3P06A

Crystal structure of tellina virus 1 vp4 protease in the form of an intra-molecular(cis)acyl-enzyme complex.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
194
Chain Sequence
NGVELSAVGVLLPVLMDSGRRISGGAFMAVKGDLSEHIKNPKNTRIAQTVAGGTIYGLSEMVNIDEAEKLPIKGAITVLPVVQATATSILVPDNQPQLAFNSWEAAACAADTLESQQTPFLMVTGAVESGNLSPNLLAVQKQLLVAKPAGIGLAANSDRALKVVTLEQLRQVVGDKPWRKPMVTFSSGKNVAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords VP4 protein
publication title Crystal Structure of a Viral Protease Intramolecular Acyl-enzyme Complex: INSIGHTS INTO cis-CLEAVAGE AT THE VP4/VP3 JUNCTION OF TELLINA BIRNAVIRUS.
pubmed doi rcsb
source organism Tellina virus 1
total genus 48
structure length 194
sequence length 194
ec nomenclature ec 3.4.21.115: Infectious pancreatic necrosis birnavirus Vp4 peptidase.
pdb deposition date 2010-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3p06A00
4IZJA 4IZKA 4IZJD 3P06A 2PNMA 2PNLA 4IZJB 4IZKB
chains in the Genus database with same CATH superfamily
3K85A 4JI6E 5C0XF 2BA0G 5DROA 3D4JA 4OO1C 4X66I 1E3PA 1H72C 4XTJA 3T1HE 5EL9A 2HFSA 1NZ0A 3M7ND 1S16A 5FLXC 2PNLA 3K17A 4WUDA 4JI2I 4GKKE 2VQEI 1UEKA 4DR5E 2JEBB 2VF3A 5K36E 4KQVA 1PIEA 3J80Q 2PO2B 3HULA 4DV1I 4AM3A 3QT8A 4P7AA 2BA1G 5K36D 1HR0E 4U3BA 4FWGA 1Z5CA 1XXEA 5C0XC 5LMUE 1FI4A 3GCMA 4IFDA 4DR4I 1H73A 2IOQA 2BA1D 2O1UA 5ELWA 3B82A 5FWKA 1I94E 3T1YE 2C39A 3J7AM 4KHPI 3V5RA 1S4EA 2A2CA 1N34I 1FWKA 2UXCE 4BA1B 1IBLE 4JI1I 4X64I 4OO1B 3PYDA 4JI0I 2JE6B 4B3SI 5JEAE 4LFBE 5A2QC 2Z5BB 4DV0I 4JI8I 3ZKBA 1DARA 1YHCA 4MU1A 4OX9I 1HNZE 4PRVA 5JEAD 4DV7I 4DR7E 2CVEA 4FWHA 1IBKE 4DUZE 3F0NA 4B3ME 2BV3A 2JEAA 4K0KI 1N33E 3CWVA 4DV6E 2VQFI 4JI7E 3WU3A 1N32E 4YY3I 4JG4A 4HACA 3QT6A 1B62A 2UXDE 2V34A 1Z0TA 4IFDC 1D6TA 2OI2A 1KVKA 2UUCI 2IOPA 2IERA 5DNXA 1XHKA 4LF5E 5IT9Q 1ZM9A 3JAMQ 4IZKB 2ZM6E 1XMOI 4BA2B 4DUYI 1WUUA 1R6MA 4HYMA 4HY1A 4IZJB 4JYAE 4DV4I 4JI4I 5DRRA 2UUAI 4JI2E 2VQEE 3J81C 4LFAI 1Z5AA 1YH8A 4LF9I 2F4VI 2UUBI 2WW4A 4Z7YA 3QT7A 2GS8A 1UDQA 4AQYE 2R42A 2Q2EB 4NXNI 1Y5YA 1H7UA 2AJ4A 1Z5BA 3K1JA 4RPFA 1IBME 5L3JA 1RREA 2Z5CA 3H1CA 4IFDB 