4ED4A

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
303
structure length
299
Chain Sequence
SDWVPTGAVTVRAPGKVNLYLAVGDLYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 97
structure length 299
sequence length 303
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4ed4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ed4A01
2UUBE 1N36I 1HNZI 4KHPI 4WUCA 2X7IA 4HXZA 2VQEE 2F4VI 4YHHE 1NHJA 1XMOI 2AJ4A 4DPTA 4FW9A 4LF4E 1BKNA 4PRVA 4HACA 5BR8E 4DPWA 2V34A 4DV4E 5GMDA 4JI3E 4AQYE 4DV3I 2LJPA 4JI7I 3QT5A 5FLXC 4KHPE 1UEKA 4DR5I 1XMQI 1WUUA 1ZXNA 4JI0E 1Z0CA 4DPUA 1ZM2A 4B3SE 1Z5CA 4USKA 4FWGA 4JI4E 1B62A 1N33E 1N32E 2J7KA 4USMA 4DV1E 4LF5I 2HK3A 2UU9E 1RR9A 3WU5A 4DV2E 4K0KI 4DUYI 2DEIA 4DR3I 3V2UC 2BM1A 5A2QQ 1S16A 1IBLI 3F0NA 4DR6E 3M6AA 4B3TI 3T1YE 2XEXA 2UXBE 5IWAE 4X66I 4MYTA 4DPYA 1FJGE 4JI5I 2UU9I 4DV6E 4NXMI 1N34E 4X64E 4LFBI 4LF7E 1FKAE 4RPFA 1J5EI 3ZKDA 4PU9A 1HNWE 2BV3A 4DUZI 2ZBKB 1K47A 4JI1I 1XNQE 4B3MI 1S4EA 4YHHI 4I3HA 2NPFA 2CZ9A 1XMOE 2R3VA 3LTOA 1B63A 1NHHA 1FJGI 1HNXI 3J80Q 1PIEA 3K17A 1IBKE 4JI2E 4GKJI 1KTVA 4JI4I 1H72C 4JG4A 4YY3I 2UXCE 4DV3E 1I94I 3OTOI 4JI8E 4ZVIA 4NXNE 1EI1A 1Z0EA 1VISA 4XTJA 4P52A 4URLA 3PYFA 1N36E 4DU8A 2UUAE 2HKEA 4JI6E 4DU7A 2V2QA 3ZZTA 4LF5E 4MYUA 4FWHA 2E5LI 4Z7CA 1N34I 1D6TA 1XMQE 3WU6A 4DR1E 3WU4A 2UUBI 2VQFI 1MX0A 3ZZ0A 1PVGA 3J80C 5IT9Q 3K1JA 4DR7I 4PRXA 1ZM3A 3ZZUA 2A2CA 4LF4I 4X65I 4HACB 2A2DA 2ZM6I 2UUCE 4LF7I 4X62E 4GKKE 1A6FA 4DUYE 4DV5E 4JI7E 4R1FA 4LF9I 4NXNI 4UTGA 2ZITA 3J81Q 4KQVA 4JV5E 2UXDI 2R42A 1NHIA 3JAMQ 3PYEA 4LF8I 4LF6I 4Z7YA 4LFAI 1PKPA 3B78A 3J81C 1FI4A 4GKKI 1FWKA 5FLXQ 2DEJA 2EFGA 4DV7E 4ED4A 1H7UA 5LMUI 3ZM7A 1KKHA 1EA6A 2WW4A 4JYAI 4DR2E 2VQEI 4OX9I 1Z5BA 1FWLA 1HR0I 2VF3A 1QZRA 2E5LE 4X65E 3PYGA 1MG7A 4JI8I 5GMEA 4UT4A 5A2QC 1Z0TA 5LMUE 1IBLE 3OTOE 3QT8A 1HNWI 3QT7A 3J7AG 2UUAI 4DR5E 4WUBA 2HHHI 3H4LA 3PYDA 1H73A 2UUCI 4LFAE 3GONA 4DV4I 1XNRE 4YY3E 3D4JA 2X36A 4DV5I 4EMDA 4DR3E 4DV2I 2OI2A 3QT6A 2F4VE 4DR1I 1HNZE 4B3TE 4LF6E 2UXBI 2V2VA 4X66E 3WU3A 2Q2EB 2UXCI 1XHKA 1XNRI 4P7AA 1IBME 1I94E 1DARA 3ZKBA 3JAMC 4K0KE 4DV6I 3J7AM 4LFBE 1Z0GA 4AQYI 3HULA 4X62I 2HFSA 1U2RA 3T1HI 1XNQI 3CWVA 1ZXMA 4DR2I 3T1YI 4LF8E 1H74A 5IWAI 1N0VC 1Z0VA 4B3RE 4JV5I 2UXDE 5LMNI 4DXLA 4LFCE 4FN5A 2V2ZA 4HY1A 3LNUA 4X64I 1N0UA 1Z0BA 4JI2I 4GKJE 4DPXA 2HFUA 2ZM6E 4M1KA 5BR8I 5L3JA 1NZ0A 4DR6I 4WUDA 4B3ME 1RREA 4LF9E 1Z0WA 4B3RI 1KVKA 2HK2A 3LPSA 4HYMA 5LL6R 2HHHE 4B3SI 4DV0E 1IBKI 3Q1QA 4OX9E 4JI6I 4DR4E 2HKJA 4NXME 2GS8A 1HR0E 3V5RA 1N33I 4JI3I 1ZM9A 1FNMA 1ZM4A 1H7SA 4DUZE 1Z59A 1OJ4A 4JI1E 4DV7I 1J5EE 4JI0I 1ELOA 1MU5A 1HNXE 2VQFE 4DV0I 4JYAE 3B8HA 2BM0A 2E1RA 1N32I 5IT9C 4DR4I 4DV1I 5LMNE 1IBMI 4FWDA 4LFCI 4JI5E 4DR7E 1KIJA 2V8PA 3T1HE 3B82A 1Z5AA
chains in the Genus database with same CATH superfamily
1N36I 1DY3A 1GXTA 4DV4F 1JJCB 1GTHA 4Y2MA 4U3BA 2KYZA 3W5XA 1RAIB 3FBEA 5LMUJ 3DU6A 5A6WA 2KTQA 2P6SA 2R8JA 3J7AN 4HXZA 1U1OA 2VA2A 1X9MA 1F2GA 3P06A 1KLMA 3GFXA 3OFEA 4NL5A 2W2OP 4ZPVR 4EBCA 4ECVA 1UVLA 3PRVA 4B3SF 1N34F 3MM8A 3QJJA 3OVAA 1NK0A 5DROA 3D1OA 1G6BA 1Q95G 2WSCC 1U1QA 2E5JA 4OZ3A 1ZOTA 1IWGA 1V5VA 1U47A 4IFDE 5J1EB 1QAXA 4DV4J 1WSRA 3OR2B 3RRGA 4LF4E 4F04B 1Q78A 5F8LA 5K8MA 4OL8A 1AA1B 2FLOA 3CJSA 2R2UA 3LGNA 5DO2A 3B4TA 5ETTA 4KQZA 1C1BA 1RTJA 2CZVC 2QLBB 2HBZB 3DLEA 4CQ1A 4ECZA 1Y6ZA 4JI3E 4C8MA 2YKAA 4CTAB 1XNQJ 3OL9A 5K36E 4Y28C 4CLSA 2Z56B 2LJPA 2LA6A 2PA8D 3OVBA 2M8HA 5JEAA 2NXCA 4CO4A 1V3RA 3W2VA 3OR2A 1B0PA 4K4SA 2BRKA 2X3DA 4M5DA 1OMSA 4M5KA 3K59A 2F40A 4DV7F 4B17A 1PO6A 1DRZA 2VJVA 3F44A 1S9GB 3ISZA 1ZXNA 1ACMB 1OIAA 2L9DA 3EUNA 1N5SA 3MTKA 4FXWA 4IG3A 1DTTB 1CG2A 1WTFA 5D0GA 2R7XA 1FEHA 2HFOA 2MQQA 1XBWA 2LXFA 3ILLA 3PKMA 3OHAA 3P4UB 3IWXA 1Z5CA 3PCOB 3PJXA 5KFXA 3U27A 2FZCB 4FWGA 4LMZA 1B0TA 2MB0B 5KFYA 3AAWB 1B62A 2DB1A 1N33E 1HIYA 3VHQA 4K7QA 1RB0A 4RBUA 3UNYA 4ZLJA 4QW9A 3UCZP 2AGPA 3H5XA 4LF9F 2VFRA 2HK3A 4WCEQ 2C38B 3WIUA 2FHJA 2UU9E 2HRUA 2VC0A 3SSRA 2YNGA 2AYEA 3M7VA 1KFDA 1Y10A 3OT9A 4EO6A 3DLBA 4JP8A 1F3FA 1RT5B 1KD1T 2DEIA 5CD4A 1SKWA 2CKWA 4PRFA 3DLHA 3V2UC 3DKDA 4ZPBA 3NLCA 3BDEA 2PGCA 4P9SA 4RW4B 5A2QQ 4KYZA 1S16A 2ZC4A 1EKSA 3LGHA 4OZNA 1SL1A 1JXVA 3OLAA 3RRHA 1WACA 4X64F 5LSLA 3F0NA 2MGZA 3M6WA 3N4WA 4M5MA 2HZVA 1KVJA 4DSIA 3FMWA 2BE2B 1VQLS 4ELTA 3BM7A 1VHIA 4NA1A 3ITHA 4DR1J 2UXBE 2C3OA 2K3KA 1YWXA 2GZOA 4Y2CA 4X66I 3HJVA 2Y8WA 3U1MA 1UDOA 2VFTA 2XB2D 1JLQB 1PJ5A 2XMUA 3DOMB 4NI2B 5KFEA 2MQPA 2OSRA 2XMJA 1B4SA 1PC5A 2H3EB 2HLUA 3OR1A 3PNIA 4HHUA 4M5JA 3CJ5A 3RW7A 3BSNA 1KQFB 2YH1A 4NXMI 1Q81T 5E3QA 4J7CA 3GFZA 1GMVA 2UV8A 4LF7E 1HLWA 1KEKA 1H38A 4M94A 2NYIA 2QL7B 1R8CA 1UVKA 2JEFA 4RPFA 4DG1B 4C0OC 4QYZJ 2B9EA 4AL6A 5K20B 3EDRB 3QQCD 1I94J 3GIMA 2FJVA 1UZHA 2D3ZA 3QRRA 4JB8B 4ZS6A 2HNZA 2V8DA 3DU5A 1RHQB 4F4ZA 4JI7F 1JWWA 2LEAA 1K47A 3P76A 1V3ZA 1XNQE 3ZNJ1 3TUZC 2WK4A 3MOJB 4P10A 3LP1B 4OYMA 2MXYA 4YHHI 3UN2A 4I3HA 2RJZA 1J5EJ 2XLJA 3BN7A 4G6VB 4LJMA 2W9BB 5IFMA 1PYTA 2MMYA 2HRYA 4PXEA 2OEKA 5G0RB 5A0YA 2J7WA 3ZXWA 1RHMB 3MM6A 3PJ9A 3OL7A 2QGFB 4S0MA 4OLPA 2FVQA 3JQKA 3PY8A 5L9NA 1C0TB 4LFCE 4CT9A 3VAIA 2L08A 4C0HA 2QA4S 4ZOSA 3LAKA 2UXDI 5T7LA 2EVZA 1HNVB 3CJRA 3MM9A 2CJYB 2QC3A 2EC2A 3EE3A 5GADI 4DL7A 3V4IA 3DI6A 4OX9J 3Q8RB 2XWXA 2BA9A 3VZIA 3OL8A 2NN6A 5CD4H 1JLQA 3QSYB 3OTOI 2D3UA 2UXCJ 2NN6E 5A8RB 5J2MB 2B4PA 2BKOA 2GQ2A 2LA4A 2H51B 3HZEA 3NGTA 1DTQA 3TEHB 3KK1B 1N34J 2BBEA 1YJRA 3QWUA 4X4SA 1R6YA 2F9JA 3G9CA 1TKTA 2J9DA 1T03B 2IM1A 3Q0AA 3FRYA 2HQ3A 4JI8J 1UVIA 4ECQA 1XNRI 4CO0A 1BLUA 2UXDF 4OO1F 3CO0P 1CBKA 4RLEA 1UEUA 1GAOA 3BGLA 3TVKA 4CM2A 4XPCA 1J2VA 2CVIA 2HKEA 3BSCA 5K8OA 4YFUA 2RS2A 3MAHA 3FDSA 4PWUA 1U1MA 2AE8A 4JI6E 2OPQA 4CI0B 4X66F 1MWQA 5C42A 2DNHA 4DFJA 2G4BA 1HW9A 2IDEA 4LF9J 1VCTA 1R6MA 1LV5A 4QYRA 1RHYA 4RJVA 1HYSA 3TZZA 4MYUA 2DH9A 2YQ3A 2HIYA 3T9ZA 4M5GA 4K2JA 2F8MA 4RNHA 3E51A 3NGRA 4CLKA 5HK4A 2CQ4A 1NEEA 2O5DA 4BLGA 4U6PA 2E5LI 1G3OA 2H1YA 4GKKF 1XMOF 2R7VA 2QJ3A 4PYDA 5H9FK 2HRTA 1RZMA 1SC4B 2Q43A 1TL1B 1Y5IB 2ZKUA 3MCOA 1XXEA 1D6TA 2JX2A 3MMJA 5EDWA 4KSEB 4K4XA 4DSEA 1NKEA 2HYIB 5EHHA 4DV2I 2HNYA 1YSJA 3DXSX 2Q6BA 5KFGA 3CWVA 1SXLA 1S1UB 3GYNA 1RBOB 4DFMA 2PO4A 2OLWA 1RWPB 5A8KB 2AX1A 4RO0A 2GGPA 5CYQB 2A6MA 4O44A 1WKLA 5ETVA 5FWKA 2HNDB 4HTJA 1MWZA 4LCFA 2Z2YB 4LSLB 4NCGB 4CWBA 4ECRA 4DV3F 4DV6F 2IC3A 1NAQA 2GMHA 3CJ4A 5IC4B 1ZAXA 3ZZRA 2YNFA 4ZK7M 1PVGA 3J80C 4BA2B 3AQOA 2BDPA 1EP4A 3D0HE 3PX4A 3K1JA 1SKRA 2X1FA 3FMBA 4ZVOB 1QSLA 1XN9A 2BANB 2XI2A 4IFVA 2GIFA 1BE4A 4LF4I 3UHMA 1R8PA 2KN4A 3MPYA 3DOKB 1MN9A 2XY5A 3KK2B 4PZVA 5B0AA 1TKTB 4U8VA 1M5VC 4ILLA 3CJ3A 4NA2A 4USJC 1M1GA 1FK9A 