1N32I

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n32I00
2VQEI 4UT4A 1Z5BA 4DR7E 4LF6E 1Z0WA 4LF9I 3ZZUA 1IBME 3T1YE 4DR6E 1XHKA 5BR8E 4X62I 4JI0I 1ZM2A 4FWHA 1DARA 3F0NA 1IBLE 4ED4A 1U2RA 4B3SI 2HHHI 4URLA 4I3HA 5A2QQ 2R3VA 1KTVA 2HK2A 2UXCI 3PYDA 2HKJA 4LFAE 2F4VE 4FWGA 4Z7CA 1NHJA 4NXME 1XMQI 2OI2A 2BM1A 4DV2E 1HNXI 2HFSA 2ZM6E 4JYAE 3QT5A 4X66I 2EFGA 1FI4A 2J7KA 4DV3E 1RR9A 4NXNE 1HR0I 4DUZI 1IBKE 1ELOA 1Z0VA 4B3RE 1I94I 4DU7A 2UUAE 2HK3A 4DPWA 4ZVIA 4JI2I 1PVGA 4X64I 3J81C 1N33E 3J81Q 4DR3I 4KHPE 3QT7A 3WU6A 4LF7I 1ZXMA 2V2QA 4LF8E 1KVKA 4JI6E 4KHPI 4JI8I 4JI1E 5GMEA 4DV5I 5A2QC 3H4LA 4B3RI 1H74A 2UUCI 1XNQE 2UXBI 4X65E 1XMOE 1H7UA 1B62A 4XTJA 1EI1A 1IBKI 3M6AA 1HR0E 4GKJI 1NHHA 4GKJE 1J5EE 1XNRE 2UU9I 1VISA 4LF5E 2VF3A 4PU9A 4P52A 1RREA 4X65I 4DV0I 4MYUA 4JI5E 4LFBI 4FW9A 2UUCE 4LFBE 4R1FA 2V34A 4LF5I 1K47A 4DV5E 4YY3I 1H7SA 2UU9E 1HNWI 2ZITA 1FWLA 4MYTA 4LFAI 1PIEA 4RPFA 4KQVA 2HHHE 4GKKE 4B3SE 1H73A 1Z0CA 4B3TI 1IBLI 4DR3E 4DUYI 1XMOI 1XNQI 2UXBE 2CZ9A 2XEXA 1MX0A 4DUYE 1MG7A 4JI1I 4B3TE 3CWVA 2NPFA 4JI6I 4LF8I 4GKKI 1IBMI 1KIJA 1Z0BA 4LF9E 3GONA 4DV3I 1Z59A 3WU5A 2DEIA 1N33I 1HNWE 4YY3E 3ZZTA 4JI2E 1QZRA 2ZM6I 2X7IA 4DR5E 2UUAI 1I94E 4DV2I 1HNXE 1MU5A 3LNUA 4DV0E 4JI5I 4NXMI 1Z5AA 3ZKBA 1EA6A 1S16A 4K0KE 2V2ZA 4DUZE 3V5RA 1J5EI 1XNRI 4NXNI 3J80C 4Z7YA 4JG4A 2E1RA 3D4JA 1ZM4A 4JYAI 5FLXQ 4JI0E 4DV7E 4FN5A 2BM0A 4X62E 2F4VI 4JI8E 5BR8I 4DXLA 2UUBE 3J7AG 1B63A 3T1YI 1Z0EA 4HXZA 3B82A 2WW4A 4WUBA 4LF6I 4LF7E 4DR7I 3JAMC 4X64E 1FJGE 4P7AA 4HYMA 1HNZE 2V2VA 4JV5E 1Z0GA 4USKA 4YHHI 1PKPA 3WU4A 1S4EA 2HKEA 2GS8A 4HACB 3QT8A 4DR4I 4PRVA 4DR6I 1A6FA 2E5LI 1WUUA 4PRXA 2A2CA 4DV4I 4M1KA 1OJ4A 4HACA 3T1HE 5L3JA 3OTOE 4JI3E 1N34I 4B3ME 4X66E 5IWAI 3HULA 1ZM3A 4DR2I 3V2UC 5IT9C 1XMQE 2LJPA 4JI4I 4DPYA 1N36E 4LF4I 4LFCE 4DR2E 4USMA 3ZZ0A 3K17A 4B3MI 1FWKA 2UXCE 2DEJA 5IT9Q 4DPUA 3WU3A 2R42A 4OX9I 5LMNI 4DU8A 1Z5CA 5LMUI 4DV1I 2UXDE 4JI7E 3B8HA 2E5LE 4DPTA 1FNMA 4DR4E 2Q2EB 4WUDA 1N32I 1ZXNA 4DR1E 1KKHA 2BV3A 3QT6A 4YHHE 4DPXA 1N32E 1N0VC 1UEKA 4JV5I 3Q1QA 1FJGI 2V8PA 1NZ0A 2UXDI 1NHIA 2VQEE 1BKNA 5FLXC 3JAMQ 1H72C 4OX9E 1D6TA 4DV6E 2HFUA 2UUBI 3K1JA 3ZM7A 2A2DA 3ZKDA 3PYEA 2VQFI 4DV7I 4DR1I 2ZBKB 3LPSA 3J7AM 4JI7I 4JI3I 4DV1E 4AQYI 5LMUE 2AJ4A 3T1HI 3B78A 4DV4E 5LMNE 4AQYE 1ZM9A 4FWDA 5LL6R 3PYFA 4K0KI 4WUCA 4UTGA 3J80Q 4LFCI 1N36I 4LF4E 4JI4E 1FKAE 4EMDA 2VQFE 1Z0TA 2X36A 4HY1A 3LTOA 4DR5I 5IWAE 1N0UA 1HNZI 5GMDA 4DV6I 1N34E 3OTOI 3PYGA
chains in the Genus database with same CATH superfamily
