5C0XE

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
267
structure length
267
Chain Sequence
GHMSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPISLISFAIYSALNSTYLPKLISAFDDLEVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 67
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5c0xE00
5K36D 1UDQA 3L7ZA 2JEBA 4IFDD 5C0XC 4IFDF 4OO1C 4OO1A 2JEAB 1UDSA 5K36E 2PO0B 2NN6D 1OYSA 4OO1F 4OO1D 2JEBB 1OYRA 5JEAB 4IFDA 4IFDC 5JEAC 5K36C 2C37B 2PNZA 2BA0G 4BA1B 4AIMA 3GCMA 4BA2A 3M7NG 4IFDE 1R6LA 1UDNA 1R6MA 3GMEA 1OYPA 2PO0A 1E3PA 5JEAE 2JEAA 5JEAA 4IFDB 2NN6B 4OO1B 3HKMA 2JE6B 2WP8A 2WNRA 2PO1B 2BR2B 3CDIA 2PNZB 2BA1D 2WP8B 3GLLA 3L7ZB 2BA1G 3U1KA 4BA2B 2C38B 5JEAF 2NN6E 4BA1A 3KRNA 3DD6A 2WNRB 1UDOA 2NN6A 2C39B 5C0XF 3H1CA 5K36B 3CDJA 5C0XB 1E3HA 5JEAD 5C0XA 3M7ND 4AIDA 4NBQA 5K36A 2JE6A 2PO1A 2BA0D 2NN6F 3M85D 4OO1E 4AM3A 3B4TA 2PO2B 2NN6C 3M85G 5C0XE 2BR2A 2C37A 2PO2A 2C38A 5K36F 2C39A 5C0XD
chains in the Genus database with same CATH superfamily
5BR8I 3PS2A 2O1TA 4Z7YA 1UDQA 4MQYA 1H74A 2JEBA 1I94I 4LF7E 4GKKI 4X66E 1ZM9A 3UHMA 1N36E 4RPFA 4X66I 3B8HA 4DR6I 2HK3A 4MDTA 5DRQA 2F4VI 4UTGA 4Z7CA 2LJPA 4YY3E 5EL9A 1KVKA 4JI4I 4YY3I 4OO1D 3D4JA 1KIJA 1MG7A 4GQUA 1IBKE 4IFDC 1N34I 4NXME 2ZBKB 4FW7A 1ZM3A 4WUCA 1H73A 3LPSA 4BA1B 3ZKDA 1YHCA 3ZKBA 4BA2A 1HK7A 1UEKA 1BKNA 4B3RI 3PS1A 1IBME 4FWDA 3T1YI 4DR7I 4AQYI 1XMOE 5IT9C 2O1VA 4DR3E 3WU5A 2HKJA 1HNWI 1MX0A 4KHPE 5JEAA 1Y5YA 2UUAI 3B78A 2JE6B 4KHPI 2Z5CB 2BA1D 4MU4A 1FWLA 2UU9E 1QZRA 4B3TI 1Z0BA 4LF7I 4GKKE 1H72C 4M1KA 2E1RA 5JEAF 2NPFA 2NN6E 4JI2E 3DD6A 3HJCA 4WUDA 2F4VE 4U3DA 4MU3A 4PU9A 4LCFA 1NZ0A 4I3HA 3LTOA 1XNQI 3H1CA 4JI1E 2F1DA 2O3ZA 5C0XB 2PNLA 4XTJA 1A6FA 3J80Q 1PKPA 4AIDA 4DV3E 2PO1A 1USVA 4FN5A 5DROA 5LL6R 2UUBI 1IBLI 3J81C 2V34A 3JAMQ 4UT4A 4QNKA 2VQFE 1IBLE 3JAMC 2Z5CA 4DV4E 4B3MI 1N36I 2UXBE 2C37A 3LNUA 3QT7A 2UUCE 4JI7E 5DNXA 2X36A 1ZXNA 5C0XD 2A2DA 5K36D 1Z0WA 2BM0A 3L7ZA 2CG9A 4IZJA 4JI6E 1ZM2A 1XMQE 5C0XC 2Z5BA 4HYMA 4IFDF 3WU6A 1XMQI 3OTOE 4DPTA 4LF6E 4DV1I 4USKA 2IOQA 5K36E 4LF6I 2A2CA 2GO3A 3QT8A 3J7AG 4FW4A 4JV5I 3P06A 4MYUA 3P3CA 5DRPA 4JI0I 1OYRA 5JEAB 1FNMA 2Z5EA 