3P06A

Crystal structure of tellina virus 1 vp4 protease in the form of an intra-molecular(cis)acyl-enzyme complex.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
194
Chain Sequence
NGVELSAVGVLLPVLMDSGRRISGGAFMAVKGDLSEHIKNPKNTRIAQTVAGGTIYGLSEMVNIDEAEKLPIKGAITVLPVVQATATSILVPDNQPQLAFNSWEAAACAADTLESQQTPFLMVTGAVESGNLSPNLLAVQKQLLVAKPAGIGLAANSDRALKVVTLEQLRQVVGDKPWRKPMVTFSSGKNVAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VP4 protein
publication title Crystal Structure of a Viral Protease Intramolecular Acyl-enzyme Complex: INSIGHTS INTO cis-CLEAVAGE AT THE VP4/VP3 JUNCTION OF TELLINA BIRNAVIRUS.
pubmed doi rcsb
source organism Tellina virus 1
molecule tags Hydrolase
total genus 48
structure length 194
sequence length 194
ec nomenclature ec 3.4.21.115: Infectious pancreatic necrosis birnavirus Vp4 peptidase.
pdb deposition date 2010-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3p06A00
3P06A 4IZKB 4IZKA 2PNLA 4IZJA 4IZJD 4IZJB 2PNMA
chains in the Genus database with same CATH superfamily
5K36F 3ZM7A 4LFBI 3WU5A 3T1HI 3J80Q 1I94I 1UDNA 2A2DA 4DPYA 2ZBKB 4GQUA 4USKA 3L7ZB 4DR2I 3PYGA 4DV1I 4LF8E 4DV7I 4LF9E 4DR4E 3M85D 2UXDI 1Z5CA 4YY3I 2WP8A 2R3VA 5DROA 4X64E 5C0XB 4DR7E 4NXME 2UUBI 1Z0CA 4MQYA 4AM3A 3KRNA 4LPFA 4IFDD 2NN6B 4AQYE 5DNLA 1HNWE 4DV6I 4DU8A 3NZKA 1NHJA 1Z0TA 1OYPA 4DR5I 2UU9I 4DV5I 2VQFE 2ZM6E 4DR3E 4IFDE 1RHYA 4JI8I 1Z5BA 4LOMA 4DV0I 5IT9Q 4J3DA 5L3JA 4QNJA 4ZVIA 1H73A 2IOPA 1PIEA 1UDOA 5JEAA 3P3GA 1E3PA 5C0XC 2Z5CB 2BM0A 3K85A 3U1YA 2IOQA 4HYMA 1N0VC 4URLA 1FNMA 3WU6A 1UDQA 4OO1E 4JI4E 4P7AA 2BA0G 2NN6D 4Z7CA 2V8PA 2E1RA 2CVEA 4BA1A 4JI6I 2UXCE 1PKPA 4KHPE 4BA2A 4LCFA 2V2ZA 3CWVA 4ED4A 4X66E 4K0KI 2UXBE 3HKMA 1P42A 2C38B 4B3RE 4GKJI 4LFCE 4YHHI 3H1CA 4LF6E 1MG7A 3PYDA 4PRXA 4X65I 3U1KA 3K17A 4JV5E 1IBLI 2BR2A 5K36B 5FLXC 1OJ4A 4LFAE 2PNZB 4UTGA 1A6FA 4OX9E 2UUCE 2JEBA 1DARA 4KQVA 5A2QC 4JI1I 1ZM2A 4N3OA 2F1DA 2PNMA 4B3TI 5JEAE 2HHHE 1XNQI 1KIJA 4FW7A 4OZEA 1HNZE 5LMNE 2GO3A 4LF5E 5JEAF 1EA6A 4JI3E 1XMQE 4LCHA 1Z0VA 4IFDA 2BA1G 4LF8I 4DR4I 3D4JA 1R6LA 2C39B 3P3CA 1HR0E 2HK3A 4X64I 1Y6ZA 4DR7I 2HFSA 