4ED4A

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
303
structure length
299
Chain Sequence
SDWVPTGAVTVRAPGKVNLYLAVGDLYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 97
structure length 299
sequence length 303
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4ed4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ed4A01
4DV4I 3D4JA 1Z0VA 1HNXI 1XHKA 2VQFE 2UXDE 4DR3I 5IT9Q 3ZZ0A 4LFCI 3T1HI 1B63A 4DV2I 4NXNE 4GKJE 4ZVIA 5LMUE 2AJ4A 4DR2I 1I94I 3J80Q 1UEKA 5FLXC 2GS8A 4USMA 4WUBA 1N36I 2E5LE 1FWKA 4DUYE 4JI4I 4X65I 1HNWI 1ZM4A 4DR7I 3V2UC 3ZZTA 4WUDA 2BM1A 3OTOE 3JAMQ 3QT6A 1EI1A 4JYAE 1IBKI 3ZM7A 5BR8E 3T1YE 1S16A 1FNMA 4DV4E 4B3RI 3B78A 2ZM6I 1HNXE 4JI7I 1H73A 4DR3E 3J7AG 2Q2EB 3T1HE 1HNZI 1XMOI 4DV2E 4EMDA 4DV7I 1H72C 4DR2E 1I94E 1H7SA 2UUAI 1Z0GA 4P52A 1U2RA 4DU7A 4X66I 3V5RA 1ZM2A 1N36E 1NHIA 3H4LA 4LF5I 4X65E 2HKJA 3WU3A 1MX0A 1HNWE 4JI3E 4MYTA 3B82A 1N0VC 1Z5BA 1N32I 1PIEA 3WU6A 3K1JA 2DEJA 4JI2I 4OX9E 1FI4A 3HULA 1KKHA 3QT7A 4B3RE 4JI7E 4YHHE 1HNZE 4AQYI 5IT9C 4DV7E 4B3MI 1N0UA 2WW4A 4JV5I 1FKAE 3K17A 4YY3I 2UUAE 1KVKA 4P7AA 4X66E 2V2ZA 3J80C 5LMNI 4HACB 4PRXA 2VQEI 4DR4I 4LF5E 1HR0I 2NPFA 4M1KA 3J81Q 4DPYA 4XTJA 1H7UA 5A2QQ 1Z0TA 4GKKI 2EFGA 4JI0I 1NZ0A 2HHHI 5GMEA 1ZM9A 2ZITA 1VISA 4JI2E 1Z0WA 3QT5A 4KQVA 1IBMI 5FLXQ 3M6AA 3WU4A 4DV1I 4JI5I 1RREA 4FW9A 2HFSA 1D6TA 1EA6A 1NHJA 4RPFA 1MU5A 4AQYE 4DXLA 1B62A 3LPSA 3F0NA 4LFAI 4B3ME 4USKA 2E1RA 4LFCE 1XMQI 5IWAI 4YY3E 2UXBI 4MYUA 2VQEE 4DR4E 4LFBI 2V8PA 4DV6I 2UUCI 1HR0E 1Z0CA 4PRVA 4LF4I 3LTOA 4K0KI 1ZXMA 3PYGA 4DR5I 4JI4E 4GKKE 4DR7E 4DPTA 1FWLA 4JI0E 4FN5A 2BM0A 1J5EI 2J7KA 1ZM3A 1FJGI 4JG4A 1IBKE 1IBME 1OJ4A 2HKEA 4FWDA 5L3JA 4DV1E 4JI5E 4LF8I 2ZM6E 4LF7I 4LFAE 4DUYI 2HK2A 1MG7A 1DARA 2X36A 1XMOE 4JI6I 1XMQE 4UTGA 4DR1I 3J7AM 1A6FA 4PU9A 4DV5I 1Z0EA 1NHHA 4LFBE 4DV6E 2UUCE 4LF4E 4LF9I 1KIJA 4JI8I 3T1YI 2VF3A 4DUZI 1N33I 4DR5E 2UU9I 3ZKDA 1RR9A 3J81C 2UUBI 1IBLI 4URLA 4KHPI 2HFUA 5A2QC 1N34I 4LF6I 1J5EE 2ZBKB 1FJGE 2OI2A 3CWVA 3PYDA 4I3HA 4X62I 2XEXA 1N32E 1PVGA 1QZRA 1Z5CA 3JAMC 3LNUA 1Z5AA 3ZKBA 4LF8E 1ZXNA 1KTVA 2F4VI 2HK3A 3ZZUA 2BV3A 2UXCI 4NXMI 5LL6R 4LF7E 1XNQI 4X64I 1K47A 2R3VA 4JI3I 4JI6E 4DR1E 4B3TI 3Q1QA 1WUUA 4DV5E 2V2VA 3PYFA 3PYEA 4UT4A 1H74A 4DU8A 2DEIA 4JV5E 3GONA 4LF9E 4JI8E 3WU5A 1XNRI 1ELOA 4OX9I 4DUZE 2X7IA 5LMNE 4WUCA 4DV0I 4B3SI 4DR6I 1N33E 4DPXA 2A2CA 2UU9E 4FWGA 4DV3I 4JI1I 2UUBE 4YHHI 4R1FA 1IBLE 4KHPE 1N34E 4LF6E 3QT8A 3B8HA 2VQFI 2UXDI 4X62E 2HHHE 2CZ9A 4NXNI 2F4VE 4GKJI 1PKPA 4Z7YA 2V34A 4HYMA 5LMUI 2UXCE 4NXME 2LJPA 1BKNA 4DPUA 1XNQE 4HY1A 4X64E 4B3TE 4HACA 1S4EA 2E5LI 2A2DA 4ED4A 5IWAE 2V2QA 3OTOI 5GMDA 1Z0BA 2UXBE 1XNRE 4JYAI 4FWHA 4DV0E 4B3SE 4DR6E 4DPWA 4Z7CA 1Z59A 5BR8I 2R42A 4DV3E 4HXZA 4K0KE 4JI1E
chains in the Genus database with same CATH superfamily
3PRBA 1RTJA 4V19X 2QSWA 2QLWA 4RW8B 2OFHX 1JLAA 1B63A 4O44A 3MM7A 4EBCA 2GQ0A 2PC6A 3KHHA 5KG6A 1N36J 4MU4A 1ZTTA 1NJXA 1L5UA 2JOQA 2BJ8A 1N5SA 4WUBA 4X65I 1JLEA 4A46A 2HZAA 4DR7I 1W7WA 4Y2KA 5D4LA 3G86A 1DLOB 4BHQA 3HFVA 5J2MB 1TL3B 1FNMA 3TA2A 3SYZA 2VC0A 5HVHA 4MIAA 2OD4A 1RT5A 1BD6A 3ZO7A 3IS9B 2HMIA 4P52A 1Y5YA 1YK9A 3S01A 4M94A 1HQEA 4K7QA 2VG7A 3J80Y 1XC9A 5FJ4A 4AQYF 1V5VA 3B82A 1EQ0A 2D7SA 3WX8A 1HWJA 1SIWB 2AMCB 3TNVA 1SJ4P 2WVEA 5T7LB 1TL7B 2N4CA 3JAMY 2VKZG 2HWHA 5B0CA 2RH3A 3R5CA 5U47A 1X4GA 1KLMA 5KFUA 2P5VA 1KKHA 4AL5A 4C8OA 2JVRA 5CABA 2W9CB 3QSIA 4DFMA 3NRBA 4ZPCA 4ES1A 4M5JA 4YB7A 4AYBD 2D9OA 4O4RA 2FD2A 2R7RA 1RWVB 1Y4SA 1DZ5A 1N8RT 2CVEA 5A8WA 3MGJA 1HMVA 3R97A 2Z5BA 2OFGX 3BBBA 3BN4A 4IKAA 3PNIA 2MKJA 3MAAB 2B9EA 1MROB 2FHOB 1OO0B 1OSCA 3GU0A 2XWYA 4ES2A 1MU5A 2XSFA 1AROP 1MN9A 3V81B 3LUYA 1SKWA 1GMUA 2HIQA 2XHWA 3SSSA 3UDLA 2CNLB 2CVIA 3M1VB 1ACMB 1J5EF 1XMQI 1FCAA 2PGCA 5IQ6A 3C3LA 3I0RB 6FDRA 1VMBA 3IA0A 1GH8A 2CFXA 3N6NA 2KXFA 1CULA 4HT7A 3DD6A 4IFVA 4OLOA 4OHVA 4RBTA 3M6VA 1Y60A 1WEZA 2C3PA 4B02A 2JLEA 3NWGA 3W1YC 2J7KA 1F5CA 2D41A 1DHMA 3Q8YA 2DR7A 1NKCA 1VC0A 5LMNF 1LEOA 5FLXY 4RW4A 2XBPA 3M6XA 2UU9F 2XTJP 5GVQA 2H4YB 4FS1A 2MPUA 1HWUA 3GIKA 5KT2A 4KHPF 5J2PB 2IPOB 1Z0EA 1VI7A 3R8YA 4FXVA 3H2UB 2Z57B 2DGWA 3LP2A 4JI8I 2W4PA 5SUHA 5GAEU 5K8PA 2H3EB 2ROEA 3THVA 1RR9A 3LP1B 1B0TA 1TAUA 1W2BR 3CF5Q 4M5IA 1VRUA 1IM4A 3DLEA 5E33A 4QPTA 1UPMB 2E9ZA 1RT7A 3W7BA 1RTHA 3LF0A 1D09B 1JMTA 3VQTA 4TU8A 4F3QA 2J9CA 1AXQA 1QSSA 5GAHU 3MM7B 5A0YB 1XNRJ 2XG8A 4PZVA 1F1BB 1FE0A 3PRVA 1TKTA 4ILMA 4DL0C 2CQBA 3L3CA 4LOMA 3QZ7A 2PNZA 1T03A 1X60A 2HZCA 1JLEB 2EWHA 4JV1A 4LF6E 4KC5A 4DUYF 4KV8A 1KS2A 3QJLA 2XSJB 1FFSB 1XWLA 2XMTA 2FPHX 2BANA 2ZWPA 3V6KA 1T3NA 1SCJB 2DNNA 7AT1B 2PT0A 3WBZA 4WFYA 4CLWA 3N01A 4ZDNA 1CPZA 5C24A 1RJJA 1WF1A 3SV3A 1YITS 1KVJA 4DL5A 4KB7A 5BR8I 3K58A 4CNYA 2EC0A 2MQPA 4NXMF 2ASDA 2CQ0A 2GO9A 3P6YC 1Z0VA 2VQFE 1UA1A 1PSDA 3CCES 2JLGA 3OHAA 3CD5A 1F2HA 3WX4A 4GKJE 3P5TL 1U0SA 4ECUA 5KTQA 2VOOA 4MAKA 1F3FA 5CZVA 4X65J 2H65B 4OX9F 2WVDA 1OY8A 4ZVQB 3EX7B 2XZWA 5IM0B 2EFNA 4JI4I 5ETRA 4TY9A 1TUWA 2QLBB 3DRPB 1EI1A 3THPA 5B08A 1FRIA 3KUGA 1VHIA 1RU2A 1NO8A 1JLQB 1TUVA 1Q53A 4I2QB 2HNDB 2J5AA 2BR2B 1WG5A 3D1OA 1R8CA 3BDEA 3MM8B 3SMZA 1FHTA 1IKVB 2WBMA 1WEXA 2HG4A 4ZLPA 4CCHA 1CJVB 3V5RA 1ZH5A 2F9DA 3OTBA 5HI7A 2RRNA 4NRTA 2HKJA 3THTA 1YHCA 3J81Y 3MR7A 4C98A 2RS2A 1N0VC 3B4TA 3GIJA 3T5LA 4URGA 1Q0NA 1S9FA 3ZTSA 1FJEB 5KG4A 3MMAA 4PCQA 3MM9A 5E3PA 4X4RA 2BQUA 3D7SB 2RDDA 1VQKS 3V4IB 1GQEA 2PO0A 3GJQB 2VQEF 1I94F 2PA8D 1KQSR 4B3RE 3VVTA 4AQYI 4OV6A 1FDBA 1EIYB 2XCPA 1KR4A 3I0SA 2IDLA 2J0WA 4QWEA 5C42B 4N56A 3V6DA 1AFJA 4FBTA 1CS4A 3LPEA 4EZ9A 3FZ2A 1R89A 2LU2A 3EDRB 3HD2A 1HR0I 2GIQA 3AB4B 2NPFA 3H42A 1S97A 4N77A 5L1JA 1IBKJ 2B9WA 2HBRB 5A2QQ 5F3TA 1VQNS 2EFGA 2HHUA 1GK8A 1HK7A 4PXDA 2Z4PA 4JV0A 5KT4A 4OYAA 4F8RA 4EEYA 4LFBF 4OZLA 4FW9A 4QIFA 3IBFB 3MR2A 2ZD1A 2F5GA 4QU7A 2BACA 4DR5F 1OQ3A 4YB6A 1WC1A 4ANCA 4ZLNA 4QWAA 1S48A 2IBKA 1U1NA 3H5YA 1FJGF 3BKUA 1RAAB 4ICLB 4RJVA 2ZOGA 1RBOB 3DRSA 3FEYB 4MYUA 2JHEA 4EYIB 4LCFA 3U1KA 2XO7A 3HHLB 1SC6A 4F4YA 2E29A 4ERDA 4L76A 2KVIA 2POKA 1RAGB 1CJKA 1FWLA 2GZOA 4ZVGA 3HHKA 1J5EI 5F8MA 2KU7A 1TV6B 3MWBA 1U1MA 2IESA 5GADU 3LP0B 1N88A 5HJXA 4FWDA 1TR0A 4NA3A 3OW2R 5JEAA 2W9BA 3OFEA 2VPYB 1EP4A 4MDTA 3K8WA 2M9KA 2C28A 2AJ0A 1S57A 2RD5C 4KV8B 1B64A 3UD5A 4OIXA 1VQ6S 2WP8A 4L6V3 4JI8J 4DCJB 4NPOA 3I5BA 1SKUB 4X62F 2OPPA 2HHHF 3PJXA 4QW9A 5HROB 5HLFA 4IOAQ 3FEXB 1GEHA 3P96A 2UU9I 3H5UA 2BE2A 4M5HA 1ROFA 1JK9B 4CLKA 4KHPI 5A2QC 4MU3A 4IYQA 1HBNA 2ZUGA 3M8PA 1Z5CA 1S1XA 5FD1A 5JEAD 2LVWA 1GTHA 3AHPA 5CHCB 3ZZUA 3RB3A 1R43A 3ET6B 4YEAA 3DLHA 3KLVA 3K59A 4OZ2A 5HBMB 1U1PA 2JEAB 1HI1A 4DR1E 2CGEA 1FK9B 