3P06A

Crystal structure of tellina virus 1 vp4 protease in the form of an intra-molecular(cis)acyl-enzyme complex.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
194
Chain Sequence
b'NGVELSAVGVLLPVLMDSGRRISGGAFMAVKGDLSEHIKNPKNTRIAQTVAGGTIYGLSEMVNIDEAEKLPIKGAITVLPVVQATATSILVPDNQPQLAFNSWEAAACAADTLESQQTPFLMVTGAVESGNLSPNLLAVQKQLLVAKPAGIGLAANSDRALKVVTLEQLRQVVGDKPWRKPMVTFSSGKNVAQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VP4 protein
publication title Crystal Structure of a Viral Protease Intramolecular Acyl-enzyme Complex: INSIGHTS INTO cis-CLEAVAGE AT THE VP4/VP3 JUNCTION OF TELLINA BIRNAVIRUS.
pubmed doi rcsb
source organism Tellina virus 1
molecule tags Hydrolase
total genus 48
structure length 194
sequence length 194
ec nomenclature ec 3.4.21.115: Infectious pancreatic necrosis birnavirus Vp4 peptidase.
pdb deposition date 2010-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3p06A00
4IZKA 4IZJD 4IZJB 3P06A 4IZKB 2PNLA 4IZJA 2PNMA
chains in the Genus database with same CATH superfamily
5IWAE 4IFDF 1ZM4A 4DR5E 1HR0E 2PO1A 1OYPA 4FW7A 2BA0D 1RHYA 4ISAA 4JI8E 5FLXC 2UXBE 4HY1A 4IS9A 4N3OA 3M6AA 3HULA 5LMUE 1OYSA 4LF4I 3T1YI 4OO1F 4JV5I 4DR2E 4FN5A 3T1HI 4JI3I 4GKJE 4PRVA 4I3HA 1FJGE 1Z0GA 4OO1D 4DV2E 4QNKA 5A2QC 3U1YA 3B78A 1N36E 4DV0E 4JI4E 3CWVA 4X64E 1XMQE 2J65A 4LF9E 2HFUA 1U2RA 2Z5CB 2GS8A 4X65E 4DR4E 2XEXA 2AJ4A 3HKMA 4LF5E 2V2VA 4PRXA 5C0XD 1N32E 5DROA 2WP8B 3J80C 4NXMI 3M85D 2OI2A 3P76A 1XNQI 1BKNA 2VESA 4JI7I 4FW3A 2NPFA 4X66I 1NHJA 3JAMC 4BA2B 2VQFI 4FW5A 4DPUA 2CG9A 4LF4E 4GQUA 3T1YE 2UUCI 1UDQA 3T1HE 4JI3E 4DUZI 5JEAB 1XNRI 4YY3E 2CVEA 5LMNE 2HK2A 4DU8A 2R42A 2ZM6I 5ELWA 4JI5I 1NHIA 2JE6B 1FI4A 1N0UA 1USVA 1Z5CA 1YH8A 3J7AM 1UDOA 2EFGA 5DNXA 2Z5CA 4FW6A 3P3GA 3P06A 4DR7I 2IOPA 2PNMA 1IBKI 5JEAE 2UXDI 2NN6B 1S4EA 1MU5A 4RPFA 3PS1A 4JI2I 4DR1I 4X66E 1Z0EA 4IFDB 3M7NG 5K36C 2VQFE 1R6MA 4OO1C 4K0KI 1Z0CA 4DV1E 2PO2B 4HACB 1H74A 4X62E 4BA2A 1NHHA 4DV5I 1KIJA 3B82A 4DR3I 4R1FA 1EA6A 3WU5A 4U3DA 4DV4I 5JEAA 4OO1B 1R6LA 2JEAB 4LF7I 4DR6E 4AM3A 4B3ME 2ZM6E 1KVKA 2NN6E 1PVGA 3DD6A 2E1RA 4B3TE 5C0XC 4Z7YA 