5C0XE

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
267
structure length
267
Chain Sequence
GHMSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPISLISFAIYSALNSTYLPKLISAFDDLEVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 67
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5c0xE00
4NBQA 2WNRB 5C0XF 4IFDF 2NN6A 1R6MA 2BA1G 1OYPA 1E3PA 2PO0A 2C38B 2JEAA 5C0XD 5C0XE 2WNRA 4IFDD 4IFDE 3L7ZB 2NN6F 2PO0B 5JEAB 2C38A 5JEAF 2JEAB 3H1CA 2BA1D 5JEAC 2JEBB 2NN6D 2NN6E 3L7ZA 4OO1A 2WP8B 5JEAD 2PO1B 5JEAE 5JEAA 3CDIA 2JEBA 3GMEA 2C37B 4OO1B 4OO1F 2WP8A 4OO1C 2BA0G 3M85D 2PO1A 2C39B 5K36B 2PNZB 3KRNA 1UDSA 3GCMA 4OO1D 4OO1E 3M85G 5K36C 3B4TA 2C37A 2BR2A 2JE6B 1R6LA 3CDJA 2C39A 3HKMA 5K36A 4AIMA 2PNZA 3GLLA 2BA0D 4BA2A 2BR2B 2JE6A 4BA1A 5C0XB 4IFDB 5K36F 5C0XC 1UDNA 4BA2B 1OYRA 4IFDC 1UDOA 3U1KA 4BA1B 2PO2B 5C0XA 5K36D 1UDQA 3M7ND 1OYSA 4AIDA 5K36E 1E3HA 3DD6A 4IFDA 2NN6B 3M7NG 4AM3A 2NN6C 2PO2A
chains in the Genus database with same CATH superfamily
2WNRB 4LF7E 3J7AM 2DEIA 2NN6A 4FW4A 4DR4E 4DV4E 4LFBE 2AE8A 4FW3A 5C0XD 4DR1I 4MYUA 3P06A 1U2RA 4MU3A 4MYTA 4HYMA 1USVA 3L7ZB 3GONA 2NN6F 3T1HE 2O1TA 4LOMA 4B3TI 2IOPA 4JI5I 3JAMQ 4LFAE 2C38A 4JI0E 2UUAI 1XNQE 2JEBB 3ZKBA 2IERA 1H74A 4QNKA 4ISAA 5JEAD 5DROA 1HNWI 2HK2A 4OZEA 5JEAA 2V2QA 4MQYA 3J81C 1J5EI 1NHJA 4DV0I 2VQEE 5ELWA 4DV1E 5BR8I 4DR7I 2CVEA 3K17A 3F0NA 2JT2A 3M85D 4X62I 2HKJA 4JI3I 2Z5BA 3KRNA 4FW5A 1Z5AA 2HFUA 1XMQE 3GCMA 4OO1D 1RREA 2UXDI 1Z0CA 3OTOE 1N32E 2C37A 4URLA 4XTJA 1Y60A 1FKAE 1Y6ZA 4NXNE 2Z5CB 4LF7I 1FWLA 5K36A 4DR4I 4BA2A 4DV4I 4DPTA 4LFBI 1Z0TA 4FWDA 1P42A 1PVGA 2CG9A 4LF6E 2E5LI 2HFSA 4DUZE 3T1HI 4FN5A 5K36F 3B82A 1UDNA 4DPWA 4DU8A 4BA2B 2Z5EA 2O3ZA 4LFAI 2HHHE 1NHHA 4JV5E 1HNXE 4JI0I 4P7AA 2UXCE 3NZKA 1XNQI 4JYAE 4LF9E 5IT9Q 4DV2E 4GKJE 1E3HA 1Z0EA 1Z5BA 4N3OA 4IFDA 4NXME 2J7KA 4DV6E 1EI1A 5DRQA 4DR5E 1N0UA 2BV3A 3M7NG 5LL6R 1ZM3A 1N34E 2UUBI 4DV1I 4R1FA 4WUDA 4IFDF 2DEJA 4M1KA 2VQFE 1J5EE 4DR6I 2PNMA 1H72C 3WU6A 1OYPA 1XMQI 1ZM4A 2O1WA 5BR8E 5C0XE 1S4EA 2ZM6I 1N32I 2WNRA 2GO4A 5FLXC 4YHHI 4LPFA 5GMDA 4NXNI 2V34A 3Q1QA 3QT6A 1RHYA 3ZZ0A 3H1CA 2BA1D 4FWHA 2NN6D 2V2VA 