;  4HAC A;  2R3V A;  1J5E I;  4JI8 I;  1IBM I;  2HKJ A;  5IWA E;  2UUC I;  1Z5A A;  4KQV A;  4DV5 E;  4DV4 I;  1S16 A;  2Z5E A;  4X66 I;  1HR0 E;  5IT9 C;  4LF6 E;  2ZBK B;  3M6A A;  4X62 I;  4LFB I;  1MX0 A;  4JYA I;  4YY3 E;  2HFS A;  2E1R A;  4HAC B;  1PIE A;  4DR4 I;  3K1J A;  5A2Q Q;  3J81 Q;  4DV2 E;  1N32 I;  4DUY I;  4K0K E;  2ZM6 E;  4DUZ E;  2VQE E;  1USU A;  4JI2 E;  1N0U A;  1ZM4 A;  3HUL A;  3H4L A;  2UXB I;  2GQ0 A;  4B3R I;  4B3M E;  2V8P A;  4DXL A;  4LF4 I;  4R1F A;  1XNQ E;  1XMQ I;  3ZKD A;  1PVG A;  4LFC I;  4ZVI A;  1N0V C;  1HNX I;  1Z0B A;  1FWK A;  2CZ9 A;  4EMD A;  4GKK E;  1HK7 A;  4HY1 A;  1I94 E;  1N36 I;  4WUC A;  1FWL A;  4DV1 I;  4DV0 E;  2UXD I;  1FJG I;  1RRE A;  1KKH A;  4X65 I;  4JG4 A;  1N34 E;  1PKP A;  2X36 A;  1IBL E;  3ZZT A;  3PYG A;  3T1Y I;  2A2C A;  2Z5B A;  4DPX A;  3HJC A;  4NXM E;  4DR1 I;  2HHH E;  3WU6 A;  2V2Q A;  1MG7 A;  4JI6 I;  1XNR E;  4DV6 I;  3JAM Q;  2UUB E;  4KHP E;  5FLX C;  4LFA I;  4X64 I;  3B8H A;  1XMO I;  5LL6 R;  2HFU A;  1H74 A;  4PU9 A;  1HNW I;  2Z5B B;  1IBK I;  4LF9 I;  4JI0 E;  2V2V A;  4FN5 A;  5GME A;  4X62 E;  1Z0V A;  1A6F A;  4DPT A;  3T1H E;  5LMN I;  4DR4 E;  1FI4 A;  2UUA E;  4DR3 I;  1N33 E;  1NZ0 A;  2V34 A;  2EFG A;  2ZIT A;  4JV5 I;  4LF7 E;  2UU9 E;  4FWH A;  1H73 A;  2F4V I;  4DR2 E;  4URL A;  3J80 Q;  4B3S E;  4DR5 E;  4GKJ E;  5GMD A;  2WW4 A;  4DR7 I;  4Z7C A;  1QZR A;  2IOP A;  3PRY A;  4PRV A;  4NXN E;  4DPW A;  1K47 A;  4JI5 I;  4IZK A;  3QT7 A;  1UEK A;  2VQF E;  1HNZ E;  4JI7 E;  4FWD A;  4AQY I;  4LFC E;  3ZZU A;  4FW9 A;  3D4J A;  4JI1 E;  4LF8 E;  4WUD A;  3Q6M A;  5LMU I;  5FWK A;  1WUU A;  5IWA I;  4OX9 E;  2PNM A;  4DV5 I;  2R42 A;  4IZK B;  4YHH E;  1Z0W A;  3QT5 A;  4MYT A;  1NHH A;  1H7U A;  1HR0 I;  3J7A M;  4LF6 I;  3WU3 A;  2O1W A;  1ZM9 A;  4DR6 E;  1ZXM A;  3B82 A;  3WU4 A;  2A2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...