1N32I

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n32I00
4HACA 4DPXA 1PVGA 4JI1I 2UU9E 2VQEI 1XNRI 1Z0VA 1B63A 4WUBA 4JYAE 4LF4I 4DPYA 1KVKA 4DR1E 4AQYE 1MG7A 4JI5E 1H7SA 4M1KA 4FW9A 4JI1E 4JV5I 4Z7YA 1N32I 1XNRE 4ZVIA 1KTVA 3B82A 4LF4E 2BM1A 4HYMA 4DR6E 1XMQE 4HACB 1Z0WA 5IT9Q 5IT9C 4RPFA 4DR7I 1IBKI 3B78A 1HNZI 1N34E 4DUZI 4HY1A 3V2UC 4FWHA 4Z7CA 1H72C 4DR4I 1WUUA 3ZZ0A 3WU4A 2ZM6I 4JI0I 4PRVA 4UT4A 2V2VA 1ZM4A 5BR8I 2UUBE 4B3MI 1IBKE 4JI3I 1KIJA 1S4EA 4MYUA 2ZM6E 3QT6A 4YY3I 4LF6I 2E5LI 5BR8E 5LMNE 3QT5A 4B3ME 4X66E 2Q2EB 2CZ9A 4DV2I 3PYFA 3T1HI 1UEKA 3ZKDA 4PU9A 1HR0I 2V8PA 2E1RA 4LF6E 5A2QC 2HKJA 2VQFI 4USKA 3T1HE 5LMUE 2A2CA 4P7AA 4JI2E 1XMOI 2HHHE 5L3JA 1HR0E 4DV3E 4DR5I 3LPSA 2NPFA 1ZM2A 4DV5I 2LJPA 2V2QA 1DARA 4OX9I 1J5EI 4DU8A 4UTGA 1FWKA 2BM0A 1FJGE 4DV5E 1K47A 4LFCI 3WU3A 4OX9E 4K0KE 1Z0CA 1J5EE 3ZZUA 1A6FA 4NXNI 2VQEE 4DV6I 1RR9A 5GMDA 4LFCE 1Z5CA 1PIEA 4DPTA 3D4JA 3PYEA 2A2DA 3ZKBA 1N33I 4XTJA 1U2RA 1ZM9A 4JG4A 1PKPA 3ZZTA 1IBMI 1FNMA 4JV5E 1H74A 2J7KA 4NXNE 1N32E 4DV6E 3Q1QA 1HNXI 2OI2A 4GKJI 2UUCI 3WU6A 4X65I 1N33E 4LF8I 1IBLI 4JI8I 3QT7A 1XHKA 1QZRA 4JI7I 4DR7E 5IWAI 1HNZE 4DPUA 3OTOI 4DUZE 4DV0I 2UUCE 2UXDI 2R42A 1RREA 4X65E 4DUYI 4JI6I 2HFSA 4DR4E 3M6AA 1Z0TA 4JI0E 1BKNA 1IBLE 3J80C 4DV4I 4JI7E 1N36I 3LTOA 4DR3I 4DPWA 4JI3E 4JI4I 4B3RI 4KHPI 2GS8A 1Z0BA 4JI6E 2UXCI 4YY3E 4DXLA 2ZITA 5A2QQ 4DV4E 4R1FA 2E5LE 4DR3E 1HNWI 4JI4E 2X36A 1OJ4A 4KHPE 4DV2E 4DR2I 3PYDA 3K17A 1ZM3A 3JAMC 2VQFE 1FWLA 4DV7I 1HNWE 2ZBKB 2F4VI 4FWDA 1EI1A 5GMEA 1Z5AA 4I3HA 4GKKI 2AJ4A 1XMOE 4KQVA 2XEXA 3F0NA 4JI2I 4DR5E 1Z5BA 1XNQI 4MYTA 2UU9I 2F4VE 2UUAI 1ZXNA 2HFUA 4FWGA 4JYAI 4WUDA 2R3VA 3J81C 4GKKE 1N0VC 2HKEA 2UXBI 4AQYI 1NHHA 2DEIA 1FI4A 1XNQE 2UUAE 4LFBI 4DR6I 1XMQI 2DEJA 2UXBE 4LF5I 1NHIA 1KKHA 1Z59A 4X62I 1S16A 1N34I 4LFBE 4URLA 3B8HA 4FN5A 4LF5E 4LF7I 1ZXMA 1IBME 5LL6R 2X7IA 5FLXQ 2VF3A 5FLXC 4LFAI 1NZ0A 3CWVA 3K1JA 4X62E 2UUBI 1ELOA 1HNXE 4GKJE 2V2ZA 3V5RA 2EFGA 4LF8E 3J80Q 4JI8E 4LF7E 4DV1I 3PYGA 3J7AM 4LFAE 5IWAE 4WUCA 5LMNI 4DU7A 2HK2A 4X66I 1Z0EA 3OTOE 4LF9I 4DV0E 4NXMI 4YHHI 2UXDE 4DUYE 4X64I 1I94I 4B3TI 1Z0GA 4DV1E 3H4LA 1N36E 1D6TA 1EA6A 3QT8A 4LF9E 4B3RE 4NXME 4B3SI 4YHHE 3WU5A 4X64E 4PRXA 3T1YI 5LMUI 2UXCE 1I94E 4B3TE 2HHHI 1B62A 4DV3I 3JAMQ 1VISA 4B3SE 1NHJA 4EMDA 2V34A 4DR2E 1H73A 1N0UA 1H7UA 3T1YE 3J7AG 1MU5A 3ZM7A 4P52A 4ED4A 1MX0A 2HK3A 1FJGI 4DV7E 4HXZA 3GONA 4USMA 3LNUA 1FKAE 3HULA 2BV3A 3J81Q 4K0KI 4DR1I 2WW4A 4JI5I
chains in the Genus database with same CATH superfamily
