3P06A

Crystal structure of tellina virus 1 vp4 protease in the form of an intra-molecular(cis)acyl-enzyme complex.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
194
Chain Sequence
NGVELSAVGVLLPVLMDSGRRISGGAFMAVKGDLSEHIKNPKNTRIAQTVAGGTIYGLSEMVNIDEAEKLPIKGAITVLPVVQATATSILVPDNQPQLAFNSWEAAACAADTLESQQTPFLMVTGAVESGNLSPNLLAVQKQLLVAKPAGIGLAANSDRALKVVTLEQLRQVVGDKPWRKPMVTFSSGKNVAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of a Viral Protease Intramolecular Acyl-enzyme Complex: INSIGHTS INTO cis-CLEAVAGE AT THE VP4/VP3 JUNCTION OF TELLINA BIRNAVIRUS.
pubmed doi rcsb
source organism Tellina virus 1
molecule tags Hydrolase
molecule keywords VP4 protein
total genus 48
structure length 194
sequence length 194
ec nomenclature ec 3.4.21.115: Infectious pancreatic necrosis birnavirus Vp4 peptidase.
pdb deposition date 2010-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3p06A00
2PNLA 4IZJB 2PNMA 4IZJA 4IZKB 3P06A 4IZJD 4IZKA
chains in the Genus database with same CATH superfamily
2NN6C 4LFBE 3CDJA 4DR2I 5FLXC 5C0XB 4DR3I 3UHMA 2UXDE 3P06A 5C0XD 2UXBE 1K47A 1HNXI 4B3ME 4LF7I 4JYAI 3CWVA 3B78A 4AM3A 2V2ZA 4K0KI 1IBKI 2PO2A 2O1UA 3GCMA 4DV2E 4UT4A 4MU3A 3PS3A 1Z59A 1YH8A 4JI3I 4LFAE 2PNZB 2ZBKB 2XEXA 1FWKA 3HJCA 3WU3A 4YY3E 4IZJA 1N33E 3B82A 2VQFI 4GQUA 3DD6A 4IZKA 2Z5EA 2LJPA 1S16A 4LF8E 5JEAD 4JV5E 2C39A 4DPUA 4IFDA 1B62A 4MU0A 2HK2A 2VQFE 2HFUA 4NXMI 2HFSA 4DR6E 2IOQA 5K36B 2IESA 2UXBI 4DPXA 5IT9C 2C37B 1HNWI 4JI7I 3L7ZA 1Y4UA 2V34A 1OYPA 4AIMA 2UXDI 1Z0WA 1I94E 3GLLA 1WUUA 4LFCI 1UDQA 5BR8E 2UUAI 2DEIA 1ZXNA 4LF4I 4FW5A 3WU6A 1Y60A 5FWKA 4LF9I 2BR2B 1XNQE 4DR3E 1IBMI 4ISAA 3ZZ0A 4KQVA 4DV5E 4JI5E 5C0XF 4BA2B 3J80Q 4OO1D 5LMNE 1P42A 3T1HE 1I94I 5JEAC 4DUZE 2AE8A 3U1KA 4LCFA 4JI8I 3L7ZB 5LMUE 2V2VA 4KHPI 2Z5CA 4DPTA 3T1YE 4K0KE 4LF6I 5K36A 4B3TE 1DARA 2UU9I 2R3VA 4FW3A 5DNLA 2J65A 4HACA 3U1YA 4B3RI 2PO0A 2E5LI 2A2CA 2DEJA 3Q6MA 4ZVIA 4QNJA 1U2RA 4LF9E 4FW4A 1Y6ZA 4FW7A 4LCHA 4OZEA 1E3HA 1Y5YA 4U3BA 5C0XC 2JEBA 4DV6I 4JI4E 4X66E 1FJGE 4ED4A 2CGEA 2JE6A 4NXNE 2R42A 4DV2I 4LF7E 3J7AG 4JI4I 4DUZI 1R6MA 2BA1G 4JI1I 4OKGA 