3P06A

Crystal structure of tellina virus 1 vp4 protease in the form of an intra-molecular(cis)acyl-enzyme complex.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
194
Chain Sequence
NGVELSAVGVLLPVLMDSGRRISGGAFMAVKGDLSEHIKNPKNTRIAQTVAGGTIYGLSEMVNIDEAEKLPIKGAITVLPVVQATATSILVPDNQPQLAFNSWEAAACAADTLESQQTPFLMVTGAVESGNLSPNLLAVQKQLLVAKPAGIGLAANSDRALKVVTLEQLRQVVGDKPWRKPMVTFSSGKNVAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VP4 protein
publication title Crystal Structure of a Viral Protease Intramolecular Acyl-enzyme Complex: INSIGHTS INTO cis-CLEAVAGE AT THE VP4/VP3 JUNCTION OF TELLINA BIRNAVIRUS.
pubmed doi rcsb
source organism Tellina virus 1
molecule tags Hydrolase
total genus 48
structure length 194
sequence length 194
ec nomenclature ec 3.4.21.115: Infectious pancreatic necrosis birnavirus Vp4 peptidase.
pdb deposition date 2010-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3p06A00
3P06A 4IZJA 4IZKB 2PNLA 4IZJB 2PNMA 4IZJD 4IZKA
chains in the Genus database with same CATH superfamily
2BR2A 4OO1D 3QT5A 1R6MA 2BM1A 4DUYE 1RR9A 2HKJA 4LF4I 4USKA 1R6LA 4IFDE 5K36A 4X62E 1S4EA 4KHPE 4MYUA 5DRQA 4QNKA 3ZKDA 5IWAI 2JE6B 4B3RI 2IOQA 1XMOI 4JI0E 2C38A 4ED4A 2UUBE 2JEAA 1XHKA 4DR4I 1H7SA 5EKWA 4DV5E 1FJGI 1NHHA 4DR3I 1N0VC 1KVKA 5A2QC 4GKKE 5ELWA 4OX9E 4LFAE 1MU5A 5JEAE 4P52A 5DNXA 2F4VI 2DEJA 4YY3I 3PYGA 4FWHA 4OZEA 1Y60A 4ZVIA 4B3RE 3WU3A 1A6FA 4IFDC 1Z5AA 4HXZA 5EL9A 1FNMA 4BA2A 2PO0B 3WU4A 1HK7A 3B4TA 4M1KA 5LMNI 1Z0BA 4N3OA 4IZKB 1P42A 4DR3E 4GQUA 4X66I 1HNWE 4FWGA 1USVA 4JI5E 2NN6C 4YHHI 3B78A 1XNRI 4YY3E 2C39A 1Z0VA 4LCFA 2O1UA 4JI2E 4JYAI 4DR7I 5C0XE 1FKAE 1NHJA 2BM0A 4JI7I 2X36A 4WUCA 4WUBA 1S16A 1Z59A 3D4JA 4X66E 4MDTA 5K36E 3M6AA 4JV5I 3M85D 2UXBI 4IZJB 2Z5BB 3J80Q 2PNZA 1WUUA 4DPYA 4GKJE 4JI1E 4BA1B 2IERA 4JYAE 1IBLE 2PNLA 4FW6A 1ZM2A 2GO4A 2E5LI 4I3HA 1U2RA 2NN6A 1OJ4A 4AIDA 4DV0E 1E3HA 2GO3A 2UXBE 4LCGA 4FN5A 4NXMI 1Z0GA 5A2QQ 3KRNA 3GLLA 2J65A 1D6TA 4LPFA 2V2ZA 3Q1QA 5LMUE 4DV3I 1UDQA 2A2DA 3HULA 4PRVA 4DUZI 2C37B 4DPXA 2UXDI 1UDOA 3L7ZB 1E3PA 3J7AG 2GS8A 1KKHA 5DRPA 1PVGA 4DV4I 4DR1E 1J5EI 4X62I 4IZJD 