4ED4A

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
303
structure length
299
Chain Sequence
SDWVPTGAVTVRAPGKVNLYLAVGDLYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 97
structure length 299
sequence length 303
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4ed4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ed4A01
1Z0CA 4HACB 4DV6I 1HNXE 2UXBE 1BKNA 1U2RA 4DV1I 1Z0EA 4JI7E 4DR7I 1Z0TA 4DXLA 4PU9A 1XNRE 1ZM2A 4ED4A 1QZRA 4DV4E 4JI0I 4DV0E 4YY3I 5A2QQ 2V8PA 4JI1I 1B62A 2DEJA 2HHHE 1XNRI 4GKJI 1ZXNA 1J5EE 3T1YI 4NXMI 2X7IA 1NHJA 2UUCI 4DV3I 1N32E 3J81C 4LF5I 1B63A 4HY1A 4LFAE 4DUZI 1XNQE 4XTJA 4YHHE 4DUZE 2A2CA 4PRXA 2UU9E 1HR0I 3WU4A 2XEXA 4DUYI 2UU9I 4DPTA 2UXDE 4FW9A 5GMDA 1N36I 3ZZ0A 2HFSA 4DR4I 4WUDA 1IBLI 1S16A 3LNUA 4DV3E 1A6FA 1KVKA 4LFCE 4JI3I 4JI0E 4HACA 2LJPA 1OJ4A 4X64E 1FKAE 1N33I 4NXNI 1Z0BA 4PRVA 4UTGA 2NPFA 4X62E 1Z59A 4DR6I 2J7KA 1UEKA 4X66I 2OI2A 4DPYA 4JI1E 2F4VE 3J80Q 4B3TE 5L3JA 2VQEI 1N0UA 4FWDA 4UT4A 1EI1A 4LF9E 3J7AM 1Z0VA 4M1KA 2ZBKB 1XMOI 1I94E 4JI5I 4HXZA 1Z5CA 4FWGA 2BM1A 4NXNE 1RREA 3PYFA 2Q2EB 2BM0A 1ELOA 4LF7I 4LF8I 4JI8I 1PIEA 4DV5E 3T1HE 2R3VA 3ZZUA 5LMNI 2V34A 3JAMC 4GKKE 3PYGA 1PKPA 3HULA 3B82A 3B8HA 4P52A 2R42A 2UXDI 4LFBE 1N34I 4I3HA 2E5LE 1Z5AA 3T1HI 4DR3I 4DV5I 4DR1I 1FI4A 2UUBE 3V5RA 4YHHI 5LMNE 4B3RI 4JYAE 1FJGI 2UUAE 3OTOE 3J7AG 4JI5E 1EA6A 1ZM4A 1J5EI 4GKJE 4X65I 4K0KE 2F4VI 1IBKI 5FLXC 2DEIA 4FWHA 3T1YE 4DR2E 3PYDA 1N33E 4X65E 1I94I 3QT7A 4X64I 3CWVA 4DR2I 3F0NA 3PYEA 3H4LA 4LF6I 1HNXI 1IBMI 4X66E 4DV4I 4JG4A 3QT5A 5LMUI 4JI2E 3ZKDA 4DR1E 4LF4I 3JAMQ 4RPFA 2UUBI 1N34E 1XMQE 4DR4E 4DU7A 1HR0E 1HNWE 2UUAI 4LFBI 4KHPE 4DPUA 2ZITA 1N36E 3M6AA 4B3RE 4DUYE 2ZM6I 4LFAI 4DV2I 3WU5A 2GS8A 2HK3A 5BR8I 4B3MI 1NZ0A 3K17A 4DR5I 1ZM9A 3D4JA 3QT6A 2V2VA 1WUUA 2V2QA 4NXME 5LL6R 1H74A 4DU8A 4USMA 1N32I 3J81Q 4LF9I 3GONA 4B3TI 5LMUE 3ZM7A 4USKA 4YY3E 5BR8E 4B3ME 2HHHI 4P7AA 4LF6E 4DR6E 4JI4E 2A2DA 4X62I 4FN5A 1MU5A 3Q1QA 4DR5E 4DV0I 4DR7E 4MYTA 2WW4A 3ZKBA 1H72C 4JV5E 1MG7A 4JI7I 4EMDA 4DV6E 3LTOA 2ZM6E 4JI2I 2VQFI 4LFCI 1KTVA 1FNMA 3LPSA 1H73A 1ZXMA 3WU3A 1H7SA 3WU6A 4JV5I 3ZZTA 2VQFE 2VF3A 4AQYI 2BV3A 2UXBI 1DARA 2AJ4A 2X36A 5IWAI 2VQEE 5FLXQ 1HNZI 4Z7CA 4ZVIA 1Z0WA 2UXCI 4B3SI 1XNQI 2EFGA 4R1FA 3OTOI 3J80C 4DV7E 5IT9C 4LF5E 4URLA 1FJGE 4JI4I 2V2ZA 4K0KI 2UUCE 1XHKA 4OX9E 4DPWA 1N0VC 1H7UA 4DR3E 4JI8E 1VISA 1IBKE 4LF7E 4LF8E 4JI6I 4DPXA 5A2QC 3V2UC 1IBLE 2HKEA 1NHHA 5IT9Q 4WUCA 4JI6E 1Z5BA 5GMEA 1XMOE 1Z0GA 3K1JA 4JYAI 4Z7YA 3QT8A 1RR9A 4DV7I 4OX9I 1HNWI 5IWAE 2CZ9A 1ZM3A 2E5LI 4B3SE 4HYMA 2HFUA 4DV2E 1XMQI 4GKKI 4AQYE 4MYUA 4KHPI 1FWKA 2HKJA 2E1RA 3B78A 1NHIA 1PVGA 4WUBA 1KKHA 4DV1E 1MX0A 1FWLA 4KQVA 4JI3E 2UXCE 1S4EA 1K47A 1KIJA 1D6TA 1IBME 2HK2A 4LF4E 1HNZE