4FWDA 3OTOI 1N0UA 5LMUI 4DV5I 1ZM4A 4PRVA 2NN6E 4DR1E 1UEKA 3QT5A 3J81C 1OYRA 1NHJA 2UUCI 2C38A 3K85A 4FWHA 4IFDC 5BR8I 4MYTA 4N3OA 4KHPE 4JI6I 4DUYE 2ZITA 4DV0I 2JEAA 5JEAF 1NHHA 4DV4E 4FW9A 4UTGA 1YHCA 4HY1A 1XMQE 4I3HA 3JAMC 4DV1I 4JI0I 4DV7E 2A2DA 1XMQI 4Z7YA 4NBQA 1Z0TA 1Z0GA 2Z5BB 1J5EI 1IBLI 4DV6E 1KIJA 4BA2A 4DXLA 1N32E 1PKPA 2O1WA 5EKWA 1S4EA 2BA1D 4LF5E 2UXCE 4OX9E 1HR0E 4DR7I 4OO1F 4DR4E 2NN6A 3PS1A 1A6FA 4GKJI 1QZRA 1UDOA 5A2QQ 2BM1A 2HHHI 2UUBE 2X36A 5IWAE 4MQYA 1Z5CA 4LF5I 2UXCI 1Z0EA 4IZJD 2WNRB 2IOPA 5K36C 5A2QC 2Q2EB 4LCGA 1KKHA 4DUYI 1Z0BA 4IZJB 3V2UC 2JEAB 2UUBI 3PYGA 5DRRA 4X66I 1FJGI 2GS8A 4FN5A 3ZZTA 4R1FA 1H7SA 5DRQA 2VF3A 2PO1A 5L3JA 1OJ4A 3J7AM 1PVGA 2PO2B 4DV1E 4X64I 4BA1B 4IFDE 4FWGA 4U3DA 4JI6E 2ZM6I 4DU7A 4M1KA 1MX0A 1IBKE 4RPFA 3NZKA 2BA0G 1MU5A 4OO1A 4HYMA 2HKEA 4LF8I 4FW6A 2NN6F 3K1JA 1XNRE 2E1RA 2HHHE 1NHIA 2PO1B 2JE6B 4JI2E 2VESA 5GMDA 2OI2A 2UUCE 4JI1E 3PRYA 1N0VC 3GONA 4JG4A 2CZ9A 2X7IA 2IERA 3B8HA 1RHYA 2CG9A 1N33I 4LFBI 4MU4A 2UUAE 2WP8B 3HKMA 3QT6A 1Y4SA 4DR5I 2GO3A 1N34I 5GMEA 1RREA 4WUBA 2E5LE 1BKNA 1IBLE 2J7KA 4X62I 4USMA 4JI5I 1VI7A 2O3ZA 3ZZUA 1XNRI 1MG7A 3B4TA 1FKAE 4B3RE 1UDNA 1XNQI 2HKJA 2NN6B 3ZKBA 1J5EE 4DR1I 3P3GA 4DPYA 2O1TA 5K36D 5C0XE 4AIDA 4IFDF 4DU8A 5LMNI 1Z0CA 2BR2A 4YY3I 4PRXA 2F1DA 4DV3E 1XMOE 4JI3E 1HR0I 5IT9Q 4OO1E 3PYDA 1VISA 3CDIA 4Z7CA 3PYEA 3T1YI 5FLXQ 4GKKE 3P76A 3M85G 4JI8E 2AJ4A 4NXNI 4YHHE 2HK3A 4B3SE 5JEAE 4XTJA 2C39B 3QT7A 4LFCE 4IFDB 1USVA 2CVEA 4DV4I 2GO4A 4IZKB 4DR2E 1HK7A 1USUA 3F0NA 1D6TA 1KTVA 2PNZA 4OX9I 4IS9A 3V5RA 3D4JA 1N34E 1RR9A 1R6LA 4LF4E 2WW4A 3LNUA 2C38B 4GKJE 4JYAE 3LPSA 1Z0VA 4OO1B 2JT2A 3K17A 2V2QA 4URLA 4GKKI 1OYSA 1E3PA 1ELOA 2EFGA 4HXZA 5K36E 2NN6D 3LTOA 2BM0A 5C0XA 2VQEI 4X65I 4BA1A 2GQ0A 3Q1QA 3J81Q 5IWAI 4DR4I 4DV7I 1H7UA 2PNMA 3M7NG 2JEBB 3H4LA 3T1HI 1N32I 4X62E 2O1VA 3KRNA 1XXEA 4JI0E 1ZXMA 1FNMA 4X65E 2PO0B 1N36E 1HNZI 4HACB 2WNRA 4DPWA 4P52A 4JI2I 4JI7E 3PS2A 2Z5CB 4USKA 5JEAB 3HULA 1UDSA 3Q6NA 2BA0D 5DROA 3M6AA 3P3EA 4DV3I 1XMOI 5EL9A 4B3TI 4JV5I 4MYUA 3M85D 3M7ND 2ZM6E 4B3SI 4MU1A 5K36F 4IFDD 3ZM7A 4LOMA 4MDTA 1B63A 1FI4A 