4HACA 2IOQA 1E3HA 1PVGA 3P3CA 4DPXA 4JI1I 2UU9E 2VQEI 4GQUA 1XNRI 4U3DA 1Z0VA 5DRQA 1B63A 5K36C 4ISAA 4WUBA 3M7NG 4LF4I 4JYAE 4DPYA 1KVKA 4FW6A 4DR1E 4AQYE 2PO0B 1MG7A 4JI5E 1H7SA 4OZEA 4M1KA 4FW9A 3M85G 4JI1E 4JV5I 4OKGA 4Z7YA 1N32I 1XNRE 4ZVIA 3PS1A 4MU3A 1KTVA 2F1DA 3B82A 4IZJD 4LF4E 1OYSA 2BM1A 4HYMA 4DR6E 3U1KA 1XMQE 4HACB 1Z0WA 5IT9Q 5IT9C 2CGEA 4RPFA 5DRRA 2O1WA 2PNLA 4DR7I 1IBKI 3B78A 1HNZI 1N34E 4DUZI 4HY1A 4BA2A 3V2UC 4FWHA 4Z7CA 1H72C 4DR4I 1WUUA 3ZZ0A 3WU4A 2ZM6I 2BR2A 2J65A 4JI0I 4PRVA 4UT4A 2V2VA 2BA1G 1ZM4A 5BR8I 2UUBE 4B3MI 2AE8A 1IBKE 4JI3I 1KIJA 1R6MA 2VESA 1S4EA 4MYUA 5C0XA 2ZM6E 3QT6A 1USUA 4YY3I 4LF6I 2PO2A 2E5LI 5BR8E 4LCFA 3QT5A 5LMNE 4X66E 4B3ME 4BA2B 2Q2EB 2CZ9A 1VI7A 4DV2I 3PYFA 3T1HI 5K36E 1HK7A 1UEKA 4PU9A 3ZKDA 5EKWA 1HR0I 2V8PA 2E1RA 3H1CA 4LF6E 4IFDF 5A2QC 2HKJA 4MU0A 2VQFI 4BA1A 5DNXA 5C0XB 1USVA 2IERA 5DRPA 4USKA 3T1HE 5LMUE 2PO2B 2A2CA 4P7AA 4JI2E 1XMOI 2HHHE 5L3JA 1HR0E 3P76A 1Y6ZA 4DV3E 4DR5I 2BA0G 3LPSA 2NPFA 1ZM2A 3L7ZA 4DV5I 3M7ND 5C0XC 1Y4UA 2LJPA 4LPFA 2V2QA 1DARA 4OX9I 5K36B 1J5EI 3HKMA 4DU8A 1OYRA 4UTGA 4BA1B 1FWKA 2BM0A 1FJGE 4DV5E 1K47A 4OO1F 4LFCI 3WU3A 5ELWA 2PO1B 4OX9E 4K0KE 2NN6A 3P3GA 1Z0CA 1J5EE 4AIDA 3L7ZB 4FW4A 3ZZUA 1A6FA 5C0XD 2NN6F 4NXNI 2VQEE 4DV6I 2JT2A 1UDQA 1RR9A 5GMDA 4LFCE 4FW5A 1Z5CA 1PIEA 4DPTA 3D4JA 3PYEA 2A2DA 3ZKBA 2BA1D 4MDTA 1N33I 4XTJA 1U2RA 1ZM9A 4JG4A 1PKPA 3ZZTA 2C38A 1IBMI 1FNMA 4JV5E 1H74A 2J7KA 4NXNE 1N32E 4DV6E 3Q1QA 4OO1C 5K36D 1HNXI 2C37A 2OI2A 4GKJI 2Z5CA 2UUCI 3WU6A 5JEAF 4X65I 1Y5YA 1N33E 4LF8I 2GO3A 1IBLI 3PS3A 4JI8I 3QT7A 1XHKA 1QZRA 4JI7I 3GCMA 4DR7E 5FWKA 2PNZA 2NN6C 5IWAI 1HNZE 4DPUA 3OTOI 4DUZE 4DV0I 2UUCE 2UXDI 2R42A 1RREA 3DD6A 4X65E 5C0XE 4DUYI 4JI6I 2HFSA 4QNJA 4DR4E 3M6AA 1Z0TA 2C38B 4JI0E 1BKNA 2JEBA 1IBLE 3J80C 4DV4I 4JI7E 2C37B 3LTOA 4DR3I 1N36I 2Z5CB 4DPWA 4JI3E 4JI4I 2C39A 4B3RI 4MU4A 4KHPI 2BR2B 2JEAA 4IFDA 2GS8A 5JEAC 1Z0BA 4JI6E 2WNRA 2BA0D 2UXCI 4YY3E 4DXLA 2ZITA 2PNZB 5A2QQ 4DV4E 4R1FA 2E5LE 4DR3E 1HNWI 4JI4E 2X36A 1OJ4A 4KHPE 3GLLA 4DV2E 4DR2I 1YHCA 3PYDA 2JEBB 3K17A 4MU1A 1Y4SA 1ZM3A 3Q6NA 1XXEA 3JAMC 2VQFE 5DROA 2JEAB 4IFDB 1FWLA 4DV7I 1HNWE 2ZBKB 2F4VI 4FWDA 1EI1A 2GQ0A 5GMEA 4OO1E 1Z5AA 4J3DA 4I3HA 4GKKI 4OO1A 3M85D 2AJ4A 1XMOE 4KQVA 2XEXA 3F0NA 4JI2I 4DR5E 4IFDC 4NBQA 3HJCA 1Z5BA 1UDSA 1XNQI 2PO0A 4MYTA 2UU9I 3GMEA 2F4VE 2UUAI 1ZXNA 3KRNA 4IS9A 2NN6E 2O1VA 2HFUA 4FWGA 4JYAI 4WUDA 2R3VA 3J81C 1YH8A 4GKKE 1N0VC 2HKEA 2UXBI 4AQYI 1NHHA 2DEIA 1FI4A 1XNQE 3PS2A 2UUAE 4OO1B 4LFBI 2GO4A 2JE6A 4DR6I 1XMQI 2DEJA 5JEAE 2UXBE 2Z5BA 4LF5I 1NHIA 5JEAA 1KKHA 5DNLA 1Z59A 4IFDD 3NZKA 5EL9A 2WP8A 2O3ZA 3P3EA 4X62I 1S16A 2NN6B 3B4TA 2IOPA 1N34I 4LFBE 4FW3A 4URLA 3B8HA 4FN5A 4LF5E 4LF7I 1ZXMA 1IBME 5LL6R 1Y60A 2X7IA 2VF3A 5FLXQ 5FLXC 2CVEA 1NZ0A 3CWVA 3K1JA 4LFAI 3U1YA 3P06A 4X62E 2UUBI 1ELOA 2JE6B 1HNXE 4GKJE 2V2ZA 2Z5BB 3V5RA 5JEAB 2EFGA 4LF8E 3J80Q 4MQYA 4JI8E 4LF7E 2WP8B 4DV1I 3PYGA 3J7AM 4IZKA 4LFAE 4OO1D 3UHMA 4LCGA 5IWAE 4WUCA 5LMNI 4DU7A 