5DRPA 4NXMI 2NPFA 1H7SA 2BA1D 2C37B 4MU0A 3M85G 2JEAB 4DV2E 1Z0BA 1NHIA 1XXEA 4JYAE 4DPWA 4MU1A 1XHKA 3K1JA 3OTOE 4AQYI 2R42A 2Z5BA 1HNWI 4OO1A 4B3SE 3T1YE 1Y4UA 2VESA 1HNXE 4FW6A 3ZKDA 5LL6R 3DD6A 2PO2A 3PYFA 3GONA 2VQFI 2ZM6I 1VISA 2GS8A 1H7UA 4IZKB 4DUYE 4DR3I 1ELOA 4IZJD 2DEJA 3JAMQ 1IBKE 3J81Q 1N33E 1ZXNA 2AJ4A 1Z0GA 2X36A 2PNLA 4MYTA 4HY1A 3ZKBA 3M6AA 3M7NG 2WP8B 5IWAE 1U2RA 5EKWA 5A2QQ 4AIDA 4JI4I 1BKNA 4DU7A 2DEIA 1EI1A 2X7IA 3GCMA 2UXCI 3M7ND 4IFDC 4KHPI 3P06A 1H72C 4IFDF 2EFGA 1N34E 1ZXMA 2WW4A 5C0XD 4DUZE 4X66I 4LF7E 2UXBI 4B3RI 2VF3A 2JT2A 4FN5A 4LFCI 4FWHA 4LF6I 4DR6E 1B63A 5ELWA 1PVGA 2O3ZA 2WNRA 2OI2A 2PO1A 3B78A 3GLLA 4JV5I 1IBME 5EL9A 3ZZTA 1XMOE 4OO1C 4LFAI 3Q6MA 4NXNE 4OO1F 4X62E 1J5EE 2V34A 4DV3E 4OX9I 4JI7E 1Y4SA 5JEAB 2UUCI 3PS2A 1FWKA 2NN6E 4FW4A 4HACA 4EMDA 1VI7A 4I3HA 5LMUE 3J80C 4FW5A 2HHHI 1WUUA 4USMA 1UDSA 2JE6A 1HNZI 1Z0WA 1ZM3A 2PO0A 4U3BA 4BA1B 5LMNI 4LF5I 4DXLA 1N0UA 4BA2B 2LJPA 1XNRE 4JI3I 1XMQI 4PRVA 4MDTA 2HFUA 1FWLA 1HR0I 2BV3A 4LF4E 1USVA 4GKKE 2J65A 1S4EA 4JG4A 5BR8E 1OYSA 4DV2I 4IZJA 2UUAE 4XTJA 5JEAC 4DV4E 4JYAI 2BR2B 4OKGA 3OTOI 2E5LE 3WU4A 3ZZ0A 5DRRA 2JEBB 4B3SI 3T1YI 5IT9C 1N36E 3V2UC 4B3ME 1HNXI 5K36D 4DUYI 4RPFA 1NZ0A 1R6MA 5DNXA 1H74A 4MU4A 3LNUA 1IBKI 4JI5E 4DR1E 3PS1A 2V2QA 3L7ZA 1N33I 1FJGE 2VQEE 1Z59A 5K36E 4WUBA 4JI0E 1MU5A 4IFDB 2XEXA 5C0XA 1ZM4A 4DPTA 5IWAI 1KKHA 4PU9A 1Y60A 4FWDA 3V5RA 3CDIA 1UEKA 4FWGA 4NBQA 4ISAA 4FW3A 2HKJA 2NN6A 1N32E 3PS3A 3UHMA 2F4VE 4UT4A 4JI2E 5FWKA 1N34I 5FLXQ 2Z5BB 2BM1A 1S16A 3HJCA 4DUZI 4LF7I 4OO1B 1HK7A 1K47A 2O1VA 3Q1QA 4DR6I 2PO2B 2HKEA 4LFBE 3B82A 4P52A 3J7AG 3T1HE 3QT5A 1I94E 5GMEA 4DPUA 4M1KA 1IBMI 1XMOI 4DR2E 4DV1E 4NXNI 4DV7E 2Z5CA 4X62I 1J5EI 2UXDE 4DV3I 4WUCA 4YY3E 4JI7I 5DRQA 2A2CA 1D6TA 3QT7A 1RREA 4R1FA 2IESA 2UUBE 3J7AM 5LMUI 1YHCA 5C0XE 1NHHA 3GMEA 1QZRA 4OO1D 2V2VA 2Q2EB 3PRYA 1FKAE 2C38A 3LTOA 4DV6E 2O1WA 1Z5AA 1XNRI 4DR5E 5C0XF 3P3EA 2UU9E 2CGEA 4DV5E 1USUA 4JI8E 4DV0E 2Z5EA 4LF4I 4GKKI 5BR8I 2NN6C 2ZITA 5K36A 2NN6F 2WNRB 2CG9A 2PNZA 2PO1B 2UUAI 4LCGA 4DV4I 2O1UA 3CDJA 1Z0EA 2BA0D 2E5LI 3HULA 1MX0A 3P76A 4QNKA 1Y5YA 1N36I 