3P06A

Crystal structure of tellina virus 1 vp4 protease in the form of an intra-molecular(cis)acyl-enzyme complex.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
194
Chain Sequence
NGVELSAVGVLLPVLMDSGRRISGGAFMAVKGDLSEHIKNPKNTRIAQTVAGGTIYGLSEMVNIDEAEKLPIKGAITVLPVVQATATSILVPDNQPQLAFNSWEAAACAADTLESQQTPFLMVTGAVESGNLSPNLLAVQKQLLVAKPAGIGLAANSDRALKVVTLEQLRQVVGDKPWRKPMVTFSSGKNVAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of a Viral Protease Intramolecular Acyl-enzyme Complex: INSIGHTS INTO cis-CLEAVAGE AT THE VP4/VP3 JUNCTION OF TELLINA BIRNAVIRUS.
pubmed doi rcsb
source organism Tellina virus 1
molecule tags Hydrolase
molecule keywords VP4 protein
total genus 48
structure length 194
sequence length 194
ec nomenclature ec 3.4.21.115: Infectious pancreatic necrosis birnavirus Vp4 peptidase.
pdb deposition date 2010-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3p06A00
2PNMA 2PNLA 4IZJB 4IZJD 3P06A 4IZKB 4IZJA 4IZKA
chains in the Genus database with same CATH superfamily
1FWLA 4LF6I 1XNRE 2PNZA 4X65I 4DR4E 4KHPE 2WNRB 1Z5CA 4AIDA 5K36D 4LF6E 2BA1D 1XNRI 1H7SA 5JEAC 2A2DA 3K17A 5C0XD 3M6AA 2HK3A 3HJCA 1EI1A 5GMEA 4GKKI 4IFDA 4P7AA 2E1RA 4LCHA 5C0XF 4MYTA 3KRNA 4NXME 2UUCE 4M1KA 4JI0I 4K0KI 1IBKE 3Q6NA 1ZXNA 1ZM4A 4BA1B 4NXMI 3P3CA 1I94I 4DR6E 4X64E 1HNWI 4JI0E 1IBKI 2F1DA 4IFDF 1P42A 2A2CA 1HR0E 2C37A 4PRVA 1UDNA 1I94E 5K36F 1HK7A 4DPXA 4X64I 4JI1E 4MU4A 2HHHI 2O1WA 5DNXA 1HR0I 2JEAA 4MYUA 4NXNI 2CVEA 1OYSA 4OO1A 4JI1I 1FJGE 2BV3A 4LF7E 4DPYA 2Z5BA 2PNLA 4J3DA 4DV7E 4B3SE 4DR1I 4UTGA 3F0NA 5DRRA 4LF8E 4FW6A 4BA2B 4ISAA 2O1VA 2Z5BB 3J7AG 4DV7I 4UT4A 4B3SI 5DRPA 4IZJB 4OX9I 1E3PA 4FW4A 3PS2A 4LF9E 3WU5A 4OO1C 2UUAE 3M85G 4LF8I 2DEJA 5IWAI 2NPFA 1HNZE 1RHYA 2GO4A 2OI2A 1Z0BA 1Y60A 1Y4UA 2NN6B 3HKMA 2C37B 2PO2B 3M7ND 3L7ZB 4DR3I 2Z5EA 2UUBI 2UXBI 1Y6ZA 3J7AM 2BA0G 5K36E 4URLA 4LFCI 3T1HI 1B63A 4B3MI 4DV3E 2ZM6E 2UUBE 2PO0B 1DARA 4AQYI 1R6MA 4LF5I 1FI4A 2GQ0A 4LFCE 2HKEA 2LJPA 1YH8A 1OYPA 4DPTA 3J80C 1J5EE 2WP8A 1NZ0A 4JI2E 4IFDB 2R42A 1KTVA 1R6LA 2E5LI 1Z0EA 4DPWA 4KQVA 3WU6A 3GLLA 4NBQA 2JE6A 4FW5A 3DD6A 4B3RI 