2VQEE 5DNXA 3QT8A 1KVKA 3JAMQ 4YHHI 3ZKDA 4LFAI 3GMEA 4X64E 2Z5BA 1Z5BA 4DR5E 2V8PA 4EMDA 1PIEA 1HNXE 5DRPA 4B3MI 1NZ0A 3PYFA 3OTOE 2BV3A 5ELWA 4OO1C 4P7AA 5JEAA 2C37A 1H73A 3P3CA 1N36I 1Z5AA 2NPFA 1HNZE 4AQYI 1EI1A 3WU5A 4NXME 4DR6I 1EA6A 2WP8A 4DV0E 1XHKA 4AQYE 3H1CA 4LF6E 1ZM2A 3WU4A 1HNWE 4LPFA 2F4VI 4WUCA 2PNLA 1H72C 1ZM9A 3J80C 2F4VE 1H74A 4J3DA 1IBME 4DR7E 4PU9A 1FWLA 1ZM3A 4QNKA 4WUDA 2UU9E 5LL6R
chains in the Genus database with same CATH topology
4LFBE 4DR2I 5FLXC 4DR3I 2UXDE 2UXBE 3P06A 1K47A 1HNXI 4B3ME 4LF7I 4JYAI 3CWVA 3B78A 2V2ZA 4K0KI 1IBKI 2O1UA 4DV2E 4UT4A 1Z59A 4JI3I 4LFAE 2ZBKB 2XEXA 1FWKA 3HJCA 3WU3A 4YY3E 4IZJA 1N33E 3B82A 2VQFI 4IZKA 2Z5EA 2LJPA 1S16A 4LF8E 4JV5E 4DPUA 1B62A 2HK2A 2VQFE 2HFUA 4NXMI 2HFSA 4DR6E 2IOQA 2UXBI 4DPXA 5IT9C 1HNWI 4JI7I 1Y4UA 2V34A 2UXDI 1Z0WA 1I94E 1WUUA 4LFCI 5BR8E 2UUAI 2DEIA 1ZXNA 4LF4I 3WU6A 4LF9I 5FWKA 1XNQE 4DR3E 1IBMI 3ZZ0A 4KQVA 4DV5E 4JI5E 3J80Q 5LMNE 3T1HE 1I94I 4DUZE 4JI8I 5LMUE 2V2VA 4KHPI 2Z5CA 4DPTA 3T1YE 4K0KE 4LF6I 4B3TE 1DARA 2UU9I 2R3VA 4HACA 4B3RI 2E5LI 2A2CA 2DEJA 3Q6MA 4ZVIA 1U2RA 4LF9E 1Y6ZA 4DV6I 4JI4E 4X66E 1FJGE 4ED4A 2CGEA 4NXNE 2R42A 4DV2I 4LF7E 3J7AG 4JI4I 4DUZI 4JI1I 4FWDA 3OTOI 1N0UA 5LMUI 4DV5I 1ZM4A 4PRVA 4DR1E 1UEKA 3QT5A 3J81C 1NHJA 2UUCI 3K85A 4FWHA 5BR8I 4MYTA 4N3OA 4KHPE 4JI6I 4DUYE 2ZITA 4DV0I 1NHHA 4DV4E 4FW9A 4UTGA 4HY1A 1XMQE 4I3HA 3JAMC 4DV1I 4JI0I 4DV7E 2A2DA 1XMQI 4Z7YA 1Z0TA 1Z0GA 2Z5BB 1J5EI 1IBLI 4DV6E 1KIJA 4DXLA 1N32E 1PKPA 2O1WA 1S4EA 4LF5E 2UXCE 4OX9E 1HR0E 4DR7I 4DR4E 1A6FA 4GKJI 1QZRA 5A2QQ 2BM1A 2HHHI 2UUBE 2X36A 5IWAE 1Z5CA 4LF5I 2UXCI 1Z0EA 4IZJD 2IOPA 5A2QC 2Q2EB 1KKHA 4DUYI 1Z0BA 4IZJB 3V2UC 2UUBI 3PYGA 4X66I 1FJGI 2GS8A 4FN5A 3ZZTA 4R1FA 1H7SA 2VF3A 5L3JA 1OJ4A 3J7AM 1PVGA 4DV1E 4X64I 4FWGA 4JI6E 2ZM6I 4DU7A 4M1KA 1MX0A 1IBKE 4RPFA 1MU5A 4HYMA 2HKEA 4LF8I 3K1JA 1XNRE 2E1RA 2HHHE 1NHIA 4JI2E 5GMDA 2OI2A 2UUCE 4JI1E 3PRYA 1N0VC 3GONA 4JG4A 2CZ9A 2X7IA 3B8HA 2CG9A 1N33I 4LFBI 2UUAE 3QT6A 1Y4SA 4DR5I 1N34I 5GMEA 1RREA 4WUBA 2E5LE 1BKNA 1IBLE 2J7KA 4X62I 4USMA 4JI5I 3ZZUA 1XNRI 1MG7A 1FKAE 4B3RE 1XNQI 2HKJA 3ZKBA 1J5EE 