1NZ0A 3HJCA 1DARA 4LCHA 1OYRA 1Z0WA 2WP8B 4DV3E 2BA0G 2VQEE 4OO1A 4DUZE 2UXDE 4DR6E 1HR0I 1IBKI 2PO2A 4K0KE 1UDSA 4GKKI 4FW7A 4OX9I 4LFAI 1USUA 4DV4E 1J5EE 4LFCI 4DV2I 2HFSA 2HKEA 5BR8I 3ZZ0A 4LF5I 3V2UC 2J7KA 3P06A 2WNRB 2UUAI 4MU1A 3PS1A 5IT9C 4LF7I 2Z5CB 4FW4A 4MU3A 4UT4A 2NN6E 3LTOA 3QT7A 1HR0E 1IBKE 2O3ZA 1HNWI 3Q6NA 4B3MI 4JI5I 1H73A 1Y4SA 3B8HA 4LFCE 4DV2E 4FW3A 1RHYA 5BR8E 1N32E 1IBMI 1EA6A 3GONA 4JI2I 4LF5E 2PO1B 4IFDF 5GMEA 3ZZUA 2UUAE 4Z7YA 4LF7E 3LNUA 2NPFA 5FLXQ 1H72C 1HNZI 1N36E 1ELOA 4B3TI 4MU0A 4USMA 4IS9A 4B3ME 4QNJA 2JE6A 4ISAA 4GKJI 4JI1I 2WNRA 4URLA 1IBME 3QT6A 1FI4A 5JEAF 4IFDB 1IBLI 3DD6A 2Z5CA 4OO1E 2V2QA 4U3DA 1Z0EA 4R1FA 4LFBE 1HNZE 2LJPA 2V2VA 4B3TE 2R3VA 2A2CA 3Q6MA 1Z5CA 2JEBB 4DV0I 3H4LA 2EFGA 1XMQI 5JEAB 2PO0A 3PYEA 2CZ9A 5LMUI 4DV1I 2ZM6I 4IZKA 2AE8A 4RPFA 2OI2A 5C0XF 4HACB 4OO1C 1MG7A 5IT9Q 2IESA 4JI4E 1VI7A 4DR5E 5DROA 2XEXA 4DR1I 4DU7A 5DNLA 3WU5A 5K36F 1XMQE 5DRRA 2CGEA 4IFDD 1OYPA 4NXNI 2V8PA 1XNQE 2ZBKB 4XTJA 2E1RA 3HKMA 4DV1E 2ZM6E 2VQEI 2VQFI 5C0XB 1N0UA 4DR6I 4IZJA 1Z0TA 3K17A 2Z5BA 4K0KI 2BA0D 4PRXA 3PS3A 2BR2B 2UU9I 2IOPA 4MQYA 5K36B 4BA1A 2UUCI 3H1CA 3M7NG 3JAMC 5JEAD 4NXNE 4FW9A 4LF6E 1KTVA 4PU9A 4U3BA 1H7UA 3T1YI 2PNMA 3CDIA 1H74A 2VQFE 2JEAB 3LPSA 4DPTA 3PYFA 1I94I 4DXLA 2UU9E 1Y6ZA 4UTGA 2JT2A 2UUCE 1N32I 4DR2E 4DU8A 1N34E 4B3SI 2WW4A 2C37A 1OYSA 1XXEA 4X64I 5C0XA 3T1YE 4BA2B 3L7ZA 1N36I 4JI3E 4DV6E 5C0XD 2O1WA 2UXCI 4AM3A 1I94E 2O1VA 3CWVA 4EMDA 5LL6R 1PKPA 2BA1G 2GQ0A 3T1HE 4Z7CA 4JI6E 1KIJA 5K36D 4NBQA 2C39B 3OTOE 1Z5BA 2WP8A 2V34A 4B3SE 3PRYA 3V5RA 4X64E 1UEKA 4LFBI 1Y5YA 5FWKA 1ZXNA 2UXCE 3P3CA 2NN6F 3J81C 1BKNA 4LF4E 1RREA 5GMDA 1FWKA 5IWAE 4JG4A 4HYMA 3P3EA 4AIMA 2PNZB 2X7IA 1YH8A 1XMOE 1K47A 3U1YA 3WU6A 2O1TA 1PIEA 4DR4E 1FJGE 3PS2A 2ZITA 1B62A 3K1JA 4LF9I 3JAMQ 4P7AA 4JI4I 2NN6B 4DR5I 4DPWA 3ZKBA 2F4VE 3K85A 1QZRA 2PO1A 4J3DA 5JEAC 1ZM4A 4FW5A 4LOMA 4LF8I 1XNQI 1FWLA 5LMNE 4LF9E 1UDNA 4OO1F 1N33I 3P76A 2VESA 3U1KA 1NHIA 4YHHE 3ZZTA 3GMEA 4X65I 1XNRE 2HFUA 4IFDA 2VF3A 2HK3A 3NZKA 4DV7I 3CDJA 4DR7E 4KQVA 4AQYI 4LF8E 4LF6I 2Z5EA 1ZXMA 4JI7E 4DPUA 3M85G 3F0NA 3M7ND 5L3JA 