2LQJA 5C2CA 3Q8RB 3RUBL 4YDDB 3IFEA 3HD1A 1KN6A 3DMJB 3ENQA 2OEKA 3CDUA 4RBVA 1B99A 2Z2ZA 2A2CA 5B0BA 1FFGB 4C9DA 2XMUA 2PO4A 2XQCA 3QO9A 1HNIB 5GMKa 3OXGA 3BSOA 4Y2AA 5K14B 4EO6A 3TJ8A 3GV8B 1ZTWA 3R27A 4Z7YA 3DYAB 2KFYA 2NUHA 4LQ3A 4NXME 2U1AA 1IKXB 1JXEA 3D28A 2W4CA 4USWA 4G1IA 2QL7B 4QQBA 2MLZA 4ED3A 2HGLA 5BR8J 4ED5A 3Q2TC 4DV0E 4B3SE 4ANEA 1KDNA 3MAQA 4JV2A 3AQPA 1DY3A 1RWUA 3BH7B 2CPYA 3PX0A 1HQUB 2QA1A 4RL1A 2UXDE 1U6FA 4U7CA 4LFCI 1FVQA 1KQKA 1UJ4A 2FGOA 1VLOA 3U1YA 3FFIB 4PG6A 3ILLA 5HVFA 2FDNA 3NOGA 4RNFA 3WHIA 1S7HA 6AT1B 1TZ0A 1HNZF 3UQSA 3MEDB 2JEFA 1YRXA 3NEKA 1CS4B 2W2NP 1HPZB 1U7LA 3I32A 2AE8A 1LNQA 1MW7A 2Q43A 1YJWS 2IAJB 1P6TA 2VQFJ 1QVFR 1JJHA 3NXZA 3A13A 2LFVA 1T8EA 2XYPB 4Z2XA 4GKJJ 2IERA 3SDEB 1I94E 3KYLA 1NDKA 5H9FJ 2CAJA 4KE5A 1NHIA 4YB5A 4DS4A 4LBHA 3HT3A 3N9UC 4YY3F 1RAOA 2ZH4A 3HULA 4AQYJ 3B6BA 4IFDA 3J80U 4DMZA 4DX5A 3H8YA 1X8DA 1RYSA 1I51B 2MY8A 3X3UA 3QLHB 4IDKA 8AT1B 4OI2A 2Y0BB 4JV5I 1HD1A 2ZH9A 3JYTA 3JAMU 4OO1E 3BM7A 5F0WA 2BA0D 2BA9A 2NXJA 4C3KA 3GYNA 4DV1F 1SKSA 2VQEI 4O3PA 3RW6A 3OR2B 1P9YA 4IFYB 4NLOA 3CWJA 3MPYA 3E2EA 1EZZB 2NN6B 4ZOSA 4X4TA 2WP8B 1ZS6A 2BQ3A 3DLGB 3JS9A 2G2ZA 1R8HA 4HR2A 4ZS6A 1YJ9S 3GIIA 4AIMA 3D66A 1YGYA 1T9WA 3H0PA 4B3RJ 4IFDD 3WU4A 3CDIA 4Q8EA 2F9JA 2AV5A 2RILA 3IBCB 1NK8A 3TJAA 2C2KB 1FRXA 1JKHB 1L3TA 2CZ4A 5DG9A 4IOBA 2DGOA 4P2MA 1LW0B 3C19A 2DCUB 1M90T 2CUYA 1S1XB 4LVNP 4X4VA 3JQKA 4PG7A 3Q22A 4LFBI 3OFGA 2XNQA 2RDJA 3CCTA 1ZXMA 1J5EJ 4DR5I 4DR7E 1GMVA 2D1CA 2A0FB 5D0HA 4OZ1A 2XLJA 1FKOA 2EEYA 1FJGI 4TYAA 2WONA 3TVZA 3R1HA 4K4XA 1U1LA 4WK1A 4XDDA 2AYGA 3D1QA 4J37A 1QAJA 3PVXA 2M70A 2GAGC 4LCHA 3UW1A 5EWEA 2Q79A 5LMNJ 1U47A 3DM2B 1TK8A 1R6YA 2QV6A 3DCAA 3CC2S 1JIHA 2UU9J 2FGCA 1D8ZA 3T1YI 4KHPJ 5FLXU 1Y4ZB 2DXDA 3AJ2A 3NG8A 4NE9C 2Z58B 4DL6A 4B3TF 2ZHBA 5J1EA 1BMQB 2KT3A 2PNLA 4X62I 3LNUA 2CXEA 1B4SA 4BDPA 4LF8E 4PUOB 3OSNA 3NGUA 4DV3F 2AGOA 3C16A 3PJ9A 1WC3A 1LWEB 2KI2A 1IJFB 2MKIA 2UVUA 4RW9A 2DEIA 4ZJQA 5DDQC 4IOCQ 2H9ZA 1J5OB 3VQSA 4E0DA 3QQCD 2BA1D 4U95A 1H38A 2HLTA 3HXMA 5A6WA 1VRTA 2E7XA 1PC5A 1D9AA 3H5SA 2P9CA 1REVA 1MSWD 5KFFA 1G7CB 4H4OA 5EN1A 4HYMA 3CE8A 1E6YB 1HHTP 2DNHA 4W90B 4DUYJ 1XNQE 2O5DA 2MZJA 3DXSX 2KYXA 4DR1J 3IC1A 1IWAA 4DQQA 4ZVUB 1HA1A 1IWGA 1U45A 2FZCB 1FWPA 1RKJA 4ZPBA 2I38A 5C0XA 3S7RA 3RBXA 2K1RA 2EKNA 1UMJA 3RW7A 2RQMA 5ADZA 4MMOA 2ZE2A 3DU6A 3FSYA 1R3NA 4KAIA 3TR5A 3M8WA 3FKBA 5KFGA 2ABYA 3TZZA 2VPZB 4WU2A 1RLDA 4NXMJ 2A3JA 2OPQA 2G0JA 1S6OA 2VG5B 4BA1B 3ZZZA 3M30B 3N0VA 2O01C 1FWKA 2QEXS 1HI0P 2LQ9A 3IGVA 1R8AA 4A8WA 4F4XA 4OX9J 1CVJA 5C0XD 3PW7A 1FKAF 3MR3A 2ALYB 4F3OA 1QTNB 2HQDA 4QNKA 2EXUA 1S16A 1VRQC 2YKMA 3B78A 2GHWA 2WB1D 3LGHA 3R3TA 2EBEA 3DHXA 2C3MA 2KFNA 1HNZI 2UVRA 1F9EB 4EMDA 2H5EA 2W2QP 2KHCA 5DRRA 4K4TA 1B0VA 3HT0A 3MEEB 2QA4S 3GLJA 1Q5YA 3K7RA 2DNYA 2OGUA 4OI4A 4B3MF 1S12A 4XK8C 2A1BA 2O1VA 2HQIA 2G2OA 4TQSA 2R2RA 2B51A 2AKWB 4M63A 4OX7A 1QE1B 1SC4B 3G6YA 2DIVA 4F2RA 2VC1A 4PWWA 4JI7E 1VQPS 4J9LA 4OLPA 1UVIA 4B9SA 3OVAA 2IVMA 1S6PB 3J81U 3IR6B 1KHVA 1KHWA 2O1UA 4FYYB 2VQEJ 1I94J 1LOUA 1V3SA 2LYVA 1FVSA 2IM2A 3JSMA 3T3FA 4YY3I 2UUAE 1KVKA 4B9NA 1TTHB 1SJRA 3RB4A 2X1BA 3BSNA 4IZJB 5EWFA 3KG0A 3U1MA 4RR5A 2NPIA 1NH7A 1S1UB 1WDTA 2QL5B 2IRUA 1Y7PA 4C8YA 4HLBA 4AE5A 3MCSA 2CG4A 2KYZA 4M5MA 1TUGB 3V6HA 2UUCF 3M6AA 4DV1I 2NCKL 2VIHA 4ZVOB 3MEGB 3UFCX 4IZKA 4BWJA 4YN3B 2X3GA 4H54A 5J1EB 3F0NA 3FCHA 2KTQA 4CM2A 4LFBJ 3G8QA 1S1TA 4JP8A 3CUNA 3AOAA 4DR5J 1M0SA 1HKAA 2APOA 4USJC 4PRVA 3EWGA 2JJ4D 5J2NA 2I6WA 1GXLA 2QT7A 3SQOP 1FJGJ 4JI4E 4C0OC 3LAKA 1D8YA 4FN5A 4K50A 5JUMA 3BR9A 3AXMA 2HKEA 1NZAA 3JTPA 3MR6A 2J9DA 4JI5E 3CCQS 4DUZF 3KLHB 1N33F 2VG6B 3RTVA 2WK4A 3KRNA 1Y5IB 4NWBA 3QNWB 2PO2A 2MQMA 2UUBF 3HX9A 5ETOA 2W01A 2HS4A 2VFSA 5DQGA 1NHHA 3TO8A 4X4SA 2IJFA 1CBKA 2GV1A 1KIJA 3ZXWA 5ELWA 4NASA 3P3EA 2ZHOA 4DI6A 4X64F 4S0MA 2XGQA 5KFVA 3KMQA 4X62J 2HHHJ 3UO0A 5I3PA 5KFNA 2YKNA 1FXDA 4ZVTB 2HBZB 3BH6B 4PR6A 1R0AA 4AL7A 1ZAWA 4WWSA 2DY9A 5CD4A 3SCIE 3K89A 4LQ9A 2EG1A 2F8MA 4JI1F 3C14A 3UDVA 1U8SA 3M8RA 2AD9A 4B3TI 5LOQA 3DRRA 3D2WA 4CTAB 3M9OB 2DITA 2P9GA 3EM1A 5DDPC 2IVFB 3HO1A 2YNFB 1PKUA 4J9NA 1IQTA 1RT2A 3BGOP 3L7ZB 2BJDA 2O1WA 4DV3I 4R1FA 3FSXA 5IV4A 4ZN3A 5LJ3Y 4C3MA 3HVRA 5A6PA 2Q6BA 1RKIA 2BXJA 4UF4A 5K36C 4CP5A 3VCDA 4NLYA 1VGYA 2DRDA 5HANA 2JH3A 1M5OC 2FJWA 3TARA 2MGZB 2V34A 4ELTA 2KO1A 2UXCE 1EQMA 3CJKB 3HVAA 4C8ZA 4A48A 3SCLE 1KWMA 5IC4B 5FDLA 2PIIA 3QAUA 4WCEQ 4DSJA 2BA0G 1LFPA 5L46A 4CO4A 2WVBA 1JB0C 3BQ1A 4O4GA 3KMSA 2SXLA 4YR3A 3MPDA 2D3ZA 4NA1A 4P7VA 3Q8SB 3MM5A 2PA3A 2VKRA 4HXZA 4P2SA 5KFAA 1A7GE 2M4MA 1Q8IA 1NSQA 4QYZJ 1G2EA 2OLWA 4R5PB 2ERRA 4QJVA 3CJSA 1Z1ZA 4OJ3A 1QSYA 4HL9A 1EETA 4OHWA 3BGUA 3HFKA 3WC2A 2K06A 2O3DA 2DVIA 2JC0A 1RT3A 3ENAA 4YHHF 2N7CA 2VPXB 4DV7F 4ZIVA 4DX6A 2PI4A 2AYEA 2XYHB 4LT6A 3H59A 2I0XA 3VALA 1X4FA 3L09A 2CPJA 4KPYA 3HVTA 2NLWA 2MSTA 2HQ3A 1YBUA 1QAIA 3FEZA 4DG1A 2Q2EB 1KNZA 3I9ZA 1XMOI 4CZCA 3KLIB 2FY1A 2Q66A 1S72S 4J90A 4DX7A 3RR7A 1VQ4S 1S9EA 4X4UA 2FHMA 2MZQA 1CJTA 2ZJQQ 4DU7A 3KJNB 3NL0A 3O44A 1VC5A 2OP5A 4KPCA 2AJ2A 3J7AN 2C39B 3R7BB 2DGXA 1N32I 1VQYA 2Y8YA 4WIQA 4ATNA 3IM9A 2AEFA 1T9VA 4A47A 1NH8A 1VK3A 3TQ1A 5J2NB 4XDCA 5BXIA 4U8YA 3RR8A 1BLUA 4YY3J 4EZ6A 3PW0A 3TI0A 4B3MI 1IKYB 3BKTA 4I7FA 4ED2A 1PGZA 4JBCA 1P1LA 1IBMF 4X66E 4ZK7M 3HKWA 1NK9A 3P49B 2HNZA 4B08A 4F25A 3BGRA 3Q2SC 3O1LA 2ZM6F 3NOCA 1SL0A 4XTJA 4LFAF 4J9KA 1I5OB 3MM6A 3DU5A 3DOKB 4JI0I 1NZ0A 1M1KT 4ZCIA 2JNJA 2BA1G 2ZITA 5EUHA 4JI2E 3V6JA 3QT5A 2M8DB 4MKBA 1HWLA 4DCOB 2M5YA 4JI7J 1N5VA 2YNIB 2DNZA 1ZPVA 3IRXB 5EDWA 1FEHA 4G1QB 1RADB 1RXOB 4OZ5A 1EA6A 2Z5CB 2QN6B 1Y0HA 1B62A 1HHQA 5BYSA 2KRRA 4LFCE 2CQ4A 1PILA 1YJRA 1C4CA 2ZBPA 3LGNA 1UVJA 3M9MB 1UDSA 2UXBI 4P2XA 3S6EA 4C6AA 3KXDA 1X9WA 1WHYA 1M5HA 4ZP8A 2UUCI 1NAQA 1M5KC 2H48B 2QGFB 5DM6Q 1SQFA 4ECSA 1YHQS 1UFKA 3NGRA 3DRXA 4MIWA 2FJBB 4ER8A 3P3GA 2QLXA 2BOAA 2QMWA 3ZC4A 1URRA 1WC4A 1J2VA 3VHQA 4LSNA 5C7PA 2MJNA 4B9UA 1Y3JA 4U7UD 2WSEC 2CADA 4X84A 1O51A 4X4OA 1EB0A 4WXOA 3HJCA 2P8IA 2IMOA 2KZMA 1JNRB 1ZAVA 2F7VA 4ENOA 4PU9A 1B70B 2JRSA 3DOLA 5H9EJ 4K2XA 1VBYA 1K44A 4O3NA 4ES3A 4DUZI 3KLGB 1N33I 3SCJE 1WHWA 3ZKDA 5B7WA 4KR0B 2UUBI 4GVBA 1DTTB 2FUG9 1GMWA 1EAYC 4OO1A 4OZ3A 3TUJC 2W7OA 2ZEJA 3QGPA 4YFUA 3ZTPA 2R7UA 5K36F 4LRCA 3P76A 4B3TJ 3W2WB 3M8QB 4DCPB 1WC6A 4X64I 3AQOA 5D77A 2GMHA 4JI3I 3OV7A 1WUUA 1BQXA 5LSLA 2CQ3A 4DPOA 2NSCA 4TY8A 3IXQA 4PG4A 4JV5E 4O3RA 1TKZB 1UJ5A 4KKOA 4LF9E 4DV3J 4CQ1A 2DHXA 1XIQA 3A3OB 3WU5A 3P06A 1R6LA 3VWSA 3LO3A 1S99A 3CO0P 3DRYA 4JI1I 3QWUA 3QRQA 4PQUA 1GMWD 1N34E 1C0UA 4OO1D 1XQIA 5EGYA 3M2RA 2W1BA 1FERA 1M5VC 3CCUS 3R9LA 