4DR1I 4DPYA 2O1TA 4DU8A 5LMNI 1Z0CA 4YY3I 4PRXA 4DV3E 1XMOE 4JI3E 1HR0I 5IT9Q 3PYDA 1VISA 4Z7CA 3PYEA 3T1YI 5FLXQ 4GKKE 4JI8E 2AJ4A 4NXNI 4YHHE 2HK3A 4B3SE 4XTJA 3QT7A 4LFCE 4DR2E 1USVA 4DV4I 4IZKB 1HK7A 1USUA 3F0NA 1D6TA 1KTVA 4OX9I 3V5RA 3D4JA 1N34E 1RR9A 4LF4E 2WW4A 3LNUA 4GKJE 4JYAE 3LPSA 1Z0VA 3K17A 2V2QA 4URLA 4GKKI 1ELOA 2EFGA 4HXZA 3LTOA 2BM0A 2VQEI 4X65I 2GQ0A 3Q1QA 3J81Q 5IWAI 4DR4I 4DV7I 1H7UA 2PNMA 3H4LA 3T1HI 1N32I 4X62E 2O1VA 4JI0E 1ZXMA 1FNMA 4X65E 1N36E 1HNZI 4HACB 4DPWA 4P52A 4JI2I 4JI7E 2Z5CB 4USKA 3HULA 3Q6NA 3M6AA 4DV3I 1XMOI 4B3TI 4JV5I 4MYUA 2ZM6E 4B3SI 3ZM7A 1B63A 1FI4A 2VQEE 3QT8A 1KVKA 3JAMQ 4YHHI 3ZKDA 4LFAI 4X64E 2Z5BA 1Z5BA 4DR5E 2V8PA 4EMDA 1PIEA 1HNXE 4B3MI 1NZ0A 3PYFA 3OTOE 2BV3A 4P7AA 1H73A 1N36I 1HNZE 1Z5AA 2NPFA 4AQYI 1EI1A 3WU5A 4NXME 4DR6I 1EA6A 4DV0E 1XHKA 4AQYE 4LF6E 1ZM2A 3WU4A 1HNWE 2F4VI 4WUCA 2PNLA 1H72C 1ZM9A 3J80C 2F4VE 1H74A 1IBME 4DR7E 4PU9A 1FWLA 1ZM3A 4WUDA 2UU9E 5LL6R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNL A;  4IZJ B;  2PNM A;  4IZJ A;  4IZK B;  3P06 A;  4IZJ D;  4IZK A; 
#chains in the Genus database with same CATH topology
 2NN6 C;  4LFB E;  3CDJ A;  4DR2 I;  5FLX C;  5C0X B;  4DR3 I;  3UHM A;  2UXD E;  3P06 A;  5C0X D;  2UXB E;  1K47 A;  1HNX I;  4B3M E;  4LF7 I;  4JYA I;  3CWV A;  3B78 A;  4AM3 A;  2V2Z A;  4K0K I;  1IBK I;  2PO2 A;  2O1U A;  3GCM A;  4DV2 E;  4UT4 A;  4MU3 A;  3PS3 A;  1Z59 A;  1YH8 A;  4JI3 I;  4LFA E;  2PNZ B;  2ZBK B;  2XEX A;  1FWK A;  3HJC A;  3WU3 A;  4YY3 E;  4IZJ A;  1N33 E;  3B82 A;  2VQF I;  4GQU A;  3DD6 A;  4IZK A;  2Z5E A;  2LJP A;  1S16 A;  4LF8 E;  5JEA D;  4JV5 E;  2C39 A;  4DPU A;  4IFD A;  1B62 A;  4MU0 A;  2HK2 A;  2VQF E;  2HFU A;  4NXM I;  2HFS A;  4DR6 E;  2IOQ A;  5K36 B;  2IES A;  2UXB I;  4DPX A;  5IT9 C;  2C37 B;  1HNW I;  4JI7 I;  3L7Z A;  1Y4U A;  2V34 A;  1OYP A;  4AIM A;  2UXD I;  1Z0W A;  1I94 E;  3GLL A;  1WUU A;  4LFC I;  1UDQ A;  5BR8 E;  2UUA I;  2DEI A;  1ZXN A;  4LF4 I;  4FW5 A;  3WU6 A;  1Y60 A;  5FWK A;  4LF9 I;  2BR2 B;  1XNQ E;  4DR3 E;  1IBM I;  4ISA A;  3ZZ0 A;  4KQV A;  4DV5 E;  4JI5 E;  5C0X