5C0XC 4OO1B 1EI1A 2JEBA 2BV3A 4WUDA 1N33E 1MX0A 4JV5E 2PO2B 3ZM7A 2NN6D 4HY1A 4X65E 5JEAA 5K36C 5FLXC 4DV7E 4DR2I 3J81Q 1HNXI 3GCMA 1YHCA 3PYDA 2AJ4A 2R42A 1N34I 3P3GA 4AQYE 2C38B 4JI8I 3UHMA 3J7AM 4HACA 2E5LE 4JI3I 1Z0CA 4DV6I 2HHHI 4OKGA 4FWDA 4DUYI 3B82A 1B63A 4NXME 2DEIA 4KHPI 3T1HI 2CG9A 4JI6I 3QT8A 1ZM3A 1HNXE 2F1DA 3OTOI 2HK2A 4JI0I 4MYTA 1Y4UA 1ZM9A 4MU4A 2BA1D 4JI8E 2UUBI 2CVEA 3J80C 4DV5I 1VISA 2Q2EB 2HHHE
chains in the Genus database with same CATH topology
3QT5A 2BM1A 4DUYE 1RR9A 2HKJA 4LF4I 4USKA 4X62E 1S4EA 4KHPE 4MYUA 3ZKDA 5IWAI 4B3RI 2IOQA 1XMOI 4JI0E 4ED4A 2UUBE 1XHKA 4DR4I 1H7SA 4DV5E 1FJGI 1NHHA 4DR3I 1N0VC 1KVKA 5A2QC 4GKKE 4OX9E 4LFAE 1MU5A 4P52A 2F4VI 2DEJA 4YY3I 3PYGA 4FWHA 4ZVIA 4B3RE 3WU3A 1A6FA 1Z5AA 4HXZA 1FNMA 3WU4A 1HK7A 4M1KA 5LMNI 1Z0BA 4N3OA 4IZKB 4DR3E 4X66I 1HNWE 4FWGA 1USVA 4JI5E 4YHHI 3B78A 1XNRI 4YY3E 1Z0VA 2O1UA 4JI2E 4JYAI 4DR7I 1FKAE 1NHJA 2BM0A 4JI7I 2X36A 4WUCA 4WUBA 1S16A 1Z59A 3D4JA 4X66E 3M6AA 4JV5I 2UXBI 4IZJB 2Z5BB 3J80Q 1WUUA 4DPYA 4GKJE 4JI1E 4JYAE 1IBLE 2PNLA 1ZM2A 2E5LI 4I3HA 1U2RA 1OJ4A 4DV0E 2UXBE 4FN5A 4NXMI 1Z0GA 5A2QQ 1D6TA 2V2ZA 3Q1QA 5LMUE 4DV3I 2A2DA 3HULA 4PRVA 4DUZI 4DPXA 2UXDI 3J7AG 2GS8A 1KKHA 1PVGA 4DV4I 4DR1E 1J5EI 4X62I 4IZJD 1NZ0A 3HJCA 1DARA 1Z0WA 4DV3E 2VQEE 4DUZE 2UXDE 4DR6E 1HR0I 1IBKI 4K0KE 4GKKI 4OX9I 4LFAI 1USUA 4DV4E 1J5EE 4LFCI 4DV2I 2HFSA 2HKEA 5BR8I 3ZZ0A 4LF5I 3V2UC 2J7KA 3P06A 2UUAI 5IT9C 4LF7I 2Z5CB 4UT4A 3LTOA 3QT7A 1HR0E 1IBKE 1HNWI 3Q6NA 4B3MI 4JI5I 1H73A 1Y4SA 3B8HA 4LFCE 4DV2E 5BR8E 1N32E 1IBMI 1EA6A 3GONA 4JI2I 4LF5E 5GMEA 3ZZUA 2UUAE 4Z7YA 4LF7E 3LNUA 2NPFA 5FLXQ 1H72C 1HNZI 1N36E 1ELOA 4B3TI 4USMA 4B3ME 4GKJI 4JI1I 4URLA 1IBME 3QT6A 1FI4A 1IBLI 2Z5CA 2V2QA 1Z0EA 4R1FA 4LFBE 1HNZE 2LJPA 2V2VA 4B3TE 2R3VA 2A2CA 3Q6MA 1Z5CA 4DV0I 3H4LA 2EFGA 1XMQI 3PYEA 2CZ9A 5LMUI 4DV1I 2ZM6I 4IZKA 4RPFA 2OI2A 4HACB 1MG7A 5IT9Q 4JI4E 4DR5E 2XEXA 4DR1I 4DU7A 3WU5A 1XMQE 2CGEA 4NXNI 2V8PA 1XNQE 2ZBKB 4XTJA 2E1RA 4DV1E 2ZM6E 2VQEI 2VQFI 1N0UA 4DR6I 4IZJA 1Z0TA 3K17A 2Z5BA 4K0KI 4PRXA 2UU9I 2IOPA 2UUCI 3JAMC 4NXNE 4FW9A 4LF6E 1KTVA 4PU9A 1H7UA 3T1YI 2PNMA 