4ED4A

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
303
structure length
299
Chain Sequence
SDWVPTGAVTVRAPGKVNLYLAVGDLYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 97
structure length 299
sequence length 303
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4ed4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ed4A01
1IBME 1ZM9A 1N32E 1B62A 5LMUE 1HNXE 3F0NA 1MU5A 4WUDA 1HNZE 1Z5BA 3WU3A 3M6AA 4Z7YA 2WW4A 4DV4E 4KHPI 2UU9I 4DR7I 1PVGA 4B3TI 1RR9A 4DV3I 4DR5I 2F4VI 1D6TA 1XMOE 2HFSA 2ZITA 2V2ZA 4JI0I 4LF4I 4DUYE 4DPUA 5BR8E 4JYAI 4DUZE 4DXLA 4X66E 1UEKA 1NHJA 2R3VA 5A2QC 3B78A 3J81Q 4DU8A 2BM1A 3ZZTA 4DPTA 4DV1I 4LF8I 2EFGA 2J7KA 2UXDE 3H4LA 4X64E 4ZVIA 1J5EE 5GMDA 4UTGA 5LMNI 2HFUA 4FWDA 4DV7I 4JV5I 2ZM6I 1FNMA 1PKPA 5IT9C 3WU4A 3J7AG 4LF7E 4YY3I 4B3SE 4JI3I 2HKEA 2LJPA 3V2UC 1N33E 4DV0I 5IWAI 4JI2E 4X62E 4DR3E 3B8HA 1Z0EA 4DV2I 4DR4E 1KVKA 4NXNI 2VQEE 1B63A 4URLA 2UXBI 4JI5I 1PIEA 1RREA 2NPFA 2BM0A 2V8PA 2E5LI 4GKKE 1N36I 1OJ4A 4DR1I 1N34E 4JG4A 1S16A 1XMQE 3JAMQ 2VF3A 2HHHE 2XEXA 4KQVA 3OTOE 4GKJI 4HY1A 3ZM7A 1NHIA 1XNQE 4DV6I 4RPFA 2E1RA 2UXCE 2AJ4A 2UUBE 4OX9E 4Z7CA 4LF6I 4JI4E 1Z0VA 1NZ0A 1XNRE 2V34A 3T1HE 1ZM2A 4AQYI 4PRVA 1IBLE 3J80C 4XTJA 4LFAE 1ZM4A 4DR6I 3T1YI 4LF5I 1FJGI 5FLXC 4JI1E 4B3MI 1H73A 3B82A 4LFCI 4K0KI 2V2VA 1Z5CA 2BV3A 4DR2E 2UUAE 2UU9E 4LFBI 4DR7E 1S4EA 4B3RI 3WU5A 4B3TE 4DV3E 1BKNA 2F4VE 1Z5AA 1H74A 2X7IA 2VQFI 1K47A 3LPSA 2DEIA 1Z0GA 1ZM3A 4LF4E 4USMA 4JYAE 3ZKDA 2V2QA 2UXDI 1I94E 2HKJA 4NXMI 3PYEA 1FKAE 4DV1E 3J7AM 3PYFA 4PRXA 4LF8E 3HULA 4YHHE 5LMNE 4DV7E 1IBKI 3CWVA 5IT9Q 1MX0A 2ZM6E 4JV5E 4EMDA 1HNWI 4DPXA 2UUCI 1N0VC 2VQEI 4LF9I 2X36A 4JI3E 2DEJA 4JI8I 1Z0WA 3PYDA 4X65I 4DV5I 1EA6A 4DV0E 5IWAE 4HXZA 1N34I 3LTOA 4M1KA 2UXBE 4JI5E 1KKHA 1MG7A 2E5LE 1Z0BA 4JI7I 2CZ9A 3ZZUA 1N36E 2Q2EB 4DR1E 1Z59A 3K17A 3V5RA 4JI6E 1HR0E 1XNRI 4GKJE 3WU6A 3QT7A 2HK3A 1IBMI 1IBLI 1FWKA 4DV6E 1N32I 5LMUI 4LFAI 1HNXI 1HNZI 4LF6E 2HK2A 4DV4I 1NHHA 1WUUA 4DPWA 4JI1I 3J80Q 3K1JA 1N0UA 1XMOI 3QT6A 4R1FA 3D4JA 4DR6E 1Z0CA 3T1YE 4DR2I 1DARA 4DUYI 2UUAI 4LF5E 4KHPE 5BR8I 5FLXQ 4HACA 1H7UA 1FJGE 4DUZI 4DR5E 4B3ME 4LFCE 4K0KE 4MYTA 3ZZ0A 4X66I 3LNUA 1QZRA 5LL6R 1KIJA 5L3JA 4JI0E 4PU9A 3J81C 4LFBE 4B3RE 4MYUA 4X64I 1J5EI 1I94I 1Z0TA 3ZKBA 3Q1QA 5A2QQ 4WUBA 2VQFE 1VISA 1ELOA 4HYMA 4P7AA 4LF7I 3PYGA 4UT4A 4B3SI 1ZXMA 2ZBKB 4YHHI 4DPYA 1N33I 4WUCA 4JI2I 4X62I 4NXME 4DR3I 4DR4I 4DU7A 4YY3E 1EI1A 1FWLA 1U2RA 1IBKE 4GKKI 4P52A 4DV2E 5GMEA 2R42A 4I3HA 1XMQI 1HNWE 4NXNE 2HHHI 2UUCE 3JAMC 4ED4A 3OTOI 4LF9E 1H72C 4JI8E 4X65E 4DV5E 1XNQI 3GONA 2UXCI 2A2CA 2UUBI 4OX9I 4HACB 3QT5A 4JI4I 4FWGA 4JI6I 1HR0I 1KTVA 3T1HI 1A6FA 2A2DA 4JI7E 4USKA 2GS8A 4FW9A 2OI2A 4FWHA 3QT8A 4FN5A 1XHKA 4AQYE 1FI4A 1ZXNA 1H7SA
chains in the Genus database with same CATH superfamily
3CJ3A 2DNGA 3Q8UA 4AL5A 1IBMF 1F3VA 1WD6A 4FW5A 1YSJA 2FQQB 3H4DA 3TEGA 3EDQB 4J9LA 3MEGA 2UUWA 5B0CA 2PMHA 5KFJA 4KIAA 3SQGA 3EPIA 4U6PA 3MF5A 4RX6A 5GAGI 3ZTPA 2RQKA 4DR2F 2OMOA 4MKAA 4KE5A 2H54B 3CT9A 3BKFA 3G6ES 4DSLA 3CCRS 4OYXA 5B0EA 1RP5A 3MPVA 5CABA 2ZH8A 4C8LA 2R8HA 4YY3I 1SIZA 2MGZA 4DUYJ 2D3UA 3TJ9A 2R7WA 2MYFA 2QYGA 3KHRA 4LVOP 1KVKA 2IPOB 4AL6A 4DCJB 4ED1A 1UVNA 5KFTA 4ZPDA 4NA3A 1MROA 2J0WA 4IH5A 2X1FA 2WBMA 3D6TB 3R27A 2IHR1 3VAHA 2XEXA 1FRMA 5C24B 5ADZA 4QWAA 1X0FA 3OVAA 3N79A 3HHLA 4Z7CA 2Y1JA 2CADA 2ZH4A 3PS3A 3HI9A 2QMXA 1HR0F 4K2XA 2LDIA 4GKJF 2XY5A 1FESA 1NH7A 2NZCA 4IO9Q 4LREA 3PG9A 3W1YC 2ZH3A 5U47A 3FBBA 2AQ4A 1S1VA 4ZS6A 2PEBA 1G4CA 2FJBB 4Y34A 1X0PA 3ADAC 2G2ZA 1S76D 4USUA 5CD4H 4IS9A 4X84A 3HP6A 4B3TF 1FJGF 2W2MP 4C11A 5KG5A 1TKXB 4WKRA 4LF4E 1FTCA 2DNNA 2BKOA 4ZP8A 3EDRB 4ECXA 2KB2A 2C22A 4JYAF 1N88A 3V6KA 2Z5BB 2B6AB 5EKWA 4PRXA 4GVBB 2DXDA 4NLWA 2YPYA 2C37B 4J9UE 2DRBA 4DV7E 1NJXA 5B0DA 1X9WA 2PFFB 3MCMA 3GIIA 4LSNA 4YS2A 2ZUAA 1NJYA 4KPYA 3EUNA 5KAKA 1Q95G 4B3RJ 3IAM9 3PW4A 5K36B 1U0HB 2DNMA 3W64A 3HZEA 3SV3A 1WDTA 1HNWF 4DV1J 1SPBP 2UUCF 3CCQS 3HFKA 4Q0BB 5KFSA 4P2SA 4P9SA 2R4FA 1NK8A 3JAMU 1SKWA 3GLJA 4DV6E 1N32I 2Q3PA 3C15B 1HNZI 3FQLA 4IFVB 1HQ2A 4LCFA 5F0UA 4DV4I 3GFZA 3DGVA 3W3SA 3JAMY 1WSVA 2XYGB 3OTBA 3QT6A 4OQJA 2GQ0A 4DR6E 4F7VA 1Z0CA 1JLCB 4AM3A 1H7UA 2W1BA 2ZDPA 4Q8FA 1NMEB 5D6GA 4LIRA 2JDJA 3I31A 4JI0E 2HLTA 2XO7A 2J9EA 5LSRA 1XMOF 2X1GA 1UWBB 4CO2A 5K36F 3Q89A 4P2FA 1GQEA 2XBPA 3H25A 3H5UA 1CSJA 1QTMA 4X4PA 3DLLQ 2OP5A 4DU7A 4B9NA 1S1TA 4HI2A 1PBUA 1YGYA 1Z2LA 3W2WA 2G13A 4RBTA 1LW0A 4F3MA 3OTCA 3W65A 4DI6A 4OLOA 4YMEA 2LLZA 1Y6ZA 1NJIT 2R42A 1XMQI 2RHQB 1JNRB 3HDSA 3TJ8A 3JAMC 5FWKA 4BA2A 5C2GA 3BS9A 3C6TA 4JP8A 2K7KA 1SB6A 4EI2A 3PACA 3KJFB 3NEKA 9ATCB 3QT5A 1E6YA 2CQBA 2W9BB 2MB0B 1TV6B 4KYZA 2A2DA 3EZUA 5KFCA 3PZPA 4K8RA 1SL1A 5IT9Y 4UUWA 5KG6A 3GP9A 5IT0A 3JB9k 2YKOA 2DNHA 5LT5A 4FW9A 2Q1LA 2HW3A 2FLLA 4PWDA 2RDIA 3THPA 1ZAXA 3OW2R 1ZM9A 4ECUA 1S1XB 2FJAB 4O4GB 2R7VA 4DV5J 4K59A 3WU3A 2LCWA 2XYHB 2CQPA 3P06A 5DS7A 4HHUA 1FKOA 2HFSA 1RT6B 1RA7A 4H4MA 3GMGA 1TMMA 4PUOA 4DUYE 3EGNA 2CVEA 2ASLA 2WONB 2LFVA 1FVSA 3M32A 3DRYA 2F4VF 5F8NA 4LCHA 2NN6A 1RI7A 3O6QA 5DETA 2RDJA 1UZDA 2GV1A 4ELUA 4L73A 2H1YA 3CCWA 2E7XA 5IT9C 3WU4A 2HRUA 1RT1B 3C14A 3SCIE 4A8FA 1VQYA 1I6JA 1FRIA 1HBMB 4ZCIA 1F9EB 2JEBB 2OPPB 1HHTP 1CJKA 3N5BA 1KWMA 4JV5F 3PX4A 1RREA 4LCGA 1HKAA 1S1WA 4FF3A 2V8DA 3OJSA 1NHVA 2DR6A 3GYXB 4TXSA 1WG1A 2DGSA 4DUTA 1QM9A 1HWIA 1Q8LA 3D67A 2HBZB 3R1LA 3RYLA 5ETQA 3JQJA 3NGRA 4R8UB 3H98A 3OLAA 2UUBE 2P2CB 2YWEA 3BV8A 4F4YA 3D6MB 4F4KA 4RW7A 3MOZA 1LW2B 2FJXA 3T41A 4CYUA 1S6PB 2G2OA 4LFAE 3DOLA 1SC4B 2CNLB 2VH7A 4DOZA 2CQHA 5DNLA 4DFKA 4WZQA 4DLGA 4JI1E 4B3MI 1K1QA 1RACB 2FD2A 2WSFC 3OTOJ 1VMBA 3QIDA 2OAUA 1KONA 1T3OA 4H4OA 3QJJA 2BMBA 4Q2MA 4F04B 3DRPA 5JUMA 2XLIA 3ILLA 3A3NB 3R6LB 1DTTB 3IC1A 2ZOMA 1WHYA 1Z2ZA 3LPSA 4FNIA 2Z30B 2B51A 4E98A 5KFAA 3VR1A 3MMBA 2MKHA 4HL9A 4NLSA 1TMJA 2UXDI 5C0XA 4OZ5A 2PA3A 1S0NA 5KFOA 3AB2B 1FKAE 1RT4A 1CLFA 2C2OB 5L1KA 1Q5VA 4DV1E 1Y5NB 4ZVRB 3RJMB 2H51B 1KHVA 2RUSA 2CNOB 1LWEB 2EXUA 2CDRB 3D68A 1YJNS 3IWXA 3VAJA 1JLAA 2YNHB 4EZ6A 2NN6E 1C1BB 2CWKA 2AEJA 1OPZA 2XNRA 4MIWA 4HXZA 1AYEA 2ZH9A 4IUFA 2H3EB 4ECVA 2NREA 1WHVA 3HFVA 5T14A 4MKVA 3QWUA 3TUPA 2Y1LB 3O3LA 2FYXA 1S7IA 1NSAA 4ZJOA 1MWYA 2B4PA 1JQGA 1N6QA 4ECQA 2ZNZA 3V6JA 3I5CA 1FWKA 2IVYA 4IFDA 5LXRA 1S7HA 1T9WA 5IWAJ 4DV2J 3DM2B 1VBXA 2E1PA 3QGIA 3EM1A 4QJVA 3P6YC 3M2UB 4KO0B 2W8KA 2MKCA 3EZOA 4NZ0A 2UUAI 3MR2A 2POKA 1S12A 2K3KA 4KGZB 2HNYB 4U7CA 2FHMA 3SZ2A 2IM2A 2C3MA 2EG2A 4X66I 2F8MA 4OYOA 2FJWA 1NK7A 3KNAA 5I3UA 1PG5B 4EBDA 1AROP 4ID5B 2I2YA 5KG1A 2JHEA 2BJDA 2Z2YB 5KOWA 2OMLA 1XQIA 2CJQA 1HNZJ 1WF1A 1UTAA 2XSJA 