5C0XE

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
267
structure length
267
Chain Sequence
GHMSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPISLISFAIYSALNSTYLPKLISAFDDLEVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
total genus 67
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5c0xE00
2WNRB 2C39B 2NN6D 4IFDE 2PNZB 2BR2A 4OO1D 5C0XD 3GLLA 1OYSA 2BA0G 3L7ZB 5JEAC 3GMEA 5K36E 5JEAF 3B4TA 4AIMA 2C38B 2NN6C 1R6LA 2BR2B 3M7ND 4AIDA 1E3HA 4OO1C 2BA1G 2NN6F 2JEAB 5C0XC 2C38A 4OO1F 5C0XF 2JEAA 5JEAB 4BA1A 4IFDD 3M85G 3H1CA 2NN6B 5JEAA 1OYRA 4OO1B 2PO1A 1UDOA 5C0XB 2NN6A 2PO0A 3GCMA 4OO1A 5K36D 2JEBB 5C0XA 1E3PA 4BA1B 2JE6B 5JEAE 4IFDC 4IFDA 3U1KA 2JEBA 3KRNA 4IFDF 2JE6A 2NN6E 4NBQA 2PO1B 4AM3A 1UDNA 3M7NG 4OO1E 2BA0D 2PO2B 2PO0B 5C0XE 5K36C 2C37B 5K36A 2PO2A 2WP8B 5K36F 4IFDB 2BA1D 1R6MA 2WNRA 2C39A 2C37A 1UDQA 4BA2B 2PNZA 2WP8A 1UDSA 3CDJA 3DD6A 3CDIA 4BA2A 5JEAD 1OYPA 5K36B 3L7ZA 3M85D 3HKMA
chains in the Genus database with same CATH superfamily
2V2QA 4PRVA 4B3RE 4B3MI 1EA6A 1Z0CA 2C39B 2NN6D 4DV3E 4LF6E 3V5RA 3J80C 5L3JA 1RREA 4X66E 1Z5CA 4PRXA 1IBMI 2XEXA 2A2CA 1OYSA 4FWDA 4MU3A 1XNRI 1N32I 4DV6I 5GMDA 1FJGE 4HY1A 2J65A 4GKKI 2X7IA 2BA0G 3PS3A 2E1RA 4JI7I 5A2QC 1ZM4A 4JI2E 1VI7A 4DV5E 4OO1C 4ED4A 4DR5I 2JT2A 4R1FA 4LFCI 4XTJA 4DUZI 4DPXA 4JI0I 4DV1E 2JEAA 1FNMA 1WUUA 2EFGA 1IBME 4OX9I 1XNRE 1N32E 5JEAA 4DV6E 4GKKE 4IZKB 4OO1B 4LFAI 2UXBE 1QZRA 2Z5BA 2O1VA 2NN6A 2PO0A 3GCMA 3P3CA 4DR5E 2JE6B 4DU8A 2HFSA 4LFCE 4IFDA 2HKJA 1DARA 2HHHI 4JI0E 4LFBI 1HR0I 4B3SI 3B78A 2UXCE 4FW4A 3U1YA 1N34I 3V2UC 3UHMA 1PKPA 5K36A 2Z5CB 2PO2A 2WP8B 4LFAE 1S4EA 4HYMA 2C39A 1MU5A 2DEIA 2UUCI 4DR7E 2UU9I 3CDJA 1ELOA 2CGEA 1ZXNA 1FKAE 3DD6A 3QT6A 5DRPA 4DV4I 3CDIA 2ZM6I 1PVGA 1IBKE 4JI3E 2J7KA 5DRQA 2V2VA 2HHHE 2UXDE 1HR0E 4B3SE 4FW3A 5EKWA 4IZJB 1Z5BA 5DNLA 2AE8A 1H73A 2UUBI 1K47A 1N34E 2BM0A 4JV5E 1H7SA 4DU7A 4P52A 5C0XD 4LPFA 4Z7CA 2CZ9A 1ZM2A 4LF7E 4MU1A 5FWKA 1N33E 4J3DA 1USUA 1Z0BA 4DV7E 5JEAF 3B4TA 4AIMA 1HNXI 2UU9E 3LTOA 2V8PA 1NHJA 4DV4E 2ZM6E 5LL6R 3WU5A 1RHYA 2NN6F 4I3HA 3J7AM 4DPTA 4AQYI 1Z59A 3ZKBA 2C38A 1Z0WA 1P42A 4LF8I 1H74A 1Y5YA 