4WP3A 2WNRA 1RWXB 1LV5A 1X5OA 5HMXA 3CB4A 4TU7A 3M2UA 2WOMB 4Y2MA 4ZHRA 2WRMA 3I56S 2B5JB 1FX2A 2RUGA 3AXKA 2OPSA 3M4XA 4DQRA 2X1FA 5KT3A 4DR3F 2LDIA 4USIA 1CJTB 1Z0BA 4O3QA 1GFWB 4PYAA 3QBCA 7FD1A 3JB9k 2OMLA 4WE1A 2RMLA 3QZ8A 3FJ2A 4EYHB 1TFWA 4OX8A 4JUZA 4R8UB 1DFDA 2V4JA 1IKWA 4ZJOA 1UFLA 1C0TB 1PJ7A 2Y1LB 1UWBB 4OZEA 1S76D 2UXCJ 1FNOA 5C25A 3EZUA 3L7OA 2E1MC 3MUTP 4URQU 2Y9HA 1KC8T 3IMQJ 4WIIA 5I42A 3BREA 3BGLA 3V2UC 4G1PA 2WSCC 1Q82T 5F8JA 4R0EA 3OTOE 2B6AB 2DRBA 3QT6A 2DY1A 4QR1A 1A6LA 1G6BA 1W25A 4QZVB 2QMXA 5DZ7A 3CULA 5J2QA 3MAHA 2DIUA 1ULRA 3T1YE 3H20A 4DV4E 3P5BP 1VBXA 4BA2A 3DGPA 4KO0A 5B0GA 2MZSA 4Q43A 3DN9A 2FVPA 1PAUB 3G6XA 2V69A 2OIHA 4AXIA 4DV7I 2Y1IA 1H72C 3D6FB 2O66A 3IG1A 4NLPA 2NZCA 2AU0A 3TA1A 1MN7A 3MMCA 1C1BA 3DHWC 4A8MP 3WZ0A 3TEGA 1HNWE 2JLFA 3HFZB 3C15A 3KWMA 3T6BA 4IQMA 1SH3A 2GVDB 3DLKB 1Z5BA 2OHDA 4R25A 1Y5NB 3C8YA 3ZTOA 3HSDA 3WC0A 3W2VA 2ZDOA 2QYCA 2YQ0A 1CJUA 4B3MJ 3KTQA 3OFFA 3J7YU 4EO8A 2NREA 3OL8A 2QFIA 3SFUA 2RAQA 4HH1A 2ATLA 5DGBA 5HJYA 1U0HB 2PDAA 1Y5LB 1IBCB 4MH8A 4FW4A 2DO4A 1LW2B 1DBDA 3SZ2A 1S1WA 2CPIA 4IS9A 4USHA 1AYEA 3NNHA 3WDOA 4LMZA 2EFPA 4OYXA 3Q86A 2FLLA 3UVJA 2L41A 3VAKA 3KDNA 3CDBA 5IS2A 1DAXA 5D4PA 2M52A 3PACA 4IG0A 1IBMI 4KHMA 1UZHA 1RREA 3PG9A 2CNNB 2XZTB 4M8LA 3CVKA 3D3BJ 2HHTA 3CNQP 3LPSA 4LFAI 4FF4A 2B4OA 1NNDA 3RRGA 2UUCJ 5IWAI 1NDLA 1Q79A 2PE8A 3DI6B 3AAWB 3CSKA 1DQ8A 4L3NA 1NSKL 4QR0A 2R7VA 2N3LA 2FC9A 2GO8A 2GO4A 4LF7F 3W62A 3W9JA 4JI6F 4QWCA 3PKYA 1FDDA 4NI2A 2FB0A 1NEEA 5A2QY 2BUNA 4OI1A 2V0NA 3QFWA 1S6UA 2G13A 4Q8FA 3TX8A 4C11B 4IRCA 1M1HA 2MMYA 3ICLA 4GO7X 3QIPB 1RTIA 4DSFA 5KFRA 4K4WA 2VBZA 1WF2A 4LUBA 2QX0A 2HQGA 1Q8LA 3FBCA 4DUZJ 1N33J 2KFZA 2HVEA 1S4FA 3W8GA 5F9LA 4DV6E 1X0FA 2QIFA 2UUBJ 3K5NA 3O5TB 3GB0A 1TVRA 2OPSB 3UDCA 2ROGA 1LWFA 5EX3A 3IM8A 2HHPA 4HI2A 2MKCA 2G0IA 1UVNA 3GJRB 3OSPA 1YSJA 4TXSA 3KJQB 4KJIA 4I3HA 4P9SA 2FZKB 2JE6B 3JAMC 2DTJA 3MCMA 3VAHA 1USVA 3H5XA 4X64J 4LJMA 1KTVA 4WXWA 4OYWA 2PMWA 1RCXB 1TAQA 5DQHA 2OPRA 3GV7B 2F8HA 5LL6R 3KLFB 4K0KF 3FCWA 4C2MA 1JLBA 3QFHA 3OUYB 1R31A 2W9AA 1A9NB 2YWKA 3PV8A 3GV5B 4JI1J 2X7IA 1YTYA 1HW8A 1O0PA 2KZZA 1PJ6A 1HBOB 1AB8A 3BSCA 3GWCA 5JXSA 9ATCB 3OR1B 2GJFA 1F60B 3POTA 1JLFB 3KLEA 5HMWA 1ZPWX 2WSFC 1U02A 2LCWA 4QNJA 5CCMA 3QRPA 2VONA 5DRQA 3PFOA 3E3XA 4RNMA 1UKUA 3A8EA 1JQGA 3LALA 4HY1A 4P75A 3CGIA 4ZPVR 3DGPB 4HACA 4LSLA 2KN4A 5FIIA 3GTYX 5KFXA 3HHLC 3TAPA 4H4MB 3VTIA 1FTRA 1FNXH 3HKZD 1PO6A 1RP5A 2DGUA 3DLLQ 3BKFA 1S79A 2R42A 5CYQB 1XEZA 5A8KB 3N5BA 2D69A 1SV5A 5GAEI 4HH0A 4DR3I 5DJBA 2FLPA 4WZMA 4QOTA 1U1KA 4NXNE 1AFIA 4MIBA 2XMJA 3TRGA 4ZVIA 3OXLA 3TAQA 3R5JB 5FLXC 1EJ7L 4USMA 3CW2C 1RBLA 2RNEA 3TYTA 4Q45A 5DDRC 4CRJA 4IRDA 4Q0BB 5HP1A 5GAHI 3MR5A 4ZP7A 4UZCA 1TMMA 4CO1A 4B17A 2GO3A 3ITHA 4YHHJ 2ZVSA 4WFXA 2DPJA 4LF2A 4PWDB 1HNXE 4DV7J 2YPZA 3QPIA 1Y6ZA 4UQGA 1TL1B 5HO4A 4DV2E 4HEA9 3ZNJ1 4HHJA 5KFSA 5ETPA 1UPPA 5DZ6A 5KG0A 3VF0B 3CCVS 3E01A 4DR2E 1S9GB 2JX2A 2Q3PA 2HW3A 2DHAA 2J8SA 3H1CA 2QL9B 3CCJS 3H4LA 1G1XA 1IR1A 5KG7A 3MXHP 3KUEA 1N5YA 1U1QA 3C6UA 2COLA 2BOPA 1PIEA 3FMBA 4I1TA 5KFHA 2CQGA 3G6ES 4NCAA 2R7WA 3K8VA 1KTQA 2PEHA 1AUSL 2ZH6A 4NI2B 1RHKB 2DO0A 2VODA 1U2CA 1LWXA 1FXLA 2OH2A 5MAOA 3VAGA 3KKFA 3ZZOA 2CQPA 2RKIA 2LEBA 2C2MB 3UCZP 1WKKA 3PFEA 5G0RA 2GVZB 1GX6A 3ETMA 2ZJPQ 4ELVA 1WWHA 1SJ3P 2CZVC 4A4JA 3J81Q 1FX4A 1IBMJ 4ECZA 5D0GA 1CQMA 1XTZA 2BJ1A 1LWCA 2ZM6J 2OELA 3OL6A 4LFAJ 1L3UA 5KFYA 5DO2A 5D3GB 4CT9A 3VAMA 3BF4A 1QLNA 5LM7E 5HQ8A 2LXFA 1NBEB 3M32B 4K4SA 4CLSA 4USKA 2E1RA 5K8NA 3ADAC 4EFAC 1RT4B 3KK3B 2BW7A 3MFHA 4CYUB 1WTBA 1RAHB 2V8PA 3AOCA 3W8PA 2DNOA 2CJYB 3DOMB 3BPDA 3UN5A 1P9QC 2B9YA 2ZJRQ 4D3GA 4GKKE 4DPTA 1IJEB 4CLTA 3UDEA 1TELA 2GJ2A 1T9UA 3AOBA 3UR3C 1FKPA 3UPFA 1WOSA 1XK8A 5HMYA 2E5JA 2RUSA 3BN7A 2RIJA 2BDPA 4LF7I 3P3CA 1C1CB 2CWKA 3K5OA 3MTKA 4LF6F 1XMOE 4JI6I 3GG1A 3S8SA 4WKRA 3E51A 4I69A 3GYGA 1OS5A 2P2CB 4FW6A 5DRPA 2RB7A 2C38A 3GJTB 4X4QA 2YWWA 4RW7B 4LF4E 1OYDA 2Z2MA 1RWKB 4F36A 2G2YA 2HEKA 3DLJA 3QGGA 3CJ8A 2W2OP 2HNYB 3RBEA 4C8KA 1RHMB 2A10A 4N47A 4PG8A 3J81C 3PZPA 1QSLA 4EUVA 2OI2A 5KT6A 2B56A 5L9XA 4IR9A 1N32E 4NCBA 3OHBA 3N4WA 1VBZA 2R7SA 3HSJA 2OUGA 1OWXA 1AZSA 3K57A 4N41A 4I0WA 4U67Q 2PSZA 3QIDA 3P4UB 5B0AA 5THWA 4DV5E 2VQFF 1RT6B 4WF9Q 1MWYA 4LR9A 4M95A 5BJRA 2YNGA 2AYMA 2QA2A 5F3ZA 4FNHA 4GKJF 2F65A 2FJDB 2GFFA 3PM9A 2N7YA 3SQGB 3PHTA 3F41A 4DPXA 4FP9A 3R7SB 2B4VA 4W98A 1IBLE 4E8UA 3WIUA 7FDRA 3QJJA 3R1LA 1S6QA 1GAOA 1X4DA 1IUJA 2F4VE 3C2PA 3ITHB 4DS5A 1N52B 1AW0A 5GADI 1BKNA 3QATA 2MKHA 1QJHA 3VGTA 1IQZA 1NRKA 2A2DA 3EZOA 2CRLA 3KK1A 3ILOA 3H25A 2EK6A 4MJKA 1KQGB 2V2QA 2UXBE 3IWNC 1WKJA 5AE3A 4DR6E 2HPUA 2GC8A 2YX7A 1VS3A 4KGVB 4DR3J 1Z59A 3HF5A 2ZBIA 2CNOB 2O1TA 1Z2ZA 2KG1A 3NNAA 3ELHA 1X5PA 4NOHA 3C6UB 3NCRA 4L73A 1XN9A 1RQ0A 2CPEA 4RW6A 1DRZA 2PO1B 5AXLA 3O2IA 1K1SA 2MDAA 3CDAA 1RISA 4R0JA 5LMUE 2EPIA 2X51A 3M2VA 4I64A 4E98A 2KT2A 1M1GA 5RUBA 3RB6A 3PRDA 2HBYB 2VFUA 4B3RF 4USVA 2E5LE 2MHEA 1EHWA 2DGTA 3M7VA 1NLKL 2RDIA 2JEBB 4JYAE 3LW5C 1IBKI 1DTQA 1D0EA 3KK2B 1NSPA 2VICA 3D6MB 5EWGA 3EUNA 3EGNA 1N4LA 1T0TV 1NZ8A 1Y4UA 1SUQA 2RVJA 3O6QA 3T1HE 1X4AA 3NGDA 5LL6d 2D3UA 2FQQB 2GGPA 4MFBA 3H98A 2EFVA 5AXMA 3MD1A 1WC5A 2XCAA 1Z0GA 4QWBA 2ZUAA 2MYFA 4ZP9A 1HYSA 2FTRA 2VASA 2Q6CA 1OYRA 3CIMA 4JI3E 1Q8KA 1EKSA 3OTCA 1REGX 2LDYA 4OO1C 4CLYA 3FNNA 3JSBA 4Y2CA 1JLGA 3JSRA 3KJVA 3UNGC 3TAMA 5JMNA 3DKDA 3OQ2A 4ID5A 2AX1A 3QT7A 1RWMB 4DV2J 2KM8C 5I3UB 4FW3A 1VJWA 3CD0A 2IM0A 5CYMB 1HNVA 4B3OA 1FKPB 4DL2A 2WCXA 4M5LA 3FBEA 1NSAA 2I1RA 5T41A 4LF5E 2HWTA 1VR6A 2XZDB 4C8MA 1G3OA 1JXLA 1DQ9A 4WYLA 4NX9A 2DJWA 3KNGA 1BQMB 4DFPA 3CCLS 2VDIA 3RAXA 2X3DA 2C42A 5ETSA 1N56A 4FKYA 3ZZYA 4DSIA 1RTJB 4CLPA 1JLAB 4DXLA 4O44B 1VQ9S 5E3CA 2DNKA 2EC2A 2YTCA 2V8DA 1R0CB 1C4AA 2JSXA 1TKXA 4DR4E 5E5NA 1NB7A 4IRKA 2XLKA 4J5OA 4DBQA 4XPEA 5ETTA 4OYBA 2YXLA 2J76E 4WKYA 4RU2A 4DR1F 3BS9A 4FPIA 2YVSA 5B0FA 2BM0A 3N5FA 3KOAA 3HMJG 1Y3KA 1HQ2A 4LF7J 5ETQA 2MSSA 2LLZA 2IYGA 3TOQA 4JI6J 1YRUA 4OFZA 3CJ5A 2ASJA 2HHWA 1RT5B 3M9NB 3I4PA 1DARA 3BYPA 5F9NA 3Q8PB 1Q1KA 1VQ7S 5A2QU 4FNIA 2DNRA 2HMIB 1SH0A 3MUMP 1D9DA 3RGIA 1HQEB 2JZ5A 2VG7B 2HYIB 4ZCLA 1RA7A 2H5JB 4FS2A 4IG3A 2UUTA 2NN6F 2ROPA 1RT1A 2IC3A 2VFRA 1CSJA 1NK7A 2ZH1A 4F2SA 2IM1A 2ZOMA 4LF6I 1FA0A 5L1KA 2CQHA 1KLMB 2ZZNA 1CLFA 2KHDA 3LOUA 3CXCR 4DV0F 4RX6A 4B3SF 1OPZA 4C0BA 5D0EA 2R3VA 3T5JA 1JLCA 4J9VA 2P6TA 2UXDF 4QIGA 5A8WB 1HMVB 3LQVA 4LF4J 3G9CA 2Z5BB 2MZ1A 2GIFA 4K0KJ 3LANA 4NA2A 3CDWA 1HIYA 4OI3A 5CYJA 2BABA 3NKYA 2PMHA 2C2NA 4MT1A 2L48A 3OJSA 5KFQA 4J9RA 4LBIA 3GMGA 4CLZA 2VQFI 4RUBA 3UNYA 1YH8A 5DS7A 3PEHA 4GKJI 4OYIA 3W5XA 