2JE6A 4NXNI 4LCGA 4FWGA 4IFDE 4IZJB 1ELOA 1Y60A 2BA1D 4MU1A 5EL9A 3QT5A 4DV3E 1MX0A 2HHHI 2Z5BA 4B3RE 5IT9Q 1Z5AA 1XMOE 2UUAE 5K36F 1IBKE 2BM1A 4DV6I 2V2ZA 1D6TA 2UXDE 4JI0E 3ZKDA 4DPXA 5K36D 3WU4A 4OO1E 2NN6A 4JI2E 4USMA 4DR1E 4UTGA 1VISA 1OJ4A 4LFCI 2PO0A 4Z7CA 4IFDA 4DV5E 3OTOI 2F4VI 2X36A 4LPFA 4LCHA 1I94E 1E3HA 4JG4A 1VI7A 1B62A 1ZM9A 4DR3E 3QT7A 1EI1A 3NZKA 2BR2B 3ZKBA 5C0XF 4B3SI 4DV4E 1H73A 1E3PA 1HNXI 4OO1A 2PNZB 1OYRA 3KRNA 4LOMA 3LNUA 4U3BA 4GKKI 2IESA 4LCFA 4DU7A 1Z5BA 4DPWA 1FWKA 4IZKB 3H1CA 4IZJA 1Y4SA 3H4LA 4DV6E 4LFAI 4JV5E 2V8PA 2O1WA 1Z0TA 5FLXQ 1N33I 4OZEA 1NZ0A 4LF8I 4KHPI 4OX9I 4MYUA 4JI1I 4P52A 4WUCA 4WUDA 3PYFA 4NBQA 2BM0A 4YHHI 1K47A 2O1TA 2V2QA 4ZVIA 4DPYA 3OTOE 2WNRB 5LL6R 4FWHA 2F1DA 3J81C 1PKPA 5A2QQ 1DARA 2JEBB 2VF3A 2VQEI 3M85G 2BR2A 1A6FA 1J5EI 3P3EA 4DV7I 3ZM7A 4NXME 4AQYI 2PO1B 2Z5EA 2WP8A 4DR5I 1XNQE 4MYTA 2O1UA 1HR0I 4JI7E 2PNLA 3Q1QA 3F0NA 4FW4A 3B4TA 1UEKA 3K1JA 3J80Q 5DRPA 1XHKA 1HNWI 2UXBI 3PS3A 2UUCE 4IZKA 4LFAE 2DEIA 5LMUI 4DUZE 2JT2A 5JEAD 1XNRE 4JI6I 4JI1E 3PYDA 1WUUA 1IBMI 5K36B 1QZRA 4YHHE 4DV2I 2UUBI 4P7AA 4JI5E 4HYMA 2DEJA 2IERA 2BV3A 3ZZUA 1RREA 4JI4I 4LF6I 1B63A 3CDJA 1XMQI 2GO3A 2A2DA 4LF9I 2UXCI 2WNRA 4DUYI 1Z0BA 2VQEE 2O1VA 2E5LI 2JEBA 4DR7E 2C39B 1J5EE 4LF5I 1HNZI 3PS2A 5C0XB 1H72C 4AQYE 4JYAI 2NN6D 1S16A 4EMDA 5K36E 3K85A 2Q2EB 4J3DA 1Z0VA 1FWLA 4MQYA 4IFDD 3QT6A 1Y6ZA 3K17A 1HNWE 4K0KE 2AE8A 3CDIA 3WU3A 4UT4A 1YHCA 1IBLI 1H7SA 2C37B 2PO2A 4HACA 1Y5YA 1HK7A 4JI6E 1RR9A 3D4JA 1IBME 1FKAE 2O3ZA 4XTJA 4MU0A 4YY3I 2IOQA 4LF7E 2UUBE 5C0XE 5LMNI 4DXLA 5K36A 2BA0G 2JEAA 2BA1G 3QT8A 4PU9A 3J7AG 4LF6E 4FWDA 2GQ0A 4NXNE 4KQVA 2UXCE 4DUYE 4IZJD 1USUA 3PRYA 2C38B 2HHHE 1N34I 2E5LE 3U1KA 4MDTA 4HXZA 5GMDA 1HNZE 1XXEA 2A2CA 2C39A 3ZZTA 4JYAE 3V5RA 5C0XA 5L3JA 5DNLA 5JEAC 4LFCE 4BA1B 5DRQA 2UU9I 2R3VA 2CZ9A 5BR8I 4DV1I 1IBLE 4X62I 4OKGA 2F4VE 2ZITA 1ZM2A 3L7ZB 3M7ND 2GO4A 1KKHA 2C37A 4B3SE 5GMEA 1UDSA 3PYGA 3GONA 3HJCA 4AIMA 3UHMA 1HNXE 1MG7A 2J7KA 3Q6NA 4DR6I 2HKJA 3WU6A 4B3MI 4LFBI 5IT9C 5IWAI 2PNZA 1H7UA 3ZZ0A 4GKKE 3B8HA 4B3TI 3LPSA 5DRRA 2NN6C 2Z5BB 2HFSA 1N34E 1UDNA 4JI8I 4AIDA 