4JBCA 2B6AB 3BYRA 1ZPWX 4GKKE 5DGBA 4MKBA 4DUYE 3JYTB 2ZJQQ 4DV5E 2B8QA 3AY0A 4IOCQ 4JI7E 3LP0B 4C98A 2XM3A 2R2RA 1ZTWA 3NEKA 4KTQA 4LF5F 2Z5CB 3SQGB 2BVZA 4NXNI 3OPKA 5HAOA 2W2MP 4NWBA 4UZCA 2IA0A 2W2NP 4DL0C 4B9NA 3P3GA 2HSEB 2D3O1 3V81A 1VC5A 3AA8A 3R5BA 4JV5E 4LSNA 2R42A 3M6UA 5DDQC 4ECYA 2LEBA 4O3QA 3PYEA 1YI2S 1FRXA 4RW6B 4Z37A 2PI4A 1OYPA 3OUYB 1S1WA 1SUQA 2E5LJ 4JI0J 4LF8I 5THWA 4I2PA 3BN4A 4DV3J 6FD1A 4LFAI 2POKA 3P5BP 4HLBA 1GEHA 1FTRA 1VYAA 2VC1A 2YKOA 1N5YA 4LF7J 2WBRA 2FIUA 4X4TA 1PKPA 3BQ2A 2R2SA 4AM3A 4IFDB 3HVTA 2ZH2A 1VBXA 1OSDA 2LDIA 1FFWB 2DH8A 4DS4A 3CCVS 4DZDA 4EBDA 2OEJA 2G0JA 3O6QA 4L6V3 1FNXH 4LCGA 2C37B 1I5OB 4QPXA 4CLYA 2DEJA 2EFGA 2F7VA 3KLEA 5JEAE 1RT7A 4R0JA 3G4SS 4DV7E 3ZFVA 2ZC3A 3GIKA 3NY0A 5J2PB 3KHHA 1HNZJ 1B64A 1H7UA 5KT3A 3G82A 5C0XC 3WX4A 4B9SA 1P1TA 4G1QA 4J9VA 5KAKA 1MU2A 5E3AA 2C3UA 4IOAQ 3BS9A 4R25A 1FXRA 2XYPB 4F0HA 1N5VA 1KONA 2WVBA 3T41A 4QCLA 5DRPA 1RGVA 2ZVIA 3HSZA 5DETA 4LF5J 5F8GA 2HBRB 1UMJA 2G2ZA 3PRBA 2PNZA 4ECUA 3PX0A 4DR2E 1VR6A 1FRIA 4OX9I 1RLDA 4MK9A 3DCAA 1IKXA 1FWLA 3NGKA 2LQ5A 4LUBA 5F8IA 2KH9A 1YITS 2W7PA 1U1KA 2KO1A 2NN6B 4AL5A 1HR0I 1OSCA 2R9LA 1LWEB 2HHPA 2DD8S 1RT3A 4ZVFA 3PHTA 3A13A 4JI0F 4X4PA 3KK2A 2QLJB 3LPYA 2KRBA 4WK3A 3HHLC 2ADBA 5CHCB 5C0XF 4ERDA 2WB4A 5GAGI 4X65E 5HL7Q 2OFGX 3NAHA 3PYGA 1MG7A 5FIIA 2Z0GA 3D2WA 4KPCA 2NN6C 3I0RB 1JIHA 3MMBB 4DSJA 2BW7A 2LFVA 4XPEA 2QRRA 4WZQA 3E3XA 1P42A 2OGUA 1VJWA 1YRTA 4ZP6A 5IOLA 1HBMB 2YQ0A 3SXLA 2ASDA 1HNWI 3ELHA 3TAMB 1SKSA 3FBBA 2IAJB 2IJNA 4F3MA 2FJEB 4MJKA 2DR7A 3KMQA 3RRKA 2BQRA 1SB6A 4QNKA 4I67A 4DR5E 2ZNYA 3L95X 4P71A 3UN3A 3PS3A 3CJQA 5KFIA 4P72A 2OUGA 4KJIA 4IR1A 4JV5F 5D8HB 3UVJB 5FD1A 2IRYA 5L1IA 2RKIA 4O0NA 2ILYA 2ZH1A 2KG1A 3K57A 2U2FA 3B4DA 4A8MP 4LF8F 3NS5A 3OXGA 3OW2R 4JV2A 1WI8A 2DNKA 2QMUB 4U67Q 1HI8A 2HMIA 2XYHB 2UUCI 2YNHB 4FKXA 1HD1A 3W66A 3MZIA 5IWAJ 1WTBA 1IR2A 1GXLA 3AHPA 2Y0SD 2KHDA 2C2DA 3DDKA 4N7TA 4L3NA 2GO3A 1ZBTA 3D4JA 2OHDA 1B99A 2ZE2A 3I6PA 3MECA 3L3CA 2X36A 4U96A 3FGVA 3LALA 4F36A 4B9LA 4F67A 3KNAA 5HJXA 1QAJA 4EMDA 4DR3E 3IP0A 2H54B 2DXFA 4ZPTR 3QJLA 4GMKA 4NLTA 4A8YA 1S99A 1VGYA 2EWHA 2FJAB 1XR6A 4UZBA 3LWMA 4ECSA 2GVZA 5F3TA 5J1PA 5T14A 2MY8A 2VOPA 1YGYA 4FPRA 4Z2XA 4DR1I 3TX0A 4ILRA 1UWBB 2N4CA 4WFZA 1NNDA 4C0BA 4Q43A 4JI1J 4LSZB 5EWFA 2UVWA 3AJ2A 1WKJA 3AOAA 4GC7A 3G96A 2NCKL 3I82A 4TVAB 4LF6E 1IKWB 2M5YA 2PO1A 1XR7A 1DLOA 2IYIA 5J2NB 2VICA 1HHTP 2OH2A 3WU3A 3R27A 3EYZA 2Q2EB 2PMWA 3RYLA 5L1JA 5JEAD 1DQAA 1XHKA 2HWTA 3KHRA 1NPRA 4ENOA 1FFSB 3D5MA 4DR5F 4DFPA 1UVJA 5KT6A 2XZWA 4KH0B 2BJEA 1HNVA 3H25A 1U4BA 4NLVA 3M6VA 1N5YB 1HNWJ 4PWDB 4DV5J 5KFSA 2BUNA 1N5TA 4MFBA 4ZPDA 3J7AM 4AIDA 1TL5A 3U1YA 3KRNA 4RX6A 3OFHA 3R6LB 5KG0A 5D78A 3QYYA 2AWZA 5GAEI 1I6JA 5B0GA 4CT8A 3TI0A 2D9OA 5A0YB 3MXHP 4LSNB 1SQGA 1NPPA 1NHKL 3HULA 1NK5A 1LW2A 1Q5YA 3OLBA 4J9OA 1Q8KA 1JQGA 1WEZA 4LIWA 1HNWF 3CSKA 4ZHRB 2DTJA 1EZZB 2MZQA 1EKRA 2KDOA 2HIQA 2ZBQA 4KC5A 2VG5B 3D6FB 4DR2I 4K4TA 1TMMA 2FGOA 2VU5A 3IG1A 4BA1A 4L74A 4RW9B 1JLGB 3VAFA 5CCLA 4DLEA 2UUWA 1S1XB 2XBPA 4FZVA 4DXLA 1TK8A 2HS0A 4K8RA 2IYGA 2B5JB 2WCXA 4DOZA 2VV5A 2VJUA 4KRWA 3Q8UA 5JEAB 1OQ3A 2E29A 2CNLB 4FN5A 4ZLLA 2HWHA 3AJDA 3OJSA 3VF0B 4ED2A 1FE0A 1WJ9A 3P3EA 3DLEB 4HY1A 3LNUA 3J80U 4FBUA 2BANA 2G9OA 3H1CA 3OTOJ 5JVHQ 1TKZA 2AYMA 3HHNB 1CC8A 4F02A 1S9FA 2VL1A 4P7TA 1S4FA 4M1KA 2V0NA 2W2PP 3FKBA 4DN9A 3TARA 5J2QA 4ZVTB 2FVRA 5BR8I 4DV5F 3TP2A 3RU0A 3O8WA 1X4GA 5DNLA 2CQCA 3PG9A 1Z1ZA 3C15A 5IT9Y 4LBIA 5JJBA 2BR2A 2V2KA 3IFEA 3DMJA 4X4RA 2XMVA 4JI5F 4DR6I 4WUDA 4B3ME 1O6XA 2KB2A 4Q8FA 2MY7A 4AT1B 1E6VB 5H9EK 3DLLQ 3TQ1A 1RREA 3JTOA 1LXNA 4N3OA 4F4XA 4QIVA 2CA9A 3KLFA 4DR3J 4DV1I 3BJYA 3QLHB 2HK2A 5LMNJ 4B3MJ 1OY8A 2XZTB 2CPFA 1M5SA 1Q4RA 3Q8VA 4RUAA 2CG9A 1WI6A 4MT1A 2WHOA 3N01A 1U49A 2C28A 2B43A 5F8JA 2FVCA 4YUDA 4IKAA 2IDLA 2ABYA 3HSDA 3GQCA 4PG7A 1FX2A 5BXIA 1W7WA 2JEJA 5DG9A 1K73T 2KFZA 4OX9E 3Q1QA 3Q83A 2L9NA 4WPAA 2G2YA 2ACMA 2ZFHA 4NLSA 3K7RA 3TZYA 4IFDA 2GS8A 1ULRA 5KG5A 2DNYA 4B9TA 4JI3I 2LXIA 5D4NA 3G8QA 1H2UX 3V6DA 3TA0A 4NX9A 2VBYA 4NLUA 2Y8YA 1ZM4A 4LBPA 2V4JA 2GJ2A 2QZ8A 3R5AA 2KT3A 3CMQA 4WKYA 5T41A 3UDCA 5LOQA 1RT4B 1KQSR 1T7PA 1YHCA 3AD9C 2MQNA 4RW7B 2FHJD 2O1PA 1WF2A 3MR7A 5HSPA 3ET6A 3RB4A 2DO4A 2GO8A 4DV7I 2CXEA 3ISNC 1MMDA 4BCAA 4GO7X 4M5IA 4YB7A 4LCHA 3LP0A 3U1NA 2E9ZA 1NK7A 1T03A 3BH6B 4NI2A 2RE1A 1UW4A 3H4DA 3RR7A 1IM6A 3M7NG 2MKYA 3ISND 4WIQA 1C1CB 1WC5A 2K1RB 6AT1B 1SH0A 3GWCA 1X9WA 2DR6A 1RAJA 2GQ0A 4J90A 4CO5A 1YH8A 2FC9A 2BM0A 3P3DA 2GMJA 1RTHA 2B9WA 2WSEC 3KG0A 2RQKA 4TN2A 5B0FA 4CTAA 5LMNF 4DR4I 2AZ1A 3PEHA 2F8EX 4ER8A 2Z5BA 3R8YA 1V6HA 4FNIA 5DM7Q 4FNHA 3W60A 1L5UA 4QNJA 2BJDA 3CJ0A 3T5HA 3BSAA 3M7ND 4GQUA 3M30B 1SV5A 2DH7A 4HTIA 1C1CA 1A0OB 4QR0A 1CSJA 4DUYF 4R0EA 4DR4J 3FZBA 5DZ7A 3SI8A 4ES3A 3HKWA 1S0VA 2MZJA 4KH1B 3T3FA 4PABA 4TLQA 4OI3A 4O3NA 1SJ1A 3T1AA 3DGPB 1IBLF 1U25A 1CS4B 5ETOA 1U2CA 1F5CA 2AJ0A 2W9CA 1Z5AA 3R5DA 1KN6A 2UUBE 1UVNA 3D1HA 3K58A 1Y7PA 2K3IA 2RD5C 4KHPI 2H4WB 3ONQA 2X7IA 1UJ4A 4Q0BA 3PFOA 5C2CA 1RU2A 1S1WB 1CQMA 2HEKA 1S7HA 2I5JA 3FBCA 4G1IA 3NGDA 3MUMP 4KAIA 2BZ2A 3PXGa 1RWKB 1VBYA 4FW9A 2PT0A 2N7YA 3R7SB 1NH8A 2BJ7A 4WP9A 4WXOA 2OEMA 1DHMA 3TNVA 2GA7A 2XMWA 5EGYA 2FY1A 4PUOA 2EBEA 1HNXE 5F41A 2UZAA 3AOBA 1XR5A 2I6WA 2W9AA 1KSPA 1S77D 2EKNA 4DF8A 2D74B 2VDHA 3FBFA 5J2QB 2IY5B 3J7A1 1WG1A 4HACA 3PR5B 2OPQB 2X1GA 3EPIA 3GR0A 4NCAA 1S49A 4ZP8A 5HVHA 1PYSB 4CLZA 1ZPVA 1J5EF 2GCFA 1FRLA 1B7YB 1F2HA 2Z2ZA 3MOZA 4YP3A 2XGQA 4CNZA 2R8HA 4JI7I 3EVOA 4PG5A 5H1SV 3GCWP 4KGKA 4PPDA 3Q23A 1L3VA 1BWEA 4KHPE 2LMIA 1UEKA 1SCJB 2XY6A 1RHJB 2JHEA 3PTWA 2DPIA 1KBRA 2CQGA 4JI0E 3POTB 3ZTOA 1Z0CA 1TKXA 1ZM2A 4P7VA 5LM7E 2NXUA 1UKUA 1U24A 5KFUA 2ZM6F 4B3SE 3RW6A 4EYIB 2HG4A 1S1TA 3IAS9 3GZ7A 1U0HB 2Y1RI 2BA0D 1Q1KA 3QAUA 1ZZFA 1VQMS 3PO5A 4ZPCA 2H48B 5IT9U 5KFVA 1R3NA 1YJVA 4ZITA 4I6WA 3HXMA 1TL3B 3NZKA 2J9CA 1VQSA 1QSSA 5GADU 2AEJA 4PG8A 4MIWA 4Y3CA 3KLVA 4ZP9A 1RR9A 1NU4A 2X3GA 1R27B 3CCSS 3AOCA 4DV2E 5ETKA 4OI1A 4DUYI 4K0KI 1FDNA 1VMBA 3W9IA 2AJFE 1U8SA 4LRFA 3N6NA 2HFVA 1I3OB 2LVWA 2NSBA 2Z57B 1O51A 5K14B 1R6LA 2EPIA 4I56A 3DXBA 3MI7X 2DNNA 3KG1A 3SSSA 2J0SD 2BA0G 1IBLI 4EO8A 4DR2J 1FKPA 2B51A 2HGNA 4DR6E 5KFJA 4RUBA 3M6XA 3MPDA 4J37A 3W3SA 4IQMA 3J7Z5 1QUPA 3ZZZA 2QSWA 3ZZYA 3C16A 3W2VB 4NLWA 2MKSA 2RS8A 3P45B 5DRQA 3JTPA 2MKHA 2B7BB 4G1PA 1DJ0A 4IFYB 1GX6A 4MYTA 1JK9B 4KB7A 4PXDA 3SQGA 4XK8C 2GVZB 1S72S 1KFSA 2V50A 3IA0A 1LEOA 2GJIA 3IC1A 2FPHX 4N5SA 4C8YA 4FXDA 1OPZA 5AJ3J 3BKFA 5KFDA 5IT4A 3I32A 3DOMA 4FW7A 2VZ9A 2JEIA 3DDNA 2K1RA 4DV6E 1XQIA 3CJ8A 3H0PA 2FLPA 4ID5B 4RWXA 1OYSA 4L75A 1RT2A 