2O3ZA 2V2VA 2JT2A 5JEAF 3NZKA 4OO1D 2V2ZA 5DRQA 2F4VE 4MU1A 5K36B 1USVA 1MU5A 1KKHA 4B3TI 4LFBI 1PVGA 4HYMA 2BM0A 4AIMA 4I3HA 1H7UA 1XNQI 4AM3A 3L7ZA 2JEBA 3ZM7A 3T1YI 3J81C 1IBLE 4DV0E 4DUZE 4IFDE 1FNMA 4DR2I 3U1KA 2GO3A 1N33E 1RREA 4OZEA 1Z0VA 2IERA 4DV0I 1PIEA 2V8PA 2C38B 4DUYI 1XMOE 1ZM9A 1Z0CA 4IZJA 4JI6E 2UXCE 3B82A 5EKWA 3GCMA 2V2QA 3D4JA 1Z0TA 1HNXE 5LMNI 4PU9A 4DUYE 4LFAI 4DR7I 2O1TA 2C38A 4JI6I 1HNXI 2IESA 4OO1B 1NHHA 2UXDE 5K36A 5JEAE 4HXZA 1N34I 1XXEA 2C39A 1OJ4A 2NN6D 1OYRA 2UXDI 1XHKA 3U1YA 3PYFA 5C0XC 4DV1I 5DNLA 2VQFE 3CWVA 4FWGA 1ZXMA 3P06A 4LPFA 5FLXQ 2BM1A 1N32I 4X66I 2PO0A 3J81Q 4DR4I 2O1UA 2BA1G 2ZITA 4JI4E 4DV1E 2NN6C 4DV4E 4LF4I 2HFSA 2J7KA 4X66E 2JE6B 4JI5E 3P3EA 2PNZB 4JI4I 4QNKA 4DV4I 4WUBA 2CZ9A 2PO2A 4GKKE 5JEAB 3WU4A 1QZRA 1YHCA 2WP8B 4X65E 1Y5YA 2NN6A 4JI3E 4JI5I 2C39B 1FWKA 3K85A 1WUUA 2UUCI 1U2RA 1N0VC 4LCGA 4LOMA 2DEIA 1VISA 3P3GA 4USKA 4JI3I 4FW7A 4DU7A 2CGEA 3J80Q 1ZM2A 3PRYA 1Z5AA 4IZJD 4DR6I 1EA6A 2HFUA 1HNWE 4IZKA 4Z7YA 1USUA 1XMQI 4U3BA 3ZZ0A 1ELOA 1Z0GA 5EL9A 4DV6E 1K47A 3Q1QA 1H74A 1MG7A 4K0KE 3PS3A 1XMQE 4U3DA 2VQEE 4JV5E 3V2UC 3GONA 1FKAE 3UHMA 3P76A 3PYEA 4DV6I 4MQYA 1FJGI 4DU8A 2VQEI 4JV5I 2JEAB 4RPFA 4DR1E 1NHJA 5FLXC 1N36E 2BR2A 2JEBB 2HHHE 5ELWA 3V5RA 1UDSA 4YHHE 4USMA 1H73A 1KVKA 1N36I 3B78A 3QT7A 1Z59A 4MDTA 4NXNE 4OO1E 2UUAI 1UDOA 4X62E 4FWDA 4LF7I 4YHHI 4BA1A 5K36C 4FWHA 4EMDA 1HNZI 4WUCA 3QT6A 5A2QQ 4MU0A 4JI7I 1VI7A 4IS9A 4X62I 1N0UA 3QT8A 4OKGA 1Z5BA 5IT9Q 5DROA 4HY1A 2Z5CB 4OX9E 4LF9I 4JI7E 3PYGA 2UXBE 2BA0D 1Z0WA 4Z7CA 5IWAE 2X36A 3B4TA 3T1HE 4B3ME 4DV3I 4GQUA 5FWKA 2ZM6I 5GMDA 3M7NG 1RR9A 4DV2E 4AQYE 1E3HA 2ZBKB 4JYAE 2WNRA 4JI2I 4IZKB 1NHIA 3HULA 3WU3A 4DR3E 5LL6R 2Q2EB 4IFDD 4DV2I 2IOPA 4ED4A 5IT9C 2AE8A 4QNJA 3H1CA 4JYAI 3M85D 4PRXA 3K1JA 3LPSA 4B3RE 1UEKA 4DV5E 4XTJA 3ZZUA 4LF5E 2EFGA 4OO1F 1MX0A 1J5EI 5L3JA 4HACB 4LCFA 4DV5I 1H72C 2R3VA 3CDJA 4JI8I 4LFBE 2E5LE 3LTOA 4JG4A 2PO1B 2GS8A 1PKPA 4BA2A 1BKNA 1UDQA 2VF3A 3ZKBA 3T1YE 2VESA 1IBLI 3QT5A 4JI8E 4ZVIA 1N33I 2HKJA 2NN6F 2F4VI 5C0XB 2UU9I 4YY3E 4B3TE 4FN5A 1A6FA 5BR8I 5LMUI 4DPUA 4WUDA 1S4EA 4N3OA 3JAMC 1XNQE 