3CCZA 3R5DA 1S1VA 1F0XA 3KHGA 1CQNA 2QC3A 3N6MA 3PDNA 2ZZTA 2IFXA 5IWAE 2AJFE 2CQDA 2KVQE 1UDOA 3HJFA 3ENWA 3QJPA 1HBUA 3UI3A 3TP2A 4FBUA 1CULB 1NK5A 3PS3A 4IFVB 4E2FB 4PXEA 5E3QA 4ETXA 1RWWB 3MUVP 1RTDA 3GPAA 1OMSA 1MU2A 5K36A 1RB0A 1T05A 3C6TA 3G2XA 2R9LA 1W2IA 3NBPA 4K59A 4I56A 3UE2A 5CQGA 4LR8A 2UVWA 4LF1A 4DF8A 2HFZA 4RW4B 1UEKA 2K2PA 5A8RA 3MPUB 1U8WA 2ZNZA 3CTRA 2V9KA 2MQOA 3MMBA 1UEUA 4C7QA 1M5SA 2FJXA 4DZDA 2XYGB 2W2PP 3LP2B 4EU0A 4DR6J 1PG5B 3WIVA 2RHSB 4OO1F 4HHHA 4HDHA 4I2PA 2QRRA 4B3RI 2G4BA 5K36D 1VRUB 3DLEB 3D0IE 3UCGA 3AA9A 2M8HA 4L3KA 3Q8QB 2FC8A 3AB2B 5F8LA 1RT7B 1RTHB 2FIUA 5LMUJ 5K9FA 2NZ4A 1ZETA 2FVCA 2KG0A 1KP6A 2OD6A 4A8SA 2E5LJ 2DCLA 4EI2A 1N36E 2PI5A 2ATCB 1QDUB 2AIRB 4NCGA 1UJ6A 3KHRA 3VGVA 4FKXA 1IM6A 1TKTB 1YLXA 3ISZA 2N4DA 1ZBTA 2HS0A 3PCOB 4MK9A 4O3OA 2IJRA 3CCRS 1T03B 2PNZB 3H7HB 1YBAA 1N6QA 2R7OA 4ZCMA 4ED7A 3EZ5A 4NBQA 1URNA 4FW5A 5DG7A 2DKOB 3T9NA 4DR7F 4I6WA 2BANB 2V4RA 3TUIC 4CLLA 4A8XA 3GCWP 5LMNI 2IA0A 2F63A 4O3SA 1NU4A 2MTLA 1U4BA 5C24B 1H7UA 1SL2A 2Z2YB 1UZDA 1X7VA 2ZKTA 5H1SV 2V67A 4YQWA 1UTAA 1ZM9A 4KQVA 1RT1B 1TFYA 1FRHA 1NM2A 1VQMS 5GAGU 2MQ8A 1FDNA 2MLXA 1QY7A 1M5PC 1WG1A 3A4TA 4V19J 3G82A 1ICEB 1NKEA 1KD1T 1ITPA 5ETMA 3BB5A 2VL1A 5L38A 4LF8F 2E44A 1Z0CA 2KJVA 2G0CA 2IA6A 3PHEA 1MWZA 2XLIA 1FDAA 5JEAE 1F6TA 3M8SA 4BBYA 1BC6A 2DGSA 4JG4A 1YJTA 2MQQA 4RW8A 2NN6E 3HSZA 5J1PA 5I3QA 2XMKA 4ECWA 5DRKA 2D3O1 4DUYI 5M2PA 2X36A 3U02A 2B43A 4BS2A 4UTGA 4DR1I 3Q6MA 1FD8A 2IBOA 1KOHA 2FLOA 4ZPTR 5KG1A 1E6VA 4DR4J 1NJIT 3HI9A 1DLOA 1HLWA 4ZLJA 4LF6J 5F8NA 5J2MA 1XNQF 1TL3A 1NB2A 5KFLA 2RJZA 3MMAB 3EJMA 2ZBKB 1UVKA 3EXCX 3MM9B 2LEPA 1PJ5A 2HGNA 1FRKA 1PVGA 3OLBA 1EKRA 3GZ7A 4X4PA 2PO0B 3ZKBA 1SH2A 2EK1A 4OHZA 2BV3A 3MURP 3IS9A 5KFOA 4NXMI 2GCFA 5F0UA 3PIPQ 4AT1B 3SSQA 3NAHA 4Y2IA 2FVRA 1YJUA 3Q1QA 3I0SB 2G1DA 3BBCA 4GC6A 1B0PA 3PYFA 3V6DB 1X9MA 4XIUA 3DGVA 1YQHA 4OX9I 5T7LA 1TL7A 2B8PA 2NYIA 4RZRA 4WUCA 3Q89A 4DV0I 4B3SI 2AHOB 2M3DA 2Z5EA 1S0OA 2UVVA 5KFWA 2W9CA 1CEZA 5IT9Y 2UXDI 1YX2A 2ZBRA 4FZVA 4CH1A 2CWXA 2W4DA 4H4KA 3QRRA 2ZD1B 2LXIA 2NXUA 3NWRA 3PY8A 5HL7Q 3RYLA 3J81j 4OJ1A 3UN3A 3NCPA 1ZZFA 4ZLLA 3VVUA 5KAKA 3W5ZA 2IJNA 3DRSB 1D3WA 2CPZA 1XNRE 2E66A 2GQ2A 3MAAA 4HTIA 4ZVHA 1MROA 1WSVA 1CJKB 3LPYA 2YY3A 3SIPB 2ZBCA 4F4WA 1Q95G 2CDRB 1VC6A 3P3DA 2J0SD 1XHKA 2EFOA 3V81A 5JEAB 2W9BB 2HVIA 3M1VA 5KG2A 1EP4B 3L95X 2V8HA 1RHUB 1RI7A 1I94I 1F9HA 2PMZD 3I0RA 2K7KA 5CD4H 3IN5A 4JI7F 1ZZNA 1ZM4A 3IR7B 2BE7D 2OPPB 3CT9A 2DRAA 2BYCA 5HLFB 2H1YA 2HRYA 1NXIA 3R5AA 2UUAF 4BLGA 2OJ3A 1J27A 2BE2B 3IAS9 3BGFA 2IMWP 2GX8A 2JEGA 3FBBA 3CCWA 3ISND 1HBNB 2BRKA 3CCMS 3M8PB 5D4NA 1JWWA 5JVHQ 4UOGA 1NHUA 4RWXA 4DWIA 4HHUA 4DHVA 1BXNA 2EVZA 2QE5A 2XS2A 3RBZA 4J9PA 4LIRA 1EX8A 4X65E 5L1LA 2DBBA 1MX0A 2GAHC 4K4ZA 3T9ZA 3ILJA 4CLFA 3GG0A 4TN2A 4IFDE 2A6MA 3L4BC 4F0KA 4EBEA 2DH7A 1NUEA 3LP1A 3ULHA 4GVLA 3BO3A 3MECA 3W66A 3HPOA 3SCKE 1RAJA 4WFNQ 2ZKUA 1WJ9A 2HHXA 3QO9B 4ECVA 3MCOA 4LPFA 2HIYA 4JI4F 1O8BA 1MLAA 2IYIA 3OVBA 4I6YA 1NK0A 5A0YA 3MDFA 4MKYA 3BO2A 3B4DA 3BZQA 1S7IA 5F8IA 4P7AA 4JI5F 4J9OA 4ZVSB 2V2KA 1SL1A 3HHDA 2HFOA 2Y1JA 3GR0A 5IZHA 4F02A 1R27B 1E6VB 2HHHI 2QJ3A 2C3UA 2C2RA 4DL3A 2XSJA 3MF5A 4ZVPB 4DN0A 1UCNA 2MKYA 4J91A 3NZKA 3AFGA 2ZZMA 5H9FK 4AM3A 1ZAXA 1X4CA 2WAQD 4KGZB 3FGVA 2X1AA 1UW4A 4ZPWR 4U6PA 2CQCA 3TEHB 4FF3A 1Q16B 2U2FA 1FJCA 1SQGA 3IR5B 3NGSA 5KFZA 3FMWA 4MKAA 1VQ8S 4G65A 4AD6A 1KSPA 1H7WA 1IBKE 3ZTQA 4F26A 4ZJLA 3R5BA 3ILIA 4LF8I 1IR2A 2VV5A 1HR0F 2ILZA 1BQNA 3ZZRA 5CAAA 1XMQE 5IM0A 3OJUA 3PRYA 4NLGA 1A6FA 1YI2S 4B9TA 2V5HG 1UAWA 2C3OA 2XI3A 2JVOA 3DRPA 1K1QA 4NYPA 2B4PA 3DNCA 2UXCF 4ITSA 1JLQA 4J9MA 2C3YA 4I2QA 2XC9A 2AW0A 2HNDA 2BR2A 2W7PA 2RT3A 2R8JA 1H2TZ 4F50A 1X0PA 2CJKA 4IFDB 3MM8A 3ZFVA 1IKVA 4QIWD 2AJQA 2HHVA 4G6VB 3MFIA 4FYXB 1XNQI 4IDKB 4P73A 2DNPA 1CJVA 1YG0A 1H7XA 5B0DA 2I2YA 1Q7YT 1HHSA 3FVYA 1RSCA 3JYTB 2QO3A 4DV0J 4B3SJ 2ZWOA 4F0HA 4JI8E 3JQMA 3EPIA 2LP4A 1F9FA 2UXDJ 3V4IA 1WOPA 2E7WA 4OI0A 3CCSS 2FZGB 3SV4A 1NJZA 2FYXA 1LKZA 3EGWB 4Y28C 5E7OB 5C42A 5M2UA 2AGPA 5HN0A 1VK8A 2OEMA 5C0XE 4EBDA 4K4VA 1N5TA 3OLAA 4RUHA 4Y6IA 2ZDPA 4OHXA 1VYAA 1N48A 2CQ1A 1UETA 5D4OA 3N28A 2XO6A 1ZYQA 1USUA 1Q8BA 4A8KA 1FFWB 1UEVA 2QMUB 4G3IA 3NGTA 3TVKA 2LXUA 4UW2A 5K8OA 3D4JA 1WD6A 3M8ZA 1FKOB 4IO9Q 1SKRA 2WONB 5IOLA 5LSOA 2O3ZA 3O8WA 3MECB 2ZHAA 5KFBA 1U48A 4DX8H 4ICLA 4NEYA 2NS1B 3HHLA 1D1UA 2W24A 3ETOA 1BGXT 1LXNA 2F4FA 3TUZC 2BM1A 1H0HB 3VR1A 4NLUA 2BX6A 2BEFA 5KFKA 4IH5A 1TV6A 3ZM7A 2GQCA 5BR8E 4HT5A 1AT1B 4X66F 3LP0A 4RUAA 4KGMA 4CI0B 1K0VA 3PO4A 1F2GA 1SJQA 5C2GA 2DGQA 4WJBA 3D1HA 1F5BA 4JI7I 3J7AG 1DJ0A 1SJ1A 2J7UA 4B9VA 4JI2F 2UUAI 3CJ3A 1BY9A 1JNZB 3C16B 3HHLD 3EXYA 5HROA 3W3SA 4XTTA 2O67A 3IP0A 4DJBA 2KDOA 2DGVA 5KFMA 4ETZA 2D9PA 2VDHA 4MYTA 4RW9B 1HARA 4LFCF 3KG4A 1FRMA 4WTOB 2F1DA 2DEJA 1A0OB 1JXVA 1W26A 5K20B 1KFDA 3I9V9 4A8QA 2IIHA 5HATA 2IM3A 1RWPB 1VRTB 2DHHA 3ET6A 4PXCA 1KFSA 1REVB 4N8OA 2YX4A 5HBMA 5LJ5Y 2JEAA 1N0UA 4H4OB 3PXGa 2YQ3A 2YX1A 2WW8A 1FK9A 3F73A 3FDSA 2V2ZA 5KT5A 5ETVA 3CD7A 3DMJA 2VUGA 4DR7J 1BQNB 2XHCA 4U9RA 4M1KA 3SSRA 3NP5A 3RRKA 1UFWA 2L3MA 1Y00A 5C0XB 4K5SA 5GMEA 3UHMA 1HNIA 2K1RB 5K14A 3MOZA 3CC4S 4JI5I 4EWTA 3DYAA 2ZE2B 1NHJA 4AQYE 4N5SA 1VFJA 1IKXA 4U7UK 1SPBP 2J6SA 2YKOA 3PS2A 2OPQB 3TJ9A 2ZH3A 3Q24A 1UVLA 5DGAA 2AZ1A 4TKTA 1HR0E 5DNXA 1RLCL 1XERA 3OBIA 1WHXA 3JXOA 2J9DE 4N7TA 1HQUA 2KJWA 4ZVRB 4LF8J 1ZM3A 1RAEB 4X4NA 4P72A 4JV5F 1R6VA 3TUPA 1NJWA 4LF9F 2YKMB 4ZKAA 3N79A 4KGKA 3FFIA 2HRTA 4PXBA 2VBYA 4CNZA 4HVZA 3J7YI 2ZNYA 1N34F 1WTFA 5I4MA 3MEDA 1E3PA 2V63A 5B0EA 2DK2A 4HKQA 2DNGA 3TZWA 5DDOC 2IRYA 3S1TA 1HPZA 4QWDA 2W7AA 2JC1A 3TVYA 5HMZA 3IWXA 1VQLS 1ZA1B 2IAJA 5D6GA 3TX0A 1J5EE 2FJEB 3DFEA 2Y1RI 1OYPA 4LRAA 3Q83A 3NGKA 3W9HA 4C8LA 1LK7A 2VBWA 3AD7C 1XNQJ 2YPYA 3HVWA 4ZITA 5DNLA 5DROA 2XWXA 2HK3A 3SDEA 2QYGA 2UXCI 4K8RA 4KFBA 2CKWA 1T9XA 1XMQJ 2XMAA 2NXEA 1H2UX 2C22A 1KQFB 2ZH7A 1FT8A 4F0MA 3JSMB 2NYHA 5IQQA 1MWQA 3PYEA 4GQUA 4OJHA 4TQRA 5LMNE 2GHPA 2ZVIA 3IBWA 2UU9E 3D0HE 4ECTA 2BQRA 1Q4RA 2HRUA 4KHPE 3D0GE 2Z8QA 3B8HA 1S0VA 4TLRA 2NXCA 3QLHA 3OTOF 4AIDA 2OMOA 1UDQA 1PKPA 4IZKB 1SXLA 3TW0A 2W25A 2LJPA 3T1YF 1RUSA 2VJVA 4DV4F 5MLCV 2DHSA 4U96A 3OR2A 1S4EA 4IFYA 4CO2A 1S1TB 4RNNA 4ELUA 5IT9U 1LQ9A 2NN6A 4PRFA 5E0OA 5HK4A 3DLGA 2AF6A 1P1TA 2DR5A 3VAIA 1BWEA 3M7ND 3TANA 4GC7A 3CJQA 4ED6A 5IV3A 1QVGR 2IOQA 2QSFA 3PR5B 1HNWF 2P9EA 4O23A 3L9ZA 1BUXA 1OY9A 1PBUA 1JKHA 1FRJA 3HHEA 3G71S 2IDEA 1LW0A 2GMLA 2HQCA 2C1EB 2MKSA 2AJ4A 2FLNA 4UOHA 2H54B 2AX0A 2IY5B 2PO2B 3T5KA 4YOEA 3LA0A 3CJ4A 3W65A 1QM9A 1U2FA 4DUYE 5CA5A 1VJQA 2ACYA 2NN6D 3ZZTA 2CJBA 