chains in the Genus database with same CATH superfamily
5CZXA 3OFEA 1YRTA 2NXUA 1TV6B 4USVA 2AE8A 4KAIA 4PG5A 2E5HA 1NK4A 1N34J 4DV6I 1S6OA 3TAMA 5D4NA 1TAQA 1R6MA 1B64A 5BYQA 3UFCX 5E3AA 5B0AA 4B3OB 3UD4P 2AX1A 5C2GA 1P1TA 5F0UA 4DV4J 1SJQA 3PEJA 4HDGA 1NRKA 5DJBA 4RNMA 4J9MA 1U2RA 2JE6B 5C0XF 2IESA 4F0KA 5CCMA 1GTHA 1ZPWX 3CMAS 2ZD1A 3C6TA 4JI7E 2NUHA 3SDEB 4KIAA 1H2VZ 1NK6A 1LWXA 3MR6A 5E3CA 5DO2A 1UKUA 1BLUA 4HI1A 4NA3A 4QWAA 2MKSA 3Q22A 2RF2A 3VAGA 4J9KA 1WSVA 4ED3A 5B0EA 4R8UB 4YQWA 1QZRA 4WKRA 3GCMA 2RDDA 2RD5C 1VQNS 4IZKB 4M5NA 2L41A 4JI0I 3GJSB 4DV0E 1M1HA 4O0IA 1T03A 3M2RA 1WI8A 3KUEA 1AB8A 2LDYA 2B7CB 4OLOA 3TEGA 2F8EX 4H54A 2HRYA 3ZO7A 4PR6A 2HHHJ 1B62A 1ZBTA 3QAUA 2GZOA 4ZLLA 3Q8QB 1VYAA 4GKJI 4NXMJ 3US5A 3NBPA 5EX0A 3MAQA 4RNHA 1JWWA 1SB6A 3PCOB 1JLFB 2DHHA 2IJFA 4B08A 5DM7Q 2MDAA 1OPIA 2F9JA 3BBBA 3BYPA 3C16B 1TV6A 3EVOA 4ZLPA 2LVWA 2EKNA 5GAHU 4DL2A 1NJYA 1AUSL 1HWLA 3LOUA 4M5DA 3V4IA 4KV8A 4OZ0A 1QUPA 3I4PA 1FNOA 2E7XA 2MQNA 1P9YA 2X7IA 2NPIA 3BREA 2CWXA 1X4FA 2MQLA 4LRCA 2HNDB 1T0TV 1NB7A 2E5LJ 3A8IA 1KQFB 3K57A 1FX2A 4OQJA 2EPIA 2FJEB 2MSTA 5KTQA 3MEDB 4C2MA 5LJ5Y 3TRGA 4JI4F 1FDBA 2ZEJA 4U8VA 2ZKUA 2HWTA 3OR1A 4D3HA 4B3TJ 3Q2TC 4ILMA 1KLMA 2DH7A 3BKFA 1TL5A 1X5SA 2IYIA 2Z2LA 1K44A 3SDEA 1FRIA 3SCJE 4YY3F 4NLUA 2YTCA 3OV7A 2CQ2A 4GKKF 4JI2F 4NYZA 2JLGA 1S1VA 3BEGB 3H59A 3SFGA 3KHRA 2ZH3A 3Q8YA 1HR0J 4ES1A 3DXBA 1KDNA 2VDHA 1RXOB 4X66J 3NG8A 1IKYB 4LFAE 3MEEA 1L3KA 2FJAB 2DGWA 4L3NA 3DU6A 2XO6A 5I4MA 2Y8WA 2RS8A 5JUMA 2VBWA 3MCNA 4EK2A 1AA1B 3NRBA 3OLBA 4PRXA 3BN4A 1TU0B 3PHEA 4PXBA 1TZ0A 1U49A 3OJSA 4G1QB 4KO0A 1GMWD 2XEXA 4NLDA 1TQLA 3SV3A 2YNGB 4ZITA 1FHTA 2LDIA 1JLEB 5KFYA 3QSIA 3MI7X 1QDUB 1BWVA 4B9VA 2DXFA 3OTEA 2HFOA 1UFWA 2MZTA 2HW3A 2PO0B 4JI1I 1SI9A 1Q5VA 2QZ8A 3MPUB 4WFZA 1LWFB 1FA0A 4OYXA 3BH7B 4X64F 4LF8J 1N36I 1Q4RA 5L1IA 3K5NA 4KHRA 2NUUG 3CCZA 3NWRA 3PRVA 4NX9A 3PR5B 4CLPA 4DSLA 4KPYA 1W7WA 2FC9A 1DQ9A 3BF4A 3VHQA 2LP4A 2C37B 5DLFA 2IERA 3OR2A 5KFRA 2NLWA 4TNOA 3SCLE 5AJ3F 1RU2A 1UVLA 1D9AA 1IBMF 1S16A 4ZVQB 2JNJA 4Z2XA 2JWNA 3N79A 3LNUA 2XY5A 1U2CA 4LSLB 4LRAA 4O44A 1A6FA 2FJDB 4KHPF 2OSQA 1DZ5A 1BQMA 3PS2A 1XNRJ 3KLHB 4K4ZA 3BZQA 3VAHA 4EZ6A 2W2MP 4W4MA 3QRQA 2CQHA 3RB0A 1U02A 4C97A 4FPIA 2BJ9A 1FF2A 2CJKA 4RW9B 4IFDF 1EAYC 1DFDA 3IBFB 1CEZA 1HBUA 2FC8A 2I38A 3TWZA 2KB2A 5BJRA 2LJPA 4OO1D 3M05A 3BKUA 1U1OA 1YI2S 4LBIA 3MD3A 2BACA 3E8OA 3PV8A 3K5PA 4KH0B 1FVQA 3UO0A 1HI0P 1I1GA 1DQAA 4FYVB 3HT3A 2QA2A 3BQ1A 1HNXJ 3MDFA 4DBQA 2V9KA 2IA6A 3T9NA 4RZRA 1J5OA 1RT1B 1UJ6A 4UUWA 4EBEA 1UEKA 4LPFA 4BBYA 4OI4A 4LFCJ 4OJ3A 4NXNJ 2XLJA 1F2GA 1LFWA 1X4HA 5JEAB 3H5SA 3R7SB 4O4GA 2ZJPQ 1JJ4A 1EQMA 1QAYA 3Q8UA 3GE9A 3DLEB 2C38A 4QNJA 1HBOB 4DV3J 5C42A 4G3IA 3EXCX 2GO3A 5L9XA 1QUVA 2Z5EA 2VQEI 4FWDA 3G8QA 1VC5A 3DGVA 2RS2A 