3JAMC 4B3MI 4HACB 3LPSA 3B8HA 3J81C 1FI4A 1KTVA 1B62A 1OYRA 4JI6E 2JE6B 5JEAD 2HK2A 4JI5I 4DR1I 2PO0B 3ZZUA 1ZM9A 4K0KE 2AE8A 1FJGI 2J7KA 2VQEI 4GKJE 4HXZA 4Z7YA 3Q6NA 4JI0I 4WUDA 4YHHE 2C39A 3WU3A 4U3DA 2C37A 3B4TA 2JEAA 2IERA 1E3HA 4X65E 4AIMA 4MYUA 5GMDA 2CZ9A 1IBLE 1KVKA 3PYEA 2O1TA 1N32I 4FW9A 1YH8A 4IZJB 2GO4A 1RR9A 2F4VI 4JI2I 4LF9I 3QT6A 4JI1E 4B3TE 3H4LA 4IS9A 4DPXA 4IZKA 4MU3A 1XNQE 3F0NA 2GQ0A 5K36C 3QT8A
chains in the Genus database with same CATH topology
3ZM7A 4LFBI 3WU5A 3T1HI 3J80Q 1I94I 2A2DA 4DPYA 2ZBKB 4USKA 4DR2I 3PYGA 4DV1I 4LF8E 4DV7I 4LF9E 4DR4E 2UXDI 1Z5CA 4YY3I 2R3VA 4X64E 4DR7E 4NXME 2UUBI 1Z0CA 4AQYE 1HNWE 4DV6I 4DU8A 1NHJA 1Z0TA 4DR5I 2UU9I 4DV5I 2VQFE 2ZM6E 4DR3E 4JI8I 1Z5BA 4DV0I 5IT9Q 5L3JA 4ZVIA 1H73A 2IOPA 1PIEA 2Z5CB 2BM0A 3K85A 2IOQA 4HYMA 1N0VC 4URLA 1FNMA 3WU6A 4JI4E 4P7AA 4Z7CA 2V8PA 2E1RA 4JI6I 2UXCE 1PKPA 4KHPE 2V2ZA 3CWVA 4ED4A 4X66E 4K0KI 2UXBE 4B3RE 4GKJI 4LFCE 4YHHI 4LF6E 1MG7A 3PYDA 4PRXA 4X65I 3K17A 4JV5E 1IBLI 5FLXC 1OJ4A 4LFAE 4UTGA 1A6FA 4OX9E 2UUCE 1DARA 4KQVA 5A2QC 4JI1I 1ZM2A 4N3OA 4B3TI 2PNMA 2HHHE 1XNQI 1KIJA 1HNZE 5LMNE 4LF5E 1EA6A 4JI3E 1XMQE 1Z0VA 4LF8I 4DR4I 3D4JA 1HR0E 2HK3A 4X64I 1Y6ZA 4DR7I 2HFSA 4NXMI 2NPFA 1H7SA 4DV2E 1Z0BA 1NHIA 4JYAE 4DPWA 1XHKA 3K1JA 3OTOE 4AQYI 2R42A 2Z5BA 1HNWI 4B3SE 3T1YE 1Y4UA 1HNXE 3ZKDA 5LL6R 3GONA 3PYFA 2VQFI 2ZM6I 1VISA 2GS8A 1H7UA 4IZKB 4DUYE 4DR3I 1ELOA 4IZJD 2DEJA 3JAMQ 1IBKE 3J81Q 1N33E 1ZXNA 2AJ4A 1Z0GA 2X36A 2PNLA 4MYTA 4HY1A 3ZKBA 3M6AA 5IWAE 1U2RA 5A2QQ 4JI4I 1BKNA 4DU7A 2DEIA 1EI1A 2X7IA 2UXCI 4KHPI 3P06A 1H72C 2EFGA 1N34E 1ZXMA 2WW4A 4DUZE 4X66I 4LF7E 2UXBI 4B3RI 2VF3A 4FN5A 4LFCI 4FWHA 4LF6I 4DR6E 1B63A 1PVGA 2OI2A 3B78A 4JV5I 1IBME 3ZZTA 1XMOE 4LFAI 3Q6MA 4NXNE 4X62E 1J5EE 2V34A 4DV3E 4OX9I 4JI7E 1Y4SA 2UUCI 1FWKA 4HACA 4EMDA 4I3HA 5LMUE 3J80C 2HHHI 1WUUA 4USMA 1HNZI 1Z0WA 1ZM3A 5LMNI 4LF5I 4DXLA 1N0UA 2LJPA 1XNRE 4JI3I 1XMQI 4PRVA 2HFUA 1FWLA 1HR0I 2BV3A 4LF4E 1USVA 4GKKE 1S4EA 4JG4A 5BR8E 4DV2I 4IZJA 2UUAE 4XTJA 4JYAI 4DV4E 3OTOI 2E5LE 3WU4A 3ZZ0A 4B3SI 3T1YI 5IT9C 1N36E 3V2UC 4B3ME 1HNXI 4DUYI 4RPFA 1NZ0A 1H74A 3LNUA 