2WNRA 4FW9A 4JI5E 2IESA 4DV2I 4LF8I 4OZEA 5GMDA 4YHHE 1N34E 2PO0A 1XMQI 4OO1E 4M1KA 1Y60A 2V2VA 4JI1E 1ZXMA 4X64E 2C39B 4JI0E 2E5LI 4B3SE 4OO1D 2ZBKB 1OYSA 2BA0D 4PRXA 1K47A 1OYPA 3P3CA 4X62I 3LTOA 4OX9E 3LNUA 3PYEA 2WP8A 3ZZ0A 1XNRE 2V2QA 1N0VC 4K0KE 5K36F 4FWDA 1HNXE 4YY3E 1Y4SA 5EKWA 4JV5E 2ZITA 4ISAA 1EA6A 2J7KA 4LF6E 2JEAB 5JEAA 2NN6B 3OTOI 4DU7A 4Z7CA 4UT4A 1USVA 4HACB 1Z0GA 4X65I 3GLLA 1XMOE 1ZM3A 4LF4I 5BR8I 3U1YA 1U2RA 2HKEA 4IZJD 4DV4E 4USMA 4P52A 1Z0VA 4J3DA 3ZZUA 5LMNI 1HNWE 3WU5A 5JEAF 1Z0EA 1MU5A 2JT2A 4DR3I 4MU4A 1Z0BA 4NXNE 2GO3A 2UU9E 3WU6A 4MYTA 2X36A 2HFUA 5DNLA 4NXME 4LCGA 1FJGI 4JI6I 4IFDE 3UHMA 4FW4A 2AE8A 1ZM4A 2UXBI 5C0XB 3ZKDA 1RHYA 2NPFA 4B3TE 3T1HI 1UDOA 4LF8E 4IFDD 1KIJA 4LF7E 2CG9A 5JEAC 1XMQE 3M85G 4DPYA 4DV3I 4OKGA 3L7ZB 2GQ0A 2A2DA 3PYFA 2Z5CB 3CDJA 3JAMC 2WNRB 4X66E 3P3EA 3M85D 4FW3A 1HK7A 3GONA 2R3VA 5DRQA 1QZRA 1ZM2A 2PO0B 3P76A 4MYUA 2PNMA 1HR0I 4X62E 5GMEA 4DV5I 1PVGA 2HHHI 4URLA 4GQUA 4LPFA 1R6LA 4U3DA 4PU9A 3J7AG 4MU0A 1MX0A 2XEXA 2C37A 4ZVIA 3H4LA 4DV1E 2BR2A 2JE6A 3B78A 1NHJA 2WP8B 4DR1I 2NN6E 2Z5EA 4LCHA 3KRNA 1XNQI 2O1WA 4DR4E 1ELOA 3PS2A 2O3ZA 4WUCA 1IBLI 2NN6D 1N0UA 3J81Q 1OJ4A 1H7SA 4X65E 2PO1A 5IWAI 4KHPE 4LF4E 3GMEA 4DR2I 5BR8E 5K36A 5JEAB 4IS9A 4ED4A 1HNZI 3HKMA 4DR7I 4OO1F 2O1TA 1IBKI 2HK3A 4DUZI 4B3MI 4LFCI 1N33I 1KTVA 5LMNE 1USUA 4JI7I 4DV0E 1N32I 3NZKA 4FW5A 4BA2A 4JI8E 1EI1A 4FW6A 4MU3A 2UXDI 2F1DA 2C38A 4DV7E 3P3GA 2BM0A 5DRPA 4HXZA 4B3RI 4LF5I 5C0XE 2VQFE 3Q6MA 3J80C 1H74A 2ZM6I 1P42A 4DXLA 3M7NG 4NBQA 3Q1QA 2PNZA 5LL6R 2UXBE 4AIMA 5C0XD 4JYAI 3DD6A 5FLXQ 2UUCE 3M6AA 4DV3E 3B8HA 4DPTA 2X7IA 2EFGA 4JI3I 2CZ9A 1BKNA 4LCFA 3ZM7A 4DUYE 1N36I 4FN5A 2CGEA 5K36C 4AQYI 4MDTA 4JI4E 2LJPA 4DV5E 2UUAE 2HHHE 2DEIA 1NHIA 4DPWA 4DR6I 1IBMI 4LFAE 4LF9E 2F4VE 3V2UC 2DEJA 4R1FA 2UUBE 1ZXNA 4GKJI 1VI7A 1A6FA 3CDIA 1PKPA 4JI5I 4DR1E 1UDSA 4YHHI 1XNQE 1J5EI 2C37B 2BR2B 4WUBA 4IFDF 3WU4A 1NHHA 2JEBA 3B4TA 5A2QQ 4QNKA 5IWAE 1Z59A 4DR2E 4DV2E 2PO2A 3HJCA 4DPUA 1FKAE 4USKA 1B63A 2E1RA 4DU8A 4GKKI 4DR5I 5IT9C 1XNRI 2HK2A 3ZZTA 2PO1B 2J65A 2O1VA 4LFCE 1KKHA 2NN6A 2E5LE 3PRYA 1HNXI 4UTGA 5K36B 