2LEPA 5D8HB 2MXYA 5EGYA 1CULB 1YKWA 2KHCA 3MM8B 3I0SA 4CWBA 3C3LA 4UZBA 4C9DA 2KJWA 1XMOI 1PO6A 3OFHA 1B70B 1MROB 2MQMA 2EK6A 3LALA 3QATA 5A6PA 4NLVA 7AT1B 2HHQA 4NXNE 4MKYA 2K06A 3KDNA 2B7BB 4Z37A 4NLRA 4OHVA 4HKQA 4IZJA 3QJPA 2UV8A 4DN0A 2CQ1A 4IG0A 4FNHA 3QIPA 3MPVA 3CWJA 4Y00A 4CZCA 1J5EF 1KP6A 4RW7B 2C39B 4LF7I 3O3LA 5J1PA 2AT1B 2KM8B 1YJNS 2F63A 2VFRA 4ICLB 2YKNA 3OFFA 3CCQS 4QW8A 2JLFA 4ID5B 2FJWA 5KFNA 1E3HA 4OZEA 1PIEA 3TZXA 1RTDA 2FPHX 2X3GA 4FXWA 2FYXA 3T1HE 4IFDD 4LF4F 2LKZA 2FY8A 2R3VA 2FVQA 4PWWA 2XY7A 4H4KC 3GIRA 1U47A 2BKNA 4CO1A 3CJ5A 5B0GA 2V34A 6FDRA 1TELA 4GKKE 1R7IA 2WBRA 1R89A 3W2WB 5LMUJ 2OIHA 5L1KA 2H48B 1A6LA 3UVJA 1PKPA 3AJ2A 3HULA 1FO1A 1HWUA 2DYAA 2F65A 3QQCD 4I67A 1OMSA 3B82A 1H98A 2RQMA 4Y2CA 2HGLA 2E1AA 4JBCA 2Z58B 4P52A 2IC3B 1OYEA 4CYUA 3JYTB 2C39A 2WP8A 4ZPDA 4ED5A 2DNGA 3DRYA 4NWBA 2UXDI 4LFBE 2I8EA 3D6HB 2CPHA 3EMTA 3GJTB 3MM6B 4I68A 4I2PB 3ZTQA 2HNDA 1HFEL 2KU7A 3DC2A 5D6GA 2P5VA 1X9SA 1G1XA 1KOHA 4TQRA 3P3EA 1PBUA 2QTWA 4A48A 5B08A 4DR2J 4A8KA 2Y3YA 3CDEA 2HZCA 4I7FB 3DHXA 2CXEA 3QBCA 2KFZA 2PO2B 2EFVA 2UUBE 2YQ3A 4YHHI 2PA3A 2UU9F 1D8YA 5IOLA 2WHOA 4K8RA 4CT9A 3LAKA 3ZZRA 1IQZA 2BRLA 2U2FA 1IKYA 4IG3B 4K4XA 3KLGB 2H65B 1O6XA 1YJTA 4QPXA 1S1TB 5GAGU 1U45A 1VRUA 2H9ZA 2J9DE 2RAQA 3BGFA 2WVFA 3FEZA 3JTPA 2W9CB 4B9MA 2BVZA 5HSPA 2MEWA 3D5MA 3GMGA 4OYOA 5DQGA 4X65F 4JI1J 1J5EI 4E0DA 4PUOA 4LF7F 1B0VA 4I64A 4XDDA 4X65I 1G6BA 1C0UB 4ELUA 1Q7LB 1ZAVA 4DV2F 1HPZA 3DLKA 4J9NA 5FLXC 4LF4E 4PXCA 2DEIA 1RUSA 3T1YE 1RLCL 2Y1JA 3AXKA 1RAJA 3FBEA 2OH2A 4LVOP 3PKYA 4DSKA 2K1RB 2RIJA 3MMBB 3PYDA 4HHJA 2DPIA 4I7FA 4FF3A 1YBUA 2UVRA 1FX4A 3OFGA 5K5MA 1Q82T 3PYEA 2XWYA 5H1SV 5BR8F 2DISA 3D1HA 3H5UA 5K14B 1UEVA 2E5GA 2OEKA 4MQYA 2J9DA 2EWHA 3PIOQ 1NB2A 3DKDA 3GV5B 1GAOA 5KFWA 4X84A 1X7VA 3MCMA 1OYDA 1G4CA 4FW7A 4HHUA 4KFBA 1HARA 2HHWA 3RW7A 3M30B 4J5OA 5KFAA 3VGTA 2F8MA 1NHUA 4U96A 4TYBA 2ROEA 3LH2S 1VIOA 4F67A 2RU9A 2ZUAA 1RP5A 2DNYA 3K2YA 3PFEA 4PUOB 2WW8A 3HLUA 1JLFA 2KYZA 3HF5A 4C11A 2CQGA 4YS2A 1K0VA 3M8WA 1CJKB 3MPDA 2VIHA 2YNFA 4A8FA 3G82A 3ZTPA 3H4BA 4WBFA 4U7UD 2UXBF 3IG1A 2GVZB 1IKXA 1NK7A 3P96A 2B9XA 4ID8A 3NNAA 2P6TA 3ET6A 1TVRB 2MLZA 4CLFA 5B0CA 3FFIB 5J2PA 3OPKA 1IBKI 4NLSA 4ILRA 5KFOA 4LFBJ 1QM9A 2NXJA 1N34E 2JOQA 2KHDA 3G87A 3KJNB 3N5BA 5SUHA 3VWSA 4YP3A 4DR4E 1KFDA 1DTQB 1OY9A 1VCTA 1JKHB 2K7KA 4MKBA 1HR0E 2NXEA 4WFYA 2UUAI 3R5DA 2B4UA 2CQCA 4Q0BB 4UOCA 1MU2B 1Q8LA 3FZ2A 4KHPE 3M6AA 4B3RE 1UL3A 2QLJB 4ETZA 2UUAF 3TA1A 4UOGA 2O1WA 1EJ7L 1C2PA 2V94A 2ZM6I 4M63A 4PG8A 5IS2A 4O3SA 5HMYA 4JI5J 4DV2I 4LF4J 1EX8A 4YHHJ 4WK1A 5KFJA 2A6MA 1P6TA 5IC4B 5K8PA 4DSJA 1TL3A 1RAFB 5JEAA 3LP0A 5D4PA 1XBWA 4LIRA 1CULA 3RJMB 2C3PA 3W2VB 1XR5A 1T7PA 1BY9A 1F9HA 3A3PB 4WU2A 1LWFA 2MKHA 1VQ4S 4LMZA 2JT2A 2HK3A 1SUQA 