4QNJA 4B3RI 4DV3I 3GCMA 2C38A 5JEAF 4MU3A 1XMOI 2UUAI 4IFDC 1KTVA 3P3CA 3Q6MA 4USKA 5FWKA 1P42A 3LTOA 1N33E 4LF8E 3JAMQ 4DR2I 4OX9E 4KHPE 2HKEA 2X7IA 2WW4A 4JI0I 4GKJI 4MU4A 1ZXNA 1FJGI 1ZM3A 3PYEA 2V34A 2PO0B 1Y4UA 1PIEA 2UU9E 3GMEA 4DPTA 2HK3A 4FW9A 5BR8E 1N36I 4DV0I 4BA1A 4URLA 2CGEA 4X64I 3V2UC 4WUBA 1Z0WA 1I94I 1N0VC 1ZXMA 3L7ZA 5EKWA 4X65I 3GLLA 4DR4I 1FNMA 4M1KA 4ED4A 2NN6F 4DV7E 2ZBKB 3J81Q 1Z59A 1N32I 4LFBE 2LJPA
chains in the Genus database with same CATH topology
5IWAE 1ZM4A 4DR5E 1HR0E 5FLXC 4JI8E 2UXBE 4HY1A 4N3OA 3M6AA 3HULA 5LMUE 4LF4I 3T1YI 4JV5I 4DR2E 4FN5A 3T1HI 4JI3I 4GKJE 4PRVA 4I3HA 1FJGE 1Z0GA 4DV2E 5A2QC 3B78A 1N36E 4DV0E 4JI4E 3CWVA 4X64E 1XMQE 4LF9E 2HFUA 1U2RA 2Z5CB 2GS8A 4X65E 4DR4E 2XEXA 2AJ4A 4LF5E 2V2VA 4PRXA 1N32E 3J80C 4NXMI 2OI2A 1XNQI 1BKNA 4JI7I 2NPFA 4X66I 1NHJA 3JAMC 2VQFI 4DPUA 2CG9A 4LF4E 3T1YE 2UUCI 3T1HE 4JI3E 4DUZI 1XNRI 4YY3E 5LMNE 2HK2A 4DU8A 2R42A 2ZM6I 4JI5I 1NHIA 1FI4A 1N0UA 1USVA 1Z5CA 3J7AM 2EFGA 2Z5CA 3P06A 4DR7I 2IOPA 2PNMA 1IBKI 2UXDI 1S4EA 1MU5A 4RPFA 4JI2I 4DR1I 4X66E 1Z0EA 2VQFE 4K0KI 1Z0CA 4DV1E 4HACB 4X62E 1H74A 1NHHA 4DV5I 1KIJA 3B82A 4DR3I 4R1FA 1EA6A 3WU5A 4DV4I 4LF7I 4DR6E 4B3ME 2ZM6E 1KVKA 1PVGA 2E1RA 4B3TE 4Z7YA 4NXNI 4FWGA 4IZJB 1ELOA 3QT5A 4DV3E 1MX0A 2HHHI 2Z5BA 4B3RE 5IT9Q 1Z5AA 1XMOE 2UUAE 1IBKE 2BM1A 4DV6I 2V2ZA 1D6TA 2UXDE 4JI0E 3ZKDA 4DPXA 3WU4A 4JI2E 4USMA 4DR1E 4UTGA 1VISA 1OJ4A 4LFCI 4Z7CA 4DV5E 3OTOI 2F4VI 2X36A 1I94E 4JG4A 1ZM9A 1B62A 4DR3E 3QT7A 1EI1A 3ZKBA 4B3SI 4DV4E 1H73A 1HNXI 3LNUA 4GKKI 4DU7A 1Z5BA 4DPWA 1FWKA 4IZKB 4IZJA 1Y4SA 3H4LA 4DV6E 4LFAI 4JV5E 2V8PA 2O1WA 1Z0TA 5FLXQ 1N33I 1NZ0A 4LF8I 4KHPI 4OX9I 4MYUA 4JI1I 4P52A 4WUCA 4WUDA 3PYFA 2BM0A 4YHHI 1K47A 2O1TA 2V2QA 4ZVIA 4DPYA 3OTOE 5LL6R 4FWHA 3J81C 1PKPA 5A2QQ 1DARA 2VF3A 2VQEI 1A6FA 1J5EI 4DV7I 3ZM7A 4NXME 4AQYI 2Z5EA 4DR5I 1XNQE 4MYTA 2O1UA 1HR0I 4JI7E 2PNLA 3Q1QA 3F0NA 1UEKA 3K1JA 3J80Q 1XHKA 1HNWI 2UXBI 2UUCE 4IZKA 4LFAE 2DEIA 5LMUI 4DUZE 1XNRE 4JI6I 4JI1E 3PYDA 1WUUA 1IBMI 1QZRA 4YHHE 4DV2I 2UUBI 4P7AA 4JI5E 4HYMA 2DEJA 2BV3A 3ZZUA 1RREA 4JI4I 4LF6I 1B63A 1XMQI 4LF9I 2A2DA 2UXCI 4DUYI 