1IBKI 4JI5E 4DR1E 2V2QA 1N33I 1FJGE 2VQEE 1Z59A 4WUBA 4JI0E 1MU5A 2XEXA 1ZM4A 4DPTA 5IWAI 1KKHA 4PU9A 4FWDA 3V5RA 1UEKA 4FWGA 2HKJA 1N32E 2F4VE 4UT4A 4JI2E 5FWKA 1N34I 5FLXQ 2Z5BB 2BM1A 1S16A 3HJCA 4DUZI 4LF7I 1HK7A 1K47A 2O1VA 3Q1QA 4DR6I 2HKEA 4LFBE 3B82A 4P52A 3J7AG 3T1HE 3QT5A 1I94E 5GMEA 4DPUA 4M1KA 1IBMI 1XMOI 4DR2E 4DV1E 4NXNI 4DV7E 2Z5CA 4X62I 1J5EI 2UXDE 4DV3I 4WUCA 4YY3E 4JI7I 2A2CA 1D6TA 3QT7A 1RREA 4R1FA 2UUBE 3J7AM 5LMUI 1NHHA 1QZRA 2V2VA 2Q2EB 3PRYA 1FKAE 4DV6E 3LTOA 2O1WA 1Z5AA 1XNRI 4DR5E 2UU9E 2CGEA 4DV5E 1USUA 4JI8E 4DV0E 2Z5EA 4LF4I 4GKKI 5BR8I 2ZITA 2CG9A 2UUAI 4DV4I 2O1UA 1Z0EA 2E5LI 3HULA 1MX0A 1N36I 3JAMC 4B3MI 4HACB 3LPSA 3B8HA 3J81C 1FI4A 1KTVA 1B62A 4JI6E 2HK2A 4JI5I 4DR1I 3ZZUA 1ZM9A 4K0KE 1FJGI 2J7KA 2VQEI 4GKJE 4HXZA 4Z7YA 3Q6NA 4JI0I 4WUDA 4YHHE 3WU3A 4X65E 4MYUA 5GMDA 2CZ9A 1IBLE 1KVKA 3PYEA 2O1TA 1N32I 4FW9A 4IZJB 1RR9A 2F4VI 4JI2I 4LF9I 3QT6A 4JI1E 4B3TE 3H4LA 4DPXA 4IZKA 1XNQE 3F0NA 2GQ0A 3QT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P06 A;  4IZK B;  4IZK A;  2PNL A;  4IZJ A;  4IZJ D;  4IZJ B;  2PNM A; 
#chains in the Genus database with same CATH topology
 5K36 F;  3ZM7 A;  4LFB I;  3WU5 A;  3T1H I;  3J80 Q;  1I94 I;  1UDN A;  2A2D A;  4DPY A;  2ZBK B;  4GQU A;  4USK A;  3L7Z B;  4DR2 I;  3PYG A;  4DV1 I;  4LF8 E;  4DV7 I;  4LF9 E;  4DR4 E;  3M85 D;  2UXD I;  1Z5C A;  4YY3 I;  2WP8 A;  2R3V A;  5DRO A;  4X64 E;  5C0X B;  4DR7 E;  4NXM E;  2UUB I;  1Z0C A;  4MQY A;  4AM3 A;  3KRN A;  4LPF A;  4IFD D;  2NN6 B;  4AQY E;  5DNL A;  1HNW E;  4DV6 I;  4DU8 A;  3NZK A;  1NHJ A;  1Z0T A;  1OYP A;  4DR5 I;  2UU9 I;  4DV5 I;  2VQF E;  2ZM6 E;  4DR3 E;  4IFD E;  1RHY A;  4JI8 I;  1Z5B A;  4LOM A;  4DV0 I;  5IT9 Q;  4J3D A;  5L3J A;  4QNJ A;  4ZVI A;  1H73 A;  2IOP A;  1PIE A;  1UDO A;  5JEA A;  3P3G A;  1E3P A;  5C0X C;  2Z5C B;  2BM0 A;  3K85 A;  3U1Y A;  2IOQ A;  4HYM A;  1N0V C;  4URL A;  1FNM A;  3WU6 A;  1UDQ A;  4OO1 E;  4JI4 E;  4P7A A;  2BA0 G;  2NN6 D;  4Z7C A;  2V8P A;  2E1R A;  2CVE A;  4BA1 A;  4JI6 I;  2UXC E;  1PKP A;  4KHP E;  4BA2 A;  4LCF A;  2V2Z A;  3CWV A;  4ED4 A;  4X66 