3GZ7A 3VVTA 4YUDA 3G71S 1BMQB 3KXDA 1XMQF 5BR8I 3DRPB 3R2CJ 5F8IA 1JNZB 2MTLA 3H0PA 2UXDJ 4PPDA 3TUZC 1WKKA 3TZYA 4ZS6A 1ZM9A 2GVZA 2CJXB 2QL5B 5MLCV 1KVJA 4F4WA 2HQCA 2V2QA 4N56A 5LL6R 5J2MB 2CJAA 2VOOA 4LCHA 1LQ9A 2VB6A 2OLWA 1QY7A 1Y9OA 2EBEA 2X1GA 2YKNB 3MGJA 4OYAA 4D3GA 4LF5J 3AH6A 4NA1A 4USMA 4B9NA 4OI2A 2PMHA 1USUA 5L9NA 3J81Q 3P06A 1WC3A 2FHJA 3AQOA 4JI3F 4HH0A 2VICA 4LFAJ 2D3OR 1IUJA 4LF1A 2CDRB 1IJEB 2F4VJ 3K5OA 3IBCB 4JI3J 5SZTA 1JX4A 1CJTB 4DSFA 2HZAA 3CSKA 5K36B 3GMEA 1JLBB 5DQHA 1RAAB 3A3OB 4P71A 1VOMA 2DB1A 2GGPB 2N3LA 3TAMB 1CVJA 2DHGA 2VFVA 3G6VA 4ECUA 2BZ2A 3EDQB 4AT1B 1DLOB 1WHVA 5JXSA 3NGUA 5L39A 1OY8A 1V3SA 4JI4E 4EU0A 1HIYA 1VQOS 2OHDA 3MEGB 4C8NA 4DR5E 1KR4A 2DGUA 2PDAA 4H4OB 1HWKA 4N47A 4PQUA 3MM6A 1IKWB 3QMQA 2W8LA 2OPSB 4F26A 5FJ4A 1SKSA 2F4VI 4O4GB 2KT2A 4A8MP 2DY9A 4B17A 2KYXA 3W9JA 1V5IB 1Y4UA 2MJNA 1Q78A 1C0TA 5C0XA 1URNA 3VF0B 3W63A 2DNRA 3W61A 2FZKB 2UXBJ 3TANA 5GAGI 3ADAC 2KH9A 2EFOA 4IG3A 4JI2I 3HSGA 5I42A 2X1BA 2FJBB 3KK2A 2Z30B 3JAMY 3E2EA 1MWYA 1KTVA 5DDPC 4LCFA 4DCPB 1S0OA 2HPUA 1T9YA 1CJVB 2AIRB 5G0RB 5KFSA 4DEZA 3LPSA 1M5PC 3J7YI 1J27A 5D4OA 4A47A 2CG4A 3ZZYA 4DX7A 1ZXMA 3MTJA 3CJRA 2MQ8A 3GV7B 3NAHA 2M8DB 2V50A 4IDKA 2VF3A 2XM3A 3NKYA 4FF4A 2HAIA 3OHBA 1P9QC 1S79A 2C3UA 1FKAF 1T05B 1USVA 1S1XB 2ZC3A 2IM1A 1IKVA 4LT6A 3JTOA 2IYGA 3H20A 4I69A 2P9CA 4RUCA 5IWAI 4CO4A 1U6BA 4I6AA 4RX6A 1T9XA 1PG5B 2B0GA 2VZ9A 4GKJF 4YN3B 2F8HA 4Z7CA 3OXGA 1F60B 3PO5A 2V2KA 1FJGF 2ZDPA 3VQTA 1Z0WA 4LRBA 1OQ6A 1N56A 2LXUA 4AUKA 2CZ4A 1X9MA 2HZVA 2E9RX 4AIMA 3DU5A 2ZKTA 1CLFA 4L76A 3BDEA 1YTYA 3PY8A 4FYYB 2AJFE 2B9EA 3HMJG 2NQPA 1U6FA 4M95A 2F1FA 2J8AA 1RWXB 3CCTA 4NLWA 2K3KA 2WSFC 2XSJA 4WK3A 4DV1F 3OTOI 3NWGA 5IT9C 4LF5E 4JI4I 2LA4A 2V2ZA 2DH8A 4QWBA 2W2QP 2RF2B 3QT6A 3UNGC 4OX9J 1TAUA 2V8VA 3M2UB 1H3DA 2GNKA 3QAEA 3L09A 3AB2B 5CYMA 2K2PA 1FK9B 2OMLA 3D6MB 3TUIC 3ZTSA 3CDJA 3V81B 1IR0A 4TU8A 4OYMA 1V6HA 1EB0A 1UZDA 2ZD1B 3C6TB 4F3QA 1R0CB 2BR2A 4Y2MA 4EUVA 1M5VC 3BPSP 2CJQA 4NI2A 4A8SA 4F8RA 2IMOA 3KLEA 5ETKA 1HNVB 3AA8A 4L6V3 2BMBA 4U6PA 3TUPA 2M3DA 3T3FA 3JB9k 4OO1C 1TL7A 2XMAA 5RUBA 1NPKA 3SXLA 4O4RA 3DGPB 3MAAB 3W5YA 3P3CA 2OELA 3J7ZT 1AFIA 1UDQA 2ASLA 4WUCA 2RDJA 4IR1A 5AXNA 3AD7C 2PO4A 4O44B 1TUWA 3DOKA 2F1DA 2RKIB 3UN5A 4Z7YA 2OMOA 2AYGA 4JYAI 1N33J 3PKMA 1C0UA 2ZH9A 2JVOA 3Q8VA 2KXHA 4A8OA 5EX3A 2R7VA 2HVDA 1N32F 2E1MC 2FVCA 2DGVA 4OHYA 2O1TA 1MLAA 2IDEA 1N5QA 3LGHA 1SKWA 3ZM7A 5HVGA 3FEYB 2ZOMA 3D68A 3BPDA 5ITHA 3CMES 4DQPA 5IT9U 2V4JA 1ZM3A 2M52A 1YJRA 2OPPA 2R7OA 4H4MA 1HPZB 4LRDA 2GHWA 3OTDA 5KG3A 3J80U 2E5LI 2HFUA 2HNZA 4R5PB 4DV2E 1BD6A 3M6WA 5A0YA 1T3NA 4LF6F 3I31A 1BQXA 2F4FA 2LEAA 4MYUA 1BQNB 2C42A 1NZAA 1H7XA 4KHPI 1UDOA 1FJGJ 2MB0B 1VQKS 5KG6A 2I6WA 3AJ1A 3CO9A 4MIBA 4C3MA 2EXUA 4Q5VA 4CTAB 