2VQEI 4UT4A 1Z5BA 4DR7E 3CDJA 4LF6E 4IFDE 1Z0WA 2Z5BB 4LF9I 3ZZUA 2O1UA 3P06A 2BA1D 1IBME 3T1YE 2PO0A 4DR6E 1XHKA 5BR8E 3PRYA 4X62I 3P3EA 4MU3A 4JI0I 1ZM2A 4FWHA 4IZKB 1E3PA 3M85D 1DARA 3CDIA 4IFDC 3F0NA 1IBLE 1HK7A 4ED4A 1U2RA 5DNXA 4B3SI 2CVEA 2HHHI 3PS2A 4URLA 4I3HA 5DRQA 5A2QQ 4LPFA 2O1VA 1E3HA 1KTVA 2R3VA 5K36B 2HK2A 2UXCI 3PYDA 2HKJA 4LFAE 2F4VE 4FWGA 4Z7CA 1NHJA 2PO1A 5K36C 4NXME 1XMQI 2PO2A 5DROA 2OI2A 1USUA 2BM1A 4DV2E 1HNXI 2NN6F 3H1CA 4LCGA 3L7ZA 2HFSA 2ZM6E 4JYAE 3QT5A 4X66I 5C0XE 4AM3A 4OO1C 2EFGA 3HKMA 1FI4A 2J7KA 4DV3E 1RR9A 4NXNE 1HR0I 5K36E 4DUZI 1IBKE 1ELOA 1Z0VA 3Q6MA 4J3DA 4BA2B 4B3RE 1I94I 4DU7A 2UUAE 2PNLA 2HK3A 4DPWA 2Z5BA 4ZVIA 4IZKA 2JEBA 4JI2I 1PVGA 4X64I 3J81C 1N33E 3J81Q 4DR3I 4KHPE 3QT7A 3WU6A 4LF7I 5DRPA 1ZXMA 2V2QA 4OZEA 4LF8E 1KVKA 4JI6E 5DNLA 2Z5CB 4KHPI 4JI8I 4JI1E 5GMEA 4DV5I 5A2QC 3M7ND 3H4LA 4IZJB 4B3RI 2CGEA 1H74A 2UUCI 1XNQE 2UXBI 4X65E 5ELWA 2IERA 1XMOE 1H7UA 1B62A 3L7ZB 2C39B 4XTJA 1EI1A 2JEAB 1IBKI 3M6AA 1HR0E 1USVA 1OYPA 4GKJI 3K85A 5C0XC 1NHHA 3KRNA 4GKJE 2PO2B 4ISAA 1J5EE 1XNRE 2NN6A 2UU9I 3M7NG 1VISA 4LF5E 2VF3A 4PU9A 4P52A 5JEAD 5K36F 1RREA 4N3OA 4X65I 4DV0I 4MYUA 4JI5E 4LFBI 4FW9A 2UUCE 2NN6C 4U3BA 4LFBE 4MDTA 2GQ0A 4R1FA 2V34A 4LF5I 1K47A 4DV5E 4OO1D 4YY3I 1H7SA 2UU9E 1HNWI 2ZITA 1FWLA 4MYTA 4LFAI 2BA0D 1PIEA 4RPFA 4KQVA 4IS9A 1OYSA 3HJCA 2HHHE 4GKKE 4B3SE 2O3ZA 1H73A 1Z0CA 4LCHA 4B3TI 1IBLI 4DR3E 4DUYI 2AE8A 1XMOI 1XNQI 2UXBE 4LCFA 1Y6ZA 2CZ9A 2Z5EA 3P3GA 2XEXA 1MX0A 3NZKA 1MG7A 3P76A 4GQUA 4JI1I 2NN6E 4DUYE 4FW3A 4FW4A 4B3TE 4FW6A 3CWVA 2NPFA 4JI6I 4OO1B 4LF8I 4GKKI 1IBMI 1KIJA 1UDSA 3M85G 1Z0BA 4LF9E 3GONA 4DV3I 1Z59A 2GO3A 3WU5A 2DEIA 1N33I 1HNWE 4YY3E 3ZZTA 4JI2E 1QZRA 2ZM6I 2X7IA 4DR5E 2UUAI 1I94E 4DV2I 1HNXE 1MU5A 3LNUA 3U1YA 4DV0E 4JI5I 4NXMI 1Z5AA 3ZKBA 2WP8A 1EA6A 1S16A 3P3CA 3GCMA 2F1DA 4K0KE 2V2ZA 4DUZE 3V5RA 1J5EI 1XNRI 4NXNI 5C0XD 2WP8B 3J80C 4MQYA 4Z7YA 4JG4A 4QNKA 2E1RA 3D4JA 2PNMA 1ZM4A 4JYAI 5FLXQ 2BA1G 2NN6D 1P42A 2BR2B 4BA1B 4JI0E 4DV7E 4FN5A 4MU0A 2BM0A 4X62E 2WNRB 2F4VI 4JI8E 5BR8I 2JEBB 4DXLA 2IESA 1XXEA 2UUBE 3J7AG 1B63A 3T1YI 2O1WA 4OO1A 1Z0EA 1Y60A 4U3DA 2NN6B 4HXZA 5FWKA 2C37B 3B82A 1UDQA 2WW4A 4WUBA 4LF6I 4LF7E 4AIDA 4DR7I 3Q6NA 2PO1B 3JAMC 4X64E 4P7AA 1FJGE 4HYMA 1HNZE 2V2VA 4JV5E 4AIMA 1Z0GA 4USKA 3GLLA 1R6LA 4YHHI 1UDNA 1PKPA 3WU4A 1S4EA 2HKEA 2GS8A 4HACB 3QT8A 3GMEA 4IFDD 4DR4I 4IFDB 4PRVA 4DR6I 1A6FA 2E5LI 1WUUA 5JEAE 2JEAA 5EKWA 4PRXA 2A2CA 4DV4I 4M1KA 1OJ4A 4HACA 2C38A 2JE6B 2O1TA 3T1HE 5L3JA 3OTOE 4BA2A 2GO4A 1N34I 4JI3E 4B3ME 4X66E 4OKGA 5IWAI 4IFDF 1YHCA 1ZM3A 2C38B 2JE6A 3HULA 4DR2I 3V2UC 5IT9C 1XMQE 2LJPA 4JI4I 3PS3A 4DPYA 1N36E 4LF4I 4LFCE 4NBQA 4DR2E 4USMA 2J65A 3ZZ0A 3K17A 4B3MI 1FWKA 2UXCE 2DEJA 5IT9Q 5JEAB 4DPUA 3WU3A 2R42A 4OX9I 5LMNI 4DU8A 5EL9A 2Z5CA 5C0XF 1Z5CA 2C37A 2IOQA 5LMUI 4OO1E 4DV1I 5C0XA 2UXDE 2BR2A 3B8HA 4JI7E 3UHMA 1Y4UA 5JEAA 2E5LE 4OO1F 4DPTA 1FNMA 4DR4E 2Q2EB 4WUDA 1N32I 1ZXNA 5C0XB 2VESA 4DR1E 1KKHA 2BV3A 2C39A 3QT6A 1OYRA 