2HK2A 4X66I 1Z0EA 3OTOE 4LF9I 4IFDE 4DV0E 4NXMI 4YHHI 2UXDE 4DUYE 4X64I 3Q6MA 1RHYA 1I94I 2PNMA 4B3TI 1Z0GA 2Z5EA 4DV1E 4LOMA 3H4LA 4IZJA 2NN6D 1N36E 1D6TA 1EA6A 5C0XF 3QT8A 4LF9E 4B3RE 2O1TA 4U3BA 4NXME 4B3SI 4YHHE 3WU5A 4X64E 4PRXA 1P42A 3T1YI 1UDNA 4N3OA 5LMUI 2UXCE 4IZKB 1I94E 4B3TE 2HHHI 5K36A 1B62A 4DV3I 2IESA 2C39B 3JAMQ 1R6LA 1OYPA 2WNRB 5JEAD 1VISA 4B3SE 5K36F 1NHJA 4EMDA 2V34A 4DR2E 1E3PA 1H73A 1N0UA 1H7UA 3PRYA 3T1YE 3J7AG 1MU5A 3ZM7A 4IZJB 4LCHA 4P52A 4ED4A 2PO1A 4FW7A 1MX0A 4AM3A 2HK3A 2O1UA 3CDIA 1UDOA 1FJGI 4DV7E 4HXZA 3GONA 4USMA 3LNUA 1FKAE 3HULA 2BV3A 3J81Q 3K85A 4AIMA 4QNKA 4K0KI 4DR1I 3CDJA 2WW4A 4JI5I 2CG9A
chains in the Genus database with same CATH topology
4HACA 2IOQA 4DPXA 1PVGA 4JI1I 2UU9E 2VQEI 1XNRI 1Z0VA 1B63A 4WUBA 4JYAE 4LF4I 4DPYA 1KVKA 4DR1E 4AQYE 1MG7A 4JI5E 1H7SA 4M1KA 4FW9A 4JI1E 4JV5I 4Z7YA 1N32I 1XNRE 4ZVIA 1KTVA 3B82A 4IZJD 4LF4E 2BM1A 4HYMA 4DR6E 1XMQE 4HACB 1Z0WA 5IT9Q 5IT9C 2CGEA 4RPFA 2O1WA 2PNLA 4DR7I 1IBKI 3B78A 1HNZI 1N34E 4DUZI 4HY1A 3V2UC 4FWHA 4Z7CA 1H72C 4DR4I 1WUUA 3ZZ0A 3WU4A 2ZM6I 4JI0I 4PRVA 4UT4A 2V2VA 1ZM4A 5BR8I 2UUBE 4B3MI 1IBKE 4JI3I 1KIJA 1S4EA 4MYUA 2ZM6E 3QT6A 1USUA 4YY3I 4LF6I 2E5LI 5BR8E 5LMNE 3QT5A 4B3ME 4X66E 2Q2EB 2CZ9A 4DV2I 3PYFA 3T1HI 1HK7A 1UEKA 4PU9A 3ZKDA 1HR0I 2V8PA 2E1RA 4LF6E 5A2QC 2HKJA 2VQFI 1USVA 4USKA 3T1HE 5LMUE 2A2CA 4P7AA 4JI2E 1XMOI 2HHHE 5L3JA 1HR0E 1Y6ZA 4DV3E 4DR5I 3LPSA 2NPFA 1ZM2A 4DV5I 1Y4UA 2LJPA 2V2QA 1DARA 4OX9I 1J5EI 4DU8A 4UTGA 1FWKA 2BM0A 1FJGE 4DV5E 1K47A 4LFCI 3WU3A 4OX9E 4K0KE 1Z0CA 1J5EE 3ZZUA 1A6FA 4NXNI 2VQEE 4DV6I 1RR9A 5GMDA 4LFCE 1Z5CA 1PIEA 4DPTA 3D4JA 3PYEA 2A2DA 3ZKBA 1N33I 4XTJA 1U2RA 1ZM9A 4JG4A 1PKPA 3ZZTA 1IBMI 1FNMA 4JV5E 1H74A 2J7KA 4NXNE 1N32E 4DV6E 3Q1QA 1HNXI 2OI2A 4GKJI 2Z5CA 2UUCI 3WU6A 4X65I 1N33E 4LF8I 1IBLI 4JI8I 3QT7A 1XHKA 1QZRA 4JI7I 4DR7E 5FWKA 5IWAI 1HNZE 4DPUA 3OTOI 4DUZE 4DV0I 2UUCE 2UXDI 2R42A 1RREA 4X65E 4DUYI 4JI6I 2HFSA 4DR4E 3M6AA 1Z0TA 4JI0E 1BKNA 1IBLE 3J80C 4DV4I 4JI7E 1N36I 3LTOA 4DR3I 2Z5CB 4DPWA 4JI3E 4JI4I 4B3RI 4KHPI 2GS8A 1Z0BA 4JI6E 2UXCI 4YY3E 4DXLA 2ZITA 5A2QQ 4DV4E 4R1FA 2E5LE 4DR3E 1HNWI 4JI4E 2X36A 1OJ4A 4KHPE 4DV2E 4DR2I 3PYDA 3K17A 1Y4SA 1ZM3A 3Q6NA 3JAMC 2VQFE 1FWLA 4DV7I 1HNWE 2ZBKB 2F4VI 4FWDA 1EI1A 2GQ0A 5GMEA 1Z5AA 4I3HA 4GKKI 2AJ4A 1XMOE 4KQVA 2XEXA 3F0NA 4JI2I 4DR5E 3HJCA 1Z5BA 1XNQI 4MYTA 2UU9I 2F4VE 2UUAI 1ZXNA 2O1VA 2HFUA 4FWGA 4JYAI 4WUDA 2R3VA 3J81C 4GKKE 1N0VC 2HKEA 2UXBI 4AQYI 1NHHA 2DEIA 1FI4A 1XNQE 2UUAE 4LFBI 4DR6I 1XMQI 2DEJA 2UXBE 2Z5BA 4LF5I 1NHIA 1KKHA 1Z59A 4X62I 1S16A 2IOPA 1N34I 4LFBE 4URLA 3B8HA 4FN5A 4LF5E 4LF7I 1ZXMA 1IBME 5LL6R 2X7IA 5FLXQ 2VF3A 5FLXC 4LFAI 1NZ0A 3CWVA 3K1JA 3P06A 4X62E 2UUBI 1ELOA 1HNXE 4GKJE 2V2ZA 2Z5BB 3V5RA 2EFGA 4LF8E 