3L7ZA 4HY1A 4LF6I 1ZM2A 2WP8B 1N36E 5JEAE 4DUZI 4YY3E 2HHHI 4JV5I 1HNXI 4MU1A 2JEBA 2E5LE 2UXCI 4EMDA 1D6TA 1XNRE 4IZJB 1Y4SA 4JYAI 4LF9I 4DV2I 1HR0E 4GKJI 2BA0G 2C39B 4NXMI 3ZKDA 4DV6I 3J80C 4DR5I 2EFGA 1UDSA 4OO1E 1XHKA 4JI8E 2HKEA 3B4TA 1IBKE 2CZ9A 2BR2A 1N34I 4JI1E 2JE6B 1I94E 1PKPA 1R6LA 3CDJA 3PS3A 3WU3A 4FW6A 2VQFI 4AIMA 2NPFA 2BM1A 3GLLA 3HJCA 4JI6I 1NZ0A 4MU4A 2VF3A 2E1RA 2UU9I 2UUBE 2BR2B 3PYDA 5IWAE 5GMEA 5LMNE 2Z5CA 4DPXA 5C0XB 1H7SA 5EL9A 4DR6E 5LMUE 1N33E 5DNXA 5C0XC 2UUCE 1OYRA 1MU5A 4AQYE 2ZM6E 1FWKA 1VISA 4DR2E 3P3CA 4OKGA 4YHHE 4LF4I 5K36D 3M7ND 1OYSA 4AIDA 4B3RE 4DV3E 1H7UA 3J81Q 4GQUA 1N36I 4YY3I 4KQVA 2IESA 1HK7A 2X7IA 5DNLA 1XNRI 1H73A 4DPUA 3P3GA 1B63A 4FW9A 4DR3E 4JI4E 3LPSA 1HR0I 1R6MA 3PYEA 4LCGA 5DRRA 3QT5A 1HNZE 4B3ME 1PIEA 4X66E 4JI8I 1WUUA 4Z7CA 4LF5E 3LTOA 4IFDD 5A2QC 1IBKI 4I3HA 3K85A 1Y4UA 4JI1I 1I94I 2LJPA 4IZKB 4DUYE 1MX0A 4WUCA 4WUBA 1YH8A 2V2ZA 4MDTA 4DV7E 2NN6E 2J65A 4RPFA 5IWAI 1ELOA 5LMNI 4DU7A 4JI6E 2PO1B 1FNMA 1EA6A 3K1JA 5LMUI 1N33I 1K47A 2UU9E 1S16A 1IBMI 2UUCI 1ZXMA 2XEXA 3UHMA 4FW7A 4LCFA 4AQYI 4B3SI 3CDIA 1OJ4A 3PS2A 3GMEA 1KTVA 4DR2I 4UTGA 4LFCI 2WP8A 4LF8E 3JAMC 3J7AG 4B3RI 2AJ4A 5DRPA 4DV3I 2PNLA 5EKWA 2PNZB 1N0VC 1B62A 3P3EA 2OI2A 2R42A 4LF4E 4IZJA 4JI7I 1XMOE 3V5RA 4UT4A 4Z7YA 4JI4I 4JI2I 4DR3I 1ZXNA 2C39A 5FWKA 1KKHA 1FJGE 1HNZI 4B3MI 1NHIA 4X66I 5FLXQ 1KVKA 4LF5I 2JE6A 2WW4A 2UXBE 4KHPE 3PS1A 2BM0A 4DUYI 4HACB 1UDOA 3ZM7A 4IS9A 4JG4A 4ED4A 4LCHA 4J3DA 4DV7I 3U1YA 2R3VA 3ZZUA 2PO2B 1YHCA 5C0XA 1UDQA 5K36E 1Z5CA 4DV5I 3ZZTA 1FI4A 2NN6B 3P76A 2O1VA 4MU0A 1KIJA 4AM3A 2NN6C 4K0KE 2VESA 3WU4A 4HXZA 3M6AA 4NBQA 5C0XF 3PYGA 4LF8I 2X36A 4X65E 4DPYA 1IBME 3J80Q 4ZVIA 1Z0BA 4OX9I 1QZRA 2BA1G 3Q6NA 4B3SE 1E3PA 2PO0A 1XXEA 2C38B 2HK3A 2JEAA 1DARA 4LFCE 1VI7A 4FWGA 1ZM9A 4IFDE 1IBLI 1XMOI 4U3DA 4U3BA 3PRYA 3T1YE 4GKKE 1MG7A 4USMA 1FJGI 2PO0B 5JEAB 5JEAF 2JEAB 1Z59A 2A2DA 2F4VE 3B78A 4JI7E 5JEAC 4DXLA 1RR9A 4P52A 4OO1A 4JI2E 2UXBI 4PU9A 4IZKA 4KHPI 5IT9C 3HULA 4X64E 2Z5BB 1Z0GA 3CWVA 2C37B 4OO1B 4OO1F 1Z0WA 2O1UA 5L3JA 4OO1C 2PO1A 2Q2EB 5K36B 4DR1E 2V8PA 3M85G 1UEKA 2GQ0A 5K36C 4PRXA 4K0KI 4USKA 3H4LA 