1H2VZ 5IT0A 4B9MA 4NLVA 1OPIA 3BPSP 1UA0A 2LA4A 2YWHA 4FPRA 2AWZA 4O0IA 2PN6A 1WELA 3KNAA 1HI8A 2YKNB 3GCMA 1MNEA 1U26A 5K5MA 2WB4A 3KJFB 4I68A 1R0AB 2UUAJ 4FW7A 5AE2A 2V68A 1SQEA 1YWXA 1H7SA 3DM2A 2BRLA 1MMLA 1U2RA 4X66I 3C14B 1V9OA 4DUTA 3OTDA 2B7BB 4AUKA 2J65A 3DRRB 3BO4A 3ZNUA 5A76A 3L7PA 3EMTA 4QYZK 4FXWA 1MMNA 1U24A 3Q6NA 4JI2I 4OX9E 4LVOP 1RT2B 1WDDA 4K4UA 1S5ZA 4PUOA 1KRPA 2CPHA 2VA2A 2NR0A 1LWEA 2R8IA 4TLQA 3R6LB 2RU3A 4JI4J 2N3OA 5FDLB 4OMFG 1J5OA 4FXDA 3A12A 3DLBA 1L3SA 5HQMA 5E3RA 2JFKA 1YZ6A 1TKDA 4QYRA 5AT1B 4O4GB 3M05A 4WP8A 3T1AA 2C37A 2F40A 3PX6A 2HLUA 4JI5J 3QMQA 1QAYA 3FC9A 3A8KA 1VISA 3UD4P 3MM5B 4EGLA 1RDRA 2E1PA 4DV6F 4H4KC 1WG4A 3K5MA 2KXHA 1FE4A 1E6YA 4Q44A 5AJ3F 4IUFA 2XMMA 2B8QA 4IQXA 4FYWB 4FF1A 3M85D 3D6TB 4ED1A 2XMWA 4PG5A 2R7QA 1EETB 1PC4A 2VQEE 4QR2A 1RA6A 4KFBB 3IWLA 1RU1A 1RT3B 2HZVA 2KXNB 2PEBA 4ECQA 1WOOA 1P42A 2XY6A 3ISNC 2OKQA 3HVTB 5BYQA 1C2PA 1WHVA 2HVHA 2D74B 3U7JA 5EX0A 2MB0B 4DG1B 1WI6A 1S49A 3FSIA 3GFZA 2UP1A 4KIAA 2OAUA 5JVGQ 4A8YA 2VG5A 4BA1A 2KKHA 3M30A 1S9EB 2C2EA 3J7AM 2GHVC 3CJ0A 1TU0B 5IXUA 3G96A 3RU0A 4LFBE 1HR0J 4LF9I 4NEZA 2DXFA 1R6MA 2CPFA 4DR5E 2MLYA 4AL6A 5J1NA 5AE1A 2BW2A 1GX5A 2ZOFA 2H5IB 3I96A 2ZC4A 1N34I 1FJGE 3PYDA 3VZHA 1Z5AA 1TQLA 2VD3A 2DB1A 4RNOA 2ASYA 1ZXNA 1Q86T 2B3TB 4J3DA 1XBWA 5DETA 3MEEA 3T19A 2QA4G 2B4UA 2IHR1 3CC7S 4I7FB 3IO1A 2K8GA 2PFDA 4UT4A 3K85A 4DQIA 4NXNF 4NZ0A 5LXYA 2HNZB 3BGRB 4RWWA 2B9XA 1T9YA 1S0MA 1RAIB 3OL7A 2RU9A 1QE1A 5DLGA 4FWGA 1GT8A 2FJVA 3MM6B 1R8PA 4YHHI 4OL8A 2BZ2A 3GYXB 4X62E 2HHHE 1S6PA 3D5MA 1NPKA 3MCNA 2BMBA 3PKMA 4C0HA 4P71A 2ZH2A 2YH1A 1TK0A 4J9SA 4KH0B 5H9EK 2R4FA 3R5GA 3U1LA 4NL5A 5DG8A 4TYBA 4FYDA 4IZJA 1HNXF 3KUHA 4UOFA 4ED4A 1S1UA 2KL8A 4RLEA 4ILLA 4DV2F 3EYZA 3NY0A 3OTOI 4FWHA 4TU9A 4DR2F 5HQLA 5DLFA 4RKUC 4ANDA 3WQPA 1B3TA 4DV4I 3P45B 2MZRA 3MEGA 1OY6A 2CA9A 2LQ5A 1RTZA 4LSNB 1KBRA 3X1LB 4ED8A 3BQ0A 4PWUA 1UP1A 3HDSA 1K0TA 4X2BA 1RHQB 2FHKA 3J80Q 4RU9A 5D0RA 4XO0A 1NCLA 1X31C 2C2ZB 2EI5A 4WK3A 3FQLA 2AYBA 4IZJD 1U49A 2E9RX 1TP7A 1HNWI 1T95A 4WUDA 1E3HA 3H90A 4CH7A 3DOLB 3FK4A 4KY3A 3JAMQ 1P8GA 2R7TA 3GQCA 1KONA 2O1PA 4LRDA 1JJ4A 3FQKA 1RHYA 2K7JA 1Y11A 4ZPDA 4GVBB 2ZM6I 4WP9A 4OO1B 3KLHA 2C37B 3RBDA 2VG6A 3H2VE 1U1OA 2JT2A 1KOOA 2HHSA 3MOJB 4X66J 2FVQA 4MK7A 8ATCB 3NLCA 4P74A 3RG6A 2M0GB 2KM8B 4FDFA 5FWKA 1YZ7A 4DL4A 5EL9A 4KH1B 3UCUP 3CDJA 4DSEA 4A8OA 4TY8B 4JI2J 2CQ2A 4PABA 4TNOA 4KKOB 2DXEA 4HDGA 2MXYA 3WU6A 2X1GA 2XY5A 1YIJS 3BV8A 4PAAA 2AJ1A 2CYYA 2BE9B 5AXKA 5EKWA 4PQUB 2YWGA 3KHLA 3CIZA 1C0UB 4LFCJ 3M2RB 3HP6A 1HNZE 3K5PA 4K2JA 2WNRB 4GKKF 4YMEA 1U1RA 3M2UB 2B7CB 4URSA 4ZHRB 4CTAA 2AEMA 3Q23A 1FTCA 4P10A 3J80C 4U3DA 1FEEA 2OTLS 4PRXA 2C2OB 2YNFA 2RQKA 1F5AA 5E3AA 3A1YG 4DPYA 3PX4A 2LU1A 1QUPA 3L7ZA 1Z0TA 4F4ZA 3G8TA 1XMOF 2J8AA 4MU1A 1K9MT 4Y00A 4WE1B 3MI7X 5FLXQ 5LXRA 3SEOA 4LF4F 3FZBA 2V4JB 1IKWB 2MGZA 2HFSA 3IAM9 3CJKA 4L74A 2YWEA 2DR6A 4C48A 3BR8A 3T41A 2DNLA 4YY3E 5C25B 3I5CA 4ZA1A 1N32F 4LBPA 2E1AA 2MY7A 1APSA 2M7SA 3G4SS 4DV6I 1PAEX 4CDIA 3EICA 4OYZA 5I42B 4Z37A 5LSRA 2HURA 2K3IA 4K4YA 3UD3P 1T9TA 2Z30B 3EVWA 3EDQB 4DV5F 3M7NG 2W8LA 5J2QB 1L3VA 1OJ4A 4R5PA 3R6GB 5L3JA 4DV1E 3QAEA 4BA2B 2VJUA 3PJWA 4HTJA 3EPGA 4C8NA 2DHGA 4KO0B 1OIAA 1Y10A 2I9SA 1Q7LB 1K8AT 1IN0A 3CJTA 1IBLF 4JV5J 3US5A 3NMRA 3IG1B 4LF9J 3MEKA 4JI0F 4UUXA 2Y3YA 2MJUA 3G87A 2QFJA 3MMCB 2P6SA 1UL3A 3K2YA 1C1BB 2F4VF 5DQIA 2VF3A 1N34J 4M5KA 2C2DA 3C15B 3W5YA 4DF4A 2VU5A 1MMDA 4QIEA 6FD1A 4F04B 1Z2LA 3W2VB 4OYPA 3KLIA 2BKOA 1S10A 4BWMA 2UXBF 1CJUB 3PEJA 4A8FA 4ECYA 4DR6F 2R2SA 1SC1B 5D8HB 2CJAA 4L75A 3LAMA 3DDIA 5DM7Q 1K47A 1YJ7A 1TMJA 3EGVA 2NUUG 4BC7A 4QW8A 4NYOA 4UZBA 1S1WB 3R2DJ 5KFEA 3IRWP 4NZ6A 2C39A 2Q1LA 3GSIA 4W4MA 3GR1A 3FCVA 4QPXA 5LMUF 1EARA 1Q78A 2RE1A 4ED0A 3UVJB 2ADBA 5KFDA 2E5LF 1CC8A 3QT8A 1NK4A 4IG0B 1Q81T 2VA3A 5F41A 4MK8A 3FUYA 3SBMA 2OTJS 3J7A1 3CMES 4JYAF 4NXNI 1T02A 1IKYA 2L9DA 4PPZA 5ETLA 4J9UE 2R8GA 4B3TE 3HCXA 1WEYA 4QCLA 4QU6A 3OTOJ 5KG3A 3T1HF 2YKAA 4RBUA 3AD9C 3T1YJ 1SJFA 3DOKA 4DV4J 3EE3A 3QSYB 2BJEA 4HI1A 4Q5VA 5KOWA 5M2RA 2XMVA 2IVYA 4DV3E 1YDLA 2OEJA 2JDJA 2YNIA 3IRXA 1HNXI 4G1QA 2B0GA 3B54A 3JTOA 3ZZ0A 4JI3F 2Z5CA 5IC6B 4BCAA 5KG5A 3PR4A 1S77D 4DV2I 1NKBA 1PBAA 1NPPA 3ZZPA 3HKMA 3GILA 3GFXA 4DR2I 1RE1B 2XY7A 1HNWJ 4EK2A 2JEJA 3GIRA 2CNKB 1RTIB 4XPCA 3M85G 4OJGA 2UZAA 5CCLA 4ALZA 3NCQA 1QUVA 2BBEA 2LECA 2MZTA 3OD2A 1HBMA 2YBVA 1YJNS 3CJ2A 4N8NA 4NLTA 1TVRB 1RACB 2ZFHA 1LWFB 3QGIA 2Y8WA 4YS2A 4DDFA 4LF5F 1CG2A 2G9OA 2QLJB 3I5AA 4UOCA 3J7ZT 1IVZA 4DLEA 2DT9A 3TZXA 1NHKL 2DPIA 3RAMA 4CO5A 3K0JA 2OPRB 4YP3A 4Y3CA 1X4HA 4NMLA 1ZM2A 2QLFB 1JLBB 3OFHA 1O6XA 2OO4A 4OZNA 3KLGA 3P8BB 4CO3A 2DD8S 1X5TA 2VHGA 1DTTA 3RJMB 5D15A 3G6VA 1FI4A 2E5GA 5KFTA 4WZQA 3OXFA 4DR4F 2V6AA 2L9NA 1AA1B 2AQ4A 4U3BA 3AH6A 3POTB 1HWKA 2R2TA 3OPKA 3W2WA 2RHQB 2PFFB 3M8QA 3KLEB 1RABB 2NSBA 1U09A 4XAKA 3H4BA 2HQFA 4CT8A 1FKAE 2XB2D 3CDEA 1TKZA 4HACB 2HBQB 2H51B 4LSLB 1FF2A 1X5SA 1XJWB 2V94A 4QBUA 1HFEL 4GKKI 1FRLA 2RF2A 1Z0WA 3A3PB 4C3LA 1ZA2B 4KGXB 3VZIA 1JJ2R 1RHJB 1VQSA 1TK5A 2J7WA 1SV5B 2WOMA 3FRYA 1HNZJ 1D6TA 4RPFA 5JEAC 4NLWA 4UUWA 2B5JA 4B3ME 1T11A 4DV6J 4CWBA 4GO5X 2RS8A 2NN6C 4K5RA 2E9TA 4KQZA 1WI8A 5BYRA 5AJ3J 2VZ9A 1OYEA 4OX6A 4P6QA 3BQ2A 2HGMA 4LF4I 1WNEA 3HK2A 1BHNA 4K0KI 3NS5A 1TL4A 5HP1B 4KSEB 4LR7A 2Y0SD 4JI0E 2CIMA 2V50A 3CO9A 4WFAQ 4R8UA 2L08A 3M6WA 3QGHA 1C0TA 1UWBA 2ADCA 3HM9A 1RK8A 1RYRA 2E5HA 4F4AA 2FY8A 4NLSA 4B9LA 3PW2A 3E01B 1RWOB 3I31A 2NXNA 4DV5I 5C5JA 2LA6A 4OZJA 1XR6A 2B6AA 2UUCE 1TL5A 1S0NA 5E2QA 1NDCA 1RZMA 3GCXP 1N5YB 3SFGA 4KT0C 2R2UA 1HWIA 9RUBA 2KT5A 3HLUA 1UWAA 1IBLI 4URLA 4YR2A 2MKKA 3CWVA 4MU0A 1SVDA 1SIZA 1WF0A 4DV1J 5IWAF 1QZRA 2BJ7A 1XXEA 2JEIA 5D78A 2F4VI 3BBFA 1X9SA 3GJSB 3I87A 3AJ1A 8RUCA 3LWMA 2LMIA 2YNHA 5GAGI 1KVIA 2RKIB 3GSDA 1H74A 1VLYA 2GVDA 1YRTA 3AT1B 3DLKA 5G0RB 4DUZE 3GFHA 2BKPA 1N33E 4DR6I 4WFZA 2ZBQA 2M2BA 2IRXA 1RGVA 2UUBE 2VPWB 1N54B 1HBMB 4NXNJ 3HSGA 2AP6A 1LWCB 1OQ6A 4HYKA 4WU3A 5ETNA 3W9IA 4DSLA 1U0HA 5LMUI 3BDPA 3CD6S 4NLDA 1JJCB 5IT4A 3FRZA 4DPUA 4DSKA 1LW2A 4KHRA 4X64E 5ETKA 3ENVA 2MHNA 4PPDA 4CH0S 1I1GA 2E5LI 1BE4A 4U8VA 2L9WA 4Q7AA 1YKWA 2KH9A 2CJXB 5GMDA 4JYAI 3C46A 1R7IA 1HNXJ 3JTNA 3NNCA 1H98A 3I82A 1S59A 4JI1E 3FBFA 1N36F 1FO1A 1VDHA 2RRBA 4ECRA 5IT9Q 5CH7B 1GXUA 4DR2J 3T1HI 2EBGA 3MTJA 2F8EX 4ISAA 2BJ3A 5CXTA 5HVGA 2WZ1A 3TZYA 4V1Ak 4NLRA 4YB1P 2CG8A 1N5QA 4NRUA 2GS8A 3DI6A 4ZVEA 2GMJA 3C66A 4OV1A 3RB0A 3F44A 1FESA 3MD3A 1VIOA 3PTWA 1T7PA 4F4KA 4NMXA 1UDNA 2C38B 3MHYA 3CJRA 4IH6A 3GLLA 2EKYA 3I4HX 3VAJA 5KFPA 4C11A 2ILYA 3DDNA 3A8JA 4IFDC 3R7NB 2RF2B 1WORA 1DQAA 1SC3B 