4UQTA 2HQGA 5E3RA 5B08A 1M90T 2EBGA 1J5EI 1VJQA 3KJFB 1JJ2R 1HNWE 1OY9A 2BV3A 1EB0A 1FDAA 3I0SA 4A4JA 5HLFB 1RAAB 1TU0B 3GYXB 4TY8B 3T6BA 1F9EB 4OYIA 2XY7A 3PW4A 2HZAA 1U09A 4GC6A 4TQRA 4JI1I 3AB2B 1NSQA 3TA1A 3NMAA 3US5A 2CQIA 1Z2ZA 2R7WA 4B3MI 2JLEA 2KJVA 3CIZA 5KG1A 1S5ZA 4PEOA 3DRPA 4BS2A 2XCAA 4ICLA 5LXRA 3FZ2A 2Z2LA 2R3VA 5GAHU 3CC2S 2PA3A 3BKTA 1KNZA 1NHHA 4PUOB 1MMLA 2W9BA 3JQJA 2CGEA 1FO1A 3J7AG 4KIAA 3J80Q 1FNOA 3M85G 1UDSA 4OKGA 1RXOB 2PNMA 1EX8A 3K17A 2PFDA 1IBKE 4K50A 2ZH7A 1KTVA 2RDIA 5K8NA 4M5HA 3NNCA 3SCIE 2DNQA 3KTQA 2LLZA 2DGOA 1H72C 2QIFA 2IBOA 1WD6A 2WONA 5LXYA 3EPGA 3VALA 4JG4A 4YY3I 1TMJA 3FSYA 3TANA 1CVJA 3KJNB 4PQAA 3A8IA 4F0KA 4WZMA 2VG7A 3I31A 1HR0J 4C7QA 3MPUB 1FD8A 5BYSA 8ATCB 1UETA 3IN5A 4UW2A 3ENVA 4TU7A 2ASJA 3OTEA 5ETSA 2R7UA 1HQEA 1LWXA 4DX8H 2GO9A 3U02A 5KG7A 4OJHA 4ZIVA 4ZVIA 2KM8B 3QFHA 3EICA 1USUA 2KI2A 2MTLA 2W01A 4NRTA 1NUEA 1U7LA 2Y3YA 1WF0A 3NWGA 4O4GA 1KHWA 2HHSA 2C42A 2FLNA 1ICEB 1REVB 1CULA 1C0UB 4OMFG 4B02A 4DU8A 3PO4A 1SJ3P 2F1DA 3POTA 1UFLA 2BMBA 5ETNA 1D9DA 2Z5BB 3CUNA 1OY6A 2O67A 1C1BB 1RTJB 5AXLA 4DU7A 5EWEA 1XIQA 2YWWA 2ZJRQ 4DFKA 2EK6A 4CLFA 4U3DA 1BWVA 4TY9A 3R9LA 3ZZTA 5A8WB 1DAXA 5F0UA 1HNZF 2PNLA 2Z2MA 1K8AT 2ZNZA 1HNIA 1FT8A 2CUYA 3M8SA 3I87A 4K4WA 5FJ4A 2BRLA 2FYXA 2DHAA 2PDAA 4NMLA 4Z7CA 4LFAJ 4O3SA 1N34I 3HHKA 4HR2A 4IH7A 3WDOA 2BE9B 4P2XA 3JB9k 3TAPA 4A8FA 4ZHRA 1YJNS 3DFEA 2J8AA 2V8VA 3MM9B 1FVQA 1R7IA 1X5OA 2BACA 3L09A 2RRAA 3JAMU 3RAXA 2ZUGA 2IJFA 4DR1E 4IDKB 5B0EA 3WU4A 1S1UA 3AODA 4OO1C 3BF4A 4EWTA 2UUBI 3QFWA 1OYEA 2EI5A 4I68A 2M52A 2CIMA 1RT1B 2GJFA 4USVA 3ZZ0A 3VAGA 1MX0A 4IFDD 8AT1B 4KHMA 3DOLA 4OX9F 4YDDB 2E9RX 4WFYA 2BXJA 2V63A 2GV1A 3EM1A 4NEYA 1RAFB 2J9EA 3QGHA 4R5PB 5IQ6A 2XQCA 3KLGA 4F0MA 3HT3A 4ELVA 4A46A 1RTZA 2MLZA 1JB0C 1Z2LA 3BGRA 3VGVA 1QVFR 2G13A 4BBYA 3IR6B 4TQSA 2MKJA 1F9HA 4JI4F 4OZEA 1ITPA 2A2DA 3ENAA 3GSDA 4P75A 4LRAA 4RNFA 3V6KA 4LF7I 1FK9B 2QLXA 2YKMB 2KRRA 3X1LB 3AJ1A 4EUVA 2JSXA 2NSCA 2NUHA 1UWBA 2NUUG 3L4BC 1YTYA 3UDLA 2CQBA 3J80Y 2BKPA 3PW7A 2R7QA 1UDQA 5ETMA 2IFXA 4OV1A 4ELUA 3M8YA 4TKTA 5BR8J 2XMKA 4UUXA 4CDIA 4Q45A 2O01C 2EFQA 1RTHB 2PO0B 1TZ0A 4ZP7A 2RF2A 4CIOA 1RTDA 1TUWA 5ETPA 1REVA 1X5SA 5C7PA 5IT0A 1UW9A 4ED3A 4R1FA 4LF9I 1RTDB 3KXDA 2ROGA 3ZKDA 5KFTA 3SCJE 1R0AA 2FD2A 1FXLA 4QR2A 4MK7A 3C66A 2XMMA 1KLMB 2DJWA 2ALYB 5KFRA 1TV6B 3PFEA 3JSMA 3TVZA 1USVA 2DGSA 2OFHX 3V4IB 4QWCA 4X65J 2NQPA 3H98A 4UUWA 4MKAA 3KUEA 1Q8LA 3UCGA 4B08A 2W4PA 2XHCA 1IR0A 2HNYB 3M8PA 4RW9A 4BHQA 1U1LA 3QAEA 2EEYA 3Q2TC 2QO3A 3HHLD 3J81C 3ILOA 4GVLA 1CJTA 1LWFB 1FI4A 1FWKA 1N32J 3JSYA 2MDAA 4LRCA 3HVRA 4ZVQB 3ILJA 3DN9A 1F60B 3M1VA 3R6GB 5KG4A 5LSOA 4DV6J 1D8YA 5FLXQ 4NLGA 1N6QB 5FDLB 1S79A 4USTA 2B56A 3MGJA 5A8KA 4ED4A 4RNMA 3IRXB 2NXNA 1J5OB 1RYSA 2HAIA 3FC9A 2I8EA 2OD4A 2V69A 4MIBA 3CJKA 1NCLA 5CAAA 3CCTA 4LF1A 3THPA 4NLYA 1CJKA 3EJMA 3KWMA 3D6MB 4NXMF 2L48A 1N33F 5AT1B 1KKHA 4I0WA 2WTFA 5D15A 1XWLA 2P2CB 1TR0A 4ANEA 4DL6A 1B7FA 4X65I 4FF1A 2J8SA 1VQYA 5C5JA 2OPRA 2VQEI 2PMZD 5I4MA 2UXBF 4H4OA 4KFBA 2MLYA 2JOQA 1S7IA 1LWEA 1GMWD 5DQGA 4URGA 1V5IB 3J7YU 1K0VA 5F8MA 4RW8B 1HWUA 2P8IA 4U7CA 1WORA 4CCHA 2VF3A 1T8EA 1IKXB 1RAEB 2O1UA 3K0JA 2O1VA 4EZ9A 4LBHA 4X4UA 3K8VA 2E5LE 2VUGA 2R7SA 1UAWA 3MHYA 4FBTA 3PW0A 2Z30B 3K5LA 2XS7A 2JFKA 1Q7YT 2JH3A 1VBKA 3TW0A 2RVJA 3MEEA 2H9ZA 5LJ5Y 1VQPS 3H2LA 4DDFA 1U02A 2AJQA 2EC0A 5GMEA 3H59A 3MEEB 4A8XA 1FERA 3C6UA 3BPSP 5CA5A 4J9QA 3HKZD 4AQYF 1MN7A 4O3RA 4USUA 4DHVA 2HHXA 1WKKA 3CDAA 3IAM9 1HBNB 1RTIB 3FEXB 1T9VA 2DVIA 1H7XA 7FD1A 4DUZI 2V68A 4W98A 4LF6J 1HPZA 2FLLA 3W62A 2HVZA 2DIVA 5GVQA 4F4KA 2KZZA 2VASA 3MM6B 2C37A 1U2FA 1URRA 2HFZA 2LCWA 3O2IA 2ROEA 2YBVA 2YPZA 4FP9A 1HBUA 2I2YA 4DEZA 4USIA 3Q24A 4UOHA 4XDDA 2CPEA 1YRUA 4GRSA 3U7JA 1L3SA 2PSZA 2W4DA 1EJ7L 2VPYB 1TFWA 3UNGC 4GKJJ 3HKMA 1QDUB 2J7UA 3ETMA 5M2RA 5T7LB 2VPZB 2O66A 3LANA 4LF4F 1H73A 1C0TA 2W8LA 3CDBA 4USWA 5HROB 3TQEA 1N36F 3B4MA 3RG6A 5RUBA 4N8NA 4HHJA 2IM2A 2Q3PA 3TZXA 3VVUA 4DV4I 4IZJA 4IDKA 3EZ5A 1GXUA 2ZBCA 3SZ2A 1CQNA 5DM6Q 2AYBA 1OPIA 3MTJA 1HWIA 1MW7A 3H5SA 4PWWA 3CCQS 4IRKA 4DV5I 2RQCA 3MDFA 1EETB 1Y4ZB 2KVQE 2V9KA 3E01B 4HH0A 4ZCKA 5B09A 2YKNA 5HMZA 1SVDA 4CLTA 1RWUA 3OR1B 2C39B 1RCXB 2OI2A 4OHVA 1NDKA 2OO4A 1RKJA 3PHEA 2F4VE 1WHWA 3M2VB 4ALZA 2C2ZB 1X7VA 2BKNA 3M9MB 4Q8EA 2GIQA 2QV6A 2EFOA 3S1TA 2WSFC 2XMAA 1HW8A 3ITHB 4DCJB 2JNJA 1TV6A 4JUZA 3JSMB 1IBCB 4UY8T 4A8WA 2ZWPA 3DRXA 2OTJS 4JYAF 5JVGQ 1T02A 1YJTA 2FZGB 4F7VA 4U95A 5JMNA 3KLHA 5ELWA 4CRJA 2CQHA 2HURA 1IBKF 1XNRE 4L3KA 4X66E 3GP9A 2UXBI 1S97A 2W1BA 1TL7A 2BJ3A 2LQBA 4I6AA 4OZ1A 4KV8A 1XK8A 4R8UA 3OFFA 2UVRA 2VDIA 4X62J 1TL7B 2GAHC 2ZH3A 1U1NA 3O5TB 1T05B 5C24B 2IM3A 4AYBD 4BC9A 4P7AA 1I94E 2OMLA 3QPIA 2AGOA 1S59A 4K0KE 3QGGA 4DV6I 3SV4A 2BABA 3QBCA 3SBMA 4IQXA 3KJVA 4X84A 3DRYA 2LU1A 2F8HA 1BHNA 2DNZA 2YKPA 4U8YA 1VC6A 4K0KJ 4DX6A 1H7WA 2HFSA 4OX7A 4IRCA 4JI3J 4RUHA 4ZDNA 2KKHA 1SPBP 2D1CA 2IRXA 2RKIB 3MEDA 1FRKA 1R31A 1WG4A 3C8YA 2I0XA 4C3MA 5F3ZA 5KFPA 2XC9A 4DL3A 1FKPB 2ATLA 2HVIA 1XNQI 4K59A 1FF2A 1RT5A 1NB2A 2EW9A 3GMEA 1EETA 4KBIA 3E2EA 2OTLS 1IJEB 4LT6A 5FDLA 5IWAI 1WHYA 2CYYA 5KFNA 2NREA 4E0DA 4ETZA 2CNOB 2GIRA 4ZCLA 5C0XB 5LMNI 1KOHA 2MYFA 4DJBA 3CD5A 5U47A 1EIYB 3CD0A 4MMOA 5C25A 4DR4F 3MEDB 1Y60A 4YHHJ 2V2ZA 3J7ZT 2FB0A 1FDBA 3DRRA 5DLFA 1V9OA 3EX7B 3CC7S 1HWJA 4HDGA 4X64I 2YWKA 3HPOA 1N0UA 4RKUC 1R0CB 2AJ1A 1F9FA 1K1SA 1RCOB 1RWXB 2XSJA 4ZPAA 1U6ZA 3L7PA 4DPXA 3V4MA 2M4MA 3HCXA 3I0SB 3MEGB 2ZUAA 3N9UC 1RBLA 4A8SA 4F26A 1S1TB 3W63A 4WJBA 3BBFA 3TEGA 2CNNB 1OYDA 3N5BA 1WNEA 1RWNB 2MPUA 2J6UA 1NZ0A 2OAUA 1CLFA 1VC0A 3EGVA 4YY3E 4P73A 2I38A 4BC7A 3T1YJ 4NE9C 2V4QA 3FSIA 2UU9F 2KVIA 1MROB 2PO0A 4LF9E 2JEAB 5AE2A 4DF4A 3P6YC 4B3RI 4HYMA 1FD2A 3R1LA 4I7FB 4FW6A 2IESA 3CCJS 2DCUB 2ZHAA 4YS2A 1YK9A 1IBKI 3MM7A 3DM2A 3IM8A 3OXFA 5ETQA 1YJWS 3ENWA 1S6QA 2GX8A 1UP1A 1ZA2B 1S0OA 2FC8A 4DR4E 4OX6A 2APOA 3MR2A 1UCNA 3M9OB 3PW2A 4J9KA 3NCRA 5G0RA 4YHHF 2V5HG 3I4HX 2CDRB 3RZAA 2F1FA 2ZBKB 3TYTA 2ZOFA 1PCAA 2QL5B 1UWAA 1BY9A 3KG4A 1CJTB 1LWFA 4NZ0A 4WYLA 1LFWA 1OJ4A 1T9XA 2I5JB 4ZJOA 3KKFA 4JI1E 1CJKB 4WYWA 3MAQA 3QO9B 3RBXA 3T1HF 2RH3A 3D3BJ 1S6PB 2DT9A 3C19A 2OPSA 3BGUA 3HHLB 4FPIA 4IYQA 2D69A 4CH7A 1P9YA 4GO5X 5DJBA 1QM9A 4DN0A 3BO3A 2Q79A 2WW8A 2YX1A 2Y1JA 1W26A 1TL4A 5HATA 3H7HB 9RUBA 4IG3B 3Q8QB 3T1YF 3BB5A 1I94F 1NSAA 1R0AB 3DYAB 2JFDA 1J27A 1O0PA 2GVDA 2E1RA 4KKOB 5KT7A 1RABB 1B0VA 3VTIA 1NH7A 1U1PA 4QYZK 3J81U 2HHVA 2NN6D 4P2SA 5KG3A 1WELA 1SV5B 3OTBA 4OI4A 4F25A 3IO1A 1GT8A 5KOWA 1N4LA 4LR9A 4FWDA 4JI5E 2KXFA 1NJZA 1KWMA 1QUVA 4DR7E 2EXUA 3A8JA 4HHHA 3K5PA 4QR1A 5A8WA 2B7CB 