5JEAC 4YHHE 4DPXA 2PO0B 1N32E 1N0VC 2PNZA 4FW5A 1UEKA 4JV5I 1Y5YA 1UDOA 3DD6A 4IFDA 1RHYA 5K36A 3Q1QA 1FJGI 1Y4SA 2V8PA 4BA1A 1NZ0A 3U1KA 2UXDI 4FW7A 1NHIA 2VQEE 1BKNA 5FLXC 1R6MA 3JAMQ 1H72C 4OX9E 1D6TA 4DV6E 2HFUA 2UUBI 3K1JA 3ZM7A 2A2DA 3ZKDA 4MU4A 3PYEA 2VQFI 4DV7I 4DR1I 2ZBKB 2JT2A 3LPSA 2PNZB 3J7AM 2BA0G 5DRRA 4QNJA 3PS1A 2IOPA 4JI7I 4JI3I 4DV1E 4AQYI 5LMUE 2AJ4A 3T1HI 3B78A 4IZJD 1VI7A 1YH8A 4DV4E 5LMNE 4AQYE 1ZM9A 4FWDA 2CG9A 5LL6R 3PYFA 4K0KI 4MU1A 4WUCA 4UTGA 3J80Q 4LFCI 1N36I 4LF4E 4JI4E 1FKAE 4EMDA 2VQFE 1Z0TA 2X36A 4HY1A 4IZJA 3LTOA 4DR5I 5JEAF 5IWAE 1N0UA 5K36D 2WNRA 1HNZI 5GMDA 3B4TA 4DV6I 1N34E 3OTOI 4LOMA 3PYGA
chains in the Genus database with same CATH topology
2VQEI 4UT4A 1Z5BA 4DR7E 4LF6E 1Z0WA 2Z5BB 4LF9I 3ZZUA 2O1UA 3P06A 1IBME 3T1YE 4DR6E 1XHKA 5BR8E 3PRYA 4X62I 4JI0I 1ZM2A 4FWHA 4IZKB 1DARA 3F0NA 1IBLE 1HK7A 4ED4A 1U2RA 4B3SI 2HHHI 4URLA 4I3HA 5A2QQ 2O1VA 2R3VA 1KTVA 2HK2A 2UXCI 3PYDA 2HKJA 4LFAE 2F4VE 4FWGA 4Z7CA 1NHJA 4NXME 1XMQI 2OI2A 1USUA 2BM1A 4DV2E 1HNXI 2HFSA 2ZM6E 4JYAE 3QT5A 4X66I 2EFGA 1FI4A 2J7KA 4DV3E 1RR9A 4NXNE 1HR0I 4DUZI 1IBKE 1ELOA 1Z0VA 3Q6MA 4B3RE 1I94I 2UUAE 4DU7A 2PNLA 2HK3A 4DPWA 2Z5BA 4ZVIA 4IZKA 4JI2I 1PVGA 4X64I 3J81C 1N33E 3J81Q 4DR3I 4KHPE 3QT7A 3WU6A 4LF7I 1ZXMA 2V2QA 4LF8E 1KVKA 4JI6E 2Z5CB 4KHPI 4JI8I 4JI1E 5GMEA 4DV5I 5A2QC 3H4LA 4IZJB 4B3RI 2CGEA 1H74A 2UUCI 1XNQE 2UXBI 4X65E 1XMOE 1H7UA 1B62A 4XTJA 1EI1A 1IBKI 3M6AA 1HR0E 1USVA 4GKJI 3K85A 1NHHA 4GKJE 1J5EE 1XNRE 2UU9I 1VISA 4LF5E 2VF3A 4PU9A 4P52A 1RREA 4N3OA 4X65I 4DV0I 4MYUA 4JI5E 4LFBI 4FW9A 2UUCE 4LFBE 2GQ0A 4R1FA 2V34A 4LF5I 1K47A 4DV5E 4YY3I 1H7SA 2UU9E 1HNWI 2ZITA 1FWLA 4MYTA 4LFAI 1PIEA 4RPFA 4KQVA 3HJCA 2HHHE 4GKKE 4B3SE 1H73A 1Z0CA 4B3TI 1IBLI 4DR3E 4DUYI 1XMOI 1XNQI 2UXBE 1Y6ZA 2CZ9A 2Z5EA 2XEXA 1MX0A 4DUYE 1MG7A 4JI1I 4B3TE 3CWVA 2NPFA 4JI6I 4LF8I 4GKKI 1IBMI 1KIJA 1Z0BA 4LF9E 3GONA 4DV3I 1Z59A 3WU5A 2DEIA 1N33I 1HNWE 4YY3E 3ZZTA 4JI2E 1QZRA 2ZM6I 2X7IA 4DR5E 2UUAI 1I94E 4DV2I 1HNXE 1MU5A 3LNUA 4DV0E 4JI5I 4NXMI 1Z5AA 3ZKBA 1EA6A 1S16A 4K0KE 2V2ZA 4DUZE 3V5RA 1J5EI 1XNRI 4NXNI 3J80C 4Z7YA 4JG4A 2E1RA 3D4JA 2PNMA 1ZM4A 4JYAI 5FLXQ 4JI0E 4DV7E 4FN5A 2BM0A 4X62E 2F4VI 4JI8E 5BR8I 4DXLA 2UUBE 3J7AG 1B63A 3T1YI 2O1WA 1Z0EA 4HXZA 5FWKA 3B82A 2WW4A 4WUBA 4LF6I 4LF7E 4DR7I 3Q6NA 3JAMC 4X64E 4P7AA 1FJGE 4HYMA 1HNZE 2V2VA 4JV5E 1Z0GA 4USKA 4YHHI 1PKPA 3WU4A 1S4EA 2HKEA 2GS8A 4HACB 3QT8A 4DR4I 4PRVA 4DR6I 1A6FA 2E5LI 1WUUA 4PRXA 2A2CA 4DV4I 4M1KA 1OJ4A 4HACA 2O1TA 3T1HE 5L3JA 3OTOE 4JI3E 1N34I 4B3ME 4X66E 5IWAI 3HULA 1ZM3A 4DR2I 3V2UC 5IT9C 1XMQE 2LJPA 4JI4I 4DPYA 1N36E 4LF4I 4LFCE 4DR2E 4USMA 3ZZ0A 3K17A 4B3MI 1FWKA 2UXCE 2DEJA 5IT9Q 4DPUA 3WU3A 2R42A 4OX9I 5LMNI 4DU8A 2Z5CA 1Z5CA 2IOQA 5LMUI 4DV1I 