2NUUG 4DV4J 2QLXA 3DDKA 2AZ1A 2ABYA 2PN6A 2HG4A 2RJZA 2BA0G 2GVDB 1HYSB 1RAFB 4AYBD 2GO4A 1IKVA 3IGVA 1U2RA 4C2MA 2H65B 4E2FB 3U7JA 4QWCA 1GH8A 4IFYB 1H98A 3CD5A 1HW8A 4ZVQB 1EIYB 4DV5E 8AT1B 1Y00A 1TELA 2AGQA 3MR6A 4W4MA 3I9ZA 2D74B 4B17A 4KTQA 1L3TA 1WJ9A 3M85G 4O4RA 1T02A 4CI0B 1PBAA 1S9GB 5H9EK 2XULA 4ECTA 4JI4F 4X4OA 5C25B 1T94A 4CWBA 3JXOA 4XTTA 3T1HF 2IA6A 4O44B 3T1AA 1K1SA 3M8PB 4USIA 1Z5BA 4OYPA 2IMOA 4OO1B 4B9SA 1LEOA 5HVFA 1T05A 2JSXA 3ITHB 2XMAA 1RABB 1J5OB 4KAIA 3MEEA 1CJTA 5DRPA 3JYTA 1YI2S 2FY8A 4WFYA 3QLHA 4WXWA 3TNVA 4PQUA 1IBLJ 1SQFA 1JMTA 3BN4A 4FWDA 2VFRA 3MM8A 3HM9A 4WJBA 4DSKA 3D0IE 2MQLA 2QE5A 1X5OA 3PR5B 3S1TA 4ICLA 4MKYA 4MAKA 1T03A 3B8HA 2MQMA 3MM5B 1MN9A 2DHAA 5LMNF 3HHDA 5F9NA 1RAOA 2HSEB 1KTQA 1S99A 1RJJA 2V8PA 4AFFA 2ZBQA 2PSZA 2ZEJA 2VF3A 4QR1A 3OTOE 4GKJI 1Y5LB 4HY1A 1V6HA 4WFAQ 3UNYA 2ACYA 3D1QA 4DCOB 5CD4A 1XK8A 2DXEA 4WP3A 3C3LA 2DB1A 3KK2B 3CCUS 2LMIA 1XNRE 2P5VA 3M4XA 2V34A 1MMLA 1PC5A 2KH9A 3DMJA 4ZN1A 3RUBL 4J7CA 3H7HB 4FPIA 2YXLA 2F4FA 3OXLA 1FJGI 9RUBA 1I5OB 1PKUA 2DR7A 1A0OB 4TLQA 1RT7B 3SFGA 5HMYA 1IR0A 3GJRB 4DSIA 2IBKA 2YX1A 4U96A 1FJEB 1UDOA 3J7A1 1N5TA 2J6UA 1FWPA 3Q86A 2FGCA 2M9KA 1HWLA 4USMA 4X4RA 2KFYA 4R25A 2HMIA 3U1YA 1H7WA 4NPOA 2B7CB 2HKJA 4GVLA 3FDSA 4PPZA 4LRDA 5JEAC 4MU0A 1X5PA 2DHSA 2DGWA 4FXDA 3KUGA 4DR7J 1FFGB 3QATA 4KGVB 4B3MJ 4HT7A 1HNWI 2UUCI 5GMKa 2MLZA 3G9CA 1Z0WA 2KYXA 2B9EA 5IWAE 4AIDA 2RU3A 3WHIA 3NS7B 4RKUC 4OO1D 5KFKA 2HHWA 5A0YB 2BE7D 3IRXA 1Q7LB 4LF8J 3OUYB 4K4YA 1RAAB 2OSQA 3KK3B 3UCGA 4N41A 2DK2A 3WU6A 1YHQS 1RA6A 3JTPA 4RUHA 2VHGA 5DG8A 1VQKS 4FYWB 1OSDA 3I0RB 1UDSA 4CDIA 1UVJA 3KHHA 2EC2A 3VVTA 3NNAA 4DCPB 1H38A 3OHAA 5A6PA 1FK9B 3LWLA 1XMOI 3AD9C 3QIPA 5F8LA 4K7QA 1XMBA 1IKWA 5KFFA 2XSFA 4DR5E 1GX5A 3P5TL 4HHJA 3R97A 3Q22A 3PS2A 3KXDA 2R7SA 3KLGA 1RTDA 2VODA 1ZA2B 4MU3A 3ISND 4WFXA 2XCPA 1RTHB 3T9ZA 3A13A 2C38B 2OELA 2DT9A 4ELVA 1WC5A 1JLFB 1RHRB 1KQSR 3KHLA 3PX0A 2IM3A 2IAJA 4OJGA 2O01C 4HR2A 2BJ8A 1USUA 1RYSA 3NNHA 4K0KJ 3KYLA 1FX2A 1IXKA 1S77D 4H54A 1LKZA 2HS3A 1GTEA 5G4DA 4ZVSB 1CJUA 2JL9A 3ZZZA 2B0GA 1FF2A 3UPFA 4X66J 2Q66A 1LFPA 4ZVTB 2I38A 4C3LA 3D9BA 1H72C 4FPRA 3L7ZA 4KV8B 4G1QB 3LOUA 4HTIA 2OIHA 2DNOA 2KT2A 2HIYA 3SSQA 4DS5A 5D0HA 5D3GA 5HQLA 4OX9I 4HDHA 2AV5A 1JLQA 2NXNA 2ILYA 3LW5C 3M2VA 2DH9A 2C42A 2MLYA 5M2RA 4JI7E 3IWNC 1KFSA 5ETVA 3ILJA 3FNNA 4ZPTR 2MDAA 3H8YA 1DLOA 1RK8A 2F1DA 3OT9A 2VQEJ 2UP1A 3PX6A 1W25A 2OPQB 2HZCA 3PEJA 1HQUB 3DLEB 3CCSS 2CAJA 1RWKB 3BDPA 5K14B 1LK5A 2F4VI 1BMQB 1OSCA 3K5MA 1H3DA 5MAOA 1AZSB 5EDWA 1R8CA 1H2VZ 3PO5A 4YB6A 3MM9B 1YH8A 3M8SA 1YZ6A 2HAFA 4HH1A 1IBMJ 3DU6A 1NSQA 2HHVA 2JC1A 5F9LA 1T7PA 1I1GA 4FYXB 3PR4A 1VQLS 1U24A 3D3CJ 3AJ2A 4LF4F 3ENVA 4C0OC 4JV5I 1KLNA 1FNMA 4LF7E 2YWHA 2VD3A 1ROFA 4I1TA 3T9NA 4DR2J 1WKKA 2CIMA 4ILRA 2RRNA 3OXFA 1VIXA 1PAUB 4HHHA 3DXSX 3PIPQ 2YH0A 1HIYA 4DV7F 1BWEA 1RDRA 2V63A 3N01A 1FFSB 4HI1A 1HQEA 3RBEA 1BQXA 3JAMQ 1R0AA 2OGUA 2WAQD 2MZ1A 2VONA 4A8XA 2Y8YA 4IDKB 1XNQE 5J2MA 1IQZA 1TL3B 4C9DA 2ROEA 4CO3A 1RT2A 4FW6A 3R2DJ 4L3NA 3D1HA 2ZHAA 4AQYI 3CSKA 4K4VA 3EVOA 1WHXA 4XPEA 2HGLA 3HSGA 1O5JA 3Q2SC 4DV6F 4UY8T 3CE8A 5I3PA 5K8NA 1YJUA 1DRZA 4NYPA 3PDNA 1ZS6A 3J80U 5A8KB 4NLYA 1GNKA 5SUHA 4PYAA 2QMWA 3NCQA 1WF2A 4DR7E 3AD7C 5L46A 4DR6F 4QR2A 1HR0J 1SQGA 3TUZC 2X7IA 4M5GA 2JH3A 4X4QA 1RKIA 1KEKA 5DQHA 4IQMA 5DGAA 1N5YA 4DLEA 4LT6A 4A8WA 3CJTA 4PAAA 3T5LA 4JI0F 1I94E 2YWGA 2X1AA 1SXLA 3PYEA 5D4PA 4TU9A 1RT5A 1KQKA 4ZVGA 4LF8E 4M5JA 2B9XA 2DY9A 1Q4RA 4EUVA 4KH0B 4B3TJ 3GJTB 4V1Ak 1FJGJ 4DV3J 2QX0A 5IT9Q 4EMDA 4I6YA 2XMMA 3OPKA 1FCAA 1KQGB 4AIMA 4P10A 4JYAJ 2PIIA 3CMQA 2MY8A 3LAKA 1EKRA 1HNVB 1VGYA 3M8QB 2FB0A 2BOAA 1KKHA 2PEHA 1EQ0A 2PMWA 4DL5A 1TKDA 2PO2A 4CO4A 1NNDA 3BDEA 2WHOA 3UDEA 3DCAA 3DHXA 1HBOB 1UFKA 1WHWA 3K5LA 1M5KC 1VC6A 3DLGB 4X4TA 2XY6A 1MWZA 2DR9A 3C16A 3R9LA 4J9RA 2UUCJ 2FLPA 1Y4UA 4R1FA 2C3YA 3D4JA 2SXLA 3T5KA 3SDEB 2O5DA 4LSZB 3QPIA 4ES3A 4OYWA 2V4QA 3KJVB 5I4MA 4K0KE 4I2QA 1WC1A 3T3FA 4WP8A 2PC6A 4I2PB 3C66A 4NCGB 3MEDB 3PRDA 2P8IA 3DYAB 4MK7A 4H4KC 3TVYA 3V4IB 2HGNA 5KG0A 3K5OA 2DNPA 4WUBA 3TX8A 2MY7A 3MD3A 2F5GA 5SZTA 2W25A 1TUWA 2FC8A 1M5HA 1UPPA 3DFEA 4LIWA 1U1MA 2W9CB 3T1YJ 3IG1B 4DL7A 5DDRC 5EL9A 1X4BA 1Y11A 4WTYA 3ET6B 2VJVA 1GMWD 1Y5IB 1YJRA 2ZVSA 3RG6A 2E9ZA 4N8NA 3EJMA 5KT5A 1EI1A 3UE2A 4DQPA 5C5JA 2OEKA 3MWBA 2JOQA 3MTJA 5DG7A 2PNLA 3OVBA 3NMRA 2W8LA 2G1HA 5T41A 1TAQA 1UL3A 5D4NA 2CWXA 4ITSA 4OYZA 3KG4A 5L9NA 4RNFA 1SVDA 3KTQA 4JI4I 4ED5A 3T1HI 2EFOA 2WVEA 5KFQA 4DL6A 1A6FA 2XC9A 5KT3A 2HQCA 2DPIA 2BJ9A 1T9VA 2DXFA 1WOPA 1NK0A 1Q82T 2UUBF 1H7SA 1IBME 3JSMA 2QFJA 1B62A 2GO8A 3N6LA 1EARA 4KHPI 4Q5VA 5GADI 4LFAF 5AJ3F 1LXJA 3MMJA 5HP1A 4QPTA 4JI1F 1SCJB 5C24A 4J90A 2DNYA 4ED0A 1WTBA 2QV6A 5K5MA 4ZK7M 2ZZMA 2A0FB 2QEXS 4DXLA 3SCKE 5KG3A 2DNRA 4DUZF 1NHJA 1UFWA 2QN6B 4WU3A 2YNGA 4QWBA 3PTWA 5LMNI 3OXGA 4R5PB 2CZ4A 2XNQA 1NKBA 3D1OA 3AA9A 1HWUA 3N9UC 1TAUA 5ELWA 1VK8A 4ES1A 4B3SE 4Q7AA 2F8EX 1FKAF 5C0XC 2V4JB 4NEZA 4DV1F 2MXYA 2NCKL 1AW0A 2P9EA 5A76A 3E3XA 5IZHA 5JXSA 4NLUA 2RDDA 1TKXA 1RTIB 1YBTA 2FIUA 2QTWA 3K85A 4A8QA 2YX4A 2NN6F 4E0DA 2VOPA 5HJXA 1VHFA 1ZZNA 1PJ5A 2RILA 5EWEA 3BREA 3ZM7A 2Z5BA 3CXCR 2R7QA 2DVIA 4B3OB 2C37A 2DH8A 3WC0A 1UVIA 1V3RA 3BSCA 2W7PA 3TP2A 4FS1A 4JV5J 2VBYA 2ZJPQ 2GGPB 1T9UA 1RAHB 1JB0C 3PNIA 2XQCA 1B70B 2BA0D 2RE1A 1USVA 2CQ3A 3IN5A 3G8QA 5K36A 3NNCA 3LPEA 1U0HA 2CQDA 1RBAA 2I1RA 3UHMA 4F50A 3R1HA 4X2BA 3KLFA 2PDAA 2CPJA 3RB6A 4ZHRB 4IFDC 4CLWA 3SIPB 4I0WA 1Q5YA 4Q0BA 4J91A 2OPSA 2CVIA 4B3TE 3VCDA 4YOEA 4DV3E 1YVFA 2W01A 2LQ8A 4OJHA 1U2FA 1SC3B 1OQ6A 2VA3A 1X9SA 1SL0A 1Z0GA 3K2YA 3C15A 4JYAE 2G1DA 4IFVA 4W90B 4PG8A 4LMZA 1GFWB 4J37A 1N48A 4FVMA 4N5SA 3M85D 5FJ4A 2AIRB 4DG1A 2QG9B 4CLSA 3M9NB 5J2QB 1JLCA 1LWFB 4YHHE 2OD6A 2LA4A 1N54B 1FD8A 3T6JA 5F3TA 4TY8B 2PNZB 1EA6A 4DV0E 4CO1A 3CO0P 4Y00A 2HQIA 4CLZA 4EGLA 1N34I 3W63A 2QA2A 2BXJA 3TANA 2YNFB 3NAIA 4P74A 2ZVIA 3OV7A 2B7BB 3UFCX 2E5LF 4JI6E 4DV5F 1JKHB 1JLGB 3MPYA 1NH8A 2RF2A 3A8IA 3BM7A 2OPRB 5HO4A 5IM0B 5LJ3Y 1LNQA 2XLJA 2WTFA 2CJYB 3HMJG 4J9OA 4F2SA 5E3RA 1VIOA 3T1YE 1S5ZA 2LXFA 4EO6A 1RHYA 4WPAA 4Q8EA 1TV6A 2QSFA 3FRYA 5BYRA 1KIJA 2L41A 2OFGX 2NPIA 4NLDA 1IN0A 5K36E 2VASA 1F2GA 4ECRA 2IRXA 1FRJA 2FY1A 1VQOS 1RAGB 1ELOA 5DRRA 1M1KT 1RGVA 2D3OR 5B0GA 2EW9A 1WI6A 4NXME 3G8TA 1BQNB 4DFMA 2BJ3A 2JFDA 2MQPA 4NZ7A 4YY3E 1RT6A 3TZZA 3TA2A 3DKDA 5H9EJ 2LXIA 4U8VA 1NHUA 3UR0A 4I3HA 5LJ5Y 3VGUA 2AMCB 2V69A 2WONA 4M5NA 1DJ0A 2MJUA 1R0CB 4MU4A 4IQXA 2KJWA 3VZIA 1K44A 4UF4A 1VQ9S 1QY7A 1KVJA 3CJKB 2HVHA 1RT1A 4QU6A 1HBMA 4ER8A 3CDUA 3BGRA 1FVQA 2GS8A 1R6MA 4FYVB 2OPPA 2Y0SD 2BDPA 