1TKDA 4IFVB 1MX0A 3N6MA 1FWLA 2WK4A 2G2ZA 1DURA 3EWGA 2RKIA 4OJGA 2UXCE 2GMHA 3AT1B 3OJUA 4DZDA 4KFBB 5IC6B 2YH0A 5M2PA 1LWEB 3EGVA 4LSZB 2R2UA 4OZLA 5HAOA 2HFNA 1RTJA 1HNZE 1S57A 1E6YA 3UDEA 1Z0CA 5BYRA 4J9PA 4ZP7A 3RBDA 2JEAB 4QNKA 3JSYA 2N3OA 1WF0A 2M0GB 1F5BA 3OUYB 4KSEB 4ANDA 3JQJA 4FS1A 5HATA 4K50A 2UXBE 2ILYA 3EPIA 1BKNA 5JEAE 2OUGA 2BDPA 1JJ2R 4CCHA 4C8LA 2EEYA 3IXQA 5EWGA 3J7YU 3EGWB 1RBOB 3L4BC 1XK8A 2ZUGA 4P6QA 1JLEA 2GJFA 4C0BA 1Z0TA 1IR2A 3VGSA 4DXLA 4B02A 4C98A 4PU9A 2YKAA 4CO3A 1QAXA 4BC9A 1RDRA 5CH7B 4QIFA 3UNYA 2BRKA 3BV8A 4EWTA 3GLLA 3M85G 3MCSA 2LFVA 1YZ7A 2VG5B 2H5IB 4ED4A 4DQIA 1TMMA 4NBQA 4FP9A 2WOMA 3QLHA 4E8UA 5ETRA 1U1RA 1F5AA 1SBRA 4YHHF 1SQEA 3GCXP 3QGHA 5I3PA 4JI6F 2KZMA 3FNNA 4ZVGA 9ATCB 4Y34A 2UUAJ 4UOHA 4ID5A 2CQ3A 1R6LA 2JEBB 1FTRA 5D4LA 2M8HA 4NLOA 3RYLA 1C0TB 1N5VA 1S6UA 4B3OA 1SJFA 4AXIA 2VHGA 5A2QY 3QWPA 1S1UA 2BE9B 4DCOB 2KT5A 5T14A 1IBLF 5DM6Q 4WJBA 5HQMA 1WC0A 4DUTA 5KFZA 2VH7A 1AFJA 2CVEA 3D0GE 4QIWD 2V5HG 3LF0A 5LSOA 3BSOA 1J5EE 2HMIA 1FEEA 1MWZA 1WSRA 1H2TZ 2AX0A 2CPIA 2JJ4D 1ZA2B 5CD4H 4NCGA 1EZZB 2O3DA 2NXCA 4KB7A 3RAMA 5LL6d 1NDPA 2A18A 2XYPB 4DR1F 1FRMA 1U25A 4LF9J 2UUCI 1TKXB 2GC8A 3E01A 3ULHA 4CQ1A 3O44A 1SJ3P 2HVEA 4C8OA 2ZZNA 2WSEC 4Q7AA 4J9OA 5JVGQ 5ETTA 3FGVA 2ZBIA 5CA5A 3VAIA 1GEHA 2DJWA 1PC4A 1S9EA 1YBAA 2VC0A 2QN6B 2Z2YB 5THWA 5F9LA 1ULRA 4G1PA 1RT2B 2IOPA 1B63A 4EYHB 3W60A 3I9ZA 3KLGA 3DNCA 5HBMA 4DUZI 2BJ8A 2CJBA 4MIAA 5D15A 1Q86T 4YHHE 2JFDA 3FRYA 2B9WA 3H1CA 4PABA 1YGYA 3R7NB 1HNIA 3ZZOA 4ZOSA 4DG1B 1AZSB 3RBZA 1UJ5A 1X4AA 1S7IA 2BANB 2IHR1 1KFSA 2GAGC 3FK4A 4DMZA 2RILA 3C6UA 3U1YA 4KTQA 4DQRA 2MSSA 2ZVIA 3S6EA 3DLBA 3MM5A 4X64J 1VBXA 3I5AA 3CNQP 3UWTA 2CKWA 2D3O1 1TFYA 3SYZA 1X31C 1XTZA 3OVBA 2UU9I 4Y2IA 2HLUA 5IQ6A 1NDKA 4NYPA 5A2QU 3HT0A 1P1LA 2MKCA 4NLXA 3HHLA 3WHIA 2ZOGA 1X4DA 3PW7A 4FS2A 1X60A 2KG0A 4HYKA 3GFYA 3MEGA 1RA7A 3ZZ0A 1N33E 3D0HE 2XHCA 1PAEX 3M8RA 4ER8A 4JI8J 4DR4I 2BUNA 2CA9A 2WONA 1X5PA 2KL8A 4NE9C 3A13A 3KLEB 2A0FB 3J81C 5JJBA 4FBUA 1MMDA 4ZPBA 3CCRS 4WUDA 2OAUA 3M1VA 5D0HA 3LWMA 2FVPA 1IBLI 3P8BB 5A8RA 3P3DA 4EFAC 2BA0D 2QEXS 3VGUA 2MQOA 2POKA 3KLIA 4ENOA 2RMLA 4OX9E 1NPPA 1RK8A 3IMQJ 4IRDA 3ILJA 2RRNA 3HKMA 3CJ4A 3VR1A 5IT4A 3BSAA 3EZOA 2HBYB 1LW0A 4LVNP 4ZVFA 3CCWA 4LFCE 4KE5A 2CQPA 1RA6A 1QE1B 2ABYA 1NPRA 2HQDA 1M5OC 3P3GA 1OJ4A 4RR5A 4X64E 2RSQA 2MQQA 1FRHA 1N33I 3TVYA 2Y1IA 1FKOB 1M5HA 3Q89A 1WJ9A 2DNKA 2OPPB 2N7CA 4B3SF 1SC4B 4CH1A 1S6PB 2MKJA 4PRVA 3IR7B 3E51A 4K4UA 4DUZJ 2CGEA 4OV6A 1T95A 2HS3A 2J7KA 3DRRA 4OYIA 2GFFA 2VBXA 4P7TA 1NDLA 3PJWA 4FVMA 4K5RA 4PWDA 5KFHA 3NCQA 2AMCB 2LU1A 5J1EA 4X66I 3CE8A 4K4YA 3UN3A 2FVSA 1C4CA 4MK9A 1WC4A 2OI2A 3R9LA 5HROB 4M94A 1VK8A 1RHJB 1YQHA 2CNLB 2DR6A 3EJMA 3LO3A 4IYQA 3KK1B 3IS9A 4O23A 3KG1A 5DGAA 1SL1A 