4ED4A

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
303
structure length
299
Chain Sequence
b'SDWVPTGAVTVRAPGKVNLYLAVGDLYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 97
structure length 299
sequence length 303
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4ed4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ed4A01
1U2RA 1ELOA 4DPTA 2UXDE 4JI7E 3H4LA 4PRVA 2F4VI 1I94I 3ZM7A 1BKNA 2HFSA 2OI2A 4PRXA 2R3VA 1NHHA 2F4VE 1H7UA 2BV3A 1I94E 4GKJE 2V2QA 4USKA 1Z0CA 5LMUE 4DR1I 3Q1QA 2ZM6I 4JI0I 2VQEI 4DR1E 5L3JA 3OTOE 2VQEE 1H7SA 2ZITA 2UUCI 4XTJA 4JI4I 1FJGI 2UUCE 1XNRI 3LTOA 4DPXA 1MG7A 4DV5I 1N0UA 4LF6I 4DV4E 1XNRE 4JG4A 4FWDA 2HK2A 4DV5E 3GONA 3QT7A 4FWGA 4JI5E 4NXMI 4WUBA 2HHHI 4USMA 4NXME 3QT5A 5FLXQ 2HHHE 3ZZUA 4Z7YA 3JAMQ 1Z0BA 2BM0A 4JI1I 4DV3I 4FWHA 1RR9A 4RPFA 1N34I 4DV3E 4DR2E 4JI1E 4JV5E 1ZXMA 4B3RE 5IWAE 1N34E 4DPUA 4DR4E 4FN5A 1FWKA 4WUCA 1VISA 3K17A 2WW4A 1IBKI 4WUDA 4LF7E 4DUYI 1N33I 3J7AM 4DUZE 1IBKE 4I3HA 4HACA 4X65I 1Z0GA 1B62A 4DV7I 4DUYE 1NHIA 4GKKI 4X65E 2VQFE 1Z5BA 3J80Q 4DV6I 1HNZI 1N32I 4UTGA 4DV7E 4LF5I 1Z5AA 1PKPA 4DV6E 1HNZE 1N32E 5A2QQ 1B63A 2A2CA 1PIEA 3PYEA 4M1KA 4MYUA 3ZKDA 2UXDI 3QT6A 4JI2I 4DV1I 4JI2E 4GKJI 3WU6A 2EFGA 5LMUI 4DV1E 4DXLA 4R1FA 4Z7CA 4DR7I 1UEKA 3OTOI 1S4EA 5BR8E 1Z0VA 4DR7E 4DR3E 2XEXA 1MU5A 1J5EI 4DU7A 4DV4I 1J5EE 1Z59A 4DU8A 2LJPA 2UXBE 3WU4A 4DR5I 4UT4A 5LMNI 4JI5I 5IT9C 4DR5E 5LMNE 3LNUA 4DPWA 4YHHE 1FKAE 4FW9A 1HNWI 2GS8A 1ZM2A 3WU5A 2DEJA 4DR2I 1HNWE 3V2UC 4JV5I 4B3RI 5IWAI 3WU3A 2AJ4A 1KVKA 4DR4I 1HNXI 4JYAE 1H72C 3T1HI 1RREA 4X64E 4AQYE 1HNXE 1D6TA 3T1HE 3PYGA 1K47A 4LF7I 3CWVA 1IBLE 2DEIA 5GMEA 4DUZI 4P52A 2VF3A 3M6AA 2Q2EB 2VQFI 4OX9I 1ZM9A 2V2VA 1KKHA 1Z5CA 4OX9E 3ZKBA 2HKJA 2UUAE 1H74A 4KQVA 1H73A 3PYDA 1XHKA 1ZXNA 4EMDA 4DPYA 4LFCI 3J81C 3LPSA 1Z0WA 4K0KE 2V2ZA 4LFCE 4KHPI 1WUUA 1XMQI 1N36I 4KHPE 4B3SE 4LFAI 4DV2I 1XMQE 4PU9A 5LL6R 1N36E 2HFUA 2A2DA 5GMDA 4LFAE 1N0VC 4DV2E 2UUBI 5BR8I 4LFBE 2HKEA 2E5LI 4DR3I 4JI8E 4YY3I 2UUBE 1Z0TA 3B8HA 4LF8E 3B78A 1XNQI 2E5LE 4YY3E 3T1YI 1XNQE 4X66I 2UXCI 1FWLA 3T1YE 4URLA 4NXNI 4X66E 2V8PA 2UXBI 1MX0A 2UXCE 2HK3A 4NXNE 2J7KA 4B3MI 1OJ4A 2X7IA 3QT8A 1NHJA 2ZM6E 4JI0E 3F0NA 5IT9Q 4B3ME 4YHHI 3HULA 3B82A 3J7AG 4JI4E 2E1RA 1FI4A 3ZZ0A 1FJGE 1ZM4A 4JI3I 2V34A 4X62I 4JYAI 4LF6E 4LF4I 4JI3E 4X64I 4X62E 4HACB 4AQYI 1A6FA 1EA6A 1S16A 4DR6I 4LF4E 2BM1A 2X36A 1IBLI 4DV0I 1QZRA 4DR6E 5FLXC 2UU9I 2NPFA 1FNMA 4DV0E 1ZM3A 3JAMC 3V5RA 2UU9E 1DARA 3PYFA 4B3TI 4ED4A 3D4JA 4B3TE 1HR0I 2ZBKB 4P7AA 2UUAI 1HR0E 4JI6I 4HXZA 3ZZTA 4LF9I 4JI6E 1XMOI 3K1JA 4K0KI 3J81Q 2CZ9A 1IBMI 4LF9E 1N33E 1XMOE 1IBME 3J80C 4B3SI 4ZVIA 4GKKE 2R42A 4MYTA 4LF5E 4HYMA 1KTVA 5A2QC 4LFBI 1KIJA 4JI8I 4HY1A 1Z0EA 1PVGA 4LF8I 4JI7I 1NZ0A 1EI1A
chains in the Genus database with same CATH superfamily
3FDSA 2C2EA 1CC7A 1ELOA 4AL6A 4FW6A 4X66J 7AT1B 4LF7F 1HBOA 2MY8A 1U1MA 2FZGB 4IKAA 2BUNA 1YHCA 1NK7A 3I0RB 4OIXA 4XDCA 3FFIB 4DDFA 3CDBA 3Q2TC 4FVMA 3N01A 3G4SS 2HNDB 1FD2A 2UUCE 2AWZA 1HBMA 4JP8A 4K5SA 1YJVA 2ABYA 3VAIA 1XNRE 4OYOA 2KL8A 3DDNA 3DOKB 2GHWA 1HD1A 4KHPF 4QR0A 1PC5A 1JX4A 4WUBA 1D9FA 1HARA 1SC4B 4F04B 1Z0BA 2ZUGA 5K36E 1PBUA 1BQNB 4ILMA 4DR2E 4R0JA 4OZJA 2R2SA 4YR0A 3TUPA 3O44A 1Q0NA 4OI1A 4I6AA 1WNEA 3LAKA 3SQOP 3RZAA 1A7GE 3PS3A 3GR0A 2MLZA 3K17A 1RWWB 1TKXA 1IBKI 5KFCA 2B56A 1CJTA 4MU1A 4IOCQ 1PG5B 1OYPA 4W92B 2O1VA 5A8RA 5KFPA 3KJVB 1IKYA 3FBEA 4GKKI 4I4BA 4ZPCA 4X65E 2GC8A 1XQIA 4K4XA 3DLHA 2G2OA 4DV7E 4QWBA 2GA7A 3MM6B 1JLEA 1T9VA 2I0XA 1X9MA 1PBAA 1TK5A 3U1KA 1XN9A 3HZGA 4O4GA 5IM0A 4ZK7M 3K2YA 2FQQB 3OQ2A 3QWUA 2C39B 2CG4A 3A4TA 2BX6A 3PVXA 2JE6B 1HWIA 4F02A 4YOEA 3CMES 2DGOA 1Y7PA 3VWSA 3D9BA 1SPBP 4DSKA 2W2MP 3OTOI 4OO1A 3AODA 2Z58B 2IVYA 4RBUA 5ETTA 3UD5A 3N0VA 4IDKB 4TU8A 3H42A 5H9FK 2W7PA 3U02A 3LWLA 4DV4I 2YH0A 5J1EA 4DR5I 2HPUA 2ALZA 1JKHB 2QA4S 1PAUB 5IT9C 2HHHJ 1DTQB 5B08A 3ILJA 2CVEA 4DPWA 3KWMA 4X4PA 1YG0A 1RHJB 5DS7A 2XQCA 8RUCA 4B3RI 1UVIA 2DXFA 1IWAA 2NUHA 4DJBA 2QMXA 4ERDA 2PO4A 3QFHA 2PO2B 2JZ5A 3BDEA 1ZH5A 5I3UA 1U1RA 3W2VA 3AY0A 1F6TA 2FLPA 4CLZA 3N4WA 3EMTA 4ZVTB 4IFDA 5J1NA 1GXLA 4O3NA 2PE8A 3MZIA 1WSVA 2HVEA 6FD1A 3X1LB 3PYDA 3OTEA 2FGCA 4ILRA 3VZHA 2RVJA 4TYAA 2DH8A 2V2ZA 2XCAA 2LA4A 3LPYA 4FW4A 2O66A 3FCHA 3K59A 3KK2A 2E66A 2MKHA 4LFAE 4A8YA 4LFBE 2OPQB 3RYLA 4PABA 5CYMB 1OY9A 1M5HA 1MWYA 4DL6A 3MR5A 1XNQE 4X66I 4E98A 1R0AA 5DGAA 5D78A 5I3QA 1IBKF 3EXYA 3QIPB 4MU3A 4ZVUB 1SKSA 4ZVHA 2B6AA 1SV5A 3SSSA 4GKKF 2CPYA 2CYYA 3RG6A 1VGYA 1B70B 4CLPA 2VD3A 3TANA 4OZ2A 1EKSA 1IBCB 5F8GA 4HR2A 5KFKA 2VG7A 4RW6A 5IT9U 4ZLJA 4C11B 5F8IA 4CTAB 1QSSA 3NCQA 5ETPA 5B0CA 4ECSA 5A2QY 2H9ZA 1N6QA 1Q5YA 1T3NA 3JQKA 4C6AA 2VPWB 3OTOF 1WEXA 1EB0A 3W60A 2G4BA 5C2CA 1V3RA 4P7AA 3BQ0A 4E0DA 4GRSA 4DR5F 1KQKA 3D7SB 3GU0A 1OPZA 4QPTA 3DLEA 1XMOE 1TU0B 5D4NA 3M2RA 1UJ6A 1GMUA 4ETXA 3I4HX 3TNVA 2JDJA 1VK3A 2BQRA 4OI6A 2WVCA 4B3RF 1QD1A 4ZP9A 1SH0A 2B7CB 3DLGB 1Y4SA 4KB7A 2ZHAA 3M85D 4CYUA 1UDSA 2UXDE 1PAEX 1QLNA 4M94A 2ZJRQ 2CADA 2E9TA 3MECB 5E2QA 1S1UA 4Q44A 2CXEA 3CJ0A 5IC4B 5GMKa 4IZKA 3MHYA 3LP1B 3RB6A 3OSNA 1C1BA 3JQMA 2CPDA 2KXNB 3BSCA 5C24A 3PW5A 3E51A 4QW8A 5EKWA 3FSXA 4UOHA 3OBIA 1FJ7A 1UKUA 4K0KF 4C4WA 2F3JA 2XI3A 4DV5E 3GONA 3THPA 4LRBA 3N6MA 1SXLA 2HHHI 3G86A 1F3FA 1NU4A 2ACMA 5DZ7A 5EX0A 5FLXQ 2XCPA 1NSKL 2YNIA 1Y0HA 4WP3A 3M05A 4NX9A 4K4UA 5J2NB 1UPPA 3SFGA 4X66F 4ISAA 1GX5A 4C8KA 3EUNA 4NLOA 2AYMA 2DNNA 2VB6A 4LF7E 1Q7LB 3TJ9A 3I55S 4RX6A 1KVJA 1B62A 3AD8C 4G1PA 1Z5BA 3GV5B 2OPPB 2MQMA 1Z5AA 3ZTSA 5A8WB 1F9HA 4MYUA 2PO1B 2V5HG 5AE2A 3CEDA 3U1YA 1AA1B 3KG0A 1P1TA 2FD2A 1NJXA 2YWWA 4J9PA 1KEKA 5LMUI 2I2YA 3QPIA 1WF1A 2W7OA 4J9SA 1WG4A 3D66A 1T9YA 4ZP6A 5DNLA 1LWXA 5AXNA 2XEXA 3A3OB 2ILZA 2OHDA 2OGUA 4K8RA 3LW5C 2IA6A 2B9YA 3F41A 4YP3A 5L38A 3KFWX 1J5EE 3QLHB 1VRQC 4JI5J 5C0XC 1RAJA 1JXLA 2BW7A 2DCLA 3EGVA 3QATA 2HW3A 2QMUB 4FW9A 4H4KA 5D3GB 5CD4H 4QIEA 1AFJA 5CD4A 2ZDOA 5CA5A 1RAGB 3MUMP 3MCSA 3BQ2A 4WWSA 2IM3A 3FBFA 2DH7A 1NHVA 3K8WA 2DEIA 2XG8A 3R2CJ 1G6BA 4DUYJ 5GMEA 1SL2A 3DI6B 4I2QA 3M6AA 4NEZA 1NKEA 2OAUA 2ZH4A 1N4LA 3IP0A 1CG2A 1M1GA 3I5BA 1C4CA 2J5AA 3GYNA 1MMLA 2AJFE 1XC9A 5L1JA 3KUHA 4FKXA 1VI7A 3GIRA 1EHWA 3KLGB 1XBWA 3KLEB 4PWDB 1IKXA 3M8SA 4YFUA 1YGYA 3O5TB 2RU9A 4J37A 2Y1JA 4C8MA 4U8VA 1NK9A 2HHHF 2FY8A 2BJ7A 2Y0SD 1NSQA 3TI0A 5LL6R 5DG7A 3DOMB 4EBEA 2FVCA 2F4FA 3MDFA 1Q8BA 4YY3E 3EDRB 1RTZA 3IXQA 4DI6A 4ENOA 1IKWB 2Y1IA 3EWGA 3W2WB 5K9FA 1TKZB 3ET6B 1YDLA 3M2UB 2XZWA 1SUQB 3ENAA 3W64A 2VJVA 1IQTA 4U96A 4MAKA 1QTMA 2JEJA 3MEKA 1HNXJ 4WE1A 5B0EA 4YR2A 5K5MA 1S6QA 4FYXB 4NLSA 3FSYA 5HANA 4HACB 2GJIA 2I6WA 5JXSA 