1CQNA 3KG1A 4PKDB 5IFMA 4TN2A 1PYTA 2QLFB 5HMXA 1XNRF 3RR7A 2WB1D 4L74A 1P8GA 4I4BA 3R2CJ 3BJYA 2XZWA 5KG4A 4K5RA 2YKNB 3UVJA 3KRNA 2VIHA 3ZTQA 1WOSA 2GHWA 1TL1B 4R8UA 3OFEA 1FDNA 4LF4I 5BR8E 3W62A 1RAIB 5IC4B 4JI4J 2R7TA 3T1HJ 1LW2A 4EYIB 1S6PA 4HEA9 4ZVIA 4J9NA 4OHVA 4DV7I 2M3DA 5A8RB 2YTCA 3GIJA 3UW1A 1U2CA 1T11A 1YJWS 3UQSA 3MMAB 1R6LA 2J6SA 1NK9A 4USTA 2NXCA 4NYOA 3VV2B 3HKWA 4JI2E 1T8EA 2LU1A 4WFNQ 1DTTA 4NL5A 1YJ7A 3D0GE 3EMTA 4NXNI 1U25A 4N8OA 3H5YA 2C39B 1IVZA 3HO1A 1SH2A 2HVZA 4A8KA 2GJIA 4O0NA 1VQ7S 1J5EJ 1DTQB 2JT2A 2V50A 3U1MA 4WCEQ 2HHHE 3TX0A 5IWAF 2J6TA 2KT3A 4UOCA 2CA9A 4DV6I 3PKMA 5JEAB 5LMNJ 2E44A 2DD8S 2CPXA 4DR3J 3ZXWA 3IBCB 3EGWB 1HNIA 2PO1A 3ILOA 2YNHA 4KJIA 4MQYA 4WF9Q 1S1UB 1JLBB 4DR6I 3NOCA 4RW8B 4DWIA 2WOMA 5CYMB 1EJ7L 2MKKA 2O1WA 2CQGA 1TK8A 5KFWA 2AGPA 2FVCA 1DQAA 4I68A 3NMAA 5I42A 4LBPA 3MPUB 1HW9A 2EFNA 1APSA 1HWKA 2XWXA 3Q8VA 3BGUA 5FLXU 5BJRA 3AT1B 4NLOA 4DR5F 2Z2ZA 2WNRB 4LR7A 1FDDA 2BJ7A 3DNCA 2YKMB 2R8JA 3G86A 4IR1A 5ETPA 3KLIA 3M2UA 3N4WA 4KO0A 2AKWB 4IOAQ 5THWA 3HFZB 3J7AM 4ZLLA 5K9FA 2C2KB 3DGPB 4ZPVR 3PJWA 1RLCL 1F0XA 5CXTA 1KFDA 2BR0A 5DDOC 4ID5A 1DAXA 3IP0A 3LGMA 1VYAA 3FSYA 3HSDA 3MEGB 4DBQA 1T9YA 4YP3A 2VICA 1K8AT 2Q2EB 1NKCA 5CYQA 3WIUA 4HT5A 4NASA 4ZIVA 4KRWA 4I7FB 2BW2A 4R0JA 5E7OB 1KC8T 1ZH5A 2GVDA 1NBEB 1HYSA 3EVMA 1PAEX 1N5VA 4JI7F 4C8OA 2XTJP 1FA0A 4FKXA 2QL9B 5AXMA 1JXVA 4IFYA 3MGJA 3W9JA 1A7GE 2GIQA 3MECB 4LSLB 2XGQA 5G0RB 1ITPA 4FF4A 2K7JA 7AT1B 1JJ2R 2AGOA 2BA9A 3BH7B 1N36J 4DUYI 1RE1B 5KFPA 1SKUB 3OJUA 2CPEA 3AOBA 1RTJB 4A8SA 3ZZ0A 1OO0B 3KDOA 2VJUA 1QZRA 4Z37A 2R2RA 2J0XA 4PU9A 2ZBPA 3CB4A 4PWUA 4QR0A 3TW0A 1MROB 1C4AA 4Y2IA 1VBZA 5HVHA 2BR2B 3Q1QA 1S9GA 5C25A 1YK9A 3THTA 3QFHA 3M8PA 2ZBKB 1PSDA 2JWNA 5D15A 4OO1A 5JEAD 1UW4A 4MH8A 4ZLNA 4F02A 1V5VA 4OZNA 4LFCJ 3ITHA 1J5OA 1ZZFA 3EGVA 2KG1A 4X4UA 1GX6A 1QJHA 4LF7F 3U27A 1OY9A 2CNKB 2Z8QA 5KFIA 4EBEA 1SKRA 1S1VB 2C2RA 3CCZA 2ZH5A 2Y1IA 4X65E 2CPFA 2A2CA 2UUBI 1FRKA 5E0OA 3KMQA 4EZ9A 4QIFA 3H1CA 3NWRA 3ZO7A 3DRSB 4C11B 3QNWB 3CCES 3ENWA 2EFPA 1F3FA 4K4SA 1XNQF 2V5HG 2GHVC 2GFFA 2ZUGA 3H2VE 1N5QA 2HFOA 2VESA 1KDNA 3HD1A 3QAEA 2O1VA 2Z2MA 1VJQA 2QSWA 2R7UA 1X4AA 1G6BA 2I8EA 1D09B 2MZJA 2Q79A 5F8MA 5KFMA 1AB8A 1HBNB 4LF2A 1H6KX 1VRTA 1HI1A 4URSA 2OJ3A 3KK2A 1NSPA 1U1QA 3MPDA 3NWGA 4DR7F 1DY3A 1B4SA 1LWCA 4DU8A 5E3PA 3ZZTA 4IG3A 2KG0A 4DV1I 5B08A 3AD8C 2UXDE 3BO3A 2V2KA 1J5EE 3E8OA 4B9MA 5AE2A 3ZZOA 4WXOA 2BA1G 1I94F 4FXVA 4WU2A 1RBOB 2HS0A 3V81A 1RT7A 5A2QU 2O66A 1UA0A 1ZBTA 2HYIB 3Q24A 1TFWA 1JX4A 4LF8F 3TAQA 4DR3E 4CLUA 2FHJD 2L08A 3BO2A 1HMVB 4TU7A 4ELTA 4FW4A 1PGZA 4URLA 1NAQA 2IA0A 4OZEA 2VG7B 4LF4J 1NCLA 4OO1E 4RNOA 3VGSA 2ZDOA 1UFLA 1X4DA 4MFBB 5B0FA 1QE1B 4WE1A 2ZH7A 2Y1RI 5KT7A 3TEHB 1WEXA 3DC2A 5JVHQ 2JEAB 1T0TV 4LQ9A 2KU7A 2CJXB 2BRKA 4WWSA 3PRVA 4CTAA 1Q8IA 1TK0A 4YUDA 2H5IB 1S1TB 2NLWA 4LOMA 1Z5CA 5A0YA 3H4BA 5DZ7A 4F25A 3OUYA 2UUAE 2V6AA 4RUBA 5B0AA 5MLCV 2UU9E 4I6WA 3V4MA 3WU5A 3KK3A 1UPMB 2MQNA 2AD9A 3WZ0A 4QW9A 2DH7A 2DEIA 4DJBA 4I69A 3E51A 3C6TB 4K0KF 4DV6J 5M2PA 3VAFA 3NKYA 3I0RA 4Q45A 4DQIA 1BGXT 2RIJA 5BYQA 4LR9A 1EB0A 5DM6Q 1W7WA 1FK9A 2JZ5A 3HHKA 2VL1A 4OX8A 4ZPBA 2ZZNA 3GV7B 4IYQA 2JLEA 3BGLA 3CWVA 2FPHX 3TVKA 2N3LA 2IESA 3US5A 5HQMA 3GR1A 3B54A 4FF2A 4JI0J 4HDGA 4DV5I 3J81Y 4NLQA 1S6QB 3BBBA 2FZKB 1RTHA 4KBIA 1YITS 2FHKA 2RQMA 2C38A 3N5FA 1Z0BA 3DU5A 3HT0A 2R8IA 5B0BA 2Z5CB 4OZLA 1N36E 4DF4A 2HIQA 4OYIA 1Q0NA 1MU2A 2D3ZA 3SMZA 4P6QA 1YBAA 3M32B 4I56A 5EWGA 3M1VA 1U09A 1FXDA 1NHHA 1NSKL 2FC9A 3H5XA 3S8SA 4DL0C 5KFHA 3QJPA 4JI5J 2IERA 3FEZA 4GMKA 3GTYX 3LUYA 4KV8A 2KHCA 3BGOP 2WB4A 2F8HA 4U3DA 1U1NA 3C46A 4LFCE 4TU8A 1SJFA 1U0SA 1U1LA 3KHGA 4MK9A 2DGVA 1S1WB 4JUZA 3SEOA 4WZMA 3J81C 3TQEA 2LEBA 3LGNA 4IRCA 2HQFA 1ULRA 2BW7A 2CFXA 2E9RX 1RWMB 3I9V9 4PXEA 1FKPB 3J81j 2OPQA 3PS1A 3AODA 2ZWOA 5KFLA 4RUAA 1HQUA 3DLEA 5GAGU 2AU0A 1UJ5A 2HFVA 2VG6B 5K14A 3POTA 3A3PB 2ERRA 2D7SA 4YB7A 4EK2A 3B4MA 1AZSA 2K3IA 4BWJA 3GSDA 2ZD1B 1U7LA 4B3SF 4CO0A 4FBUA 3MM9A 3T19A 5J1NA 1XBWA 4Y6IA 2GMJA 4KGMA 1IBKF 3PFOA 3OTOI 2ROGA 4JI8E 1S59A 2R2SA 3SSSA 2L9NA 3H90A 3M6WA 2FVQA 3DRPB 4NE9C 2RU9A 4B9TA 3C6UB 3FEXB 2VV5A 5HN0A 3HKMA 1JLEB 3CJQA 4PQAA 2WSCC 1R0BG 2O3ZA 3WQPA 5C0XB 1B99A 2NS1B 2LU2A 4ZOSA 3KLEA 3WBZA 2DRDA 1MU5A 3G6VA 2M52A 4ZN3A 2UVUA 2YWWA 2XI2A 3IMQJ 4RWXA 5D4OA 1XR5A 1RHQB 4ZPWR 3L3CA 4QWEA 4IDKA 3KJQB 1TL3A 5K36C 3HHEA 2UUBJ 4O0IA 5CZXA 1GMWA 3DI6A 2ALZA 1UEKA 1WC3A 2HPUA 5L1LA 4DV3F 1JIHA 1GMUA 2GJFA 3Q6NA 1AT1B 3S01A 5LMUJ 4LFAJ 5AJ3J 1IUJA 4UTGA 2CQ2A 5E3AA 4J9PA 4JI1J 4ZPAA 4EBCA 1NDKA 3AXKA 1L3KA 5HMZA 2J7WA 2MTLA 4IFDB 4NLRA 5A8KA 3I82A 3V2UC 4TVAB 1I3OB 1NB7A 4URGA 5IWAI 3OR1A 4DUZJ 2GVZB 4DV2I 3DRXA 4NWBA 4V19X 4YHHF 2GQ2A 2AHOB 1B63A 4ATNA 1YWXA 3LA0A 5J2NB 1R7IA 4X64J 3RW6A 4DV0F 1VJWA 4PABA 1L5UA 1RADB 2J76E 5AXKA 1TUGB 4F8RA 3BSAA 1NHIA 1ZETA 4PXBA 1I51B 2MKSA 1EP4B 2V0NA 3PM9A 4ZP7A 4PG5A 1UA1A 2LDYA 1NZ0A 1V3ZA 1ZM2A 4QBUA 4JI6F 3M30B 3Q8PB 1PJ6A 2XZDB 3K5PA 2D69A 3KG0A 3O5TB 2ASJA 1HNVA 2HHSA 3M8QA 1HLWA 3ILIA 1H7XA 3RBZA 2WZ1A 2ZOGA 4PZVA 4ZLPA 1CC8A 3T1YF 3A3OB 2K8GA 3MUVP 1HBOA 4QIWD 2ZH2A 2ASYA 2AJFE 3JSYA 4C8YA 4MKBA 3BPSP 1UCNA 4ILLA 4TQRA 2CYYA 2GQCA 1H0HB 4OZ3A 5FD1A 3PIOQ 2B8PA 2YKPA 3L7UA 3SDEA 5DNXA 1WSRA 1QTNB 1RWPB 2W2PP 3KJVA 5D8HB 1FXLA 2IM0A 2DGQA 1MX0A 5C0XD 4I2PA 3HLUA 1P9YA 4NXMF 3DYAA 2XMUA 4YY3F 3V4IA 2CQ1A 1LWXA 3RZAA 3GQCA 4AXIA 2DR5A 3NGDA 3RAMA 4ZMMA 2AZ3A 1U8WA 2UXBE 4JI5E 3I0SB 2YWKA 1NEEA 4G65A 5ETTA 2KZMA 4JI7I 1XR7A 3Q0AA 2NSCA 1NJWA 2W9CA 2HVDA 2VOOA 4RBVA 1M5VC 3HJFA 4Y28C 3V5RA 3HKZD 5CHCB 4OL8A 3QLHB 2M5YA 1U26A 3AY0A 1IBLI 2CDQA 4O3OA 3A8EA 1DBDA 1TFYA 3QYYA 3MM8B 4YR2A 1MW7A 4DPWA 1PJ7A 3VWSA 1N0UA 2KI2A 1C2PA 3PXGa 2E5LJ 3M8YA 1UEVA 4DQRA 1D3WA 4NMLA 1IR1A 2CJAA 4IFDD 2N82B 1ZAVA 4BS2A 3N28A 4MYTA 2QLWA 4C97A 4G1PA 4G6VB 3LNUA 5LL6R 3FSXA 2FZCB 1F2HA 3EZ5A 2MKJA 2GAGC 3I4PA 3D5MA 4WTOB 1Z0TA 5BR8F 2UUTA 1VISA 5EUHA 4HYMA 2QC3A 3CNQP 2ATCB 4LF7I 1V3SA 2Z5EA 1WC0A 4ECSA 3CIMA 1K0VA 4K2JA 1Y60A 2J9DA 1DHMA 2DHGA 5KFBA 2FLNA 4QZVB 2C3UA 2UV8G 4GO5X 2Y9HA 1S9EB 2C2EA 1G2EA 2YH1A 2HS4A 4JI2F 1OPIA 2AJ0A 1XN9A 2JEIA 1XNQI 5L38A 1C0UB 1MNEA 1TL7B 2PNMA 1NRKA 2FHOB 2JX2A 5IQQA 2IC3A 3IBWA 3U02A 5HJYA 3Q8SB 1PC4A 4UQGA 1XWLA 4MDTA 2HHHF 3CJSA 3LP0B 3BGFA 2V4JA 3W5XA 3D2WA 4RW6A 3NGTA 3GZ7A 4AQYE 3RU0A 3UDCA 1Y3KA 2CJ9A 4G1IA 2PFDA 3R7SB 5AE1A 5LMUE 3F0NA 1R8HA 2DIVA 4QYRA 1RHJB 3QGHA 2C1EB 4DR7I 2HVEA 1PVGA 4EWTA 5J1PA 4QNJA 3GIRA 4ECYA 3LP1B 4BA1A 2ZITA 4TY9A 1HI8A 1M5SA 4IG0B 5KFYA 5HROB 4DUZE 2ZBRA 1J2VA 1XNRJ 4DSEA 3R5DA 1L3SA 3GFXA 2CXEA 1QUPA 5C42B 4ISAA 