3J80Q 4JI8E 4LF7E 4DV1I 3PYGA 3J7AM 4IZKA 4LFAE 5IWAE 4WUCA 5LMNI 4DU7A 2HK2A 4X66I 1Z0EA 3OTOE 4LF9I 4DV0E 4NXMI 4YHHI 2UXDE 4DUYE 4X64I 3Q6MA 1I94I 2PNMA 4B3TI 1Z0GA 2Z5EA 4DV1E 3H4LA 4IZJA 1N36E 1D6TA 1EA6A 3QT8A 4LF9E 4B3RE 2O1TA 4NXME 4B3SI 4YHHE 3WU5A 4X64E 4PRXA 3T1YI 4N3OA 5LMUI 2UXCE 4IZKB 1I94E 4B3TE 2HHHI 1B62A 4DV3I 3JAMQ 1VISA 4B3SE 1NHJA 4EMDA 2V34A 4DR2E 1H73A 1N0UA 1H7UA 3PRYA 3T1YE 3J7AG 1MU5A 3ZM7A 4IZJB 4P52A 4ED4A 1MX0A 2HK3A 2O1UA 1FJGI 4DV7E 4HXZA 3GONA 4USMA 3LNUA 1FKAE 3HULA 2BV3A 3J81Q 3K85A 4K0KI 4DR1I 2WW4A 4JI5I 2CG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAC A;  4DPX A;  1PVG A;  4JI1 I;  2UU9 E;  2VQE I;  1XNR I;  1Z0V A;  1B63 A;  4WUB A;  4JYA E;  4LF4 I;  4DPY A;  1KVK A;  4DR1 E;  4AQY E;  1MG7 A;  4JI5 E;  1H7S A;  4M1K A;  4FW9 A;  4JI1 E;  4JV5 I;  4Z7Y A;  1N32 I;  1XNR E;  4ZVI A;  1KTV A;  3B82 A;  4LF4 E;  2BM1 A;  4HYM A;  4DR6 E;  1XMQ E;  4HAC B;  1Z0W A;  5IT9 Q;  5IT9 C;  4RPF A;  4DR7 I;  1IBK I;  3B78 A;  1HNZ I;  1N34 E;  4DUZ I;  4HY1 A;  3V2U C;  4FWH A;  4Z7C A;  1H72 C;  4DR4 I;  1WUU A;  3ZZ0 A;  3WU4 A;  2ZM6 I;  4JI0 I;  4PRV A;  4UT4 A;  2V2V A;  1ZM4 A;  5BR8 I;  2UUB E;  4B3M I;  1IBK E;  4JI3 I;  1KIJ A;  1S4E A;  4MYU A;  2ZM6 E;  3QT6 A;  4YY3 I;  4LF6 I;  2E5L I;  5BR8 E;  5LMN E;  3QT5 A;  4B3M E;  4X66 E;  2Q2E B;  2CZ9 A;  4DV2 I;  3PYF A;  3T1H I;  1UEK A;  3ZKD A;  4PU9 A;  1HR0 I;  2V8P A;  2E1R A;  4LF6 E;  5A2Q C;  2HKJ A;  2VQF I;  4USK A;  3T1H E;  5LMU E;  2A2C A;  4P7A A;  4JI2 E;  1XMO I;  2HHH E;  5L3J A;  1HR0 E;  4DV3 E;  4DR5 I;  3LPS A;  2NPF A;  1ZM2 A;  4DV5 I;  2LJP A;  2V2Q A;  1DAR A;  4OX9 I;  1J5E I;  4DU8 A;  4UTG A;  1FWK A;  2BM0 A;  1FJG E;  4DV5 E;  1K47 A;  4LFC I;  3WU3 A;  4OX9 E;  4K0K E;  1Z0C A;  1J5E E;  3ZZU A;  1A6F A;  4NXN I;  2VQE E;  4DV6 I;  1RR9 A;  5GMD A;  4LFC E;  1Z5C A;  1PIE A;  4DPT A;  3D4J A;  3PYE A;  2A2D A;  3ZKB A;  1N33 I;  4XTJ A;  1U2R A;  1ZM9 A;  4JG4 A;  1PKP A;  3ZZT A;  1IBM I;  1FNM A;  4JV5 E;  1H74 A;  2J7K A;  4NXN E;  1N32 E;  4DV6 E;  3Q1Q A;  1HNX I;  2OI2 A;  4GKJ I;  2UUC I;  3WU6 A;  4X65 I;  1N33 E;  4LF8 I;  1IBL I;  4JI8 I;  3QT7 A;  1XHK A;  1QZR A;  4JI7 I;  4DR7 E;  5IWA I;  1HNZ E;  4DPU A;  3OTO I;  4DUZ E;  4DV0 I;  2UUC E;  2UXD I;  2R42 A;  1RRE A;  4X65 E;  4DUY I;  4JI6 I;  2HFS A;  4DR4 E;  3M6A A;  1Z0T A;  4JI0 E;  1BKN A;  1IBL E;  3J80 C;  4DV4 I;  4JI7 E;  1N36 I;  3LTO A;  4DR3 I;  4DPW A;  4JI3 E;  4JI4 I;  4B3R I;  4KHP I;  2GS8 A;  1Z0B A;  4JI6 E;  2UXC I;  4YY3 E;  4DXL A;  2ZIT A;  5A2Q Q;  4DV4 E;  4R1F A;  2E5L E;  4DR3 E;  1HNW I;  4JI4 E;  2X36 A;  1OJ4 A;  4KHP E;  4DV2 E;  4DR2 I;  3PYD A;  3K17 A;  1ZM3 A;  3JAM C;  2VQF E;  1FWL