2UXDE 4JI7E 3B8HA 1Y4UA 2E5LE 4DPTA 1FNMA 4DR4E 2Q2EB 4WUDA 1N32I 1ZXNA 4DR1E 1KKHA 2BV3A 3QT6A 4YHHE 4DPXA 1N32E 1N0VC 1UEKA 4JV5I 3Q1QA 1FJGI 1Y4SA 2V8PA 1NZ0A 2UXDI 1NHIA 2VQEE 1BKNA 5FLXC 3JAMQ 1H72C 4OX9E 1D6TA 4DV6E 2HFUA 2UUBI 3K1JA 3ZM7A 2A2DA 3ZKDA 3PYEA 2VQFI 4DV7I 4DR1I 2ZBKB 3LPSA 3J7AM 2IOPA 4JI7I 4JI3I 4DV1E 4AQYI 5LMUE 2AJ4A 3T1HI 3B78A 4IZJD 4DV4E 5LMNE 4AQYE 1ZM9A 4FWDA 2CG9A 5LL6R 3PYFA 4K0KI 4WUCA 4UTGA 3J80Q 4LFCI 1N36I 4LF4E 4JI4E 1FKAE 4EMDA 2VQFE 1Z0TA 2X36A 4HY1A 4IZJA 3LTOA 4DR5I 5IWAE 1N0UA 1HNZI 5GMDA 4DV6I 1N34E 3OTOI 3PYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE I;  4UT4 A;  1Z5B A;  4DR7 E;  4LF6 E;  1Z0W A;  4LF9 I;  3ZZU A;  1IBM E;  3T1Y E;  4DR6 E;  1XHK A;  5BR8 E;  4X62 I;  4JI0 I;  1ZM2 A;  4FWH A;  1DAR A;  3F0N A;  1IBL E;  4ED4 A;  1U2R A;  4B3S I;  2HHH I;  4URL A;  4I3H A;  5A2Q Q;  2R3V A;  1KTV A;  2HK2 A;  2UXC I;  3PYD A;  2HKJ A;  4LFA E;  2F4V E;  4FWG A;  4Z7C A;  1NHJ A;  4NXM E;  1XMQ I;  2OI2 A;  2BM1 A;  4DV2 E;  1HNX I;  2HFS A;  2ZM6 E;  4JYA E;  3QT5 A;  4X66 I;  2EFG A;  1FI4 A;  2J7K A;  4DV3 E;  1RR9 A;  4NXN E;  1HR0 I;  4DUZ I;  1IBK E;  1ELO A;  1Z0V A;  4B3R E;  1I94 I;  4DU7 A;  2UUA E;  2HK3 A;  4DPW A;  4ZVI A;  4JI2 I;  1PVG A;  4X64 I;  3J81 C;  1N33 E;  3J81 Q;  4DR3 I;  4KHP E;  3QT7 A;  3WU6 A;  4LF7 I;  1ZXM A;  2V2Q A;  4LF8 E;  1KVK A;  4JI6 E;  4KHP I;  4JI8 I;  4JI1 E;  5GME A;  4DV5 I;  5A2Q C;  3H4L A;  4B3R I;  1H74 A;  2UUC I;  1XNQ E;  2UXB I;  4X65 E;  1XMO E;  1H7U A;  1B62 A;  4XTJ A;  1EI1 A;  1IBK I;  3M6A A;  1HR0 E;  4GKJ I;  1NHH A;  4GKJ E;  1J5E E;  1XNR E;  2UU9 I;  1VIS A;  4LF5 E;  2VF3 A;  4PU9 A;  4P52 A;  1RRE A;  4X65 I;  4DV0 I;  4MYU A;  4JI5 E;  4LFB I;  4FW9 A;  2UUC E;  4LFB E;  4R1F A;  2V34 A;  4LF5 I;  1K47 A;  4DV5 E;  4YY3 I;  1H7S A;  2UU9 E;  1HNW I;  2ZIT A;  1FWL A;  4MYT A;  4LFA I;  1PIE A;  4RPF A;  4KQV A;  2HHH E;  4GKK E;  4B3S E;  1H73 A;  1Z0C A;  4B3T I;  1IBL I;  4DR3 E;  4DUY I;  1XMO I;  1XNQ I;  2UXB E;  2CZ9 A;  2XEX A;  1MX0 A;  4DUY E;  1MG7 A;  4JI1 I;  4B3T E;  3CWV A;  2NPF A;  4JI6 I;  4LF8 I;  4GKK I;  1IBM I;  1KIJ A;  1Z0B A;  4LF9 E;  3GON A;  4DV3 I;  1Z59 A;  3WU5 A;  2DEI A;  1N33 I;  1HNW E;  4YY3 E;  3ZZT A;  4JI2 E;  1QZR A;  2ZM6 I;  2X7I A;  4DR5 E;  2UUA I;  1I94 E;  4DV2 I;  1HNX E;  1MU5 A;  3LNU A;  4DV0 E;  4JI5 I;  4NXM I;  1Z5A A;  3ZKB A;  1EA6 A;  1S16 A;  4K0K E;  2V2Z A;  4DUZ E;  3V5R A;  1J5E I;  1XNR I;  4NXN I;  3J80 C;  4Z7Y A;  4JG4 A;  2E1R A;  3D4J A;  1ZM4 A;  4JYA I;  5FLX Q;  4JI0 E;  4DV7 E;  4FN5 A;  2BM0 A;  4X62 E;  2F4V I;  4JI8 E;  5BR8 I;  4DXL A;  2UUB E;  3J7A G;  1B63 A;  3T1Y I;  1Z0E A;  4HXZ A;  3B82 A;  2WW4 A;  4WUB A;  4LF6 I;  