1OYRA 3PYGA 4FW7A 4JV5I 5LMUI 4I3HA 4LF6I 1E3HA 4MQYA 1MG7A 4B3RE 1FNMA 4BA1A 4OO1A 3T1YI 1I94I 3LPSA 1Z0CA 2C38B 2BM1A 4EMDA 2GO4A 2Z5BA 1UDNA 2NN6F 4QNJA 2VESA 2V2ZA 2UXCI 3OTOE 2PNZB 4JI3E 1RR9A 3PS3A 3P06A 1N36E 4LFBI 3U1KA 1HNWI 2HKJA 4AIDA 2V8PA 4DPXA 5C0XA 3Q6NA 1Y4UA 3QT5A 2UU9I 1VISA 4DR6E 4DV6I 2NN6C 4NXMI 4LOMA 1Y6ZA 3L7ZA 4IZKA 4GKJE 4DR3E 1Z0WA 4B3TI 1FWLA 4IZJA 4LF7I 3PS1A 1FJGE 1J5EE 4N3OA
chains in the Genus database with same CATH topology
3K85A 4JI6E 3D4JA 4X66I 1H72C 4XTJA 3T1HE 2HFSA 1NZ0A 1S16A 5FLXC 2PNLA 3K17A 4WUDA 4JI2I 4GKKE 2VQEI 1UEKA 4DR5E 2VF3A 4KQVA 1PIEA 3J80Q 3HULA 4DV1I 3QT8A 4P7AA 1HR0E 4FWGA 1Z5CA 5LMUE 1FI4A 4DR4I 1H73A 2IOQA 2O1UA 3B82A 5FWKA 1I94E 3T1YE 3J7AM 4KHPI 3V5RA 1S4EA 2A2CA 1N34I 1FWKA 2UXCE 1IBLE 4JI1I 4X64I 3PYDA 4JI0I 4B3SI 4LFBE 5A2QC 2Z5BB 4DV0I 4JI8I 3ZKBA 1DARA 4OX9I 1HNZE 4PRVA 4DV7I 4DR7E 4FWHA 1IBKE 4DUZE 3F0NA 4B3ME 2BV3A 4K0KI 1N33E 3CWVA 4DV6E 2VQFI 4JI7E 3WU3A 1N32E 4YY3I 4JG4A 4HACA 3QT6A 1B62A 2UXDE 2V34A 1Z0TA 1D6TA 2OI2A 1KVKA 2UUCI 2IOPA 1XHKA 4LF5E 5IT9Q 1ZM9A 3JAMQ 4IZKB 2ZM6E 1XMOI 4DUYI 1WUUA 4HYMA 4HY1A 4IZJB 4JYAE 4DV4I 4JI4I 2UUAI 4JI2E 2VQEE 3J81C 4LFAI 1Z5AA 4LF9I 2F4VI 2UUBI 2WW4A 4Z7YA 3QT7A 2GS8A 4AQYE 2R42A 2Q2EB 4NXNI 1H7UA 2AJ4A 1Z5BA 3K1JA 4RPFA 1IBME 5L3JA 1RREA 2Z5CA 4JI5E 4FW9A 4DV2I 4LF8I 5GMDA 4YHHE 1N34E 1XMQI 4M1KA 2V2VA 4JI1E 1ZXMA 4X64E 4JI0E 2E5LI 4B3SE 2ZBKB 4PRXA 1K47A 4X62I 3LTOA 4OX9E 3LNUA 3PYEA 3ZZ0A 1XNRE 2V2QA 1N0VC 4K0KE 4FWDA 1HNXE 4YY3E 1Y4SA 4JV5E 2ZITA 1EA6A 2J7KA 4LF6E 3OTOI 4DU7A 4Z7CA 4UT4A 1USVA 4HACB 1Z0GA 4X65I 1XMOE 1ZM3A 4LF4I 5BR8I 1U2RA 2HKEA 4IZJD 4DV4E 4USMA 4P52A 1Z0VA 3ZZUA 5LMNI 1HNWE 3WU5A 1Z0EA 1MU5A 4DR3I 1Z0BA 4NXNE 2UU9E 3WU6A 4MYTA 2X36A 2HFUA 4NXME 1FJGI 4JI6I 1ZM4A 2UXBI 3ZKDA 2NPFA 4B3TE 3T1HI 4LF8E 1KIJA 4LF7E 2CG9A 1XMQE 4DPYA 4DV3I 2GQ0A 2A2DA 3PYFA 2Z5CB 3JAMC 4X66E 1HK7A 3GONA 2R3VA 1QZRA 1ZM2A 4MYUA 2PNMA 1HR0I 4X62E 5GMEA 4DV5I 1PVGA 2HHHI 4URLA 4PU9A 3J7AG 1MX0A 2XEXA 4ZVIA 3H4LA 4DV1E 3B78A 1NHJA 4DR1I 2Z5EA 1XNQI 2O1WA 4DR4E 1ELOA 1IBLI 4WUCA 1N0UA 3J81Q 1OJ4A 1H7SA 4X65E 5IWAI 4KHPE 