A;  4DV7 I;  1HNW E;  2ZBK B;  2F4V I;  4FWD A;  1EI1 A;  5GME A;  1Z5A A;  4I3H A;  4GKK I;  2AJ4 A;  1XMO E;  4KQV A;  2XEX A;  3F0N A;  4JI2 I;  4DR5 E;  1Z5B A;  1XNQ I;  4MYT A;  2UU9 I;  2F4V E;  2UUA I;  1ZXN A;  2HFU A;  4FWG A;  4JYA I;  4WUD A;  2R3V A;  3J81 C;  4GKK E;  1N0V C;  2HKE A;  2UXB I;  4AQY I;  1NHH A;  2DEI A;  1FI4 A;  1XNQ E;  2UUA E;  4LFB I;  4DR6 I;  1XMQ I;  2DEJ A;  2UXB E;  4LF5 I;  1NHI A;  1KKH A;  1Z59 A;  4X62 I;  1S16 A;  1N34 I;  4LFB E;  4URL A;  3B8H A;  4FN5 A;  4LF5 E;  4LF7 I;  1ZXM A;  1IBM E;  5LL6 R;  2X7I A;  5FLX Q;  2VF3 A;  5FLX C;  4LFA I;  1NZ0 A;  3CWV A;  3K1J A;  4X62 E;  2UUB I;  1ELO A;  1HNX E;  4GKJ E;  2V2Z A;  3V5R A;  2EFG A;  4LF8 E;  3J80 Q;  4JI8 E;  4LF7 E;  4DV1 I;  3PYG A;  3J7A M;  4LFA E;  5IWA E;  4WUC A;  5LMN I;  4DU7 A;  2HK2 A;  4X66 I;  1Z0E A;  3OTO E;  4LF9 I;  4DV0 E;  4NXM I;  4YHH I;  2UXD E;  4DUY E;  4X64 I;  1I94 I;  4B3T I;  1Z0G A;  4DV1 E;  3H4L A;  1N36 E;  1D6T A;  1EA6 A;  3QT8 A;  4LF9 E;  4B3R E;  4NXM E;  4B3S I;  4YHH E;  3WU5 A;  4X64 E;  4PRX A;  3T1Y I;  5LMU I;  2UXC E;  1I94 E;  4B3T E;  2HHH I;  1B62 A;  4DV3 I;  3JAM Q;  1VIS A;  4B3S E;  1NHJ A;  4EMD A;  2V34 A;  4DR2 E;  1H73 A;  1N0U A;  1H7U A;  3T1Y E;  3J7A G;  1MU5 A;  3ZM7 A;  4P52 A;  4ED4 A;  1MX0 A;  2HK3 A;  1FJG I;  4DV7 E;  4HXZ A;  3GON A;  4USM A;  3LNU A;  1FKA E;  3HUL A;  2BV3 A;  3J81 Q;  4K0K I;  4DR1 I;  2WW4 A;  4JI5 I; 
#chains in the Genus database with same CATH topology
 4HAC A;  2IOQ A;  1E3H A;  1PVG A;  3P3C A;  4DPX A;  4JI1 I;  2UU9 E;  2VQE I;  4GQU A;  1XNR I;  4U3D A;  1Z0V A;  5DRQ A;  1B63 A;  5K36 C;  4ISA A;  4WUB A;  3M7N G;  4LF4 I;  4JYA E;  4DPY A;  1KVK A;  4FW6 A;  4DR1 E;  4AQY E;  2PO0 B;  1MG7 A;  4JI5 E;  1H7S A;  4OZE A;  4M1K A;  4FW9 A;  3M85 G;  4JI1 E;  4JV5 I;  4OKG A;  4Z7Y A;  1N32 I;  1XNR E;  4ZVI A;  3PS1 A;  4MU3 A;  1KTV A;  2F1D A;  3B82 A;  4IZJ D;  4LF4 E;  1OYS A;  2BM1 A;  4HYM A;  4DR6 E;  3U1K A;  1XMQ E;  4HAC B;  1Z0W A;  5IT9 Q;  5IT9 C;  2CGE A;  4RPF A;  5DRR A;  2O1W A;  2PNL A;  4DR7 I;  1IBK I;  3B78 A;  1HNZ I;  1N34 E;  4DUZ I;  4HY1 A;  4BA2 A;  3V2U C;  4FWH A;  4Z7C A;  1H72 C;  4DR4 I;  1WUU A;  3ZZ0 A;  3WU4 A;  2ZM6 I;  2BR2 A;  2J65 A;  4JI0 I;  4PRV A;  4UT4 A;  2V2V A;  2BA1 G;  1ZM4 A;  5BR8 I;  2UUB E;  4B3M I;  2AE8 A;  1IBK E;  4JI3 I;  1KIJ A;  1R6M A;  2VES A;  1S4E A;  4MYU A;  5C0X A;  2ZM6 E;  3QT6 A;  1USU A;  4YY3 I;  4LF6 I;  2PO2 A;  2E5L I;  5BR8 E;  4LCF A;  3QT5 A;  5LMN E;  4X66 E;  4B3M E;  4BA2 B;  2Q2E B;  2CZ9 A;  1VI7 A;  4DV2 I;  3PYF A;  3T1H I;  5K36 E;  1HK7 A;  1UEK A;  4PU9 A;  3ZKD A;  5EKW A;  1HR0 I;  2V8P A;  2E1R A;  3H1C A;  4LF6 E;  4IFD F;  5A2Q