2HBRB 2WNRB 1N0UA 3SQGB 4UT4A 4LF9E 1HHQA 2LU2A 2KRBA 2DRBA 1QD1A 2JEAA 2IAJB 4P73A 1HNWF 1TL3B 4M1KA 2RU3A 1RADB 3R7BB 4M5MA 1HLWA 4OYPA 3QFWA 5A8KB 1I94E 2XLKA 3O8WA 1NEEA 2JFKA 1U1MA 2K3IA 4X65J 4J9LA 4RUHA 3CPWR 2XULA 3ZFVA 4DR4F 3SSSA 1LWEA 1ROFA 2CDQA 3FVYA 3PIPQ 2IVMA 1J5EJ 2PIIA 1R8PA 3PYFA 4K0KJ 3WIUA 5LM7E 2BM0A 2AJ2A 4USUA 4OO1A 3MFIA 3GIIA 2QC3A 3N5FA 2LMIA 1RZMA 1LKZA 2C3MA 3KTQA 3N28A 4GKKJ 2VBZA 3IA0A 5DRKA 3IR6B 3NNCA 1XWLA 4K7QA 2B5JB 1REVB 5E3QA 5DQIA 4GKJJ 4JI8I 1VQPS 2VG5A 5KFTA 1L3VA 4W92B 3IWLA 4Q8EA 1VJQA 1YDLA 3AXMA 3FCWA 2ZHAA 3EE3A 4DV5J 3N01A 2XMVA 3C66A 4ZLJA 4DUYJ 4IFDB 3H42A 4MDTA 2GX8A 3JSBA 3KJQB 2DNHA 4F04B 3GQCA 4DV3F 4WIQA 1G3OA 3DM2B 4CH0S 5G4DA 3RAQA 2DVIA 3EICA 1IBCB 4ZDNA 4X4RA 4J9RA 2FHJD 1VQSA 2HNYA 1LV5A 3AB4B 3M8QB 4ECXA 2BKOA 3TOQA 5KFQA 1KQGB 4FPRA 3HKWA 2R42A 3D6FB 3M7NG 2V68A 2V63A 3L7UA 4YB1P 4XO0A 3Q0AA 3PRYA 1BE4A 1CG2A 4MKAA 3M9NB 1VI7A 1KHWA 4DLEA 1IBKF 4AE5A 2MZQA 5KFVA 2E5LE 3QNWB 4X4PA 3EVMA 3HZEA 3GYGA 3PJXA 4N8NA 4NCGB 4XAKA 3R5JB 4W90B 2I1RA 2E7WA 4RBUA 3ZC4A 4DV5I 2AZ1A 3NL0A 2C37A 3VZHA 1FI4A 1RABB 1YSJA 4NASA 2E44A 3H40A 1NK9A 5LMNE 1X4BA 2OTJS 5DRRA 4OL8A 4JYAE 2KVIA 4DS5A 2BQ3A 3PG9A 1LW2A 1FJGI 4LR8A 3IBWA 1N5TA 5HBMB 5B0BA 5CXTA 2M7SA 5ETLA 4DL7A 3PW5A 2EVZA 2RH3A 5D77A 2VOPA 1LEOA 1KC8T 2O1PA 4DV4F 2A6OA 4BDPA 4Q45A 4KKOB 1EA6A 2R8GA 2ZDOA 2QRRA 1FJEB 1NM2A 1FKPB 4QU7A 1PYTA 3ZTRA 1NSAA 3A4TA 5FIIA 3MUVP 2DNQA 3HZGA 1IR1A 2BXJA 3TQ1A 3IGVA 3TUJC 2XBPA 2H5JB 2JVRA 4RW6A 2J5AA 5KG0A 4DR3J 2ASDA 4WE1B 3DXSX 1ZTTA 4QYZK 4NZ6A 5GAHI 4P2XA 3HHNB 4GRSA 4EO6A 2J6SA 3ENVA 2QSWA 1KN6A 4X4SA 3CWVA 3F0NA 2HQGA 3OL9A 1HWJA 2FZCB 4B3MF 4N5SA 5J2NA 2ZHOA 2PNLA 4A46A 3EGNA 2R2TA 1SVDA 2B56A 3HKZD 3H4LA 3BGLA 2HRUA 5K36F 3PJ9A 1HMVB 2VPXB 4R0JA 5E7OB 4YR0A 3K0JA 3IGNA 4AYBD 1Q0NA 4X66E 1SC3B 3CDBA 3G86A 2KTQA 4I56A 2UUTA 2PFFB 2CG9A 5I3UB 3ELHA 4P75A 5B0DA 3TZZA 3MUTP 3AQPA 2HMIB 2F9DA 5EDWA 3F73A 4ILLA 2BA1D 2C1EB 1RHYA 2FD2A 1UP1A 1FKPA 1K1QA 2BW7A 2KI2A 5K8MA 1LNQA 3NGKA 3ENWA 4IQXA 3ZKDA 1HQ2A 3THTA 4RU9A 3RTVA 1RWMB 3CIZA 1CS4B 4KKOA 2MQPA 1WD6A 4JI4J 1Y60A 4DV2J 4IG0B 4RPFA 4QIEA 5ETVA 1VLOA 3ISNC 4IZJB 2E5LF 2E7VA 1WEZA 5IM0A 4ZVPB 4F4XA 1AXQA 1UW9A 3GYNA 5DG9A 1T9UA 4ICLA 1SC6A 1HYSA 5J2NB 2C2MB 2VBYA 2YKPA 2HQ3A 3LAMA 3CIMA 1WHYA 4ATNA 2P2CB 3AOBA 3K58A 2QSFA 4RW7A 5D0EA 4DJBA 5I3QA 3R5GA 1S7HA 1FXRA 4QYRA 3TJ8A 1GTEA 1V5VA 1TK0A 1QTMA 4Y6IA 4F2RA 4LOMA 2DNLA 2ZITA 3O2IA 1Q53A 2DO0A 4DPUA 2AYBA 4WZQA 4HHHA 3U1MA 4DZ6A 3RGIA 1FERA 4DLGA 3NS5A 4FZVA 4FW6A 4DPOA 2N4CA 4K4TA 2MZRA 3JS9A 1NKBA 1IM4A 2J7WA 2MZJA 3EDRB 4IKAA 5AXMA 3JYTA 2DNPA 3D28A 2GJ2A 4EGLA 3DI6A 2GQQA 1X5TA 1WF1A 3MZIA 4JYAJ 5A6WA 5M2UA 2CRLA 3H2VE 1PC5A 1P8GA 4YMEA 4DFJA 1S9FA 2X3DA 2R7UA 4TXSA 1WOOA 