1H74A 2VQFE 3LPSA 4DPTA 3PYFA 1I94I 4DXLA 2UU9E 1Y6ZA 4UTGA 2UUCE 1N32I 4DR2E 4DU8A 1N34E 4B3SI 2WW4A 4X64I 3T1YE 1N36I 4JI3E 4DV6E 2O1WA 2UXCI 1I94E 2O1VA 3CWVA 4EMDA 5LL6R 1PKPA 3T1HE 2GQ0A 4Z7CA 4JI6E 1KIJA 3OTOE 1Z5BA 2V34A 4B3SE 3PRYA 3V5RA 4X64E 1UEKA 4LFBI 5FWKA 1ZXNA 2UXCE 3J81C 1BKNA 4LF4E 1RREA 5GMDA 1FWKA 5IWAE 4JG4A 4HYMA 2X7IA 1XMOE 1K47A 3WU6A 2O1TA 1PIEA 4DR4E 1FJGE 2ZITA 1B62A 3K1JA 4LF9I 3JAMQ 4P7AA 4JI4I 4DR5I 4DPWA 3ZKBA 2F4VE 3K85A 1QZRA 1ZM4A 4LF8I 1XNQI 1FWLA 5LMNE 4LF9E 1N33I 1NHIA 4YHHE 3ZZTA 4X65I 1XNRE 2HFUA 2VF3A 2HK3A 4DV7I 4DR7E 4KQVA 4AQYI 4LF8E 4LF6I 2Z5EA 1ZXMA 4JI7E 4DPUA 3F0NA 5L3JA 1EI1A 2BV3A 4WUDA 1N33E 1MX0A 4JV5E 3ZM7A 4HY1A 4X65E 5FLXC 4DV7E 4DR2I 3J81Q 1HNXI 3PYDA 2AJ4A 2R42A 1N34I 4AQYE 4JI8I 3J7AM 4HACA 2E5LE 4JI3I 1Z0CA 4DV6I 2HHHI 4FWDA 4DUYI 3B82A 1B63A 4NXME 2DEIA 4KHPI 3T1HI 2CG9A 4JI6I 3QT8A 1ZM3A 1HNXE 3OTOI 2HK2A 4JI0I 4MYTA 1Y4UA 1ZM9A 2UUBI 4JI8E 3J80C 4DV5I 1VISA 2Q2EB 2HHHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P06 A;  4IZJ A;  4IZK B;  2PNL A;  4IZJ B;  2PNM A;  4IZJ D;  4IZK A; 
#chains in the Genus database with same CATH topology
 2BR2 A;  4OO1 D;  3QT5 A;  1R6M A;  2BM1 A;  4DUY E;  1RR9 A;  2HKJ A;  4LF4 I;  4USK A;  1R6L A;  4IFD E;  5K36 A;  4X62 E;  1S4E A;  4KHP E;  4MYU A;  5DRQ A;  4QNK A;  3ZKD A;  5IWA I;  2JE6 B;  4B3R I;  2IOQ A;  1XMO I;  4JI0 E;  2C38 A;  4ED4 A;  2UUB E;  2JEA A;  1XHK A;  4DR4 I;  1H7S A;  5EKW A;  4DV5 E;  1FJG I;  1NHH A;  4DR3 I;  1N0V C;  1KVK A;  5A2Q C;  4GKK E;  5ELW A;  4OX9 E;  4LFA E;  1MU5 A;  5JEA E;  4P52 A;  5DNX A;  2F4V I;  2DEJ A;  4YY3 I;  3PYG A;  4FWH A;  4OZE A;  1Y60 A;  4ZVI A;  4B3R E;  3WU3 A;  1A6F A;  4IFD C;  1Z5A A;  4HXZ A;  5EL9 A;  1FNM A;  4BA2 A;  2PO0 B;  3WU4 A;  1HK7 A;  3B4T A;  4M1K A;  5LMN I;  1Z0B A;  4N3O A;  4IZK B;  1P42 A;  4DR3 E;  4GQU A;  4X66 I;  1HNW E;  4FWG A;  1USV A;  4JI5 E;  2NN6 C;  4YHH I;  3B78 A;  1XNR I;  4YY3 E;  2C39 A;  1Z0V A;  4LCF A;  2O1U A;  4JI2 E;  4JYA I;  4DR7 I;  5C0X E;  1FKA E;  1NHJ A;  2BM0 A;  4JI7 I;  2X36 A;  4WUC A;  4WUB A;  1S16 A;  1Z59 