2BM1A 2CZVC 4LF8I 1WEZA 4X64E 3VQSA 5GMDA 4UOGA 2Z0GA 2M4MA 3A4TA 3AXMA 4ZHRA 2IMWP 3M9OB 1UETA 3LPYA 1JXLA 2E5HA 4KC5A 1N33E 2W4CA 2ZFHA 5DDQC 3Q83A 4WFZA 3GV5B 2R7OA 3D0HE 3V6DB 4OV1A 2BM0A 3G82B 1G3OA 3AJDA 1B7YB 1S16A 2FGOA 3FEYB 2NR0A 1YJTA 2J9DE 4A46A 4TNOA 3AB4B 1WNEA 5JVGQ 1D1UA 1XMQF 1HFEL 5J2QA 1LWFA 3OTDA 3BPDA 3TAPA 3KLGB 4X62J 5E5NA 2HBQB 1P9QC 4DQQA 4RW4B 2ZBIA 2KXNB 4P2XA 1DQ9A 4TY8A 2FTRA 4ZLJA 3IS9B 1VQ5S 2HZAA 1ZM4A 2PNZA 4Y2MA 1UAWA 5EX0A 2M70A 1H73A 4K0KI 1NUEA 4UY85 2EKNA 3C8YA 4ZVPB 1UP1A 3TWZA 1N4LA 3CW2C 1QAJA 5HLFB 2I5JB 1C4CA 1AFJA 1CJUB 1JKHA 2A6MA 2N3OA 1JLGA 1ZTWA 2BE2B 2B9WA 2E1AA 3C19A 4CLYA 3L7OA 2HGMA 2A18A 5CZVA 4O3PA 1X4HA 1UVMA 1KHWA 5IM0A 3I32A 3H0PA 1VLOA 2RD5C 2A1BA 1TR0A 2DGXA 1U8SA 4GC6A 2KHDA 2BANB 4P71A 2DR8A 4DR5J 4OV6A 4DZ6A 4C4WA 1OIAA 3PW0A 2VQEI 4JI3E 2DEJA 2QIFA 3BYPA 3PCOB 3DLKB 4K4TA 4K4ZA 3CJ2A 4NRTA 2YNIB 2GQQA 3QRRA 4NEYA 2E5LE 1F5AA 4KGXB 1M0SA 2DYAA 1QSSA 3ZZRA 4X65F 1BQNA 4ZJLA 1GMVA 1NDPA 2VKRA 2BA1D 1IBMI 2V9WA 1WTFA 2EK6A 2PD1A 4F0HA 4LF6E 1R43A 4P72A 2B4UA 2ZJRQ 4DSJA 4QW8A 3OFGA 3T5HA 2HNZB 4F3QA 2XS7A 1FT8A 3SYZA 1VQMS 4DR2I 4KHPE 1RWUA 2WP8B 3RBXA 4WYLA 3BSNA 1ZAWA 2GX8A 1XERA 1NB2A 3DDNA 4OI6A 2DRAA 4JI7J 3W5YA 3FZBA 4OYMA 4BC9A 3TZXA 3L95X 4FKYA 2F1FA 4L72B 1D0EA 5A2QQ 2RMLA 2EFVA 1ZPVA 4B3SI 1LV5A 1BWVA 3R5CA 3G71S 1KNZA 3UR3C 2RS8A 5A8WB 1RT2B 4C8MA 4ZKAA 2YKNA 2UXDF 2EI5A 2O67A 1UW9A 3NS5A 1J5EF 2V67A 1TL1A 1Q86T 4OZJA 3FQKA 1HD0A 2K2PA 5LM7E 4YQWA 1T95A 2JNJA 4ED4A 4XO0A 1FJ7A 4DR3F 5ETRA 2MKIA 3I56S 5CCLA 3GONA 1RBLA 2FZGB 4DX6A 2XMVA 3RB4A 4HACB 3O1LA 4OO1F 1HR0I 5A8RA 3K7RA 3VF0B 3Q23A 4IZKB 4LF7J 1HL6A 1N5YB 2ZKUA 1QLNA 3MMAA 3QRPA 1YJ9S 3QT8A 2PI4A 3O8WA 4F0MA 2G4BA 4LF9J 1IKXB 3VAGA 1SUQB 2P6SA 2C39A 3QRQA 2AYBA 2ZE2B 1U49A 3OLBA 1DTQA 4B3TI 2JLFA 4KFBA 1GTHA 3CMAS 5E33A 4DFPA 4DV3I 2BJEA 1IJFB 2HWIA 2IOPA 1R3NA 3B6BA 4N76A 1XNQJ 5JEAA 4JYAI 4AD6A 3OTEA 2UUAF 4UOHA 3M8RA 3TVZA 2UU9F 1AUSL 1BY9A 3J81Q 1RHKB 2B9YA 4DPTA 1CBKA 1S1UA 1SKSA 2L9DA 4JOUA 4RW8A 1WG4A 5CYMA 3J7YI 3CCVS 3J7AG 2M8HA 5F8JA 1RU2A 2OSRA 4DV0I 1ICEB 4X62E 3CDBA 4PG4A 3CJ0A 2D9PA 2HVIA 2E29A 3MR5A 3R5BA 2WNRA 1RYRA 2O1UA 1XIQA 1SBRA 2NPFA 2OEMA 2J9CA 3WDOA 4U7UK 2YKMA 4GKKE 1N34E 1KN6A 2XO6A 1I94J 5L39A 2Z4PA 1FD2A 4W92B 1EETB 4Y65A 5D0RA 4GC7A 1S6OA 1R8PA 5GAEU 4OI4A 2XG8A 2OH2A 1N36F 2OUGA 1JK9B 1TVRB 3EGZA 1AUDA 1U1PA 4LJMA 1Q1KA 2QL5B 4GQUA 4U7UD 4NI2B 3PEHA 2B5JA 3T1YI 2MSSA 3F41A 1UDQA 3KLHA 3NAHA 2B3TB 5KFRA 4LRCA 4C7QA 3RRGA 2BJ1A 2YQ1A 2R7RA 3MM7B 1FFWB 1FTRA 2KM8B 2UXCJ 1CG2A 3FCWA 2G9OA 4I7FA 3A12A 1PO6A 2LYVA 1ZM3A 4LFCF 2BX6A 3KUEA 2B43A 2FHJA 3GILA 1F5CA 1OY8A 1WOOA 4K5SA 3CJ5A 1KQFB 4NXMI 3MECA 1IKYB 4LSLA 5G0RA 4NLPA 4IH6A 4O3QA 5JEAE 3NCRA 2DGUA 1F1BB 3HULA 2HRTA 2IVFB 3GFHA 3WC2A 1RTJA 3AHPA 1S6UA 3CDAA 1SC1B 3I5AA 1N0VC 4NBQA 1FRXA 4CRJA 3JSMB 5DLFA 2ALYB 4JB8B 2GW8A 4M5DB 4HTJA 5HBMB 4PR6A 4ZCLA 1KLMB 3MFIA 3CDIA 1Y4SA 2BR2A 2AYEA 1WORA 3AQPA 4B9VA 3R5JB 4DL3A 5HP1B 2VZ9A 2CZ9A 6AT1B 4OZ1A 3D6FB 4Y3CA 4JI8F 3K17A 1WEYA 2O1PA 4ZIWA 2ZM6J 2ZC3A 3K0JA 1QAYA 2YNGB 3M7VA 2EWHA 4HLBA 4CT9A 1Q78A 3F73A 1TKZB 4F4WA 3BR9A 4Y2KA 1SL2A 5DQGA 4OKGA 4BHQA 2FVRA 5D4LA 3NG8A 1UVKA 1C0TB 3PVXA 5KG2A 3Q2TC 2G2YA 3HHLC 2MJNA 3HT3A 4DR1J 5BR8I 1Q16B 2J8AA 3OHBA 2PT0A 4IRKA 1RU1A 2QRRA 3DRSA 2GO9A 2PO4A 2K1RA 4RZRA 2RKIB 3MUTP 2MZSA 1M1HA 4OI1A 4J3DA 2VQFE 3PFEA 5L9XA 1TKTB 1ZPWX 4NRUA 5BYSA 3JQMA 4DMZA 4LF5J 2RQ4A 4JI2I 1VBKA 1YDLA 3AOAA 4DN0A 4BBYA 5KFGA 1HBNA 5FDLB 1S48A 1NLKL 1CQMA 2CRLA 4FYYB 4LFBJ 1X31C 3S6EA 3VZHA 4Z2XA 3NBPB 3CCTA 4KSEB 4NXNE 1W2BR 2HHHI 4O3NA 3KLFB 4LF9E 1BQMB 5FIIA 2QMUB 2PO0A 4IOBA 2HFNA 3ENAA 5ETLA 4J9VA 4KPCA 4DFJA 4OI3A 2OPSB 4FF1A 4BLGA 3OSNA 1P1LA 5D0GA 4CCHA 1NK6A 3DN9A 4URQU 4B3SJ 3AOCA 4FNHA 1IBKJ 2CPYA 1R8BA 1HMVA 2KKHA 4IOCQ 3M2RB 2VG7A 3GU0A 4DG1B 4UW2A 1HNXE 3SSRA 4WUDA 1X4CA 4MIAA 2KO1A 2FDNA 4OZ2A 4BC7A 1R6YA 1WC6A 2YBVA 1RR9A 1E6VB 4MFBA 4NOHA 3HD2A 2HHUA 1QE1A 1KRPA 3B4DA 1H2UX 2QT7A 4X4SA 1RWVB 4XIUA 3IR5B 3MAAA 3MURP 3BQ2A 3KMSA 2JEAA 2YKQA 1VR6A 3O2IA 2IVMA 4L76A 4TYBA 1YKWA 2R3VA 3IBFB 4LRFA 1GEHA 4QIVA 1DFDA 3J80Y 5T7LB 4CLPA 3K89A 3D7SB 1ZYQA 2IFXA 4L6V3 2E7VA 3BQ1A 3BZQA 1U45A 2GZOA 3FSIA 2EVZA 5E3QA 2RF2B 2MLXA 4G3IA 3VQTA 4CT8A 2VBWA 2YVSA 2QFIA 5J2PA 4YR3A 4ERDA 2RRAA 5LXYA 4DR4E 2E9TA 3ZZPA 3OR2B 2HQ3A 1XTZA 5HK4A 5IT9U 3SCLE 1CULB 3EWGA 2EKYA 4RUCA 2QL7B 1LOUA 1OJ4A 4XK8C 5IXUA 5ETKA 5EHHA 4CNZA 1K73T 2QGFB 3QMQA 3M8WA 1A6LA 3FFIB 2NXUA 2UXBF 4I67A 4RPFA 4JI5F 3R7NB 2UXCE 4YHHJ 3VAKA 2EK1A 2HNDB 3NLCA 4AT1B 3FBEA 2W9AA 3KK1A 4F4XA 4OX9F 2LQ9A 3NGSA 1VBYA 2FUG9 3J80C 1K9MT 1HD1A 4V19J 3L9ZA 3MD1A 2BOPA 4DV0J 4KH1B 4ANDA 3U1NA 4C98A 3P96A 4H4KA 1HARA 1U48A 1S6QA 4M8LA 4YB5A 2DGOA 2R2TA 2XI3A 3W7BA 3HZGA 3KUHA 1NHKL 4RJVA 2Z5CA 4F26A 3CWJA 3UO0A 1NK4A 3LWMA 1S4EA 3RRKA 4O3RA 2DNLA 4JI6J 2NXJA 2RQCA 5J1EB 1M90T 1U47A 5K36D 4UZCA 2RT3A 2N4DA 2H48B 6FDRA 3HVRA 4OI0A 4FYDA 1X5SA 3W8PA 5F8GA 2JVRA 3GIMA 2MZRA 3AJ1A 2G0CA 2P9GA 1YHCA 3G4SS 4QPXA 3T5JA 2A3JA 3NOGA 2J5AA 3BGRB 1R89A 2W4DA 3M05A 2WW8A 4ECZA 4IRDA 2V9KA 3CCLS 1HBUB 2X3DA 1FRLA 2ZM6E 4IZJB 2C3PA 1QD1A 3J7ZT 1OYSA 4F3OA 2WRMA 4PPDA 2X36A 2NN6C 5KFZA 4X65I 1VS3A 4AL7A 2IDLA 1WC4A 3UVJB 3HJVA 1M1GA 1FKPA 3GCXP 2XMKA 4U9RA 3GG1A 2AX1A 3T6BA 3QQCD 4WK1A 2KVIA 4DR1E 1U4BA 1Z59A 4ZVFA 3MM6B 2VG6A 2WVCA 3W61A 4NXMJ 4IR9A 2VFTA 2Z2LA 3P3GA 1TQLA 2IYIA 4YY3J 2D41A 3FJ2A 1NO8A 2YQ0A 3GR0A 3NZKA 2ZD1A 4OHXA 2F65A 2X1BA 4EO8A 3TYTA 2N4CA 1RB0A 1XXEA 1WWHA 2JEFA 3K1JA 4N3OA 1QUVA 2VG5B 4AQYF 2RRBA 3IWLA 5JMNA 4LF5E 1VRUB 4ED6A 2AW0A 5LMUF 4YDDB 1D8ZA 1FNOA 3KWMA 4RR5A 3DLJA 2GC8A 6FD1A 3C6UA 1KD1T 1JLEA 1W2IA 2CKWA 4M5LA 4PEOA 3UN2A 5DO2A 2YWFA 4LFBE 4B3RE 1QSYA 3NS6A 5GADU 1J5EI 2AWZA 2IY5B 3P3DA 1HI0P 3QWPA 2JC0A 3HSJA 4M63A 1RKJA 2EEYA 2R9LA 4DPYA 2FVPA 4DR3I 4KHRA 1KS2A 4X64F 1HNIB 2NQPA 2PO1B 1GAOA 1Z1ZA 1OYRA 5BR8J 2VC0A 4MK8A 2KT5A 2CUYA 1IBKE 2CQ4A 2WOMB 1W26A 3THVA 2ACMA 1CJVB 1N33F 4KKOB 1MLAA 2ASDA 1VFJA 3RR8A 1UZHA 3HVTB 3TOQA 2K06A 3MFHA 4Y0FA 5I42B 4A4JA 2LVWA 2XHCA 3DOMB 2MKYA 1S4FA 4OMFG 4JV0A 1YJVA 1KTVA 1U1KA 3PRYA 3QO9B 5F41A 2B6AA 3EPGA 3MEKA 5KFNA 4GVBA 4MTPA 2ZOFA 4USKA 2E7WA 1S57A 1UWAA 3QSYB 4JI2J 2GVZA 2VPZB 4WBFA 5KOXA 1NPPA 1UKUA 2KXHA 3KLIB 1TP7A 2AYGA 3N6NA 5J2NA 4FVCA 2VBZA 2KL8A 1IBCB 4E8UA 2UU9I 2LQ5A 3TO8A 4EEYA 4K4UA 2EFQA 2HHHJ 2JVOA 2DIUA 4AXJA 2CPDA 1U1OA 2XMJA 2FVSA 3AFGA 1D6TA 4IZJD 1N52B 2NYIA 4J9SA 5EN1A 3W9IA 3FVYA 1EP4A 4F67A 3G6YA 3PW5A 2FJEB 3GFYA 4DZDA 3L09A 1Q7YT 1HWJA 3M30A 2VBXA 1N32J 3DRRB 2A10A 1VQPS 5ETMA 2OO4A 5CYQB 3GV8B 