E;  4K0K I;  2UXB E;  3HKM A;  1P42 A;  2C38 B;  4B3R E;  4GKJ I;  4LFC E;  4YHH I;  3H1C A;  4LF6 E;  1MG7 A;  3PYD A;  4PRX A;  4X65 I;  3U1K A;  3K17 A;  4JV5 E;  1IBL I;  2BR2 A;  5K36 B;  5FLX C;  1OJ4 A;  4LFA E;  2PNZ B;  4UTG A;  1A6F A;  4OX9 E;  2UUC E;  2JEB A;  1DAR A;  4KQV A;  5A2Q C;  4JI1 I;  1ZM2 A;  4N3O A;  2F1D A;  2PNM A;  4B3T I;  5JEA E;  2HHH E;  1XNQ I;  1KIJ A;  4FW7 A;  4OZE A;  1HNZ E;  5LMN E;  2GO3 A;  4LF5 E;  5JEA F;  1EA6 A;  4JI3 E;  1XMQ E;  4LCH A;  1Z0V A;  4IFD A;  2BA1 G;  4LF8 I;  4DR4 I;  3D4J A;  1R6L A;  2C39 B;  3P3C A;  1HR0 E;  2HK3 A;  4X64 I;  1Y6Z A;  4DR7 I;  2HFS A;  5DRP A;  4NXM I;  2NPF A;  1H7S A;  2BA1 D;  2C37 B;  4MU0 A;  3M85 G;  2JEA B;  4DV2 E;  1Z0B A;  1NHI A;  1XXE A;  4JYA E;  4DPW A;  4MU1 A;  1XHK A;  3K1J A;  3OTO E;  4AQY I;  2R42 A;  2Z5B A;  1HNW I;  4OO1 A;  4B3S E;  3T1Y E;  1Y4U A;  2VES A;  1HNX E;  4FW6 A;  3ZKD A;  5LL6 R;  3DD6 A;  2PO2 A;  3PYF A;  3GON A;  2VQF I;  2ZM6 I;  1VIS A;  2GS8 A;  1H7U A;  4IZK B;  4DUY E;  4DR3 I;  1ELO A;  4IZJ D;  2DEJ A;  3JAM Q;  1IBK E;  3J81 Q;  1N33 E;  1ZXN A;  2AJ4 A;  1Z0G A;  2X36 A;  2PNL A;  4MYT A;  4HY1 A;  3ZKB A;  3M6A A;  3M7N G;  2WP8 B;  5IWA E;  1U2R A;  5EKW A;  5A2Q Q;  4AID A;  4JI4 I;  1BKN A;  4DU7 A;  2DEI A;  1EI1 A;  2X7I A;  3GCM A;  2UXC I;  3M7N D;  4IFD C;  4KHP I;  3P06 A;  1H72 C;  4IFD F;  2EFG A;  1N34 E;  1ZXM A;  2WW4 A;  5C0X D;  4DUZ E;  4X66 I;  4LF7 E;  2UXB I;  4B3R I;  2VF3 A;  2JT2 A;  4FN5 A;  4LFC I;  4FWH A;  4LF6 I;  4DR6 E;  1B63 A;  5ELW A;  1PVG A;  2O3Z A;  2WNR A;  2OI2 A;  2PO1 A;  3B78 A;  3GLL A;  4JV5 I;  1IBM E;  5EL9 A;  3ZZT A;  1XMO E;  4OO1 C;  4LFA I;  3Q6M A;  4NXN E;  4OO1 F;  4X62 E;  1J5E E;  2V34 A;  4DV3 E;  4OX9 I;  4JI7 E;  1Y4S A;  5JEA B;  2UUC I;  3PS2 A;  1FWK A;  2NN6 E;  4FW4 A;  4HAC A;  4EMD A;  1VI7 A;  4I3H A;  5LMU E;  3J80 C;  4FW5 A;  2HHH I;  1WUU A;  4USM A;  1UDS A;  2JE6 A;  1HNZ I;  1Z0W A;  1ZM3 A;  2PO0 A;  4U3B A;  4BA1 B;  5LMN I;  4LF5 I;  4DXL A;  1N0U A;  4BA2 B;  2LJP A;  1XNR E;  4JI3 I;  1XMQ I;  4PRV A;  4MDT A;  2HFU