C;  2HKJ A;  4MU0 A;  2VQF I;  4BA1 A;  5DNX A;  5C0X B;  1USV A;  2IER A;  5DRP A;  4USK A;  3T1H E;  5LMU E;  2PO2 B;  2A2C A;  4P7A A;  4JI2 E;  1XMO I;  2HHH E;  5L3J A;  1HR0 E;  3P76 A;  1Y6Z A;  4DV3 E;  4DR5 I;  2BA0 G;  3LPS A;  2NPF A;  1ZM2 A;  3L7Z A;  4DV5 I;  3M7N D;  5C0X C;  1Y4U A;  2LJP A;  4LPF A;  2V2Q A;  1DAR A;  4OX9 I;  5K36 B;  1J5E I;  3HKM A;  4DU8 A;  1OYR A;  4UTG A;  4BA1 B;  1FWK A;  2BM0 A;  1FJG E;  4DV5 E;  1K47 A;  4OO1 F;  4LFC I;  3WU3 A;  5ELW A;  2PO1 B;  4OX9 E;  4K0K E;  2NN6 A;  3P3G A;  1Z0C A;  1J5E E;  4AID A;  3L7Z B;  4FW4 A;  3ZZU A;  1A6F A;  5C0X D;  2NN6 F;  4NXN I;  2VQE E;  4DV6 I;  2JT2 A;  1UDQ A;  1RR9 A;  5GMD A;  4LFC E;  4FW5 A;  1Z5C A;  1PIE A;  4DPT A;  3D4J A;  3PYE A;  2A2D A;  3ZKB A;  2BA1 D;  4MDT A;  1N33 I;  4XTJ A;  1U2R A;  1ZM9 A;  4JG4 A;  1PKP A;  3ZZT A;  2C38 A;  1IBM I;  1FNM A;  4JV5 E;  1H74 A;  2J7K A;  4NXN E;  1N32 E;  4DV6 E;  3Q1Q A;  4OO1 C;  5K36 D;  1HNX I;  2C37 A;  2OI2 A;  4GKJ I;  2Z5C A;  2UUC I;  3WU6 A;  5JEA F;  4X65 I;  1Y5Y A;  1N33 E;  4LF8 I;  2GO3 A;  1IBL I;  3PS3 A;  4JI8 I;  3QT7 A;  1XHK A;  1QZR A;  4JI7 I;  3GCM A;  4DR7 E;  5FWK A;  2PNZ A;  2NN6 C;  5IWA I;  1HNZ E;  4DPU A;  3OTO I;  4DUZ E;  4DV0 I;  2UUC E;  2UXD I;  2R42 A;  1RRE A;  3DD6 A;  4X65 E;  5C0X E;  4DUY I;  4JI6 I;  2HFS A;  4QNJ A;  4DR4 E;  3M6A A;  1Z0T A;  2C38 B;  4JI0 E;  1BKN A;  2JEB A;  1IBL E;  3J80 C;  4DV4 I;  4JI7 E;  2C37 B;  3LTO A;  4DR3 I;  1N36 I;  2Z5C B;  4DPW A;  4JI3 E;  4JI4 I;  2C39 A;  4B3R I;  4MU4 A;  4KHP I;  2BR2 B;  2JEA A;  4IFD A;  2GS8 A;  5JEA C;  1Z0B A;  4JI6 E;  2WNR A;  2BA0 D;  2UXC I;  4YY3 E;  4DXL A;  2ZIT A;  2PNZ B;  5A2Q Q;  4DV4 E;  4R1F A;  2E5L E;  4DR3 E;  1HNW I;  4JI4 E;  2X36 A;  1OJ4 A;  4KHP E;  3GLL A;  4DV2 E;  4DR2 I;  1YHC A;  3PYD A;  2JEB B;  3K17 A;  4MU1 A;  1Y4S A;  1ZM3 A;  3Q6N A;  1XXE A;  3JAM C;  2VQF E;  5DRO A;  2JEA B;  4IFD B;  1FWL A;  4DV7 I;  1HNW E;  2ZBK B;  2F4V I;  4FWD A;  1EI1 A;  2GQ0 A;  5GME A;  4OO1 E;  1Z5A A;  4J3D A;  4I3H A;  4GKK I;  4OO1 A;  3M85 D;  2AJ4 A;  1XMO E;  4KQV A;  2XEX A;  3F0N A;  4JI2 I;  4DR5 E;  4IFD C;  4NBQ A;  3HJC A;  1Z5B A;  1UDS A;  1XNQ I;  2PO0 A;  4MYT A;  2UU9 I;  3GME A;  2F4V E;  2UUA I;  1ZXN A;  3KRN A;  4IS9 A;  2NN6 E;  2O1V A;  2HFU A;  4FWG A;  4JYA I;  4WUD A;  2R3V A;  3J81 C;  1YH8 A;  4GKK E;  1N0V C;  2HKE A;  2UXB I;  4AQY I;  1NHH A;  2DEI A;  1FI4 A;  1XNQ E;  3PS2 A;  2UUA E;  4OO1 B;  4LFB I;  2GO4 A;  2JE6 A;  4DR6 I;  1XMQ I;  2DEJ A;  5JEA E;  2UXB E;  2Z5B A;  4LF5 I;  1NHI A;  5JEA A;  1KKH A;  5DNL A;  1Z59 A;  4IFD D;  3NZK A;  5EL9 A;  2WP8 A;  2O3Z A;  3P3E A;  4X62 I;  1S16 A;  2NN6 B;  3B4T A;  