2V8GA 3GYGA 3PJWA 2XNRA 1SKWA 1AFIA 2IESA 3UNYA 3QJPA 5LMUF 3KK1B 2I5JB 4DL0C 1S1XB 1TL7B 1UTAA 2VESA 2UU9E 1RWUA 1N48A 2WHOA 1RAFB 3B6BA 1OSCA 3JSMA 1QAXA 4AT1B 5KFYA 3UCZP 2KM8C 4HXZA 1JLGB 4NI2A 1VJWA 4F25A 3A8IA 2VG6B 1XMQJ 3SQGA 1Y5LB 4GKKE 3HT3A 3P3DA 3FUYA 3W65A 3PNIA 4OLOA 2IJNA 1SJFA 2AGPA 1AXQA 4HY1A 1LEOA 3CIMA 1EP4B 3T1YJ 1M1KT 3EVWA 4OL8A 1UW4A 3T5KA 2YX1A 1UFWA 1NHHA 2L3MA 4NWBA 1IKVA 4USWA 4ER8A 4B3MJ 1LWCA 1WC6A 3UN5A 2BA1D 4DR1E 3BF4A 3OTOE 1RT5B 3T19A 2KZZA 1H7SA 5CZVA 2MKCA 3CJ2A 5HATA 5IFMA 3IRXA 2ROPA 3T9NA 2KFYA 2R8HA 5HMZA 3B4MA 1S5ZA 3CJTA 4Q2LA 1LWFA 1MG7A 2Q6CA 1Q78A 4DV4E 2JEFA 4ED0A 2QO3A 2HMIA 2ZBRA 1FRKA 5K36D 3CCSS 2K06A 1RTJA 2H1YA 3MPVA 2F63A 5GAHU 1F5AA 3GCMA 3WDOA 5DG8A 2ATCB 3IWLA 2JLGA 1IXKA 3DKDA 4H4OB 1NPRA 2M2BA 4DV3E 4JI1E 4B3RE 1NHUA 1YJ7A 2UUWA 2P9CA 3G2XA 1S6PA 4C2MA 4K4YA 2VPZB 4P71A 3L4BC 2R7XA 3NGTA 4ELUA 4DUYI 1CS4A 1U1PA 4PUOB 1SI9A 2L9DA 4A4JA 4IZJA 3QQCD 3L09A 3UDCA 3KOAA 4QNJA 4DV6E 1HNZE 4LVOP 1EQMA 1B7YB 4ELTA 4OYWA 5DNXA 1CSJA 4LCHA 3I31A 2XWYA 2OEKA 4KY3A 3M7ND 1WJ9A 4JI2E 4QW9A 4B9LA 1Z1ZA 4Z7CA 1ZAVA 2DGWA 2HWIA 2CA9A 1Q16B 3EGZA 2IAJA 5E5NA 3KNAA 5SZTA 1FNXH 2R8IA 3S6EA 1KNZA 4WK1A 3A1YG 2KYZA 5JEAC 5GADU 4OI2A 1E3PA 2GMLA 6FDRA 1VLOA 4P72A 3MI7X 4ZPBA 2M7SA 2PDAA 2ZBCA 5AJ3F 1RT1A 3SCKE 3KLVA 4DLEA 1FX4A 1P9YA 1RISA 4PG8A 1VQKS 5F8MA 2ZDPA 4WKRA 1HNWE 3H98A 4V1Ak 1U1LA 3D1OA 4F50A 1HNXI 2O3DA 1GNKA 2YKNB 1WHXA 2XTJP 2DT9A 3CCTA 1S1TA 2DY9A 3GQCA 2BJDA 2XMAA 2KI2A 4LT6A 2LLZA 5DDQC 5ETVA 5D4LA 3MEDB 2MKIA 2D9OA 1LXNA 4OO1C 2PNZB 1RTDA 4CDIA 4FYDA 1ZM9A 2V2VA 1VQPS 3MPYA 2AJ0A 4OX9E 3G6XA 4ECRA 3L7ZA 3DRPA 2B7BB 5K36A 1CJVB 2YVSA 1Z0WA 3QGGA 3BYPA 4DSFA 1XMQI 1UDNA 2XY6A 4OQJA 3MM8A 3GZ7A 1SC1B 3FZ2A 1WKKA 1A6LA 4DCJB 2A2DA 1T9UA 4F4AA 3I6PA 1GX6A 1X4BA 5BR8I 3QRPA 3C19A 2FUG9 1V6HA 3TOQA 2WBMA 2IRUA 4G65A 3T1YI 3GWCA 3M7VA 2BW2A 4WFXA 5FLXY 1HW8A 3DXSX 2D3OR 4DUYF 2XMMA 2J6SA 3OJUA 4B3MI 1OJ4A 4WTOB 3LOUA 4IFDC 2CVIA 1H2TZ 3P5BP 2DO0A 4GMKA 3I0SB 4CLUA 3MM5B 4ANCA 1NH8A 4ZDNA 2E1PA 3JXOA 2WNRA 2C2KB 1YJTA 3BGRB 1AYEA 2QC3A 3TAMB 3UDEA 2NS1B 5ADZA 1T0TV 4X64I 3BDPA 5AXMA 2B43A 2PC6A 2MLXA 4J91A 1NCLA 4DR6E 3R1LA 1IJEB 4DV0E 2LQBA 3JAMC 4UZCA 1MNEA 3RB3A 2W8LA 1KC8T 1DARA 3O6QA 3MMBB 4ED4A 2ROGA 2WVEA 1B0TA 4YR3A 3PIPQ 4IOAQ 2CQ4A 1FRXA 3NS5A 3HPOA 3C6UB 2IRYA 3ZZTA 3K8VA 4DQIA 1MN7A 1NK8A 2HNZA 5HMWA 3EVMA 4OV1A 3TRGA 1EARA 1AW0A 4FF1A 4ED5A 1R6YA 3OT9A 3ISNC 2UV8A 4R8UB 2QV6A 2OPSA 1SC6A 1VC0A 4O44A 3GR1A 3HHEA 4NBQA 1HNXF 2RKIA 3AB2B 3WHIA 3UO0A 4C48A 2UXCJ 1DY3A 3CCJS 1X0FA 2HFSA 2XMVA 2OI2A 2CDQA 2BJEA 4YB1P 1Y3KA 2RF2A 5KT5A 5D0RA 5LMUE 2DNGA 5LXRA 2QN6B 1I3OB 1ZS6A 4YHHJ 3G6VA 2O01C 1XWLA 3PM9A 3BEGB 2ALYB 2BQUA 3KKFA 2W9CB 1N5YB 4ECXA 4X4QA 2YNFB 3GLJA 1AROP 4KO0B 1AUSL 5LSRA 3C2PA 5KFJA 4A8SA 3RRGA 1XMQF 2Z8QA 3DRSB 4PXCA 4FW3A 4LIRA 2QYCA 5DQHA 4Z7YA 1FKOA 2XO7A 1R8PA 3OFEA 1N5VA 4CLKA 1EZZB 1J2VA 3OR2B 2VA3A 5KFMA 4UW2A 1WORA 1HR0J 4P6QA 4LQ9A 3UHMA 3T1YF 1N34E 1FWKA 3W9IA 5KFWA 4IH7A 1N33J 4USHA 3SSRA 3JAMU 5EWEA 3N5FA 4B3MF 4M5JA 2Z56B 3KUEA 5ITHA 2IOQA 5CYQB 3CIZA 3P49B 3QRQA 2B3TB 2V69A 1MWQA 3CJKB 1N52B 4O23A 5ETOA 2MZQA 4X64F 2F8HA 1C0TA 3HKMA 4GKJJ 4MIAA 2QGFB 2HHWA 3S8SA 1GEHA 2MZJA 4ILLA 3PEHA 1Y00A 4KH1B 4AIMA 3D0IE 4CO0A 4LSZB 4DR7E 2D3O1 5HBMA 3J7YU 4OHYA 1XR5A 3BBFA 4LCFA 3C14A 5M2PA 4J9QA 4FPRA 1Z59A 4LR9A 3MOZA 1NJIT 4BBYA 3OR1A 3T41A 5LMNE 4RNNA 2RH3A 3G6YA 2ZZMA 4OZ1A 3ZTRA 3CSKA 2RHQB 1ZM2A 2DEJA 1BWVA 4R5PA 1HW9A 2Z2ZA 2R7OA 3UPFA 4W4MA 2COLA 3AFGA 1TKDA 1ZPVA 4LIWA 3Q83A 2WAQD 1NHKL 3U1MA 3CVKA 4ID5A 3LQVA 3MAAA 2WP8A 1VRUA 1S76D 2OMLA 2GW8A 3DHXA 4KPYA 2DHXA 4NE9C 2J7UA 1S0NA 2U1AA 3M8PA 1R8CA 1Z5CA 1YBAA 1WG5A 3RR7A 1U1NA 1F2HA 5L1IA 2FHMA 5K14A 2NCKL 3Q6MA 2DR8A 3SZ2A 1S1WA 3M2VA 3M6WA 1SH2A 2CAJA 5D77A 2EK1A 3DU5A 3HSZA 1S72S 4QWEA 2ZE2A 3GPAA 2BABA 3DLKA 4LSNB 4AE5A 3P5TL 3T5JA 1Z4UA 4OX7A 1WC5A 5BYSA 3JSYA 2LFVA 1P1LA 2VASA 3WIVA 3MR2A 4KGVB 3UQSA 2UXCI 4TY8B 3RBDA 3VR1A 4NXNE 3P45B 2HVZA 3QT8A 4FS2A 3D2WA 3VV2B 3J7ZT 1WHYA 3U7JA 4B3OA 4YHHI 1QSLA 2VOPA 1UVKA 1FFSB 1WF0A 3HULA 3W66A 4CO2A 1WC1A 1YLXA 3I0RA 4TN2A 4JV5J 1FI4A 1FO1A 2R7SA 5J1PA 4AQYJ 4NLXA 3T1HJ 3NGSA 1RWMB 4L3KA 4WYWA 4A47A 3QGIA 2RILA 2ZWPA 1RHRB 3BR9A 2V8HA 4RL1A 2VQFJ 2DIUA 3DOKA 1W26A 1VK8A 2BA0D 4FBUA 3M9NB 2EEYA 3CCUS 4UY85 1VQ9S 1Y5IB 2HVHA 3D4JA 2FB0A 1HR0I 1RT4B 3ZZZA 4LREA 2HQIA 3MEGA 1SJRA 1BQNA 5L1LA 2H4YB 3W63A 3IC1A 3POTB 4LF9E 2RRNA 2ZFHA 4B3SJ 4HHUA 3PX4A 2J8AA 4F4WA 2Q79A 3FQLA 2L08A 2ZHOA 2E29A 2GIQA 4NYZA 2FTRA 2UUBJ 2W9BB 2JEBA 2F8EX 3GFZA 4QIVA 5FIIA 4JI8I 4NA3A 3HXMA 1SQEA 3AQPA 1DURA 1NZ0A 4NL5A 2FHOB 1U2RA 2BR2B 2VICA 3VQSA 2X3DA 3IS9B 1YITS 1R3NA 2ZM6I 3BB5A 4JV0A 2ADCA 2APOA 4NRTA 2C39A 1SCJB 2R8JA 4LPFA 2ZD1B 5HMXA 2JE6A 2VQEE 1FWPA 3OL8A 3RAQA 2D41A 4FYYB 4KHRA 4HL9A 4EBCA 3LP0A 2ZH2A 1G7CB 5HP1B 3KHLA 1DQ9A 2AKWB 4QYRA 2CWXA 3CDUA 4IDKA 2AU0A 4L76A 3O2IA 1KR4A 3GLLA 1FF2A 2CQBA 3L3CA 4DQQA 5IT0A 1JKHA 4CH7A 1IR1A 2Z4PA 1UL3A 2OTLS 1DTQA 4CO4A 2FLNA 2UVVA 1FDAA 2BRLA 2ZUAA 1RSCA 1U02A 2V4JB 2UXCF 3K5LA 2L41A 1F5CA 3J7A1 4PG5A 2FZKB 3HFZB 2MQOA 1MROB 3ZTOA 4KKOA 3SFUA 1KHWA 4YHHF 3FBCA 2F7VA 4ZVQB 3M85G 3CC2S 3MD1A 3FVYA 2PO2A 2NXUA 2WSCC 3P06A 1JLCB 2HG4A 1VYAA 2WZ1A 3OTDA 1PO6A 1QVGR 2XB2D 4DQPA 2E5GA 2VPYB 1FX2A 3HVTA 5KFGA 4IR1A 3KTQA 4OHVA 3PRYA 2CG8A 3CTRA 2NSBA 3NMRA 2MZRA 3NRBA 1HWJA 4AD6A 2NLWA 2R2RA 1YZ7A 1W2IA 2HVDA 3OLAA 1K0VA 4JI0J 1M90T 2ZH7A 1YRUA 2VFSA 2JX2A 2W25A 1KSPA 1S4FA 5BR8E 3I87A 3TX8A 1HR0F 2UUCJ 4JI4J 4RUCA 1K1QA 4WXWA 1EX8A 1K0TA 2XMWA 1XNRJ 5ETMA 3LO3A 4X4SA 3W7BA 2Z57B 5AXLA 5KFSA 5KFNA 3CCZA 5I42B 1ZAWA 2DNQA 2YX7A 2OPQA 4GVBA 5CYMA 3MMAB 4I68A 2FJEB 3K5OA 1TL3B 2WVFA 3QIPA 1RYSA 1NEEA 1ZBTA 2N7CA 4DR2J 1R31A 4OZNA 4A8XA 4JV5I 1B0VA 3SCJE 1HWUA 2W2OP 2K7KA 3T1HI 4X64E 4Z2XA 1D8ZA 1U1KA 1UJ4A 1M5KC 1OWXA 3TX0A 2KB2A 2ZM6F 2ASLA 3NP5A 4X65J 1B4SA 3TUZC 2E44A 4DV7J 3Q23A 3H4DA 2VQFI 3KLIB 4NZ7A 1X4HA 1NJWA 3L7PA 2XHWA 1FRHA 4CTAA 2DNZA 2PMHA 3A12A 3KLHB 1BQMB 4K4VA 1U25A 1KLNA 2B5JB 3J81C 3LPSA 4FNIA 3VHQA 4LFCE 3T1AA 3R1HA 1U6FA 4DX7A 4FW7A 4WP8A 4OZEA 5DGBA 3IWNC 5KFOA 1KVIA 3T6BA 1Y5YA 2HFUA 2RS8A 3AXKA 1HL6A 2UUBI 3WX8A 3QAEA 3PHTA 3FEXB 2VJUA 3R5DA 3IM9A 1Q53A 2HVIA 5HI7A 5A8KB 8AT1B 4RW4B 2UXBI 4MH8A 2QL9B 3DLGA 4TVAB 2W1BA 1S57A 3KHGA 2JLEA 1NJYA 3MUVP 2EFVA 3R9LA 2C37B 2IMWP 3MECA 3B82A 2CPIA 1B99A 1WF2A 3CW2C 2IM1A 3ZTPA 2HHXA 4JBCA 3LP1A 5J2QB 2I38A 1JLAB 2FC9A 2IPOB 1BHNA 3MM9B 4RKUC 1RBAA 1H7XA 5C0XB 4HT7A 3M6XA 2GJFA 2CJAA 4IG3B 2E7VA 2X36A 1IBLI 4FVCA 4LVNP 3ZO7A 3BZQA 4Y34A 1HA1A 1HPZB 