A;  1FWL A;  1HR0 I;  2BV3 A;  4LF4 E;  1USV A;  4GKK E;  2J65 A;  1S4E A;  4JG4 A;  5BR8 E;  1OYS A;  4DV2 I;  4IZJ A;  2UUA E;  4XTJ A;  5JEA C;  4DV4 E;  4JYA I;  2BR2 B;  4OKG A;  3OTO I;  2E5L E;  3WU4 A;  3ZZ0 A;  5DRR A;  2JEB B;  4B3S I;  3T1Y I;  5IT9 C;  1N36 E;  3V2U C;  4B3M E;  1HNX I;  5K36 D;  4DUY I;  4RPF A;  1NZ0 A;  1R6M A;  5DNX A;  1H74 A;  4MU4 A;  3LNU A;  1IBK I;  4JI5 E;  4DR1 E;  3PS1 A;  2V2Q A;  3L7Z A;  1N33 I;  1FJG E;  2VQE E;  1Z59 A;  5K36 E;  4WUB A;  4JI0 E;  1MU5 A;  4IFD B;  2XEX A;  5C0X A;  1ZM4 A;  4DPT A;  5IWA I;  1KKH A;  4PU9 A;  1Y60 A;  4FWD A;  3V5R A;  3CDI A;  1UEK A;  4FWG A;  4NBQ A;  4ISA A;  4FW3 A;  2HKJ A;  2NN6 A;  1N32 E;  3PS3 A;  3UHM A;  2F4V E;  4UT4 A;  4JI2 E;  5FWK A;  1N34 I;  5FLX Q;  2Z5B B;  2BM1 A;  1S16 A;  3HJC A;  4DUZ I;  4LF7 I;  4OO1 B;  1HK7 A;  1K47 A;  2O1V A;  3Q1Q A;  4DR6 I;  2PO2 B;  2HKE A;  4LFB E;  3B82 A;  4P52 A;  3J7A G;  3T1H E;  3QT5 A;  1I94 E;  5GME A;  4DPU A;  4M1K A;  1IBM I;  1XMO I;  4DR2 E;  4DV1 E;  4NXN I;  4DV7 E;  2Z5C A;  4X62 I;  1J5E I;  2UXD E;  4DV3 I;  4WUC A;  4YY3 E;  4JI7 I;  5DRQ A;  2A2C A;  1D6T A;  3QT7 A;  1RRE A;  4R1F A;  2IES A;  2UUB E;  3J7A M;  5LMU I;  1YHC A;  5C0X E;  1NHH A;  3GME A;  1QZR A;  4OO1 D;  2V2V A;  2Q2E B;  3PRY A;  1FKA E;  2C38 A;  3LTO A;  4DV6 E;  2O1W A;  1Z5A A;  1XNR I;  4DR5 E;  5C0X F;  3P3E A;  2UU9 E;  2CGE A;  4DV5 E;  1USU A;  4JI8 E;  4DV0 E;  2Z5E A;  4LF4 I;  4GKK I;  5BR8 I;  2NN6 C;  2ZIT A;  5K36 A;  2NN6 F;  2WNR B;  2CG9 A;  2PNZ A;  2PO1 B;  2UUA I;  4LCG A;  4DV4 I;  2O1U A;  3CDJ A;  1Z0E A;  2BA0 D;  2E5L I;  3HUL A;  1MX0 A;  3P76 A;  4QNK A;  1Y5Y A;  1N36 I;  3JAM C;  4B3M I;  4HAC B;  3LPS A;  3B8H A;  3J81 C;  1FI4 A;  1KTV A;  1B62 A;  1OYR A;  4JI6 E;  2JE6 B;  5JEA D;  2HK2 A;  4JI5 I;  4DR1 I;  2PO0 B;  3ZZU A;  1ZM9 A;  4K0K E;  2AE8 A;  1FJG I;  2J7K A;  2VQE I;  4GKJ E;  4HXZ A;  4Z7Y A;  3Q6N A;  4JI0 I;  4WUD A;  4YHH E;  2C39 A;  3WU3 A;  4U3D A;  2C37 A;  3B4T A;  2JEA A;  2IER A;  1E3H A;  4X65 E;  4AIM A;  4MYU A;  5GMD A;  2CZ9 A;  1IBL E;  1KVK A;  3PYE A;  2O1T A;  1N32 I;  4FW9 A;  1YH8 A;  4IZJ B;  2GO4 A;  1RR9 A;  2F4V I;  4JI2 I;  4LF9 I;  3QT6 A;  4JI1 E;  4B3T E;  3H4L A;  4IS9 A;  4DPX A;  4IZK A;  4MU3 A;  1XNQ E;  3F0N A;  2GQ0 A;  5K36 C;  3QT8 A; 