2IOP A;  1N34 I;  4LFB E;  4FW3 A;  4URL A;  3B8H A;  4FN5 A;  4LF5 E;  4LF7 I;  1ZXM A;  1IBM E;  5LL6 R;  1Y60 A;  2X7I A;  2VF3 A;  5FLX Q;  5FLX C;  2CVE A;  1NZ0 A;  3CWV A;  3K1J A;  4LFA I;  3U1Y A;  3P06 A;  4X62 E;  2UUB I;  1ELO A;  2JE6 B;  1HNX E;  4GKJ E;  2V2Z A;  2Z5B B;  3V5R A;  5JEA B;  2EFG A;  4LF8 E;  3J80 Q;  4MQY A;  4JI8 E;  4LF7 E;  2WP8 B;  4DV1 I;  3PYG A;  3J7A M;  4IZK A;  4LFA E;  4OO1 D;  3UHM A;  4LCG A;  5IWA E;  4WUC A;  5LMN I;  4DU7 A;  2HK2 A;  4X66 I;  1Z0E A;  3OTO E;  4LF9 I;  4IFD E;  4DV0 E;  4NXM I;  4YHH I;  2UXD E;  4DUY E;  4X64 I;  3Q6M A;  1RHY A;  1I94 I;  2PNM A;  4B3T I;  1Z0G A;  2Z5E A;  4DV1 E;  4LOM A;  3H4L A;  4IZJ A;  2NN6 D;  1N36 E;  1D6T A;  1EA6 A;  5C0X F;  3QT8 A;  4LF9 E;  4B3R E;  2O1T A;  4U3B A;  4NXM E;  4B3S I;  4YHH E;  3WU5 A;  4X64 E;  4PRX A;  1P42 A;  3T1Y I;  1UDN A;  4N3O A;  5LMU I;  2UXC E;  4IZK B;  1I94 E;  4B3T E;  2HHH I;  5K36 A;  1B62 A;  4DV3 I;  2IES A;  2C39 B;  3JAM Q;  1R6L A;  1OYP A;  2WNR B;  5JEA D;  1VIS A;  4B3S E;  5K36 F;  1NHJ A;  4EMD A;  2V34 A;  4DR2 E;  1E3P A;  1H73 A;  1N0U A;  1H7U A;  3PRY A;  3T1Y E;  3J7A G;  1MU5 A;  3ZM7 A;  4IZJ B;  4LCH A;  4P52 A;  4ED4 A;  2PO1 A;  4FW7 A;  1MX0 A;  4AM3 A;  2HK3 A;  2O1U A;  3CDI A;  1UDO A;  1FJG I;  4DV7 E;  4HXZ A;  3GON A;  4USM A;  3LNU A;  1FKA E;  3HUL A;  2BV3 A;  3J81 Q;  3K85 A;  4AIM A;  4QNK A;  4K0K I;  4DR1 I;  3CDJ A;  2WW4 A;  4JI5 I;  2CG9 A; 
#chains in the Genus database with same CATH homology
 4HAC A;  2IOQ A;  4DPX A;  1PVG A;  4JI1 I;  2UU9 E;  2VQE I;  1XNR I;  1Z0V A;  1B63 A;  4WUB A;  4JYA E;  4LF4 I;  4DPY A;  1KVK A;  4DR1 E;  4AQY E;  1MG7 A;  4JI5 E;  1H7S A;  4M1K A;  4FW9 A;  4JI1 E;  4JV5 I;  4Z7Y A;  1N32 I;  1XNR E;  4ZVI A;  1KTV A;  3B82 A;  4IZJ D;  4LF4 E;  2BM1 A;  4HYM A;  4DR6 E;  1XMQ E;  4HAC B;  1Z0W A;  5IT9 Q;  5IT9 C;  2CGE A;  4RPF A;  2O1W A;  2PNL A;  4DR7 I;  1IBK I;  3B78 A;  1HNZ I;  1N34 E;  4DUZ I;  4HY1 A;  3V2U C;  4FWH A;  4Z7C A;  1H72 C;  4DR4 I;  1WUU A;  3ZZ0 A;  3WU4 A;  2ZM6 I;  4JI0 I;  4PRV A;  4UT4 A;  2V2V A;  1ZM4 A;  5BR8 I;  2UUB E;  4B3M I;  1IBK E;  4JI3 I;  1KIJ A;  1S4E A;  4MYU A;  2ZM6 E;  3QT6 A;  1USU A;  4YY3 I;  4LF6 I;  2E5L I;  5BR8 E;  5LMN E;  3QT5 A;  4B3M E;  4X66 E;  2Q2E B;  2CZ9 A;  4DV2 I;  3PYF A;  3T1H I;  1HK7 A;  1UEK A;  4PU9 A;  3ZKD A;  1HR0 I;  2V8P A;  2E1R A;  4LF6 E;  5A2Q C;  2HKJ A;  2VQF I;  1USV A;  4USK A;  3T1H E;  5LMU E;  2A2C A;  4P7A A;  4JI2 E;  1XMO I;  2HHH E;  5L3J A;  1HR0 E;  1Y6Z A;  4DV3 E;  4DR5 I;  3LPS A;  2NPF A;  1ZM2 A;  4DV5 I;  1Y4U A;  2LJP A;  2V2Q A;  1DAR A;  4OX9 I;  1J5E I;  4DU8 A;  4UTG A;  1FWK A;  2BM0 A;  1FJG E;  4DV5 E;  1K47 A;  