3QIPA 2RQCA 4Q2MA 1AZSB 2A6OA 1FD2A 4F7VA 1YVFA 4WTYA 2CPDA 2VOPA 3KFWX 1SI9A 2VBXA 4LF5I 1UW9A 2OSQA 3WU3A 3D54A 3OTEA 3BJYA 2UV8A 3NAIA 2YNGB 2Z56B 2AEJA 2GNKA 3NS7B 4I67A 3K1JA 1PYTA 3HZEA 3Q8UA 4ZPAA 2JE6A 4AFFA 2XGPA 4DOZA 2M88A 4KTQA 3HZGA 3QWPA 1QTMA 2KB2A 1Y9OA 2FHJA 4YHHE 1R8BA 1XR7A 3PW5A 3LH2S 1IR0A 1HW9A 1S6QB 3KLFA 5IT9C 3D6HB 5JEAF 2GA7A 4DV7E 2VFTA 4C97A 2EFQA 3OUYA 3HHNB 3PS1A 3E8OA 2ZH5A 1FXRA 4OI6A 4UY8T 4DR4I 3D3CJ 4GKKJ 2WBRA 1K73T 2DR8A 4IO1A 3EVOA 3KK1B 3EGZA 4OYMA 5SZTA 4PQAA 1VHFA 1HBOA 3BEGB 3B4MA 3OR1A 2V4QA 3RRHA 4LREA 1JLFA 1U6ZA 3SXLA 4NLQA 1WACA 4LRBA 2BR0A 1G4CA 2I5JA 4WFBQ 2DH9A 2WVCA 2YQ1A 2FHJD 2CJ9A 1XMOJ 3HJVA 2F1FA 4NYZA 4RW6B 4IR1A 4IH7A 3VGSA 3J7Z5 4CIOA 1V6HA 2K3KA 3M2VB 2UUWA 4H4MA 5G4DA 3W63A 3CPWR 3T5HA 4DL7A 3W60A 4AXJA 5B09A 3AD8C 4M5GA 3MPVA 5ITHA 4DLGA 4CLUA 2YNHB 2WTFA 5CYQA 1N32J 4USUA 5A8KA 3GMEA 3GP9A 4MKVA 1DTQB 3LWLA 1RBAA 2DISA 2RSQA 2ZC3A 1VOMA 1IBME 2CDQA 1XR5A 1VBKA 4LRFA 1Z4UA 1SUQB 2G1HA 2ZM6E 4DV5J 3AODA 4LFAE 2HK2A 1MG7A 4WYWA 3GE9A 2GGPB 4MFBB 1RWNB 2XM3A 1WSRA 2GIRA 4Q0BA 2XI2A 1P27B 4DEZA 4OYOA 1VQ5S 1HYSB 3D9BA 1IBLJ 4DQPA 4JI0J 2DYAA 4F3MA 3U1NA 4PWDA 3PIOQ 1JLGB 2F4VJ 1R0BG 3KJVB 3TAMB 4KRWA 2HWIA 1TL1A 5KFCA 4ID5B 3AY0A 1XNRF 2VFVA 3MZIA 2CQIA 4WBFA 3K5LA 1S9GA 2GQQA 1FJ7A 1NPRA 2H4WB 3F56A 2IOPA 3JQJA 1HNVB 1SBRA 4B3OB 2UXBJ 2AZ3A 2KRBA 4NLXA 2V9WA 3U27A 2V2VA 1WKLA 4DU8A 1NHVA 1ELOA 5C0XC 2FVSA 3IGNA 3DC2A 3DXBA 2PD1A 4FF2A 2NQPA 3G8SA 3Q0AA 3CMQA 1KEKA 2CPXA 4YR0A 3L7UA 4J9QA 2RQ4A 5L9NA 5L1IA 4UQTA 3M6UA 4DQSA 3T6JA 1QD1A 2GVZA 3ZTRA 4JYAJ 4JOUA 1V5IB 2ALZA 4GMKA 1TKXB 3A3NB 2AT1B 5K36E 1B7FA 2V8VA 1O5JA 4Y65A 1GNKA 4FVCA 4DPWA 4J7CA 3PO5A 3T1HJ 2VH7A 1RHRB 4Y34A 3EVMA 1OSDA 1V3RA 4X65F 5D3GA 4BC9A 2HFVA 3Q8VA 5F8HA 3NS6A 4IFDF 3M32A 2YKPA 1RT4A 3KK3A 2ASLA 4CYUA 4JI3J 3AJDA 1KLNA 3OL9A 1N36I 4ZCKA 1SB6A 3AA8A 3DOMA 2W8KA 4DFKA 1NMEB 1VCTA 4OQJA 1Q5VA 2WHOA 4IG3B 1XMBA 2IC3B 2F3JA 3O3LA 5T14A 1VQOS 2W2MP 3GIMA 3MMJA 2HAFA 1H73A 4DR3E 2J6TA 4O0NA 4W92B 4PKDB 4KBIA 4YDXA 1D9FA 1C1CA 3UWTA 1F3VA 4M5DA 4RNHA 4LF5J 1T94A 2I5JB 4YUDA 5KFJA 4F67A 2JWNA 1JLCB 1PCAA 4RW7A 4ECXA 2DNMA 4MQYA 1PYOB 2OSRA 2J0XA 2HNYA 4FYVB 1H6KX 3KG1A 1V3ZA 4I6AA 4P2FA 4TVAB 2BVZA 3TQEA 2BKNA 3OT9A 4USTA 2R8HA 2MQNA 1UVMA 2HAIA 1YJVA 4DZ6A 2R7XA 3VAFA 4OZ0A 2E1CA 2DNQA 1GTEA 4OKGA 2LKZA 3I6PA 1DURA 2WW4A 4I4BA 3H4DA 1RT6A 4Y0FA 3K17A 1IBKF 3DDKA 1S1VB 3MPWA 4JB8B 2JFDA 5AXNA 1LK5A 3N6LA 3SQGA 5K8MA 4ZIWA 2V8GA 1L3KA 4QIVA 2FJAB 1XMQF 2XULA 1HBUB 4N3OA 2Z0GA 2J6UA 1U25A 3D68A 1X4EA 3D67A 3V4MA 3RAQA 4OHYA 3W64A 1RTDB 1NDPA 2QTWA 4P7TA 1MU2B 4ZP6A 5K36B 1T05B 3C6TB 4L72B 3NBPB 4GRSA 4LCGA 4D3HA 2I8EA 3NMAA 3I55S 3TA0A 4KYZA 5A8RB 4C4WA 2YWFA 4ILRA 3H40A 2XS7A 3VGUA 2XS5A 4NZ7A 3LTOA 3MMBB 1JX4A 1GXTA 1X4BA 5L39A 1OYSA 3PYGA 2HSEB 3W61A 1IXKA 2HVDA 5CZXA 1LFWA 2LQBA 2LEAA 3UN2A 3PW4A 1NJYA 3ONQA 2PO1A 2EW9A 2YH0A 4I2PB 4JI8F 2ACMA 3UR0A 1HL6A 5KFIA 2ZH8A 4PEOA 2D3OR 2RRAA 1CC7A 4MTPA 4LIWA 5E41A 2E5IA 2JEBA 2PNMA 2MEWA 4RO0A 2CJQA 1PYSB 4CM0A 2CG9A 4UY85 3KK2A 3LGMA 4NCGB 3CEDA 2R8KA 3QYYA 2AGQA 5C0XF 3TWZA 2E7VA 4DFJA 5KT7A 2HFUA 2YKQA 4ID8A 1VIXA 2HVZA 3M8YA 2DH8A 2DR9A 2XEXA 3JSYA 1T3OA 1B7YB 1N6QB 3BSAA 2HHQA 4ZMMA 5LT5A 4ZVFA 1RCOB 3KDOA 2HS3A 1I6JA 3GFYA 4LF7E 1AUDA 5IWAJ 4JI6E 5HSPA 2XNRA 2LQ8A 1LXJA 3GONA 3RZAA 1XNRI 5EHHA 2MQLA 1WC0A 3CMAS 4M5NA 2HFNA 2Z2LA 1I3OB 2A18A 4DN9A 4LSZB 3BYRA 2JL9A 4ZN1A 5KOXA 2EG2A 5J2PA 5I3UA 5L8RC 5IFMA 3VV2B 4RUCA 2CZ9A 4Q2LA 5CYMA 2GW8A 2J9EA 4FVMA 2QZ8A 3OVSA 4PYDA 1U6BA 1QAXA 3H2LA 5BR8F 1NK6A 2J0QD 4N76A 3SI8A 3A8IA 1YBTA 3G82B 1HD0A 2QG9B 5HAOA 5JJBA 2VB6A 1ZOTA 4M5DB 5F8GA 1H3DA 4CO0A 3R2CJ 2N82B 2WVFA 2VESA 4WPAA 1BQMA 1RAFB 2UV8G 1BWVA 2BJ9A 2GJIA 4Z7CA 4K0KE
chains in the Genus database with same CATH topology
2O1TA 4DV4I 3D4JA 1Z0VA 2IOQA 1HNXI 1XHKA 2VQFE 2UXDE 4DR3I 5IT9Q 3ZZ0A 2Z5CA 4LFCI 3T1HI 1B63A 4DV2I 4NXNE 2GQ0A 4GKJE 4ZVIA 5LMUE 2AJ4A 4DR2I 1I94I 3J80Q 1UEKA 5FLXC 2GS8A 4USMA 4IZJD 4WUBA 1N36I 2E5LE 1FWKA 4DUYE 4JI4I 4X65I 1HNWI 1ZM4A 4DR7I 3V2UC 3ZZTA 4WUDA 2BM1A 3OTOE 3JAMQ 3QT6A 1EI1A 4JYAE 1IBKI 3ZM7A 5BR8E 3T1YE 1S16A 1FNMA 4DV4E 4B3RI 1Y4UA 3B78A 2ZM6I 1HNXE 4JI7I 1H73A 4DR3E 3J7AG 2Q2EB 1Y6ZA 3T1HE 1HNZI 1XMOI 4DV2E 4EMDA 4DV7I 1H72C 4DR2E 1I94E 1H7SA 2UUAI 1Z0GA 4P52A 1U2RA 4DU7A 4X66I 3V5RA 1ZM2A 1N36E 1NHIA 3H4LA 5FWKA 4LF5I 4X65E 2HKJA 3WU3A 1MX0A 1HNWE 4JI3E 4MYTA 3B82A 1N0VC 2O1VA 1Z5BA 1N32I 1PIEA 3WU6A 3K1JA 2DEJA 3Q6NA 4JI2I 4OX9E 1FI4A 3HULA 1KKHA 3QT7A 4B3RE 4JI7E 4YHHE 1HNZE 4AQYI 5IT9C 4DV7E 4B3MI 1N0UA 2O1UA 2WW4A 1Y4SA 4JV5I 1FKAE 3K17A 4YY3I 2UUAE 1KVKA 4P7AA 4X66E 2V2ZA 3J80C 5LMNI 4HACB 4PRXA 2VQEI 2Z5BA 4DR4I 4IZJB 4LF5E 1HR0I 2NPFA 4M1KA 3J81Q 4DPYA 4XTJA 1H7UA 5A2QQ 1Z0TA 4GKKI 2EFGA 4JI0I 1NZ0A 2HHHI 1HK7A 5GMEA 1ZM9A 2ZITA 4N3OA 1VISA 4JI2E 1Z0WA 3QT5A 4KQVA 1IBMI 5FLXQ 3M6AA 3WU4A 4DV1I 4JI5I 1RREA 4FW9A 4IZKA 2HFSA 1D6TA 1EA6A 1NHJA 4RPFA 1MU5A 2Z5CB 4AQYE 4DXLA 1B62A 3LPSA 3F0NA 4LFAI 4B3ME 4USKA 2E1RA 4LFCE 1XMQI 5IWAI 4YY3E 2UXBI 4MYUA 2VQEE 4DR4E 4LFBI 2V8PA 4DV6I 2UUCI 1HR0E 1Z0CA 4PRVA 4LF4I 3LTOA 4K0KI 1ZXMA 3PYGA 4DR5I 4JI4E 4GKKE 4DR7E 4DPTA 1FWLA 4JI0E 4FN5A 2BM0A 1J5EI 2J7KA 1ZM3A 1FJGI 4JG4A 1IBKE 1IBME 1OJ4A 2HKEA 4FWDA 5L3JA 4DV1E 4JI5E 4LF8I 3HJCA 2ZM6E 4LF7I 4LFAE 4DUYI 2HK2A 1MG7A 1DARA 2X36A 1XMOE 4JI6I 1XMQE 4UTGA 4DR1I 3Q6MA 3PRYA 3J7AM 1A6FA 4PU9A 4DV5I 1Z0EA 1NHHA 2PNMA 4LFBE 4DV6E 2UUCE 4LF4E 4LF9I 1KIJA 4JI8I 2CG9A 3T1YI 2VF3A 4DUZI 1N33I 4DR5E 2UU9I 3ZKDA 1RR9A 3J81C 2UUBI 1IBLI 4URLA 4KHPI 2HFUA 5A2QC 1N34I 4LF6I 1J5EE 2ZBKB 2PNLA 1FJGE 2OI2A 3CWVA 3PYDA 4I3HA 4X62I 2XEXA 1N32E 1PVGA 1QZRA 1Z5CA 3JAMC 3LNUA 1Z5AA 3ZKBA 1USVA 4LF8E 1ZXNA 1KTVA 2F4VI 2HK3A 3ZZUA 2BV3A 2UXCI 4NXMI 5LL6R 4LF7E 1XNQI 2IOPA 4X64I 1K47A 2R3VA 4JI3I 4JI6E 4DR1E 4B3TI 3Q1QA 1WUUA 2CGEA 4DV5E 2V2VA 3PYFA 3PYEA 4UT4A 3K85A 1H74A 4DU8A 2DEIA 4JV5E 3GONA 2Z5BB 4LF9E 4JI8E 3WU5A 1XNRI 1ELOA 3P06A 4OX9I 4DUZE 2X7IA 5LMNE 4WUCA 4DV0I 4B3SI 4DR6I 1N33E 4DPXA 2A2CA 2Z5EA 2UU9E 4FWGA 2O1WA 4DV3I 4JI1I 2UUBE 4YHHI 4R1FA 1IBLE 4KHPE 1N34E 4LF6E 3QT8A 3B8HA 2VQFI 2UXDI 4X62E 2HHHE 2CZ9A 4NXNI 2F4VE 4GKJI 1PKPA 4Z7YA 2V34A 4HYMA 4IZKB 5LMUI 2UXCE 4NXME 2LJPA 1BKNA 4DPUA 1XNQE 4HY1A 4X64E 4B3TE 4HACA 4IZJA 1S4EA 2E5LI 2A2DA 4ED4A 5IWAE 2V2QA 3OTOI 5GMDA 1Z0BA 2UXBE 1XNRE 4JYAI 4FWHA 1USUA 4DV0E 4B3SE 4DR6E 4DPWA 4Z7CA 1Z59A 5BR8I 2R42A 4DV3E 4HXZA 4K0KE 4JI1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 I;  3D4J A;  1Z0V A;  1HNX I;  1XHK A;  2VQF E;  2UXD E;  4DR3 I;  5IT9 Q;  3ZZ0 A;  4LFC I;  