1UW4A 4UW2A 2CPJA 2WCXA 3RRGA 4B9SA 4R5PA 4DR7J 5DZ6A 3K17A 4KC5A 2IRXA 3X1LB 3GFHA 4BWJA 2CADA 4DR6F 3MMJA 1S99A 8AT1B 1WUUA 5HMWA 4NXME 4CLSA 2Z5CB 2XYHB 3MF5A 3OTBA 3VAJA 5IT9Y 1NSKL 1V9OA 3NMRA 1RT1A 2ASJA 4QU6A 4B3MJ 2RDIA 1DQ8A 3AY0A 1DTQA 2BBEA 2B5JA 1GMVA 2KG1A 3CUNA 1T9WA 1W2BR 2K8GA 1N32I 1VRUB 4LF9I 1JLGA 2IBOA 1N5YB 4LJMA 1S1TA 3GONA 3HSDA 3TVZA 1HK7A 2QMWA 3T1HF 3PFOA 3I82A 3PW2A 1ICEB 1RTHA 2I9SA 4ZPVR 4FW4A 2W7AA 2XMTA 2OD6A 4BA2A 1FT8A 4DV6F 2AEMA 4USWA 3W2VA 3NGDA 3CEDA 3GWCA 4P10A 2LLZA 5AXKA 2XGQA 4ZIWA 3SV4A 3WQPA 2XTJP 3QSYB 5BR8E 2EC2A 2X51A 1G7CB 2H3EB 4IOCQ 3PACA 2HHHI 2HNYB 3W1YC 1I51B 1X4EA 2ILZA 2JSXA 1JNRB 4DV0J 5HVHA 1YJWS 1HHSA 1B0PA 4LF6E 2YPZA 4FN5A 2LQBA 3MR3A 2V4RA 3MECB 3EZ5A 1MU5A 3NOCA 4FYDA 2AHOB 2PO1B 1TL1A 4KGMA 4LIWA 1T3OA 2D69A 3P49B 3H5XA 3IRXB 1SPBP 2YKOA 3GFXA 4J9UE 2BE2A 3KJVA 4K0KF 2H4YB 3D67A 3KMQA 1ZS6A 2D9PA 4JV5E 2XO7A 4OO1F 1MG7A 1FNXH 1HNVA 4LUBA 1H0HB 1NBEB 3FRZA 4JI0F 3FC9A 1VC6A 1M5KC 4EMDA 1T11A 1XEZA 1CSJA 2CYYA 1RTHB 1RWPB 2VL1A 2JEIA 2RHQB 2ZM6E 1LWCB 1DJ0A 4B3RF 5HQLA 1N36F 3QO9A 3MCOA 3W8PA 1LW2B 5K8OA 2ZJQQ 4LFCI 4ZHRA 4AD6A 4O3QA 2CPDA 2Q6CA 2AZ3A 4NLQA 4P72A 4URGA 1TFWA 3KK1A 4ECZA 4WXOA 2PSZA 4BCAA 1RAHB 1H73A 3LGMA 3QJJA 3RB6A 2XS7A 2QFJA 1C1CA 3DCAA 1N34F 3WU6A 1KVIA 4BA1A 3T5KA 2DNOA 1XIQA 1IKWA 3I0RB 3HSJA 4NZ0A 1IM6A 2MY7A 2FGCA 4PG6A 4CM0A 2BV3A 2H54B 1SL0A 2OFHX 2UXBI 2WB1D 2J76E 4PXDA 2FY1A 2WVCA 1FXDA 3MECA 4Y65A 3SCKE 5C25A 2R2RA 1RKJA 2PO1A 2LYVA 3HJCA 3HFZB 1MNEA 3JSRA 4OKGA 1CC7A 1WACA 1PYSB 4H4KA 4WCEQ 2FGOA 4UQTA 2RB7A 1NDCA 2B6AA 2G13A 4PEOA 5ETPA 3K5LA 2ZWPA 1I94F 3NCRA 1B7FA 2W24A 3R5BA 4KHPJ 2R8KA 5IQQA 1GQEA 2EK1A 1JK9B 2PA8D 3DM2A 5E5NA 5H9EK 4Q2MA 4F36A 2MMYA 5CCLA 3LWLA 1YITS 2IPOB 2BQUA 5C0XD 2C2EA 5JMNA 3T5HA 1VIXA 2I5JB 2Q43A 2UXCJ 4OX6A 1O8BA 4KYZA 3DRSA 2HQFA 2RUSA 3LPYA 3VAKA 1JLAA 4MMOA 2E1PA 4OX7A 3TX8A 4QZVB 2ROPA 2J0SD 2HHSA 2HIQA 4U7CA 4DV7E 2ZH4A 3BKTA 1FE4A 3D2WA 2QMUB 3W3SA 2MHEA 4NA2A 4K0KI 4X4VA 1R0AB 3P6YC 4HL9A 3KLHA 3TARA 4B3MI 3QRPA 4CIOA 4DPWA 2N4DA 1ZPVA 4RBTA 3UI3A 4MFBB 3NLCA 4F4AA 5C2CA 1WHWA 4X2BA 1SH0A 5KFUA 1YJUA 4K5SA 5IWAF 1K1SA 4NMLA 4KR0B 1PILA 3IAS9 5A2QC 2AD9A 2HGMA 1E3PA 2JX2A 2K7JA 4OFZA 2WONB 2XCPA 3SSRA 3V2UC 2C3YA 3HFVA 2OGUA 4I4BA 3SIPB 2R7WA 2KZZA 4ETXA 4A8XA 1NHHA 2Z5BA 1RACB 1IBLE 1EQ0A 1CPZA 3U1LA 4AXJA 4XTTA 4X66F 1XC9A 1D0EA 2PI4A 1Z5BA 4JI6E 4WIIA 4LFAI 1HBOA 3KLIB 2E5IA 2Y9HA 1XMOE 2VPYB 1C1BB 2HSEB 2FB0A 2KN4A 3A1YG 1AYEA 3NNHA 3K1JA 3OTOF 1I3OB 3M1VB 2KKHA 2L9WA 4DV7I 1DHMA 2E66A 1MROA 4OX9I 3PTWA 1DLOA 2WB4A 4FF2A 8RUCA 4GQUA 3T41A 4QR2A 3D3CJ 1HNWI 1UAWA 2DNMA 4XK8C 5L8RC 4DL5A 1S1WB 5CHCB 1R6YA 5DNLA 1OS5A 2YNIA 2J0QD 2FIUA 2YWEA 3DOMB 2CQIA 3W7BA 1RGVA 3NZKA 4HYMA 5E2QA 1HBNB 1RAGB 2XI2A 