4LF7 E;  4DR7 I;  3JAM C;  4X64 E;  1FJG E;  4P7A A;  4HYM A;  1HNZ E;  2V2V A;  4JV5 E;  1Z0G A;  4USK A;  4YHH I;  1PKP A;  3WU4 A;  1S4E A;  2HKE A;  2GS8 A;  4HAC B;  3QT8 A;  4DR4 I;  4PRV A;  4DR6 I;  1A6F A;  2E5L I;  1WUU A;  4PRX A;  2A2C A;  4DV4 I;  4M1K A;  1OJ4 A;  4HAC A;  3T1H E;  5L3J A;  3OTO E;  4JI3 E;  1N34 I;  4B3M E;  4X66 E;  5IWA I;  3HUL A;  1ZM3 A;  4DR2 I;  3V2U C;  5IT9 C;  1XMQ E;  2LJP A;  4JI4 I;  4DPY A;  1N36 E;  4LF4 I;  4LFC E;  4DR2 E;  4USM A;  3ZZ0 A;  3K17 A;  4B3M I;  1FWK A;  2UXC E;  2DEJ A;  5IT9 Q;  4DPU A;  3WU3 A;  2R42 A;  4OX9 I;  5LMN I;  4DU8 A;  1Z5C A;  5LMU I;  4DV1 I;  2UXD E;  4JI7 E;  3B8H A;  2E5L E;  4DPT A;  1FNM A;  4DR4 E;  2Q2E B;  4WUD A;  1N32 I;  1ZXN A;  4DR1 E;  1KKH A;  2BV3 A;  3QT6 A;  4YHH E;  4DPX A;  1N32 E;  1N0V C;  1UEK A;  4JV5 I;  3Q1Q A;  1FJG I;  2V8P A;  1NZ0 A;  2UXD I;  1NHI A;  2VQE E;  1BKN A;  5FLX C;  3JAM Q;  1H72 C;  4OX9 E;  1D6T A;  4DV6 E;  2HFU A;  2UUB I;  3K1J A;  3ZM7 A;  2A2D A;  3ZKD A;  3PYE A;  2VQF I;  4DV7 I;  4DR1 I;  2ZBK B;  3LPS A;  3J7A M;  4JI7 I;  4JI3 I;  4DV1 E;  4AQY I;  5LMU E;  2AJ4 A;  3T1H I;  3B78 A;  4DV4 E;  5LMN E;  4AQY E;  1ZM9 A;  4FWD A;  5LL6 R;  3PYF A;  4K0K I;  4WUC A;  4UTG A;  3J80 Q;  4LFC I;  1N36 I;  4LF4 E;  4JI4 E;  1FKA E;  4EMD A;  2VQF E;  1Z0T A;  2X36 A;  4HY1 A;  3LTO A;  4DR5 I;  5IWA E;  1N0U A;  1HNZ I;  5GMD A;  4DV6 I;  1N34 E;  3OTO I;  3PYG A; 
#chains in the Genus database with same CATH topology
 2VQE I;  4UT4 A;  1Z5B A;  4DR7 E;  3CDJ A;  4LF6 E;  4IFD E;  1Z0W A;  2Z5B B;  4LF9 I;  3ZZU A;  2O1U A;  3P06 A;  2BA1 D;  1IBM E;  3T1Y E;  2PO0 A;  4DR6 E;  1XHK A;  5BR8 E;  3PRY A;  4X62 I;  3P3E A;  4MU3 A;  4JI0 I;  1ZM2 A;  4FWH A;  4IZK B;  1E3P A;  3M85 D;  1DAR A;  3CDI A;  4IFD C;  3F0N A;  1IBL E;  1HK7 A;  4ED4 A;  1U2R A;  5DNX A;  4B3S I;  2CVE A;  2HHH I;  3PS2 A;  4URL A;  4I3H A;  5DRQ A;  5A2Q Q;  4LPF A;  2O1V A;  1E3H A;  1KTV A;  2R3V A;  5K36 B;  2HK2 A;  2UXC I;  3PYD A;  2HKJ A;  4LFA E;  2F4V E;  4FWG A;  4Z7C A;  1NHJ A;  2PO1 A;  5K36 C;  4NXM E;  1XMQ I;  2PO2 A;  5DRO A;  2OI2 A;  1USU A;  2BM1 A;  4DV2 E;  1HNX I;  2NN6 F;  3H1C A;  4LCG A;  3L7Z A;  2HFS A;  2ZM6 E;  4JYA E;  3QT5 A;  4X66 I;  5C0X E;  4AM3 A;  4OO1 C;  2EFG A;  3HKM A;  1FI4 A;  2J7K A;  4DV3 E;  1RR9 A;  4NXN E;  1HR0 I;  5K36 E;  4DUZ I;  1IBK E;  1ELO A;  1Z0V A;  3Q6M A;  4J3D A;  4BA2 B;  4B3R E;  1I94 I;  4DU7 A;  2UUA E;  2PNL A;  2HK3 A;  4DPW A;  2Z5B A;  4ZVI A;  4IZK A;  2JEB A;  4JI2 I;  1PVG A;  4X64 I;  3J81 C;  1N33 E;  3J81 Q;  4DR3 I;  4KHP E;  3QT7 A;  3WU6 A;  4LF7 I;  5DRP A;  1ZXM A;  2V2Q A;  4OZE A;  4LF8 E;  1KVK A;  4JI6 E;  5DNL A;  2Z5C B;  4KHP