2VQEI 4DUZI 2PNZA 2ZM6I 3WU4A 4YHHI 4DV2I 4JI5I 5DNLA 4LF5I 3HULA 4AIMA 1ZM4A 3GCMA 3K85A 3Q6MA 3T1HI 4IFDE 4DR2E 3ZZTA 4OKGA 3GMEA 1XMOI 1OJ4A 2E5LE 2Q2EB 1RREA 2PO0A 4HACA 1Z59A 2JEAA 3B82A 2NN6B 5EKWA 4PRXA 2UUCI 2ZITA 4DR4I 4DU8A 4B3TE 5FLXQ 4OZEA 4LFAE 2WP8B 5IT9Q 3GLLA 3H4LA 4LFBE 4LFAI 4X64E 1EI1A 2C38B 4JI1I 5FWKA 4X65E 1KKHA 3J81Q 4DV0E 3KRNA 4JI4E 2V2VA 4DXLA 4DV3I 2WNRB 2NN6A 3J80C 2O1WA 4R1FA 4LOMA 4IZKB 5C0XF 1HNZE 5K36B 4DR1E 3CWVA 1E3HA 2GS8A 4LCHA 2O1UA 4NBQA 5K36A 2HKEA 4DU7A 1ZXMA 1U2RA 2BA0D 4X62I 4B3RE 4HXZA 4QNJA 4DV5I 1Z0TA 1Z0EA 4B3ME 1I94E 1Z0GA 2HFUA 4DV6E 3M85G 4HY1A 1Z0CA 2BR2A 4DV6I 1Y4SA 4JI3I 5FLXC 2UXCI 3J7AM 1Z5CA 2UUAE 2V2ZA 1N33I 1Z5BA 3PRYA 2CZ9A 4DPWA 2BV3A 2HFSA 2J65A 2UU9I 2XEXA 1PVGA 4OX9E 4OO1A 2R3VA 3QT6A 2DEIA 4MU1A 4WUBA 1FI4A 2PO0B 4GKJI 3PYDA 3M6AA 4LFCE 4K0KI 3NZKA 4IFDA 1Y6ZA 3WU3A 5JEAC 2IOPA 2JT2A 1XNQE 2GO4A 5K36C 2AE8A 2C37B 1IBMI 1Y60A 2BA0G 2IESA 2E5LI 3ZM7A 4LF8I 1J5EI 1RR9A 1HNZI 5ELWA 3M7NG 4LF8E 4EMDA 1UDNA 4NXNI 1R6MA 4FW3A 2UXDE 1YH8A 5L3JA 4DV4I 2R42A 1OYPA 3K1JA 3P3GA 1KTVA 1K47A 5JEAE 5LMNI 3V5RA 2HK2A 4DR5E 4X64I 1N0UA 4OO1B 2DEJA 1HR0I 4DR4E 5LMNE 5BR8E 2WNRA 4DR5I 2CGEA 4PRVA 1S16A 2PNMA 3CDIA 4MU0A 2PNZB 4P52A 4DR6E 5LMUI 5GMDA 3U1KA 3F0NA 4JYAE 5IWAI 1N34E 1EA6A 4LF9I 4ED4A 5DRRA 5GMEA 2X7IA 2C39B 4DR1I 4NXMI 1FWKA 4DV5E 4DV7E 4B3SE 4ISAA 4LFCI 3ZZ0A 1DARA 4JI5E 3V2UC 4DV7I 3M7ND 4YHHE 4DV2E 3PYFA 1FJGE 4JI3E 2UXCE 4KQVA 4OO1E 2NN6F 1VI7A 4JI8E 1FKAE 4FWHA 4DUYE 1HNWE 4LF5E 1Z5AA 2NN6C 3U1YA 1J5EE 4AQYE 3T1YE 3T1HE 4DR7E 2J7KA 2AJ4A 2C38A 2GQ0A 5A2QQ 5K36F 4MYTA 2C39A 1NHJA 1XHKA 2V2QA 2OI2A 1RHYA 1H7SA 4FW9A 4J3DA 4DPYA 1HNXE 4IFDD 2BM1A 4FW6A 5A2QC 1HNXI 1XXEA 4LFBI 4JI7I 4OO1C 2JEAB 4IS9A 1UDSA 2NN6D 1OYSA 4OO1F 4DUZE 4DV0I 4N3OA 2EFGA 4K0KE 2JEBB 4IZKA 5IWAE 3P3EA 4URLA 1WUUA 4LF9E 2V8PA 3GONA 4P7AA 2Z5BB 3Q6NA 3K17A 4JV5E 1D6TA 2CVEA 4X62E 1IBKI 2UXBI 1R6LA 3ZZUA 3P76A 2HHHI 4LCGA 2HHHE 2WW4A 3PYEA 1MU5A 1VISA 1NHHA 5LMUE 4JI6I 3Q1QA 1E3PA 1B62A 1Y4UA 4LF4I 4IFDB 4JG4A 1P42A 3HKMA 1S4EA 2WP8A 3PS3A 4LF4E 2PO1B 4DV1E 2BR2B 1N33E 4IZJB 4U3BA 2IERA 2VESA 4USMA 3L7ZB 2BA1G 