2MSTA 5LSOA 4FXWA 2W2OP 1Y7PA 5LOQA 1KBRA 2AJ2A 4F0KA 5C0XE 2O1TA 3UCZP 2DGTA 3QSIA 2WVBA 2DCLA 4NX9A 4UQTA 3KOAA 2WSEC 1WKJA 5A6WA 1UWBA 1N36I 4JI3F 4F4AA 4JG4A 3OFFA 4RBUA 2E5GA 3NCPA 4ANEA 4C3MA 3LH2S 1S0MA 2ILZA 2CQ0A 4B08A 2CG9A 2AX0A 2WVDA 3W2VB 3DOKB 4ALZA 2H4YB 1PYSB 2ZH6A 3Q6MA 4B9UA 4OFZA 4P2MA 3CMES 3GJSB 5F8HA 1SV5B 4WYWA 1J27A 2GCFA 1XMQJ 2DTJA 4LF6F 3B82A 3DXBA 4LFCI 3I0SA 4TLRA 4IFDE 2COLA 3CD7A 3RRHA 5KT4A 1BD6A 4M94A 1RXOB 4OYAA 2J0SD 1OYEA 3SQOP 1RHUB 2W9BA 1JXEA 5IV3A 4KHPF 4ZPCA 4QIGA 2HBRB 1K47A 3CGIA 2KZZA 3ZKDA 2AP6A 1O0PA 4XPCA 4Q44A 4ES2A 3H20A 3SBMA 2Q43A 1CPZA 2V68A 2DO4A 2C2ZB 1RAEB 1S1XA 3SXLA 4O4GA 3ISZA 3OD2A 2MPUA 3J7AN 1G7CB 1YX2A 3MDFA 4Q43A 1GXUA 4UUXA 4O23A 1B7FA 4JI8I 4A8YA 1FERA 4LR8A 1S49A 2MQOA 2J0QD 4PG6A 3TUJC 1Y9OA 4M1KA 3NP5A 2NSBA 4CLLA 4M5HA 4P73A 2W2NP 2W4PA 1VRTB 2W2QP 2BQ3A 2HHTA 4KB7A 2W24A 5KTQA 5HATA 1RZMA 3IM9A 2ADBA 1UJ4A 1LWCB 4IG3B 3GPAA 5H9FK 2H5JB 1XR6A 1S9EA 1IM6A 4IO1A 5EX3A 2JEBA 1URNA 4CIOA 1NDCA 2H5EA 2B4OA 3GB0A 3V81B 1URRA 4X65J 4J9KA 1C0UA 1KR4A 1SQEA 1TL7A 1A9NB 2RHSB 2GO3A 4K4XA 3I55S 2MQ8A 4DEZA 1RWWB 3LF0A 4W98A 2P9CA 3F56A 2N7CA 1TU0B 5L3JA 3LP0A 2RUGA 4YEAA 1EAYC 4NLVA 5IQ6A 4U8YA 4RW9B 1B64A 2H4WB 3BYRA 1X5TA 1Z4UA 1S97A 4RU9A 3R7BB 1HHSA 1Y3JA 1SIWB 4YR0A 5DRKA 4WE1B 1ZA1B 3UCUP 1SJ3P 2M7SA 2R7XA 4XAKA 1HPZB 2PA8D 5DGBA 3LP1A 3I4HX 4OLPA 2F9JA 2BVZA 1SH0A 4IG0A 5GAEI 3BQ0A 5HROA 4MJKA 4C0HA 2M8DB 5EGYA 3TA0A 1ZOTA 4DV2E 4CTAB 4ZP9A 4C8NA 4CNYA 1S9FA 3FCHA 2Q6CA 4ZCMA 5C42A 4X62F 2FJVA 3CCMS 2HRYA 3AH6A 2PMZD 3LP2B 2UXDJ 1TTHB 3NL0A 2RH3A 1VLYA 1UMJA 3QGGA 5HMWA 4GKKF 1N34F 2OTLS 1C1CB 2GIFA 3H2UB 3Q8QB 4ZCKA 3VGTA 3CJ8A 3D6HB 4RLEA 1OWXA 3A1YG 3JQKA 2GA7A 3FRZA 2DNKA 3I87A 1LWEA 2DISA 3W5ZA 3TAMB 2ZC4A 3MXHP 1N32E 1CS4B 3ELHA 3V6DA 2QZ8A 1YRUA 3BBFA 1C1BA 3G82A 1EHWA 1HNZE 1Y10A 4QYZK 1R8AA 4DV4E 1REVB 4AUKA 4PCQA 3MMCB 5IT4A 3CJ4A 1LFWA 2EC0A 1G1XA 2Y8WA 5GAHU 4JI0I 3GSIA 1RT3B 5DRQA 2B8QA 1S0VA 2QA4S 3FC9A 2VU5A 4RW4A 2QLJB 1TL4A 2KDOA 1MWQA 4ID8A 1MSWD 2D3O1 4C8KA 3IS9A 1TZ0A 2M2BA 3R6GB 2XY7A 1RHMB 2PE8A 2OHDA 1VRQC 2MHNA 3IFEA 3DM2A 2AJQA 1MU2B 3A8KA 5FLXY 3CC2S 1T9XA 2HWHA 2EBEA 2OLWA 3E01B 2XGPA 2RB7A 3UN3A 2JE6B 2UUAJ 5HLFA 2I5JA 2UU9J 3M1VB 5JEAF 3BBCA 2YY3A 3QZ8A 2BQUA 2HNYA 2VA2A 2BE2A 5KFXA 4DN9A 2KN4A 3CDEA 2UXBI 4JI5I 4RNHA 3M7NG 3K58A 5K8OA 1YTYA 1XMQE 4YFUA 1F6TA 1DZ5A 4KQVA 2L9WA 3FK4A 2VPYB 2BANA 3BKUA 2E1CA 5L1IA 3ETMA 3D3BJ 1VK3A 3SQGB 2ZBCA 3L7PA 3PY8A 2KYZA 2I6WA 1OYPA 3HPOA 2QO3A 1VQ8S 2VB6A 2WK4A 3EE3A 1IBLE 2DITA 1X7VA 2ATLA 2VPXB 3CULA 4C6AA 4JV2A 2XMWA 3X1LB 3DLKA 4IH7A 3POTB 1JJCB 3BF4A 5FLXC 3PHEA 2JEGA 2YNIA 1L3UA 2XWYA 2HFZA 4UZBA 3I6PA 1BHNA 3OVSA 1QDUB 4FW3A 2MGZB 4L75A 1HA1A 3C2PA 3MR3A 2EG1A 1T3NA 1FNXH 2DKOB 3TARA 4OJ1A 3AAWB 1QVFR 2FLOA 3IO1A 3CUNA 3LALA 2V2QA 5HL7Q 4CLKA 1WACA 3W66A 3VVUA 4A8MP 4DL4A 2HNZA 1FDBA 1B0PA 4O44A 2YKAA 2VQFF 2WP8A 2D1CA 3HHLB 1E3HA 1D9DA 1P42A 3P8BB 3KLEB 2BQRA 3CC7S 2OEJA 3LQVA 3KNGA 3OQ2A 3BO4A 2YPZA 2GJ2A 3OSPA 4OHYA 4NXNF 2NXEA 5KFUA 4C0BA 3EX7B 4LF9F 3ZZUA 3ZNJ1 1UDNA 5A8WA 2KTQA 3HVWA 3HSZA 3DI6B 3UN5A 5D0EA 2CG8A 4K4WA 3FKBA 2U1AA 3KJNB 4ZVUB 3WX8A 4M5KA 3QZ7A 3CC4S 5LMUI 4LFAI 1N5SA 1SJQA 3FGVA 1U6FA 2AYMA 1UJ6A 4QCLA 1P6TA 3MM5A 4JI1I 3J80Q 4N56A 1EZZB 3KFWX 3FZ2A 3ICLA 2P6TA 4JI8J 3PV8A 2ZZTA 3PRBA 1NZAA 5DZ6A 1MN7A 1Q8KA 4HACA 1HNXF 2E5JA 3OR1B 2J8SA 3GLLA 4DUZI 4B3ME 1VQ4S 4GKJJ 4LSNB 4FW7A 3QGPA 3V6HA 4IZKA 2BE9B 3FBFA 5HANA 4ETXA 3TZYA 3HF5A 3OBIA 2DO0A 1FEHA 2HURA 1X4EA 2XS2A 3G2XA 4X64I 4UOFA 1ACMB 1IKXA 4EFAC 1SUQA 1VQ6S 4P7AA 2BYCA 2ZE2A 4XDCA 4NA2A 3CTRA 5E41A 1N33I 3HX9A 2R2UA 2F9DA 1KOOA 5CCMA 4A8OA 1P1TA 5HI7A 3GCMA 1U02A 2KRRA 2BZ2A 4LRBA 2QLBB 5GMEA 4IKAA 1IM4A 3LGHA 4N77A 5A2QY 4DR4F 4NLTA 2HLUA 4KT0C 2IOQA 4JBCA 1RTZA 1WDDA 4KR0B 1S72S 3M8ZA 4OHZA 1RISA 1T9TA 3MCNA 4I64A 1JWWA 2OI2A 1L3VA 4JV1A 2UXCF 1FI4A 1HNWJ 2OFHX 3MR7A 3RB0A 3ZC4A 2KFZA 3JTNA 3G8SA 1RSCA 4ECWA 1B3TA 3F44A 1PILA 1F9HA 4P75A 2WW4A 4NMXA 3U1LA 3K5NA 3HHLD 4OX7A 3DLHA 1EETA 3W2WB 1YZ7A 4WIIA 2XCAA 1LW0B 1X9MA 2V2ZA 3HK2A 3H42A 3TI0A 1RCOB 2MZTA 1S10A 4DUYF 1TVRA 3UWTA 1LXNA 4X66E 3RBDA 1RQ0A 4D3HA 2CQIA 3FMWA 2AEMA 4EYHB 3QFWA 1NK5A 5A2QC 4BA2B 3EXCX 1Y0HA 4NI2A 5BXIA 1TK5A 2I0XA 5IS2A 3M6VA 3P5BP 3U1KA 2IJNA 1E6YB 3Q8RB 2C28A 1OYDA 3P4UB 1XMOJ 2BEFA 3MM7A 1VC0A 4JI3I 1IWAA 4U67Q 2FJDB 1OY6A 1BC6A 3CF5Q 4PWDB 3NRBA 2VQEE 4GO7X 4R0EA 2ZHOA 4OIXA 2G0JA 2ZM6F 2JFKA 3CDWA 2E5LI 4Y2AA 4N7TA 1KOHA 2CJKA 3MUMP 3AQOA 2VDHA 2GAHC 2BACA 1IKYA 2XMTA 5HSPA 1FKOB 2Z57B 4H4MB 4PUOB 3M6XA 1JLFA 4LF6I 4LBIA 1SJRA 2CPZA 1Z0VA 3AA8A 1VC5A 2QA1A 4DR1F 2X51A 2H9ZA 1WELA 3HJCA 2HEKA 3TRGA 4M5DA 4XTJA 5HBMA 4CZCA 4NCAA 2BRLA 2E5IA 3P3EA 4LUBA 2NN6B 3OL8A 1KLMA 3H59A 2M88A 2MEWA 1B0VA 3OL7A 4YN3B 3IR6B 2UXBJ 2V2VA 3UD5A 4J9QA 3C14B 2YX7A 4DR2E 4G1QA 4QQBA 2NUHA 4OX9J 4HKQA 1EKSA 4RU2A 1Z5AA 4LF5F 5AE3A 5KFEA 4CP5A 4ETZA 2WBRA 1CJKB 3B4TA 3ULHA 3IR7B 2BUNA 5ETNA 4USVA 5F8IA 1TKZA 1X4FA 2F63A 4YDXA 1FE0A 1YRTA 5L1JA 2HBYB 4EU0A 4LFBF 2IC3B 4B3RF 2MMYA 2DPJA 1C0TA 3UNGC 4DQSA 2Z58B 4TKTA 2BKPA 1MMNA 3NXZA 2UVRA 4P7VA 1VQSA 4PXDA 4D3GA 4RW6B 2LEAA 3VAMA 4MT1A 1QAIA 1PCAA 2F4VJ 3SI8A 3MZIA 2EPIA 4RW7B 1R27B 4ED2A 4CYUB 3DOLB 3H2LA 4WK3A 1O6XA 4ZJQA 2RKIA 1N8RT 3LTOA 5DQIA 4BDPA 3EXYA 7FD1A 4BA1B 1TKTA 1MG7A 4H4OB 2UV8A 4FDFA 4PXCA 1VQNS 4FZVA 1OS5A 1D8YA 1HR0E 1R6VA 4RWWA 5L8RC 3HXMA 1VI7A 3FBCA 1XNRI 4GKJE 3RB3A 5FDLA 5DROA 1Q8BA 2CG4A 3MMBB 2DHXA 4HYKA 4NZ6A 3SV4A 1WUUA 2L3MA 3NBPA 3RGIA 3GJQB 5CQGA 3HCXA 4ZVEA 2J65A 2DBBA 1BQMA 4ED3A 3ZNUA 1RT4B 4C8ZA 4WFBQ 1U6ZA 3UI3A 4QU7A 3PJXA 1FJGE 1QVGR 4J9MA 1XEZA 1M5PC 5HVGA 1RCXB 1JLAB 2Y3YA 5EWFA 3W60A 3TUIC 5RUBA 2OKQA 2QJ3A 2IBOA 4OHWA 3CO9A 4AQYJ 3ZKBA 2HQDA 3M2RA 1XC9A 2IYGA 3PYGA 4F36A 4UT4A 5ETOA 1RUSA 2RNEA 1PYOB 4QWDA 5I3QA 4X62I 2LXUA 1E6VA 3GMEA 2XZTB 1N6QB 2IDEA 3H40A 3M6UA 1FWLA 2L48A 3K57A 4GKKI 4P52A 5JJBA 4CQ1A 2HWTA 1SJ4P 4L3KA 2NN6D 5C0XF 1HNWE 2UUCE 3D54A 1QSLA 4YB1P 3DDIA 3MCOA 4LQ3A 5T7LA 2LQJA 2GHPA 3CCJS 1NZ8A 3MPWA 3PW7A 1U6BA 2LP4A 1IR2A 5D78A 2DY1A 3MAHA 3NGUA 5I3UB 1N33J 1JNZB 4FWHA 3MTKA 2UZAA 1Y4ZB 5B7WA 1BUXA 2W7AA 5KT2A 1UVLA 3OR2A 1YIJS 1CULA 3VTIA 1HK7A 4FS2A 2AE8A 3R5AA 2XSJB 2YQ3A 5KFDA 1E3PA 3MOJB 4K50A 5DG9A 5CA5A 4X4NA 4DR5I 4QNKA 2VPWB 1S0OA 1XMOE 3FFIA 1FEEA 1X4GA 4DDFA 3P3CA 1IKVB 4DPUA 4IFDF 4ZITA 4USWA 2HNDA 1NKEA 4NLGA 4S0MA 3RAQA 4TYAA 3BB5A 2EFGA 2J7KA 3DLGA 3ZTSA 2EBGA 3D66A 5AXNA 1WKLA 2BBEA 2DCUB 4NYZA 1FJCA 1AXQA 2DNQA 3EYZA 1TL5A 3MCSA 4BWMA 3N0VA 1NU4A 3PW2A 3UDLA 5J1EA 1Z0EA 2XS5A 1V5IB 1K0TA 2ZJQQ 3RW7A 4NCGA 3MEDA 5LSLA 1V9OA 3VALA 2KXFA 3IGNA 2ZHBA 1T05B 2CJBA 4DHVA 1IQTA 1DQ8A 2E1MC 3MEEB 1CJTB 3OTOF 2ZKTA 2E1RA 3VGVA 3JYTB 2AJ4A 2HHPA 3IG1A 4OX9E 4RL1A 1REGX 7FDRA 5K8MA 1HBUA 3I96A 4IZJA 3ET6A 2KFNA 4PQUB 3G87A 4USJC 1NJZA 3MI7X 4JI3J 1B0TA 5ETSA 4P7TA 3ZTRA 2NZ4A 4C3KA 2MZQA 8ATCB 1NM2A 5IV4A 4QIEA 1S79A 2Z56B 3O44A 1XJWB 4ICLB 3MM6A 3ZTOA 3FMBA 1JJ4A 3LO3A 1BLUA 1T03B 1BKNA 2F4VE 1H74A 2HZVA 1OMSA 2DJWA 2VQFI 4A47A 2IJFA 1CEZA 4PWWA 3PHTA 5E3CA 4ZDNA 4LF6J 3K8WA 4MMOA 3G6XA 4Y2CA 4ILMA 1YQHA 4HH0A 4ZVOB 3TA1A 2VG5A 1KVIA 4CO5A 2N7YA 1VRUA 4KHPJ 1EX8A 4DF8A 3H5SA 4ZA1A 4JV5E 2WCXA 3QBCA 4DX8H 3DMJB 5H9FJ 1FHTA 2GMHA 3DHWC 2BABA 4LF9I 4PYDA 3PYDA 1YLXA 1NPRA 2VKZG 2C3OA 4CH1A 1NDLA 2PI5A 4KFBB 4GRSA 3OFHA 2F40A 3I5BA 4KQZA 4DV2F 4HVZA 2O3DA 4RNMA 2ZWPA 2IIHA 2RAQA 3OL9A 3R3TA 5ITHA 4KGKA 5IC6B 5H1SV 1QAXA 4R5PA 3K59A 2V8VA 4OZ0A 1GXLA 3QT7A 2HK3A 3CJRA 5GAHI 3P76A 3JSBA 1HNXI 1FX4A 4MIBA 1N56A 2HMIB 3GE9A 1FE4A 2V4RA 4NA1A 1CJVA 1LQ9A 1FDAA 3FCVA 4KKOA 3BR8A 1JJHA 3L4BC 3HVTA 5E2QA 1RTIA 3QAUA 3M7ND 1DARA 1N32F 4USHA 1BXNA 1OQ3A 3DOMA 4WKYA 4ED8A 5FLXQ 3KDNA 3A8JA 2MQQA 1HNZF 2Y0BB 3QO9A 2JRSA 4DV4F 4LRAA 1F9FA 4B3OA 1EQMA 2A6OA 3JTOA 1GK8A 2XM3A 2M0GB 3PO4A 1I94I 3GG0A 3IRWP 2F7VA 2GGPA 4PG7A 2X3GA 3IRXB 1ZXMA 1P27B 4C48A 3DLBA 4WUCA 2IJRA 1D9FA 4DR4I 3BKTA 4Q2LA 2QA4G 3GWCA 4KHMA 4F4ZA 2VDIA 3VAIA 1HHQA 3IXQA 2B5JB 1FXRA 5IOLA 3KLHB 2KJVA 3EVWA 2XB2D 4QYZJ 3BSOA 3MAQA 2V94A 3DRRA 2AF6A 3E2EA 4LF1A 4KY3A 5K20B 3QIPB 1H2TZ 2UXCI 1IKWB 2E66A 2CQCA 4FWGA 3CEDA 5CH7B 2WVFA 3HVAA 4ED7A 2LA6A 1X60A 5DLGA 2C2NA 3WIVA 3IA0A 1RTDB 4FN5A 1CC7A 4CLTA 1ZXNA 2JLGA 2IM1A 3FUYA 4RO0A 3UD3P 3GYNA 2G0IA 1IBLF 3SFUA 3M6AA 4DX7A 4Z7YA 4GKKJ 2ZH1A 3VHQA 1N34J 4CM0A 2RS2A 2V8HA 2IAJB 2NYHA 5K8PA 2YNFA 4WP9A 3Q8YA 4OJ3A 3KKFA 3W2VA 2W7OA 3DOKA 2VFUA 4OI2A 2PGCA 1BE4A 4DSFA 2GMLA 3B78A 4DL2A 3GCWP 2CNNB 2ADCA 3L7ZB 1LK7A 2CPHA 3SCJE 1GT8A 1SV5A 3H4LA 2B4VA 2OPRA 1SC6A 2Q6BA 1RWXB 5D3GB 4DX5A 2HFUA 3RTVA 1JLQB 2RVJA 2ZM6I 3M2VB 4U3BA 1PKPA 5C7PA 2UVWA 2DHHA 1TUVA 2JJ4D 3ETOA 2LKZA 2HKEA 2LJPA 1SH3A 4NLXA 1O51A 4ZVHA 5LL6d 2CPIA 1SI9A 3KLVA 1DLOB 4RNNA 2AEFA 3W8GA 1PIEA 4MU1A 4B02A 1CVJA 1AFIA 4OO1C 3BEGB 4DR1I 2BKNA 2KRBA 4OX6A 2UVVA 4LVNP 2V8GA 2D9OA 1Q81T 5HAOA 1NXIA 1RWOB 1FRHA 3MHYA 3GYGA 4BCAA 4NCBA 2MHEA 2GNKA 3DD6A 2K1RB 4JI4E 3QJLA 3T1HE 3TR5A 4CLFA 4PRVA 3CD6S 1GXTA 3TJAA 1SJ1A 2U2FA 4LF5I 3CPWR 4M5MA 1F60B 3GIKA 2AJ1A 1RWNB 1R31A 4PRFA 1FO1A 4ZP6A 2LECA 5KFVA 3UDVA 2BV3A 1VHIA 1YRXA 3R5GA 1YG0A 4LFBI 1F5BA 4B3RI 1Q79A 5DDPC 3CJKA 2ZNYA 3BN7A 4B3MF 1O8BA 2APOA 1WI8A 2XYPB 2PO0B 2JEJA 1RLDA 3ISNC 2RSQA 1HQEB 5CYJA 2VFVA 2HAIA 1X8DA 1R0AB 1IWGA 3X3UA 5F3ZA 3PYFA 5J2MB 5KG7A 5LMNE 1M5OC 4FBTA 2LEPA 1IBKI 4XDDA 3BH6B 1WG5A 4DPXA 1D9AA 2CGEA 1VDHA 2XLKA 3J7Z5 2VFSA 4RW9A 4U95A 1U1RA 1KSPA 2VQFJ 1VOMA 1VCTA 1AA1B 3M9MB 2B56A 3W9HA 5M2UA 3HHNB 4CH0S 3WX4A 1Y5YA 4A48A 1HPZA 4DV7J 4X4VA 3D28A 5F0WA 4QOTA 3MAAB 2R8KA 3S7RA 2HHXA 4WIQA 5DM7Q 3ENQA 5GVQA 1IJEB 4N47A 2AT1B 1RAJA 5CAAA 2HHQA 1YBUA 2HK2A 1WF0A 3JS9A 3R8YA 3G96A 3IAS9 4M5IA 1NPKA 4NXNJ 3RAXA 5AXLA 2OTJS 2IRYA 4O3SA 3NGKA 1RT5B 3N6MA 3LP2A 4F2RA 2F3JA 5J2PB 1Q53A 1KP6A 2IRUA 2I9SA 3ZZYA 4OYBA 2DNZA 3PJ9A 4I6AA 4B9LA 3P45B 3TQ1A 3NY0A 2ROPA 4LPFA 1C1CA 3OL6A 4CH7A 2R8GA 8RUCA 5HQ8A 2QYCA 4MYUA 2LQBA 3CDJA 3TAMA 3ONQA 1CS4A 5B09A 4FP9A 1HNXJ 2HQGA 4X66F 2C2MB 1JLBA 4DR6J 3J81U 4YHHI 2PO2B 1REVA 3MMCA 5DJBA 3KK1B 3LANA 3PKYA 2VUGA 4ENOA 1UEUA 3CVKA 2KVQE 3CIZA 3JSRA 2XHWA 4M95A 3ZFVA 3K8VA 1RT3A 2GIRA 3IM8A 1MMDA 1ZTTA 3J7YU 3C16B 4ANCA 4CM2A 2KM8C 2VQEF 3LAMA 2J7UA 5D77A 3EICA 3P49B 3TZWA 2VC1A 4JI6I 1DURA 5AT1B 4DS4A 4I2QB 4LBHA 3UD4P 2C2DA 5C2CA 3E01A 2JE6A 2OD4A 3CD0A 4AE5A 3DGPA 1XHKA 4TQSA 4DPOA 4DR4J 4J5OA 5KT6A
chains in the Genus database with same CATH topology
1IBME 1ZM9A 1N32E 1HK7A 1B62A 5LMUE 1HNXE 2O1VA 3F0NA 1MU5A 4WUDA 1HNZE 1Z5BA 3WU3A 3M6AA 4Z7YA 2WW4A 4DV4E 4KHPI 2UU9I 3P06A 4DR7I 1PVGA 4B3TI 1RR9A 4DV3I 4DR5I 2F4VI 2IOPA 1D6TA 1XMOE 4IZJD 2HFSA 2ZITA 2V2ZA 4JI0I 4LF4I 4DUYE 4DPUA 5BR8E 4JYAI 4DUZE 4DXLA 4X66E 1UEKA 1NHJA 2R3VA 5A2QC 3B78A 3J81Q 3Q6NA 4DU8A 2BM1A 3ZZTA 4DPTA 4DV1I 4LF8I 2EFGA 2J7KA 2UXDE 3H4LA 4X64E 4ZVIA 1J5EE 5GMDA 4UTGA 5LMNI 2HFUA 4FWDA 4DV7I 4JV5I 2ZM6I 1FNMA 1PKPA 5IT9C 3WU4A 3J7AG 4LF7E 4YY3I 4B3SE 4JI3I 2HKEA 2LJPA 3V2UC 2O1TA 1N33E 4DV0I 5IWAI 4JI2E 4X62E 4DR3E 3B8HA 1Z0EA 4DV2I 4DR4E 1KVKA 4NXNI 2VQEE 1B63A 4URLA 2UXBI 4JI5I 1PIEA 2O1UA 1RREA 2NPFA 2BM0A 2V8PA 2E5LI 3K85A 4GKKE 1N36I 1OJ4A 4DR1I 1N34E 4JG4A 1S16A 1XMQE 3JAMQ 2VF3A 2HHHE 2XEXA 4KQVA 3OTOE 4GKJI 4HY1A 3ZM7A 2Z5BA 1NHIA 2CG9A 1XNQE 4DV6I 4RPFA 2E1RA 2UXCE 2AJ4A 2UUBE 4OX9E 4Z7CA 4LF6I 4JI4E 1Z0VA 1NZ0A 1XNRE 4IZJA 2V34A 3T1HE 3Q6MA 1ZM2A 4AQYI 4PRVA 3HJCA 1IBLE 3J80C 4XTJA 4LFAE 1ZM4A 4DR6I 1USVA 3T1YI 4LF5I 1FJGI 5FLXC 4JI1E 4B3MI 1H73A 2O1WA 3B82A 4LFCI 4K0KI 2V2VA 1Z5CA 2BV3A 2Z5CA 4DR2E 2UUAE 2UU9E 4LFBI 4DR7E 1S4EA 4B3RI 3WU5A 4B3TE 4DV3E 1BKNA 2F4VE 1Z5AA 1H74A 2X7IA 2VQFI 1K47A 3LPSA 2DEIA 1Z0GA 1ZM3A 4LF4E 4USMA 4JYAE 3ZKDA 2V2QA 2UXDI 1I94E 2HKJA 4NXMI 3PYEA 1FKAE 2Z5BB 4DV1E 3J7AM 3PYFA 4PRXA 4LF8E 3HULA 4YHHE 5LMNE 4DV7E 1IBKI 3CWVA 5IT9Q 1MX0A 2ZM6E 4JV5E 4IZJB 4EMDA 1HNWI 4DPXA 2UUCI 1N0VC 2CGEA 2VQEI 4LF9I 2X36A 4JI3E 2DEJA 4JI8I 1Z0WA 3PYDA 4X65I 4DV5I 1EA6A 4DV0E 5IWAE 4HXZA 1N34I 3LTOA 1Y4SA 4M1KA 2UXBE 4JI5E 1KKHA 1MG7A 2E5LE 1Z0BA 4JI7I 2CZ9A 2Z5CB 3ZZUA 1N36E 2Q2EB 4DR1E 1Z59A 3K17A 3V5RA 4JI6E 1HR0E 1XNRI 4GKJE 3WU6A 3QT7A 2HK3A 1IBMI 1IBLI 1FWKA 4DV6E 1N32I 5LMUI 4LFAI 1HNXI 1HNZI 4LF6E 2HK2A 4DV4I 1NHHA 1WUUA 4DPWA 4JI1I 3J80Q 3K1JA 4N3OA 1N0UA 1XMOI 3QT6A 1Y4UA 4R1FA 3D4JA 2GQ0A 4DR6E 1Z0CA 3T1YE 4DR2I 1DARA 4DUYI 2UUAI 4LF5E 4KHPE 5BR8I 5FLXQ 4HACA 1H7UA 1FJGE 4DUZI 4DR5E 4B3ME 4LFCE 4K0KE 4MYTA 3ZZ0A 4X66I 3LNUA 4IZKA 1QZRA 5LL6R 1KIJA 5L3JA 4JI0E 4PU9A 3J81C 4LFBE 4B3RE 4MYUA 4X64I 1J5EI 1I94I 1Z0TA 3ZKBA 3Q1QA 5A2QQ 4WUBA 2VQFE 1VISA 1ELOA 4HYMA 4P7AA 4LF7I 3PYGA 2Z5EA 4UT4A 4B3SI 1ZXMA 2ZBKB 4YHHI 4DPYA 1N33I 4WUCA 1USUA 4JI2I 4X62I 4NXME 4DR3I 4DR4I 4DU7A 4YY3E 1EI1A 1FWLA 1U2RA 1IBKE 4GKKI 4P52A 1Y6ZA 2PNLA 4DV2E 5GMEA 2R42A 4I3HA 1XMQI 1HNWE 4NXNE 2HHHI 2UUCE 3JAMC 4ED4A 5FWKA 3OTOI 4LF9E 1H72C 4JI8E 4X65E 4DV5E 1XNQI 3GONA 2UXCI 2A2CA 2UUBI 2IOQA 4OX9I 4HACB 3QT5A 4JI4I 4FWGA 4JI6I 2PNMA 1HR0I 1KTVA 3PRYA 3T1HI 1A6FA 2A2DA 4IZKB 4JI7E 4USKA 2GS8A 4FW9A 2OI2A 4FWHA 3QT8A 4FN5A 1XHKA 4AQYE 1FI4A 1ZXNA 1H7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM E;  1ZM9 A;  1N32 E;  1B62 A;  5LMU E;  1HNX E;  3F0N A;  1MU5 A;  4WUD A;  1HNZ E;  1Z5B A;  