1Z0BA 2VQEE 2O1VA 2E5LI 4DR7E 1J5EE 4LF5I 1HNZI 1H72C 4AQYE 4JYAI 1S16A 4EMDA 3K85A 2Q2EB 1Z0VA 1FWLA 3QT6A 1Y6ZA 3K17A 1HNWE 4K0KE 3WU3A 4UT4A 1IBLI 1H7SA 4HACA 1HK7A 4JI6E 1RR9A 3D4JA 1IBME 1FKAE 4XTJA 4YY3I 2IOQA 4LF7E 2UUBE 5LMNI 4DXLA 3QT8A 4PU9A 3J7AG 4LF6E 4FWDA 2GQ0A 4NXNE 4KQVA 2UXCE 4DUYE 4IZJD 1USUA 3PRYA 2HHHE 1N34I 2E5LE 4HXZA 5GMDA 1HNZE 2A2CA 3ZZTA 4JYAE 3V5RA 5L3JA 4LFCE 2UU9I 2R3VA 2CZ9A 5BR8I 4DV1I 1IBLE 4X62I 2F4VE 2ZITA 1ZM2A 1KKHA 4B3SE 5GMEA 3PYGA 3GONA 3HJCA 1HNXE 1MG7A 2J7KA 3Q6NA 4DR6I 2HKJA 3WU6A 4B3MI 4LFBI 5IT9C 5IWAI 1H7UA 3ZZ0A 4GKKE 3B8HA 4B3TI 3LPSA 2Z5BB 2HFSA 1N34E 4JI8I 4B3RI 4DV3I 1XMOI 2UUAI 1KTVA 3Q6MA 4USKA 5FWKA 3LTOA 1N33E 4LF8E 3JAMQ 4DR2I 4OX9E 4KHPE 2HKEA 2X7IA 2WW4A 4JI0I 4GKJI 1ZXNA 1FJGI 1ZM3A 3PYEA 2V34A 1Y4UA 1PIEA 2UU9E 4DPTA 2HK3A 4FW9A 5BR8E 1N36I 4DV0I 4URLA 2CGEA 4X64I 3V2UC 1Z0WA 4WUBA 1I94I 1N0VC 1ZXMA 4X65I 4DR4I 1FNMA 4M1KA 4ED4A 4DV7E 2ZBKB 3J81Q 1Z59A 1N32I 4LFBE 2LJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZK A;  4IZJ D;  4IZJ B;  3P06 A;  4IZK B;  2PNL A;  4IZJ A;  2PNM A; 
#chains in the Genus database with same CATH topology
 5IWA E;  4IFD F;  1ZM4 A;  4DR5 E;  1HR0 E;  2PO1 A;  1OYP A;  4FW7 A;  2BA0 D;  1RHY A;  4ISA A;  4JI8 E;  5FLX C;  2UXB E;  4HY1 A;  4IS9 A;  4N3O A;  3M6A A;  3HUL A;  5LMU E;  1OYS A;  4LF4 I;  3T1Y I;  4OO1 F;  4JV5 I;  4DR2 E;  4FN5 A;  3T1H I;  4JI3 I;  4GKJ E;  4PRV A;  4I3H A;  1FJG E;  1Z0G A;  4OO1 D;  4DV2 E;  4QNK A;  5A2Q C;  3U1Y A;  3B78 A;  1N36 E;  4DV0 E;  4JI4 E;  3CWV A;  4X64 E;  1XMQ E;  2J65 A;  4LF9 E;  2HFU A;  1U2R A;  2Z5C B;  2GS8 A;  4X65 E;  4DR4 E;  2XEX A;  2AJ4 A;  3HKM A;  4LF5 E;  2V2V A;  4PRX A;  5C0X D;  1N32 E;  5DRO A;  2WP8 B;  3J80 C;  4NXM I;  3M85 D;  2OI2 A;  3P76 A;  1XNQ I;  1BKN A;  2VES A;  4JI7 I;  4FW3 A;  2NPF A;  4X66 I;  1NHJ A;  3JAM C;  4BA2 B;  2VQF I;  4FW5 A;  4DPU A;  2CG9 A;  4LF4 E;  4GQU A;  3T1Y E;  2UUC I;  1UDQ A;  3T1H E;  4JI3 E;  4DUZ I;  5JEA B;  1XNR I;  4YY3 E;  2CVE A;  5LMN E;  2HK2 A;  4DU8 A;  2R42 A;  2ZM6 I;  5ELW A;  4JI5 I;  1NHI A;  2JE6 B;  1FI4 