4LF4E 4DR2I 5BR8E 4ED4A 1HNZI 4DR7I 2O1TA 1IBKI 2HK3A 4DUZI 4B3MI 4LFCI 1N33I 1KTVA 5LMNE 1USUA 4JI7I 4DV0E 1N32I 4JI8E 1EI1A 2UXDI 4DV7E 2BM0A 4HXZA 4B3RI 4LF5I 2VQFE 3Q6MA 3J80C 1H74A 2ZM6I 4DXLA 3Q1QA 5LL6R 2UXBE 4JYAI 5FLXQ 2UUCE 3M6AA 4DV3E 3B8HA 4DPTA 2X7IA 2EFGA 4JI3I 2CZ9A 1BKNA 3ZM7A 4DUYE 1N36I 4FN5A 2CGEA 4AQYI 4JI4E 2LJPA 4DV5E 2UUAE 2HHHE 2DEIA 1NHIA 4DPWA 4DR6I 1IBMI 4LFAE 4LF9E 2F4VE 3V2UC 2DEJA 4R1FA 2UUBE 1ZXNA 4GKJI 1A6FA 1PKPA 4JI5I 4DR1E 4YHHI 1XNQE 1J5EI 4WUBA 3WU4A 1NHHA 5A2QQ 5IWAE 1Z59A 4DR2E 4DV2E 3HJCA 4DPUA 1FKAE 4USKA 1B63A 2E1RA 4DU8A 4GKKI 4DR5I 5IT9C 1XNRI 2HK2A 3ZZTA 2O1VA 4LFCE 1KKHA 2E5LE 3PRYA 1HNXI 4UTGA 3PYGA 4JV5I 5LMUI 4I3HA 4LF6I 1MG7A 4B3RE 1FNMA 1I94I 3T1YI 3LPSA 1Z0CA 2BM1A 4EMDA 2Z5BA 2V2ZA 2UXCI 3OTOE 4JI3E 1RR9A 3P06A 1N36E 4LFBI 1HNWI 2HKJA 2V8PA 4DPXA 3Q6NA 1Y4UA 3QT5A 2UU9I 1VISA 4DR6E 4DV6I 4NXMI 1Y6ZA 4IZKA 4GKJE 4DR3E 1Z0WA 4B3TI 1FWLA 4IZJA 4LF7I 1FJGE 1J5EE 4N3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZJ A;  4IZK A;  4IZJ D;  3P06 A;  2PNM A;  2PNL A;  4IZJ B;  4IZK B; 
#chains in the Genus database with same CATH topology
 3K85 A;  4JI6 E;  5C0X F;  2BA0 G;  5DRO A;  3D4J A;  4OO1 C;  4X66 I;  1E3P A;  1H72 C;  4XTJ A;  3T1H E;  5EL9 A;  2HFS A;  1NZ0 A;  3M7N D;  1S16 A;  5FLX C;  2PNL A;  3K17 A;  4WUD A;  4JI2 I;  4GKK E;  2VQE I;  1UEK A;  4DR5 E;  2JEB B;  2VF3 A;  5K36 E;  4KQV A;  1PIE A;  3J80 Q;  2PO2 B;  3HUL A;  4DV1 I;  4AM3 A;  3QT8 A;  4P7A A;  2BA1 G;  5K36 D;  1HR0 E;  4U3B A;  4FWG A;  1Z5C A;  1XXE A;  5C0X C;  5LMU E;  1FI4 A;  3GCM A;  4IFD A;  4DR4 I;  1H73 A;  2IOQ A;  2BA1 D;  2O1U A;  5ELW A;  3B82 A;  5FWK A;  1I94 E;  3T1Y E;  2C39 A;  3J7A M;  4KHP I;  3V5R A;  1S4E A;  2A2C A;  1N34 I;  1FWK A;  2UXC E;  4BA1 B;  1IBL E;  4JI1 I;  4X64 I;  4OO1 B;  3PYD A;  4JI0 I;  2JE6 B;  4B3S I;  5JEA E;  4LFB E;  5A2Q C;  2Z5B B;  4DV0 I;  4JI8 I;  3ZKB A;  1DAR A;  1YHC A;  4MU1 A;  4OX9 I;  1HNZ E;  4PRV A;  5JEA D;  4DV7 I;  4DR7 E;  2CVE A;  4FWH A;  1IBK E;  4DUZ E;  3F0N A;  4B3M E;  2BV3 A;  2JEA A;  4K0K I;  1N33 E;  3CWV A;  4DV6 