5EL9A 1KQSR 3ZZOA 1CJKB 3KDNA 2R8GA 1T03B 2NQPA 4K59A 2RQ4A 2DNPA 2ZH8A 1GXTA 3CDJA 2BR0A 1WACA 2XBPA 5KT6A 4MIBA 4ELVA 3BGUA 2FVRA 4ID8A 2A10A 1QJHA 1SIWB 4LFAJ 4N41A 2GO8A 2HGLA 1RWOB 5KG0A 1PILA 1NXIA 1T05A 5GAGI 4JV5F 4BA1B 1LOUA 3CUNA 4YDXA 5L1KA 4A8FA 1XNQJ 1FE4A 2YKAA 3J81U 3T1HF 2OPPA 3ZC4A 5LJ5Y 2K7JA 1F3VA 5A8WA 4C9DA 1YHQS 1H7UA 4USKA 1RCXB 2IJFA 3W9HA 4IO1A 2PO1A 3FJ2A 2YWEA 2DGXA 2VQFF 2PN6A 4JI0I 3W5YA 2KVQE 2V4RA 1BLUA 2DNHA 3NBPB 1F1BB 2ZITA 2UUCI 1H0HB 5DG9A 4JI4I 2QG9B 1WG1A 1XNRI 2W4PA 2ZC4A 1EETB 3CDAA 4M5DB 1RYRA 1UA1A 4IYQA 3MM7A 2Y1RI 3FQKA 1REGX 2AW0A 4IQXA 2ZBQA 3K85A 2NN6B 3QLHA 4QU6A 4RO0A 2N4CA 4DS4A 2MZSA 2UUBF 1PYTA 3N6NA 3H5XA 5L8RC 4RPFA 4PPDA 1S6OA 1ZXMA 1NUEA 3D6MB 1ITPA 3ENWA 5C25B 3V6DB 4A8OA 4KGZB 1JLQB 5D3GA 2R7UA 1XMOJ 2IIHA 2JFKA 3R6GB 3THTA 5GAEU 3G8TA 5KG6A 3M9OB 4I3HA 4X65I 2UZAA 4FF2A 2NN6F 2F40A 4DV7I 3FBBA 4G1QB 3Q6NA 4YUDA 2MSTA 4MIWA 5KT7A 1VS3A 1AUDA 3DI6A 5CABA 1LWEB 3K5PA 2KM8B 2UXDJ 1XIQA 3HHLB 4LF1A 2BA1G 1N5SA 2LQJA 1X7VA 2OPRA 3LGHA 1IBLF 3KLGA 3R5JB 4DV1E 4PWDA 2BQ3A 1T9TA 2HFVA 2O5DA 2XGPA 3SIPB 4B9TA 2BJ8A 1S1VA 4DV5J 3DOMA 1PC4A 4F3QA 1R8BA 4C98A 4N5SA 4NMLA 1IKWA 4XTTA 3W2WA 4HYKA 3UW1A 4YHHE 2M8DB 1OPIA 3VCDA 5DRKA 2D7SA 3IA0A 3MMCB 1TKZA 3V2UC 2R8KA 1HQEB 3CC4S 2AJQA 1TELA 3M2UA 2GO3A 1SUQA 1UVMA 1NPPA 3CCRS 3FK4A 3G82A 3DRXA 3SYZA 4DUZI 3T6JA 4JI0F 2QIFA 5F3ZA 4GO7X 3M7NG 5ETRA 2UUCF 4JI4F 3ZKBA 3KK1A 4Q43A 8ATCB 1OSDA 2Z2LA 1NK0A 2I5JA 2Y9HA 2HLTA 1TL7A 1XNRF 3M1VB 2R9LA 4U3BA 4QR2A 2JC0A 3N28A 4F3MA 1HBOB 3AD9C 2K3IA 2MMYA 1X9SA 3EJMA 2AF6A 1UAWA 3Q24A 4WTYA 3R27A 2ZNYA 2LCWA 4F67A 3KMQA 4NZ6A 2FJBB 4NLYA 4LFAI 1N36E 4J90A 4OJGA 1YTYA 2RNEA 2G1HA 4K4TA 2AE8A 3I5CA 5DROA 2VG6A 3I96A 4JI8E 2RB7A 2BOPA 2AJ2A 2CPJA 1D9DA 1XNQI 2E5LE 1RAHB 1J5EJ 2GQ2A 4P74A 1RTHB 3NKYA 3UD4P 4DL7A 3ILLA 1LV5A 2DRDA 1FWLA 5CZXA 3AA8A 4NLTA 3RGIA 1X4GA 3QJJA 3JTOA 4X65F 2UV8G 3NWGA 1EP4A 4NLPA 4DV7F 2ZM6E 4DQRA 3F0NA 1W7WA 3H25A 4WP9A 4ED7A 3GJQB 4QWCA 2CPZA 4EZ9A 3HSDA 3D6TB 3NGDA 4PEOA 5JEAB 4LMZA 1HMVB 2ATLA 2W2NP 4WFNQ 5A8RB 1SQFA 3LH2S 1S16A 4OFZA 1MN9A 5EN1A 5DRQA 2AIRB 2YNGB 3MCOA 1QM9A 3TWZA 2QFJA 1ZM3A 3V5RA 1NK4A 4O4GB 4JUZA 2W01A 4MK9A 4DL3A 2R7VA 1KONA 4B3TE 2Y1LB 3D67A 3BGOP 4OYBA 4H4OA 3KHHA 4QU7A 1Q1KA 5EDWA 1TFYA 1XMOI 2XS7A 1VQYA 4CCHA 3FZBA 3CWJA 3IG1A 4IS9A 3EICA 1TL1B 1IBME 3J80C 3DLLQ 4OI4A 2X51A 4Y2CA 1MW7A 3DRRA 2CJXB 2Z5BB 2DGVA 2ZZNA 1E6VB 4U8YA 3EXCX 4YB6A 4PUOA 3VGTA 4YY3J 2ACYA 2BANB 4X4RA 3WZ0A 2FDNA 4F7VA 1RGVA 4Q45A 2N3LA 5J1EB 1K44A 2FPHX 4JI7E 3QBCA 2EXUA 1X9WA 4IQMA 1HI8A 1KS2A 4F36A 2F4VE 1LNQA 2BV3A 4DUZF 2D9PA 5B7WA 3K0JA 1TUWA 1DTTB 4DS5A 2ZH5A 3OL7A 3C46A 3DD6A 2K1RB 2JEGA 4UOFA 3PIOQ 2BDPA 3W5ZA 2C3YA 3QWPA 3IM8A 2DNLA 4DV5I 4ZCKA 4G6VB 3TO8A 4JOUA 5AE1A 5I3UB 2ZBPA 1IM6A 3MAQA 2MZ1A 5C0XE 4FKYA 2CNOB 1TQLA 1RBOB 2WOMB 1UWBB 4IFDB 2UU9J 4LFAF 3W3SA 1VQ5S 1Q4RA 1NMEB 3HFVA 1WEYA 3R5AA 2LQ5A 3HI9A 4AL5A 3CD5A 1XNQF 4JV5E 1OYEA 1SIZA 1XR7A 4CM0A 2O3ZA 1VCTA 3PKMA 4U7UK 2J0WA 1RKJA 1VJQA 3Q0AA 1T9XA 4TLRA 3RB4A 3BBBA 2CGEA 3QIDA 3DDKA 2RD5C 4IH6A 4GKKJ 2AX0A 5A0YA 2YKNA 3AJ1A 2Z5CB 2VQFE 3CCQS 3BR8A 2EPIA 1GTEA 2AYEA 5DDPC 1FXRA 2YNHB 3K5MA 3MEDA 4EO8A 2B4VA 1WC4A 3SXLA 4ZKAA 2PNZA 2YWKA 2DGSA 2HHTA 1SL1A 3SV3A 3IR5B 2W4DA 2HS3A 4LRAA 3OXGA 2H4WB 2CQ3A 3J80U 1WKJA 1GMVA 4QWAA 3HKWA 3KYLA 3R97A 4DR1J 3P6YC 3GIMA 1RABB 5HO4A 2C1EB 1CJVA 1UEKA 4CT9A 3QZ8A 4MU4A 5BXIA 5KOXA 3E01B 4PG4A 2CNKB 2OFGX 2XS5A 4RW6B 1TVRB 4DV4J 1J5EI 1UDOA 2MKJA 3D6HB 4FP9A 1XMOF 4IFVB 2LXFA 4ZMMA 2UXBE 2PIIA 3T5HA 4X2BA 4O0NA 2NN6E 2YX4A 1HQ2A 1UFKA 1I1GA 3Q8PB 2UVRA 4DV3J 4JI1J 3CD0A 2P8IA 4B3RJ 5GVQA 3DFEA 4EWTA 3V6JA 4IUFA 4LSLB 5KFXA 3EDQB 1PJ5A 3DLEB 2F1FA 1YSJA 2LP4A 2DGTA 1ZA2B 4O4RA 5AXKA 1IBLE 3KRNA 1DQ8A 3BGRA 3HJVA 4LOMA 3TAMA 3M8ZA 4BA2B 4DV6J 1HNZJ 5DRRA 1OY6A 4AIDA 4LF5J 3CNQP 2EBEA 3EM1A 2VONA 4OZLA 3A3NB 4KH0B 3RU0A 4CYUB 4RU2A 4DG1B 4X4OA 1OYDA 3PRDA 4DV5F 3E8OA 1H73A 3JTPA 4FNHA 4OMFG 3CJ3A 4EMDA 3MMBA 2IM2A 4JI2J 4WU2A 2YKMB 4D3GA 2VIHA 2MEWA 1C1BB 1OO0B 3BM7A 3MAHA 3C6UA 4CO3A 3W9JA 1H98A 1X60A 1VQMS 5HAOA 4DV2E 3DGVA 1J5OA 2OD4A 4DR3I 4YY3I 2VFVA 2QYGA 1Z0TA 2MJNA 3PR5B 4LF2A 3EZUA 4N47A 5FDLA 1C1CB 4XPEA 2VH7A 2XS2A 3WC2A 4KGMA 4F0MA 4GQUA 5KOWA 2V8PA 3TZXA 1Y10A 1N56A 2OLWA 2J7KA 2DHAA 2YNIB 5B09A 4JI0E 2MLYA 2QSWA 3LWMA 1HNWJ 1U26A 2ZVSA 3QNWB 1W2BR 3QRRA 4JI4E 1QVFR 1YJNS 3G9CA 2HFNA 2V34A 4JYAI 2XULA 3TZZA 4CT8A 4CNZA 3M8RA 4JI3E 2W9CA 1N5YA 1A6FA 3PV8A 1X5SA 2YNFA 1TAQA 4LF4E 4C8ZA 2DJWA 1R89A 2UU9I 1FNMA 2ZVIA 4Q5VA 4EU0A 4OX9J 3RR8A 1V5VA 4DUTA 5CCLA 3DRSA 3QGPA 4OZ5A 2A18A 1NRKA 1J5EF 2J9CA 1FVQA 4I56A 4TYBA 4BDPA 1Y5NB 1WDDA 4KTQA 3OR2A 2X1GA 3TUJC 1WDTA 2R2TA 4PWUA 4P2SA 3UR0A 2OFHX 3NWRA 2X1FA 4IR9A 4ZVIA 3GFXA 2XNQA 1YZ6A 4PXDA 2PA3A 2ZJPQ 5A2QC 4IG0A 4CLTA 1KIJA 1UPMB 4OI3A 1YK9A 5CYQA 5A76A 1OY8A 3GJSB 3ICLA 2HNYB 3H4LA 5DQIA 2BOAA 3GG0A 3CJKA 1S9EB 1U8WA 5B0GA 4PRXA 1CJUA 3EZOA 2H3EB 3IBCB 2DVIA 4DR1I 2O1WA 2G0JA 3M30B 2OP5A 5HLFB 1MSWD 4EUVA 3MTJA 1VQ8S 2HHQA 3SSQA 3VQTA 1HQUA 3GIKA 3LTOA 1G4CA 5JEAE 1QTNB 5E41A 2BA0G 4JG4A 3EE3A 5IXUA 4DR6J 4ZJOA 4DV0J 4ZPAA 2OJ3A 4ZP8A 2XZTB 3OW2R 2ZH3A 3QT5A 4ZN3A 2RJZA 3ZZUA 4TLQA 1GFWB 2GO9A 3QZ7A 4JI1I 4DV3I 3TAPA 4DR3F 1L3SA 5E3PA 4YY3F 4ED8A 4EYHB 1CLFA 3VALA 1IKXB 1L3KA 3Q8VA 1UP1A 4HTJA 4KV8A 5K8PA 1M5VC 4OYZA 4DUZE 2WVBA 4L73A 3NL0A 5L9NA 4DV6I 4E8UA 1HNZI 4UTGA 1BC6A 4LF5I 4YDDB 5CYJA 1TV6B 1B63A 3OJSA 4JYAF 4M5HA 3HHKA 4NOHA 3RTVA 2X1AA 2A6MA 2CQIA 5SUHA 4ETZA 4JI2I 3CJQA 5LMUJ 1VBKA 3KG1A 2UU9F 2LU2A 1GH8A 3KDOA 2C22A 5A2QU 1HBUA 1FJEB 3SI8A 5AT1B 3DDIA 3CCMS 3H0PA 4RW9B 3U1NA 1XMBA 4LSNA 2XSJA 1U8SA 3DGPB 4A46A 4ZLNA 2ASJA 3VAGA 3WU4A 2GGPA 2AYBA 3M6UA 2EW9A 2EWHA 4IFDE 2MGZB 1QAIA 3GIIA 2P2CB 1YI2S 5M2RA 4DBQA 4TY8A 5RUBA 1HNWI 4M8LA 4LCGA 3BGLA 2WCXA 1N34J 5IWAI 1PYOB 2AJ4A 2EFOA 2MQNA 4DR4I 2AEMA 1RREA 3LF0A 4BWMA 4DR1F 3CC7S 2SXLA 1HNVB 4NYPA 5L39A 3FC9A 4ZP7A 4OX9I 5CAAA 4DQSA 1RAIB 2ZKTA 3BO3A 3OL6A 3GCXP 4QQBA 4DV4F 3FKBA 2IYIA 4I6YA 5T7LB 4U7UD 4C0HA 2DKOB 3JQJA 4HH1A 4UQTA 1RT4A 3ONQA 2QX0A 2HHPA 1FNOA 5ETSA 3MOJB 4Y0FA 4PU9A 4DV3F 4JI1F 2KFZA 4DR7J 2KJWA 3POTA 1USVA 4O3PA 1LWFB 3UFCX 2DNMA 2AGOA 2JEIA 2BE7D 1FRLA 2HMIB 5D0GA 3NEKA 3KXDA 2W9BA 5D0HA 1P42A 3PJXA 4V19J 5LMNJ 4KIAA 2XLKA 3US5A 5L9XA 2BR2A 4DV6F 1HNZF 3H7HB 4AXIA 4GVLA 3BGFA 4LF5F 3N6LA 2AYGA 3C3LA 1ZPWX 2AZ1A 2OELA 4K5RA 2HZAA 1Y3JA 1WSRA 5F41A 5B0BA 3DRYA 2ZD1A 3Q8UA 3B4DA 1A0OB 2BE2B 4JI2F 3KUGA 2PO0A 3OTBA 4MMOA 4NMXA 1EA6A 1Q8LA 4IZJB 4DR6I 3NG8A 4DV0I 4DL2A 1ZAXA 1NDKA 4PKDB 3ETMA 2YKOA 1P6TA 1U1QA 2LDIA 