2UXCI 2UU9E 4IFDC 2Z5CA 3CDIA 4YY3I 4DUZI 4DR2E 5BR8E 4GKJI 5LMUE 4DR7E 2VQFI 3H4LA 2J65A 4DXLA 3Q6MA 1Y4SA 1KIJA 1IBME 2IOQA 5A2QC 4GKJE 1XMOI 4MU3A 1S16A 3LNUA 1B62A 2AJ4A 5JEAD 2HK2A 5C0XE 3B8HA 1IBMI 2XEXA 5LMNE 3GMEA 4P52A 4DR5E 4LFAE 2BR2B 4HACA 1D6TA 3PS1A 1N32E 5C0XA 4DR5I 2WW4A 4FW9A 4FW3A 3OTOE 3JAMQ 1N34E 4LF4E 4R1FA 3ZKDA 2PNMA 2V34A 2NN6E 2X7IA 3PYDA 3ZZTA 2PO1A 4KHPI 3OTOI 2CG9A 1ZM3A 5JEAA
chains in the Genus database with same CATH topology
1FWLA 4LF6I 1XNRE 4X65I 4DR4E 4KHPE 1Z5CA 4LF6E 1XNRI 1H7SA 2A2DA 3K17A 3M6AA 2HK3A 3HJCA 1EI1A 5GMEA 4GKKI 4P7AA 2E1RA 4MYTA 4NXME 2UUCE 4M1KA 4JI0I 4K0KI 1IBKE 3Q6NA 1ZXNA 1ZM4A 4NXMI 1I94I 4DR6E 4X64E 1HNWI 4JI0E 1IBKI 2A2CA 1HR0E 4PRVA 1I94E 1HK7A 4DPXA 4X64I 4JI1E 2HHHI 2O1WA 1HR0I 4MYUA 4NXNI 4JI1I 1FJGE 2BV3A 4LF7E 4DPYA 4DV7E 2PNLA 2Z5BA 4B3SE 4DR1I 4UTGA 3F0NA 4LF8E 2O1VA 2Z5BB 3J7AG 4DV7I 4UT4A 4B3SI 4IZJB 4OX9I 4LF9E 3WU5A 2UUAE 4LF8I 2DEJA 5IWAI 2NPFA 1HNZE 2OI2A 1Z0BA 1Y4UA 1ZM3A 4DR3I 2Z5EA 2UUBI 2UXBI 1Y6ZA 3J7AM 4URLA 4LFCI 3T1HI 1B63A 4B3MI 4DV3E 2ZM6E 2UUBE 1DARA 4AQYI 4LF5I 1FI4A 2GQ0A 4LFCE 2HKEA 2LJPA 4DPTA 1J5EE 3J80C 4JI2E 1NZ0A 2R42A 1KTVA 2E5LI 1Z0EA 4DPWA 4KQVA 3WU6A 4B3RI 2V2VA 2V2ZA 2F4VE 1USVA 1MU5A 1KKHA 4B3TI 4LFBI 1PVGA 4HYMA 2BM0A 4I3HA 1H7UA 1XNQI 3ZM7A 3T1YI 3J81C 1IBLE 4DV0E 4DUZE 1FNMA 4DR2I 1N33E 1RREA 1Z0VA 4DV0I 1PIEA 2V8PA 4DUYI 1XMOE 1ZM9A 1Z0CA 4IZJA 4JI6E 2UXCE 3B82A 2V2QA 3D4JA 1Z0TA 1HNXE 5LMNI 4PU9A 4DUYE 4LFAI 4DR7I 2O1TA 4JI6I 1HNXI 1NHHA 2UXDE 4HXZA 1N34I 1OJ4A 2UXDI 1XHKA 3PYFA 4DV1I 2VQFE 3CWVA 4FWGA 1ZXMA 3P06A 5FLXQ 1N32I 2BM1A 4X66I 3J81Q 4DR4I 2O1UA 2ZITA 4JI4E 4DV1E 4DV4E 4LF4I 2HFSA 2J7KA 4X66E 4JI5E 4JI4I 4DV4I 4WUBA 2CZ9A 4GKKE 3WU4A 1QZRA 4X65E 4JI3E 4JI5I 1FWKA 3K85A 1WUUA 2UUCI 1U2RA 1N0VC 2DEIA 1VISA 4USKA 4JI3I 4DU7A 3J80Q 2CGEA 1ZM2A 3PRYA 1Z5AA 4IZJD 4DR6I 1EA6A 2HFUA 1HNWE 4IZKA 4Z7YA 1USUA 1XMQI 3ZZ0A 1ELOA 1Z0GA 4DV6E 1K47A 3Q1QA 1H74A 1MG7A 4K0KE 1XMQE 2VQEE 4JV5E 3V2UC 3GONA 1FKAE 3PYEA 4DV6I 1FJGI 4DU8A 2VQEI 4JV5I 1N36E 4RPFA 1NHJA 5FLXC 4DR1E 2HHHE 3V5RA 4YHHE 4USMA 1H73A 1KVKA 1N36I 3B78A 3QT7A 