E;  2VQF I;  4JI7 E;  3WU3 A;  1N32 E;  4YY3 I;  4JG4 A;  4HAC A;  3QT6 A;  1B62 A;  2UXD E;  2V34 A;  1Z0T A;  4IFD C;  1D6T A;  2OI2 A;  1KVK A;  2UUC I;  2IOP A;  2IER A;  5DNX A;  1XHK A;  4LF5 E;  5IT9 Q;  1ZM9 A;  3JAM Q;  4IZK B;  2ZM6 E;  1XMO I;  4BA2 B;  4DUY I;  1WUU A;  1R6M A;  4HYM A;  4HY1 A;  4IZJ B;  4JYA E;  4DV4 I;  4JI4 I;  5DRR A;  2UUA I;  4JI2 E;  2VQE E;  3J81 C;  4LFA I;  1Z5A A;  1YH8 A;  4LF9 I;  2F4V I;  2UUB I;  2WW4 A;  4Z7Y A;  3QT7 A;  2GS8 A;  1UDQ A;  4AQY E;  2R42 A;  2Q2E B;  4NXN I;  1Y5Y A;  1H7U A;  2AJ4 A;  1Z5B A;  3K1J A;  4RPF A;  1IBM E;  5L3J A;  1RRE A;  2Z5C A;  3H1C A;  4IFD B;  2WNR A;  4FW9 A;  4JI5 E;  2IES A;  4DV2 I;  4LF8 I;  4OZE A;  5GMD A;  4YHH E;  1N34 E;  2PO0 A;  1XMQ I;  4OO1 E;  4M1K A;  1Y60 A;  2V2V A;  4JI1 E;  1ZXM A;  4X64 E;  2C39 B;  4JI0 E;  2E5L I;  4B3S E;  4OO1 D;  2ZBK B;  1OYS A;  2BA0 D;  4PRX A;  1K47 A;  1OYP A;  3P3C A;  4X62 I;  3LTO A;  4OX9 E;  3LNU A;  3PYE A;  2WP8 A;  3ZZ0 A;  1XNR E;  2V2Q A;  1N0V C;  4K0K E;  5K36 F;  4FWD A;  1HNX E;  4YY3 E;  1Y4S A;  5EKW A;  4JV5 E;  2ZIT A;  4ISA A;  1EA6 A;  2J7K A;  4LF6 E;  2JEA B;  5JEA A;  2NN6 B;  3OTO I;  4DU7 A;  4Z7C A;  4UT4 A;  1USV A;  4HAC B;  1Z0G A;  4X65 I;  3GLL A;  1XMO E;  1ZM3 A;  4LF4 I;  5BR8 I;  3U1Y A;  1U2R A;  2HKE A;  4IZJ D;  4DV4 E;  4USM A;  4P52 A;  1Z0V A;  4J3D A;  3ZZU A;  5LMN I;  1HNW E;  3WU5 A;  5JEA F;  1Z0E A;  1MU5 A;  2JT2 A;  4DR3 I;  4MU4 A;  1Z0B A;  4NXN E;  2GO3 A;  2UU9 E;  3WU6 A;  4MYT A;  2X36 A;  2HFU A;  5DNL A;  4NXM E;  4LCG A;  1FJG I;  4JI6 I;  4IFD E;  3UHM A;  4FW4 A;  2AE8 A;  1ZM4 A;  2UXB I;  5C0X B;  3ZKD A;  1RHY A;  2NPF A;  4B3T E;  3T1H I;  1UDO A;  4LF8 E;  4IFD D;  1KIJ A;  4LF7 E;  2CG9 A;  5JEA C;  1XMQ E;  3M85 G;  4DPY A;  4DV3 I;  4OKG A;  3L7Z B;  2GQ0 A;  2A2D A;  3PYF A;  2Z5C B;  3CDJ A;  3JAM C;  2WNR B;  4X66 E;  3P3E A;  3M85 D;  4FW3 A;  1HK7 A;  3GON A;  2R3V A;  5DRQ A;  1QZR A;  1ZM2 A;  2PO0 B;  3P76 A;  4MYU A;  2PNM A;  1HR0 I;  4X62 E;  5GME A;  4DV5 I;  1PVG A;  2HHH I;  4URL A;  4GQU A;  4LPF A;  1R6L A;  