4DXLA 2UUBE 1XMQI 4IFDD 2IERA 4DUYE 3M85G 1ZXMA 5LMUE 3H1CA 4USKA 1Y4SA 1Z0GA 3Q6MA 2X36A 4K0KI 1FWLA 5LMNI 1U2RA 5IT9Q 1NHIA 5K36D 1NHHA 5ELWA 4FWHA 5C0XA 2Z5CA 4B3ME 4HACA 5JEAE 4AQYE 4LF9I 1PIEA 4UT4A 3U1KA 2JEBA 1KIJA 4LF8E 3P3EA 4U3BA 4GQUA 2NN6E 4ZVIA 1UDNA 2E5LI 4OZEA 4X62I 1ZM9A 4LF5I 1B62A 5DRRA 4YHHI 2C37B 4JI7E 1HNWI 2BA1D 4JI8I 3ZZ0A 3OTOI 2IOQA 4X64I 1MX0A 3LPSA 4BA2B 2IESA 3PYFA 4DR6I 4DUZE 4PU9A 4KQVA 3ZZUA 2VESA 1OYPA 1FWKA 3PS1A 4OKGA 2E5LE 4OX9E 4X62E 3QT7A 4LCFA 1B63A 2PNZB 3Q6NA 4OO1D 4NXNI 3PS2A 4DR4I 4JI6I 5IT9C 5IWAI 2ZITA 4MQYA 2AJ4A 2Z5EA 2R42A 1A6FA 1KTVA 2WW4A 4JI8E 4IS9A 4DV2I 4X64E 3L7ZB 5JEAC 4NXMI 3B8HA 4FW7A 4DPUA 3J7AG 2GO3A 4FN5A 2V2ZA 4DR6E 2NN6C 1R6LA 2BR2B 1N36I 3M7ND 4X65I 4LCHA 1E3HA 4DR3I 5DNXA 3T1HI 4LFBE 2JEAB 1H7UA 3LNUA 2LJPA 5C0XF 2GS8A 3CWVA 1N0VC 4N3OA 3ZKDA 5JEAB 2R3VA 4NXNE 4DR4E 1USVA 4JI6E 4EMDA 5IWAE 2GQ0A 3HJCA 2ZBKB 4RPFA 4DV0I 4B3RI 2NN6B 1OYRA 4DV3I 4LF6I 2UUCE 1RR9A 3Q1QA 4DV2E 4NXME 1J5EI 1Y4UA 3HULA 1UDOA 3PYEA 2BV3A 2O1UA 1IBLI 4IZKA 1XNQI 4OO1A 3J81Q 2BM1A 1N36E 1Z5AA 4QNJA 2PNMA 3T1HE 2DEJA 4BA1B 2F4VI 4UTGA 4B3TI 4MDTA 4HXZA 2CVEA 4U3DA 4IZJD 3WU4A 4FW5A 4YY3I 1Y6ZA 4IFDF 2JE6A 2UUAI 2PO1B 3PYDA 1HK7A 2BA0D 2PO2B 3JAMQ 1XHKA 1XMOI 2NPFA 4DR2I 2O1WA 5C0XE 4DV0E 4JG4A 3PRYA 3K85A 3QT8A 4LF4I 4DV1I 1HNXE 1J5EE 3QT5A 5K36F 4FW9A 1KKHA 4URLA 4FWGA 1IBLE 1XNQE 5FLXQ 2PNZA 2GO4A 2WP8A 1UDSA 4ISAA 3M6AA 2F4VE 2UXBI 4B3TE 3B82A 4YY3E 1YHCA 4LCGA 1FI4A 3L7ZA 1H72C 1XMQE 3HKMA 4LOMA 2UUAE 2WNRB 1XMOE 4DR2E 4IFDE 2BR2A 4P7AA 1YH8A 3ZZTA 3ZM7A 4K0KE 1Z0VA 2CG9A 5GMEA 3J81C 5LMNE 4JI5I 4IZJA 3GLLA 4LF4E 2UXCI 2HKEA 4JYAI 1EI1A 3GONA 4MYTA 1VISA 3GMEA 2VQEI 4LF9E 2O1TA 3P76A 4WUDA 2VQFI 2A2DA 4QNKA 2IOPA 5K36E 3WU6A 3H4LA 1N0UA 1KVKA 2C38B 1D6TA 1ZM3A 4AIDA 3JAMC 2BA1G 5C0XC 2OI2A 2HK3A 4LF5E 4OO1F 4DR7I 1I94I 1BKNA 4YHHE 4GKJI 1MG7A 1IBKI 4JI3I 4KHPI 5BR8I 1HNWE 3T1YI 4BA1A 5FLXC 3OTOE 4WUBA 4JI5E 2UXDI 4JI1I 4MYUA 1HNZI 4JYAE 2F1DA 2PO1A 3J80Q 1Z0EA 2O3ZA 4USMA 2VQEE 4JV5I 5C0XB 2VQFE 4MU0A 2HFUA 4Z7YA 1Y60A 1Z0TA 4HACB 3PYGA 4LF7I 2JEBB 1N33I 3D4JA 4JI4I 1E3PA 4IFDC 4DV7I 4DR1I 2V34A 5EL9A 3KRNA 