4DV5E 3LNUA 3D4JA 4X65I 4B3TE 3HKMA 2PNZA 4JI5E 2BA0D 1Y5YA 5A2QQ 2UUAE 1BKNA 1A6FA 4BA1A 2VQEI 4OX9E 3WU5A 3T1YI 1Z0VA 4IFDB 3V2UC 1HNWE 4GKKI 2GS8A 2A2CA 3QT7A 4IZJD 4IFDC 4DV0E 4PRVA 2F4VI 3B8HA 1USUA 2IOQA 3U1KA 1IBLE 4BA1B 4DR7E 3Q6MA 3OTOI 3QT8A 3DD6A 2GO3A 4X62E 2F1DA 4QNJA 4JI3E 4HACA 4X64I 2ZITA 3PYFA 2ZBKB 2UXDE 2CGEA 2PO2A
chains in the Genus database with same CATH topology
4NBQA 2WNRB 5C0XF 4IFDF 2NN6A 1R6MA 2BA1G 1OYPA 1E3PA 2PO0A 2C38B 2JEAA 5C0XD 5C0XE 2WNRA 4IFDD 4IFDE 3L7ZB 2NN6F 2PO0B 5JEAB 2C38A 5JEAF 2JEAB 3H1CA 2BA1D 5JEAC 2JEBB 2NN6D 2NN6E 3L7ZA 4OO1A 2WP8B 5JEAD 2PO1B 5JEAE 5JEAA 3CDIA 2JEBA 3GMEA 2C37B 4OO1B 4OO1F 2WP8A 4OO1C 2BA0G 3M85D 2PO1A 2C39B 5K36B 2PNZB 3KRNA 1UDSA 3GCMA 4OO1D 4OO1E 3M85G 5K36C 3B4TA 2C37A 2BR2A 2JE6B 1R6LA 3CDJA 2C39A 3HKMA 5K36A 4AIMA 2PNZA 3GLLA 2BA0D 4BA2A 2BR2B 2JE6A 4BA1A 5C0XB 4IFDB 5K36F 5C0XC 1UDNA 4BA2B 1OYRA 4IFDC 1UDOA 3U1KA 4BA1B 2PO2B 5C0XA 5K36D 1UDQA 3M7ND 1OYSA 4AIDA 5K36E 1E3HA 3DD6A 4IFDA 2NN6B 3M7NG 4AM3A 2NN6C 2PO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBQ A;  2WNR B;  5C0X F;  4IFD F;  2NN6 A;  1R6M A;  2BA1 G;  1OYP A;  1E3P A;  2PO0 A;  2C38 B;  2JEA A;  5C0X D;  5C0X E;  2WNR A;  4IFD D;  4IFD E;  3L7Z B;  2NN6 F;  2PO0 B;  5JEA B;  2C38 A;  5JEA F;  2JEA B;  3H1C A;  2BA1 D;  5JEA C;  2JEB B;  2NN6 D;  2NN6 E;  3L7Z A;  4OO1 A;  2WP8 B;  5JEA D;  2PO1 B;  5JEA E;  5JEA A;  3CDI A;  2JEB A;  3GME A;  2C37 B;  4OO1 B;  4OO1 F;  2WP8 A;  4OO1 C;  2BA0 G;  3M85 D;  2PO1 A;  2C39 B;  5K36 B;  2PNZ B;  3KRN A;  1UDS A;  3GCM A;  4OO1 D;  4OO1 E;  3M85 G;  5K36 C;  3B4T A;  2C37 A;  2BR2 A;  2JE6 B;  1R6L A;  3CDJ A;  2C39 A;  3HKM A;  5K36 A;  4AIM A;  2PNZ A;  3GLL A;  2BA0 D;  4BA2 A;  2BR2 B;  2JE6 A;  4BA1 A;  5C0X B;  4IFD B;  5K36 F;  5C0X C;  1UDN A;  4BA2 B;  1OYR A;  4IFD C;  1UDO A;  3U1K A;  4BA1 B;  2PO2 B;  5C0X A;  5K36 D;  1UDQ A;  3M7N D;  1OYS A;  4AID A;  5K36 E;  1E3H A;  3DD6 A;  4IFD A;  2NN6 B;  3M7N G;  4AM3 A;  2NN6 C;  2PO2 A; 
#chains in the Genus database with same CATH topology