F;  4BA2 B;  3J80 Q;  4OO1 D;  5LMN E;  1P42 A;  3T1H E;  1I94 I;  5JEA C;  4DUZ E;  2AE8 A;  3U1K A;  4LCF A;  4JI8 I;  3L7Z B;  5LMU E;  2V2V A;  4KHP I;  2Z5C A;  4DPT A;  3T1Y E;  4K0K E;  4LF6 I;  5K36 A;  4B3T E;  1DAR A;  2UU9 I;  2R3V A;  4FW3 A;  5DNL A;  2J65 A;  4HAC A;  3U1Y A;  4B3R I;  2PO0 A;  2E5L I;  2A2C A;  2DEJ A;  3Q6M A;  4ZVI A;  4QNJ A;  1U2R A;  4LF9 E;  4FW4 A;  1Y6Z A;  4FW7 A;  4LCH A;  4OZE A;  1E3H A;  1Y5Y A;  4U3B A;  5C0X C;  2JEB A;  4DV6 I;  4JI4 E;  4X66 E;  1FJG E;  4ED4 A;  2CGE A;  2JE6 A;  4NXN E;  2R42 A;  4DV2 I;  4LF7 E;  3J7A G;  4JI4 I;  4DUZ I;  1R6M A;  2BA1 G;  4JI1 I;  4OKG A;  4FWD A;  3OTO I;  1N0U A;  5LMU I;  4DV5 I;  1ZM4 A;  4PRV A;  2NN6 E;  4DR1 E;  1UEK A;  3QT5 A;  3J81 C;  1OYR A;  1NHJ A;  2UUC I;  2C38 A;  3K85 A;  4FWH A;  4IFD C;  5BR8 I;  4MYT A;  4N3O A;  4KHP E;  4JI6 I;  4DUY E;  2ZIT A;  4DV0 I;  2JEA A;  5JEA F;  1NHH A;  4DV4 E;  4FW9 A;  4UTG A;  1YHC A;  4HY1 A;  1XMQ E;  4I3H A;  3JAM C;  4DV1 I;  4JI0 I;  4DV7 E;  2A2D A;  1XMQ I;  4Z7Y A;  4NBQ A;  1Z0T A;  1Z0G A;  2Z5B B;  1J5E I;  1IBL I;  4DV6 E;  1KIJ A;  4BA2 A;  4DXL A;  1N32 E;  1PKP A;  2O1W A;  5EKW A;  1S4E A;  2BA1 D;  4LF5 E;  2UXC E;  4OX9 E;  1HR0 E;  4DR7 I;  4OO1 F;  4DR4 E;  2NN6 A;  3PS1 A;  1A6F A;  4GKJ I;  1QZR A;  1UDO A;  5A2Q Q;  2BM1 A;  2HHH I;  2UUB E;  2X36 A;  5IWA E;  4MQY A;  1Z5C A;  4LF5 I;  2UXC I;  1Z0E A;  4IZJ D;  2WNR B;  2IOP A;  5K36 C;  5A2Q C;  2Q2E B;  4LCG A;  1KKH A;  4DUY I;  1Z0B A;  4IZJ B;  3V2U C;  2JEA B;  2UUB I;  3PYG A;  5DRR A;  4X66 I;  1FJG I;  2GS8 A;  4FN5 A;  3ZZT A;  4R1F A;  1H7S A;  5DRQ A;  2VF3 A;  2PO1 A;  5L3J A;  1OJ4 A;  3J7A M;  1PVG A;  2PO2 B;  4DV1 E;  4X64 I;  4BA1 B;  4IFD E;  4FWG A;  4U3D A;  4JI6 E;  2ZM6 I;  4DU7 A;  4M1K A;  1MX0 A;  1IBK E;  4RPF A;  3NZK A;  2BA0 G;  1MU5 A;  4OO1 A;  4HYM A;  2HKE A;  4LF8 I;  4FW6 A;  2NN6 F;  3K1J A;  1XNR E;  2E1R A;  2HHH E;  1NHI A;  2PO1 B;  2JE6 B;  4JI2 E;  2VES A;  5GMD A;  2OI2 A;  2UUC E;  4JI1 E;  3PRY A;  1N0V C;  3GON A;  4JG4 A;  2CZ9 A;  2X7I A;  2IER A;  3B8H A;  