1Z59A 4NXNE 2UUAI 4X62E 4FWDA 4LF7I 4YHHI 4FWHA 4EMDA 1HNZI 4WUCA 3QT6A 5A2QQ 4JI7I 4X62I 1N0UA 3QT8A 1Z5BA 5IT9Q 4HY1A 2Z5CB 4OX9E 4LF9I 4JI7E 3PYGA 2UXBE 1Z0WA 4Z7CA 5IWAE 2X36A 3T1HE 4B3ME 4DV3I 5FWKA 2ZM6I 5GMDA 1RR9A 4DV2E 4AQYE 2ZBKB 4JYAE 4JI2I 4IZKB 1NHIA 3HULA 3WU3A 4DR3E 5LL6R 2Q2EB 4DV2I 2IOPA 4ED4A 5IT9C 4JYAI 3K1JA 4PRXA 3LPSA 4B3RE 1UEKA 4DV5E 4XTJA 3ZZUA 4LF5E 2EFGA 1MX0A 1J5EI 5L3JA 4HACB 4DV5I 1H72C 2R3VA 4LFBE 4JI8I 2E5LE 3LTOA 4JG4A 2GS8A 1PKPA 1BKNA 2VF3A 3ZKBA 3T1YE 1IBLI 3QT5A 4JI8E 4ZVIA 1N33I 2HKJA 2F4VI 2UU9I 4YY3E 4B3TE 4FN5A 1A6FA 5BR8I 5LMUI 4DPUA 4WUDA 1S4EA 4N3OA 3JAMC 1XNQE 2UXCI 2UU9E 2Z5CA 4YY3I 4DUZI 4DR2E 5BR8E 4GKJI 5LMUE 4DR7E 3H4LA 4DXLA 3Q6MA 1Y4SA 1KIJA 1IBME 2IOQA 5A2QC 4GKJE 1XMOI 1S16A 3LNUA 1B62A 2AJ4A 2HK2A 3B8HA 1IBMI 2XEXA 5LMNE 4P52A 4DR5E 4LFAE 4HACA 1D6TA 1N32E 4DR5I 2WW4A 4FW9A 3OTOE 3JAMQ 1N34E 4LF4E 4R1FA 3ZKDA 2PNMA 2V34A 2X7IA 3PYDA 3ZZTA 4KHPI 3OTOI 2CG9A 2VQFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNM A;  2PNL A;  4IZJ B;  4IZJ D;  3P06 A;  4IZK B;  4IZJ A;  4IZK A; 
#chains in the Genus database with same CATH topology
 1FWL A;  4LF6 I;  1XNR E;  2PNZ A;  4X65 I;  4DR4 E;  4KHP E;  2WNR B;  1Z5C A;  4AID A;  5K36 D;  4LF6 E;  2BA1 D;  1XNR I;  1H7S A;  5JEA C;  2A2D A;  3K17 A;  5C0X D;  3M6A A;  2HK3 A;  3HJC A;  1EI1 A;  5GME A;  4GKK I;  4IFD A;  4P7A A;  2E1R A;  4LCH A;  5C0X F;  4MYT A;  3KRN A;  4NXM E;  2UUC E;  4M1K A;  4JI0 I;  4K0K I;  1IBK E;  3Q6N A;  1ZXN A;  1ZM4 A;  4BA1 B;  4NXM I;  3P3C A;  1I94 I;  4DR6 E;  4X64 E;  1HNW I;  4JI0 E;  1IBK I;  2F1D A;  4IFD F;  1P42 A;  2A2C A;  1HR0 E;  2C37 A;  4PRV A;  1UDN A;  1I94 E;  5K36 F;  1HK7 A;  4DPX A;  4X64 I;  4JI1 E;  4MU4 A;  2HHH I;  2O1W A;  5DNX A;  1HR0 I;  2JEA A;  4MYU A;  4NXN I;  2CVE A;  1OYS A;  4OO1 A;  4JI1 I;  1FJG E;  2BV3 A;  4LF7 E;  4DPY A;  2Z5B A;  2PNL A;  4J3D A;  4DV7 E;  4B3S E;  4DR1 I;  4UTG A;  3F0N A;  5DRR A;  4LF8 E;  4FW6 A;  4BA2 B;  4ISA A;  2O1V A;  2Z5B B;  3J7A G;  4DV7 I;  4UT4 A;  4B3S I;  5DRP A;  4IZJ B;  4OX9 I;  1E3P A;  4FW4 A;  3PS2 A;  4LF9 