2BA1D 2CQ3A 2V8PA 2WBMA 1U0SA 3KLHB 2VBXA 2HBYB 1FJGJ 1Y4SA 2WNRA 5EN1A 1MROA 2ZVSA 2JVOA 3BR9A 2DHGA 3FNNA 1S1VB 3HD1A 3IBFB 4IH6A 5F0WA 3AD8C 4DQRA 2PO2A 2DHHA 3NWRA 2QMWA 4WXWA 4WTOB 4B3SJ 4OYWA 5B0BA 1BD6A 4AXIA 2JEGA 1NKBA 2GQCA 2UUCF 3QRPA 3IWLA 1DZ5A 4OJGA 3MF5A 3TAQA 4FVCA 4IS9A 4WUCA 2H5IB 2F4VI 3FEYB 3GG1A 3NNAA 1ZZNA 4B3RF 4NMXA 1NHJA 5C0XD 2AJ4A 1XMOI 1BUXA 5F8HA 1LW2B 3W64A 1FRHA 5KT5A 3C16B 4O4RA 1PKUA 1RT1A 3L7UA 4D3GA 4M8LA 1U45A 2H5EA 2OPSB 2UUCJ 4OO1E 5JUMA 3UD3P 2DIUA 5A6PA 4ED1A 1NXIA 2M88A 4M5LA 2QYCA 3BPDA 1BKNA 2AW0A 2W2QP 2W4CA 2ASLA 3HJFA 1JKHB 4EU0A 1RWMB 5L8RC 1ZYQA 4LFBF 2WVEA 5BR8E 1NJXA 3LP2A 1TAQA 4DV4E 3ZNUA 4ILMA 4AQYE 5DRKA 4OHYA 4DV3I 2J6SA 2E44A 1PJ7A 3EXYA 2JRSA 4WFXA 2I9SA 2C3YA 3NCQA 3QGIA 5HBMA 3MCSA 3S6EA 3ILIA 4XDCA 4ZN3A 3MUTP 3BQ0A 4J9RA 4W90B 3KMSA 3QT5A 4EK2A 4MU0A 5D0RA 2PO1B 1BQMA 1D9AA 4JI1F 1JLAA 2RU3A 1FVSA 3LQVA 2XI3A 4C8LA 2ZZNA 4LFBJ 1PAUB 4ZPWR 5AE1A 4MDTA 1X8DA 1XMQI 4ZVPB 5K8PA 2V4RA 3BBBA 3SV3A 3T5LA 2E1CA 1RLCL 3HLUA 4RR5A 4ZJQA 4RZRA 5EX3A 3CC4S 5L38A 5HLFA 1X60A 2B4OA 3ULHA 2JEBB 4MH8A 4UOCA 2DXEA 4USHA 3UE2A 1M1HA 2HHTA 2HS4A 2YWEA 4DV0F 1YJ9S 1UFWA 1CULB 4R8UB 4C4WA 1T95A 4ID5A 1RU1A 4JOUA 4FDFA 1HNIB 1WDDA 2PO2B 3CXCR 4N41A 1N32E 4OJ3A 4USMA 4DV1E 2PE8A 2AEMA 4LVOP 1UA1A 3SEOA 4A47A 1BQNA 2WNRB 4K5RA 3WHIA 4JV1A 2JEBA 4NLXA 3KHLA 4H4KC 4NEZA 1NDPA 5K36C 4OZ5A 5K36A 1GTEA 1NZAA 3VWSA 4NBQA 4EZ6A 2BM1A 4UQGA 2DNLA 1JLGA 1Y5NB 4ECTA 2J6TA 4AIMA 4OZ0A 3UVJA 2R7TA 2DK2A 2KHCA 2YY3A 2DRBA 1FRJA 2VKRA 2E5IA 2J9DE 1V3SA 2VG5A 5C25B 4PG6A 4MU1A 2W7AA 2YNGB 4DUYJ 4JI2F 2J65A 3I4PA 2CPXA 1Q82T 1N54B 3M6AA 4B3TI 3M1VB 1M5KC 5CYQA 2NPIA 1OQ6A 4DBQA 4PAAA 3T1YE 3TUPA 3M2RB 5AXMA 5IWAE 3ETOA 1NK4A 1X9SA 4DPYA 2ZOGA 3E8OA 2M2BA 3TVYA 5DZ6A 3L9ZA 1UJ5A 4JI5I 1VQ4S 1AROP 2ZJPQ 2UXBJ 1YLXA 4RWWA 2GFFA 2AIRB 1RP5A 3GJSB 4DUZJ 2C2RA 1AUSL 4QIWD 3WBZA 1KC8T 3AB4B 1JJHA 3MMAB 2NZ4A 5K9FA 2RILA 4NOHA 4X64E 3BQ1A 4EYHB 1Y4UA 3BDPA 1KS2A 2FHMA 2OP5A 1S9GA 5JEAC 4LFBI 2HHQA 4OZJA 3C15B 4M5DB 2NXJA 5M2UA 1Q53A 4ECWA 1HR0F 2C3PA 2SXLA 2MSTA 1D8ZA 3HX9A 1TUVA 3M30A 1E6YB 2ZH9A 2FGCA 2W25A 4ZN1A 4AQYJ 1HQ2A 4E8UA 4BWJA 3GIJA 2HGMA 4UOGA 3VAKA 4X2BA 4FW5A 3GYGA 2NPFA 4J9NA 4NCBA 2YX7A 5IM0A 2IJRA 1YZ7A 3NGSA 3N79A 3NS7B 1IKYB 3HHDA 3LTOA 4JI2J 5DS7A 2ILZA 4OLOA 3BEGB 1UDNA 1X5TA 1HL6A 2HVEA 1FJGI 3D7SB 3HVWA 2I1RA 1IN0A 1CJUB 2D3OR 1TAUA 1S9EA 1KVIA 4MTPA 1PIEA 3MM8B 1FXDA 4JI2E 4GKJI 2IM0A 2VG6B 4JI4I 3VGSA 2QL9B 1HI1A 1SQEA 2IPOB 1QVGR 2CPDA 2FDNA 3R2DJ 1YZ6A 3RUBL 3S7RA 1VQ8S 2CPZA 2UUAF 1UZDA 3IBCB 5AXKA 4E2FB 1K1QA 2CJBA 2ZHBA 1JKHA 1U26A 4O23A 4QIEA 1HA1A 3ZTRA 4ES1A 1T3NA 4IZKA 1SBRA 3HHLA 3CJKB 4JI8E 1U6FA 3C6TA 4NXNE 3M2RA 3EGNA 1JLEA 1NLKL 3NP5A 1EI1A 3MMCA 3D0GE 1N6QA 4DL4A 2CPIA 1RA7A 1WC6A 3PRDA 3UFCX 4MQYA 4XTJA 4P52A 3W8PA 5E41A 2NLWA 4WE1B 2KFNA 3BREA 2VIHA 2WVCA 4J9SA 1MMNA 3O44A 1PAEX 1U1RA 1AUDA 4FKYA 5CZVA 2RRNA 3G6ES 3DD6A 3KLIA 4ED0A 2CQ2A 1S10A 1KLNA 2V2QA 2YNIB 1NO8A 1RHUB 1KP6A 2KG0A 1FJGF 2B6AA 5DGAA 2X51A 4YY3J 2DGWA 3ICLA 4NA3A 4TY8A 4MKYA 2M70A 1XMBA 4HH1A 4KGZB 1YX2A 5HQMA 5M2PA 5IM0B 4J9PA 4DV7J 4ISAA 4WK1A 3BO2A 4AL7A 1S0MA 3I56S 4FWHA 2QFIA 3IM9A 1RT2B 3H4BA 3P3CA 2CG4A 1CPZA 1VLYA 3LA0A 3PX6A 2JEAA 1PBAA 4C8NA 1TTHB 1T05A 4N77A 2QT7A 4FF4A 4LOMA 2WP8B 1EQ0A 4C9DA 1VIXA 2E5HA 1NMEB 2E7XA 3A8EA 3FFIB 1XMQE 1QAIA 1L3UA 1D0EA 4RL1A 4I64A 2RSQA 4NLOA 2UXCF 2NN6F 3CCES 1FKOB 3NNHA 2IERA 5CXTA 1X4BA 2CPHA 1VQ7S 1XNRF 3MCNA 3Q2SC 1FEEA 1DQ8A 1IM4A 4HDHA 2EFVA 4U7UK 2B4VA 2GGPB 1ZAWA 2YTCA 3FQKA 4C3KA 3BBCA 4CLLA 4ZLNA 2KYXA 2VQFI 1X4AA 2PMHA 4RUCA 4RU2A 5DQHA 1R89A 2E7VA 5ETLA 2DR9A 5IT9Q 4Y2IA 4Q0BB 3QO9A 3CCZA 1HNXF 3QMQA 1YJUA 3PM9A 4C97A 3J7YI 2IRUA 1ZM3A 2DKOB 2E66A 4R5PA 1UVMA 3MWBA 3AXKA 2AYGA 4MIAA 1JNRB 3TZWA 1J5OA 5L9XA 3DLGB 3I5CA 4YB6A 2ZM6I 4FVMA 1TFYA 5GAGU 3CJTA 3RAMA 3NL0A 1JLCA 1Q7LB 2JC1A 3UPFA 1JLFB 4QIGA 1NSKL 3VCDA 4JI7J 4PPZA 1UPPA 1A7GE 1FDDA 1SKUB 4KT0C 2J0XA 1XMOJ 1A6FA 2UXCE 3R2CJ 1HKAA 3I5BA 3R5JB 1HMVB 2P6TA 3M32B 1HARA 3H90A 4WU2A 1CS4A 4CYUB 4KY3A 3CD6S 4UTGA 4Y00A 2QEXS 3J81Q 2O1WA 3GPAA 1RT3B 1H3DA 1AZSA 4L73A 4TLRA 1U0HA 4U9RA 2N3OA 4YR3A 4YOEA 1FX4A 2EG1A 4FYVB 1NK8A 3JAMQ 4NXMJ 1X4DA 2RDDA 2QMXA 2F4VJ 1W25A 2Z58B 2HHHF 3TA2A 1NK6A 2DGQA 1L3KA 2WP8A 4Z7YA 3TO8A 2RF2B 3DDIA 5A2QY 2HW3A 3UDEA 3GMGA 2XZDB 3C6UB 4NLPA 4PXBA 1S0NA 4OO1B 3FRZA 4C8ZA 1WSVA 4WFBQ 4OV6A 2R7OA 2DYAA 3A4TA 1T9YA 3B78A 2O3ZA 3DHWC 1FESA 1E6YA 4QIFA 1RT6B 3IR5B 2B5JA 2UUBJ 2KT5A 1OYRA 3DC2A 2AHOB 3G8SA 3MPVA 1U48A 2DNGA 4WP8A 3ZC4A 3M8RA 1SQFA 3IGNA 3C46A 3CCRS 5C0XA 2P9GA 1ZS6A 2HNDA 3D6TB 5LMUI 3THTA 2XWYA 3FCHA 4KGVB 1E3HA 2X1AA 3ET6B 1H7SA 3A3OB 1LK5A 5CZXA 2GHPA 3H8YA 4ED6A 3DOLB 4IR9A 5GAHI 4NYOA 1XMQJ 1U8WA 1P8GA 4JYAI 3KK3A 3ZTPA 3C6TB 4WU3A 1F6TA 3BYPA 2OSQA 2Z4PA 4DR6J 4N76A 3K8WA 4EI2A 2AKWB 3M8QA 3TJ8A 4Y2KA 2O3DA 3N6LA 3W9HA 3SYZA 1IKVB 3WC0A 3HDSA 4I2QA 2HHHJ 2R4FA 3A1YG 3F56A 4IG0B 4X62E 2QN6B 5DRRA 1IJFB 3FVYA 2IVMA 2EFPA 3OFGA 4A8OA 1GMUA 4DV2J 3GLJA 1ZH5A 1AW0A 2C2OB 2DHSA 3BZQA 3WIVA 1VDHA 5C24A 4NXNJ 4O3PA 5E3PA 1DLOB 1D3WA 3SSQA 3JYTA 5GAEU 1D1UA 3QRQA 2V8HA 3LH2S 3EXCX 4RBVA 5A2QC 1IXKA 3CE8A 4Y6IA 3OTCA 4XO0A 3G6YA 3RAQA 4HKQA 3OJUA 3QT8A 4I7FA 3G8TA 5LMUE 1VLOA 2K7JA 3CEDA 4WIIA 2MKIA 3JQMA 3CWJA 1LW0A 4QJVA 3NG8A 1NRKA 3CCUS 2DNRA 4XAKA 2RUSA 4YY3F 4F4YA 1XC9A 3DMJB 1SJ4P 1SIWB 2LKZA 2QX0A 1M5PC 1O5JA 3IBWA 4QQBA 3HSJA 3UQSA 4K4VA 3NRBA 2B3TB 5IWAF 1XTZA 5I42B 2MJNA 5I3UA 4RW4A 2KZMA 4WUBA 1AYEA 5DQIA 1JX4A 2Y1IA 2HHHI 2KM8C 4DR5J 3OSNA 3MR3A 5LJ3Y 1W2BR 1JJ4A 5CABA 4J3DA 2XLKA 1I51B 3PYDA 2OJ3A 3DLKB 5K36D 1KOOA 4G1QB 3TWZA 3VGUA 3BO4A 3V6HA 3VAMA 2HMIB 5ETRA 4QWBA 3D68A 2PEBA 4ZVGA 2VG7B 2RNEA 1RHKB 2ZBPA 1P1LA 5HQLA 2MLXA 3KLEB 2QG9B 3BKUA 2LDYA 1LXJA 3SIPB 1HD0A 2LYVA 3GV7B 3V6DB 4IO1A 2CJKA 3CDEA 5KT4A 1S76D 2AU0A 4KQVA 2K2PA 1YDLA 1VRUB 2VD3A 3A8KA 3DLGA 2ZBRA 3D0IE 4FS1A 3D67A 2GO4A 2MQOA 1SC1B 1SIZA 2DY1A 1P27B 1FCAA 2P5VA 2XTJP 2JL9A 3I9ZA 4WP3A 3MD1A 3OVSA 1SL0A 3MMCB 2E5LF 1CJVB 5KTQA 3GE9A 2B0GA 1YRXA 4X4OA 1HNZE 1S6OA 4B3TE 4B3OA 2HAFA 3H5UA 1GFWB 1CC7A 4GVBA 4G65A 4J9LA 2DR5A 3P5TL 1NPKA 4LF2A 1URNA 1M0SA 4JI6F 1Y9OA 4DUTA 1RDRA 4OYXA 3GR1A 4DSKA 1IUJA 3H20A 2ATCB 3IR7B 2VFVA 2KT2A 3AXMA 3S8SA 1L3TA 2UUBF 2VG6A 1X4EA 2MZRA 3QGPA 3C2PA 2C2MB 1DARA 3ZKBA 2FJBB 4ZVHA 3JAMC 3DRSA 1TK0A 4ID8A 1LFPA 1QY7A 1R6VA 3QIPB 5HN0A 4H4KA 1YG0A 4L72B 1SH3A 3M2UB 4J5OA 4C48A 6FDRA 4DMZA 5HP1A 3RR8A 1WC4A 3EDQB 1APSA 2VFUA 5KFMA 1Z0GA 3L7ZA 2MQLA 4X62I 1SC3B 3T1HI 2HS3A 1VRTA 5AXNA 2E1PA 2J0WA 3K2YA 2IBKA 4K4UA 2CVEA 1YHQS 3QWPA 2GC8A 