A;  3D4J A;  4X66 E;  4MDT A;  5K36 E;  3M6A A;  4JV5 I;  3M85 D;  2UXB I;  4IZJ B;  2Z5B B;  3J80 Q;  2PNZ A;  1WUU A;  4DPY A;  4GKJ E;  4JI1 E;  4BA1 B;  2IER A;  4JYA E;  1IBL E;  2PNL A;  4FW6 A;  1ZM2 A;  2GO4 A;  2E5L I;  4I3H A;  1U2R A;  2NN6 A;  1OJ4 A;  4AID A;  4DV0 E;  1E3H A;  2GO3 A;  2UXB E;  4LCG A;  4FN5 A;  4NXM I;  1Z0G A;  5A2Q Q;  3KRN A;  3GLL A;  2J65 A;  1D6T A;  4LPF A;  2V2Z A;  3Q1Q A;  5LMU E;  4DV3 I;  1UDQ A;  2A2D A;  3HUL A;  4PRV A;  4DUZ I;  2C37 B;  4DPX A;  2UXD I;  1UDO A;  3L7Z B;  1E3P A;  3J7A G;  2GS8 A;  1KKH A;  5DRP A;  1PVG A;  4DV4 I;  4DR1 E;  1J5E I;  4X62 I;  4IZJ D;  1NZ0 A;  3HJC A;  1DAR A;  4LCH A;  1OYR A;  1Z0W A;  2WP8 B;  4DV3 E;  2BA0 G;  2VQE E;  4OO1 A;  4DUZ E;  2UXD E;  4DR6 E;  1HR0 I;  1IBK I;  2PO2 A;  4K0K E;  1UDS A;  4GKK I;  4FW7 A;  4OX9 I;  4LFA I;  1USU A;  4DV4 E;  1J5E E;  4LFC I;  4DV2 I;  2HFS A;  2HKE A;  5BR8 I;  3ZZ0 A;  4LF5 I;  3V2U C;  2J7K A;  3P06 A;  2WNR B;  2UUA I;  4MU1 A;  3PS1 A;  5IT9 C;  4LF7 I;  2Z5C B;  4FW4 A;  4MU3 A;  4UT4 A;  2NN6 E;  3LTO A;  3QT7 A;  1HR0 E;  1IBK E;  2O3Z A;  1HNW I;  3Q6N A;  4B3M I;  4JI5 I;  1H73 A;  1Y4S A;  3B8H A;  4LFC E;  4DV2 E;  4FW3 A;  1RHY A;  5BR8 E;  1N32 E;  1IBM I;  1EA6 A;  3GON A;  4JI2 I;  4LF5 E;  2PO1 B;  4IFD F;  5GME A;  3ZZU A;  2UUA E;  4Z7Y A;  4LF7 E;  3LNU A;  2NPF A;  5FLX Q;  1H72 C;  1HNZ I;  1N36 E;  1ELO A;  4B3T I;  4MU0 A;  4USM A;  4IS9 A;  4B3M E;  4QNJ A;  2JE6 A;  4ISA A;  4GKJ I;  4JI1 I;  2WNR A;  4URL A;  1IBM E;  3QT6 A;  1FI4 A;  5JEA F;  4IFD B;  1IBL I;  3DD6 A;  2Z5C A;  4OO1 E;  2V2Q A;  4U3D A;  1Z0E A;  4R1F A;  4LFB E;  1HNZ E;  2LJP A;  2V2V A;  4B3T E;  2R3V A;  2A2C A;  3Q6M A;  1Z5C A;  2JEB B;  4DV0 I;  3H4L A;  2EFG A;  1XMQ I;  5JEA B;  2PO0 A;  3PYE A;  2CZ9 A;  5LMU I;  4DV1 I;  2ZM6 I;  4IZK A;  2AE8 A;  4RPF A;  2OI2 A;  5C0X F;  4HAC B;  4OO1 C;  1MG7 A;  5IT9 Q;  2IES A;  4JI4 E;  1VI7 A;  4DR5 E;  5DRO A;  2XEX A;  4DR1 I;  4DU7 A;  5DNL A;  3WU5 A;  5K36 F;  1XMQ E;  5DRR A;  2CGE A;  4IFD D;  1OYP A;  4NXN I;  2V8P A;  1XNQ E;  2ZBK B;  4XTJ A;  2E1R A;  3HKM A;  4DV1 E;  2ZM6 E;  2VQE I;  2VQF I;  5C0X B;  1N0U A;  4DR6 I;  4IZJ A;  1Z0T A;  3K17 A;  2Z5B A;  4K0K I;  2BA0 D;  4PRX A;  3PS3 A;  2BR2 B;  2UU9 I;  2IOP A;  4MQY A;  5K36 B;  4BA1 A;  2UUC I;  3H1C A;  3M7N G;  3JAM C;  5JEA D;  4NXN E;  4FW9 A;  4LF6 E;  1KTV A;  4PU9 A;  4U3B A;  1H7U A;  3T1Y I;  2PNM A;  3CDI A;  1H74 A;  2VQF E;  2JEA B;  3LPS A;  4DPT A;  3PYF A;  1I94 I;  4DXL A;  2UU9 E;  1Y6Z A;  4UTG A;  2JT2 A;  2UUC E;  1N32 I;  4DR2 E;  4DU8 A;  1N34 E;  4B3S I;  2WW4 A;  2C37 A;  1OYS A;  1XXE A;  4X64 I;  5C0X A;  3T1Y E;  4BA2 B;  3L7Z A;  1N36 I;  4JI3 E;  4DV6 E;  5C0X D;  2O1W A;  2UXC I;  4AM3 A;  1I94 E;  2O1V A;  3CWV A;  4EMD A;  5LL6 R;  1PKP A;  2BA1 G;  2GQ0 A;  3T1H E;  4Z7C A;  4JI6 E;  1KIJ A;  5K36 D;  4NBQ A;  2C39 B;  3OTO E;  1Z5B A;  2WP8 A;  2V34 A;  4B3S E;  3PRY A;  3V5R A;  4X64 E;  1UEK A;  4LFB I;  1Y5Y A;  5FWK A;  1ZXN A;  2UXC E;  3P3C A;  2NN6 F;  3J81 C;  1BKN A;  4LF4 E;  1RRE A;  5GMD A;  1FWK A;  5IWA E;  4JG4 A;  4HYM A;  3P3E A;  4AIM A;  2PNZ B;  2X7I A;  1YH8 A;  1XMO E;  1K47 A;  3U1Y A;  3WU6 A;  2O1T A;  1PIE A;  4DR4 E;  1FJG E;  3PS2 A;  2ZIT A;  1B62 A;  3K1J A;  4LF9 I;  3JAM Q;  4P7A A;  4JI4 I;  2NN6 B;  4DR5 I;  4DPW A;  3ZKB A;  2F4V E;  3K85 A;  1QZR A;  2PO1 A;  4J3D A;  5JEA C;  1ZM4 A;  4FW5 A;  4LOM A;  4LF8 I;  1XNQ I;  1FWL A;  5LMN E;  4LF9 E;  1UDN A;  4OO1 F;  1N33 I;  3P76 A;  2VES A;  3U1K A;  1NHI A;  4YHH E;  3ZZT A;  3GME A;  4X65 I;  1XNR E;  2HFU A;  4IFD A;  2VF3 A;  2HK3 A;  3NZK A;  4DV7 I;  3CDJ A;  4DR7 E;  4KQV A;  4AQY I;  4LF8 E;  4LF6 I;  2Z5E A;  1ZXM A;  4JI7 E;  4DPU A;  3M85 G;  3F0N A;  3M7N D;  5L3J A;  5C0X C;  4OO1 B;  1EI1 A;  2JEB A;  2BV3 A;  4WUD A;  1N33 E;  1MX0 A;  4JV5 E;  2PO2 B;  3ZM7 A;  2NN6 D;  4HY1 A;  4X65 E;  5JEA A;  5K36 C;  5FLX C;  4DV7 E;  4DR2 I;  3J81 Q;  1HNX I;  3GCM A;  1YHC A;  3PYD A;  2AJ4 A;  2R42 A;  1N34 I;  3P3G A;  4AQY E;  2C38 B;  4JI8 I;  3UHM A;  3J7A M;  4HAC A;  2E5L E;  4JI3 I;  1Z0C A;  4DV6 I;  2HHH I;  4OKG A;  4FWD A;  4DUY I;  3B82 A;  1B63 A;  4NXM E;  2DEI A;  4KHP I;  3T1H I;  2CG9 A;  4JI6 I;  3QT8 A;  1ZM3 A;  1HNX E;  2F1D A;  3OTO I;  2HK2 A;  4JI0 I;  4MYT A;  1Y4U A;  1ZM9 A;  4MU4 A;  2BA1 D;  4JI8 E;  2UUB I;  2CVE A;  3J80 C;  4DV5 I;  1VIS A;  2Q2E B;  2HHH E; 