3T1H I;  1B63 A;  4DV2 I;  4NXN E;  4GKJ E;  4ZVI A;  5LMU E;  2AJ4 A;  4DR2 I;  1I94 I;  3J80 Q;  1UEK A;  5FLX C;  2GS8 A;  4USM A;  4WUB A;  1N36 I;  2E5L E;  1FWK A;  4DUY E;  4JI4 I;  4X65 I;  1HNW I;  1ZM4 A;  4DR7 I;  3V2U C;  3ZZT A;  4WUD A;  2BM1 A;  3OTO E;  3JAM Q;  3QT6 A;  1EI1 A;  4JYA E;  1IBK I;  3ZM7 A;  5BR8 E;  3T1Y E;  1S16 A;  1FNM A;  4DV4 E;  4B3R I;  3B78 A;  2ZM6 I;  1HNX E;  4JI7 I;  1H73 A;  4DR3 E;  3J7A G;  2Q2E B;  3T1H E;  1HNZ I;  1XMO I;  4DV2 E;  4EMD A;  4DV7 I;  1H72 C;  4DR2 E;  1I94 E;  1H7S A;  2UUA I;  1Z0G A;  4P52 A;  1U2R A;  4DU7 A;  4X66 I;  3V5R A;  1ZM2 A;  1N36 E;  1NHI A;  3H4L A;  4LF5 I;  4X65 E;  2HKJ A;  3WU3 A;  1MX0 A;  1HNW E;  4JI3 E;  4MYT A;  3B82 A;  1N0V C;  1Z5B A;  1N32 I;  1PIE A;  3WU6 A;  3K1J A;  2DEJ A;  4JI2 I;  4OX9 E;  1FI4 A;  3HUL A;  1KKH A;  3QT7 A;  4B3R E;  4JI7 E;  4YHH E;  1HNZ E;  4AQY I;  5IT9 C;  4DV7 E;  4B3M I;  1N0U A;  2WW4 A;  4JV5 I;  1FKA E;  3K17 A;  4YY3 I;  2UUA E;  1KVK A;  4P7A A;  4X66 E;  2V2Z A;  3J80 C;  5LMN I;  4HAC B;  4PRX A;  2VQE I;  4DR4 I;  4LF5 E;  1HR0 I;  2NPF A;  4M1K A;  3J81 Q;  4DPY A;  4XTJ A;  1H7U A;  5A2Q Q;  1Z0T A;  4GKK I;  2EFG A;  4JI0 I;  1NZ0 A;  2HHH I;  5GME A;  1ZM9 A;  2ZIT A;  1VIS A;  4JI2 E;  1Z0W A;  3QT5 A;  4KQV A;  1IBM I;  5FLX Q;  3M6A A;  3WU4 A;  4DV1 I;  4JI5 I;  1RRE A;  4FW9 A;  2HFS A;  1D6T A;  1EA6 A;  1NHJ A;  4RPF A;  1MU5 A;  4AQY E;  4DXL A;  1B62 A;  3LPS A;  3F0N A;  4LFA I;  4B3M E;  4USK A;  2E1R A;  4LFC E;  1XMQ I;  5IWA I;  4YY3 E;  2UXB I;  4MYU A;  2VQE E;  4DR4 E;  4LFB I;  2V8P A;  4DV6 I;  2UUC I;  1HR0 E;  1Z0C A;  4PRV A;  4LF4 I;  3LTO A;  4K0K I;  1ZXM A;  3PYG A;  4DR5 I;  4JI4 E;  4GKK E;  4DR7 E;  4DPT A;  1FWL A;  4JI0 E;  4FN5 A;  2BM0 A;  1J5E I;  2J7K A;  1ZM3 A;  1FJG I;  4JG4 A;  1IBK E;  1IBM E;  1OJ4 A;  2HKE A;  4FWD A;  5L3J A;  4DV1 E;  4JI5 E;  4LF8 I;  2ZM6 E;  4LF7 I;  4LFA E;  4DUY I;  2HK2 A;  1MG7 A;  1DAR A;  2X36 A;  1XMO E;  4JI6 I;  1XMQ E;  4UTG A;  4DR1 I;  3J7A M;  1A6F A;  4PU9 A;  4DV5 I;  1Z0E A;  1NHH A;  4LFB E;  4DV6 E;  2UUC E;  4LF4 E;  4LF9 I;  1KIJ A;  4JI8 I;  3T1Y I;  2VF3 A;  4DUZ I;  1N33 I;  4DR5 E;  2UU9 I;  3ZKD A;  1RR9 A;  3J81 C;  2UUB I;  1IBL I;  4URL A;  4KHP I;  2HFU A;  5A2Q C;  1N34 I;  4LF6 I;  1J5E E;  2ZBK B;  1FJG E;  2OI2 A;  3CWV A;  3PYD A;  4I3H A;  4X62 I;  2XEX A;  1N32 E;  1PVG A;  1QZR A;  1Z5C A;  3JAM C;  3LNU A;  1Z5A A;  3ZKB A;  4LF8 E;  1ZXN A;  1KTV A;  2F4V I;  2HK3 A;  3ZZU A;  2BV3 A;  2UXC I;  4NXM I;  5LL6 R;  4LF7 E;  1XNQ I;  4X64 I;  1K47 A;  2R3V A;  4JI3 I;  4JI6 E;  4DR1 E;  4B3T I;  3Q1Q A;  1WUU A;  4DV5 E;  2V2V A;  3PYF A;  3PYE A;  4UT4 A;  1H74 A;  4DU8 A;  2DEI A;  4JV5 E;  3GON A;  4LF9 E;  4JI8 E;  3WU5 A;  1XNR I;  1ELO A;  4OX9 I;  4DUZ E;  2X7I A;  5LMN E;  4WUC A;  4DV0 I;  4B3S I;  4DR6 I;  1N33 E;  4DPX A;  2A2C A;  2UU9 E;  4FWG A;  4DV3 I;  4JI1 I;  2UUB E;  4YHH I;  4R1F A;  1IBL E;  4KHP E;  1N34 E;  4LF6 E;  3QT8 A;  3B8H A;  2VQF I;  2UXD I;  4X62 E;  2HHH E;  2CZ9 A;  4NXN I;  2F4V E;  4GKJ I;  1PKP A;  4Z7Y A;  2V34 A;  4HYM A;  5LMU I;  2UXC E;  4NXM E;  2LJP A;  1BKN A;  4DPU A;  1XNQ E;  4HY1 A;  4X64 E;  4B3T E;  4HAC A;  1S4E A;  2E5L I;  2A2D A;  4ED4 A;  5IWA E;  2V2Q A;  3OTO I;  5GMD A;  1Z0B A;  2UXB E;  1XNR E;  4JYA I;  4FWH A;  4DV0 E;  4B3S E;  4DR6 E;  4DPW A;  4Z7C A;  1Z59 A;  5BR8 I;  2R42 A;  4DV3 E;  4HXZ A;  4K0K E;  4JI1 E; 
#chains in the Genus database with same CATH topology
 3PRB A;  1RTJ A;  4V19 X;  2QSW A;  2QLW A;  4RW8 B;  2OFH X;  1JLA A;  1B63 A;  4O44 A;  3MM7 A;  4EBC A;  2GQ0 A;  2PC6 A;  3KHH A;  5KG6 A;  1N36 J;  4MU4 A;  1ZTT A;  1NJX A;  1L5U A;  2JOQ A;  2BJ8 A;  1N5S A;  4WUB A;  4X65 I;  1JLE A;  4A46 A;  2HZA A;  4DR7 I;  1W7W A;  4Y2K A;  5D4L A;  3G86 A;  1DLO B;  4BHQ A;  3HFV A;  5J2M B;  1TL3 B;  1FNM A;  3TA2 A;  3SYZ A;  2VC0 A;  5HVH A;  4MIA A;  2OD4 A;  1RT5 A;  1BD6 A;  3ZO7 A;  3IS9 B;  2HMI A;  4P52 A;  1Y5Y A;  1YK9 A;  3S01 A;  4M94 A;  1HQE A;  4K7Q A;  2VG7 A;  3J80 Y;  1XC9 A;  5FJ4 A;  4AQY F;  1V5V A;  3B82 A;  1EQ0 A;  2D7S A;  3WX8 A;  1HWJ A;  1SIW B;  2AMC B;  3TNV A;  1SJ4 P;  2WVE A;  5T7L B;  1TL7 B;  2N4C A;  3JAM Y;  2VKZ G;  2HWH A;  5B0C A;  2RH3 A;  3R5C A;  5U47 A;  1X4G A;  1KLM A;  5KFU A;  2P5V A;  1KKH A;  4AL5 A;  4C8O A;  2JVR A;  5CAB A;  2W9C B;  3QSI A;  4DFM A;  3NRB A;  4ZPC A;  4ES1 A;  4M5J A;  4YB7 A;  4AYB D;  2D9O A;  4O4R A;  2FD2 A;  2R7R A;  1RWV B;  1Y4S A;  1DZ5 A;  1N8R T;  2CVE A;  5A8W A;  3MGJ A;  1HMV A;  3R97 A;  2Z5B A;  2OFG X;  3BBB A;  3BN4 A;  4IKA A;  3PNI A;  2MKJ A;  3MAA B;  2B9E A;  1MRO B;  2FHO B;  1OO0 B;  1OSC A;  3GU0 A;  2XWY A;  4ES2 A;  1MU5 A;  2XSF A;  1ARO P;  1MN9 A;  3V81 B;  3LUY A;  1SKW A;  1GMU A;  2HIQ A;  2XHW A;  3SSS A;  3UDL A;  2CNL B;  2CVI A;  3M1V B;  1ACM B;  1J5E F;  1XMQ I;  1FCA A;  2PGC A;  5IQ6 A;  3C3L A;  3I0R B;  6FDR A;  1VMB A;  3IA0 A;  1GH8 A;  2CFX A;  3N6N A;  2KXF A;  1CUL A;  4HT7 A;  3DD6 A;  4IFV A;  4OLO A;  4OHV A;  4RBT A;  3M6V A;  1Y60 A;  1WEZ A;  2C3P A;  4B02 A;  2JLE A;  3NWG A;  3W1Y C;  2J7K A;  1F5C A;  2D41 A;  1DHM A;  3Q8Y A;  2DR7 A;  1NKC A;  1VC0 A;  5LMN F;  1LEO A;  5FLX Y;  4RW4 A;  2XBP A;  3M6X A;  2UU9 F;  2XTJ P;  5GVQ A;  2H4Y B;  4FS1 A;  2MPU A;  1HWU A;  3GIK A;  5KT2 A;  4KHP F;  5J2P B;  2IPO B;  1Z0E A;  1VI7 A;  3R8Y A;  4FXV A;  3H2U B;  2Z57 B;  2DGW A;  3LP2 A;  4JI8 I;  2W4P A;  5SUH A;  5GAE U;  5K8P A;  2H3E B;  2ROE A;  3THV A;  1RR9 A;  3LP1 B;  1B0T A;  1TAU A;  1W2B R;  3CF5 Q;  4M5I A;  1VRU A;  1IM4 A;  3DLE A;  5E33 A;  4QPT A;  1UPM B;  2E9Z A;  1RT7 A;  3W7B A;  1RTH A;  3LF0 A;  1D09 B;  1JMT A;  3VQT A;  4TU8 A;  4F3Q A;  2J9C A;  1AXQ A;  1QSS A;  5GAH U;  3MM7 B;  5A0Y B;  1XNR J;  2XG8 A;  4PZV A;  1F1B B;  1FE0 A;  3PRV A;  1TKT A;  4ILM A;  4DL0 C;  2CQB A;  3L3C A;  4LOM A;  3QZ7 A;  2PNZ A;  1T03 A;  1X60 A;  2HZC A;  1JLE B;  2EWH A;  4JV1 A;  4LF6 E;  4KC5 A;  4DUY F;  4KV8 A;  1KS2 A;  3QJL A;  2XSJ B;  1FFS B;  1XWL A;  2XMT A;  2FPH X;  2BAN A;  2ZWP A;  3V6K A;  1T3N A;  1SCJ B;  2DNN A;  7AT1 B;  2PT0 A;  3WBZ A;  4WFY A;  4CLW A;  3N01 A;  4ZDN A;  1CPZ A;  5C24 A;  1RJJ A;  1WF1 A;  3SV3 A;  1YIT S;  1KVJ A;  4DL5 A;  4KB7 A;  5BR8 I;  3K58 A;  4CNY A;  2EC0 A;  2MQP A;  4NXM F;  2ASD A;  2CQ0 A;  2GO9 A;  3P6Y C;  1Z0V A;  2VQF E;  1UA1 A;  1PSD A;  3CCE S;  2JLG A;  3OHA A;  3CD5 A;  1F2H A;  3WX4 A;  4GKJ E;  3P5T L;  1U0S