2HQFA 2P9EA 4LF7F 3GLLA 1FRMA 3T1YI 2DXDA 1IBMF 1Q0NA 1H74A 1N56A 2YXLA 4NZ6A 4AE5A 2VPXB 4B3RE 4NASA 2C39A 4DQSA 1RBAA 1PBUA 2ZH5A 3MECB 2DY9A 2RUGA 3BGRB 4RU9A 5CQGA 1VK3A 1XEZA 2E5GA 3BSOA 3PV8A 4RNOA 1XMOE 3UWTA 4QWAA 3MMAA 3KLGB 4NXNF 3LP2B 2O1TA 5EKWA 1IKVA 4F50A 4OIXA 1QAYA 4JI6J 5EUHA 1Z0BA 1R8AA 1S6PA 3BR8A 5AE3A 5KFKA 1NJIT 1KDNA 2J5AA 1O8BA 2CAJA 4OQJA 3RBEA 2ZM6E 4IZKB 2Q1LA 5E3CA 3AA9A 5KFOA 1K44A 3QLHA 4URSA 4H4MB 3OSPA 5L3JA 1IBMJ 1QTNB 5KFZA 4ANCA 4ECXA 4F2RA 2VESA 3C14A 1TL3A 2QE5A 4K4ZA 1Y3KA 3CVKA 3MCMA 1DTTA 1RISA 2OELA 4ZVSB 1FJ7A 1GK8A 4C6AA 1HBMA 4PR6A 2HWIA 5MAOA 1RHRB 1GH8A 3H2UB 4LF8E 1MLAA 5F9LA 3I5AA 1Z0WA 1KVKA 2G1DA 2IVYA 3DRPB 1KQKA 5KOXA 2ERRA 3D3CJ 4OJ1A 5LL6R 2HHHE 2FUG9 4MKVA 4Y34A 5ITHA 1TKXB 1X0PA 3B54A 4I69A 4PCQA 4TNOA 3SDEA 3WX8A 4DSFA 2H5JB 2NYHA 1B70B 1IVZA 1SJRA 3H40A 4DV0E 3D1QA 4BDPA 4DWIA 2WZ1A 4UY85 3EWGA 3R3TA 2AX0A 2D7SA 2FJXA 4OO1A 4JI6I 2C22A 2ROPA 2XG8A 4B3TJ 1VQOS 3WQPA 4KPYA 5K36B 3I9V9 3LO3A 4B3MF 1ZTTA 3Q86A 3MR6A 3QIPA 1S1XA 1RT7B 2G1HA 3CB4A 4C11B 4TU9A 1FNMA 2HZCA 3LOUA 2LECA 3A3NB 5B7WA 4FYWB 4BA1B 3F73A 2VA3A 2Q6CA 4C8KA 3MM5B 4Y2AA 4PQUB 1FJCA 5ADZA 4BA2A 2JVRA 3DYAA 1JXEA 1H98A 4X62F 4JI0I 3VAJA 2MEWA 1HQEB 4IFYA 3UO0A 2VQFJ 4UF4A 4XIUA 2EG2A 1BC6A 3CW2C 4ZCIA 1K9MT 2X1BA 4N8OA 1R43A 1JLEB 2MQ8A 2RT3A 2V4JB 1PILA 1NBEB 4OZ2A 4H4MA 4ZCMA 4X4VA 4ZIWA 4OFZA 3BV8A 1ZA1B 1UEVA 1M5HA 5HROA 1SJFA 2VQFE 2WRMA 5HBMB 2UVVA 2XS5A 4DV0I 1AXQA 3B8HA 1REGX 3JTNA 3NKYA 1N32I 5IT9C 2MZSA 1WDTA 1KHVA 1OWXA 2PEHA 2A0FB 4ITSA 3CMAS 2YWFA 4A8KA 2XGPA 2JE6A 1TVRB 1EQMA 2ZZTA 3P96A 4B9VA 1RE1B 2WOMB 1LWCA 4AXJA 3ZTQA 1YVFA 2M9KA 1KIJA 3U1KA 1IKWA 3I0RA 3MMBA 4ZVEA 2R8KA 3OUYA 3EVWA 3MUVP 2XNRA 1JXLA 5D0EA 5C42B 4Y0FA 4F3QA 1BGXT 2JLFA 4LIRA 3T1HE 2JLGA 2XCPA 3D54A 3N6MA 3D66A 1UJ6A 3PJWA 3OD2A 4L76A 4DCOB 2BR0A 1BQNB 2HVHA 2ZM6J 2ZWOA 2AD9A 2M7SA 1HNZI 5H9FJ 2Y0BB 2FVSA 4CO3A 2VQEE 4KV8B 3A12A 3M2UA 4ANDA 5I3UB 3T5KA 2NR0A 4YHHE 3T9NA 3NBPA 2ZD1A 3BGFA 4DPTA 2ZE2B 2IC3B 1H2TZ 4NCGA 4CLUA 3UR3C 4YR2A 1N36J 1U6BA 2DHXA 3GFYA 3OHBA 4KHPJ 4H4OB 5JXSA 1M5OC 2YNHA 4O44B 5IC6B 1IWAA 3M8WA 2EK1A 5LL6d 4CP5A 2MGZB 2M8DB 4FF3A 1RA6A 5J2PA 3NMRA 4TU8A 4G3IA 1D09B 3PRYA 4LPFA 4PRVA 3MPWA 4X4NA 4NRUA 4DPWA 2V34A 3DRRB 1Y0HA 2BOAA 3N0VA 5GMDA 2KXHA 4FF2A 2WONB 4HYKA 2LP4A 4JI5J 2YKNB 3G2XA 1JLFA 3CNQP 3GIRA 3IRXA 2G2OA 1JLCB 2DNOA 4MU3A 4NLDA 4CH1A 1M1KT 3HK2A 5HI7A 5FLXC 1TUGB 2GNKA 3VVTA 1NM2A 1WC0A 2L9WA 4DX5A 4DR5I 3C14B 1WUUA 1NB7A 2CJQA 1VRUA 4P2FA 2MHNA 4OYAA 1SH2A 1VOMA 2NXEA 2OKQA 2RMLA 3G87A 3HD2A 3T6JA 1GMWA 4NYZA 4DPUA 3KK3B 4Q5VA 4V19J 3W9JA 1VRQC 3GJTB 3KYLA 1X31C 1YBUA 5HJYA 5L1LA 1D9FA 4IUFA 1KQGB 4OYBA 1T9UA 5GMKa 2OD6A 3R5CA 4QBUA 3KLFB 4ETXA 4V19X 1P6TA 4LQ3A 3CULA 2W9CB 5IV3A 2F4FA 2CQ1A 4USKA 3QZ7A 3PR4A 2XSFA 1G2EA 4JI4E 1HFEL 4MU4A 4DV1F 3CDJA 1N5QA 2Z5EA 1NZ8A 5CH7B 4OYOA 2J7KA 4CLPA 1HWKA 2QLFB 5EX0A 2BR2B 3I96A 1RYRA 1XNQF 4LF5I 3CGIA 4DR2F 3H42A 1S6QB 3AD7C 3MFIA 4HVZA 4OX8A 4XTTA 4AFFA 2DCLA 3WU5A 3EVMA 2WB1D 3Q8PB 3J81Y 2UUTA 3QZ8A 3GIIA 2DPJA 4DR3I 5MLCV 5D3GA 3PZPA 2FTRA 4Y65A 2RB7A 1QE1B 3CJ2A 1TELA 2BJ8A 2M0GB 1VRTB 3IS9A 2CWXA 4PXCA 1UA0A 2D9PA 4LFAF 5F9NA 4F4AA 3SDEB 5DDOC 3NAIA 5DG8A 3G82B 2FJWA 5E7OB 2F63A 2N7CA 1RAGB 3THVA 2LXUA 5L39A 3KHGA 2VHGA 1FFGB 2HVDA 2XYGB 3MFHA 3R5GA 3WZ0A 3GJRB 2J0QD 5L46A 4P6QA 1A9NB 2XEXA 1Y3JA 4QOTA 3R97A 2AJ2A 2ADCA 1WC1A 1YQHA 4YR0A 3TOQA 3MEGA 2HBQB 2OPRB 4EGLA 3SCLE 4CYUA 2CRLA 4MK8A 2A6OA 3ZTSA 5KFWA 2YWHA 5HO4A 3GILA 4B9UA 1EAYC 5HQ8A 3RBZA 1VQ5S 4RW7A 4DQIA 2UU9I 2UXDJ 2AMCB 4DI6A 1LQ9A 4QPTA 4IZJB 4HT7A 4RNNA 3JAMY 3PVXA 3Q22A 1JLBA 4HT5A 1SUQB 1N34E 2AT1B 1RQ0A 1KR4A 1TQLA 5HANA 3HFKA 4WWSA 5FLXU 3MURP 4LVNP 3QJPA 1MWYA 1CJVA 1HWLA 4MFBB 4DX7A 3W1YC 1FKAE 2RAQA 5KG6A 3V81B 1HBOA 2VQEF 3BH7B 1AFIA 1JNZB 1LKZA 1R8BA 2L3MA 2DNPA 4D3HA 1Q16B 2UU9J 4I1TA 2R8GA 1BQXA 1Q8BA 2C3MA 1FWPA 4TYBA 1HI0P 2N4DA 4C2MA 3GV8B 3W7BA 3PS1A 5EL9A 3IGVA 1S4EA 1H2VZ 3LAMA 2L41A 4CZCA 4KO0A 3TJAA 4OZLA 3UI3A 2CZ9A 2DGXA 2YVSA 5I3QA 3K5MA 4NZ7A 2AQ4A 5D6GA 1QLNA 5IV4A 1NJYA 4DG1A 4N56A 2YWGA 2XHWA 3UW1A 3UCUP 1RI7A 1B63A 4FYYB 3ENQA 1HNXI 2VKZG 3IWNC 2MSSA 1WEXA 3DLKA 2JC0A 1LW0B 1VI7A 1N52B 1FKOA 2H4YB 1LOUA 1QE1A 4QZVB 5HP1B 3O3LA 1VK8A 4JV5J 2A3JA 5D3GB 1CEZA 1DTQB 2DGTA 3FCWA 3TUJC 2AEFA 3CT9A 1PJ6A 2YH0A 5CCMA 3AQPA 3DRSB 4DV3E 1AB8A 3GG0A 2QA4G 1FJEB 3VQTA 4PG4A 5HMWA 3KDNA 3W5ZA 1I94I 2B9YA 4RW8A 2GQQA 2BJ1A 1HHSA 2XULA 4LSLA 3GB0A 4ZVUB 3Q8YA 2ZDPA 3FJ2A 1MU2B 2VODA 4O3OA 4P2MA 3W65A 3B6BA 3LWLA 3OBIA 1Z4UA 5KFAA 1Y11A 2ZH8A 1QJHA 2YKMA 1S48A 4Q7AA 1VISA 1TKDA 1Z0EA 2VFSA 4C3LA 5KFBA 2DGUA 2NZCA 3CF5Q 2IOQA 4URLA 3PYFA 2ALZA 1FKAF 1VQNS 1N36E 2WOMA 3VV2B 1E3PA 1Y5LB 4LR7A 2UUAE 4HL9A 3SQOP 2C2NA 4DV1J 2UP1A 4IFDF 2RIJA 4IZJD 3AH6A 3OV7A 4OI2A 4HEA9 5D0HA 4EEYA 4IG0A 3KNGA 1HBOB 3O1LA 3W2WB 3PKYA 2R8IA 4LF5E 3DHXA 2R2TA 1EARA 2Z5CA 2QSFA 1PC4A 5SZTA 3NGUA 3GCXP 2DNMA 3TJ9A 1RWOB 1UFKA 4DR1F 5HVFA 3ZO7A 2U1AA 3T19A 2LQ9A 2QA1A 3M8PB 3JSRA 2VH7A 4PWDA 3VAHA 1NHVA 2CG8A 5F8NA 1GQEA 3IMQJ 3MEKA 5D4PA 2C2EA 2PN6A 4KR0B 5DDPC 1C4CA 2V67A 3GTYX 1K0TA 4P74A 2IOPA 4DUZF 3MM5A 4PQUA 5LMUF 3WU6A 4BWMA 3DNCA 4OYPA 4K4YA 2A10A 4O0IA 3L7ZB 4B3RJ 4IFDC 3HP6A 2KJWA 2VBWA 2ZD1B 2DGVA 4C11A 3UD4P 4HI2A 4C8OA 4W92B 1RWWB 1HBNA 1HQUB 1LNQA 1RTIA 2HGLA 3LW5C 4NYPA 3RGIA 4QWEA 3IXQA 2OIHA 4JI4J 4AUKA 1VQ6S 4OO1D 2AP6A 1FE4A 3PIPQ 2QA2A 5E0OA 1VBZA 3SCKE 1T9TA 5SUHA 3TX8A 1GX5A 4DR7I 4LR8A 4JYAE 1LK7A 4PRXA 3MD3A 4KHRA 3FUYA 2K8GA 4PKDB 3ZZUA 3G6VA 2A2CA 3GU0A 4HACB 1WEYA 1BQMB 5J1EA 3JS9A 5L1KA 2Q66A 2HPUA 4B3OB 4O4GB 3K85A 3LGMA 2F3JA 2UUCE 3E01A 1LWCB 4JI8F 3JSBA 3FEZA 1AZSB 1WHVA 4Q2MA 2IVFB 2ZKTA 1UPMB 4KFBB 3W2WA 4CO1A 3RTVA 2CFXA 1IBKJ 3OTOF 2QYGA 3G71S 4F4WA 2PI5A 2ZDOA 3GFHA 3RJMB 2ZH4A 1IQTA 3FSXA 1TK5A 2CJXB 2K7KA 3CDUA 3KDOA 5I3PA 3VR1A 4QWDA 4B9MA 2DRAA 4U7UD 4CLWA 3DGVA 1MNEA 2WVFA 2JWNA 4FYXB 2HNZB 5A76A 1SL2A 2ZITA 4WBFA 1TL1A 2RDJA 2AV5A 4DV0J 3KUGA 4RW6A 3SMZA 2BQ3A 4AQYI 3QIDA 1NHIA 1E6VA 1WOSA 4DR7J 1NSPA 3VZHA 4QW8A 5BR8F 3PW5A 3DGPA 2MJUA 2MQMA 1HBUB 2IAJA 2J76E 2E1AA 2RU9A 3UDVA 1HYSB 2OMOA 2YQ1A 3H2VE 4LF6I 2VQEJ 2BOPA 1FA0A 4DR6F 3EGWB 3QATA 3M8ZA 3WC2A 4EFAC 5KFLA 3FFIA 3SFGA 4ED5A 1S9EB 5E2QA 3DM2B 2XO7A 1NKCA 2WAQD 2WVDA 2ZZMA 5I42A 3PIOQ 4DS5A 4GKKI 1N33J 1S1VA 1WOPA 1VQKS 2HHUA 1WWHA 1X4FA 2RHSB 1RAOA 3M4XA 4ZMMA 4ED7A 4FS2A 1X5PA 3OTDA 2VONA 4DV2F 4YQWA 3I55S 3UD5A 1HNXJ 5CYMB 1DFDA 1F5AA 1C0UA 2IA6A 3NOGA 4ZA1A 4GKKJ 3ZM7A 2IMWP 2MKKA 4JI3F 3KLIB 2DRDA 1RSCA 2UV8G 1VS3A 2JDJA 2YNFB 4NLQA 1EA6A 1RWVB 1F0XA 1HHQA 2GVDB 1PYOB 