2DB1A 2YY3A 2VC1A 2NYIA 3Q86A 2IBKA 4CQ1A 3TA2A 4WZMA 2FC8A 2JVRA 3BV8A 3DOLB 4JI6E 2NREA 4PG7A 5AJ3J 4AUKA 3FMWA 4YMEA 1LKZA 4G1IA 2V4JA 3HMJG 2GCFA 4MT1A 3C15B 1QE1A 2R42A 4FYVB 1HNWF 3O8WA 3M8QB 3OVSA 1UJ5A 3CF5Q 3EYZA 4DR4F 4X4VA 3TVYA 2HRUA 4F3OA 2H54B 4RU9A 1JLCA 4RW8B 2J8SA 4NXNJ 4URSA 3RBZA 4OYXA 1Z0CA 3CJ4A 1Q8KA 3NS6A 3Q1QA 2U2FA 4OX9F 3FNNA 2DXEA 3G96A 5B0AA 4ZVFA 2RE1A 5C0XD 1RCOB 3ITHB 1AZSB 1P8GA 4L74A 3OFFA 1TP7A 3C16B 4GO5X 4P10A 5KG3A 2KU7A 3TJ8A 1RB0A 3OHAA 1RTDB 2Z2MA 1BQXA 2YQ3A 1HI0P 2HEKA 1R7IA 4WYLA 3MMAA 3PZPA 4HVZA 5LOQA 1N34I 4ED2A 5HK4A 2NXCA 1OYSA 2UUAJ 3UI3A 4PYAA 4DPUA 1DFDA 1LQ9A 4CRJA 2XYGB 2VZ9A 1JWWA 3W62A 4MQYA 3MURP 4LF9J 1Y9OA 4J9RA 3MM8B 2ZZTA 5D15A 2HQDA 3BSAA 1T3OA 4HI1A 4ZJLA 3V4IB 2MSSA 4W98A 1DLOB 1PKPA 1VQSA 2BJ9A 4WFZA 3B54A 1TMJA 4CLSA 3UR3C 1ROFA 4PQAA 1OS5A 2CQCA 3GIJA 5HVFA 1FT8A 3T9ZA 5K8OA 1FFGB 3KLIA 1F0XA 4Y28C 1RU2A 2MKSA 3M32B 3SMZA 1S49A 4DR6F 3OV7A 3PR4A 4DV0F 3KLHA 1B7FA 1BQMA 1UA0A 2VQEJ 2YTCA 3OL9A 2IFXA 2DD8S 4DR7I 3CGIA 3RW6A 4CLWA 2WNRB 4FDFA 2GFFA 4DR3E 1TUGB 2LKZA 4YS2A 1FJGJ 1U49A 4MK8A 2CNNB 3J7Z5 1IWGA 3HD2A 2NN6D 4CLYA 1VBZA 4N76A 2H5JB 3Q8YA 3GFYA 5LMNI 1VHIA 1RWPB 3H59A 1RHKB 1F5BA 2XY7A 3GV7B 1H6KX 2QE5A 1K9MT 4WIIA 4RW4A 4Q7AA 4L6V3 3FEYB 3OVBA 1C0UB 2EFQA 2YQ1A 4B17A 2H5EA 3UCUP 1VMBA 4H4MB 3FMBA 4F2SA 1O0PA 3HCXA 4JYAE 1VQ6S 3CJ8A 4LBHA 4A8MP 4DHVA 2ASDA 2ROEA 2EFPA 2HFZA 4A8WA 4OHZA 5J2QA 1RDRA 1JLAA 3HSJA 3PACA 5KFHA 3MM9A 2VF3A 3S01A 3HHLD 1T9WA 4EEYA 1S7HA 2NXEA 2PNMA 4IG3A 2QJ3A 5U47A 4XO0A 1WC3A 2C2DA 3OSPA 1HPZA 3FEZA 2CQGA 2CJ9A 3DC2A 2ZJQQ 1Y11A 1FERA 1PYSB 1CJKA 2RF2B 4DPYA 3RBEA 3ELHA 1GQEA 7FD1A 3VAFA 1T03A 3MGJA 2CJQA 2CIMA 5F0UA 3PX6A 4DFJA 1P27B 5C2GA 3HT0A 3AOBA 3CXCR 5BR8J 4I67A 3IBWA 5GMDA 3NS7B 1N34F 2Z0GA 3W8GA 2IA0A 3D0GE 3VAMA 2DIVA 1H7WA 2M88A 4AYBD 4PRFA 4ECWA 3MD3A 2Z30B 2DHGA 1XXEA 4NXNI 3R7SB 4BC9A 3J81j 1FFWB 3QO9B 5ETNA 1FK9B 3J7AN 5IT9Q 5DETA 2GVZB 2I1RA 1JJHA 2CQPA 4NLRA 3VGVA 4F2RA 2MQPA 3OUYA 1HNIB 1CQMA 3ZZ0A 3H90A 4X64J 1VIXA 3VAKA 3NBPA 2W2PP 5CHCB 4GC6A 4PWWA 3TZYA 1S9FA 1H2VZ 5E7OB 2NZ4A 3VTIA 3LUYA 4ITSA 1FRIA 3DHWC 5FLXC 1VBYA 1EETA 3R2DJ 1JK9B 4DR7F 4M5DA 2EFNA 1JJCB 5HJYA 1CQNA 4BC7A 2ZBKB 3HZEA 2NN6A 2UUAI 3UN2A 4ES2A 3BO4A 4LFCJ 4LF9I 2RU3A 3JYTB 1YJ9S 1RTIB 1U24A 5LMNF 2M4MA 2B4PA 4EGLA 5C25A 3ILOA 3IGVA 3GCWP 1TTHB 2MYFA 3O1LA 1XTZA 4MYTA 4LF5E 1F9EB 3BQ1A 2GAGC 3SV4A 2DRBA 4UF4A 2H5IB 2C2RA 3GSDA 2OO4A 2VL1A 4G1QA 4K2JA 3CB4A 3P96A 3ZZYA 3VVUA 3GJRB 1OIAA 3ZM7A 2DR5A 4NLVA 1LWEA 2Z5EA 3HHLA 4DL4A 2HBQB 4WFAQ 3TP2A 2BBEA 2VQEI 2CKWA 2VBYA 3PO4A 5JEAD 3BH6B 5KG1A 4WZQA 3I5AA 3UDVA 5BJRA 2G9OA 4OYPA 4XTJA 4MK7A 2VU5A 4LR8A 5ELWA 1Q95G 2QA1A 1FJGI 1KD1T 3DN9A 4ZIWA 1ACMB 1RI7A 2WP8B 2DNKA 1VRUB 1FXDA 2ZBIA 2I8EA 2JOQA 2W8KA 1RP5A 4CO5A 2KHCA 4EK2A 3AQOA 2KKHA 2QRRA 4MKAA 4Y2AA 1RR9A 4ZPTR 5K14B 2KZMA 2RUGA 1YJWS 4QYZK 4XIUA 1O6XA 4ECQA 3NY0A 1T8EA 1VQNS 4Q8EA 1VLYA 5IWAE 2W7AA 4DR4E 2Y3YA 1M5OC 2RS2A 5B0FA 1UCNA 4NXNF 2DITA 3VF0B 2CG9A 5FLXU 3MMCA 1HQEA 2RQCA 1GAOA 5JMNA 4NYOA 1XJWB 4Q0BB 3K57A 2WONB 1V5IB 2QMWA 2C3PA 3KJFB 2GQ0A 2B9EA 5LXYA 4M63A 2MKKA 3GV8B 4U95A 3OLBA 2HYIB 3P8BB 3U1LA 2KG0A 2OEJA 4B3OB 9ATCB 2ZOGA 3M1VA 3TAQA 2XLIA 2HQFA 3UNGC 4C3KA 3BKUA 4K4WA 2PT0A 2V2KA 2QLWA 5F3TA 2E5IA 4DCPB 1VBXA 3D54A 4ZCIA 5KFIA 1Q8IA 4F0KA 2UUAF 4TU9A 2PMWA 4P2MA 1L3UA 3N9UC 2PEBA 2R7TA 4IFDD 2JFDA 1X4EA 1BXNA 4LF9F 4PCQA 4LF6J 1XK8A 4Y3CA 3AD7C 2D1CA 1UVNA 2LJPA 1UW9A 3CD7A 2IVFB 5EWGA 3PG9A 3HO1A 3CDWA 1BMQB 1RTHA 3H4BA 4ZVSB 2OTJS 4WFYA 4IO9Q 3MXHP 2B8PA 2EG1A 2QA4G 1U0HB 2MB0B 3DYAB 3MEGB 3IN5A 3BBCA 1HWLA 3WU3A 1KVKA 4LRCA 3C66A 3C6TA 4XAKA 1LXJA 2PNLA 1C4AA 2XY5A 5F9LA 2XC9A 1SVDA 4URGA 1SJ3P 1NLKL 1V3ZA 5JEAA 1HMVA 2VQEF 1N88A 2JEBB 2OIHA 1MMDA 2IDEA 4R0EA 4J3DA 1KKHA 1KQFB 1K8AT 2YNGA 1FJGF 5KFBA 1UVLA 3AH6A 2KDOA 1CBKA 2GQQA 1E6YB 3ISND 4LFCI 3TUIC 1N5QA 4DV1J 1CULA 4MJKA 2DK2A 1NK5A 4RR5A 3MFHA 4WJBA 2H48B 2RRBA 1K1SA 2J9EA 3LP0B 2XMKA 5ETKA 1RT7B 1ZETA 4RZRA 4RWXA 1TL1A 3B8HA 3CMQA 4OLPA 2N82B 5KFFA 1S10A 4ZVPB 2Z5BA 2WB4A 2VKRA 1E6VA 3S7RA 1YBTA 2D74B 2XMUA 1MX0A 2BANA 2WW8A 4OYMA 4F8RA 3JSBA 5A6WA 4M5NA 1RWNB 2KHDA 3H2VE 3AJDA 4DFPA 3J7AG 2VG5B 1T02A 1UETA 2HRTA 3LGNA 4ZVOB 1H2UX 4WF9Q 2OSRA 3H20A 1DTTA 3A8EA 1EQ0A 2HBRB 4X62E 4KKOB 2VDHA 3SEOA 2K1RA 2RMLA 1B64A 1JXEA 4KPCA 4NLQA 2HZCA 2VC0A 1BY9A 2M0GB 5BR8F 4KT0C 5JJBA 4WU3A 4CWBA 2EKNA 2BVZA 6AT1B 2FVQA 2NXJA 2WOMA 3PTWA 4Y00A 1UWBA 4PG6A 3HVTB 3H5UA 1RLCL 2ZKUA 2KO1A 4I7FB 2FLOA 1ICEB 3DXBA 4HI2A 1X5PA 2QFIA 3EX7B 1NDLA 1HHTP 2W9AA 5J2PA 3RRHA 4K0KI 2CZ9A 1RT2B 5C42B 1FD8A 5HL7Q 1N36J 4QCLA 3AB4B 2G1DA 5DRPA 2V94A 4JI8J 2OD6A 4NEYA 2QEXS 3MEEA 2E5LJ 2ASYA 1QDUB 2Z5CA 3UD3P 4GVBB 2YNHA 2R3VA 2ZM6J 2ERRA 5K8MA 2IVMA 1I94E 1NNDA 2VOOA 4DWIA 1KLMB 1LW0A 2C2NA 2EC2A 2A0FB 3RW7A 2F8MA 3Q89A 5H9EJ 5IC6B 1UVJA 2L48A 4USVA 2PEHA 1NDPA 2G2ZA 4HT5A 2LEAA 4Q2MA 4DPXA 4LFCF 4LF6I 2JWNA 3Q8SB 2MDAA 3E01A 5E3QA 1VQ4S 2E5HA 2R7RA 1TVRA 1X5OA 2CPXA 3OVAA 3IRWP 4NXME 1NSPA 3IWXA 1FTCA 4IFVA 2ZOMA 2CQ2A 3I82A 1S48A 5LSOA 2CNLB 3D6FB 4B3TJ 4M5LA 1QUPA 2VV5A 5HJXA 5D0EA 2H51B 2N7YA 4ZIVA 2RRAA 4FN5A 2CZ4A 4X84A 3KK3B 2NZCA 2WW4A 2ADBA 4LSLA 4DN0A 4NLUA 1IBMJ 4ANDA 2WVDA 2YWGA 2JVOA 3DCAA 1S77D 5BYRA 5T41A 4F4YA 1N32E 1UWAA 2DNRA 1PIEA 2OEMA 4M1KA 4JI7J 4BA2A 3SCLE 4JV1A 2F4VJ 5IT9Y 3CE8A 1ZZFA 4OKGA 4DV1I 4DG1A 1KBRA 4H4KC 3WU6A 4DZDA 1A9NB 1RAAB 2IRXA 2GX8A 4O0IA 4IFYB 3PW2A 1DAXA 3HF5A 4NCGB 2YKMA 3KLFB 2QTWA 4QIWD 1FXLA 2FJWA 3MR7A 3TW0A 2LEPA 4IRDA 1OMSA 2IC3A 4UOGA 5HROB 1HK7A 4TNOA 4DU8A 2C2ZB 1JQGA 2A3JA 3P4UB 5D8HB 1C1CA 3SDEB 2DYAA 3K89A 1X5TA 2V68A 1RZMA 4ZVEA 2PFFB 3WU5A 1TZ0A 3H2LA 4WKYA 3FFIA 2J65A 4CH0S 3KJNB 4KC5A 4K4SA 1YKWA 2KT3A 2HNDA 5KFRA 3HLUA 1JXVA 1HYSB 2R2UA 3PYGA 5ETLA 1ZZNA 4EYIB 4Z37A 1JLFB 2CQHA 4ZCMA 1D9AA 2O1UA 1T05B 4C8YA 2E1MC 2ZWOA 2UVUA 4DF4A 4FXVA 1X4DA 1RHQB 2IHR1 4MKYA 1WTFA 3N79A 1IR0A 2FHKA 2HKJA 3TA1A 4RNHA 2UUAE 4LF6F 2HFOA 4FS1A 4PQUB 3K58A 2MPUA 5FJ4A 1KQGB 5EUHA 2AZ3A 4N8NA 3R8YA 3R6LB 2GO4A 1FCAA 2GV1A 4J9KA 1RADB 1N36I 4KHPE 5DO2A 4M95A 3GP9A 3OFHA 3PX0A 3KJVA 1OQ6A 3BH7B 2C38B 4I2PB 2E5LI 2VKZG 3R5CA 3NOCA 4P9SA 2FY1A 3IGNA 3MM6A 1HHQA 1Q82T 2N4DA 4ZLLA 1U47A 2CQDA 3MM7B 2MJUA 4USTA 1WI6A 2UXBJ 2MKYA 4RJVA 1TK0A 4R25A 3HVAA 5KFEA 2HNYA 3LGMA 2KXFA 1SJ4P 1S9EA 4JB8B 4CP5A 3KMSA 1R27B 2F9DA 1FJGE 3M30A 1ZM4A 3CMAS 2BKOA 5HLFA 2JL9A 2BRKA 1IBLJ 4DV1F 1Y60A 3M8WA 2G0CA 1U6ZA 4C3LA 1DRZA 2HBZB 2QSFA 3JB9k 1T7PA 4CLLA 3L7UA 2JC1A 4P7TA 3D68A 2ZH1A 3MTKA 1WTBA 2P6TA 4FF3A 5DQGA 4B3TI 5IV3A 2GMJA 4A8QA 4KFBB 1D09B 4RNOA 