A;  1N0U A;  1USV A;  1Z5C A;  1YH8 A;  3J7A M;  1UDO A;  2EFG A;  5DNX A;  2Z5C A;  4FW6 A;  3P3G A;  3P06 A;  4DR7 I;  2IOP A;  2PNM A;  1IBK I;  5JEA E;  2UXD I;  2NN6 B;  1S4E A;  1MU5 A;  4RPF A;  3PS1 A;  4JI2 I;  4DR1 I;  4X66 E;  1Z0E A;  4IFD B;  3M7N G;  5K36 C;  2VQF E;  1R6M A;  4OO1 C;  4K0K I;  1Z0C A;  4DV1 E;  2PO2 B;  4HAC B;  1H74 A;  4X62 E;  4BA2 A;  1NHH A;  4DV5 I;  1KIJ A;  3B82 A;  4DR3 I;  4R1F A;  1EA6 A;  3WU5 A;  4U3D A;  4DV4 I;  5JEA A;  4OO1 B;  1R6L A;  2JEA B;  4LF7 I;  4DR6 E;  4AM3 A;  4B3M E;  2ZM6 E;  1KVK A;  2NN6 E;  1PVG A;  3DD6 A;  2E1R A;  4B3T E;  5C0X C;  4Z7Y A;  2JE6 A;  4NXN I;  4LCG A;  4FWG A;  4IFD E;  4IZJ B;  1ELO A;  1Y60 A;  2BA1 D;  4MU1 A;  5EL9 A;  3QT5 A;  4DV3 E;  1MX0 A;  2HHH I;  2Z5B A;  4B3R E;  5IT9 Q;  1Z5A A;  1XMO E;  2UUA E;  5K36 F;  1IBK E;  2BM1 A;  4DV6 I;  2V2Z A;  1D6T A;  2UXD E;  4JI0 E;  3ZKD A;  4DPX A;  5K36 D;  3WU4 A;  4OO1 E;  2NN6 A;  4JI2 E;  4USM A;  4DR1 E;  4UTG A;  1VIS A;  1OJ4 A;  4LFC I;  2PO0 A;  4Z7C A;  4IFD A;  4DV5 E;  3OTO I;  2F4V I;  2X36 A;  4LPF A;  4LCH A;  1I94 E;  1E3H A;  4JG4 A;  1VI7 A;  1B62 A;  1ZM9 A;  4DR3 E;  3QT7 A;  1EI1 A;  3NZK A;  2BR2 B;  3ZKB A;  5C0X F;  4B3S I;  4DV4 E;  1H73 A;  1E3P A;  1HNX I;  4OO1 A;  2PNZ B;  1OYR A;  3KRN A;  4LOM A;  3LNU A;  4U3B A;  4GKK I;  2IES A;  4LCF A;  4DU7 A;  1Z5B A;  4DPW A;  1FWK A;  4IZK B;  3H1C A;  4IZJ A;  1Y4S A;  3H4L A;  4DV6 E;  4LFA I;  4JV5 E;  2V8P A;  2O1W A;  1Z0T A;  5FLX Q;  1N33 I;  4OZE A;  1NZ0 A;  4LF8 I;  4KHP I;  4OX9 I;  4MYU A;  4JI1 I;  4P52 A;  4WUC A;  4WUD A;  3PYF A;  4NBQ A;  2BM0 A;  4YHH I;  1K47 A;  2O1T A;  2V2Q A;  4ZVI A;  4DPY A;  3OTO E;  2WNR B;  5LL6 R;  4FWH A;  2F1D A;  3J81 C;  1PKP A;  5A2Q Q;  1DAR A;  2JEB B;  2VF3 A;  2VQE I;  3M85 G;  2BR2 A;  1A6F A;  1J5E I;  3P3E A;  4DV7 I;  3ZM7 A;  4NXM E;  4AQY I;  2PO1 B;  2Z5E A;  2WP8 A;  4DR5 I;  1XNQ E;  4MYT A;  2O1U A;  1HR0 I;  4JI7 E;  2PNL A;  3Q1Q A;  3F0N A;  4FW4 A;  3B4T A;  1UEK A;  3K1J A;  3J80 Q;  5DRP A;  1XHK A;  1HNW I;  2UXB I;  3PS3 A;  2UUC E;  4IZK A;  4LFA