 2WNR B;  4LF7 E;  3J7A M;  2DEI A;  2NN6 A;  4FW4 A;  4DR4 E;  4DV4 E;  4LFB E;  2AE8 A;  4FW3 A;  5C0X D;  4DR1 I;  4MYU A;  3P06 A;  1U2R A;  4MU3 A;  4MYT A;  4HYM A;  1USV A;  3L7Z B;  3GON A;  2NN6 F;  3T1H E;  2O1T A;  4LOM A;  4B3T I;  2IOP A;  4JI5 I;  3JAM Q;  4LFA E;  2C38 A;  4JI0 E;  2UUA I;  1XNQ E;  2JEB B;  3ZKB A;  2IER A;  1H74 A;  4QNK A;  4ISA A;  5JEA D;  5DRO A;  1HNW I;  2HK2 A;  4OZE A;  5JEA A;  2V2Q A;  4MQY A;  3J81 C;  1J5E I;  1NHJ A;  4DV0 I;  2VQE E;  5ELW A;  4DV1 E;  5BR8 I;  4DR7 I;  2CVE A;  3K17 A;  3F0N A;  2JT2 A;  3M85 D;  4X62 I;  2HKJ A;  4JI3 I;  2Z5B A;  3KRN A;  4FW5 A;  1Z5A A;  2HFU A;  1XMQ E;  3GCM A;  4OO1 D;  1RRE A;  2UXD I;  1Z0C A;  3OTO E;  1N32 E;  2C37 A;  4URL A;  4XTJ A;  1Y60 A;  1FKA E;  1Y6Z A;  4NXN E;  2Z5C B;  4LF7 I;  1FWL A;  5K36 A;  4DR4 I;  4BA2 A;  4DV4 I;  4DPT A;  4LFB I;  1Z0T A;  4FWD A;  1P42 A;  1PVG A;  2CG9 A;  4LF6 E;  2E5L I;  2HFS A;  4DUZ E;  3T1H I;  4FN5 A;  5K36 F;  3B82 A;  1UDN A;  4DPW A;  4DU8 A;  4BA2 B;  2Z5E A;  2O3Z A;  4LFA I;  2HHH E;  1NHH A;  4JV5 E;  1HNX E;  4JI0 I;  4P7A A;  2UXC E;  3NZK A;  1XNQ I;  4JYA E;  4LF9 E;  5IT9 Q;  4DV2 E;  4GKJ E;  1E3H A;  1Z0E A;  1Z5B A;  4N3O A;  4IFD A;  4NXM E;  2J7K A;  4DV6 E;  1EI1 A;  5DRQ A;  4DR5 E;  1N0U A;  2BV3 A;  3M7N G;  5LL6 R;  1ZM3 A;  1N34 E;  2UUB I;  4DV1 I;  4R1F A;  4WUD A;  4IFD F;  2DEJ A;  4M1K A;  2VQF E;  1J5E E;  4DR6 I;  2PNM A;  1H72 C;  3WU6 A;  1OYP A;  1XMQ I;  1ZM4 A;  2O1W A;  5BR8 E;  5C0X E;  1S4E A;  2ZM6 I;  1N32 I;  2WNR A;  2GO4 A;  5FLX C;  4YHH I;  4LPF A;  5GMD A;  4NXN I;  2V34 A;  3Q1Q A;  3QT6 A;  1RHY A;  3ZZ0 A;  3H1C A;  2BA1 D;  4FWH A;  2NN6 D;  2V2V A;  3L7Z A;  4HY1 A;  4LF6 I;  1ZM2 A;  2WP8 B;  1N36 E;  5JEA E;  4DUZ I;  4YY3 E;  2HHH I;  4JV5 I;  1HNX I;  4MU1 A;  2JEB A;  2E5L E;  2UXC I;  4EMD A;  1D6T A;  1XNR E;  4IZJ B;  1Y4S A;  4JYA I;  4LF9 I;  4DV2 I;  1HR0 E;  4GKJ I;  2BA0 G;  2C39 B;  4NXM I;  3ZKD A;  4DV6 I;  3J80 C;  4DR5 I;  2EFG A;  1UDS A;  4OO1 E;  1XHK A;  4JI8 E;  2HKE A;  3B4T A;  1IBK E;  2CZ9 A;  2BR2 A;  1N34 I;  4JI1 E;  2JE6 B;  1I94 E;  1PKP A;  1R6L A;  3CDJ A;  3PS3 A;  3WU3 A;  4FW6 A;  