1RHY A;  2CG9 A;  1N33 I;  4LFB I;  4MU4 A;  2UUA E;  2WP8 B;  3HKM A;  3QT6 A;  1Y4S A;  4DR5 I;  2GO3 A;  1N34 I;  5GME A;  1RRE A;  4WUB A;  2E5L E;  1BKN A;  1IBL E;  2J7K A;  4X62 I;  4USM A;  4JI5 I;  1VI7 A;  2O3Z A;  3ZZU A;  1XNR I;  1MG7 A;  3B4T A;  1FKA E;  4B3R E;  1UDN A;  1XNQ I;  2HKJ A;  2NN6 B;  3ZKB A;  1J5E E;  4DR1 I;  3P3G A;  4DPY A;  2O1T A;  5K36 D;  5C0X E;  4AID A;  4IFD F;  4DU8 A;  5LMN I;  1Z0C A;  2BR2 A;  4YY3 I;  4PRX A;  2F1D A;  4DV3 E;  1XMO E;  4JI3 E;  1HR0 I;  5IT9 Q;  4OO1 E;  3PYD A;  1VIS A;  3CDI A;  4Z7C A;  3PYE A;  3T1Y I;  5FLX Q;  4GKK E;  3P76 A;  3M85 G;  4JI8 E;  2AJ4 A;  4NXN I;  4YHH E;  2HK3 A;  4B3S E;  5JEA E;  4XTJ A;  2C39 B;  3QT7 A;  4LFC E;  4IFD B;  1USV A;  2CVE A;  4DV4 I;  2GO4 A;  4IZK B;  4DR2 E;  1HK7 A;  1USU A;  3F0N A;  1D6T A;  1KTV A;  2PNZ A;  4OX9 I;  4IS9 A;  3V5R A;  3D4J A;  1N34 E;  1RR9 A;  1R6L A;  4LF4 E;  2WW4 A;  3LNU A;  2C38 B;  4GKJ E;  4JYA E;  3LPS A;  1Z0V A;  4OO1 B;  2JT2 A;  3K17 A;  2V2Q A;  4URL A;  4GKK I;  1OYS A;  1E3P A;  1ELO A;  2EFG A;  4HXZ A;  5K36 E;  2NN6 D;  3LTO A;  2BM0 A;  5C0X A;  2VQE I;  4X65 I;  4BA1 A;  2GQ0 A;  3Q1Q A;  3J81 Q;  5IWA I;  4DR4 I;  4DV7 I;  1H7U A;  2PNM A;  3M7N G;  2JEB B;  3H4L A;  3T1H I;  1N32 I;  4X62 E;  2O1V A;  3KRN A;  1XXE A;  4JI0 E;  1ZXM A;  1FNM A;  4X65 E;  2PO0 B;  1N36 E;  1HNZ I;  4HAC B;  2WNR A;  4DPW A;  4P52 A;  4JI2 I;  4JI7 E;  3PS2 A;  2Z5C B;  4USK A;  5JEA B;  3HUL A;  1UDS A;  3Q6N A;  2BA0 D;  5DRO A;  3M6A A;  3P3E A;  4DV3 I;  1XMO I;  5EL9 A;  4B3T I;  4JV5 I;  4MYU A;  3M85 D;  3M7N D;  2ZM6 E;  4B3S I;  4MU1 A;  5K36 F;  4IFD D;  3ZM7 A;  4LOM A;  4MDT A;  1B63 A;  1FI4 A;  2VQE E;  5DNX A;  3QT8 A;  1KVK A;  3JAM Q;  4YHH I;  3ZKD A;  4LFA I;  3GME A;  4X64 E;  2Z5B A;  1Z5B A;  4DR5 E;  2V8P A;  4EMD A;  1PIE A;  1HNX E;  5DRP A;  4B3M I;  1NZ0 A;  3PYF A;  3OTO E;  2BV3 A;  5ELW A;  4OO1 C;  4P7A A;  5JEA A;  2C37 A;  1H73 A;  3P3C A;  1N36 I;  1Z5A A;  2NPF A;  1HNZ E;  4AQY I;  1EI1 A;  3WU5 A;  4NXM E;  4DR6 I;  1EA6 A;  2WP8 A;  4DV0 E;  1XHK A;  4AQY E;  3H1C A;  4LF6 E;  1ZM2 A;  3WU4 A;  1HNW E;  4LPF A;  2F4V I;  4WUC A;  2PNL A;  1H72 C;  1ZM9 A;  3J80 C;  2F4V E;  1H74 A;  4J3D A;  1IBM E;  4DR7 E;  4PU9 A;  1FWL A;  1ZM3 A;  4QNK A;  4WUD A;  2UU9 E;  5LL6 R; 