E;  2DEI A;  5LMU I;  4DUZ E;  2JT2 A;  5JEA D;  1XNR E;  4JI6 I;  4JI1 E;  3PYD A;  1WUU A;  1IBM I;  5K36 B;  1QZR A;  4YHH E;  4DV2 I;  2UUB I;  4P7A A;  4JI5 E;  4HYM A;  2DEJ A;  2IER A;  2BV3 A;  3ZZU A;  1RRE A;  4JI4 I;  4LF6 I;  1B63 A;  3CDJ A;  1XMQ I;  2GO3 A;  2A2D A;  4LF9 I;  2UXC I;  2WNR A;  4DUY I;  1Z0B A;  2VQE E;  2O1V A;  2E5L I;  2JEB A;  4DR7 E;  2C39 B;  1J5E E;  4LF5 I;  1HNZ I;  3PS2 A;  5C0X B;  1H72 C;  4AQY E;  4JYA I;  2NN6 D;  1S16 A;  4EMD A;  5K36 E;  3K85 A;  2Q2E B;  4J3D A;  1Z0V A;  1FWL A;  4MQY A;  4IFD D;  3QT6 A;  1Y6Z A;  3K17 A;  1HNW E;  4K0K E;  2AE8 A;  3CDI A;  3WU3 A;  4UT4 A;  1YHC A;  1IBL I;  1H7S A;  2C37 B;  2PO2 A;  4HAC A;  1Y5Y A;  1HK7 A;  4JI6 E;  1RR9 A;  3D4J A;  1IBM E;  1FKA E;  2O3Z A;  4XTJ A;  4MU0 A;  4YY3 I;  2IOQ A;  4LF7 E;  2UUB E;  5C0X E;  5LMN I;  4DXL A;  5K36 A;  2BA0 G;  2JEA A;  2BA1 G;  3QT8 A;  4PU9 A;  3J7A G;  4LF6 E;  4FWD A;  2GQ0 A;  4NXN E;  4KQV A;  2UXC E;  4DUY E;  4IZJ D;  1USU A;  3PRY A;  2C38 B;  2HHH E;  1N34 I;  2E5L E;  3U1K A;  4MDT A;  4HXZ A;  5GMD A;  1HNZ E;  1XXE A;  2A2C A;  2C39 A;  3ZZT A;  4JYA E;  3V5R A;  5C0X A;  5L3J A;  5DNL A;  5JEA C;  4LFC E;  4BA1 B;  5DRQ A;  2UU9 I;  2R3V A;  2CZ9 A;  5BR8 I;  4DV1 I;  1IBL E;  4X62 I;  4OKG A;  2F4V E;  2ZIT A;  1ZM2 A;  3L7Z B;  3M7N D;  2GO4 A;  1KKH A;  2C37 A;  4B3S E;  5GME A;  1UDS A;  3PYG A;  3GON A;  3HJC A;  4AIM A;  3UHM A;  1HNX E;  1MG7 A;  2J7K A;  3Q6N A;  4DR6 I;  2HKJ A;  3WU6 A;  4B3M I;  4LFB I;  5IT9 C;  5IWA I;  2PNZ A;  1H7U A;  3ZZ0 A;  4GKK E;  3B8H A;  4B3T I;  3LPS A;  5DRR A;  2NN6 C;  2Z5B B;  2HFS A;  1N34 E;  1UDN A;  4JI8 I;  4AID A;  4QNJ A;  4B3R I;  4DV3 I;  3GCM A;  2C38 A;  5JEA F;  4MU3 A;  1XMO I;  2UUA I;  4IFD C;  1KTV A;  3P3C A;  3Q6M A;  4USK A;  5FWK A;  1P42 A;  3LTO A;  1N33 E;  4LF8 E;  3JAM Q;  4DR2 I;  4OX9 E;  4KHP E;  2HKE A;  2X7I A;  2WW4 A;  4JI0 I;  4GKJ I;  4MU4 A;  1ZXN A;  1FJG I;  1ZM3 A;  3PYE A;  2V34 A;  2PO0 B;  1Y4U A;  1PIE A;  2UU9 E;  3GME A;  4DPT A;  2HK3 A;  4FW9 A;  5BR8 E;  1N36 I;  4DV0 I;  4BA1 A;  4URL A;  2CGE A;  4X64 I;  3V2U C;  4WUB A;  1Z0W A;  1I94 I;  1N0V C;  1ZXM A;  3L7Z A;  5EKW A;  4X65 I;  3GLL A;  4DR4 I;  1FNM A;  4M1K A;  4ED4 A;  2NN6 F;  4DV7 E;  2ZBK B;  3J81 Q;  1Z59 A;  1N32 I;  4LFB E;  2LJP A; 