I;  4JI8 I;  4JI1 E;  5GME A;  4DV5 I;  5A2Q C;  3M7N D;  3H4L A;  4IZJ B;  4B3R I;  2CGE A;  1H74 A;  2UUC I;  1XNQ E;  2UXB I;  4X65 E;  5ELW A;  2IER A;  1XMO E;  1H7U A;  1B62 A;  3L7Z B;  2C39 B;  4XTJ A;  1EI1 A;  2JEA B;  1IBK I;  3M6A A;  1HR0 E;  1USV A;  1OYP A;  4GKJ I;  3K85 A;  5C0X C;  1NHH A;  3KRN A;  4GKJ E;  2PO2 B;  4ISA A;  1J5E E;  1XNR E;  2NN6 A;  2UU9 I;  3M7N G;  1VIS A;  4LF5 E;  2VF3 A;  4PU9 A;  4P52 A;  5JEA D;  5K36 F;  1RRE A;  4N3O A;  4X65 I;  4DV0 I;  4MYU A;  4JI5 E;  4LFB I;  4FW9 A;  2UUC E;  2NN6 C;  4U3B A;  4LFB E;  4MDT A;  2GQ0 A;  4R1F A;  2V34 A;  4LF5 I;  1K47 A;  4DV5 E;  4OO1 D;  4YY3 I;  1H7S A;  2UU9 E;  1HNW I;  2ZIT A;  1FWL A;  4MYT A;  4LFA I;  2BA0 D;  1PIE A;  4RPF A;  4KQV A;  4IS9 A;  1OYS A;  3HJC A;  2HHH E;  4GKK E;  4B3S E;  2O3Z A;  1H73 A;  1Z0C A;  4LCH A;  4B3T I;  1IBL I;  4DR3 E;  4DUY I;  2AE8 A;  1XMO I;  1XNQ I;  2UXB E;  4LCF A;  1Y6Z A;  2CZ9 A;  2Z5E A;  3P3G A;  2XEX A;  1MX0 A;  3NZK A;  1MG7 A;  3P76 A;  4GQU A;  4JI1 I;  2NN6 E;  4DUY E;  4FW3 A;  4FW4 A;  4B3T E;  4FW6 A;  3CWV A;  2NPF A;  4JI6 I;  4OO1 B;  4LF8 I;  4GKK I;  1IBM I;  1KIJ A;  1UDS A;  3M85 G;  1Z0B A;  4LF9 E;  3GON A;  4DV3 I;  1Z59 A;  2GO3 A;  3WU5 A;  2DEI A;  1N33 I;  1HNW E;  4YY3 E;  3ZZT A;  4JI2 E;  1QZR A;  2ZM6 I;  2X7I A;  4DR5 E;  2UUA I;  1I94 E;  4DV2 I;  1HNX E;  1MU5 A;  3LNU A;  3U1Y A;  4DV0 E;  4JI5 I;  4NXM I;  1Z5A A;  3ZKB A;  2WP8 A;  1EA6 A;  1S16 A;  3P3C A;  3GCM A;  2F1D A;  4K0K E;  2V2Z A;  4DUZ E;  3V5R A;  1J5E I;  1XNR I;  4NXN I;  5C0X D;  2WP8 B;  3J80 C;  4MQY A;  4Z7Y A;  4JG4 A;  4QNK A;  2E1R A;  3D4J A;  2PNM A;  1ZM4 A;  4JYA I;  5FLX Q;  2BA1 G;  2NN6 D;  1P42 A;  2BR2 B;  4BA1 B;  4JI0 E;  4DV7 E;  4FN5 A;  4MU0 A;  2BM0 A;  4X62 E;  2WNR B;  2F4V I;  4JI8 E;  5BR8 I;  2JEB B;  4DXL A;  2IES A;  1XXE A;  2UUB E;  3J7A G;  1B63 A;  3T1Y I;  2O1W A;  4OO1 A;  1Z0E A;  1Y60 A;  4U3D A;  2NN6 B;  4HXZ A;  5FWK A;  2C37 B;  3B82 A;  1UDQ A;  2WW4 A;  4WUB A;  4LF6 I;  4LF7 E;  4AID A;  4DR7 I;  3Q6N A;  2PO1 B;  3JAM C;  4X64 E;  4P7A A;  1FJG E;  4HYM A;  1HNZ E;  2V2V A;  4JV5 E;  4AIM A;  1Z0G A;  4USK A;  3GLL A;  1R6L A;  4YHH I;  1UDN A;  1PKP A;  3WU4 A;  1S4E A;  2HKE A;  2GS8 A;  4HAC B;  3QT8 A;  3GME A;  4IFD D;  4DR4 I;  4IFD B;  4PRV A;  4DR6 I;  1A6F A;  2E5L I;  1WUU A;  5JEA E;  2JEA A;  5EKW A;  4PRX A;  2A2C A;  4DV4 I;  4M1K A;  1OJ4 A;  4HAC A;  2C38 A;  2JE6 B;  2O1T A;  3T1H E;  5L3J A;  3OTO E;  4BA2 A;  2GO4 A;  1N34 I;  4JI3 E;  4B3M E;  4X66 E;  4OKG A;  5IWA I;  4IFD F;  1YHC A;  1ZM3 A;  2C38 B;  2JE6 A;  3HUL A;  4DR2 I;  3V2U C;  5IT9 C;  1XMQ E;  2LJP A;  4JI4 I;  3PS3 A;  4DPY A;  1N36 E;  4LF4 I;  