4U3D A;  4PU9 A;  3J7A G;  4MU0 A;  1MX0 A;  2XEX A;  2C37 A;  4ZVI A;  3H4L A;  4DV1 E;  2BR2 A;  2JE6 A;  3B78 A;  1NHJ A;  2WP8 B;  4DR1 I;  2NN6 E;  2Z5E A;  4LCH A;  3KRN A;  1XNQ I;  2O1W A;  4DR4 E;  1ELO A;  3PS2 A;  2O3Z A;  4WUC A;  1IBL I;  2NN6 D;  1N0U A;  3J81 Q;  1OJ4 A;  1H7S A;  4X65 E;  2PO1 A;  5IWA I;  4KHP E;  4LF4 E;  3GME A;  4DR2 I;  5BR8 E;  5K36 A;  5JEA B;  4IS9 A;  4ED4 A;  1HNZ I;  3HKM A;  4DR7 I;  4OO1 F;  2O1T A;  1IBK I;  2HK3 A;  4DUZ I;  4B3M I;  4LFC I;  1N33 I;  1KTV A;  5LMN E;  1USU A;  4JI7 I;  4DV0 E;  1N32 I;  3NZK A;  4FW5 A;  4BA2 A;  4JI8 E;  1EI1 A;  4FW6 A;  4MU3 A;  2UXD I;  2F1D A;  2C38 A;  4DV7 E;  3P3G A;  2BM0 A;  5DRP A;  4HXZ A;  4B3R I;  4LF5 I;  5C0X E;  2VQF E;  3Q6M A;  3J80 C;  1H74 A;  2ZM6 I;  1P42 A;  4DXL A;  3M7N G;  4NBQ A;  3Q1Q A;  2PNZ A;  5LL6 R;  2UXB E;  4AIM A;  5C0X D;  4JYA I;  3DD6 A;  5FLX Q;  2UUC E;  3M6A A;  4DV3 E;  3B8H A;  4DPT A;  2X7I A;  2EFG A;  4JI3 I;  2CZ9 A;  1BKN A;  4LCF A;  3ZM7 A;  4DUY E;  1N36 I;  4FN5 A;  2CGE A;  5K36 C;  4AQY I;  4MDT A;  4JI4 E;  2LJP A;  4DV5 E;  2UUA E;  2HHH E;  2DEI A;  1NHI A;  4DPW A;  4DR6 I;  1IBM I;  4LFA E;  4LF9 E;  2F4V E;  3V2U C;  2DEJ A;  4R1F A;  2UUB E;  1ZXN A;  4GKJ I;  1VI7 A;  1A6F A;  3CDI A;  1PKP A;  4JI5 I;  4DR1 E;  1UDS A;  4YHH I;  1XNQ E;  1J5E I;  2C37 B;  2BR2 B;  4WUB A;  4IFD F;  3WU4 A;  1NHH A;  2JEB A;  3B4T A;  5A2Q Q;  4QNK A;  5IWA E;  1Z59 A;  4DR2 E;  4DV2 E;  2PO2 A;  3HJC A;  4DPU A;  1FKA E;  4USK A;  1B63 A;  2E1R A;  4DU8 A;  4GKK I;  4DR5 I;  5IT9 C;  1XNR I;  2HK2 A;  3ZZT A;  2PO1 B;  2J65 A;  2O1V A;  4LFC E;  1KKH A;  2NN6 A;  2E5L E;  3PRY A;  1HNX I;  4UTG A;  5K36 B;  1OYR A;  3PYG A;  4FW7 A;  4JV5 I;  5LMU I;  4I3H A;  4LF6 I;  1E3H A;  4MQY A;  1MG7 A;  4B3R E;  1FNM A;  4BA1 A;  4OO1 A;  3T1Y I;  1I94 I;  3LPS A;  1Z0C A;  2C38 B;  2BM1 A;  4EMD A;  2GO4 A;  2Z5B A;  1UDN A;  2NN6 F;  4QNJ A;  2VES A;  2V2Z A;  2UXC I;  3OTO E;  2PNZ B;  4JI3 E;  1RR9 A;  3PS3 A;  3P06 A;  1N36 E;  4LFB I;  3U1K A;  1HNW I;  2HKJ A;  4AID A;  2V8P A;  4DPX A;  5C0X A;  3Q6N A;  1Y4U A;  3QT5 A;  2UU9 I;  1VIS A;  4DR6 E;  4DV6 I;  2NN6 C;  4NXM I;  4LOM A;  1Y6Z A;  3L7Z A;  4IZK A;  4GKJ E;  4DR3 E;  1Z0W A;  4B3T I;  1FWL A;  4IZJ A;  4LF7 I;  3PS1 A;  1FJG E;  1J5E E;  4N3O A; 