#chains in the Genus database with same CATH homology
 3QT5 A;  2BM1 A;  4DUY E;  1RR9 A;  2HKJ A;  4LF4 I;  4USK A;  4X62 E;  1S4E A;  4KHP E;  4MYU A;  3ZKD A;  5IWA I;  4B3R I;  2IOQ A;  1XMO I;  4JI0 E;  4ED4 A;  2UUB E;  1XHK A;  4DR4 I;  1H7S A;  4DV5 E;  1FJG I;  1NHH A;  4DR3 I;  1N0V C;  1KVK A;  5A2Q C;  4GKK E;  4OX9 E;  4LFA E;  1MU5 A;  4P52 A;  2F4V I;  2DEJ A;  4YY3 I;  3PYG A;  4FWH A;  4ZVI A;  4B3R E;  3WU3 A;  1A6F A;  1Z5A A;  4HXZ A;  1FNM A;  3WU4 A;  1HK7 A;  4M1K A;  5LMN I;  1Z0B A;  4N3O A;  4IZK B;  4DR3 E;  4X66 I;  1HNW E;  4FWG A;  1USV A;  4JI5 E;  4YHH I;  3B78 A;  1XNR I;  4YY3 E;  1Z0V A;  2O1U A;  4JI2 E;  4JYA I;  4DR7 I;  1FKA E;  1NHJ A;  2BM0 A;  4JI7 I;  2X36 A;  4WUC A;  4WUB A;  1S16 A;  1Z59 A;  3D4J A;  4X66 E;  3M6A A;  4JV5 I;  2UXB I;  4IZJ B;  2Z5B B;  3J80 Q;  1WUU A;  4DPY A;  4GKJ E;  4JI1 E;  4JYA E;  1IBL E;  2PNL A;  1ZM2 A;  2E5L I;  4I3H A;  1U2R A;  1OJ4 A;  4DV0 E;  2UXB E;  4FN5 A;  4NXM I;  1Z0G A;  5A2Q Q;  1D6T A;  2V2Z A;  3Q1Q A;  5LMU E;  4DV3 I;  2A2D A;  3HUL A;  4PRV A;  4DUZ I;  4DPX A;  2UXD I;  3J7A G;  2GS8 A;  1KKH A;  1PVG A;  4DV4 I;  4DR1 E;  1J5E I;  4X62 I;  4IZJ D;  1NZ0 A;  3HJC A;  1DAR A;  1Z0W A;  4DV3 E;  2VQE E;  4DUZ E;  2UXD E;  4DR6 E;  1HR0 I;  1IBK I;  4K0K E;  4GKK I;  4OX9 I;  4LFA I;  1USU A;  4DV4 E;  1J5E E;  4LFC I;  4DV2 I;  2HFS A;  2HKE A;  5BR8 I;  3ZZ0 A;  4LF5 I;  3V2U C;  2J7K A;  3P06 A;  2UUA I;  5IT9 C;  4LF7 I;  2Z5C B;  4UT4 A;  3LTO A;  3QT7 A;  1HR0 E;  1IBK E;  1HNW I;  3Q6N A;  4B3M I;  4JI5 I;  1H73 A;  1Y4S A;  3B8H A;  4LFC E;  4DV2 E;  5BR8 E;  1N32 E;  1IBM I;  1EA6 A;  3GON A;  4JI2 I;  4LF5 E;  5GME A;  3ZZU A;  2UUA E;  4Z7Y A;  4LF7 E;  3LNU A;  2NPF A;  5FLX Q;  1H72 C;  1HNZ I;  1N36 E;  1ELO A;  4B3T I;  4USM A;  4B3M E;  4GKJ I;  4JI1 I;  4URL A;  1IBM E;  3QT6 A;  1FI4 A;  1IBL I;  