2VQF I;  4AIM A;  2NPF A;  2BM1 A;  3GLL A;  3HJC A;  4JI6 I;  1NZ0 A;  4MU4 A;  2VF3 A;  2E1R A;  2UU9 I;  2UUB E;  2BR2 B;  3PYD A;  5IWA E;  5GME A;  5LMN E;  2Z5C A;  4DPX A;  5C0X B;  1H7S A;  5EL9 A;  4DR6 E;  5LMU E;  1N33 E;  5DNX A;  5C0X C;  2UUC E;  1OYR A;  1MU5 A;  4AQY E;  2ZM6 E;  1FWK A;  1VIS A;  4DR2 E;  3P3C A;  4OKG A;  4YHH E;  4LF4 I;  5K36 D;  3M7N D;  1OYS A;  4AID A;  4B3R E;  4DV3 E;  1H7U A;  3J81 Q;  4GQU A;  1N36 I;  4YY3 I;  4KQV A;  2IES A;  1HK7 A;  2X7I A;  5DNL A;  1XNR I;  1H73 A;  4DPU A;  3P3G A;  1B63 A;  4FW9 A;  4DR3 E;  4JI4 E;  3LPS A;  1HR0 I;  1R6M A;  3PYE A;  4LCG A;  5DRR A;  3QT5 A;  1HNZ E;  4B3M E;  1PIE A;  4X66 E;  4JI8 I;  1WUU A;  4Z7C A;  4LF5 E;  3LTO A;  4IFD D;  5A2Q C;  1IBK I;  4I3H A;  3K85 A;  1Y4U A;  4JI1 I;  1I94 I;  2LJP A;  4IZK B;  4DUY E;  1MX0 A;  4WUC A;  4WUB A;  1YH8 A;  2V2Z A;  4MDT A;  4DV7 E;  2NN6 E;  2J65 A;  4RPF A;  5IWA I;  1ELO A;  5LMN I;  4DU7 A;  4JI6 E;  2PO1 B;  1FNM A;  1EA6 A;  3K1J A;  5LMU I;  1N33 I;  1K47 A;  2UU9 E;  1S16 A;  1IBM I;  2UUC I;  1ZXM A;  2XEX A;  3UHM A;  4FW7 A;  4LCF A;  4AQY I;  4B3S I;  3CDI A;  1OJ4 A;  3PS2 A;  3GME A;  1KTV A;  4DR2 I;  4UTG A;  4LFC I;  2WP8 A;  4LF8 E;  3JAM C;  3J7A G;  4B3R I;  2AJ4 A;  5DRP A;  4DV3 I;  2PNL A;  5EKW A;  2PNZ B;  1N0V C;  1B62 A;  3P3E A;  2OI2 A;  2R42 A;  4LF4 E;  4IZJ A;  4JI7 I;  1XMO E;  3V5R A;  4UT4 A;  4Z7Y A;  4JI4 I;  4JI2 I;  4DR3 I;  1ZXN A;  2C39 A;  5FWK A;  1KKH A;  1FJG E;  1HNZ I;  4B3M I;  1NHI A;  4X66 I;  5FLX Q;  1KVK A;  4LF5 I;  2JE6 A;  2WW4 A;  2UXB E;  4KHP E;  3PS1 A;  2BM0 A;  4DUY I;  4HAC B;  1UDO A;  3ZM7 A;  4IS9 A;  4JG4 A;  4ED4 A;  4LCH A;  4J3D A;  4DV7 I;  3U1Y A;  2R3V A;  3ZZU A;  2PO2 B;  1YHC A;  5C0X A;  1UDQ A;  5K36 E;  1Z5C A;  4DV5 I;  3ZZT A;  1FI4 A;  2NN6 B;  3P76 A;  2O1V A;  4MU0 A;  1KIJ A;  4AM3 A;  2NN6 C;  4K0K E;  2VES A;  3WU4 A;  4HXZ A;  3M6A A;  4NBQ A;  5C0X F;  3PYG A;  4LF8 I;  2X36 A;  4X65 E;  4DPY A;  1IBM E;  3J80 Q;  4ZVI A;  1Z0B A;  4OX9 I;  1QZR A;  2BA1 G;  3Q6N A;  4B3S E;  1E3P A;  2PO0 A;  1XXE A;  2C38 B;  2HK3 A;  2JEA