1I94E 3F0NA 5A2QQ 4GKJE 4NBQA 4AM3A 1S16A 4KHPE 5BR8E 1XXEA 3M7NG 2Z5BB 3T1YE 4OO1E 3K1JA 2PO0B 2PNLA 4JI1E 3WU3A 4X66I 4MU4A 5K36C 1HNZE 2Q2EB 3P06A 4IFDB 5DROA 1FJGI 1R6MA 2WNRA 4X65E 1UEKA 4DR3E 3NZKA 4DUYI 2C37A 5LMUI 1UDQA 1OJ4A 3P3GA 4JI4E 4M1KA 4JI2I 4DPWA 4BA2A 4DR1E 4DV5I 5JEAD 2VF3A 1NZ0A 5K36B 3M85D 4DPYA 3K17A 4WUCA 2HK2A 4FW6A
chains in the Genus database with same CATH topology
2WNRB 2C39B 2NN6D 4IFDE 2PNZB 2BR2A 4OO1D 5C0XD 3GLLA 1OYSA 2BA0G 3L7ZB 5JEAC 3GMEA 5K36E 5JEAF 3B4TA 4AIMA 2C38B 2NN6C 1R6LA 2BR2B 3M7ND 4AIDA 1E3HA 4OO1C 2BA1G 2NN6F 2JEAB 5C0XC 2C38A 4OO1F 5C0XF 2JEAA 5JEAB 4BA1A 4IFDD 3M85G 3H1CA 2NN6B 5JEAA 1OYRA 4OO1B 2PO1A 1UDOA 5C0XB 2NN6A 2PO0A 3GCMA 4OO1A 5K36D 2JEBB 5C0XA 1E3PA 4BA1B 2JE6B 5JEAE 4IFDC 4IFDA 3U1KA 2JEBA 3KRNA 4IFDF 2JE6A 2NN6E 4NBQA 2PO1B 4AM3A 1UDNA 3M7NG 4OO1E 2BA0D 2PO2B 2PO0B 5C0XE 5K36C 2C37B 5K36A 2PO2A 2WP8B 5K36F 4IFDB 2BA1D 1R6MA 2WNRA 2C39A 2C37A 1UDQA 4BA2B 2PNZA 2WP8A 1UDSA 3CDJA 3DD6A 3CDIA 4BA2A 5JEAD 1OYPA 5K36B 3L7ZA 3M85D 3HKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNR B;  2C39 B;  2NN6 D;  4IFD E;  2PNZ B;  2BR2 A;  4OO1 D;  5C0X D;  3GLL A;  1OYS A;  2BA0 G;  3L7Z B;  5JEA C;  3GME A;  5K36 E;  5JEA F;  3B4T A;  4AIM A;  2C38 B;  2NN6 C;  1R6L A;  2BR2 B;  3M7N D;  4AID A;  1E3H A;  4OO1 C;  2BA1 G;  2NN6 F;  2JEA B;  5C0X C;  2C38 A;  4OO1 F;  5C0X F;  2JEA A;  5JEA B;  4BA1 A;  4IFD D;  3M85 G;  3H1C A;  2NN6 B;  5JEA A;  1OYR A;  4OO1 B;  2PO1 A;  1UDO A;  5C0X B;  2NN6 A;  2PO0 A;  3GCM A;  4OO1 A;  5K36 D;  2JEB B;  5C0X A;  1E3P A;  4BA1 B;  2JE6 B;  5JEA E;  4IFD C;  4IFD A;  3U1K A;  2JEB A;  3KRN A;  4IFD F;  2JE6 A;  2NN6 E;  4NBQ A;  2PO1 B;  4AM3 A;  1UDN A;  3M7N G;  4OO1 E;  2BA0 D;  2PO2 B;  2PO0 B;  5C0X E;  5K36 C;  2C37 B;  5K36 A;  2PO2 A;  2WP8 B;  5K36 F;  4IFD B;  2BA1 D;  1R6M A;  2WNR A;  2C39 A;  2C37 A;  1UDQ A;  4BA2 B;  2PNZ A;  2WP8 A;  1UDS A;  3CDJ A;  3DD6 A;  3CDI A;  4BA2 A;  5JEA D;  1OYP A;  5K36 B;  3L7Z A;  3M85 D;  3HKM A; 
#chains in the Genus database with same CATH topology