1RLDA 4WIQA 2OPRB 4XK8C 5HQMA 3V6KA 1VQ7S 3CO9A 1IM4A 3NCRA 1T11A 3TYTA 3L9ZA 3JS9A 1EAYC 5KFLA 2EVZA 5KTQA 1IBMI 3UCGA 3IO1A 1U2FA 3TVZA 4DV2J 4CIOA 4PYDA 3LALA 4HYMA 3NZKA 1S1VB 1TL4A 1KTVA 5KT2A 4ED6A 1PVGA 4KR0B 4JI7I 3A3PB 2LXIA 3VGUA 2B0GA 3HKZD 3NNAA 2DR9A 3DMJB 2MQ8A 2F4VI 1SH3A 1VDHA 4OJ1A 1BKNA 3KG4A 1TV6A 4BS2A 3CULA 3LP2B 2KT5A 2V2QA 3DLJA 1MWZA 3D5MA 5G0RB 2NN6C 2E7XA 2GJ2A 1SKRA 4IZJD 2EG2A 1PKUA 1T94A 2B8QA 3G82B 4JI3J 2VUGA 4LF4J 3KJQB 1AB8A 1GXUA 2AGQA 1FRMA 4NA2A 4RW9A 1N36F 2PD1A 1REVB 2V6AA 1F2GA 3DGPA 4ECZA 4WCEQ 4QOTA 2YPZA 4JI8F 3JAMQ 4CI0B 2E5LF 3GFHA 4YB5A 4J9OA 2ZH6A 3PCOB 2GMHA 2MGZA 2KH9A 1R0CB 4M5KA 2VHGA 3JSRA 2V63A 1WOSA 3PRBA 4WUCA 3QSYB 2YQ0A 1BWEA 2BA9A 2QLBB 3HHLC 1VRTB 4J5OA 5E33A 4MKBA 4KRWA 2DPIA 2J0XA 2GQCA 2QLJB 3H40A 1R6MA 4EI2A 1IBKE 4RNMA 1SQGA 4C11A 4ECTA 4MKVA 3EZ5A 3NNCA 4ZHRB 1MMNA 4ES1A 3MR3A 1XEZA 1HNVA 4GC7A 2VDIA 2KXHA 5DLGA 5LSLA 4RW7B 2DCUB 5MAOA 3QT6A 1D0EA 4MFBB 2W2QP 3BN7A 2OUGA 3BJYA 5T7LA 1S0VA 4U6PA 4U3DA 1RT6B 1DBDA 3BKFA 3Q8QB 4B3TF 4DX6A 3M9MB 2HGNA 4ZPVR 4HHJA 2B4UA 3CCES 3MCNA 5KT3A 4DU7A 5DLFA 5F0WA 1VC6A 3NOGA 1IBMF 2VFTA 4JI5I 4I69A 2HIQA 4DR5E 4M5GA 4QIFA 5GAHI 2M8HA 2UP1A 2JEAB 1Y4UA 3G71S 1IJFB 2GS8A 5E3RA 5K36C 1N54B 3RJMB 4C8OA 4JI7F 2HAFA 4FF4A 1NM2A 4OZ0A 2IM0A 2J0SD 2F4VF 2IYGA 3TEGA 3AJ2A 1RHMB 3IG1B 3ZXWA 2POKA 3BO2A 2GVDB 3GILA 4DUZJ 2KN4A 2Z2YB 3DRRB 4P52A 3QAUA 4DSLA 1NJZA 2BE2A 3TEHB 1RT3B 1WKLA 2KTQA 4KHMA 2HS4A 3DNCA 3Q8RB 1FJCA 4IOBA 1H74A 4KQVA 4ICLB 3ZZRA 3R7BB 5EWFA 5C0XF 1S9GB 1ZXNA 2AT1B 5J2NA 2J9DE 3MMJA 1AT1B 4UZBA 1IVZA 4K0KE 5J2MB 4OHXA 3V81B 4RUHA 1RUSA 3DOLA 4DV2I 5BYQA 2XMTA 2DR6A 2L9WA 3IAM9 3HX9A 5GAGU 3ILIA 1Z2ZA 1RU1A 1JJ4A 4EBDA 3C15A 4A8KA 4J9NA 3I9V9 4N56A 4FPIA 3MUTP 1HBNB 3M8QA 3CT9A 4B9NA 5THWA 3TARA 5GADI 3ZNUA 4X66E 2FJVA 1RKIA 4UUWA 1NHJA 3PS2A 2DNOA 4RW8A 2WRMA 2YWFA 4RBVA 1TKTB 3G8SA 2WTFA 2K2PA 2MQLA 2E1RA 5EHHA 4JI3I 2HURA 4H54A 4LF6E 1D1UA 2D3ZA 4LF4I 5HSPA 5A0YB 3R5GA 1FTRA 3ITHA 1AZSA 2BM1A 4X4NA 3EPGA 3C16A 2CJBA 3UVJB 4M5MA 3WX4A 1PJ7A 2D69A 1LW2B 3H5SA 3PYFA 1W25A 4BWJA 5L46A 1WOPA 1FKPB 2RAQA 1X4FA 3D3BJ 1O5JA 2AQ4A 3EGNA 2V9WA 1V3SA 2WSFC 2UXBF 2R7QA 4I6WA 5FD1A 1J27A 3GMEA 5DZ6A 3C8YA 1DJ0A 1KFSA 4K7QA 4JI5F 3RUBL 2CFXA 4F0HA 3HJCA 2XLJA 2M5YA 1HFEL 4KJIA 3I32A 3IFEA 3Q22A 2OKQA 4LRFA 3CJ5A 1Z0EA 3V4IA 3GTYX 1JLBB 4V19X 2MHNA 1DLOA 1JIHA 4QIGA 3P76A 4K50A 4DSEA 3NGRA 3T3FA 4N77A 5HMYA 3KLEA 1S12A 3UN3A 1B0PA 3AOAA 2BXJA 3M32A 2GIFA 4PAAA 2DXDA 1O8BA 3R3TA 1UFLA 1KWMA 3PDNA 5CH7B 3RBXA 1L3TA 4IRKA 3LA0A 2QA2A 4C8LA 2C3UA 1GMWD 4DMZA 3DM2B 2W4CA 3FCVA 1F60B 3CPWR 1MU2B 2YPYA 5EGYA 3W1YC 4CH1A 5H1SV 3PY8A 4DV2F 4ATNA 2HZVA 3M6VA 2HHHE 1VIOA 2C2OB 2BM0A 1S97A 4FWHA 4F4ZA 3ET6A 1EKRA 4PR6A 3DU6A 4KGXB 4QJVA 4TKTA 3P3GA 1KHVA 1S99A 4ZN1A 4JI6J 4RNFA 3T5LA 5KAKA 3A8JA 1UEUA 2GHPA 1G3OA 1F9FA 2RHSB 1C0UA 3TQEA 4HLBA 4ZPDA 2PA8D 4H4MA 3J7AM 4HACA 1ULRA 1Z0GA 3ADAC 3TR5A 1J5OB 2IERA 1FKAF 5E3AA 4C0BA 2C28A 1NB7A 4C0OC 4P75A 4OJ3A 1S1XA 4B9SA 2RSQA 1B3TA 5FDLB 3MFIA 2PFDA 2A2CA 4LF8J 4JI3F 4HTIA 4RUBA 4LF4F 2W24A 2IY5B 3TA0A 1BD6A 3DLBA 5DDOC 2LEBA 1WOOA 1QAJA 3QGHA 1JLGA 3OHBA 1URRA 1LFPA 3A8KA 1HBMB 2M70A 3MPUB 2DO4A 1U45A 4OHWA 4ZCLA 1KOHA 4RWWA 4U7CA 1NDCA 2OMOA 4E2FB 5HVGA 3AT1B 2QLFB 4FYWB 5A6PA 3CCVS 4M5IA 2BJ1A 1TKXB 2KG1A 3QO9A 3RAMA 1CJTB 1FK9A 1RT5A 2GVZA 3D3CJ 1YJUA 1H72C 1IKYB 2BJ3A 1HNIA 4ZS6A 1JLEB 4ED3A 2LMIA 5I3PA 4DX5A 2D3UA 4IG0B 5IM0B 2Q2EB 1SBRA 5DM6Q 4ZITA 1NKBA 1ZYQA 4ECYA 3W8PA 5KT4A 5JEAF 3D1HA 4TQSA 1GMWA 5T14A 4UOCA 3W61A 1CJUB 3ZZPA 4N8OA 2F1DA 4PZVA 1S59A 1YRXA 1XHKA 1RWKB 2QZ8A 3NXZA 1USUA 2M3DA 5F8NA 2EI5A 3I9ZA 5MLCV 4OO1B 1D8YA 1HI1A 5LL6d 1CC8A 1Q86T 2QT7A 5C5JA 3JYTA 4DR3J 1QAYA 1RTIA 3SBMA 1HQUB 1VOMA 3THVA 2VBWA 3VAHA 3B78A 3J7YI 2ZHBA 2KRBA 3OXLA 1BUXA 4OO1F 2ILYA 3JAMY 1VR6A 1YIJS 2YKQA 2VODA 3L95X 3MR6A 2CPEA 2A1BA 4I0WA 2BEFA 2LQ9A 3BREA 2Q3PA 1WHVA 2CPFA 2LECA 3CJRA 2R4FA 2UVWA 3M4XA 4KV8B 2EK6A 4JYAJ 1U6BA 1JJ2R 2R7WA 3W2VB 3KHRA 2CUYA 2DHHA 1QSYA 1WEZA 3LANA 3LPEA 1MLAA 4C97A 2HSEB 1X4CA 1DQAA 2F9JA 4A48A 4EZ6A 3IR7B 3RAXA 2CPHA 5IQQA 4L3NA 3R5BA 2FVSA 2G13A 1XERA 2DY1A 2QLXA 4QYZJ 2Y0BB 3K7RA 4JI6I 1URNA 2ZOFA 2CDRB 3IBFB 3AHPA 5KFAA 4IFDF 1I5OB 3KK2B 3J81Q 1HBUB 5KG4A 2ZNZA 3BN4A 2GHVC 2E9ZA 4TQRA 3HVWA 1L5UA 3P3CA 1FDDA 1R0AB 2HBYB 2JSXA 4Q0BA 2WONA 4U67Q 2XSJB 1LK5A 2FYXA 1UDQA 2B6AB 2M52A 4LF8I 2KYXA 1SV5B 2NUUG 4AL7A 1NBEB 1EI1A 4RUAA 2WBRA 2GGPB 4PXBA 2RIJA 1VQOS 2RQKA 3D1QA 2E1AA 2E9RX 4W90B 4B02A 5H9EK 2EKYA 1BGXT 2LQ8A 2ZC3A 1HLWA 1WD6A 1K73T 1TFWA 2VG7B 2V8VA 2YH1A 5IQ6A 4FXDA 4XDDA 5AE3A 1N6QB 4BCAA 4ZA1A 2HK2A 4WFBQ 4J9MA 1LK7A 4FWGA 1SL0A 1SJ1A 4JI5E 4NCBA 1UZDA 3E3XA 4USMA 1PJ6A 1G2EA 1NH7A 4Y2MA 5KG7A 4DSIA 3HD1A 1U48A 4TXSA 1KFDA 4LJMA 1R8AA 2BE9B 3I0SA 3Q2SC 3UDLA 2F5GA 3MM5A 5M2UA 2Y8YA 3IAS9 3PW0A 3M2RB 2Q66A 3PW4A 1VISA 2C3OA 1U0HA 5CXTA 3DYAA 1N33I 2J76E 4DUYE 2AJ1A 4FXWA 4O3RA 4YEAA 1R6VA 2XMJA 4USUA 5JUMA 2B4OA 2I9SA 4HH0A 3HDSA 1S1UB 1GTHA 4DLGA 2B9XA 2X3GA 5G4DA 4F4KA 4IZKB 4IH5A 2RDIA 1U09A 1R0BG 3OD2A 2RUSA 4URQU 4DZ6A 2HS0A 2EBGA 1I51B 4GKJI 4D3HA 5C24B 1EIYB 2AX1A 3D28A 1M5SA 4DCOB 5IZHA 1E6YA 1JB0C 1NO8A 4WK3A 3U27A 2FGOA 2AEFA 5HN0A 2G2YA 1Z0VA 5EX3A 4F4XA 1U7LA 4R8UA 3NGKA 2PO0B 4FW5A 4JI6F 2MQQA 5F8LA 1RT7A 5D4OA 4I1TA 2KFNA 3L7OA 1TUVA 2G0IA 2MHEA 2VFRA 2J7WA 5H9FJ 1Y4ZB 4FBTA 2O1PA 4BLGA 1TR0A 3GJTB 4B9MA 1FKAE 2DTJA 4B9UA 5IWAJ 3FRYA 4DR4J 4LF8F 1X4AA 3S1TA 2JHEA 2HQGA 1R8HA 4ECUA 4ANEA 1KN6A 1HNXE 3JTNA 2CWKA 1QY7A 2VG5A 4KO0A 3OXFA 2JLFA 1QE1B 1YBUA 4KBIA 3GSIA 2JJ4D 5KG5A 1YVFA 4P7VA 1D3WA 4OX6A 4HHHA 3PJ9A 4CZCA 1Q81T 4CLFA 1IN0A 4NLWA 5E0OA 5IV4A 5IS2A 3QMQA 2HHUA 2DHSA 1TAUA 3H8YA 4DSJA 3NMAA 4TU7A 5DDRC 4C7QA 1L3VA 1Q7YT 4DL5A 5IT4A 4I7FA 3V4MA 2CJYB 2HWHA 1XMQE 4DOZA 3QSIA 1JMTA 5KFUA 4QBUA 1RT2A 5C42A 2OH2A 2WB1D 4F26A 4J9UE 2C2MB 4NASA 5ETQA 2N3OA 1RQ0A 5CCMA 3T1YE 3NGUA 9RUBA 4URLA 2GNKA 2K3KA 1N33F 4L72B 1R6LA 1NZ8A 2X7IA 3CDEA 4MDTA 3NLCA 4B3ME 3EVOA 2LDYA 3CO0P 2BZ2A 4OYIA 1KLMA 4DFMA 1M5PC 4I2QB 2HIYA 4CNYA 4AQYI 5CQGA 4GKJF 1JNZB 2CRLA 1QZRA 2NPFA 3G6ES 1CVJA 4DPOA 3BKTA 4K4ZA 4Q8FA 3RRKA 2BMBA 5C7PA 3GB0A 4B08A 5F9NA 2K8GA 4OO1E 4XPCA 3FCWA 3OFGA 1U0SA 3X3UA 4Y2KA 3I4PA 3WBZA 2DISA 4B3SI 3KK3A 1RBLA 1RJJA 1LFWA 2BKNA 3HHNB 1HD0A 3ZTQA 1GK8A 4UQGA 1WWHA 4PRVA 4USIA 3V6HA 4LR7A 2HRYA 3I56S 3WIUA 3ENQA 2IBOA 4NA1A 3PFEA 4ED1A 4N3OA 1S79A 2UUTA 2J9DA 4WE1B 1S6QB 3A13A 2J6UA 1N8RT 2XI2A 3F44A 4L75A 4CO1A 3N5BA 4IFYA 1IUJA 4X62J 4NCGA 3KLFA 1N0UA 1NB2A 3PKYA 4C3MA 5E3CA 3ULHA 4AM3A 3JSMB 1WHWA 2VFUA 5DJBA 4YN3B 