#chains in the Genus database with same CATH homology
 4LFB E;  4DR2 I;  5FLX C;  4DR3 I;  2UXD E;  2UXB E;  3P06 A;  1K47 A;  1HNX I;  4B3M E;  4LF7 I;  4JYA I;  3CWV A;  3B78 A;  2V2Z A;  4K0K I;  1IBK I;  2O1U A;  4DV2 E;  4UT4 A;  1Z59 A;  4JI3 I;  4LFA E;  2ZBK B;  2XEX A;  1FWK A;  3HJC A;  3WU3 A;  4YY3 E;  4IZJ A;  1N33 E;  3B82 A;  2VQF I;  4IZK A;  2Z5E A;  2LJP A;  1S16 A;  4LF8 E;  4JV5 E;  4DPU A;  1B62 A;  2HK2 A;  2VQF E;  2HFU A;  4NXM I;  2HFS A;  4DR6 E;  2IOQ A;  2UXB I;  4DPX A;  5IT9 C;  1HNW I;  4JI7 I;  1Y4U A;  2V34 A;  2UXD I;  1Z0W A;  1I94 E;  1WUU A;  4LFC I;  5BR8 E;  2UUA I;  2DEI A;  1ZXN A;  4LF4 I;  3WU6 A;  4LF9 I;  5FWK A;  1XNQ E;  4DR3 E;  1IBM I;  3ZZ0 A;  4KQV A;  4DV5 E;  4JI5 E;  3J80 Q;  5LMN E;  3T1H E;  1I94 I;  4DUZ E;  4JI8 I;  5LMU E;  2V2V A;  4KHP I;  2Z5C A;  4DPT A;  3T1Y E;  4K0K E;  4LF6 I;  4B3T E;  1DAR A;  2UU9 I;  2R3V A;  4HAC A;  4B3R I;  2E5L I;  2A2C A;  2DEJ A;  3Q6M A;  4ZVI A;  1U2R A;  4LF9 E;  1Y6Z A;  4DV6 I;  4JI4 E;  4X66 E;  1FJG E;  4ED4 A;  2CGE A;  4NXN E;  2R42 A;  4DV2 I;  4LF7 E;  3J7A G;  4JI4 I;  4DUZ I;  4JI1 I;  4FWD A;  3OTO I;  1N0U A;  5LMU I;  4DV5 I;  1ZM4 A;  4PRV A;  4DR1 E;  1UEK A;  3QT5 A;  3J81 C;  1NHJ A;  2UUC I;  3K85 A;  4FWH A;  5BR8 I;  4MYT A;  4N3O A;  4KHP E;  4JI6 I;  4DUY E;  2ZIT A;  4DV0 I;  1NHH A;  4DV4 E;  4FW9 A;  4UTG A;  4HY1 A;  1XMQ E;  4I3H A;  3JAM C;  4DV1 I;  4JI0 I;  4DV7 E;  2A2D A;  1XMQ I;  4Z7Y A;  1Z0T A;  1Z0G A;  2Z5B B;  1J5E I;  1IBL I;  4DV6 E;  1KIJ A;  4DXL A;  1N32 E;  1PKP A;  2O1W A;  1S4E A;  4LF5 E;  2UXC E;  4OX9 E;  1HR0 E;  4DR7 I;  4DR4 E;  1A6F A;  4GKJ I;  1QZR A;  5A2Q Q;  2BM1 A;  2HHH I;  2UUB E;  2X36 A;  5IWA E;  1Z5C A;  4LF5 I;  2UXC I;  1Z0E A;  4IZJ D;  2IOP A;  5A2Q C;  2Q2E B;  1KKH A;  4DUY I;  1Z0B A;  4IZJ B;  3V2U C;  2UUB I;  3PYG A;  4X66 I;  1FJG I;  