4LFC I;  3WU3 A;  4OX9 E;  4K0K E;  1Z0C A;  1J5E E;  3ZZU A;  1A6F A;  4NXN I;  2VQE E;  4DV6 I;  1RR9 A;  5GMD A;  4LFC E;  1Z5C A;  1PIE A;  4DPT A;  3D4J A;  3PYE A;  2A2D A;  3ZKB A;  1N33 I;  4XTJ A;  1U2R A;  1ZM9 A;  4JG4 A;  1PKP A;  3ZZT A;  1IBM I;  1FNM A;  4JV5 E;  1H74 A;  2J7K A;  4NXN E;  1N32 E;  4DV6 E;  3Q1Q A;  1HNX I;  2OI2 A;  4GKJ I;  2Z5C A;  2UUC I;  3WU6 A;  4X65 I;  1N33 E;  4LF8 I;  1IBL I;  4JI8 I;  3QT7 A;  1XHK A;  1QZR A;  4JI7 I;  4DR7 E;  5FWK A;  5IWA I;  1HNZ E;  4DPU A;  3OTO I;  4DUZ E;  4DV0 I;  2UUC E;  2UXD I;  2R42 A;  1RRE A;  4X65 E;  4DUY I;  4JI6 I;  2HFS A;  4DR4 E;  3M6A A;  1Z0T A;  4JI0 E;  1BKN A;  1IBL E;  3J80 C;  4DV4 I;  4JI7 E;  1N36 I;  3LTO A;  4DR3 I;  2Z5C B;  4DPW A;  4JI3 E;  4JI4 I;  4B3R I;  4KHP I;  2GS8 A;  1Z0B A;  4JI6 E;  2UXC I;  4YY3 E;  4DXL A;  2ZIT A;  5A2Q Q;  4DV4 E;  4R1F A;  2E5L E;  4DR3 E;  1HNW I;  4JI4 E;  2X36 A;  1OJ4 A;  4KHP E;  4DV2 E;  4DR2 I;  3PYD A;  3K17 A;  1Y4S A;  1ZM3 A;  3Q6N A;  3JAM C;  2VQF E;  1FWL A;  4DV7 I;  1HNW E;  2ZBK B;  2F4V I;  4FWD A;  1EI1 A;  2GQ0 A;  5GME A;  1Z5A A;  4I3H A;  4GKK I;  2AJ4 A;  1XMO E;  4KQV A;  2XEX A;  3F0N A;  4JI2 I;  4DR5 E;  3HJC A;  1Z5B A;  1XNQ I;  4MYT A;  2UU9 I;  2F4V E;  2UUA I;  1ZXN A;  2O1V A;  2HFU A;  4FWG A;  4JYA I;  4WUD A;  2R3V A;  3J81 C;  4GKK E;  1N0V C;  2HKE A;  2UXB I;  4AQY I;  1NHH A;  2DEI A;  1FI4 A;  1XNQ E;  2UUA E;  4LFB I;  4DR6 I;  1XMQ I;  2DEJ A;  2UXB E;  2Z5B A;  4LF5 I;  1NHI A;  1KKH A;  1Z59 A;  4X62 I;  1S16 A;  2IOP A;  1N34 I;  4LFB E;  4URL A;  3B8H A;  4FN5 A;  4LF5 E;  4LF7 I;  1ZXM A;  1IBM E;  5LL6 R;  2X7I A;  5FLX Q;  2VF3 A;  5FLX C;  4LFA I;  1NZ0 A;  3CWV A;  3K1J A;  3P06 A;  4X62 E;  2UUB I;  1ELO A;  1HNX E;  4GKJ E;  2V2Z A;  2Z5B B;  3V5R A;  2EFG A;  4LF8 E;  3J80 Q;  4JI8 E;  4LF7 E;  4DV1 I;  3PYG A;  3J7A M;  4IZK A;  4LFA E;  5IWA E;  4WUC A;  5LMN I;  4DU7 A;  2HK2 A;  4X66 I;  1Z0E A;  3OTO E;  4LF9 I;  4DV0 E;  4NXM I;  4YHH I;  2UXD E;  4DUY E;  4X64 I;  3Q6M A;  1I94 I;  2PNM A;  4B3T I;  1Z0G A;  2Z5E A;  4DV1 E;  3H4L A;  4IZJ A;  1N36 E;  1D6T A;  1EA6 A;  3QT8 A;  4LF9 E;  4B3R E;  2O1T A;  4NXM E;  4B3S I;  4YHH E;  3WU5 A;  4X64 E;  4PRX A;  3T1Y I;  4N3O A;  5LMU I;  2UXC E;  4IZK B;  1I94 E;  4B3T E;  2HHH I;  1B62 A;  4DV3 I;  3JAM Q;  1VIS A;  4B3S E;  1NHJ A;  4EMD A;  2V34 A;  4DR2 E;  1H73 A;  1N0U A;  1H7U A;  3PRY A;  3T1Y E;  3J7A G;  1MU5 A;  3ZM7 A;  4IZJ B;  4P52 A;  4ED4 A;  1MX0 A;  2HK3 A;  2O1U A;  1FJG I;  4DV7 E;  4HXZ A;  3GON A;  4USM A;  3LNU A;  1FKA E;  3HUL A;  2BV3 A;  3J81 Q;  3K85 A;  4K0K I;  4DR1 I;  2WW4 A;  4JI5 I;  2CG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...