4ZVIA 4DPXA 1XNRE 4DR3I 4JYAI 3OTOI 1XNRI 4JI0E 4BA2B 4FWGA 4BA1A 4FW5A 3PYGA 1UDOA 2ZM6E 4LPFA 1USUA 4GKJE 1H7UA 4B3SI 4IZJD 2VQEE 4JI8I 1N0VC 1B63A 4DUYI 3CDJA 4JI2I 4X65I 1ELOA 1PIEA 5JEAD 5C0XA 1FJGI 2JE6A 4DPUA 3M85D 1N32E 4HACB 4AM3A 3B4TA 3QT5A 4DR2I 2UXDI 2PO2B 1N32I 1NHIA 4NXNE 1Z0VA 2VQFI 5C0XE 2PO2A 2VF3A 4OX9I 2UUBE 1HR0E
chains in the Genus database with same CATH topology
5K36D 1UDQA 3L7ZA 2JEBA 4IFDD 5C0XC 4IFDF 4OO1C 4OO1A 2JEAB 1UDSA 5K36E 2PO0B 2NN6D 1OYSA 4OO1F 4OO1D 2JEBB 1OYRA 5JEAB 4IFDA 4IFDC 5JEAC 5K36C 2C37B 2PNZA 2BA0G 4BA1B 4AIMA 3GCMA 4BA2A 3M7NG 4IFDE 1R6LA 1UDNA 1R6MA 3GMEA 1OYPA 2PO0A 1E3PA 5JEAE 2JEAA 5JEAA 4IFDB 2NN6B 4OO1B 3HKMA 2JE6B 2WP8A 2WNRA 2PO1B 2BR2B 3CDIA 2PNZB 2BA1D 2WP8B 3GLLA 3L7ZB 2BA1G 3U1KA 4BA2B 2C38B 5JEAF 2NN6E 4BA1A 3KRNA 3DD6A 2WNRB 1UDOA 2NN6A 2C39B 5C0XF 3H1CA 5K36B 3CDJA 5C0XB 1E3HA 5JEAD 5C0XA 3M7ND 4AIDA 4NBQA 5K36A 2JE6A 2PO1A 2BA0D 2NN6F 3M85D 4OO1E 4AM3A 3B4TA 2PO2B 2NN6C 3M85G 5C0XE 2BR2A 2C37A 2PO2A 2C38A 5K36F 2C39A 5C0XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 D;  1UDQ A;  3L7Z A;  2JEB A;  4IFD D;  5C0X C;  4IFD F;  4OO1 C;  4OO1 A;  2JEA B;  1UDS A;  5K36 E;  2PO0 B;  2NN6 D;  1OYS A;  4OO1 F;  4OO1 D;  2JEB B;  1OYR A;  5JEA B;  4IFD A;  4IFD C;  5JEA C;  5K36 C;  2C37 B;  2PNZ A;  2BA0 G;  4BA1 B;  4AIM A;  3GCM A;  4BA2 A;  3M7N G;  4IFD E;  1R6L A;  1UDN A;  1R6M A;  3GME A;  1OYP A;  2PO0 A;  1E3P A;  5JEA E;  2JEA A;  5JEA A;  4IFD B;  2NN6 B;  4OO1 B;  3HKM A;  2JE6 B;  2WP8 A;  2WNR A;  2PO1 B;  2BR2 B;  3CDI A;  2PNZ B;  2BA1 D;  2WP8 B;  3GLL A;  3L7Z B;  2BA1 G;  3U1K A;  4BA2 B;  2C38 B;  5JEA F;  2NN6 E;  4BA1 A;  3KRN A;  3DD6 A;  2WNR B;  1UDO A;  2NN6 A;  2C39 B;  5C0X F;  3H1C A;  5K36 B;  3CDJ A;  5C0X B;  1E3H A;  5JEA D;  5C0X A;  3M7N D;  4AID A;  4NBQ A;  5K36 A;  2JE6 A;  2PO1 A;  2BA0 D;  2NN6 F;  3M85 D;  4OO1 E;  4AM3 A;  3B4T A;  2PO2 B;  2NN6 C;  3M85 G;  5C0X E;  2BR2 A;  2C37 A;  2PO2 A;  2C38 A;  5K36 F;  2C39 A;  5C0X D; 
#chains in the Genus database with same CATH topology