5HROA 1HHSA 1X31C 4K2XA 1G1XA 4NI2B 2V8DA 2AV5A 3SDEA 3SQGB 2HGMA 1YRTA 2BKPA 1Z2LA 4ZPWR 2ZEJA 4O3QA 4AFFA 2IMOA 1RK8A 3SCIE 3AOCA 3J80Q 1HYSA 3BS9A 3MPDA 2DPJA 4LBPA 3PO5A 1JLFA 4LFBJ 1FEHA 4OYAA 3HM9A 3QFWA 1IKVB 1FE0A 5KFQA 1LWCB 1FEEA 3ZKDA 1FDBA 4NRUA 4AQYF 1I94J 3ZFVA 1VQLS 4QR1A 4ZLPA 2EFGA 3IRXB 4DXLA 4WPAA 4R1FA 4PQUA 3OUYB 2XWXA 4CM2A 1RWXB 1S4EA 2KVIA 1H38A 1RWVB 1MU5A 2FJAB 1RTJB 4J7CA 5KG2A 1ZOTA 3VGSA 2C38A 4I2PA 2PMZD 4O3OA 4NLDA 5JVGQ 4BHQA 4UT4A 4NXMJ 3MWBA 4JV2A 4B3SF 2XHCA 3TQ1A 3LNUA 3IS9A 1TMMA 2P9GA 1QUVA 2C3MA 2RDJA 1S6PB 2YXLA 4O3SA 1V9OA 3FSIA 4DR2I 4KGKA 2XYHB 3J81Y 2CZVC 1CS4B 2DR7A 4OI0A 3BYRA 2AEJA 3FGVA 5HP1A 1S7IA 1D6TA 5HQLA 1K47A 5LM7E 4U9RA 5GAEI 2B9WA 3O3LA 1X0PA 4MTPA 2XGQA 1N32J 3HK2A 5D6GA 4KSEB 2IJRA 2DBBA 3B4TA 2AHOB 3GE9A 3PXGa 3TZWA 1FESA 3NCPA 4DEZA 1VC5A 4KFBA 3AXMA 2J0QD 2J6TA 2LU1A 2E1CA 1WUUA 2IAJB 4PPZA 1JNRB 2QL7B 3VZIA 4DX8H 1EJ7L 4TY9A 1MROA 4ZVRB 1N0VC 5IWAF 1FHTA 5D4PA 2PGCA 2V0NA 4ECVA 2DH9A 2HQ3A 4LF8E 2IDLA 3HJFA 1UEVA 1RT1B 1SC3B 1UZHA 2UXCE 4P2FA 4KYZA 3ETOA 1NZAA 3NNHA 3DMJA 3KNGA 3M8YA 4QNKA 5HVHA 3GMGA 3BSNA 4QZVB 3LP2A 2RT3A 2E7WA 5K8NA 1S1TB 3RB0A 2A6OA 1Q79A 1HIYA 2YWHA 3QYYA 4C8NA 2KJVA 4ZOSA 1OYRA 4X62I 1SKUB 2XZDB 5G0RA 2B51A 1VFJA 1APSA 2DGUA 1NK6A 4LF7J 2HQCA 5I42A 2NYHA 1XR6A 1YH8A 3L7ZB 1RXOB 2GAHC 3DRPB 5KFZA 4YB7A 3PFOA 5IOLA 5K36B 1TL3A 1REVA 2FLLA 4RBTA 3CCWA 2RDDA 4HKQA 1HR0E 4DF8A 5KFTA 1RA7A 4B9VA 4MU0A 3K1JA 4HEA9 3TJAA 1N33E 3UWTA 4OX8A 4KHPJ 3AAWB 1ZA1B 1FA0A 1VRTA 5K36F 1S0OA 1S6UA 4DR2F 4LFBI 2HWTA 3F56A 3IMQJ 1U4BA 4QPXA 3AA9A 3EGWB 4DPTA 4ZHRA 4NCAA 2H65B 4NLGA 1KRPA 1I94I 4HDGA 4PXEA 2VBZA 4GKJE 3HSGA 2B5JA 4RW7A 1HWKA 1RA6A 3HP6A 4MFBA 2MTLA 3R7NB 3NAIA 2NR0A 1TL5A 5L3JA 3BSOA 1CPZA 2L9NA 2HAIA 3C6TB 1RT6A 3H5YA 4J9VA 2CJKA 1UMJA 1ZTTA 2GZOA 4S0MA 1PGZA 4YQWA 4FWDA 5DM7Q 1IQZA 4I64A 2QL5B 2WK4A 3QT7A 4NXMI 1SB6A 2O67A 5A8KA 3HVRA 1RE1B 5LT5A 4G3IA 4Y65A 2C42A 2LVWA 4EO6A 5JVHQ 1RAEB 3PHEA 3HFKA 4OV6A 2C37A 5F8HA 2WSEC 3ZNJ1 2HNZB 3CJSA 2JEAA 2MZTA 2JRSA 2NPIA 1CULB 2JNJA 4ZVGA 3WQPA 4UY8T 3H2UB 2KT2A 2V50A 4WUDA 3ENVA 2OPSB 2JT2A 2DRAA 1M0SA 2FJDB 4O44B 5C0XA 1NHIA 2RKIB 1N32I 4AXJA 5KFDA 2GVDA 2EC0A 2VPXB 3EPIA 1YJRA 2V67A 4NPOA 3HHDA 5A2QQ 4HDHA 3PYEA 1R43A 2V9KA 4X62F 3ISZA 1RT3A 1CEZA 1KDNA 2UXDI 1SJQA 7FDRA 2Q6BA 2YKPA 3IR6B 1FVSA 2XM3A 2YBVA 4ICLA 1HKAA 1Q5VA 1S9GA 3MPWA 4DN9A 4X4UA 3D0HE 1KOOA 2FJXA 2PI4A 5J2MA 3V81A 2FHJD 1I6JA 2NSCA 1H3DA 4N7TA 4KE5A 3CD6S 4BA1A 1RACB 1M1HA 3PRVA 1U1OA 1FKOB 3VVTA 1O51A 1PSDA 5B0DA 4RLEA 2CQ1A 2RQMA 1HBNA 3PEJA 4LFBF 3G87A 4LUBA 1NSAA 5I4MA 1DHMA 2XO6A 2P9EA 1TKTA 5J2PB 4QWDA 3E2EA 3GYXB 1I94F 5LJ3Y 4AQYE 2AD9A 4Y6IA 2MY7A 3OTCA 3T1HE 1IBKJ 1C2PA 1FDNA 1T95A 4LF7I 3CWVA 3GG1A 4Y2IA 3MEEB 1VHFA 4EFAC 2ZH9A 3W5XA 1C0TB 1WI8A 3UVJA 2GIRA 4KAIA 3G8QA 2P6SA 3BPSP 2XYPB 1DZ5A 4WBFA 4WXOA 2MXYA 1LW2A 3K5NA 2LXUA 4FZVA 2KRRA 1E3HA 4DFKA 1FKPA 4P73A 2JH3A 2O1TA 1RHUB 2CQ0A 3V6DA 4NXMF 4KHPI 1JLQA 1LW0B 5KFVA 2BACA 1OQ3A 4ZJQA 3PW7A 3F73A 2Y8WA 4B3SE 1YX2A 5HBMB 3QJLA 2Q43A 4J9LA 1NKCA 3OTOJ 1FRJA 3C14B 3LAMA 3PS1A 1NAQA 1WELA 2HKEA 2UUBE 4NZ0A 4LBIA 2AP6A 2HLUA 1N5TA 3MF5A 2AMCB 3OR1B 4IRCA 4X4TA 2M9KA 2FZCB 1YQHA 2BYCA 3VAJA 2HK3A 4DR5J 3P3EA 3H1CA 1JLBA 2PI5A 2DGQA 4R5PB 1N32F 1YWXA 2E5JA 3CCLS 2LYVA 2IOPA 1X8DA 1KP6A 1RHYA 4ID5B 3MAAB 2UXDF 2V4QA 1NPKA 2FVPA 2LA6A 1U2CA 2HHVA 5FWKA 2FIUA 3CDIA 3J80Y 2VBXA 3M8PB 2VA2A 3FRZA 2X1BA 5HQ8A 3DM2A 2F65A 4LRDA 4OZ3A 1MU2A 4KQZA 1S1WB 2FHJA 1BE4A 3UE2A 4USJC 3M2VB 2HHSA 1GT8A 4OO1D 1IR2A 4UUXA 2DNYA 1TK8A 2ZE2B 1P9QC 1PCAA 4K0KJ 3DLKB 2XSFA 1ZTWA 1S0MA 4LQ3A 4P2XA 2P5VA 4OJHA 4ES3A 5F8JA 3OPKA 2PSZA 2NXNA 1RAOA 3WC0A 1Y6ZA 3MCMA 1KTQA 3TVKA 2OSQA 5K20B 2IC3B 2Q1LA 3BPDA 4ALZA 1WC0A 3NAHA
chains in the Genus database with same CATH topology
1U2RA 1ELOA 4DPTA 2UXDE 4JI7E 3H4LA 4PRVA 2F4VI 1I94I 3ZM7A 1BKNA 2HFSA 2OI2A 4PRXA 2R3VA 1NHHA 2F4VE 1H7UA 2BV3A 2Z5EA 1I94E 4GKJE 2V2QA 4USKA 1Z0CA 4N3OA 5LMUE 4DR1I 3Q1QA 2ZM6I 2O1WA 4IZKA 4JI0I 2VQEI 4DR1E 5L3JA 3OTOE 2VQEE 1H7SA 2ZITA 2UUCI 4IZJD 4XTJA 4JI4I 1FJGI 2UUCE 1XNRI 3LTOA 4DPXA 1MG7A 4DV5I 1NZ0A 1N0UA 4LF6I 4DV4E 1XNRE 4JG4A 4FWDA 2HK2A 4DV5E 3GONA 3QT7A 4FWGA 4JI5E 4NXMI 4WUBA 2HHHI 4USMA 3K85A 4NXME 3QT5A 5FLXQ 2HHHE 3ZZUA 4Z7YA 3JAMQ 1Z0BA 2BM0A 4DV3I 4JI1I 4FWHA 1RR9A 4RPFA 1N34I 4DV3E 4DR2E 4JI1E 4JV5E 1ZXMA 4B3RE 5IWAE 1N34E 4DPUA 4DR4E 4FN5A 1FWKA 4WUCA 1VISA 3K17A 2CG9A 2WW4A 1IBKI 4WUDA 2CGEA 4LF7E 4DUYI 1N33I 2O1VA 3J7AM 4DUZE 1IBKE 4I3HA 4HACA 4X65I 1Z0GA 1B62A 4DV7I 4DUYE 4IZJA 1NHIA 2IOQA 4GKKI 2Z5CB 4X65E 2VQFE 1Z5BA 3J80Q 4DV6I 1HNZI 1N32I 4UTGA 4DV7E 2GQ0A 4LF5I 1Z5AA 3Q6NA 1PKPA 3P06A 4DV6E 1HNZE 1N32E 5A2QQ 1B63A 2A2CA 1PIEA 3PYEA 4M1KA 4MYUA 3ZKDA 2UXDI 4IZKB 3QT6A 4JI2I 3PRYA 4DV1I 4JI2E 4GKJI 3WU6A 2EFGA 5LMUI 4DV1E 4DXLA 4R1FA 4Z7CA 4DR7I 1UEKA 3OTOI 1S4EA 5BR8E 1Z0VA 4DR7E 4DR3E 2XEXA 1MU5A 1J5EI 4DU7A 4DV4I 1J5EE 1HK7A 1Z59A 4DU8A 2LJPA 2UXBE 3WU4A 4DR5I 4UT4A 5LMNI 4JI5I 5IT9C 4DR5E 5LMNE 3LNUA 4DPWA 4YHHE 1Y4UA 1FKAE 4FW9A 1HNWI 2GS8A 1ZM2A 3WU5A 2DEJA 4DR2I 1HNWE 3V2UC 4JV5I 4B3RI 5IWAI 3WU3A 2AJ4A 1KVKA 4DR4I 1HNXI 4JYAE 1H72C 3T1HI 1RREA 2PNLA 4X64E 4AQYE 1HNXE 1D6TA 3T1HE 3PYGA 1K47A 4LF7I 3CWVA 1IBLE 2DEIA 5GMEA 4DUZI 4P52A 2VF3A 3M6AA 2O1UA 2Q2EB 2VQFI 4OX9I 1ZM9A 2V2VA 2PNMA 1KKHA 1Z5CA 4OX9E 3ZKBA 2HKJA 2UUAE 1H74A 4KQVA 3Q6MA 1H73A 3PYDA 1XHKA 1ZXNA 4EMDA 4DPYA 1USUA 4LFCI 3J81C 3LPSA 2O1TA 1Z0WA 4K0KE 2V2ZA 4LFCE 4KHPI 1WUUA 1XMQI 1N36I 4KHPE 4B3SE 4LFAI 4DV2I 1XMQE 4PU9A 5LL6R 1N36E 2HFUA 2A2DA 5GMDA 1USVA 4LFAE 1N0VC 4DV2E 2UUBI 5BR8I 4LFBE 2HKEA 2E5LI 4DR3I 4JI8E 4YY3I 2UUBE 1Z0TA 3B8HA 4LF8E 3B78A 1XNQI 2E5LE 4YY3E 3T1YI 1XNQE 4X66I 2Z5BA 2UXCI 1FWLA 3T1YE 4URLA 4NXNI 4X66E 2V8PA 2UXBI 1MX0A 2UXCE 2HK3A 4NXNE 2J7KA 4B3MI 1OJ4A 2X7IA 3QT8A 1NHJA 2ZM6E 4JI0E 3F0NA 5IT9Q 4B3ME 4YHHI 3HULA 3B82A 3J7AG 2IOPA 4JI4E 2E1RA 1FI4A 3ZZ0A 1FJGE 1ZM4A 4JI3I 2V34A 4X62I 4JYAI 4LF6E 4LF4I 4JI3E 4X64I 4X62E 4HACB 4AQYI 5FWKA 1A6FA 1EA6A 1S16A 4IZJB 4DR6I 4LF4E 2BM1A 2X36A 1IBLI 4DV0I 1QZRA 4DR6E 5FLXC 2UU9I 2NPFA 1FNMA 4DV0E 1ZM3A 3JAMC 3V5RA 2UU9E 1DARA 3PYFA 4B3TI 4ED4A 3D4JA 4B3TE 1HR0I 2ZBKB 4P7AA 2UUAI 1HR0E 4JI6I 4HXZA 3ZZTA 4LF9I 4JI6E 1XMOI 3K1JA 4K0KI 3J81Q 2CZ9A 1IBMI 4LF9E 1N33E 1XMOE 1IBME 3J80C 3HJCA 4B3SI 4ZVIA 4GKKE 2R42A 4MYTA 4LF5E 4HYMA 1Y6ZA 2Z5BB 1KTVA 5A2QC 4LFBI 1KIJA 4JI8I 4HY1A 1Z0EA 1PVGA 4LF8I 4JI7I 1Y4SA 2Z5CA 1EI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2R A;  1ELO A;  4DPT A;  2UXD E;  4JI7 E;  3H4L A;  4PRV A;  2F4V I;  1I94 I;  3ZM7 A;  