2Z5C A;  2V2Q A;  1Z0E A;  4R1F A;  4LFB E;  1HNZ E;  2LJP A;  2V2V A;  4B3T E;  2R3V A;  2A2C A;  3Q6M A;  1Z5C A;  4DV0 I;  3H4L A;  2EFG A;  1XMQ I;  3PYE A;  2CZ9 A;  5LMU I;  4DV1 I;  2ZM6 I;  4IZK A;  4RPF A;  2OI2 A;  4HAC B;  1MG7 A;  5IT9 Q;  4JI4 E;  4DR5 E;  2XEX A;  4DR1 I;  4DU7 A;  3WU5 A;  1XMQ E;  2CGE A;  4NXN I;  2V8P A;  1XNQ E;  2ZBK B;  4XTJ A;  2E1R A;  4DV1 E;  2ZM6 E;  2VQE I;  2VQF I;  1N0U A;  4DR6 I;  4IZJ A;  1Z0T A;  3K17 A;  2Z5B A;  4K0K I;  4PRX A;  2UU9 I;  2IOP A;  2UUC I;  3JAM C;  4NXN E;  4FW9 A;  4LF6 E;  1KTV A;  4PU9 A;  1H7U A;  3T1Y I;  2PNM A;  1H74 A;  2VQF E;  3LPS A;  4DPT A;  3PYF A;  1I94 I;  4DXL A;  2UU9 E;  1Y6Z A;  4UTG A;  2UUC E;  1N32 I;  4DR2 E;  4DU8 A;  1N34 E;  4B3S I;  2WW4 A;  4X64 I;  3T1Y E;  1N36 I;  4JI3 E;  4DV6 E;  2O1W A;  2UXC I;  1I94 E;  2O1V A;  3CWV A;  4EMD A;  5LL6 R;  1PKP A;  3T1H E;  2GQ0 A;  4Z7C A;  4JI6 E;  1KIJ A;  3OTO E;  1Z5B A;  2V34 A;  4B3S E;  3PRY A;  3V5R A;  4X64 E;  1UEK A;  4LFB I;  5FWK A;  1ZXN A;  2UXC E;  3J81 C;  1BKN A;  4LF4 E;  1RRE A;  5GMD A;  1FWK A;  5IWA E;  4JG4 A;  4HYM A;  2X7I A;  1XMO E;  1K47 A;  3WU6 A;  2O1T A;  1PIE A;  4DR4 E;  1FJG E;  2ZIT A;  1B62 A;  3K1J A;  4LF9 I;  3JAM Q;  4P7A A;  4JI4 I;  4DR5 I;  4DPW A;  3ZKB A;  2F4V E;  3K85 A;  1QZR A;  1ZM4 A;  4LF8 I;  1XNQ I;  1FWL A;  5LMN E;  4LF9 E;  1N33 I;  1NHI A;  4YHH E;  3ZZT A;  4X65 I;  1XNR E;  2HFU A;  2VF3 A;  2HK3 A;  4DV7 I;  4DR7 E;  4KQV A;  4AQY I;  4LF8 E;  4LF6 I;  2Z5E A;  1ZXM A;  4JI7 E;  4DPU A;  3F0N A;  5L3J A;  1EI1 A;  2BV3 A;  4WUD A;  1N33 E;  1MX0 A;  4JV5 E;  3ZM7 A;  4HY1 A;  4X65 E;  5FLX C;  4DV7 E;  4DR2 I;  3J81 Q;  1HNX I;  3PYD A;  2AJ4 A;  2R42 A;  1N34 I;  4AQY E;  4JI8 I;  3J7A M;  4HAC A;  2E5L E;  4JI3 I;  1Z0C A;  4DV6 I;  2HHH I;  4FWD A;  4DUY I;  3B82 A;  1B63 A;  4NXM E;  2DEI A;  4KHP I;  3T1H I;  2CG9 A;  4JI6 I;  3QT8 A;  1ZM3 A;  1HNX E;  3OTO I;  2HK2 A;  4JI0 I;  4MYT A;  1Y4U A;  1ZM9 A;  2UUB I;  4JI8 E;  3J80 C;  4DV5 I;  1VIS A;  2Q2E B;  2HHH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...