 5BR8 I;  3PS2 A;  2O1T A;  4Z7Y A;  1UDQ A;  4MQY A;  1H74 A;  2JEB A;  1I94 I;  4LF7 E;  4GKK I;  4X66 E;  1ZM9 A;  3UHM A;  1N36 E;  4RPF A;  4X66 I;  3B8H A;  4DR6 I;  2HK3 A;  4MDT A;  5DRQ A;  2F4V I;  4UTG A;  4Z7C A;  2LJP A;  4YY3 E;  5EL9 A;  1KVK A;  4JI4 I;  4YY3 I;  4OO1 D;  3D4J A;  1KIJ A;  1MG7 A;  4GQU A;  1IBK E;  4IFD C;  1N34 I;  4NXM E;  2ZBK B;  4FW7 A;  1ZM3 A;  4WUC A;  1H73 A;  3LPS A;  4BA1 B;  3ZKD A;  1YHC A;  3ZKB A;  4BA2 A;  1HK7 A;  1UEK A;  1BKN A;  4B3R I;  3PS1 A;  1IBM E;  4FWD A;  3T1Y I;  4DR7 I;  4AQY I;  1XMO E;  5IT9 C;  2O1V A;  4DR3 E;  3WU5 A;  2HKJ A;  1HNW I;  1MX0 A;  4KHP E;  5JEA A;  1Y5Y A;  2UUA I;  3B78 A;  2JE6 B;  4KHP I;  2Z5C B;  2BA1 D;  4MU4 A;  1FWL A;  2UU9 E;  1QZR A;  4B3T I;  1Z0B A;  4LF7 I;  4GKK E;  1H72 C;  4M1K A;  2E1R A;  5JEA F;  2NPF A;  2NN6 E;  4JI2 E;  3DD6 A;  3HJC A;  4WUD A;  2F4V E;  4U3D A;  4MU3 A;  4PU9 A;  4LCF A;  1NZ0 A;  4I3H A;  3LTO A;  1XNQ I;  3H1C A;  4JI1 E;  2F1D A;  2O3Z A;  5C0X B;  2PNL A;  4XTJ A;  1A6F A;  3J80 Q;  1PKP A;  4AID A;  4DV3 E;  2PO1 A;  1USV A;  4FN5 A;  5DRO A;  5LL6 R;  2UUB I;  1IBL I;  3J81 C;  2V34 A;  3JAM Q;  4UT4 A;  4QNK A;  2VQF E;  1IBL E;  3JAM C;  2Z5C A;  4DV4 E;  4B3M I;  1N36 I;  2UXB E;  2C37 A;  3LNU A;  3QT7 A;  2UUC E;  4JI7 E;  5DNX A;  2X36 A;  1ZXN A;  5C0X D;  2A2D A;  5K36 D;  1Z0W A;  2BM0 A;  3L7Z A;  2CG9 A;  4IZJ A;  4JI6 E;  1ZM2 A;  1XMQ E;  5C0X C;  2Z5B A;  4HYM A;  4IFD F;  3WU6 A;  1XMQ I;  3OTO E;  4DPT A;  4LF6 E;  4DV1 I;  4USK A;  2IOQ A;  5K36 E;  4LF6 I;  2A2C A;  2GO3 A;  3QT8 A;  3J7A G;  4FW4 A;  4JV5 I;  3P06 A;  4MYU A;  3P3C A;  5DRP A;  4JI0 I;  1OYR A;  5JEA B;  1FNM A;  2Z5E A;  2VQE I;  4DUZ I;  2PNZ A;  2ZM6 I;  3WU4 A;  4YHH I;  4DV2 I;  4JI5 I;  5DNL A;  4LF5 I;  3HUL A;  4AIM A;  1ZM4 A;  3GCM A;  3K85 A;  3Q6M A;  3T1H I;  4IFD E;  4DR2 E;  3ZZT A;  4OKG A;  3GME A;  1XMO I;  1OJ4 A;  2E5L E;  2Q2E B;  1RRE A;  2PO0 A;  4HAC A;  1Z59 A;  2JEA A;  3B82 A;  2NN6 B;  5EKW A;  4PRX A;  2UUC I;  2ZIT A;  4DR4 I;  4DU8 A;  4B3T E;  5FLX Q;  4OZE A;  4LFA E;  2WP8 B;  5IT9 Q;  3GLL A;  3H4L A;  4LFB E;  4LFA I;  4X64 E;  1EI1 A;  2C38 B;  4JI1 I;  