A;  4ECU A;  5KTQ A;  2VOO A;  4MAK A;  1F3F A;  5CZV A;  4X65 J;  2H65 B;  4OX9 F;  2WVD A;  1OY8 A;  4ZVQ B;  3EX7 B;  2XZW A;  5IM0 B;  2EFN A;  4JI4 I;  5ETR A;  4TY9 A;  1TUW A;  2QLB B;  3DRP B;  1EI1 A;  3THP A;  5B08 A;  1FRI A;  3KUG A;  1VHI A;  1RU2 A;  1NO8 A;  1JLQ B;  1TUV A;  1Q53 A;  4I2Q B;  2HND B;  2J5A A;  2BR2 B;  1WG5 A;  3D1O A;  1R8C A;  3BDE A;  3MM8 B;  3SMZ A;  1FHT A;  1IKV B;  2WBM A;  1WEX A;  2HG4 A;  4ZLP A;  4CCH A;  1CJV B;  3V5R A;  1ZH5 A;  2F9D A;  3OTB A;  5HI7 A;  2RRN A;  4NRT A;  2HKJ A;  3THT A;  1YHC A;  3J81 Y;  3MR7 A;  4C98 A;  2RS2 A;  1N0V C;  3B4T A;  3GIJ A;  3T5L A;  4URG A;  1Q0N A;  1S9F A;  3ZTS A;  1FJE B;  5KG4 A;  3MMA A;  4PCQ A;  3MM9 A;  5E3P A;  4X4R A;  2BQU A;  3D7S B;  2RDD A;  1VQK S;  3V4I B;  1GQE A;  2PO0 A;  3GJQ B;  2VQE F;  1I94 F;  2PA8 D;  1KQS R;  4B3R E;  3VVT A;  4AQY I;  4OV6 A;  1FDB A;  1EIY B;  2XCP A;  1KR4 A;  3I0S A;  2IDL A;  2J0W A;  4QWE A;  5C42 B;  4N56 A;  3V6D A;  1AFJ A;  4FBT A;  1CS4 A;  3LPE A;  4EZ9 A;  3FZ2 A;  1R89 A;  2LU2 A;  3EDR B;  3HD2 A;  1HR0 I;  2GIQ A;  3AB4 B;  2NPF A;  3H42 A;  1S97 A;  4N77 A;  5L1J A;  1IBK J;  2B9W A;  2HBR B;  5A2Q Q;  5F3T A;  1VQN S;  2EFG A;  2HHU A;  1GK8 A;  1HK7 A;  4PXD A;  2Z4P A;  4JV0 A;  5KT4 A;  4OYA A;  4F8R A;  4EEY A;  4LFB F;  4OZL A;  4FW9 A;  4QIF A;  3IBF B;  3MR2 A;  2ZD1 A;  2F5G A;  4QU7 A;  2BAC A;  4DR5 F;  1OQ3 A;  4YB6 A;  1WC1 A;  4ANC A;  4ZLN A;  4QWA A;  1S48 A;  2IBK A;  1U1N A;  3H5Y A;  1FJG F;  3BKU A;  1RAA B;  4ICL B;  4RJV A;  2ZOG A;  1RBO B;  3DRS A;  3FEY B;  4MYU A;  2JHE A;  4EYI B;  4LCF A;  3U1K A;  2XO7 A;  3HHL B;  1SC6 A;  4F4Y A;  2E29 A;  4ERD A;  4L76 A;  2KVI A;  2POK A;  1RAG B;  1CJK A;  1FWL A;  2GZO A;  4ZVG A;  3HHK A;  1J5E I;  5F8M A;  2KU7 A;  1TV6 B;  3MWB A;  1U1M A;  2IES A;  5GAD U;  3LP0 B;  1N88 A;  5HJX A;  4FWD A;  1TR0 A;  4NA3 A;  3OW2 R;  5JEA A;  2W9B A;  3OFE A;  2VPY B;  1EP4 A;  4MDT A;  3K8W A;  2M9K A;  2C28 A;  2AJ0 A;  1S57 A;  2RD5 C;  4KV8 B;  1B64 A;  3UD5 A;  4OIX A;  1VQ6 S;  2WP8 A;  4L6V 3;  4JI8 J;  4DCJ B;  4NPO A;  3I5B A;  1SKU B;  4X62 F;  2OPP A;  2HHH F;  3PJX A;  4QW9 A;  5HRO B;  5HLF A;  4IOA Q;  3FEX B;  1GEH A;  3P96 A;  2UU9 I;  3H5U A;  2BE2 A;  4M5H A;  1ROF A;  1JK9 B;  4CLK A;  4KHP I;  5A2Q C;  4MU3 A;  4IYQ A;  1HBN A;  2ZUG A;  3M8P A;  1Z5C A;  1S1X A;  5FD1 A;  5JEA D;  2LVW A;  1GTH A;  3AHP A;  5CHC B;  3ZZU A;  3RB3 A;  1R43 A;  3ET6 B;  4YEA A;  3DLH A;  3KLV A;  3K59 A;  4OZ2 A;  5HBM B;  1U1P A;  2JEA B;  1HI1 A;  4DR1 E;  2CGE A;  1FK9 B;  2LQJ A;  5C2C A;  3Q8R B;  3RUB L;  4YDD B;  3IFE A;  3HD1 A;  1KN6 A;  3DMJ B;  3ENQ A;  2OEK A;  3CDU A;  4RBV A;  1B99 A;  2Z2Z A;  2A2C A;  5B0B A;  1FFG B;  4C9D A;  2XMU A;  2PO4 A;  2XQC A;  3QO9 A;  1HNI B;  5GMK a;  3OXG A;  3BSO A;  4Y2A A;  5K14 B;  4EO6 A;  3TJ8 A;  3GV8 B;  1ZTW A;  3R27 A;  4Z7Y A;  3DYA B;  2KFY A;  2NUH A;  4LQ3 A;  4NXM E;  2U1A A;  1IKX B;  1JXE A;  3D28 A;  2W4C A;  4USW A;  4G1I A;  2QL7 B;  4QQB A;  2MLZ A;  4ED3 A;  2HGL A;  5BR8 J;  4ED5 A;  3Q2T C;  4DV0 E;  4B3S E;  4ANE A;  1KDN A;  3MAQ A;  4JV2 A;  3AQP A;  1DY3 A;  1RWU A;  3BH7 B;  2CPY A;  3PX0 A;  1HQU B;  2QA1 A;  4RL1 A;  2UXD E;  1U6F A;  4U7C A;  4LFC I;  1FVQ A;  1KQK A;  1UJ4 A;  2FGO A;  1VLO A;  3U1Y A;  3FFI B;  4PG6 A;  3ILL A;  5HVF A;  2FDN A;  3NOG A;  4RNF A;  3WHI A;  1S7H A;  6AT1 B;  1TZ0 A;  1HNZ F;  3UQS A;  3MED B;  2JEF A;  1YRX A;  3NEK A;  1CS4 B;  2W2N P;  1HPZ B;  1U7L A;  3I32 A;  2AE8 A;  1LNQ A;  1MW7 A;  2Q43 A;  1YJW S;  2IAJ B;  1P6T A;  2VQF J;  1QVF R;  1JJH A;  3NXZ A;  3A13 A;  2LFV A;  1T8E A;  2XYP B;  4Z2X A;  4GKJ J;  2IER A;  3SDE B;  1I94 E;  3KYL A;  1NDK A;  5H9F J;  2CAJ A;  4KE5 A;  1NHI A;  4YB5 A;  4DS4 A;  4LBH A;  3HT3 A;  3N9U C;  4YY3 F;  1RAO A;  2ZH4 A;  3HUL A;  4AQY J;  3B6B A;  4IFD A;  3J80 U;  4DMZ A;  4DX5 A;  3H8Y A;  1X8D A;  1RYS A;  1I51 B;  2MY8 A;  3X3U A;  3QLH B;  4IDK A;  8AT1 B;  4OI2 A;  2Y0B B;  4JV5 I;  1HD1 A;  2ZH9 A;  3JYT A;  3JAM U;  4OO1 E;  3BM7 A;  5F0W A;  2BA0 D;  2BA9 A;  2NXJ A;  4C3K A;  3GYN A;  4DV1 F;  1SKS A;  2VQE I;  4O3P A;  3RW6 A;  3OR2 B;  1P9Y A;  4IFY B;  4NLO A;  3CWJ A;  3MPY A;  3E2E A;  1EZZ B;  2NN6 B;  4ZOS A;  4X4T A;  2WP8 B;  1ZS6 A;  2BQ3 A;  3DLG B;  3JS9 A;  2G2Z A;  1R8H A;  4HR2 A;  4ZS6 A;  1YJ9 S;  3GII A;  4AIM A;  3D66 A;  1YGY A;  1T9W A;  3H0P A;  4B3R J;  4IFD D;  3WU4 A;  3CDI A;  4Q8E A;  2F9J A;  2AV5 A;  2RIL A;  3IBC B;  1NK8 A;  3TJA A;  2C2K B;  1FRX A;  1JKH B;  1L3T A;  2CZ4 A;  5DG9 A;  4IOB A;  2DGO A;  4P2M A;  1LW0 B;  3C19 A;  2DCU B;  1M90 T;  2CUY A;  1S1X B;  4LVN P;  4X4V A;  3JQK A;  4PG7 A;  3Q22 A;  4LFB I;  3OFG A;  2XNQ A;  2RDJ A;  3CCT A;  1ZXM A;  1J5E J;  4DR5 I;  4DR7 E;  1GMV A;  2D1C A;  2A0F B;  5D0H A;  4OZ1 A;  2XLJ A;  1FKO A;  2EEY A;  1FJG I;  4TYA A;  2WON A;  3TVZ A;  3R1H A;  4K4X A;  1U1L A;  4WK1 A;  4XDD A;  2AYG A;  3D1Q A;  4J37 A;  1QAJ A;  3PVX A;  2M70 A;  2GAG C;  4LCH A;  3UW1 A;  5EWE A;  2Q79 A;  5LMN J;  1U47 A;  3DM2 B;  1TK8 A;  1R6Y A;  2QV6 A;  3DCA A;  3CC2 S;  1JIH A;  2UU9 J;  2FGC A;  1D8Z A;  3T1Y I;  4KHP J;  5FLX U;  1Y4Z B;  2DXD A;  3AJ2 A;  3NG8 A;  4NE9 C;  2Z58 B;  4DL6 A;  4B3T F;  2ZHB A;  5J1E A;  1BMQ B;  2KT3 A;  2PNL A;  4X62 I;  3LNU A;  2CXE A;  1B4S A;  4BDP A;  4LF8 E;  4PUO B;  3OSN A;  3NGU A;  4DV3 F;  2AGO A;  3C16 A;  3PJ9 A;  1WC3 A;  1LWE B;  2KI2 A;  1IJF B;  2MKI A;  2UVU A;  4RW9 A;  2DEI A;  4ZJQ A;  5DDQ C;  4IOC Q;  2H9Z A;  1J5O B;  3VQS A;  4E0D A;  3QQC D;  2BA1 D;  4U95 A;  1H38 A;  2HLT A;  3HXM A;  5A6W A;  1VRT A;  2E7X A;  1PC5 A;  1D9A A;  3H5S A;  2P9C A;  1REV A;  1MSW D;  5KFF A;  1G7C B;  4H4O A;  5EN1 A;  4HYM A;  3CE8 A;  1E6Y B;  1HHT P;  2DNH A;  4W90 B;  4DUY J;  1XNQ E;  2O5D A;  2MZJ A;  3DXS X;  2KYX A;  4DR1 J;  3IC1 A;  1IWA A;  4DQQ A;  4ZVU B;  1HA1 A;  1IWG A;  1U45 A;  2FZC B;  1FWP A;  1RKJ A;  4ZPB A;  2I38 A;  5C0X A;  3S7R A;  3RBX A;  2K1R A;  2EKN A;  1UMJ A;  3RW7 A;  2RQM A;  5ADZ A;  4MMO A;  2ZE2 A;  3DU6 A;  3FSY A;  1R3N A;  4KAI A;  3TR5 A;  3M8W A;  3FKB A;  5KFG A;  2ABY A;  3TZZ A;  2VPZ B;  4WU2 A;  1RLD A;  4NXM J;  2A3J A;  2OPQ A;  2G0J A;  1S6O A;  2VG5 B;  4BA1 B;  3ZZZ A;  3M30 B;  3N0V A;  2O01 C;  1FWK A;  2QEX S;  1HI0 P;  2LQ9 A;  3IGV A;  1R8A A;  4A8W A;  4F4X A;  4OX9 J;  1CVJ A;  5C0X D;  3PW7 A;  1FKA F;  3MR3 A;  2ALY B;  4F3O A;  1QTN B;  2HQD A;  4QNK A;  2EXU A;  1S16 A;  1VRQ