#chains in the Genus database with same CATH homology
 5IWA E;  1ZM4 A;  4DR5 E;  1HR0 E;  5FLX C;  4JI8 E;  2UXB E;  4HY1 A;  4N3O A;  3M6A A;  3HUL A;  5LMU E;  4LF4 I;  3T1Y I;  4JV5 I;  4DR2 E;  4FN5 A;  3T1H I;  4JI3 I;  4GKJ E;  4PRV A;  4I3H A;  1FJG E;  1Z0G A;  4DV2 E;  5A2Q C;  3B78 A;  1N36 E;  4DV0 E;  4JI4 E;  3CWV A;  4X64 E;  1XMQ E;  4LF9 E;  2HFU A;  1U2R A;  2Z5C B;  2GS8 A;  4X65 E;  4DR4 E;  2XEX A;  2AJ4 A;  4LF5 E;  2V2V A;  4PRX A;  1N32 E;  3J80 C;  4NXM I;  2OI2 A;  1XNQ I;  1BKN A;  4JI7 I;  2NPF A;  4X66 I;  1NHJ A;  3JAM C;  2VQF I;  4DPU A;  2CG9 A;  4LF4 E;  3T1Y E;  2UUC I;  3T1H E;  4JI3 E;  4DUZ I;  1XNR I;  4YY3 E;  5LMN E;  2HK2 A;  4DU8 A;  2R42 A;  2ZM6 I;  4JI5 I;  1NHI A;  1FI4 A;  1N0U A;  1USV A;  1Z5C A;  3J7A M;  2EFG A;  2Z5C A;  3P06 A;  4DR7 I;  2IOP A;  2PNM A;  1IBK I;  2UXD I;  1S4E A;  1MU5 A;  4RPF A;  4JI2 I;  4DR1 I;  4X66 E;  1Z0E A;  2VQF E;  4K0K I;  1Z0C A;  4DV1 E;  4HAC B;  4X62 E;  1H74 A;  1NHH A;  4DV5 I;  1KIJ A;  3B82 A;  4DR3 I;  4R1F A;  1EA6 A;  3WU5 A;  4DV4 I;  4LF7 I;  4DR6 E;  4B3M E;  2ZM6 E;  1KVK A;  1PVG A;  2E1R A;  4B3T E;  4Z7Y A;  4NXN I;  4FWG A;  4IZJ B;  1ELO A;  3QT5 A;  4DV3 E;  1MX0 A;  2HHH I;  2Z5B A;  4B3R E;  5IT9 Q;  1Z5A A;  1XMO E;  2UUA E;  1IBK E;  2BM1 A;  4DV6 I;  2V2Z A;  1D6T A;  2UXD E;  4JI0 E;  3ZKD A;  4DPX A;  3WU4 A;  4JI2 E;  4USM A;  4DR1 E;  4UTG A;  1VIS A;  1OJ4 A;  4LFC I;  4Z7C A;  4DV5 E;  3OTO I;  2F4V I;  2X36 A;  1I94 E;  4JG4 A;  1ZM9 A;  1B62 A;  4DR3 E;  3QT7 A;  1EI1 A;  3ZKB A;  4B3S I;  4DV4 E;  1H73 A;  1HNX I;  3LNU A;  4GKK I;  4DU7 A;  1Z5B A;  4DPW A;  1FWK A;  4IZK B;  4IZJ A;  1Y4S A;  3H4L A;  4DV6 E;  4LFA I;  4JV5 E;  2V8P A;  2O1W A;  1Z0T A;  5FLX Q;  1N33 I;  1NZ0 A;  4LF8 I;  4KHP I;  4OX9 I;  4MYU A;  4JI1 I;  4P52 A;  4WUC A;  4WUD A;  3PYF A;  2BM0 A;  4YHH I;  1K47 