5FWK A;  4X65 E;  1KKH A;  3J81 Q;  4DV0 E;  3KRN A;  4JI4 E;  2V2V A;  4DXL A;  4DV3 I;  2WNR B;  2NN6 A;  3J80 C;  2O1W A;  4R1F A;  4LOM A;  4IZK B;  5C0X F;  1HNZ E;  5K36 B;  4DR1 E;  3CWV A;  1E3H A;  2GS8 A;  4LCH A;  2O1U A;  4NBQ A;  5K36 A;  2HKE A;  4DU7 A;  1ZXM A;  1U2R A;  2BA0 D;  4X62 I;  4B3R E;  4HXZ A;  4QNJ A;  4DV5 I;  1Z0T A;  1Z0E A;  4B3M E;  1I94 E;  1Z0G A;  2HFU A;  4DV6 E;  3M85 G;  4HY1 A;  1Z0C A;  2BR2 A;  4DV6 I;  1Y4S A;  4JI3 I;  5FLX C;  2UXC I;  3J7A M;  1Z5C A;  2UUA E;  2V2Z A;  1N33 I;  1Z5B A;  3PRY A;  2CZ9 A;  4DPW A;  2BV3 A;  2HFS A;  2J65 A;  2UU9 I;  2XEX A;  1PVG A;  4OX9 E;  4OO1 A;  2R3V A;  3QT6 A;  2DEI A;  4MU1 A;  4WUB A;  1FI4 A;  2PO0 B;  4GKJ I;  3PYD A;  3M6A A;  4LFC E;  4K0K I;  3NZK A;  4IFD A;  1Y6Z A;  3WU3 A;  5JEA C;  2IOP A;  2JT2 A;  1XNQ E;  2GO4 A;  5K36 C;  2AE8 A;  2C37 B;  1IBM I;  1Y60 A;  2BA0 G;  2IES A;  2E5L I;  3ZM7 A;  4LF8 I;  1J5E I;  1RR9 A;  1HNZ I;  5ELW A;  3M7N G;  4LF8 E;  4EMD A;  1UDN A;  4NXN I;  1R6M A;  4FW3 A;  2UXD E;  1YH8 A;  5L3J A;  4DV4 I;  2R42 A;  1OYP A;  3K1J A;  3P3G A;  1KTV A;  1K47 A;  5JEA E;  5LMN I;  3V5R A;  2HK2 A;  4DR5 E;  4X64 I;  1N0U A;  4OO1 B;  2DEJ A;  1HR0 I;  4DR4 E;  5LMN E;  5BR8 E;  2WNR A;  4DR5 I;  2CGE A;  4PRV A;  1S16 A;  2PNM A;  3CDI A;  4MU0 A;  2PNZ B;  4P52 A;  4DR6 E;  5LMU I;  5GMD A;  3U1K A;  3F0N A;  4JYA E;  5IWA I;  1N34 E;  1EA6 A;  4LF9 I;  4ED4 A;  5DRR A;  5GME A;  2X7I A;  2C39 B;  4DR1 I;  4NXM I;  1FWK A;  4DV5 E;  4DV7 E;  4B3S E;  4ISA A;  4LFC I;  3ZZ0 A;  1DAR A;  4JI5 E;  3V2U C;  4DV7 I;  3M7N D;  4YHH E;  4DV2 E;  3PYF A;  1FJG E;  4JI3 E;  2UXC E;  4KQV A;  4OO1 E;  2NN6 F;  1VI7 A;  4JI8 E;  1FKA E;  4FWH A;  4DUY E;  1HNW E;  4LF5 E;  1Z5A A;  2NN6 C;  3U1Y A;  1J5E E;  4AQY E;  3T1Y E;  3T1H E;  4DR7 E;  2J7K A;  2AJ4 A;  2C38 A;  2GQ0 A;  5A2Q Q;  5K36 F;  4MYT A;  2C39 A;  1NHJ A;  1XHK A;  2V2Q A;  2OI2 A;  1RHY A;  1H7S A;  4FW9 A;  4J3D A;  4DPY A;  1HNX E;  4IFD D;  2BM1 A;  4FW6 A;  5A2Q C;  1HNX I;  1XXE A;  4LFB I;  4JI7 I;  4OO1 C;  2JEA B;  4IS9 A;  1UDS A;  2NN6 D;  1OYS A;  4OO1 