4LFC E;  4NBQ A;  4DR2 E;  4USM A;  2J65 A;  3ZZ0 A;  3K17 A;  4B3M I;  1FWK A;  2UXC E;  2DEJ A;  5IT9 Q;  5JEA B;  4DPU A;  3WU3 A;  2R42 A;  4OX9 I;  5LMN I;  4DU8 A;  5EL9 A;  2Z5C A;  5C0X F;  1Z5C A;  2C37 A;  2IOQ A;  5LMU I;  4OO1 E;  4DV1 I;  5C0X A;  2UXD E;  2BR2 A;  3B8H A;  4JI7 E;  3UHM A;  1Y4U A;  5JEA A;  2E5L E;  4OO1 F;  4DPT A;  1FNM A;  4DR4 E;  2Q2E B;  4WUD A;  1N32 I;  1ZXN A;  5C0X B;  2VES A;  4DR1 E;  1KKH A;  2BV3 A;  2C39 A;  3QT6 A;  1OYR A;  5JEA C;  4YHH E;  4DPX A;  2PO0 B;  1N32 E;  1N0V C;  2PNZ A;  4FW5 A;  1UEK A;  4JV5 I;  1Y5Y A;  1UDO A;  3DD6 A;  4IFD A;  1RHY A;  5K36 A;  3Q1Q A;  1FJG I;  1Y4S A;  2V8P A;  4BA1 A;  1NZ0 A;  3U1K A;  2UXD I;  4FW7 A;  1NHI A;  2VQE E;  1BKN A;  5FLX C;  1R6M A;  3JAM Q;  1H72 C;  4OX9 E;  1D6T A;  4DV6 E;  2HFU A;  2UUB I;  3K1J A;  3ZM7 A;  2A2D A;  3ZKD A;  4MU4 A;  3PYE A;  2VQF I;  4DV7 I;  4DR1 I;  2ZBK B;  2JT2 A;  3LPS A;  2PNZ B;  3J7A M;  2BA0 G;  5DRR A;  4QNJ A;  3PS1 A;  2IOP A;  4JI7 I;  4JI3 I;  4DV1 E;  4AQY I;  5LMU E;  2AJ4 A;  3T1H I;  3B78 A;  4IZJ D;  1VI7 A;  1YH8 A;  4DV4 E;  5LMN E;  4AQY E;  1ZM9 A;  4FWD A;  2CG9 A;  5LL6 R;  3PYF A;  4K0K I;  4MU1 A;  4WUC A;  4UTG A;  3J80 Q;  4LFC I;  1N36 I;  4LF4 E;  4JI4 E;  1FKA E;  4EMD A;  2VQF E;  1Z0T A;  2X36 A;  4HY1 A;  4IZJ A;  3LTO A;  4DR5 I;  5JEA F;  5IWA E;  1N0U A;  5K36 D;  2WNR A;  1HNZ I;  5GMD A;  3B4T A;  4DV6 I;  1N34 E;  3OTO I;  4LOM A;  3PYG A; 
#chains in the Genus database with same CATH homology
 2VQE I;  4UT4 A;  1Z5B A;  4DR7 E;  4LF6 E;  1Z0W A;  2Z5B B;  4LF9 I;  3ZZU A;  2O1U A;  3P06 A;  1IBM E;  3T1Y E;  4DR6 E;  1XHK A;  5BR8 E;  3PRY A;  4X62 I;  4JI0 I;  1ZM2 A;  4FWH A;  4IZK B;  1DAR A;  3F0N A;  1IBL E;  1HK7 A;  4ED4 A;  1U2R A;  4B3S I;  2HHH I;  4URL A;  4I3H A;  5A2Q Q;  2O1V A;  2R3V A;  1KTV A;  2HK2 A;  2UXC I;  3PYD A;  2HKJ A;  4LFA E;  2F4V E;  4FWG A;  4Z7C A;  1NHJ A;  4NXM E;  1XMQ I;  2OI2 A;  1USU A;  2BM1 A;  4DV2 E;  1HNX I;  2HFS A;  2ZM6 E;  4JYA E;  3QT5 A;  4X66 I;  2EFG A;  1FI4 A;  2J7K A;  4DV3 E;  1RR9 A;  4NXN E;  1HR0 I;  4DUZ I;  1IBK E;  1ELO A;  1Z0V A;  3Q6M A;  4B3R E;  1I94 I;  2UUA E;  4DU7 A;  2PNL A;  2HK3 A;  4DPW A;  2Z5B A;  4ZVI A;  4IZK A;  4JI2 I;  1PVG A;  4X64 I;  3J81 C;  1N33 E;  3J81 Q;  4DR3 I;  4KHP E;  3QT7 A;  3WU6 A;  4LF7 I;  1ZXM A;  2V2Q A;  4LF8 E;  1KVK A;  4JI6 E;  2Z5C B;  4KHP I;  4JI8 I;  4JI1 E;  5GME A;  4DV5 I;  5A2Q C;  3H4L A;  4IZJ B;  4B3R I;  2CGE A;  1H74 A;  2UUC I;  1XNQ E;  2UXB I;  4X65 E;  1XMO E;  1H7U A;  1B62 A;  4XTJ A;  1EI1 A;  1IBK I;  3M6A A;  1HR0 E;  1USV A;  4GKJ I;  3K85 A;  1NHH A;  4GKJ E;  1J5E E;  1XNR E;  2UU9 I;  1VIS A;  4LF5 E;  2VF3 A;  4PU9 A;  