 2V2Q A;  4PRV A;  4B3R E;  4B3M I;  1EA6 A;  1Z0C A;  2C39 B;  2NN6 D;  4DV3 E;  4LF6 E;  3V5R A;  3J80 C;  5L3J A;  1RRE A;  4X66 E;  1Z5C A;  4PRX A;  1IBM I;  2XEX A;  2A2C A;  1OYS A;  4FWD A;  4MU3 A;  1XNR I;  1N32 I;  4DV6 I;  5GMD A;  1FJG E;  4HY1 A;  2J65 A;  4GKK I;  2X7I A;  2BA0 G;  3PS3 A;  2E1R A;  4JI7 I;  5A2Q C;  1ZM4 A;  4JI2 E;  1VI7 A;  4DV5 E;  4OO1 C;  4ED4 A;  4DR5 I;  2JT2 A;  4R1F A;  4LFC I;  4XTJ A;  4DUZ I;  4DPX A;  4JI0 I;  4DV1 E;  2JEA A;  1FNM A;  1WUU A;  2EFG A;  1IBM E;  4OX9 I;  1XNR E;  1N32 E;  5JEA A;  4DV6 E;  4GKK E;  4IZK B;  4OO1 B;  4LFA I;  2UXB E;  1QZR A;  2Z5B A;  2O1V A;  2NN6 A;  2PO0 A;  3GCM A;  3P3C A;  4DR5 E;  2JE6 B;  4DU8 A;  2HFS A;  4LFC E;  4IFD A;  2HKJ A;  1DAR A;  2HHH I;  4JI0 E;  4LFB I;  1HR0 I;  4B3S I;  3B78 A;  2UXC E;  4FW4 A;  3U1Y A;  1N34 I;  3V2U C;  3UHM A;  1PKP A;  5K36 A;  2Z5C B;  2PO2 A;  2WP8 B;  4LFA E;  1S4E A;  4HYM A;  2C39 A;  1MU5 A;  2DEI A;  2UUC I;  4DR7 E;  2UU9 I;  3CDJ A;  1ELO A;  2CGE A;  1ZXN A;  1FKA E;  3DD6 A;  3QT6 A;  5DRP A;  4DV4 I;  3CDI A;  2ZM6 I;  1PVG A;  1IBK E;  4JI3 E;  2J7K A;  5DRQ A;  2V2V A;  2HHH E;  2UXD E;  1HR0 E;  4B3S E;  4FW3 A;  5EKW A;  4IZJ B;  1Z5B A;  5DNL A;  2AE8 A;  1H73 A;  2UUB I;  1K47 A;  1N34 E;  2BM0 A;  4JV5 E;  1H7S A;  4DU7 A;  4P52 A;  5C0X D;  4LPF A;  4Z7C A;  2CZ9 A;  1ZM2 A;  4LF7 E;  4MU1 A;  5FWK A;  1N33 E;  4J3D A;  1USU A;  1Z0B A;  4DV7 E;  5JEA F;  3B4T A;  4AIM A;  1HNX I;  2UU9 E;  3LTO A;  2V8P A;  1NHJ A;  4DV4 E;  2ZM6 E;  5LL6 R;  3WU5 A;  1RHY A;  2NN6 F;  4I3H A;  3J7A M;  4DPT A;  4AQY I;  1Z59 A;  3ZKB A;  2C38 A;  1Z0W A;  1P42 A;  4LF8 I;  1H74 A;  1Y5Y A;  4DXL A;  2UUB E;  1XMQ I;  4IFD D;  2IER A;  4DUY E;  3M85 G;  1ZXM A;  5LMU E;  3H1C A;  4USK A;  1Y4S A;  1Z0G A;  3Q6M A;  2X36 A;  4K0K I;  1FWL A;  5LMN I;  1U2R A;  5IT9 Q;  1NHI A;  5K36 D;  1NHH A;  5ELW A;  4FWH A;  5C0X A;  2Z5C A;  4B3M E;  4HAC A;  5JEA E;  4AQY E;  4LF9 I;  1PIE A;  4UT4 A;  3U1K A;  2JEB A;  1KIJ A;  4LF8 E;  3P3E A;  4U3B A;  4GQU A;  2NN6 E;  4ZVI A;  1UDN A;  2E5L I;  4OZE A;  4X62 I;  1ZM9 A;  4LF5 I;  1B62 A;  5DRR A;  4YHH I;  2C37 B;  4JI7 E;  1HNW