F;  4DUZ E;  4DV0 I;  4N3O A;  2EFG A;  4K0K E;  2JEB B;  4IZK A;  5IWA E;  3P3E A;  4URL A;  1WUU A;  4LF9 E;  2V8P A;  3GON A;  4P7A A;  2Z5B B;  3Q6N A;  3K17 A;  4JV5 E;  1D6T A;  2CVE A;  4X62 E;  1IBK I;  2UXB I;  1R6L A;  3ZZU A;  3P76 A;  2HHH I;  4LCG A;  2HHH E;  2WW4 A;  3PYE A;  1MU5 A;  1VIS A;  1NHH A;  5LMU E;  4JI6 I;  3Q1Q A;  1E3P A;  1B62 A;  1Y4U A;  4LF4 I;  4IFD B;  4JG4 A;  1P42 A;  3HKM A;  1S4E A;  2WP8 A;  3PS3 A;  4LF4 E;  2PO1 B;  4DV1 E;  2BR2 B;  1N33 E;  4IZJ B;  4U3B A;  2IER A;  2VES A;  4USM A;  3L7Z B;  2BA1 G;  4ZVI A;  4DPX A;  1XNR E;  4DR3 I;  4JYA I;  3OTO I;  1XNR I;  4JI0 E;  4BA2 B;  4FWG A;  4BA1 A;  4FW5 A;  3PYG A;  1UDO A;  2ZM6 E;  4LPF A;  1USU A;  4GKJ E;  1H7U A;  4B3S I;  4IZJ D;  2VQE E;  4JI8 I;  1N0V C;  1B63 A;  4DUY I;  3CDJ A;  4JI2 I;  4X65 I;  1ELO A;  1PIE A;  5JEA D;  5C0X A;  1FJG I;  2JE6 A;  4DPU A;  3M85 D;  1N32 E;  4HAC B;  4AM3 A;  3B4T A;  3QT5 A;  4DR2 I;  2UXD I;  2PO2 B;  1N32 I;  1NHI A;  4NXN E;  1Z0V A;  2VQF I;  5C0X E;  2PO2 A;  2VF3 A;  4OX9 I;  2UUB E;  1HR0 E; 
#chains in the Genus database with same CATH homology
 5K36 D;  1UDQ A;  3L7Z A;  2JEB A;  4IFD D;  5C0X C;  4IFD F;  4OO1 C;  4OO1 A;  2JEA B;  1UDS A;  5K36 E;  2PO0 B;  2NN6 D;  1OYS A;  4OO1 F;  4OO1 D;  2JEB B;  1OYR A;  5JEA B;  4IFD A;  4IFD C;  5JEA C;  5K36 C;  2C37 B;  2PNZ A;  2BA0 G;  4BA1 B;  4AIM A;  3GCM A;  4BA2 A;  3M7N G;  4IFD E;  1R6L A;  1UDN A;  1R6M A;  3GME A;  1OYP A;  2PO0 A;  1E3P A;  5JEA E;  2JEA A;  5JEA A;  4IFD B;  2NN6 B;  4OO1 B;  3HKM A;  2JE6 B;  2WP8 A;  2WNR A;  2PO1 B;  2BR2 B;  3CDI A;  2PNZ B;  2BA1 D;  2WP8 B;  3GLL A;  3L7Z B;  2BA1 G;  3U1K A;  4BA2 B;  2C38 B;  5JEA F;  2NN6 E;  4BA1 A;  3KRN A;  3DD6 A;  2WNR B;  1UDO A;  2NN6 A;  2C39 B;  5C0X F;  3H1C A;  5K36 B;  3CDJ A;  5C0X B;  1E3H A;  5JEA D;  5C0X A;  3M7N D;  4AID A;  4NBQ A;  5K36 A;  2JE6 A;  2PO1 A;  2BA0 D;  2NN6 F;  3M85 D;  4OO1 E;  4AM3 A;  3B4T A;  2PO2 B;  2NN6 C;  3M85 G;  5C0X E;  2BR2 A;  2C37 A;  2PO2 A;  2C38 A;  5K36 F;  2C39 A;  5C0X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...