E;  3WU5 A;  4OO1 C;  2UUA E;  3M85 G;  4LF8 I;  2DEJ A;  5IWA I;  2NPF A;  1HNZ E;  1RHY A;  2GO4 A;  2OI2 A;  1Z0B A;  1Y60 A;  1Y4U A;  2NN6 B;  3HKM A;  2C37 B;  2PO2 B;  3M7N D;  3L7Z B;  4DR3 I;  2Z5E A;  2UUB I;  2UXB I;  1Y6Z A;  3J7A M;  2BA0 G;  5K36 E;  4URL A;  4LFC I;  3T1H I;  1B63 A;  4B3M I;  4DV3 E;  2ZM6 E;  2UUB E;  2PO0 B;  1DAR A;  4AQY I;  1R6M A;  4LF5 I;  1FI4 A;  2GQ0 A;  4LFC E;  2HKE A;  2LJP A;  1YH8 A;  1OYP A;  4DPT A;  3J80 C;  1J5E E;  2WP8 A;  1NZ0 A;  4JI2 E;  4IFD B;  2R42 A;  1KTV A;  1R6L A;  2E5L I;  1Z0E A;  4DPW A;  4KQV A;  3WU6 A;  3GLL A;  4NBQ A;  2JE6 A;  4FW5 A;  3DD6 A;  4B3R I;  2O3Z A;  2V2V A;  2JT2 A;  5JEA F;  3NZK A;  4OO1 D;  2V2Z A;  5DRQ A;  2F4V E;  4MU1 A;  5K36 B;  1USV A;  1MU5 A;  1KKH A;  4B3T I;  4LFB I;  1PVG A;  4HYM A;  2BM0 A;  4AIM A;  4I3H A;  1H7U A;  1XNQ I;  4AM3 A;  3L7Z A;  2JEB A;  3ZM7 A;  3T1Y I;  3J81 C;  1IBL E;  4DV0 E;  4DUZ E;  4IFD E;  1FNM A;  4DR2 I;  3U1K A;  2GO3 A;  1N33 E;  1RRE A;  4OZE A;  1Z0V A;  2IER A;  4DV0 I;  1PIE A;  2V8P A;  2C38 B;  4DUY I;  1XMO E;  1ZM9 A;  1Z0C A;  4IZJ A;  4JI6 E;  2UXC E;  3B82 A;  5EKW A;  3GCM A;  2V2Q A;  3D4J A;  1Z0T A;  1HNX E;  5LMN I;  4PU9 A;  4DUY E;  4LFA I;  4DR7 I;  2O1T A;  2C38 A;  4JI6 I;  1HNX I;  2IES A;  4OO1 B;  1NHH A;  2UXD E;  5K36 A;  5JEA E;  4HXZ A;  1N34 I;  1XXE A;  2C39 A;  1OJ4 A;  2NN6 D;  1OYR A;  2UXD I;  1XHK A;  3U1Y A;  3PYF A;  5C0X C;  4DV1 I;  5DNL A;  2VQF E;  3CWV A;  4FWG A;  1ZXM A;  3P06 A;  4LPF A;  5FLX Q;  2BM1 A;  1N32 I;  4X66 I;  2PO0 A;  3J81 Q;  4DR4 I;  2O1U A;  2BA1 G;  2ZIT A;  4JI4 E;  4DV1 E;  2NN6 C;  4DV4 E;  4LF4 I;  2HFS A;  2J7K A;  4X66 E;  2JE6 B;  4JI5 E;  3P3E A;  2PNZ B;  4JI4 I;  4QNK A;  4DV4 I;  4WUB A;  2CZ9 A;  2PO2 A;  4GKK E;  5JEA B;  3WU4 A;  1QZR A;  1YHC A;  2WP8 B;  4X65 E;  1Y5Y A;  2NN6 A;  4JI3 E;  4JI5 I;  2C39 B;  1FWK A;  3K85 A;  1WUU A;  2UUC I;  1U2R A;  1N0V C;  4LCG A;  4LOM A;  2DEI A;  1VIS A;  3P3G A;  4USK A;  4JI3 I;  4FW7 A;  4DU7 A;  2CGE A;  3J80 Q;  1ZM2 A;  3PRY A;  1Z5A A;  4IZJ D;  4DR6 I;  1EA6 A;  