A;  1DAR A;  4LFC E;  1VI7 A;  4FWG A;  1ZM9 A;  4IFD E;  1IBL I;  1XMO I;  4U3D A;  4U3B A;  3PRY A;  3T1Y E;  4GKK E;  1MG7 A;  4USM A;  1FJG I;  2PO0 B;  5JEA B;  5JEA F;  2JEA B;  1Z59 A;  2A2D A;  2F4V E;  3B78 A;  4JI7 E;  5JEA C;  4DXL A;  1RR9 A;  4P52 A;  4OO1 A;  4JI2 E;  2UXB I;  4PU9 A;  4IZK A;  4KHP I;  5IT9 C;  3HUL A;  4X64 E;  2Z5B B;  1Z0G A;  3CWV A;  2C37 B;  4OO1 B;  4OO1 F;  1Z0W A;  2O1U A;  5L3J A;  4OO1 C;  2PO1 A;  2Q2E B;  5K36 B;  4DR1 E;  2V8P A;  3M85 G;  1UEK A;  2GQ0 A;  5K36 C;  4PRX A;  4K0K I;  4USK A;  3H4L A;  4DV5 E;  3LNU A;  3D4J A;  4X65 I;  4B3T E;  3HKM A;  2PNZ A;  4JI5 E;  2BA0 D;  1Y5Y A;  5A2Q Q;  2UUA E;  1BKN A;  1A6F A;  4BA1 A;  2VQE I;  4OX9 E;  3WU5 A;  3T1Y I;  1Z0V A;  4IFD B;  3V2U C;  1HNW E;  4GKK I;  2GS8 A;  2A2C A;  3QT7 A;  4IZJ D;  4IFD C;  4DV0 E;  4PRV A;  2F4V I;  3B8H A;  1USU A;  2IOQ A;  3U1K A;  1IBL E;  4BA1 B;  4DR7 E;  3Q6M A;  3OTO I;  3QT8 A;  3DD6 A;  2GO3 A;  4X62 E;  2F1D A;  4QNJ A;  4JI3 E;  4HAC A;  4X64 I;  2ZIT A;  3PYF A;  2ZBK B;  2UXD E;  2CGE A;  2PO2 A; 
#chains in the Genus database with same CATH homology
 4NBQ A;  2WNR B;  5C0X F;  4IFD F;  2NN6 A;  1R6M A;  2BA1 G;  1OYP A;  1E3P A;  2PO0 A;  2C38 B;  2JEA A;  5C0X D;  5C0X E;  2WNR A;  4IFD D;  4IFD E;  3L7Z B;  2NN6 F;  2PO0 B;  5JEA B;  2C38 A;  5JEA F;  2JEA B;  3H1C A;  2BA1 D;  5JEA C;  2JEB B;  2NN6 D;  2NN6 E;  3L7Z A;  4OO1 A;  2WP8 B;  5JEA D;  2PO1 B;  5JEA E;  5JEA A;  3CDI A;  2JEB A;  3GME A;  2C37 B;  4OO1 B;  4OO1 F;  2WP8 A;  4OO1 C;  2BA0 G;  3M85 D;  2PO1 A;  2C39 B;  5K36 B;  2PNZ B;  3KRN A;  1UDS A;  3GCM A;  4OO1 D;  4OO1 E;  3M85 G;  5K36 C;  3B4T A;  2C37 A;  2BR2 A;  2JE6 B;  1R6L A;  3CDJ A;  2C39 A;  3HKM A;  5K36 A;  4AIM A;  2PNZ A;  3GLL A;  2BA0 D;  4BA2 A;  2BR2 B;  2JE6 A;  4BA1 A;  5C0X B;  4IFD B;  5K36 F;  5C0X C;  1UDN A;  4BA2 B;  1OYR A;  4IFD C;  1UDO A;  3U1K A;  4BA1 B;  2PO2 B;  5C0X A;  5K36 D;  1UDQ A;  3M7N D;  1OYS A;  4AID A;  5K36 E;  1E3H A;  3DD6 A;  4IFD A;  2NN6 B;  3M7N G;  4AM3 A;  2NN6 C;  2PO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...