2BJ9A 2WW4A 3D6HB 2W7OA 1RUSA 2A1BA 1DBDA 3DI6B 4WE1A 3S01A 2ZH6A 2RHQB 3G6XA 4DSLA 2IHR1 1Z5BA 5H9EJ 2F9DA 5CYJA 2E1MC 1FTCA 4OHXA 3G86A 3A3PB 4ZLPA 4DR7F 4GVBB 5BYQA 1PSDA 5FLXY 2XNQA 3UN5A 2CNKB 1OO0B 2YX4A 3M8QB 2YPYA 4KGMA 5KFQA 3RBDA 1QZRA 1JLBB 2CWKA 7FDRA 4YDXA 2JZ5A 4K2XA 1RKIA 8RUCA 2XLIA 4ES2A 2Y1LB 3EZUA 4ZJLA 2XO6A 1KTQA 4JI8I 3EGZA 3HFZB 4WFAQ 3LPEA 4UT4A 3HM9A 4PU9A 5KFHA 3P8BB 1Z0TA 4PYAA 5LSRA 1IBLE 1T0TV 2V6AA 4YB5A 3OTOE 1RADB 4I2PB 4GKJF 2BW2A 3QT7A 2PIIA 5G4DA 3ADAC 4A8QA 1YIJS 1QSYA 2UUAI 4JYAJ 1IR1A 4DPOA 2CQDA 1VHFA 4CH0S 1IKYA 2NS1B 3EZOA 3HHEA 3H5YA 4QU6A 1N88A 1NDLA 1F3VA 1RJJA 3IS9B 2LEPA 2ASYA 2DO0A 2MKCA 2VB6A 1Q86T 1QD1A 2H65B 2C2KB 4LRDA 4A48A 3FK4A 2UUAJ 4LF6F 1VIOA 2CJ9A 3HO1A 2CZ4A 2MZTA 4WTYA 3H4LA 3GJQB 1HQUA 2QTWA 1BXNA 4LFAE 1KRPA 2BX6A 2EKYA 2CADA 2FZKB 3D28A 3AFGA 3GONA 2A18A 2CPJA 3Q89A 3TRGA 3RB6A 4OI0A 1AT1B 1S6UA 4KHPF 3KFWX 4V1Ak 1QTMA 2F4VF 5KFFA 4F3OA 3DOKA 5C2GA 5A2QU 2FVPA 2AZ3A 5K36F 1T3OA 3R7NB 2XS2A 4HI1A 2W24A 5HMXA 5DDRC 5HMYA 4DL2A 1YJ7A 2FJDB 2FQQB 1P9QC 3CIMA 3M2VA 3T5JA 1G7CB 1RT4A 2YNIA 3QT6A 1EP4B 5J1NA 4YMEA 4FYDA 3JXOA 4WF9Q 3HI9A 4I4BA 4J9MA 1FHTA 5JEAF 3MAAA 4X66J 3M85D 2V8GA 5BYRA 4OHZA 4ED8A 4M95A 4DQQA 5DG7A 2PC6A 3W61A 3Q6NA 1Q8IA 2FY8A 1Y00A 2ACYA 3DLJA 3TAMA 2DBBA 1RK8A 1EHWA 2V2VA 2DITA 3NOCA 2JJ4D 2DISA 4H54A 4KE5A 3CO9A 4FXVA 3TR5A 2W8KA 4DLGA 1G4CA 2VPWB 2HQCA 1B3TA 7AT1B 1MSWD 2UXCI 1XERA 3OL6A 4ZVRB 4LREA 2N3LA 1XMQF 3PDNA 1IBME 2CQ0A 2VQFF 2Z8QA 4E98A 2HQIA 3VGTA 4ZKAA 3CCLS 2PD1A 5B0DA 2GHVC 3M9NB 1H0HB 2COLA 1SJQA 2BYCA 5IQQA 5J2NA 1F5BA 2B9XA 2RRBA 3HZGA 3N28A 3OXLA 4DZ6A 3GCMA 4LFBE 5BJRA 3CDIA 3BGOP 1XNRJ 3W5YA 1U2RA 5IS2A 1HPZB 3PACA 2K06A 5C0XE 1Y5YA 5DLGA 4LF8J 4X65F 3MM7B 3N5FA 3Q8SB 1FJGE 1RT6A 2PNZB 5D4OA 2GAGC 3CPWR 3SFUA 5CYMA 2G0IA 3CCMS 1ZXMA 3PEJA 2AGQA 1PGZA 3R1HA 3VQSA 1WG5A 3V6JA 3HVAA 3K5OA 5IZHA 4Q44A 1N0VC 2BE2A 1Z0VA 4K0KF 1WOOA 2EFNA 4IH5A 4JV5I 2UXDE 1N32F 3PS2A 2BQUA 3L7OA 4FW3A 2GW8A 4IFVB 5HVGA 3OQ2A 1ROFA 3M05A 1C2PA 1T9WA 3HMJG 3CDWA 4LFCF 5J2MA 3U1LA 2CDQA 1DURA 4DQPA 2HHWA 1RACB 3J81j 3IG1B 1WC3A 4JI2I 3C3LA 3NS6A 4KKOA 4GKJE 2HFUA 4RBTA 5E33A 5AJ3F 3KUHA 2KXNB 4Q2LA 4YN3B 4B3TF 1YBAA 4OI6A 5LT5A 2JE6B 4F8RA 2BE7D 2XSJB 5DNXA 2CQPA 4DL5A 2PFFB 3KJQB 5K5MA 1R8HA 1HMVA 4I2QB 1OS5A 4CO2A 2ZEJA 2E9TA 4YEAA 2VBZA 2Y9HA 1ZAVA 2KL8A 2ZBIA 3HF5A 3ZZOA 1HK7A 3KOAA 4QU7A 2QLWA 1AFJA 2CPYA 4LRBA 2LU2A 2YKQA 3W8GA 3UR0A 2KFYA 1YKWA 4NLRA 1G1XA 1TP7A 3RB3A 4LF4J 3F41A 4IRDA 3LPSA 2B8PA 2P9CA 4J9UE 5K14A 3LP1A 1C4AA 1N48A 4B3SI 4CNYA 4WFNQ 1UTAA 1WHXA 1VFJA 2C1EB 2F65A 3QSIA 4ICLB 2LQJA 1T11A 4KGXB 1NHUA 2KU7A 4CM0A 3TUIC 3ZZPA 2RQ4A 5KG2A 1UL3A 1SI9A 3MR5A 1CJUA 4X64J 2GHWA 3D9BA 1VQ9S 2UVUA 3K89A 2HKJA 1HR0E 3V5RA 4F2SA 3FCVA 4NXME 2HLTA 3CD7A 9ATCB 1N33I 4YB1P 3GSIA 3T1HJ 4NPOA 1ZETA 2JT2A 4LFCJ 1ZM9A 2XMTA 3KJVB 4OHWA 3X3UA 2VOOA 1Q5VA 4M5NA 2MZ1A 1RAHB 4DCPB 5KT2A 3QNWB 4DUZE 5E5NA 5KFCA 1Z59A 2RQMA 3NBPB 3HT0A 4AD6A 2G0CA 5EWGA 2ZOMA 1J5EE 3KK1A 1IQZA 1BMQB 1TKZB 2HQDA 4TXSA 5A8RA 4UOFA 3HJCA 3LUYA 2R7RA 4M63A 4WKRA 4X4QA 3AT1B 1IBLJ 1T94A 2F5GA 1X4CA 3CCWA 2BEFA 3NCPA 1ELOA 1YBTA 1MU5A 3Q6MA 4EBEA 2MHEA 3LF0A 4URQU 3GV5B 5B0CA 2CJAA 4IOBA 1XJWB 2GMLA 1X4HA 2M3DA 4LQ9A 1JLAB 1NDCA 2QFJA 4IO9Q 3R7BB 3M32A 1N8RT 5IXUA 4JV0A 2E7WA 2AF6A 2DR8A 1H6KX 3CMES 2V9WA 4KO0B 5LMNE 1A6LA 3RB0A 1IBMI 1JMTA 4I6YA 4LFCI 1WF1A 4MAKA 1F1BB 4ATNA 2V94A 1W2IA 2ZHOA 3EMTA 4N47A 2FHKA 1TVRA 3NXZA 1NK9A 2N82B 1GNKA 1S57A 3HVTB 1Q79A 2OPPB 3FQLA 2HFNA 4K5SA 5D77A 1SC6A 1I1GA 1DQ9A 4TYAA 1NJWA 3K5NA 2C38A 4DR3F 2OPPA 1S12A 2LQ8A 3IRWP 1R0BG 3MAAB 4W4MA 1X0FA 3CTRA 2B4UA 4J91A 2FHOB 2D41A 2IMOA 2BA1G 4FW4A 2IIHA 3P49B 1PG5B 3HFVA 3HSGA 4OYZA 5D4LA 3B82A
chains in the Genus database with same CATH topology
2UUBE 1N36I 1HNZI 4KHPI 4WUCA 2X7IA 4HXZA 2VQEE 2F4VI 4YHHE 3P06A 1NHJA 1XMOI 2AJ4A 4DPTA 4FW9A 4LF4E 3PRYA 1BKNA 4PRVA 4HACA 5BR8E 4DPWA 2V34A 4DV4E 5GMDA 4JI3E 4AQYE 4DV3I 2LJPA 4JI7I 3QT5A 5FLXC 4KHPE 1UEKA 4DR5I 1XMQI 1WUUA 1ZXNA 4JI0E 1Z0CA 4DPUA 1ZM2A 4B3SE 1Z5CA 4USKA 4FWGA 4JI4E 1B62A 1N33E 2J7KA 1N32E 4USMA 4DV1E 4LF5I 2HK3A 2UU9E 1RR9A 3WU5A 4DV2E 4K0KI 4DUYI 2DEIA 4DR3I 3V2UC 2BM1A 5A2QQ 1S16A 1IBLI 3F0NA 4DR6E 3M6AA 4B3TI 3T1YE 2XEXA 2UXBE 5IWAE 4X66I 4MYTA 4DPYA 1FJGE 4JI5I 2UU9I 4IZJB 4DV6E 4NXMI 1N34E 4X64E 1Y4UA 4LFBI 4LF7E 1FKAE 4RPFA 1J5EI 3ZKDA 4PU9A 1HNWE 2BV3A 4DUZI 2ZBKB 1K47A 4JI1I 1XNQE 4B3MI 1S4EA 4YHHI 4I3HA 2NPFA 2CZ9A 1XMOE 2R3VA 3LTOA 1B63A 1NHHA 1FJGI 2CGEA 1HNXI 3J80Q 2PNMA 1PIEA 3K17A 1IBKE 4JI2E 4GKJI 1KTVA 4JI4I 1H72C 4JG4A 4YY3I 2UXCE 4DV3E 1I94I 3OTOI 4IZKA 4JI8E 4ZVIA 4NXNE 1EI1A 1Z0EA 1USUA 1VISA 4XTJA 4P52A 2IOQA 4URLA 3PYFA 1N36E 4DU8A 2UUAE 2HKEA 2Z5BB 4JI6E 4IZJD 4DU7A 2V2QA 3ZZTA 4LF5E 2Z5CA 2PNLA 4MYUA 4FWHA 2E5LI 4Z7CA 1N34I 1D6TA 2IOPA 1XMQE 3WU6A 4DR1E 3WU4A 2UUBI 5FWKA 2VQFI 1MX0A 3ZZ0A 1PVGA 3J80C 5IT9Q 3K1JA 4DR7I 4PRXA 1ZM3A 3ZZUA 2A2CA 4LF4I 4X65I 4HACB 2A2DA 3K85A 2ZM6I 2UUCE 4LF7I 4X62E 4GKKE 1A6FA 4DUYE 4DV5E 4JI7E 4R1FA 4LF9I 4NXNI 4UTGA 2ZITA 3J81Q 2O1WA 4KQVA 4JV5E 2UXDI 2R42A 1NHIA 3JAMQ 3PYEA 4LF8I 1USVA 4LF6I 4Z7YA 4LFAI 1PKPA 3B78A 3J81C 1FI4A 4GKKI 1FWKA 5FLXQ 2DEJA 2EFGA 4DV7E 4ED4A 1H7UA 5LMUI 3ZM7A 1KKHA 1EA6A 2WW4A 4JYAI 4DR2E 2VQEI 4OX9I 1Z5BA 1FWLA 1HR0I 2O1VA 2VF3A 2O1UA 1QZRA 2E5LE 4X65E 3PYGA 1MG7A 4JI8I 5GMEA 4UT4A 5A2QC 1Z0TA 5LMUE 1IBLE 3OTOE 3QT8A 1HNWI 3QT7A 3J7AG 2UUAI 4DR5E 4WUBA 2HHHI 3H4LA 3PYDA 1H73A 2UUCI 4LFAE 3GONA 4DV4I 1XNRE 4IZJA 4YY3E 3D4JA 2X36A 4DV5I 4EMDA 4DR3E 4DV2I 2OI2A 3QT6A 2F4VE 4DR1I 1HNZE 4B3TE 4LF6E 3Q6NA 2UXBI 2V2VA 4X66E 3WU3A 2Q2EB 2UXCI 1XHKA 1XNRI 4P7AA 1IBME 1I94E 1DARA 3ZKBA 3JAMC 4K0KE 4DV6I 3J7AM 4LFBE 1Z0GA 4AQYI 3HULA 4X62I 2HFSA 1U2RA 3T1HI 1XNQI 3CWVA 1ZXMA 4DR2I 3T1YI 4LF8E 1H74A 5IWAI 1N0VC 1Z0VA 4B3RE 4JV5I 2UXDE 5LMNI 4DXLA 4LFCE 4FN5A 2V2ZA 4HY1A 2O1TA 3LNUA 4X64I 1N0UA 1Z0BA 4JI2I 4GKJE 4DPXA 2HFUA 2ZM6E 4IZKB 4M1KA 5BR8I 5L3JA 1NZ0A 4DR6I 4WUDA 4B3ME 1HK7A 1RREA 4N3OA 4LF9E 1Z0WA 4B3RI 1KVKA 2HK2A 3LPSA 4HYMA 2CG9A 5LL6R 2HHHE 4B3SI 1Y6ZA 4DV0E 1IBKI 3Q1QA 4OX9E 4JI6I 4DR4E 2HKJA 4NXME 2GS8A 1HR0E 3V5RA 1N33I 4JI3I 1ZM9A 1FNMA 1ZM4A 1H7SA 4DUZE 1Z59A 1OJ4A 4JI1E 4DV7I 1J5EE 4JI0I 3HJCA 3Q6MA 1ELOA 1MU5A 1HNXE 2VQFE 2GQ0A 4DV0I 4JYAE 3B8HA 2BM0A 2E1RA 1N32I 5IT9C 4DR4I 4DV1I 5LMNE 2Z5BA 1IBMI 4FWDA 4LFCI 4JI5E 4DR7E 2Z5CB 1KIJA 2V8PA 1Y4SA 3T1HE 2Z5EA 3B82A 1Z5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB E;  1N36 I;  1HNZ I;  4KHP I;  4WUC A;  2X7I A;  4HXZ A;  2VQE E;  2F4V I;  4YHH E;  1NHJ A;  1XMO I;  2AJ4 A;  4DPT