2HFU A;  1HNW E;  4IZK A;  4Z7Y A;  1USU A;  1XMQ I;  4U3B A;  3ZZ0 A;  1ELO A;  1Z0G A;  5EL9 A;  4DV6 E;  1K47 A;  3Q1Q A;  1H74 A;  1MG7 A;  4K0K E;  3PS3 A;  1XMQ E;  4U3D A;  2VQE E;  4JV5 E;  3V2U C;  3GON A;  1FKA E;  3UHM A;  3P76 A;  3PYE A;  4DV6 I;  4MQY A;  1FJG I;  4DU8 A;  2VQE I;  4JV5 I;  2JEA B;  4RPF A;  4DR1 E;  1NHJ A;  5FLX C;  1N36 E;  2BR2 A;  2JEB B;  2HHH E;  5ELW A;  3V5R A;  1UDS A;  4YHH E;  4USM A;  1H73 A;  1KVK A;  1N36 I;  3B78 A;  3QT7 A;  1Z59 A;  4MDT A;  4NXN E;  4OO1 E;  2UUA I;  1UDO A;  4X62 E;  4FWD A;  4LF7 I;  4YHH I;  4BA1 A;  5K36 C;  4FWH A;  4EMD A;  1HNZ I;  4WUC A;  3QT6 A;  5A2Q Q;  4MU0 A;  4JI7 I;  1VI7 A;  4IS9 A;  4X62 I;  1N0U A;  3QT8 A;  4OKG A;  1Z5B A;  5IT9 Q;  5DRO A;  4HY1 A;  2Z5C B;  4OX9 E;  4LF9 I;  4JI7 E;  3PYG A;  2UXB E;  2BA0 D;  1Z0W A;  4Z7C A;  5IWA E;  2X36 A;  3B4T A;  3T1H E;  4B3M E;  4DV3 I;  4GQU A;  5FWK A;  2ZM6 I;  5GMD A;  3M7N G;  1RR9 A;  4DV2 E;  4AQY E;  1E3H A;  2ZBK B;  4JYA E;  2WNR A;  4JI2 I;  4IZK B;  1NHI A;  3HUL A;  3WU3 A;  4DR3 E;  5LL6 R;  2Q2E B;  4IFD D;  4DV2 I;  2IOP A;  4ED4 A;  5IT9 C;  2AE8 A;  4QNJ A;  3H1C A;  4JYA I;  3M85 D;  4PRX A;  3K1J A;  3LPS A;  4B3R E;  1UEK A;  4DV5 E;  4XTJ A;  3ZZU A;  4LF5 E;  2EFG A;  4OO1 F;  1MX0 A;  1J5E I;  5L3J A;  4HAC B;  4LCF A;  4DV5 I;  1H72 C;  2R3V A;  3CDJ A;  4JI8 I;  4LFB E;  2E5L E;  3LTO A;  4JG4 A;  2PO1 B;  2GS8 A;  1PKP A;  4BA2 A;  1BKN A;  1UDQ A;  2VF3 A;  3ZKB A;  3T1Y E;  2VES A;  1IBL I;  3QT5 A;  4JI8 E;  4ZVI A;  1N33 I;  2HKJ A;  2NN6 F;  2F4V I;  5C0X B;  2UU9 I;  4YY3 E;  4B3T E;  4FN5 A;  1A6F A;  5BR8 I;  5LMU I;  4DPU A;  4WUD A;  1S4E A;  4N3O A;  3JAM C;  1XNQ E;  2UXC I;  2UU9 E;  4IFD C;  2Z5C A;  3CDI A;  4YY3 I;  4DUZ I;  4DR2 E;  5BR8 E;  4GKJ I;  5LMU E;  4DR7 E;  2VQF I;  3H4L A;  2J65 A;  4DXL A;  3Q6M A;  1Y4S A;  1KIJ A;  1IBM E;  2IOQ A;  5A2Q C;  4GKJ E;  1XMO I;  4MU3 A;  1S16 A;  3LNU A;  1B62 A;  2AJ4 A;  5JEA D;  2HK2 A;  5C0X E;  3B8H A;  1IBM I;  2XEX A;  5LMN E;  3GME A;  4P52 A;  4DR5 E;  4LFA E;  2BR2 B;  4HAC A;  1D6T A;  3PS1 A;  1N32 E;  5C0X A;  4DR5 I;  2WW4 A;  4FW9 A;  4FW3 A;  3OTO E;  3JAM Q;  1N34 E;  4LF4 E;  4R1F A;  3ZKD A;  2PNM A;  2V34 A;  2NN6 E;  2X7I A;  3PYD A;  3ZZT A;  2PO1 A;  4KHP I;  3OTO I;  2CG9 A;  1ZM3 A;  5JEA A; 