I;  2BA1 D;  4JI8 I;  3ZZ0 A;  3OTO I;  2IOQ A;  4X64 I;  1MX0 A;  3LPS A;  4BA2 B;  2IES A;  3PYF A;  4DR6 I;  4DUZ E;  4PU9 A;  4KQV A;  3ZZU A;  2VES A;  1OYP A;  1FWK A;  3PS1 A;  4OKG A;  2E5L E;  4OX9 E;  4X62 E;  3QT7 A;  4LCF A;  1B63 A;  2PNZ B;  3Q6N A;  4OO1 D;  4NXN I;  3PS2 A;  4DR4 I;  4JI6 I;  5IT9 C;  5IWA I;  2ZIT A;  4MQY A;  2AJ4 A;  2Z5E A;  2R42 A;  1A6F A;  1KTV A;  2WW4 A;  4JI8 E;  4IS9 A;  4DV2 I;  4X64 E;  3L7Z B;  5JEA C;  4NXM I;  3B8H A;  4FW7 A;  4DPU A;  3J7A G;  2GO3 A;  4FN5 A;  2V2Z A;  4DR6 E;  2NN6 C;  1R6L A;  2BR2 B;  1N36 I;  3M7N D;  4X65 I;  4LCH A;  1E3H A;  4DR3 I;  5DNX A;  3T1H I;  4LFB E;  2JEA B;  1H7U A;  3LNU A;  2LJP A;  5C0X F;  2GS8 A;  3CWV A;  1N0V C;  4N3O A;  3ZKD A;  5JEA B;  2R3V A;  4NXN E;  4DR4 E;  1USV A;  4JI6 E;  4EMD A;  5IWA E;  2GQ0 A;  3HJC A;  2ZBK B;  4RPF A;  4DV0 I;  4B3R I;  2NN6 B;  1OYR A;  4DV3 I;  4LF6 I;  2UUC E;  1RR9 A;  3Q1Q A;  4DV2 E;  4NXM E;  1J5E I;  1Y4U A;  3HUL A;  1UDO A;  3PYE A;  2BV3 A;  2O1U A;  1IBL I;  4IZK A;  1XNQ I;  4OO1 A;  3J81 Q;  2BM1 A;  1N36 E;  1Z5A A;  4QNJ A;  2PNM A;  3T1H E;  2DEJ A;  4BA1 B;  2F4V I;  4UTG A;  4B3T I;  4MDT A;  4HXZ A;  2CVE A;  4U3D A;  4IZJ D;  3WU4 A;  4FW5 A;  4YY3 I;  1Y6Z A;  4IFD F;  2JE6 A;  2UUA I;  2PO1 B;  3PYD A;  1HK7 A;  2BA0 D;  2PO2 B;  3JAM Q;  1XHK A;  1XMO I;  2NPF A;  4DR2 I;  2O1W A;  5C0X E;  4DV0 E;  4JG4 A;  3PRY A;  3K85 A;  3QT8 A;  4LF4 I;  4DV1 I;  1HNX E;  1J5E E;  3QT5 A;  5K36 F;  4FW9 A;  1KKH A;  4URL A;  4FWG A;  1IBL E;  1XNQ E;  5FLX Q;  2PNZ A;  2GO4 A;  2WP8 A;  1UDS A;  4ISA A;  3M6A A;  2F4V E;  2UXB I;  4B3T E;  3B82 A;  4YY3 E;  1YHC A;  4LCG A;  1FI4 A;  3L7Z A;  1H72 C;  1XMQ E;  3HKM A;  4LOM A;  2UUA E;  2WNR B;  1XMO E;  4DR2 E;  4IFD E;  2BR2 A;  4P7A A;  1YH8 A;  3ZZT A;  3ZM7 A;  4K0K E;  1Z0V A;  2CG9 A;  5GME A;  3J81 C;  5LMN E;  4JI5 I;  4IZJ A;  3GLL A;  4LF4 E;  2UXC I;  2HKE A;  4JYA I;  1EI1 A;  3GON A;  4MYT A;  1VIS A;  3GME A;  2VQE I;  4LF9 E;  2O1T A;  3P76 A;  4WUD A;  2VQF I;  2A2D A;  4QNK A;  2IOP A;  5K36 E;  3WU6 A;  3H4L A;  1N0U A;  1KVK A;  2C38 B;  