#chains in the Genus database with same CATH homology
 3K85 A;  4JI6 E;  3D4J A;  4X66 I;  1H72 C;  4XTJ A;  3T1H E;  2HFS A;  1NZ0 A;  1S16 A;  5FLX C;  2PNL A;  3K17 A;  4WUD A;  4JI2 I;  4GKK E;  2VQE I;  1UEK A;  4DR5 E;  2VF3 A;  4KQV A;  1PIE A;  3J80 Q;  3HUL A;  4DV1 I;  3QT8 A;  4P7A A;  1HR0 E;  4FWG A;  1Z5C A;  5LMU E;  1FI4 A;  4DR4 I;  1H73 A;  2IOQ A;  2O1U A;  3B82 A;  5FWK A;  1I94 E;  3T1Y E;  3J7A M;  4KHP I;  3V5R A;  1S4E A;  2A2C A;  1N34 I;  1FWK A;  2UXC E;  1IBL E;  4JI1 I;  4X64 I;  3PYD A;  4JI0 I;  4B3S I;  4LFB E;  5A2Q C;  2Z5B B;  4DV0 I;  4JI8 I;  3ZKB A;  1DAR A;  4OX9 I;  1HNZ E;  4PRV A;  4DV7 I;  4DR7 E;  4FWH A;  1IBK E;  4DUZ E;  3F0N A;  4B3M E;  2BV3 A;  4K0K I;  1N33 E;  3CWV A;  4DV6 E;  2VQF I;  4JI7 E;  3WU3 A;  1N32 E;  4YY3 I;  4JG4 A;  4HAC A;  3QT6 A;  1B62 A;  2UXD E;  2V34 A;  1Z0T A;  1D6T A;  2OI2 A;  1KVK A;  2UUC I;  2IOP A;  1XHK A;  4LF5 E;  5IT9 Q;  1ZM9 A;  3JAM Q;  4IZK B;  2ZM6 E;  1XMO I;  4DUY I;  1WUU A;  4HYM A;  4HY1 A;  4IZJ B;  4JYA E;  4DV4 I;  4JI4 I;  2UUA I;  4JI2 E;  2VQE E;  3J81 C;  4LFA I;  1Z5A A;  4LF9 I;  2F4V I;  2UUB I;  2WW4 A;  4Z7Y A;  3QT7 A;  2GS8 A;  4AQY E;  2R42 A;  2Q2E B;  4NXN I;  1H7U A;  2AJ4 A;  1Z5B A;  3K1J A;  4RPF A;  1IBM E;  5L3J A;  1RRE A;  2Z5C A;  4JI5 E;  4FW9 A;  4DV2 I;  4LF8 I;  5GMD A;  4YHH E;  1N34 E;  1XMQ I;  4M1K A;  2V2V A;  4JI1 E;  1ZXM A;  4X64 E;  4JI0 E;  2E5L I;  4B3S E;  2ZBK B;  4PRX A;  1K47 A;  4X62 I;  3LTO A;  4OX9 E;  3LNU A;  3PYE A;  3ZZ0 A;  1XNR E;  2V2Q A;  1N0V C;  4K0K E;  4FWD A;  1HNX E;  4YY3 E;  1Y4S A;  4JV5 E;  2ZIT A;  1EA6 A;  2J7K A;  4LF6 E;  3OTO I;  4DU7 A;  4Z7C A;  4UT4 A;  1USV A;  4HAC B;  1Z0G A;  4X65 I;  1XMO E;  1ZM3 A;  4LF4 I;  5BR8 I;  1U2R A;  2HKE A;  4IZJ D;  4DV4 E;  4USM A;  4P52 A;  1Z0V A;  3ZZU A;  5LMN I;  1HNW E;  3WU5 A;  1Z0E A;  1MU5 A;  