#chains in the Genus database with same CATH homology
 3ZM7 A;  4LFB I;  3WU5 A;  3T1H I;  3J80 Q;  1I94 I;  2A2D A;  4DPY A;  2ZBK B;  4USK A;  4DR2 I;  3PYG A;  4DV1 I;  4LF8 E;  4DV7 I;  4LF9 E;  4DR4 E;  2UXD I;  1Z5C A;  4YY3 I;  2R3V A;  4X64 E;  4DR7 E;  4NXM E;  2UUB I;  1Z0C A;  4AQY E;  1HNW E;  4DV6 I;  4DU8 A;  1NHJ A;  1Z0T A;  4DR5 I;  2UU9 I;  4DV5 I;  2VQF E;  2ZM6 E;  4DR3 E;  4JI8 I;  1Z5B A;  4DV0 I;  5IT9 Q;  5L3J A;  4ZVI A;  1H73 A;  2IOP A;  1PIE A;  2Z5C B;  2BM0 A;  3K85 A;  2IOQ A;  4HYM A;  1N0V C;  4URL A;  1FNM A;  3WU6 A;  4JI4 E;  4P7A A;  4Z7C A;  2V8P A;  2E1R A;  4JI6 I;  2UXC E;  1PKP A;  4KHP E;  2V2Z A;  3CWV A;  4ED4 A;  4X66 E;  4K0K I;  2UXB E;  4B3R E;  4GKJ I;  4LFC E;  4YHH I;  4LF6 E;  1MG7 A;  3PYD A;  4PRX A;  4X65 I;  3K17 A;  4JV5 E;  1IBL I;  5FLX C;  1OJ4 A;  4LFA E;  4UTG A;  1A6F A;  4OX9 E;  2UUC E;  1DAR A;  4KQV A;  5A2Q C;  4JI1 I;  1ZM2 A;  4N3O A;  4B3T I;  2PNM A;  2HHH E;  1XNQ I;  1KIJ A;  1HNZ E;  5LMN E;  4LF5 E;  1EA6 A;  4JI3 E;  1XMQ E;  1Z0V A;  4LF8 I;  4DR4 I;  3D4J A;  1HR0 E;  2HK3 A;  4X64 I;  1Y6Z A;  4DR7 I;  2HFS A;  4NXM I;  2NPF A;  1H7S A;  4DV2 E;  1Z0B A;  1NHI A;  4JYA E;  4DPW A;  1XHK A;  3K1J A;  3OTO E;  4AQY I;  2R42 A;  2Z5B A;  1HNW I;  4B3S E;  3T1Y E;  1Y4U A;  1HNX E;  3ZKD A;  5LL6 R;  3GON A;  3PYF A;  2VQF I;  2ZM6 I;  1VIS A;  2GS8 A;  1H7U A;  4IZK B;  4DUY E;  4DR3 I;  1ELO A;  4IZJ D;  2DEJ A;  3JAM Q;  1IBK E;  3J81 Q;  1N33 E;  1ZXN A;  2AJ4 A;  1Z0G A;  2X36 A;  2PNL A;  4MYT A;  4HY1 A;  3ZKB A;  3M6A A;  5IWA E;  1U2R A;  5A2Q Q;  4JI4 I;  1BKN A;  4DU7 A;  2DEI A;  1EI1 A;  2X7I A;  2UXC I;  4KHP I;  3P06 A;  1H72 C;  2EFG A;  1N34 E;  1ZXM A;  2WW4 A;  4DUZ E;  4X66 I;  4LF7 E;  2UXB I;  4B3R I;  2VF3 A;  4FN5 A;  4LFC I;  4FWH A;  4LF6 I;  4DR6 E;  1B63 A;  1PVG A;  2OI2 A;  3B78 A;  4JV5 I;  1IBM E;  