#chains in the Genus database with same CATH homology
 1FWL A;  4LF6 I;  1XNR E;  4X65 I;  4DR4 E;  4KHP E;  1Z5C A;  4LF6 E;  1XNR I;  1H7S A;  2A2D A;  3K17 A;  3M6A A;  2HK3 A;  3HJC A;  1EI1 A;  5GME A;  4GKK I;  4P7A A;  2E1R A;  4MYT A;  4NXM E;  2UUC E;  4M1K A;  4JI0 I;  4K0K I;  1IBK E;  3Q6N A;  1ZXN A;  1ZM4 A;  4NXM I;  1I94 I;  4DR6 E;  4X64 E;  1HNW I;  4JI0 E;  1IBK I;  2A2C A;  1HR0 E;  4PRV A;  1I94 E;  1HK7 A;  4DPX A;  4X64 I;  4JI1 E;  2HHH I;  2O1W A;  1HR0 I;  4MYU A;  4NXN I;  4JI1 I;  1FJG E;  2BV3 A;  4LF7 E;  4DPY A;  4DV7 E;  2PNL A;  2Z5B A;  4B3S E;  4DR1 I;  4UTG A;  3F0N A;  4LF8 E;  2O1V A;  2Z5B B;  3J7A G;  4DV7 I;  4UT4 A;  4B3S I;  4IZJ B;  4OX9 I;  4LF9 E;  3WU5 A;  2UUA E;  4LF8 I;  2DEJ A;  5IWA I;  2NPF A;  1HNZ E;  2OI2 A;  1Z0B A;  1Y4U A;  1ZM3 A;  4DR3 I;  2Z5E A;  2UUB I;  2UXB I;  1Y6Z A;  3J7A M;  4URL A;  4LFC I;  3T1H I;  1B63 A;  4B3M I;  4DV3 E;  2ZM6 E;  2UUB E;  1DAR A;  4AQY I;  4LF5 I;  1FI4 A;  2GQ0 A;  4LFC E;  2HKE A;  2LJP A;  4DPT A;  1J5E E;  3J80 C;  4JI2 E;  1NZ0 A;  2R42 A;  1KTV A;  2E5L I;  1Z0E A;  4DPW A;  4KQV A;  3WU6 A;  4B3R I;  2V2V A;  2V2Z A;  2F4V E;  1USV A;  1MU5 A;  1KKH A;  4B3T I;  4LFB I;  1PVG A;  4HYM A;  2BM0 A;  4I3H A;  1H7U A;  1XNQ I;  3ZM7 A;  3T1Y I;  3J81 C;  1IBL E;  4DV0 E;  4DUZ E;  1FNM A;  4DR2 I;  1N33 E;  1RRE A;  1Z0V A;  4DV0 I;  1PIE A;  2V8P A;  4DUY I;  1XMO E;  1ZM9 A;  1Z0C A;  4IZJ A;  4JI6 E;  2UXC E;  3B82 A;  2V2Q A;  3D4J A;  1Z0T A;  1HNX E;  5LMN I;  4PU9 A;  4DUY E;  4LFA I;  4DR7 I;  2O1T A;  4JI6 I;  1HNX I;  1NHH A;  2UXD E;  4HXZ A;  1N34 I;  1OJ4 A;  2UXD I;  1XHK A;  3PYF A;  4DV1 I;  2VQF E;  3CWV A;  4FWG A;  1ZXM A;  3P06 A;  5FLX Q;  1N32 I;  2BM1 A;  4X66 I;  3J81 Q;  4DR4 I;  2O1U A;  2ZIT A;  4JI4 E;  4DV1 E;  4DV4 E;  4LF4 I;  2HFS A;  2J7K A;  4X66 E;  4JI5 E;  4JI4 I;  4DV4 I;  