1BKN A;  2HFS A;  2OI2 A;  4PRX A;  2R3V A;  1NHH A;  2F4V E;  1H7U A;  2BV3 A;  1I94 E;  4GKJ E;  2V2Q A;  4USK A;  1Z0C A;  5LMU E;  4DR1 I;  3Q1Q A;  2ZM6 I;  4JI0 I;  2VQE I;  4DR1 E;  5L3J A;  3OTO E;  2VQE E;  1H7S A;  2ZIT A;  2UUC I;  4XTJ A;  4JI4 I;  1FJG I;  2UUC E;  1XNR I;  3LTO A;  4DPX A;  1MG7 A;  4DV5 I;  1N0U A;  4LF6 I;  4DV4 E;  1XNR E;  4JG4 A;  4FWD A;  2HK2 A;  4DV5 E;  3GON A;  3QT7 A;  4FWG A;  4JI5 E;  4NXM I;  4WUB A;  2HHH I;  4USM A;  4NXM E;  3QT5 A;  5FLX Q;  2HHH E;  3ZZU A;  4Z7Y A;  3JAM Q;  1Z0B A;  2BM0 A;  4JI1 I;  4DV3 I;  4FWH A;  1RR9 A;  4RPF A;  1N34 I;  4DV3 E;  4DR2 E;  4JI1 E;  4JV5 E;  1ZXM A;  4B3R E;  5IWA E;  1N34 E;  4DPU A;  4DR4 E;  4FN5 A;  1FWK A;  4WUC A;  1VIS A;  3K17 A;  2WW4 A;  1IBK I;  4WUD A;  4LF7 E;  4DUY I;  1N33 I;  3J7A M;  4DUZ E;  1IBK E;  4I3H A;  4HAC A;  4X65 I;  1Z0G A;  1B62 A;  4DV7 I;  4DUY E;  1NHI A;  4GKK I;  4X65 E;  2VQF E;  1Z5B A;  3J80 Q;  4DV6 I;  1HNZ I;  1N32 I;  4UTG A;  4DV7 E;  4LF5 I;  1Z5A A;  1PKP A;  4DV6 E;  1HNZ E;  1N32 E;  5A2Q Q;  1B63 A;  2A2C A;  1PIE A;  3PYE A;  4M1K A;  4MYU A;  3ZKD A;  2UXD I;  3QT6 A;  4JI2 I;  4DV1 I;  4JI2 E;  4GKJ I;  3WU6 A;  2EFG A;  5LMU I;  4DV1 E;  4DXL A;  4R1F A;  4Z7C A;  4DR7 I;  1UEK A;  3OTO I;  1S4E A;  5BR8 E;  1Z0V A;  4DR7 E;  4DR3 E;  2XEX A;  1MU5 A;  1J5E I;  4DU7 A;  4DV4 I;  1J5E E;  1Z59 A;  4DU8 A;  2LJP A;  2UXB E;  3WU4 A;  4DR5 I;  4UT4 A;  5LMN I;  4JI5 I;  5IT9 C;  4DR5 E;  5LMN E;  3LNU A;  4DPW A;  4YHH E;  1FKA E;  4FW9 A;  1HNW I;  2GS8 A;  1ZM2 A;  3WU5 A;  2DEJ A;  4DR2 I;  1HNW E;  3V2U C;  4JV5 I;  4B3R I;  5IWA I;  3WU3 A;  2AJ4 A;  1KVK A;  4DR4 I;  1HNX I;  4JYA E;  1H72 C;  3T1H I;  1RRE A;  4X64 E;  4AQY E;  1HNX E;  1D6T A;  3T1H E;  3PYG A;  1K47 A;  4LF7 I;  3CWV A;  1IBL E;  2DEI A;  5GME A;  4DUZ I;  4P52 A;  2VF3 A;  3M6A A;  2Q2E B;  2VQF I;  4OX9 I;  1ZM9 A;  2V2V A;  1KKH A;  1Z5C A;  4OX9 E;  3ZKB A;  2HKJ A;  2UUA E;  1H74 A;  4KQV A;  1H73 A;  3PYD A;  1XHK A;  1ZXN A;  4EMD A;  4DPY A;  4LFC I;  3J81 C;  3LPS A;  1Z0W A;  4K0K E;  2V2Z A;  4LFC E;  4KHP I;  1WUU A;  1XMQ I;  1N36 I;  4KHP E;  4B3S E;  4LFA I;  4DV2 I;  1XMQ E;  4PU9 A;  5LL6 R;  1N36 E;  2HFU A;  2A2D A;  5GMD A;  4LFA E;  1N0V C;  4DV2 E;  2UUB I;  5BR8 I;  4LFB E;  2HKE A;  2E5L I;  4DR3 I;  4JI8 E;  4YY3 I;  2UUB E;  1Z0T A;  3B8H A;  4LF8 E;  3B78 A;  1XNQ I;  2E5L E;  4YY3 E;  3T1Y I;  1XNQ E;  4X66 I;  2UXC I;  1FWL A;  3T1Y E;  4URL A;  4NXN I;  4X66 E;  2V8P A;  2UXB I;  1MX0 A;  2UXC E;  2HK3 A;  4NXN E;  2J7K A;  4B3M I;  1OJ4 A;  2X7I A;  3QT8 A;  1NHJ A;  2ZM6 E;  4JI0 E;  3F0N A;  5IT9 Q;  4B3M E;  4YHH I;  3HUL A;  3B82 A;  3J7A G;  4JI4 E;  2E1R A;  1FI4 A;  3ZZ0 A;  1FJG E;  1ZM4 A;  4JI3 I;  2V34 A;  4X62 I;  4JYA I;  4LF6 E;  4LF4 I;  4JI3 E;  4X64 I;  4X62 E;  4HAC B;  4AQY I;  1A6F A;  1EA6 A;  1S16 A;  4DR6 I;  4LF4 E;  2BM1 A;  2X36 A;  1IBL I;  4DV0 I;  1QZR A;  4DR6 E;  5FLX C;  2UU9 I;  2NPF A;  1FNM A;  4DV0 E;  1ZM3 A;  3JAM C;  3V5R A;  2UU9 E;  1DAR A;  3PYF A;  4B3T I;  4ED4 A;  3D4J A;  4B3T E;  1HR0 I;  2ZBK B;  4P7A A;  2UUA I;  1HR0 E;  4JI6 I;  4HXZ A;  3ZZT A;  4LF9 I;  4JI6 E;  1XMO I;  3K1J A;  4K0K I;  3J81 Q;  2CZ9 A;  1IBM I;  4LF9 E;  1N33 E;  1XMO E;  1IBM E;  3J80 C;  4B3S I;  4ZVI A;  4GKK E;  2R42 A;  4MYT A;  4LF5 E;  4HYM A;  1KTV A;  5A2Q C;  4LFB I;  1KIJ A;  4JI8 I;  4HY1 A;  1Z0E A;  1PVG A;  4LF8 I;  4JI7 I;  1NZ0 A;  1EI1 A; 
#chains in the Genus database with same CATH topology
 3FDS A;  2C2E A;  1CC7 A;  1ELO A;  4AL6 A;  4FW6 A;  4X66 J;  7AT1 B;  4LF7 F;  1HBO A;  2MY8 A;  1U1M A;  2FZG B;  4IKA A;  2BUN A;  1YHC A;  1NK7 A;  3I0R B;  4OIX A;  4XDC A;  3FFI B;  4DDF A;  3CDB A;  3Q2T C;  4FVM A;  3N01 A;  3G4S S;  2HND B;  1FD2 A;  2UUC E;  2AWZ A;  1HBM A;  4JP8 A;  4K5S A;  1YJV A;  2ABY A;  3VAI A;  1XNR E;  4OYO A;  2KL8 A;  3DDN A;  3DOK B;  2GHW A;  1HD1 A;  4KHP F;  4QR0 A;  1PC5 A;  1JX4 A;  4WUB A;  1D9F A;  1HAR A;  1SC4 B;  4F04 B;  1Z0B A;  2ZUG A;  5K36 E;  1PBU A;  1BQN B;  4ILM A;  4DR2 E;  4R0J A;  4OZJ A;  2R2S A;  4YR0 A;  3TUP A;  3O44 A;  1Q0N A;  4OI1 A;  4I6A A;  1WNE A;  3LAK A;  3SQO P;  3RZA A;  1A7G E;  3PS3 A;  3GR0 A;  2MLZ A;  3K17 A;  1RWW B;  1TKX A;  1IBK I;  5KFC A;  2B56 A;  1CJT A;  4MU1 A;  4IOC Q;  1PG5 B;  1OYP A;  4W92 B;  2O1V A;  5A8R A;  5KFP A;  3KJV B;  1IKY A;  3FBE A;  4GKK I;  4I4B A;  4ZPC A;  4X65 E;  2GC8 A;  1XQI A;  4K4X A;  3DLH A;  2G2O A;  4DV7 E;  4QWB A;  2GA7 A;  3MM6 B;  1JLE A;  1T9V A;  2I0X A;  1X9M A;  1PBA A;  1TK5 A;  3U1K A;  1XN9 A;  3HZG A;  4O4G A;  5IM0 A;  4ZK7 M;  3K2Y A;  2FQQ B;  3OQ2 A;  3QWU A;  2C39 B;  2CG4 A;  3A4T A;  2BX6 A;  3PVX A;  2JE6 B;  1HWI A;  4F02 A;  4YOE A;  3CME S;  2DGO A;  1Y7P A;  3VWS A;  3D9B A;  1SPB P;  4DSK A;  2W2M P;  3OTO I;  4OO1 A;  3AOD A;  2Z58 B;  2IVY A;  4RBU A;  5ETT A;  3UD5 A;  3N0V A;  4IDK B;  4TU8 A;  3H42 A;  5H9F K;  2W7P A;  3U02 A;  3LWL A;  4DV4 I;  2YH0 A;  5J1E A;  4DR5 I;  2HPU A;  2ALZ A;  1JKH B;  2QA4 S;  1PAU B;  5IT9 C;  2HHH J;  1DTQ B;  5B08 A;  3ILJ A;  2CVE A;  4DPW A;  3KWM A;  4X4P A;  1YG0 A;  1RHJ B;  5DS7 A;  2XQC A;  8RUC A;  4B3R I;  1UVI A;  2DXF A;  1IWA A;  2NUH A;  4DJB A;  2QMX A;  4ERD A;  2PO4 A;  3QFH A;  2PO2 B;  2JZ5 A;  3BDE A;  1ZH5 A;  5I3U A;  1U1R A;  3W2V A;  3AY0 A;  1F6T A;  2FLP A;  4CLZ A;  3N4W A;  3EMT A;  4ZVT B;  4IFD A;  5J1N A;  1GXL A;  4O3N A;  2PE8 A;  3MZI A;  1WSV A;  2HVE A;  6FD1 A;  3X1L B;  3PYD A;  3OTE A;  2FGC A;  4ILR A;  3VZH A;  2RVJ A;  4TYA A;  2DH8 A;  2V2Z A;  2XCA A;  2LA4 A;  3LPY A;  4FW4 A;  2O66 A;  3FCH A;  3K59 A;  3KK2 A;  2E66 A;  2MKH A;  4LFA E;  4A8Y A;  4LFB E;  2OPQ B;  3RYL A;  4PAB A;  5CYM B;  1OY9 A;  1M5H A;  1MWY A;  4DL6 A;  3MR5 A;  1XNQ E;  4X66 I;  4E98 A;  1R0A A;  5DGA A;  5D78 A;  5I3Q A;  1IBK F;  3EXY A;  3QIP B;  4MU3 A;  4ZVU B;  1SKS A;  4ZVH A;  2B6A A;  1SV5 A;  3SSS A;  4GKK F;  2CPY A;  2CYY A;  3RG6 A;  1VGY A;  1B70 B;  4CLP A;  2VD3 A;  3TAN A;  4OZ2 A;  1EKS A;  1IBC B;  5F8G A;  4HR2 A;  5KFK A;  2VG7 A;  4RW6 A;  5IT9 U;  4ZLJ A;  4C11 B;  5F8I A;  4CTA B;  1QSS A;  3NCQ A;  5ETP A;  5B0C A;  4ECS A;  5A2Q Y;  2H9Z A;  1N6Q A;  1Q5Y A;  1T3N A;  3JQK A;  4C6A A;  2VPW B;  3OTO F;  1WEX A;  1EB0 A;  3W60 A;  2G4B A;  5C2C A;  1V3R A;  4P7A A;  3BQ0 A;  4E0D A;  4GRS A;  4DR5 F;  1KQK A;  3D7S B;  3GU0 A;  1OPZ A;  4QPT A;  3DLE A;  1XMO E;  1TU0 B;  5D4N A;  3M2R A;  1UJ6 A;  1GMU A;  4ETX