1D6T A;  1ZM3 A;  4AID A;  3JAM C;  2BA1 G;  5C0X C;  2OI2 A;  2HK3 A;  4LF5 E;  4OO1 F;  4DR7 I;  1I94 I;  1BKN A;  4YHH E;  4GKJ I;  1MG7 A;  1IBK I;  4JI3 I;  4KHP I;  5BR8 I;  1HNW E;  3T1Y I;  4BA1 A;  5FLX C;  3OTO E;  4WUB A;  4JI5 E;  2UXD I;  4JI1 I;  4MYU A;  1HNZ I;  4JYA E;  2F1D A;  2PO1 A;  3J80 Q;  1Z0E A;  2O3Z A;  4USM A;  2VQE E;  4JV5 I;  5C0X B;  2VQF E;  4MU0 A;  2HFU A;  4Z7Y A;  1Y60 A;  1Z0T A;  4HAC B;  3PYG A;  4LF7 I;  2JEB B;  1N33 I;  3D4J A;  4JI4 I;  1E3P A;  4IFD C;  4DV7 I;  4DR1 I;  2V34 A;  5EL9 A;  3KRN A;  1I94 E;  3F0N A;  5A2Q Q;  4GKJ E;  4NBQ A;  4AM3 A;  1S16 A;  4KHP E;  5BR8 E;  1XXE A;  3M7N G;  2Z5B B;  3T1Y E;  4OO1 E;  3K1J A;  2PO0 B;  2PNL A;  4JI1 E;  3WU3 A;  4X66 I;  4MU4 A;  5K36 C;  1HNZ E;  2Q2E B;  3P06 A;  4IFD B;  5DRO A;  1FJG I;  1R6M A;  2WNR A;  4X65 E;  1UEK A;  4DR3 E;  3NZK A;  4DUY I;  2C37 A;  5LMU I;  1UDQ A;  1OJ4 A;  3P3G A;  4JI4 E;  4M1K A;  4JI2 I;  4DPW A;  4BA2 A;  4DR1 E;  4DV5 I;  5JEA D;  2VF3 A;  1NZ0 A;  5K36 B;  3M85 D;  4DPY A;  3K17 A;  4WUC A;  2HK2 A;  4FW6 A; 
#chains in the Genus database with same CATH homology
 2WNR B;  2C39 B;  2NN6 D;  4IFD E;  2PNZ B;  2BR2 A;  4OO1 D;  5C0X D;  3GLL A;  1OYS A;  2BA0 G;  3L7Z B;  5JEA C;  3GME A;  5K36 E;  5JEA F;  3B4T A;  4AIM A;  2C38 B;  2NN6 C;  1R6L A;  2BR2 B;  3M7N D;  4AID A;  1E3H A;  4OO1 C;  2BA1 G;  2NN6 F;  2JEA B;  5C0X C;  2C38 A;  4OO1 F;  5C0X F;  2JEA A;  5JEA B;  4BA1 A;  4IFD D;  3M85 G;  3H1C A;  2NN6 B;  5JEA A;  1OYR A;  4OO1 B;  2PO1 A;  1UDO A;  5C0X B;  2NN6 A;  2PO0 A;  3GCM A;  4OO1 A;  5K36 D;  2JEB B;  5C0X A;  1E3P A;  4BA1 B;  2JE6 B;  5JEA E;  4IFD C;  4IFD A;  3U1K A;  2JEB A;  3KRN A;  4IFD F;  2JE6 A;  2NN6 E;  4NBQ A;  2PO1 B;  4AM3 A;  1UDN A;  3M7N G;  4OO1 E;  2BA0 D;  2PO2 B;  2PO0 B;  5C0X E;  5K36 C;  2C37 B;  5K36 A;  2PO2 A;  2WP8 B;  5K36 F;  4IFD B;  2BA1 D;  1R6M A;  2WNR A;  2C39 A;  2C37 A;  1UDQ A;  4BA2 B;  2PNZ A;  2WP8 A;  1UDS A;  3CDJ A;  3DD6 A;  3CDI A;  4BA2 A;  5JEA D;  1OYP A;  5K36 B;  3L7Z A;  3M85 D;  3HKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...