4WUB A;  2CZ9 A;  4GKK E;  3WU4 A;  1QZR A;  4X65 E;  4JI3 E;  4JI5 I;  1FWK A;  3K85 A;  1WUU A;  2UUC I;  1U2R A;  1N0V C;  2DEI A;  1VIS A;  4USK A;  4JI3 I;  4DU7 A;  3J80 Q;  2CGE A;  1ZM2 A;  3PRY A;  1Z5A A;  4IZJ D;  4DR6 I;  1EA6 A;  2HFU A;  1HNW E;  4IZK A;  4Z7Y A;  1USU A;  1XMQ I;  3ZZ0 A;  1ELO A;  1Z0G A;  4DV6 E;  1K47 A;  3Q1Q A;  1H74 A;  1MG7 A;  4K0K E;  1XMQ E;  2VQE E;  4JV5 E;  3V2U C;  3GON A;  1FKA E;  3PYE A;  4DV6 I;  1FJG I;  4DU8 A;  2VQE I;  4JV5 I;  1N36 E;  4RPF A;  1NHJ A;  5FLX C;  4DR1 E;  2HHH E;  3V5R A;  4YHH E;  4USM A;  1H73 A;  1KVK A;  1N36 I;  3B78 A;  3QT7 A;  1Z59 A;  4NXN E;  2UUA I;  4X62 E;  4FWD A;  4LF7 I;  4YHH I;  4FWH A;  4EMD A;  1HNZ I;  4WUC A;  3QT6 A;  5A2Q Q;  4JI7 I;  4X62 I;  1N0U A;  3QT8 A;  1Z5B A;  5IT9 Q;  4HY1 A;  2Z5C B;  4OX9 E;  4LF9 I;  4JI7 E;  3PYG A;  2UXB E;  1Z0W A;  4Z7C A;  5IWA E;  2X36 A;  3T1H E;  4B3M E;  4DV3 I;  5FWK A;  2ZM6 I;  5GMD A;  1RR9 A;  4DV2 E;  4AQY E;  2ZBK B;  4JYA E;  4JI2 I;  4IZK B;  1NHI A;  3HUL A;  3WU3 A;  4DR3 E;  5LL6 R;  2Q2E B;  4DV2 I;  2IOP A;  4ED4 A;  5IT9 C;  4JYA I;  3K1J A;  4PRX A;  3LPS A;  4B3R E;  1UEK A;  4DV5 E;  4XTJ A;  3ZZU A;  4LF5 E;  2EFG A;  1MX0 A;  1J5E I;  5L3J A;  4HAC B;  4DV5 I;  1H72 C;  2R3V A;  4LFB E;  4JI8 I;  2E5L E;  3LTO A;  4JG4 A;  2GS8 A;  1PKP A;  1BKN A;  2VF3 A;  3ZKB A;  3T1Y E;  1IBL I;  3QT5 A;  4JI8 E;  4ZVI A;  1N33 I;  2HKJ A;  2F4V I;  2UU9 I;  4YY3 E;  4B3T E;  4FN5 A;  1A6F A;  5BR8 I;  5LMU I;  4DPU A;  4WUD A;  1S4E A;  4N3O A;  3JAM C;  1XNQ E;  2UXC I;  2UU9 E;  2Z5C A;  4YY3 I;  4DUZ I;  4DR2 E;  5BR8 E;  4GKJ I;  5LMU E;  4DR7 E;  3H4L A;  4DXL A;  3Q6M A;  1Y4S A;  1KIJ A;  1IBM E;  2IOQ A;  5A2Q C;  4GKJ E;  1XMO I;  1S16 A;  3LNU A;  1B62 A;  2AJ4 A;  2HK2 A;  3B8H A;  1IBM I;  2XEX A;  5LMN E;  4P52 A;  4DR5 E;  4LFA E;  4HAC A;  1D6T A;  1N32 E;  4DR5 I;  2WW4 A;  4FW9 A;  3OTO E;  3JAM Q;  1N34 E;  4LF4 E;  4R1F A;  3ZKD A;  2PNM A;  2V34 A;  2X7I A;  3PYD A;  3ZZT A;  4KHP I;  3OTO I;  2CG9 A;  2VQF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...