4DR3 I;  1Z0B A;  4NXN E;  2UU9 E;  3WU6 A;  4MYT A;  2X36 A;  2HFU A;  4NXM E;  1FJG I;  4JI6 I;  1ZM4 A;  2UXB I;  3ZKD A;  2NPF A;  4B3T E;  3T1H I;  4LF8 E;  1KIJ A;  4LF7 E;  2CG9 A;  1XMQ E;  4DPY A;  4DV3 I;  2GQ0 A;  2A2D A;  3PYF A;  2Z5C B;  3JAM C;  4X66 E;  1HK7 A;  3GON A;  2R3V A;  1QZR A;  1ZM2 A;  4MYU A;  2PNM A;  1HR0 I;  4X62 E;  5GME A;  4DV5 I;  1PVG A;  2HHH I;  4URL A;  4PU9 A;  3J7A G;  1MX0 A;  2XEX A;  4ZVI A;  3H4L A;  4DV1 E;  3B78 A;  1NHJ A;  4DR1 I;  2Z5E A;  1XNQ I;  2O1W A;  4DR4 E;  1ELO A;  1IBL I;  4WUC A;  1N0U A;  3J81 Q;  1OJ4 A;  1H7S A;  4X65 E;  5IWA I;  4KHP E;  4LF4 E;  4DR2 I;  5BR8 E;  4ED4 A;  1HNZ I;  4DR7 I;  2O1T A;  1IBK I;  2HK3 A;  4DUZ I;  4B3M I;  4LFC I;  1N33 I;  1KTV A;  5LMN E;  1USU A;  4JI7 I;  4DV0 E;  1N32 I;  4JI8 E;  1EI1 A;  2UXD I;  4DV7 E;  2BM0 A;  4HXZ A;  4B3R I;  4LF5 I;  2VQF E;  3Q6M A;  3J80 C;  1H74 A;  2ZM6 I;  4DXL A;  3Q1Q A;  5LL6 R;  2UXB E;  4JYA I;  5FLX Q;  2UUC E;  3M6A A;  4DV3 E;  3B8H A;  4DPT A;  2X7I A;  2EFG A;  4JI3 I;  2CZ9 A;  1BKN A;  3ZM7 A;  4DUY E;  1N36 I;  4FN5 A;  2CGE A;  4AQY I;  4JI4 E;  2LJP A;  4DV5 E;  2UUA E;  2HHH E;  2DEI A;  1NHI A;  4DPW A;  4DR6 I;  1IBM I;  4LFA E;  4LF9 E;  2F4V E;  3V2U C;  2DEJ A;  4R1F A;  2UUB E;  1ZXN A;  4GKJ I;  1A6F A;  1PKP A;  4JI5 I;  4DR1 E;  4YHH I;  1XNQ E;  1J5E I;  4WUB A;  3WU4 A;  1NHH A;  5A2Q Q;  5IWA E;  1Z59 A;  4DR2 E;  4DV2 E;  3HJC A;  4DPU A;  1FKA E;  4USK A;  1B63 A;  2E1R A;  4DU8 A;  4GKK I;  4DR5 I;  5IT9 C;  1XNR I;  2HK2 A;  3ZZT A;  2O1V A;  4LFC E;  1KKH A;  2E5L E;  3PRY A;  1HNX I;  4UTG A;  3PYG A;  4JV5 I;  5LMU I;  4I3H A;  4LF6 I;  1MG7 A;  4B3R E;  1FNM A;  1I94 I;  3T1Y I;  3LPS A;  1Z0C A;  2BM1 A;  4EMD A;  2Z5B A;  2V2Z A;  2UXC I;  3OTO E;  4JI3 E;  1RR9 A;  3P06 A;  1N36 E;  4LFB I;  1HNW I;  2HKJ A;  2V8P A;  4DPX A;  3Q6N A;  1Y4U A;  3QT5 A;  2UU9 I;  1VIS A;  4DR6 E;  4DV6 I;  4NXM I;  1Y6Z A;  4IZK A;  4GKJ E;  4DR3 E;  1Z0W A;  4B3T I;  1FWL A;  4IZJ A;  4LF7 I;  1FJG E;  1J5E E;  4N3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...