3ZZT A;  1XMO E;  4LFA I;  3Q6M A;  4NXN E;  4X62 E;  1J5E E;  2V34 A;  4DV3 E;  4OX9 I;  4JI7 E;  1Y4S A;  2UUC I;  1FWK A;  4HAC A;  4EMD A;  4I3H A;  5LMU E;  3J80 C;  2HHH I;  1WUU A;  4USM A;  1HNZ I;  1Z0W A;  1ZM3 A;  5LMN I;  4LF5 I;  4DXL A;  1N0U A;  2LJP A;  1XNR E;  4JI3 I;  1XMQ I;  4PRV A;  2HFU A;  1FWL A;  1HR0 I;  2BV3 A;  4LF4 E;  1USV A;  4GKK E;  1S4E A;  4JG4 A;  5BR8 E;  4DV2 I;  4IZJ A;  2UUA E;  4XTJ A;  4JYA I;  4DV4 E;  3OTO I;  2E5L E;  3WU4 A;  3ZZ0 A;  4B3S I;  3T1Y I;  5IT9 C;  1N36 E;  3V2U C;  4B3M E;  1HNX I;  4DUY I;  4RPF A;  1NZ0 A;  1H74 A;  3LNU A;  1IBK I;  4JI5 E;  4DR1 E;  2V2Q A;  1N33 I;  1FJG E;  2VQE E;  1Z59 A;  4WUB A;  4JI0 E;  1MU5 A;  2XEX A;  1ZM4 A;  4DPT A;  5IWA I;  1KKH A;  4PU9 A;  4FWD A;  3V5R A;  1UEK A;  4FWG A;  2HKJ A;  1N32 E;  2F4V E;  4UT4 A;  4JI2 E;  5FWK A;  1N34 I;  5FLX Q;  2Z5B B;  2BM1 A;  1S16 A;  3HJC A;  4DUZ I;  4LF7 I;  1HK7 A;  1K47 A;  2O1V A;  3Q1Q A;  4DR6 I;  2HKE A;  4LFB E;  3B82 A;  4P52 A;  3J7A G;  3T1H E;  3QT5 A;  1I94 E;  5GME A;  4DPU A;  4M1K A;  1IBM I;  1XMO I;  4DR2 E;  4DV1 E;  4NXN I;  4DV7 E;  2Z5C A;  4X62 I;  1J5E I;  2UXD E;  4DV3 I;  4WUC A;  4YY3 E;  4JI7 I;  2A2C A;  1D6T A;  3QT7 A;  1RRE A;  4R1F A;  2UUB E;  3J7A M;  5LMU I;  1NHH A;  1QZR A;  2V2V A;  2Q2E B;  3PRY A;  1FKA E;  4DV6 E;  3LTO A;  2O1W A;  1Z5A A;  1XNR I;  4DR5 E;  2UU9 E;  2CGE A;  4DV5 E;  1USU A;  4JI8 E;  4DV0 E;  2Z5E A;  4LF4 I;  4GKK I;  5BR8 I;  2ZIT A;  2CG9 A;  2UUA I;  4DV4 I;  2O1U A;  1Z0E A;  2E5L I;  3HUL A;  1MX0 A;  1N36 I;  3JAM C;  4B3M I;  4HAC B;  3LPS A;  3B8H A;  3J81 C;  1FI4 A;  1KTV A;  1B62 A;  4JI6 E;  2HK2 A;  4JI5 I;  4DR1 I;  3ZZU A;  1ZM9 A;  4K0K E;  1FJG I;  2J7K A;  2VQE I;  4GKJ E;  4HXZ A;  4Z7Y A;  3Q6N A;  4JI0 I;  4WUD A;  4YHH E;  3WU3 A;  4X65 E;  4MYU A;  5GMD A;  2CZ9 A;  1IBL E;  1KVK A;  3PYE A;  2O1T A;  1N32 I;  4FW9 A;  4IZJ B;  1RR9 A;  2F4V I;  4JI2 I;  4LF9 I;  3QT6 A;  4JI1 E;  4B3T E;  3H4L A;  4DPX A;  4IZK A;  1XNQ E;  3F0N A;  2GQ0 A;  3QT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...