A;  4FW9 A;  4LF4 E;  1BKN A;  4PRV A;  4HAC A;  5BR8 E;  4DPW A;  2V34 A;  4DV4 E;  5GMD A;  4JI3 E;  4AQY E;  4DV3 I;  2LJP A;  4JI7 I;  3QT5 A;  5FLX C;  4KHP E;  1UEK A;  4DR5 I;  1XMQ I;  1WUU A;  1ZXN A;  4JI0 E;  1Z0C A;  4DPU A;  1ZM2 A;  4B3S E;  1Z5C A;  4USK A;  4FWG A;  4JI4 E;  1B62 A;  1N33 E;  1N32 E;  2J7K A;  4USM A;  4DV1 E;  4LF5 I;  2HK3 A;  2UU9 E;  1RR9 A;  3WU5 A;  4DV2 E;  4K0K I;  4DUY I;  2DEI A;  4DR3 I;  3V2U C;  2BM1 A;  5A2Q Q;  1S16 A;  1IBL I;  3F0N A;  4DR6 E;  3M6A A;  4B3T I;  3T1Y E;  2XEX A;  2UXB E;  5IWA E;  4X66 I;  4MYT A;  4DPY A;  1FJG E;  4JI5 I;  2UU9 I;  4DV6 E;  4NXM I;  1N34 E;  4X64 E;  4LFB I;  4LF7 E;  1FKA E;  4RPF A;  1J5E I;  3ZKD A;  4PU9 A;  1HNW E;  2BV3 A;  4DUZ I;  2ZBK B;  1K47 A;  4JI1 I;  1XNQ E;  4B3M I;  1S4E A;  4YHH I;  4I3H A;  2NPF A;  2CZ9 A;  1XMO E;  2R3V A;  3LTO A;  1B63 A;  1NHH A;  1FJG I;  1HNX I;  3J80 Q;  1PIE A;  3K17 A;  1IBK E;  4JI2 E;  4GKJ I;  1KTV A;  4JI4 I;  1H72 C;  4JG4 A;  4YY3 I;  2UXC E;  4DV3 E;  1I94 I;  3OTO I;  4JI8 E;  4ZVI A;  4NXN E;  1EI1 A;  1Z0E A;  1VIS A;  4XTJ A;  4P52 A;  4URL A;  3PYF A;  1N36 E;  4DU8 A;  2UUA E;  2HKE A;  4JI6 E;  4DU7 A;  2V2Q A;  3ZZT A;  4LF5 E;  4MYU A;  4FWH A;  2E5L I;  4Z7C A;  1N34 I;  1D6T A;  1XMQ E;  3WU6 A;  4DR1 E;  3WU4 A;  2UUB I;  2VQF I;  1MX0 A;  3ZZ0 A;  1PVG A;  3J80 C;  5IT9 Q;  3K1J A;  4DR7 I;  4PRX A;  1ZM3 A;  3ZZU A;  2A2C A;  4LF4 I;  4X65 I;  4HAC B;  2A2D A;  2ZM6 I;  2UUC E;  4LF7 I;  4X62 E;  4GKK E;  1A6F A;  4DUY E;  4DV5 E;  4JI7 E;  4R1F A;  4LF9 I;  4NXN I;  4UTG A;  2ZIT A;  3J81 Q;  4KQV A;  4JV5 E;  2UXD I;  2R42 A;  1NHI A;  3JAM Q;  3PYE A;  4LF8 I;  4LF6 I;  4Z7Y A;  4LFA I;  1PKP A;  3B78 A;  3J81 C;  1FI4 A;  4GKK I;  1FWK A;  5FLX Q;  2DEJ A;  2EFG A;  4DV7 E;  4ED4 A;  1H7U A;  5LMU I;  3ZM7 A;  1KKH A;  1EA6 A;  2WW4 A;  4JYA I;  4DR2 E;  2VQE I;  4OX9 I;  1Z5B A;  1FWL A;  1HR0 I;  2VF3 A;  1QZR A;  2E5L E;  4X65 E;  3PYG A;  1MG7 A;  4JI8 I;  5GME A;  4UT4 A;  5A2Q C;  1Z0T A;  5LMU E;  1IBL E;  3OTO E;  3QT8 A;  1HNW I;  3QT7 A;  3J7A G;  2UUA I;  4DR5 E;  4WUB A;  2HHH I;  3H4L A;  3PYD A;  1H73 A;  2UUC I;  4LFA E;  3GON A;  4DV4 I;  1XNR E;  4YY3 E;  3D4J A;  2X36 A;  4DV5 I;  4EMD A;  4DR3 E;  4DV2 I;  2OI2 A;  3QT6 A;  2F4V E;  4DR1 I;  1HNZ E;  4B3T E;  4LF6 E;  2UXB I;  2V2V A;  4X66 E;  3WU3 A;  2Q2E B;  2UXC I;  1XHK A;  1XNR I;  4P7A A;  1IBM E;  1I94 E;  1DAR A;  3ZKB A;  3JAM C;  4K0K E;  4DV6 I;  3J7A M;  4LFB E;  1Z0G A;  4AQY I;  3HUL A;  4X62 I;  2HFS A;  1U2R A;  3T1H I;  1XNQ I;  3CWV A;  1ZXM A;  4DR2 I;  3T1Y I;  4LF8 E;  1H74 A;  5IWA I;  1N0V C;  1Z0V A;  4B3R E;  4JV5 I;  2UXD E;  5LMN I;  4DXL A;  4LFC E;  4FN5 A;  2V2Z A;  4HY1 A;  3LNU A;  4X64 I;  1N0U A;  1Z0B A;  4JI2 I;  4GKJ E;  4DPX A;  2HFU A;  2ZM6 E;  4M1K A;  5BR8 I;  5L3J A;  1NZ0 A;  4DR6 I;  4WUD A;  4B3M E;  1RRE A;  4LF9 E;  1Z0W A;  4B3R I;  1KVK A;  2HK2 A;  3LPS A;  4HYM A;  5LL6 R;  2HHH E;  4B3S I;  4DV0 E;  1IBK I;  3Q1Q A;  4OX9 E;  4JI6 I;  4DR4 E;  2HKJ A;  4NXM E;  2GS8 A;  1HR0 E;  3V5R A;  1N33 I;  4JI3 I;  1ZM9 A;  1FNM A;  1ZM4 A;  1H7S A;  4DUZ E;  1Z59 A;  1OJ4 A;  4JI1 E;  4DV7 I;  1J5E E;  4JI0 I;  1ELO A;  1MU5 A;  1HNX E;  2VQF E;  4DV0 I;  4JYA E;  3B8H A;  2BM0 A;  2E1R A;  1N32 I;  5IT9 C;  4DR4 I;  4DV1 I;  5LMN E;  1IBM I;  4FWD A;  4LFC I;  4JI5 E;  4DR7 E;  1KIJ A;  2V8P A;  3T1H E;  3B82 A;  1Z5A A; 
#chains in the Genus database with same CATH topology
 1N36 I;  1DY3 A;  1GXT A;  4DV4 F;  1JJC B;  1GTH A;  4Y2M A;  4U3B A;  2KYZ A;  3W5X A;  1RAI B;  3FBE A;  5LMU J;  3DU6 A;  5A6W A;  2KTQ A;  2P6S A;  2R8J A;  3J7A N;  4HXZ A;  1U1O A;  2VA2 A;  1X9M A;  1F2G A;  3P06 A;  1KLM A;  3GFX A;  3OFE A;  4NL5 A;  2W2O P;  4ZPV R;  4EBC A;  4ECV A;  1UVL A;  3PRV A;  4B3S F;  1N34 F;  3MM8 A;  3QJJ A;  3OVA A;  1NK0 A;  5DRO A;  3D1O A;  1G6B A;  1Q95 G;  2WSC C;  1U1Q A;  2E5J A;  4OZ3 A;  1ZOT A;  1IWG A;  1V5V A;  1U47 A;  4IFD E;  5J1E B;  1QAX A;  4DV4 J;  1WSR A;  3OR2 B;  3RRG A;  4LF4 E;  4F04 B;  1Q78 A;  5F8L A;  5K8M A;  4OL8 A;  1AA1 B;  2FLO A;  3CJS A;  2R2U A;  3LGN A;  5DO2 A;  3B4T A;  5ETT A;  4KQZ A;  1C1B A;  1RTJ A;  2CZV C;  2QLB B;  2HBZ B;  3DLE A;  4CQ1 A;  4ECZ A;  1Y6Z A;  4JI3 E;  4C8M A;  2YKA A;  4CTA B;  1XNQ J;  3OL9 A;  5K36 E;  4Y28 C;  4CLS A;  2Z56 B;  2LJP A;  2LA6 A;  2PA8 D;  3OVB A;  2M8H A;  5JEA A;  2NXC A;  4CO4 A;  1V3R A;  3W2V A;  3OR2 A;  1B0P A;  4K4S A;  2BRK A;  2X3D A;  4M5D A;  1OMS A;  4M5K A;  3K59 A;  2F40 A;  4DV7 F;  4B17 A;  1PO6 A;  1DRZ A;  2VJV A;  3F44 A;  1S9G B;  3ISZ A;  1ZXN A;  1ACM B;  1OIA A;  2L9D A;  3EUN A;  1N5S A;  3MTK A;  4FXW A;  4IG3 A;  1DTT B;  1CG2 A;  1WTF A;  5D0G A;  2R7X A;  1FEH A;  2HFO A;  2MQQ A;  1XBW A;  2LXF A;  3ILL A;  3PKM A;  3OHA A;  3P4U B;  3IWX A;  1Z5C A;  3PCO B;  3PJX A;  5KFX A;  3U27 A;  2FZC B;  4FWG A;  4LMZ A;  1B0T A;  2MB0 B;  5KFY A;  3AAW B;  1B62 A;  2DB1 A;  1N33 E;  1HIY A;  3VHQ A;  4K7Q A;  1RB0 A;  4RBU A;  3UNY A;  4ZLJ A;  4QW9 A;  3UCZ P;  2AGP A;  3H5X A;  4LF9 F;  2VFR A;  2HK3 A;  4WCE Q;  2C38 B;  3WIU A;  2FHJ A;  2UU9 E;  2HRU A;  2VC0 A;  3SSR A;  2YNG A;  2AYE A;  3M7V A;  1KFD A;  1Y10 A;  3OT9 A;  4EO6 A;  3DLB A;  4JP8 A;  1F3F A;  1RT5 B;  1KD1 T;  2DEI A;  5CD4 A;  1SKW A;  2CKW A;  4PRF A;  3DLH A;  3V2U C;  3DKD A;  4ZPB A;  3NLC A;  3BDE A;  2PGC A;  4P9S A;  4RW4 B;  5A2Q Q;  4KYZ A;  1S16 A;  2ZC4 A;  1EKS A;  3LGH A;  4OZN A;  1SL1 A;  1JXV A;  3OLA A;  3RRH A;  1WAC A;  4X64 F;  5LSL A;  3F0N A;  2MGZ A;  3M6W A;  3N4W A;  4M5M A;  2HZV A;  1KVJ A;  4DSI A;  3FMW A;  2BE2 B;  1VQL S;  4ELT A;  3BM7 A;  1VHI A;  4NA1 A;  3ITH A;  4DR1 J;  2UXB E;  2C3O A;  2K3K A;  1YWX A;  2GZO A;  4Y2C A;  4X66 I;  3HJV A;  2Y8W A;  3U1M A;  1UDO A;  2VFT A;  2XB2 D;  1JLQ B;  1PJ5 A;  2XMU A;  3DOM B;  4NI2 B;  5KFE A;  2MQP A;  2OSR A;  2XMJ A;  1B4S A;  1PC5 A;  2H3E B;  2HLU A;  3OR1 A;  3PNI A;  4HHU A;  4M5J A;  3CJ5 A;  3RW7 A;  3BSN A;  1KQF B;  2YH1 A;  4NXM I;  1Q81 T;  5E3Q A;  4J7C A;  3GFZ A;  1GMV A;  2UV8 A;  4LF7 E;  1HLW A;  1KEK A;  1H38 A;  4M94 A;  2NYI A;  2QL7 B;  1R8C A;  1UVK A;  2JEF A;  4RPF A;  4DG1 B;  4C0O C;  4QYZ J;  2B9E A;  4AL6 A;  5K20 B;  3EDR B;  3QQC D;  1I94 J;  3GIM A;  2FJV A;  1UZH A;  2D3Z A;  3QRR A;  4JB8 B;  4ZS6 A;  2HNZ A;  2V8D A;  3DU5 A;  1RHQ B;  4F4Z A;  4JI7 F;  1JWW A;  2LEA A;  1K47 A;  3P76 A;  1V3Z A;  1XNQ E;  3ZNJ 1;  3TUZ C;  2WK4 A;  3MOJ B;  4P10 