2GS8 A;  4FN5 A;  3ZZT A;  4R1F A;  1H7S A;  2VF3 A;  5L3J A;  1OJ4 A;  3J7A M;  1PVG A;  4DV1 E;  4X64 I;  4FWG A;  4JI6 E;  2ZM6 I;  4DU7 A;  4M1K A;  1MX0 A;  1IBK E;  4RPF A;  1MU5 A;  4HYM A;  2HKE A;  4LF8 I;  3K1J A;  1XNR E;  2E1R A;  2HHH E;  1NHI A;  4JI2 E;  5GMD A;  2OI2 A;  2UUC E;  4JI1 E;  3PRY A;  1N0V C;  3GON A;  4JG4 A;  2CZ9 A;  2X7I A;  3B8H A;  2CG9 A;  1N33 I;  4LFB I;  2UUA E;  3QT6 A;  1Y4S A;  4DR5 I;  1N34 I;  5GME A;  1RRE A;  4WUB A;  2E5L E;  1BKN A;  1IBL E;  2J7K A;  4X62 I;  4USM A;  4JI5 I;  3ZZU A;  1XNR I;  1MG7 A;  1FKA E;  4B3R E;  1XNQ I;  2HKJ A;  3ZKB A;  1J5E E;  4DR1 I;  4DPY A;  2O1T A;  4DU8 A;  5LMN I;  1Z0C A;  4YY3 I;  4PRX A;  4DV3 E;  1XMO E;  4JI3 E;  1HR0 I;  5IT9 Q;  3PYD A;  1VIS A;  4Z7C A;  3PYE A;  3T1Y I;  5FLX Q;  4GKK E;  4JI8 E;  2AJ4 A;  4NXN I;  4YHH E;  2HK3 A;  4B3S E;  4XTJ A;  3QT7 A;  4LFC E;  4DR2 E;  1USV A;  4DV4 I;  4IZK B;  1HK7 A;  1USU A;  3F0N A;  1D6T A;  1KTV A;  4OX9 I;  3V5R A;  3D4J A;  1N34 E;  1RR9 A;  4LF4 E;  2WW4 A;  3LNU A;  4GKJ E;  4JYA E;  3LPS A;  1Z0V A;  3K17 A;  2V2Q A;  4URL A;  4GKK I;  1ELO A;  2EFG A;  4HXZ A;  3LTO A;  2BM0 A;  2VQE I;  4X65 I;  2GQ0 A;  3Q1Q A;  3J81 Q;  5IWA I;  4DR4 I;  4DV7 I;  1H7U A;  2PNM A;  3H4L A;  3T1H I;  1N32 I;  4X62 E;  2O1V A;  4JI0 E;  1ZXM A;  1FNM A;  4X65 E;  1N36 E;  1HNZ I;  4HAC B;  4DPW A;  4P52 A;  4JI2 I;  4JI7 E;  2Z5C B;  4USK A;  3HUL A;  3Q6N A;  3M6A A;  4DV3 I;  1XMO I;  4B3T I;  4JV5 I;  4MYU A;  2ZM6 E;  4B3S I;  3ZM7 A;  1B63 A;  1FI4 A;  2VQE E;  3QT8 A;  1KVK A;  3JAM Q;  4YHH I;  3ZKD A;  4LFA I;  4X64 E;  2Z5B A;  1Z5B A;  4DR5 E;  2V8P A;  4EMD A;  1PIE A;  1HNX E;  4B3M I;  1NZ0 A;  3PYF A;  3OTO E;  2BV3 A;  4P7A A;  1H73 A;  1N36 I;  1HNZ E;  1Z5A A;  2NPF A;  4AQY I;  1EI1 A;  3WU5 A;  4NXM E;  4DR6 I;  1EA6 A;  4DV0 E;  1XHK A;  4AQY E;  4LF6 E;  1ZM2 A;  3WU4 A;  1HNW E;  2F4V I;  4WUC A;  2PNL A;  1H72 C;  1ZM9 A;  3J80 C;  2F4V E;  1H74 A;  1IBM E;  4DR7 E;  4PU9 A;  1FWL A;  1ZM3 A;  4WUD A;  2UU9 E;  5LL6 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...