3WU3 A;  3M6A A;  4Z7Y A;  2WW4 A;  4DV4 E;  4KHP I;  2UU9 I;  4DR7 I;  1PVG A;  4B3T I;  1RR9 A;  4DV3 I;  4DR5 I;  2F4V I;  1D6T A;  1XMO E;  2HFS A;  2ZIT A;  2V2Z A;  4JI0 I;  4LF4 I;  4DUY E;  4DPU A;  5BR8 E;  4JYA I;  4DUZ E;  4DXL A;  4X66 E;  1UEK A;  1NHJ A;  2R3V A;  5A2Q C;  3B78 A;  3J81 Q;  4DU8 A;  2BM1 A;  3ZZT A;  4DPT A;  4DV1 I;  4LF8 I;  2EFG A;  2J7K A;  2UXD E;  3H4L A;  4X64 E;  4ZVI A;  1J5E E;  5GMD A;  4UTG A;  5LMN I;  2HFU A;  4FWD A;  4DV7 I;  4JV5 I;  2ZM6 I;  1FNM A;  1PKP A;  5IT9 C;  3WU4 A;  3J7A G;  4LF7 E;  4YY3 I;  4B3S E;  4JI3 I;  2HKE A;  2LJP A;  3V2U C;  1N33 E;  4DV0 I;  5IWA I;  4JI2 E;  4X62 E;  4DR3 E;  3B8H A;  1Z0E A;  4DV2 I;  4DR4 E;  1KVK A;  4NXN I;  2VQE E;  1B63 A;  4URL A;  2UXB I;  4JI5 I;  1PIE A;  1RRE A;  2NPF A;  2BM0 A;  2V8P A;  2E5L I;  4GKK E;  1N36 I;  1OJ4 A;  4DR1 I;  1N34 E;  4JG4 A;  1S16 A;  1XMQ E;  3JAM Q;  2VF3 A;  2HHH E;  2XEX A;  4KQV A;  3OTO E;  4GKJ I;  4HY1 A;  3ZM7 A;  1NHI A;  1XNQ E;  4DV6 I;  4RPF A;  2E1R A;  2UXC E;  2AJ4 A;  2UUB E;  4OX9 E;  4Z7C A;  4LF6 I;  4JI4 E;  1Z0V A;  1NZ0 A;  1XNR E;  2V34 A;  3T1H E;  1ZM2 A;  4AQY I;  4PRV A;  1IBL E;  3J80 C;  4XTJ A;  4LFA E;  1ZM4 A;  4DR6 I;  3T1Y I;  4LF5 I;  1FJG I;  5FLX C;  4JI1 E;  4B3M I;  1H73 A;  3B82 A;  4LFC I;  4K0K I;  2V2V A;  1Z5C A;  2BV3 A;  4DR2 E;  2UUA E;  2UU9 E;  4LFB I;  4DR7 E;  1S4E A;  4B3R I;  3WU5 A;  4B3T E;  4DV3 E;  1BKN A;  2F4V E;  1Z5A A;  1H74 A;  2X7I A;  2VQF I;  1K47 A;  3LPS A;  2DEI A;  1Z0G A;  1ZM3 A;  4LF4 E;  4USM A;  4JYA E;  3ZKD A;  2V2Q A;  2UXD I;  1I94 E;  2HKJ A;  4NXM I;  3PYE A;  1FKA E;  4DV1 E;  3J7A M;  3PYF A;  4PRX A;  4LF8 E;  3HUL A;  4YHH E;  5LMN E;  4DV7 E;  1IBK I;  3CWV A;  5IT9 Q;  1MX0 A;  2ZM6 E;  4JV5 E;  4EMD A;  1HNW I;  4DPX A;  2UUC I;  1N0V C;  2VQE I;  4LF9 I;  2X36 A;  4JI3 E;  2DEJ A;  4JI8 I;  1Z0W A;  3PYD A;  4X65 I;  4DV5 I;  1EA6 A;  4DV0 E;  5IWA E;  4HXZ A;  1N34 I;  3LTO A;  4M1K A;  2UXB E;  4JI5 E;  1KKH A;  1MG7 A;  2E5L E;  1Z0B A;  4JI7 I;  2CZ9 A;  3ZZU A;  1N36 E;  2Q2E B;  4DR1 E;  1Z59 A;  3K17 A;  3V5R A;  4JI6 E;  1HR0 E;  1XNR I;  4GKJ E;  3WU6 A;  3QT7 A;  2HK3 A;  1IBM I;  1IBL I;  1FWK A;  4DV6 E;  1N32 I;  5LMU I;  4LFA I;  1HNX I;  1HNZ I;  4LF6 E;  2HK2 A;  4DV4 I;  1NHH A;  1WUU A;  4DPW A;  4JI1 I;  3J80 Q;  3K1J A;  1N0U A;  1XMO I;  3QT6 A;  4R1F A;  3D4J A;  4DR6 E;  1Z0C A;  3T1Y E;  4DR2 I;  1DAR A;  4DUY I;  2UUA I;  4LF5 E;  4KHP E;  5BR8 I;  5FLX Q;  4HAC A;  1H7U A;  1FJG E;  4DUZ I;  4DR5 E;  4B3M E;  4LFC E;  4K0K E;  4MYT A;  3ZZ0 A;  4X66 I;  3LNU A;  1QZR A;  5LL6 R;  1KIJ A;  5L3J A;  4JI0 E;  4PU9 A;  3J81 C;  4LFB E;  4B3R E;  4MYU A;  4X64 I;  1J5E I;  1I94 I;  1Z0T A;  3ZKB A;  3Q1Q A;  5A2Q Q;  4WUB A;  2VQF E;  1VIS A;  1ELO A;  4HYM A;  4P7A A;  4LF7 I;  3PYG A;  4UT4 A;  4B3S I;  1ZXM A;  2ZBK B;  4YHH I;  4DPY A;  1N33 I;  4WUC A;  4JI2 I;  4X62 I;  4NXM E;  4DR3 I;  4DR4 I;  4DU7 A;  4YY3 E;  1EI1 A;  1FWL A;  1U2R A;  1IBK E;  4GKK I;  4P52 A;  4DV2 E;  5GME A;  2R42 A;  4I3H A;  1XMQ I;  1HNW E;  4NXN E;  2HHH I;  2UUC E;  3JAM C;  4ED4 A;  3OTO I;  4LF9 E;  1H72 C;  4JI8 E;  4X65 E;  4DV5 E;  1XNQ I;  3GON A;  2UXC I;  2A2C A;  2UUB I;  4OX9 I;  4HAC B;  3QT5 A;  4JI4 I;  4FWG A;  4JI6 I;  1HR0 I;  1KTV A;  3T1H I;  1A6F A;  2A2D A;  4JI7 E;  4USK A;  2GS8 A;  4FW9 A;  2OI2 A;  4FWH A;  3QT8 A;  4FN5 A;  1XHK A;  4AQY E;  1FI4 A;  1ZXN A;  1H7S A; 
#chains in the Genus database with same CATH topology
 3CJ3 A;  2DNG A;  3Q8U A;  4AL5 A;  1IBM F;  1F3V A;  1WD6 A;  4FW5 A;  1YSJ A;  2FQQ B;  3H4D A;  3TEG A;  3EDQ B;  4J9L A;  3MEG A;  2UUW A;  5B0C A;  2PMH A;  5KFJ A;  4KIA A;  3SQG A;  3EPI A;  4U6P A;  3MF5 A;  4RX6 A;  5GAG I;  3ZTP A;  2RQK A;  4DR2 F;  2OMO A;  4MKA A;  4KE5 A;  2H54 B;  3CT9 A;  3BKF A;  3G6E S;  4DSL A;  3CCR S;  4OYX A;  5B0E A;  1RP5 A;  3MPV A;  5CAB A;  2ZH8 A;  4C8L A;  2R8H A;  4YY3 I;  1SIZ A;  2MGZ A;  4DUY J;  2D3U A;  3TJ9 A;  2R7W A;  2MYF A;  2QYG A;  3KHR A;  4LVO P;  1KVK A;  2IPO B;  4AL6 A;  4DCJ B;  4ED1 A;  1UVN A;  5KFT A;  4ZPD A;  4NA3 A;  1MRO A;  2J0W A;  4IH5 A;  2X1F A;  2WBM A;  3D6T B;  3R27 A;  2IHR 1;  3VAH A;  2XEX A;  1FRM A;  5C24 B;  5ADZ A;  4QWA A;  1X0F A;  3OVA A;  3N79 A;  3HHL A;  4Z7C A;  2Y1J A;  2CAD A;  2ZH4 A;  3PS3 A;  3HI9 A;  2QMX A;  1HR0 F;  4K2X A;  2LDI A;  4GKJ F;  2XY5 A;  1FES A;  1NH7 A;  2NZC A;  4IO9 Q;  4LRE A;  3PG9 A;  3W1Y C;  2ZH3 A;  5U47 A;  3FBB A;  2AQ4 A;  1S1V A;  4ZS6 A;  2PEB A;  1G4C A;  2FJB B;  4Y34 A;  1X0P A;  3ADA C;  2G2Z A;  1S76 D;  4USU A;  5CD4 H;  4IS9 A;  4X84 A;  3HP6 A;  4B3T F;  1FJG F;  2W2M P;  4C11 A;  5KG5 A;  1TKX B;  4WKR A;  4LF4 E;  1FTC A;  2DNN A;  2BKO A;  4ZP8 A;  3EDR B;  4ECX A;  2KB2 A;  2C22 A;  4JYA F;  1N88 A;  3V6K A;  2Z5B B;  2B6A B;  5EKW A;  4PRX A;  4GVB B;  2DXD A;  4NLW A;  2YPY A;  2C37 B;  4J9U E;  2DRB A;  4DV7 E;  1NJX A;  5B0D A;  1X9W A;  2PFF B;  3MCM A;  3GII A;  4LSN A;  4YS2 A;  2ZUA A;  1NJY A;  4KPY A;  3EUN A;  5KAK A;  1Q95 G;  4B3R J;  3IAM 9;  3PW4 A;  5K36 B;  1U0H B;  2DNM A;  3W64 A;  3HZE A;  3SV3 A;  1WDT A;  1HNW F;  4DV1 J;  1SPB P;  2UUC F;  3CCQ S;  3HFK A;  4Q0B B;  5KFS A;  4P2S A;  4P9S A;  2R4F A;  1NK8 A;  3JAM U;  1SKW A;  3GLJ A;  4DV6 E;  1N32 I;  2Q3P A;  3C15 B;  1HNZ I;  3FQL A;  4IFV B;  1HQ2 A;  4LCF A;  5F0U A;  4DV4 I;  3GFZ A;  3DGV A;  3W3S A;  3JAM Y;  1WSV A;  2XYG B;  3OTB A;  3QT6 A;  4OQJ A;  2GQ0 A;  4DR6 E;  4F7V A;  1Z0C A;  1JLC B;  4AM3 A;  1H7U A;  2W1B A;  2ZDP A;  4Q8F A;  1NME B;  5D6G A;  4LIR A;  2JDJ A;  3I31 A;  4JI0 E;  2HLT A;  2XO7 A;  2J9E A;  5LSR A;  1XMO F;  2X1G A;  1UWB B;  4CO2 A;  5K36 F;  3Q89 A;  4P2F A;  1GQE A;  2XBP A;  3H25 A;  3H5U A;  1CSJ A;  1QTM A;  4X4P A;  3DLL Q;  2OP5 A;  4DU7 A;  4B9N A;  1S1T A;  4HI2 A;  1PBU A;  1YGY A;  1Z2L A;  3W2W A;  2G13 A;  4RBT A;  1LW0 A;  4F3M A;  3OTC A;  3W65 A;  4DI6 A;  4OLO A;  4YME A;  2LLZ A;  1Y6Z A;  1NJI T;  2R42 A;  1XMQ I;  2RHQ B;  1JNR B;  3HDS A;  3TJ8 A;  3JAM C;  5FWK A;  4BA2 A;  5C2G A;  3BS9 A;  3C6T A;  4JP8 A;  2K7K A;  1SB6 A;  4EI2 A;  3PAC A;  3KJF B;  3NEK A;  9ATC B;  3QT5 A;  1E6Y A;  2CQB A;  2W9B B;  2MB0 B;  1TV6 B;  4KYZ A;  2A2D A;  3EZU A;  5KFC A;  3PZP A;  4K8R A;  1SL1 A;  5IT9 Y;  4UUW A;  5KG6 A;  3GP9 A;  5IT0 A;  3JB9 k;  2YKO A;  2DNH A;  5LT5 A;  4FW9 A;  2Q1L A;  2HW3 A;  2FLL A;  4PWD A;  2RDI A;  3THP A;  1ZAX A;  3OW2 R;  1ZM9 A;  4ECU A;  1S1X B;  2FJA