A;  3LP1 B;  4OYM A;  2MXY A;  4YHH I;  3UN2 A;  4I3H A;  2RJZ A;  1J5E J;  2XLJ A;  3BN7 A;  4G6V B;  4LJM A;  2W9B B;  5IFM A;  1PYT A;  2MMY A;  2HRY A;  4PXE A;  2OEK A;  5G0R B;  5A0Y A;  2J7W A;  3ZXW A;  1RHM B;  3MM6 A;  3PJ9 A;  3OL7 A;  2QGF B;  4S0M A;  4OLP A;  2FVQ A;  3JQK A;  3PY8 A;  5L9N A;  1C0T B;  4LFC E;  4CT9 A;  3VAI A;  2L08 A;  4C0H A;  2QA4 S;  4ZOS A;  3LAK A;  2UXD I;  5T7L A;  2EVZ A;  1HNV B;  3CJR A;  3MM9 A;  2CJY B;  2QC3 A;  2EC2 A;  3EE3 A;  5GAD I;  4DL7 A;  3V4I A;  3DI6 A;  4OX9 J;  3Q8R B;  2XWX A;  2BA9 A;  3VZI A;  3OL8 A;  2NN6 A;  5CD4 H;  1JLQ A;  3QSY B;  3OTO I;  2D3U A;  2UXC J;  2NN6 E;  5A8R B;  5J2M B;  2B4P A;  2BKO A;  2GQ2 A;  2LA4 A;  2H51 B;  3HZE A;  3NGT A;  1DTQ A;  3TEH B;  3KK1 B;  1N34 J;  2BBE A;  1YJR A;  3QWU A;  4X4S A;  1R6Y A;  2F9J A;  3G9C A;  1TKT A;  2J9D A;  1T03 B;  2IM1 A;  3Q0A A;  3FRY A;  2HQ3 A;  4JI8 J;  1UVI A;  4ECQ A;  1XNR I;  4CO0 A;  1BLU A;  2UXD F;  4OO1 F;  3CO0 P;  1CBK A;  4RLE A;  1UEU A;  1GAO A;  3BGL A;  3TVK A;  4CM2 A;  4XPC A;  1J2V A;  2CVI A;  2HKE A;  3BSC A;  5K8O A;  4YFU A;  2RS2 A;  3MAH A;  3FDS A;  4PWU A;  1U1M A;  2AE8 A;  4JI6 E;  2OPQ A;  4CI0 B;  4X66 F;  1MWQ A;  5C42 A;  2DNH A;  4DFJ A;  2G4B A;  1HW9 A;  2IDE A;  4LF9 J;  1VCT A;  1R6M A;  1LV5 A;  4QYR A;  1RHY A;  4RJV A;  1HYS A;  3TZZ A;  4MYU A;  2DH9 A;  2YQ3 A;  2HIY A;  3T9Z A;  4M5G A;  4K2J A;  2F8M A;  4RNH A;  3E51 A;  3NGR A;  4CLK A;  5HK4 A;  2CQ4 A;  1NEE A;  2O5D A;  4BLG A;  4U6P A;  2E5L I;  1G3O A;  2H1Y A;  4GKK F;  1XMO F;  2R7V A;  2QJ3 A;  4PYD A;  5H9F K;  2HRT A;  1RZM A;  1SC4 B;  2Q43 A;  1TL1 B;  1Y5I B;  2ZKU A;  3MCO A;  1XXE A;  1D6T A;  2JX2 A;  3MMJ A;  5EDW A;  4KSE B;  4K4X A;  4DSE A;  1NKE A;  2HYI B;  5EHH A;  4DV2 I;  2HNY A;  1YSJ A;  3DXS X;  2Q6B A;  5KFG A;  3CWV A;  1SXL A;  1S1U B;  3GYN A;  1RBO B;  4DFM A;  2PO4 A;  2OLW A;  1RWP B;  5A8K B;  2AX1 A;  4RO0 A;  2GGP A;  5CYQ B;  2A6M A;  4O44 A;  1WKL A;  5ETV A;  5FWK A;  2HND B;  4HTJ A;  1MWZ A;  4LCF A;  2Z2Y B;  4LSL B;  4NCG B;  4CWB A;  4ECR A;  4DV3 F;  4DV6 F;  2IC3 A;  1NAQ A;  2GMH A;  3CJ4 A;  5IC4 B;  1ZAX A;  3ZZR A;  2YNF A;  4ZK7 M;  1PVG A;  3J80 C;  4BA2 B;  3AQO A;  2BDP A;  1EP4 A;  3D0H E;  3PX4 A;  3K1J A;  1SKR A;  2X1F A;  3FMB A;  4ZVO B;  1QSL A;  1XN9 A;  2BAN B;  2XI2 A;  4IFV A;  2GIF A;  1BE4 A;  4LF4 I;  3UHM A;  1R8P A;  2KN4 A;  3MPY A;  3DOK B;  1MN9 A;  2XY5 A;  3KK2 B;  4PZV A;  5B0A A;  1TKT B;  4U8V A;  1M5V C;  4ILL A;  3CJ3 A;  4NA2 A;  4USJ C;  1M1G A;  1FK9 A;  4JBC A;  2B6A B;  3BYR A;  1ZPW X;  4GKK E;  5DGB A;  4MKB A;  4DUY E;  3JYT B;  2ZJQ Q;  4DV5 E;  2B8Q A;  3AY0 A;  4IOC Q;  4JI7 E;  3LP0 B;  4C98 A;  2XM3 A;  2R2R A;  1ZTW A;  3NEK A;  4KTQ A;  4LF5 F;  2Z5C B;  3SQG B;  2BVZ A;  4NXN I;  3OPK A;  5HAO A;  2W2M P;  4NWB A;  4UZC A;  2IA0 A;  2W2N P;  4DL0 C;  4B9N A;  3P3G A;  2HSE B;  2D3O 1;  3V81 A;  1VC5 A;  3AA8 A;  3R5B A;  4JV5 E;  4LSN A;  2R42 A;  3M6U A;  5DDQ C;  4ECY A;  2LEB A;  4O3Q A;  3PYE A;  1YI2 S;  1FRX A;  4RW6 B;  4Z37 A;  2PI4 A;  1OYP A;  3OUY B;  1S1W A;  1SUQ A;  2E5L J;  4JI0 J;  4LF8 I;  5THW A;  4I2P A;  3BN4 A;  4DV3 J;  6FD1 A;  4LFA I;  2POK A;  3P5B P;  4HLB A;  1GEH A;  1FTR A;  1VYA A;  2VC1 A;  2YKO A;  1N5Y A;  4LF7 J;  2WBR A;  2FIU A;  4X4T A;  1PKP A;  3BQ2 A;  2R2S A;  4AM3 A;  4IFD B;  3HVT A;  2ZH2 A;  1VBX A;  1OSD A;  2LDI A;  1FFW B;  2DH8 A;  4DS4 A;  3CCV S;  4DZD A;  4EBD A;  2OEJ A;  2G0J A;  3O6Q A;  4L6V 3;  1FNX H;  4LCG A;  2C37 B;  1I5O B;  4QPX A;  4CLY A;  2DEJ A;  2EFG A;  2F7V A;  3KLE A;  5JEA E;  1RT7 A;  4R0J A;  3G4S S;  4DV7 E;  3ZFV A;  2ZC3 A;  3GIK A;  3NY0 A;  5J2P B;  3KHH A;  1HNZ J;  1B64 A;  1H7U A;  5KT3 A;  3G82 A;  5C0X C;  3WX4 A;  4B9S A;  1P1T A;  4G1Q A;  4J9V A;  5KAK A;  1MU2 A;  5E3A A;  2C3U A;  4IOA Q;  3BS9 A;  4R25 A;  1FXR A;  2XYP B;  4F0H A;  1N5V A;  1KON A;  2WVB A;  3T41 A;  4QCL A;  5DRP A;  1RGV A;  2ZVI A;  3HSZ A;  5DET A;  4LF5 J;  5F8G A;  2HBR B;  1UMJ A;  2G2Z A;  3PRB A;  2PNZ A;  4ECU A;  3PX0 A;  4DR2 E;  1VR6 A;  1FRI A;  4OX9 I;  1RLD A;  4MK9 A;  3DCA A;  1IKX A;  1FWL A;  3NGK A;  2LQ5 A;  4LUB A;  5F8I A;  2KH9 A;  1YIT S;  2W7P A;  1U1K A;  2KO1 A;  2NN6 B;  4AL5 A;  1HR0 I;  1OSC A;  2R9L A;  1LWE B;  2HHP A;  2DD8 S;  1RT3 A;  4ZVF A;  3PHT A;  3A13 A;  4JI0 F;  4X4P A;  3KK2 A;  2QLJ B;  3LPY A;  2KRB A;  4WK3 A;  3HHL C;  2ADB A;  5CHC B;  5C0X F;  4ERD A;  2WB4 A;  5GAG I;  4X65 E;  5HL7 Q;  2OFG X;  3NAH A;  3PYG A;  1MG7 A;  5FII A;  2Z0G A;  3D2W A;  4KPC A;  2NN6 C;  3I0R B;  1JIH A;  3MMB B;  4DSJ A;  2BW7 A;  2LFV A;  4XPE A;  2QRR A;  4WZQ A;  3E3X A;  1P42 A;  2OGU A;  1VJW A;  1YRT A;  4ZP6 A;  5IOL A;  1HBM B;  2YQ0 A;  3SXL A;  2ASD A;  1HNW I;  3ELH A;  3TAM B;  1SKS A;  3FBB A;  2IAJ B;  2IJN A;  4F3M A;  2FJE B;  4MJK A;  2DR7 A;  3KMQ A;  3RRK A;  2BQR A;  1SB6 A;  4QNK A;  4I67 A;  4DR5 E;  2ZNY A;  3L95 X;  4P71 A;  3UN3 A;  3PS3 A;  3CJQ A;  5KFI A;  4P72 A;  2OUG A;  4KJI A;  4IR1 A;  4JV5 F;  5D8H B;  3UVJ B;  5FD1 A;  2IRY A;  5L1I A;  2RKI A;  4O0N A;  2ILY A;  2ZH1 A;  2KG1 A;  3K57 A;  2U2F A;  3B4D A;  4A8M P;  4LF8 F;  3NS5 A;  3OXG A;  3OW2 R;  4JV2 A;  1WI8 A;  2DNK A;  2QMU B;  4U67 Q;  1HI8 A;  2HMI A;  2XYH B;  2UUC I;  2YNH B;  4FKX A;  1HD1 A;  3W66 A;  3MZI A;  5IWA J;  1WTB A;  1IR2 A;  1GXL A;  3AHP A;  2Y0S D;  2KHD A;  2C2D A;  3DDK A;  4N7T A;  4L3N A;  2GO3 A;  1ZBT A;  3D4J A;  2OHD A;  1B99 A;  2ZE2 A;  3I6P A;  3MEC A;  3L3C A;  2X36 A;  4U96 A;  3FGV A;  3LAL A;  4F36 A;  4B9L A;  4F67 A;  3KNA A;  5HJX A;  1QAJ A;  4EMD A;  4DR3 E;  3IP0 A;  2H54 B;  2DXF A;  4ZPT R;  3QJL A;  4GMK A;  4NLT A;  4A8Y A;  1S99 A;  1VGY A;  2EWH A;  2FJA B;  1XR6 A;  4UZB A;  3LWM A;  4ECS A;  2GVZ A;  5F3T A;  5J1P A;  5T14 A;  2MY8 A;  2VOP A;  1YGY A;  4FPR A;  4Z2X A;  4DR1 I;  3TX0 A;  4ILR A;  1UWB B;  2N4C A;  4WFZ A;  1NND A;  4C0B A;  4Q43 A;  4JI1 J;  4LSZ B;  5EWF A;  2UVW A;  3AJ2 A;  1WKJ A;  3AOA A;  4GC7 A;  3G96 A;  2NCK L;  3I82 A;  4TVA B;  4LF6 E;  1IKW B;  2M5Y A;  2PO1 A;  1XR7 A;  1DLO A;  2IYI A;  5J2N B;  2VIC A;  1HHT P;  2OH2 A;  3WU3 A;  3R27 A;  3EYZ A;  2Q2E B;  2PMW A;  3RYL A;  5L1J A;  5JEA D;  1DQA A;  1XHK A;  2HWT A;  3KHR A;  1NPR A;  4ENO A;  1FFS B;  3D5M A;  4DR5 F;  4DFP A;  1UVJ A;  5KT6 A;  2XZW A;  4KH0 B;  2BJE A;  1HNV A;  3H25 A;  1U4B A;  4NLV A;  3M6V A;  1N5Y B;  1HNW J;  4PWD B;  4DV5 J;  5KFS A;  2BUN A;  1N5T A;  4MFB A;