4P52 A;  1RRE A;  4N3O A;  4X65 I;  4DV0 I;  4MYU A;  4JI5 E;  4LFB I;  4FW9 A;  2UUC E;  4LFB E;  2GQ0 A;  4R1F A;  2V34 A;  4LF5 I;  1K47 A;  4DV5 E;  4YY3 I;  1H7S A;  2UU9 E;  1HNW I;  2ZIT A;  1FWL A;  4MYT A;  4LFA I;  1PIE A;  4RPF A;  4KQV A;  3HJC A;  2HHH E;  4GKK E;  4B3S E;  1H73 A;  1Z0C A;  4B3T I;  1IBL I;  4DR3 E;  4DUY I;  1XMO I;  1XNQ I;  2UXB E;  1Y6Z A;  2CZ9 A;  2Z5E A;  2XEX A;  1MX0 A;  4DUY E;  1MG7 A;  4JI1 I;  4B3T E;  3CWV A;  2NPF A;  4JI6 I;  4LF8 I;  4GKK I;  1IBM I;  1KIJ A;  1Z0B A;  4LF9 E;  3GON A;  4DV3 I;  1Z59 A;  3WU5 A;  2DEI A;  1N33 I;  1HNW E;  4YY3 E;  3ZZT A;  4JI2 E;  1QZR A;  2ZM6 I;  2X7I A;  4DR5 E;  2UUA I;  1I94 E;  4DV2 I;  1HNX E;  1MU5 A;  3LNU A;  4DV0 E;  4JI5 I;  4NXM I;  1Z5A A;  3ZKB A;  1EA6 A;  1S16 A;  4K0K E;  2V2Z A;  4DUZ E;  3V5R A;  1J5E I;  1XNR I;  4NXN I;  3J80 C;  4Z7Y A;  4JG4 A;  2E1R A;  3D4J A;  2PNM A;  1ZM4 A;  4JYA I;  5FLX Q;  4JI0 E;  4DV7 E;  4FN5 A;  2BM0 A;  4X62 E;  2F4V I;  4JI8 E;  5BR8 I;  4DXL A;  2UUB E;  3J7A G;  1B63 A;  3T1Y I;  2O1W A;  1Z0E A;  4HXZ A;  5FWK A;  3B82 A;  2WW4 A;  4WUB A;  4LF6 I;  4LF7 E;  4DR7 I;  3Q6N A;  3JAM C;  4X64 E;  4P7A A;  1FJG E;  4HYM A;  1HNZ E;  2V2V A;  4JV5 E;  1Z0G A;  4USK A;  4YHH I;  1PKP A;  3WU4 A;  1S4E A;  2HKE A;  2GS8 A;  4HAC B;  3QT8 A;  4DR4 I;  4PRV A;  4DR6 I;  1A6F A;  2E5L I;  1WUU A;  4PRX A;  2A2C A;  4DV4 I;  4M1K A;  1OJ4 A;  4HAC A;  2O1T A;  3T1H E;  5L3J A;  3OTO E;  4JI3 E;  1N34 I;  4B3M E;  4X66 E;  5IWA I;  3HUL A;  1ZM3 A;  4DR2 I;  3V2U C;  5IT9 C;  1XMQ E;  2LJP A;  4JI4 I;  4DPY A;  1N36 E;  4LF4 I;  4LFC E;  4DR2 E;  4USM A;  3ZZ0 A;  3K17 A;  4B3M I;  1FWK A;  2UXC E;  2DEJ A;  5IT9 Q;  4DPU A;  3WU3 A;  2R42 A;  4OX9 I;  5LMN I;  4DU8 A;  2Z5C A;  1Z5C A;  2IOQ A;  5LMU I;  4DV1 I;  2UXD E;  4JI7 E;  3B8H A;  1Y4U A;  2E5L E;  4DPT A;  1FNM A;  4DR4 E;  2Q2E B;  4WUD A;  1N32 I;  1ZXN A;  4DR1 E;  1KKH A;  2BV3 A;  3QT6 A;  4YHH E;  4DPX A;  1N32 E;  1N0V C;  1UEK A;  4JV5 I;  3Q1Q A;  1FJG I;  1Y4S A;  2V8P A;  1NZ0 A;  2UXD I;  1NHI A;  2VQE E;  1BKN A;  5FLX C;  3JAM Q;  1H72 C;  4OX9 E;  1D6T A;  4DV6 E;  2HFU A;  2UUB I;  3K1J A;  3ZM7 A;  2A2D A;  3ZKD A;  3PYE A;  2VQF I;  4DV7 I;  4DR1 I;  2ZBK B;  3LPS A;  3J7A M;  2IOP A;  4JI7 I;  4JI3 I;  4DV1 E;  4AQY I;  5LMU E;  2AJ4 A;  3T1H I;  3B78 A;  4IZJ D;  4DV4 E;  5LMN E;  4AQY E;  1ZM9 A;  4FWD A;  2CG9 A;  5LL6 R;  3PYF A;  4K0K I;  4WUC A;  4UTG A;  3J80 Q;  4LFC I;  1N36 I;  4LF4 E;  4JI4 E;  1FKA E;  4EMD A;  2VQF E;  1Z0T A;  2X36 A;  4HY1 A;  4IZJ A;  3LTO A;  4DR5 I;  5IWA E;  1N0U A;  1HNZ I;  5GMD A;  4DV6 I;  1N34 E;  3OTO I;  3PYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...