A;  3I4H X;  3TNV A;  2JDJ A;  1VK3 A;  2BQR A;  4OI6 A;  2WVC A;  4B3R F;  1QD1 A;  4ZP9 A;  1SH0 A;  2B7C B;  3DLG B;  1Y4S A;  4KB7 A;  2ZHA A;  3M85 D;  4CYU A;  1UDS A;  2UXD E;  1PAE X;  1QLN A;  4M94 A;  2ZJR Q;  2CAD A;  2E9T A;  3MEC B;  5E2Q A;  1S1U A;  4Q44 A;  2CXE A;  3CJ0 A;  5IC4 B;  5GMK a;  4IZK A;  3MHY A;  3LP1 B;  3RB6 A;  3OSN A;  1C1B A;  3JQM A;  2CPD A;  2KXN B;  3BSC A;  5C24 A;  3PW5 A;  3E51 A;  4QW8 A;  5EKW A;  3FSX A;  4UOH A;  3OBI A;  1FJ7 A;  1UKU A;  4K0K F;  4C4W A;  2F3J A;  2XI3 A;  4DV5 E;  3GON A;  3THP A;  4LRB A;  3N6M A;  1SXL A;  2HHH I;  3G86 A;  1F3F A;  1NU4 A;  2ACM A;  5DZ7 A;  5EX0 A;  5FLX Q;  2XCP A;  1NSK L;  2YNI A;  1Y0H A;  4WP3 A;  3M05 A;  4NX9 A;  4K4U A;  5J2N B;  1UPP A;  3SFG A;  4X66 F;  4ISA A;  1GX5 A;  4C8K A;  3EUN A;  4NLO A;  2AYM A;  2DNN A;  2VB6 A;  4LF7 E;  1Q7L B;  3TJ9 A;  3I55 S;  4RX6 A;  1KVJ A;  1B62 A;  3AD8 C;  4G1P A;  1Z5B A;  3GV5 B;  2OPP B;  2MQM A;  1Z5A A;  3ZTS A;  5A8W B;  1F9H A;  4MYU A;  2PO1 B;  2V5H G;  5AE2 A;  3CED A;  3U1Y A;  1AA1 B;  3KG0 A;  1P1T A;  2FD2 A;  1NJX A;  2YWW A;  4J9P A;  1KEK A;  5LMU I;  2I2Y A;  3QPI A;  1WF1 A;  2W7O A;  4J9S A;  1WG4 A;  3D66 A;  1T9Y A;  4ZP6 A;  5DNL A;  1LWX A;  5AXN A;  2XEX A;  3A3O B;  2ILZ A;  2OHD A;  2OGU A;  4K8R A;  3LW5 C;  2IA6 A;  2B9Y A;  3F41 A;  4YP3 A;  5L38 A;  3KFW X;  1J5E E;  3QLH B;  1VRQ C;  4JI5 J;  5C0X C;  1RAJ A;  1JXL A;  2BW7 A;  2DCL A;  3EGV A;  3QAT A;  2HW3 A;  2QMU B;  4FW9 A;  4H4K A;  5D3G B;  5CD4 H;  4QIE A;  1AFJ A;  5CD4 A;  2ZDO A;  5CA5 A;  1RAG B;  3MUM P;  3MCS A;  3BQ2 A;  4WWS A;  2IM3 A;  3FBF A;  2DH7 A;  1NHV A;  3K8W A;  2DEI A;  2XG8 A;  3R2C J;  1G6B A;  4DUY J;  5GME A;  1SL2 A;  3DI6 B;  4I2Q A;  3M6A A;  4NEZ A;  1NKE A;  2OAU A;  2ZH4 A;  1N4L A;  3IP0 A;  1CG2 A;  1M1G A;  3I5B A;  1C4C A;  2J5A A;  3GYN A;  1MML A;  2AJF E;  1XC9 A;  5L1J A;  3KUH A;  4FKX A;  1VI7 A;  3GIR A;  1EHW A;  3KLG B;  1XBW A;  3KLE B;  4PWD B;  1IKX A;  3M8S A;  4YFU A;  1YGY A;  3O5T B;  2RU9 A;  4J37 A;  2Y1J A;  4C8M A;  4U8V A;  1NK9 A;  2HHH F;  2FY8 A;  2BJ7 A;  2Y0S D;  1NSQ A;  3TI0 A;  5LL6 R;  5DG7 A;  3DOM B;  4EBE A;  2FVC A;  2F4F A;  3MDF A;  1Q8B A;  4YY3 E;  3EDR B;  1RTZ A;  3IXQ A;  4DI6 A;  4ENO A;  1IKW B;  2Y1I A;  3EWG A;  3W2W B;  5K9F A;  1TKZ B;  3ET6 B;  1YDL A;  3M2U B;  2XZW A;  1SUQ B;  3ENA A;  3W64 A;  2VJV A;  1IQT A;  4U96 A;  4MAK A;  1QTM A;  2JEJ A;  3MEK A;  1HNX J;  4WE1 A;  5B0E A;  4YR2 A;  5K5M A;  1S6Q A;  4FYX B;  4NLS A;  3FSY A;  5HAN A;  4HAC B;  2GJI A;  2I6W A;  5JXS A;  2V8G A;  3GYG A;  3PJW A;  2XNR A;  1SKW A;  1AFI A;  2IES A;  3UNY A;  3QJP A;  5LMU F;  3KK1 B;  2I5J B;  4DL0 C;  1S1X B;  1TL7 B;  1UTA A;  2VES A;  2UU9 E;  1RWU A;  1N48 A;  2WHO A;  1RAF B;  3B6B A;  1OSC A;  3JSM A;  1QAX A;  4AT1 B;  5KFY A;  3UCZ P;  2KM8 C;  4HXZ A;  1JLG B;  4NI2 A;  1VJW A;  4F25 A;  3A8I A;  2VG6 B;  1XMQ J;  3SQG A;  1Y5L B;  4GKK E;  3HT3 A;  3P3D A;  3FUY A;  3W65 A;  3PNI A;  4OLO A;  2IJN A;  1SJF A;  2AGP A;  1AXQ A;  4HY1 A;  1LEO A;  3CIM A;  1EP4 B;  3T1Y J;  1M1K T;  3EVW A;  4OL8 A;  1UW4 A;  3T5K A;  2YX1 A;  1UFW A;  1NHH A;  2L3M A;  4NWB A;  1IKV A;  4USW A;  4ER8 A;  4B3M J;  1LWC A;  1WC6 A;  3UN5 A;  2BA1 D;  4DR1 E;  3BF4 A;  3OTO E;  1RT5 B;  3T19 A;  2KZZ A;  1H7S A;  5CZV A;  2MKC A;  3CJ2 A;  5HAT A;  5IFM A;  3IRX A;  2ROP A;  3T9N A;  2KFY A;  2R8H A;  5HMZ A;  3B4M A;  1S5Z A;  3CJT A;  4Q2L A;  1LWF A;  1MG7 A;  2Q6C A;  1Q78 A;  4DV4 E;  2JEF A;  4ED0 A;  2QO3 A;  2HMI A;  2ZBR A;  1FRK A;  5K36 D;  3CCS S;  2K06 A;  1RTJ A;  2H1Y A;  3MPV A;  2F63 A;  5GAH U;  1F5A A;  3GCM A;  3WDO A;  5DG8 A;  2ATC B;  3IWL A;  2JLG A;  1IXK A;  3DKD A;  4H4O B;  1NPR A;  2M2B A;  4DV3 E;  4JI1 E;  4B3R E;  1NHU A;  1YJ7 A;  2UUW A;  2P9C A;  3G2X A;  1S6P A;  4C2M A;  4K4Y A;  2VPZ B;  4P71 A;  3L4B C;  2R7X A;  3NGT A;  4ELU A;  4DUY I;  1CS4 A;  1U1P A;  4PUO B;  1SI9 A;  2L9D A;  4A4J A;  4IZJ A;  3QQC D;  3L09 A;  3UDC A;  3KOA A;  4QNJ A;  4DV6 E;  1HNZ E;  4LVO P;  1EQM A;  1B7Y B;  4ELT A;  4OYW A;  5DNX A;  1CSJ A;  4LCH A;  3I31 A;  2XWY A;  2OEK A;  4KY3 A;  3M7N D;  1WJ9 A;  4JI2 E;  4QW9 A;  4B9L A;  1Z1Z A;  4Z7C A;  1ZAV A;  2DGW A;  2HWI A;  2CA9 A;  1Q16 B;  3EGZ A;  2IAJ A;  5E5N A;  3KNA A;  5SZT A;  1FNX H;  2R8I A;  3S6E A;  1KNZ A;  4WK1 A;  3A1Y G;  2KYZ A;  5JEA C;  5GAD U;  4OI2 A;  1E3P A;  2GML A;  6FDR A;  1VLO A;  4P72 A;  3MI7 X;  4ZPB A;  2M7S A;  2PDA A;  2ZBC A;  5AJ3 F;  1RT1 A;  3SCK E;  3KLV A;  4DLE A;  1FX4 A;  1P9Y A;  1RIS A;  4PG8 A;  1VQK S;  5F8M A;  2ZDP A;  4WKR A;  1HNW E;  3H98 A;  4V1A k;  1U1L A;  3D1O A;  4F50 A;  1HNX I;  2O3D A;  1GNK A;  2YKN B;  1WHX A;  2XTJ P;  2DT9 A;  3CCT A;  1S1T A;  2DY9 A;  3GQC A;  2BJD A;  2XMA A;  2KI2 A;  4LT6 A;  2LLZ A;  5DDQ C;  5ETV A;  5D4L A;  3MED B;  2MKI A;  2D9O A;  1LXN A;  4OO1 C;  2PNZ B;  1RTD A;  4CDI A;  4FYD A;  1ZM9 A;  2V2V A;  1VQP S;  3MPY A;  2AJ0 A;  4OX9 E;  3G6X A;  4ECR A;  3L7Z A;  3DRP A;  2B7B B;  5K36 A;  1CJV B;  2YVS A;  1Z0W A;  3QGG A;  3BYP A;  4DSF A;  1XMQ I;  1UDN A;  2XY6 A;  4OQJ A;  3MM8 A;  3GZ7 A;  1SC1 B;  3FZ2 A;  1WKK A;  1A6L A;  4DCJ B;  2A2D A;  1T9U A;  4F4A A;  3I6P A;  1GX6 A;  1X4B A;  5BR8 I;  3QRP A;  3C19 A;  2FUG 9;  1V6H A;  3TOQ A;  2WBM A;  2IRU A;  4G65 A;  3T1Y I;  3GWC A;  3M7V A;  2BW2 A;  4WFX A;  5FLX Y;  1HW8 A;  3DXS X;  2D3O R;  4DUY F;  2XMM A;  2J6S A;  3OJU A;  4B3M I;  1OJ4 A;  4WTO B;  3LOU A;  4IFD C;  2CVI A;  1H2T Z;  3P5B P;  2DO0 A;  4GMK A;  3I0S B;  4CLU A;  3MM5 B;  4ANC A;  1NH8 A;  4ZDN A;  2E1P A;  3JXO A;  2WNR A;  2C2K B;  1YJT A;  3BGR B;  1AYE A;  2QC3 A;  3TAM B;  3UDE A;  2NS1 B;  5ADZ A;  1T0T V;  4X64 I;  3BDP A;  5AXM A;  2B43 A;  2PC6 A;  2MLX A;  4J91 A;  1NCL A;  4DR6 E;  3R1L A;  1IJE B;  4DV0 E;  2LQB A;  3JAM C;  4UZC A;  1MNE A;  3RB3 A;  2W8L A;  1KC8 T;  1DAR A;  3O6Q A;  3MMB B;  4ED4 A;  2ROG A;  2WVE A;  1B0T A;  4YR3 A;  3PIP Q;  4IOA Q;  2CQ4 A;  1FRX A;  3NS5 A;  3HPO A;  3C6U B;  2IRY A;  3ZZT A;  3K8V A;  4DQI A;  1MN7 A;  1NK8 A;  2HNZ A;  5HMW A;  3EVM A;  4OV1 A;  3TRG A;  1EAR A;  1AW0 A;  4FF1 A;  4ED5 A;  1R6Y A;  3OT9 A;  3ISN C;  2UV8 A;  4R8U B;  2QV6 A;  2OPS A;  1SC6 A;  1VC0 A;  4O44 A;  3GR1 A;  3HHE A;  4NBQ A;  1HNX F;  2RKI A;  3AB2 B;  3WHI A;  3UO0 A;  4C48 A;  2UXC J;  1DY3 A;  3CCJ S;  1X0F A;  2HFS A;  2XMV A;  2OI2 A;  2CDQ A;  2BJE A;  4YB1 P;  1Y3K A;  2RF2 A;  5KT5 A;  5D0