A;  2O1T A;  2V2Q A;  4ZVI A;  4DPY A;  3OTO E;  5LL6 R;  4FWH A;  3J81 C;  1PKP A;  5A2Q Q;  1DAR A;  2VF3 A;  2VQE I;  1A6F A;  1J5E I;  4DV7 I;  3ZM7 A;  4NXM E;  4AQY I;  2Z5E A;  4DR5 I;  1XNQ E;  4MYT A;  2O1U A;  1HR0 I;  4JI7 E;  2PNL A;  3Q1Q A;  3F0N A;  1UEK A;  3K1J A;  3J80 Q;  1XHK A;  1HNW I;  2UXB I;  2UUC E;  4IZK A;  4LFA E;  2DEI A;  5LMU I;  4DUZ E;  1XNR E;  4JI6 I;  4JI1 E;  3PYD A;  1WUU A;  1IBM I;  1QZR A;  4YHH E;  4DV2 I;  2UUB I;  4P7A A;  4JI5 E;  4HYM A;  2DEJ A;  2BV3 A;  3ZZU A;  1RRE A;  4JI4 I;  4LF6 I;  1B63 A;  1XMQ I;  4LF9 I;  2A2D A;  2UXC I;  4DUY I;  1Z0B A;  2VQE E;  2O1V A;  2E5L I;  4DR7 E;  1J5E E;  4LF5 I;  1HNZ I;  1H72 C;  4AQY E;  4JYA I;  1S16 A;  4EMD A;  3K85 A;  2Q2E B;  1Z0V A;  1FWL A;  3QT6 A;  1Y6Z A;  3K17 A;  1HNW E;  4K0K E;  3WU3 A;  4UT4 A;  1IBL I;  1H7S A;  4HAC A;  1HK7 A;  4JI6 E;  1RR9 A;  3D4J A;  1IBM E;  1FKA E;  4XTJ A;  4YY3 I;  2IOQ A;  4LF7 E;  2UUB E;  5LMN I;  4DXL A;  3QT8 A;  4PU9 A;  3J7A G;  4LF6 E;  4FWD A;  2GQ0 A;  4NXN E;  4KQV A;  2UXC E;  4DUY E;  4IZJ D;  1USU A;  3PRY A;  2HHH E;  1N34 I;  2E5L E;  4HXZ A;  5GMD A;  1HNZ E;  2A2C A;  3ZZT A;  4JYA E;  3V5R A;  5L3J A;  4LFC E;  2UU9 I;  2R3V A;  2CZ9 A;  5BR8 I;  4DV1 I;  1IBL E;  4X62 I;  2F4V E;  2ZIT A;  1ZM2 A;  1KKH A;  4B3S E;  5GME A;  3PYG A;  3GON A;  3HJC A;  1HNX E;  1MG7 A;  2J7K A;  3Q6N A;  4DR6 I;  2HKJ A;  3WU6 A;  4B3M I;  4LFB I;  5IT9 C;  5IWA I;  1H7U A;  3ZZ0 A;  4GKK E;  3B8H A;  4B3T I;  3LPS A;  2Z5B B;  2HFS A;  1N34 E;  4JI8 I;  4B3R I;  4DV3 I;  1XMO I;  2UUA I;  1KTV A;  3Q6M A;  4USK A;  5FWK A;  3LTO A;  1N33 E;  4LF8 E;  3JAM Q;  4DR2 I;  4OX9 E;  4KHP E;  2HKE A;  2X7I A;  2WW4 A;  4JI0 I;  4GKJ I;  1ZXN A;  1FJG I;  1ZM3 A;  3PYE A;  2V34 A;  1Y4U A;  1PIE A;  2UU9 E;  4DPT A;  2HK3 A;  4FW9 A;  5BR8 E;  1N36 I;  4DV0 I;  4URL A;  2CGE A;  4X64 I;  3V2U C;  1Z0W A;  4WUB A;  1I94 I;  1N0V C;  1ZXM A;  4X65 I;  4DR4 I;  1FNM A;  4M1K A;  4ED4 A;  4DV7 E;  2ZBK B;  3J81 Q;  1Z59 A;  1N32 I;  4LFB E;  2LJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...