B;  4O4G B;  2R7V A;  4DV5 J;  4K59 A;  3WU3 A;  2LCW A;  2XYH B;  2CQP A;  3P06 A;  5DS7 A;  4HHU A;  1FKO A;  2HFS A;  1RT6 B;  1RA7 A;  4H4M A;  3GMG A;  1TMM A;  4PUO A;  4DUY E;  3EGN A;  2CVE A;  2ASL A;  2WON B;  2LFV A;  1FVS A;  3M32 A;  3DRY A;  2F4V F;  5F8N A;  4LCH A;  2NN6 A;  1RI7 A;  3O6Q A;  5DET A;  2RDJ A;  1UZD A;  2GV1 A;  4ELU A;  4L73 A;  2H1Y A;  3CCW A;  2E7X A;  5IT9 C;  3WU4 A;  2HRU A;  1RT1 B;  3C14 A;  3SCI E;  4A8F A;  1VQY A;  1I6J A;  1FRI A;  1HBM B;  4ZCI A;  1F9E B;  2JEB B;  2OPP B;  1HHT P;  1CJK A;  3N5B A;  1KWM A;  4JV5 F;  3PX4 A;  1RRE A;  4LCG A;  1HKA A;  1S1W A;  4FF3 A;  2V8D A;  3OJS A;  1NHV A;  2DR6 A;  3GYX B;  4TXS A;  1WG1 A;  2DGS A;  4DUT A;  1QM9 A;  1HWI A;  1Q8L A;  3D67 A;  2HBZ B;  3R1L A;  3RYL A;  5ETQ A;  3JQJ A;  3NGR A;  4R8U B;  3H98 A;  3OLA A;  2UUB E;  2P2C B;  2YWE A;  3BV8 A;  4F4Y A;  3D6M B;  4F4K A;  4RW7 A;  3MOZ A;  1LW2 B;  2FJX A;  3T41 A;  4CYU A;  1S6P B;  2G2O A;  4LFA E;  3DOL A;  1SC4 B;  2CNL B;  2VH7 A;  4DOZ A;  2CQH A;  5DNL A;  4DFK A;  4WZQ A;  4DLG A;  4JI1 E;  4B3M I;  1K1Q A;  1RAC B;  2FD2 A;  2WSF C;  3OTO J;  1VMB A;  3QID A;  2OAU A;  1KON A;  1T3O A;  4H4O A;  3QJJ A;  2BMB A;  4Q2M A;  4F04 B;  3DRP A;  5JUM A;  2XLI A;  3ILL A;  3A3N B;  3R6L B;  1DTT B;  3IC1 A;  2ZOM A;  1WHY A;  1Z2Z A;  3LPS A;  4FNI A;  2Z30 B;  2B51 A;  4E98 A;  5KFA A;  3VR1 A;  3MMB A;  2MKH A;  4HL9 A;  4NLS A;  1TMJ A;  2UXD I;  5C0X A;  4OZ5 A;  2PA3 A;  1S0N A;  5KFO A;  3AB2 B;  1FKA E;  1RT4 A;  1CLF A;  2C2O B;  5L1K A;  1Q5V A;  4DV1 E;  1Y5N B;  4ZVR B;  3RJM B;  2H51 B;  1KHV A;  2RUS A;  2CNO B;  1LWE B;  2EXU A;  2CDR B;  3D68 A;  1YJN S;  3IWX A;  3VAJ A;  1JLA A;  2YNH B;  4EZ6 A;  2NN6 E;  1C1B B;  2CWK A;  2AEJ A;  1OPZ A;  2XNR A;  4MIW A;  4HXZ A;  1AYE A;  2ZH9 A;  4IUF A;  2H3E B;  4ECV A;  2NRE A;  1WHV A;  3HFV A;  5T14 A;  4MKV A;  3QWU A;  3TUP A;  2Y1L B;  3O3L A;  2FYX A;  1S7I A;  1NSA A;  4ZJO A;  1MWY A;  2B4P A;  1JQG A;  1N6Q A;  4ECQ A;  2ZNZ A;  3V6J A;  3I5C A;  1FWK A;  2IVY A;  4IFD A;  5LXR A;  1S7H A;  1T9W A;  5IWA J;  4DV2 J;  3DM2 B;  1VBX A;  2E1P A;  3QGI A;  3EM1 A;  4QJV A;  3P6Y C;  3M2U B;  4KO0 B;  2W8K A;  2MKC A;  3EZO A;  4NZ0 A;  2UUA I;  3MR2 A;  2POK A;  1S12 A;  2K3K A;  4KGZ B;  2HNY B;  4U7C A;  2FHM A;  3SZ2 A;  2IM2 A;  2C3M A;  2EG2 A;  4X66 I;  2F8M A;  4OYO A;  2FJW A;  1NK7 A;  3KNA A;  5I3U A;  1PG5 B;  4EBD A;  1ARO P;  4ID5 B;  2I2Y A;  5KG1 A;  2JHE A;  2BJD A;  2Z2Y B;  5KOW A;  2OML A;  1XQI A;  2CJQ A;  1HNZ J;  1WF1 A;  1UTA A;  2XSJ A;  2NUU G;  4DV4 J;  2QLX A;  3DDK A;  2AZ1 A;  2ABY A;  2PN6 A;  2HG4 A;  2RJZ A;  2BA0 G;  2GVD B;  1HYS B;  1RAF B;  4AYB D;  2GO4 A;  1IKV A;  3IGV A;  1U2R A;  4C2M A;  2H65 B;  4E2F B;  3U7J A;  4QWC A;  1GH8 A;  4IFY B;  1H98 A;  3CD5 A;  1HW8 A;  4ZVQ B;  1EIY B;  4DV5 E;  8AT1 B;  1Y00 A;  1TEL A;  2AGQ A;  3MR6 A;  4W4M A;  3I9Z A;  2D74 B;  4B17 A;  4KTQ A;  1L3T A;  1WJ9 A;  3M85 G;  4O4R A;  1T02 A;  4CI0 B;  1PBA A;  1S9G B;  5H9E K;  2XUL A;  4ECT A;  4JI4 F;  4X4O A;  5C25 B;  1T94 A;  4CWB A;  3JXO A;  4XTT A;  3T1H F;  2IA6 A;  4O44 B;  3T1A A;  1K1S A;  3M8P B;  4USI A;  1Z5B A;  4OYP A;  2IMO A;  4OO1 B;  4B9S A;  1LEO A;  5HVF A;  1T05 A;  2JSX A;  3ITH B;  2XMA A;  1RAB B;  1J5O B;  4KAI A;  3MEE A;  1CJT A;  5DRP A;  3JYT A;  1YI2 S;  2FY8 A;  4WFY A;  3QLH A;  4WXW A;  3TNV A;  4PQU A;  1IBL J;  1SQF A;  1JMT A;  3BN4 A;  4FWD A;  2VFR A;  3MM8 A;  3HM9 A;  4WJB A;  4DSK A;  3D0I E;  2MQL A;  2QE5 A;  1X5O A;  3PR5 B;  3S1T A;  4ICL A;  4MKY A;  4MAK A;  1T03 A;  3B8H A;  2MQM A;  3MM5 B;  1MN9 A;  2DHA A;  5LMN F;  3HHD A;  5F9N A;  1RAO A;  2HSE B;  1KTQ A;  1S99 A;  1RJJ A;  2V8P A;  4AFF A;  2ZBQ A;  2PSZ A;  2ZEJ A;  2VF3 A;  4QR1 A;  3OTO E;  4GKJ I;  1Y5L B;  4HY1 A;  1V6H A;  4WFA Q;  3UNY A;  2ACY A;  3D1Q A;  4DCO B;  5CD4 A;  1XK8 A;  2DXE A;  4WP3 A;  3C3L A;  2DB1 A;  3KK2 B;  3CCU S;  2LMI A;  1XNR E;  2P5V A;  3M4X A;  2V34 A;  1MML A;  1PC5 A;  2KH9 A;  3DMJ A;  4ZN1 A;  3RUB L;  4J7C A;  3H7H B;  4FPI A;  2YXL A;  2F4F A;  3OXL A;  1FJG I;  9RUB A;  1I5O B;  1PKU A;  2DR7 A;  1A0O B;  4TLQ A;  1RT7 B;  3SFG A;  5HMY A;  1IR0 A;  3GJR B;  4DSI A;  2IBK A;  2YX1 A;  4U96 A;  1FJE B;  1UDO A;  3J7A 1;  1N5T A;  2J6U A;  1FWP A;  3Q86 A;  2FGC A;  2M9K A;  1HWL A;  4USM A;  4X4R A;  2KFY A;  4R25 A;  2HMI A;  3U1Y A;  1H7W A;  4NPO A;  2B7C B;  2HKJ A;  4GVL A;  3FDS A;  4PPZ A;  4LRD A;  5JEA C;  4MU0 A;  1X5P A;  2DHS A;  2DGW A;  4FXD A;  3KUG A;  4DR7 J;  1FFG B;  3QAT A;  4KGV B;  4B3M J;  4HT7 A;  1HNW I;  2UUC I;  5GMK a;  2MLZ A;  3G9C A;  1Z0W A;  2KYX A;  2B9E A;  5IWA E;  4AID A;  2RU3 A;  3WHI A;  3NS7 B;  4RKU C;  4OO1 D;  5KFK A;  2HHW A;  5A0Y B;  2BE7 D;  3IRX A;  1Q7L B;  4LF8 J;  3OUY B;  4K4Y A;  1RAA B;  2OSQ A;  3KK3 B;  3UCG A;  4N41 A;  2DK2 A;  3WU6 A;  1YHQ S;  1RA6 A;  3JTP A;  4RUH A;  2VHG A;  5DG8 A;  1VQK S;  4FYW B;  1OSD A;  3I0R B;  1UDS A;  4CDI A;  1UVJ A;  3KHH A;  2EC2 A;  3VVT A;  3NNA A;  4DCP B;  1H38 A;  3OHA A;  5A6P A;  1FK9 B;  3LWL A;  1XMO I;  3AD9 C;  3QIP A;  5F8L A;  4K7Q A;  1XMB A;  1IKW A;  5KFF A;  2XSF A;  4DR5 E;  1GX5 A;  3P5T L;  4HHJ A;  3R97 A;  3Q22 A;  3PS2 A;  3KXD A;  2R7S A;  3KLG A;  1RTD A;  2VOD A;  1ZA2 B;  4MU3 A;  3ISN D;  4WFX A;  2XCP A;  1RTH B;  3T9Z A;  3A13 A;  2C38 B;  2OEL A;  2DT9 A;  4ELV A;  1WC5 A;  1JLF B;  1RHR B;  1KQS R;  3KHL A;  3PX0 A;  2IM3 A;  2IAJ A;  4OJG A;  2O01 C;  4HR2 A;  2BJ8 A;  1USU A;  1RYS A;  3NNH A;  4K0K J;  3KYL A;  1FX2 A;  1IXK A;  1S77 D;  4H54 A;  1LKZ A;  2HS3 A;  1GTE A;  5G4D A;  4ZVS B;  1CJU A;  2JL9 A;  3ZZZ A;  2B0G A;  1FF2 A;  3UPF A;  4X66 J;  2Q66 A;  1LFP A;  4ZVT B;  2I38 A;  4C3L A;  3D9B A;  1H72 C;  4FPR A;  3L7Z A;  4KV8 B;  4G1Q B;  3LOU A;  4HTI A;  2OIH A;  2DNO A;  2KT2 A;  2HIY A;  3SSQ A;  4DS5 A;  5D0H A;  5D3G A;  5HQL A;  4OX9 I;  4HDH A;  2AV5 A;  1JLQ A;  2NXN A;  2ILY A;  3LW5 C;  3M2V A;  2DH9 A;  2C42 A;  2MLY A;  5M2R A;  4JI7 E;  3IWN C;  1KFS A;  5ETV A;  3ILJ A;  3FNN A;  4ZPT R;  2MDA A;  3H8Y A;  1DLO A;  1RK8 A;  2F1D A;  3OT9 A;  2VQE J;  2UP1 A;  3PX6 A;  1W25 A;  2OPQ B;  2HZC A;  3PEJ A;  1HQU B;  3DLE B;  3CCS S;  2CAJ A;  1RWK B;  3BDP A;  5K14 B;  1LK5 A;  2F4V I;  1BMQ B;  1OSC A;  3K5M A;  1H3D A;  5MAO A;  1AZS B;  5EDW A;  1R8C A;  1H2V Z;  3PO5 A;  4YB6 A;  3MM9 B;  1YH8 A;  3M8S A;  1YZ6 A;  2HAF A;  4HH1 A;  1IBM J;  3DU6 A;  1NSQ A;  2HHV A;  2JC1