3AJDA 1FVSA 1VQ9S 4DU7A 4AQYE 4GKKI 2V8HA 2XMKA 1VHFA 1S48A 3M32B 5EKWA 1GNKA 3PS3A 2CQDA 1FWKA 2RRBA 2RVJA 3BR9A 4JV2A 1XN9A 1EP4B 4KHMA 3CCES 1PVGA 4UOFA 2LEBA 4WUBA 1B99A 4DV1E 4DG1A 2ZH1A 3QIPB 1RCXB 2DGQA 2YX1A 4NOHA 1Y7PA 3DFEA 3VTIA 3H5YA 2EFNA 4F2SA 2G0JA 1HNWJ 3AOCA 4PQAA 5A8WB 4JI3E 1S4EA 2NREA 2GQ0A 1YG0A 2NN6A 5IZHA 1RT2A 1D6TA 2Y1RI 1S1WA 4PWUA 4A8YA 1S0MA 1IBME 2HQIA 4OIXA 2P8IA 1RHRB 4HACB 3OL7A 1UPMB 1KNZA 4ECQA 1HNXE 4ZCMA 1L3TA 1LK7A 2G1DA 1TKTA 2XZDB 3FBBA 3LP0B 4JUZA 3TA0A 3DLHA 3PO4A 4MU3A 1WDTA 1IKVB 2W4PA 1NSQA 2J6UA 2MKYA 4DR6J 4CI0B 1TUGB 1WORA 1KQKA 3MURP 3T1YF 1UVMA 2Z0GA 3FFIA 2EFPA 3F41A 4CT8A 1IVZA 5B09A 5ETQA 4USTA 2ZH6A 2CNNB 4JI2J 2NZCA 3FMWA 1WKLA 4DR7I 5KFBA 1Y4SA 3FBFA 3BN7A 1XNRE 1I6JA 2YNFB 2IBKA 3D3BJ 1WTBA 2Z8QA 2QG9B 4M5GA 3MMCB 5L38A 1HKAA 1RWKB 5CQGA 4F7VA 1OY6A 2GO8A 3HJFA 2ZZMA 1UDNA 3T1HI 2MZSA 4K4SA 1NHVA 3B6BA 2L48A 2BJDA 2V8PA 1HWIA 2PNMA 1QSLA 2RT3A 4W98A 2O5DA 1VGYA 4FNIA 1T03B 2HHHE 4MKVA 3OL8A 2RNEA 1S49A 3GTYX 2PMWA 3W5XA 1WG5A 5JEAD 2FLOA 2YNHA 4ZA1A 3GYXB 2DR5A 5C0XC 3G2XA 3KHHA 2VD3A 4NXMF 1ZXNA 1MWQA 1RISA 4WTYA 4JI8F 2K1RA 3KUHA 5LXRA 3N6LA 4C0OC 4NXMI 2VU5A 3BYRA 4RO0A 1VQ6S 1XXEA 4IOAQ 3UE2A 2RQCA 2DNNA 4PXEA 1S9GA 4OX8A 1CC8A 2XYGB 3MTKA 4EO8A 4U67Q 4EZ9A 4IFDE 3C16A 3M8ZA 4DV3I 1LFPA 1VQ5S 1XJWB 3H90A 4JI0J 3H7HB 5J1EB 1L3UA 3H98A 1PBAA 2L3MA 2B4VA 2B51A 1B0TA 1UPPA 2MJUA 4WP8A 2KFYA 1NK8A 1UFLA 1NJWA 4LF5I 3WX4A 2LQ5A 3AFGA 3MMBA 1XMOF 2JEGA 1Y00A 4C8YA 3FBCA 1HD0A 4DDFA 5A76A 2J6TA 2DCLA 4DN9A 3JSMB 1HHTP 2UXCF 1FRLA 2R7RA 1QLNA 3QRRA 3BDPA 2DHSA 3HX9A 2PFDA 3CVKA 4XTJA 1YLXA 1HI1A 3G82B 4DV0F 1T8EA 4DUZE 2CIMA 1RE1B 1E6VA 4A4JA 3K5MA 2B3TB 2CPEA 3DOLA 2VDIA 2G2YA 2XZWA 3WU4A 4DL6A 3K8WA 4CO5A 2RQKA 3KHGA 3HO1A 4DUYI 2N82B 3HCXA 3DDNA 4IH7A 4P7VA 3BSNA 2DT9A 3MUMP 3R6GB 5KG7A 8ATCB 3KYLA 4IFDC 1HQEB 1TVRA 1JB0C 4ZK7M 5J2QA 3DRXA 1FJCA 2FTRA 4DX5A 4LF2A 2DITA 4PYAA 4O3PA 3B4TA 2HAFA 1GFWB 2ZNYA 3W66A 1UA1A 2L08A 2FLPA 4IZKA 2HFSA 1EHWA 4C48A 5DETA 2PO2A 4DFPA 2DHAA 3C19A 4NMXA 4J9SA 3E01B 4OI3A 1M90T 2XB2D 4DS4A 2O1UA 2O66A 2QFIA 2AJ1A 3F44A 3GG1A 3ZNUA 2V6AA 4DUZF 3EYZA 1QAJA 1F5CA 3GV8B 2WVEA 1JLQB 1NO8A 1SJRA 1TUVA 4PYDA 3W9IA 5F8LA 1RI7A 1N36J 3I56S 4B3RJ 3CJ8A 4WP9A 5ELWA 2C2NA 1RTDB 5A0YB 3RUBL 3EGZA 1QJHA 4GO7X 4X4OA 3BQ2A 3DDIA 2GW8A 3M8QA 1EKSA 4RKUC 3V4IB 1N32J 2C2ZB 4UUXA 3NMAA 4JI3I 1NMEB 1S72S 5FLXY 3R2DJ 1FKAE 5J2MA 1B4SA 4NZ7A 5CABA 3IM8A 3LA0A 4L3KA 1O51A 3ZNJ1 4B9UA 1Z0BA 3V81A 3DOMA 2CJYB 4UTGA 2ZBPA 3CTRA 1DTTA 2BEFA 2NPFA 2E9TA 2EW9A 5KFIA 4DR6I 1SUQB 3OHAA 1HW9A 3CCSS 1HBUB 1EP4A 2W2OP 2DD8S 1X5OA 2B6AB 1YHQS 2NZ4A 2AEJA 3GCWP 1RT6B 3HHEA 3I0SB 3Q86A 3CMQA 1HQUB 4YB5A 4ANCA 1JLAB 2GVDA 6FD1A 3UR0A 1C4AA 1WKJA 2UVWA 3QIDA 3DLJA 4DPYA 5AT1B 4DUYF 5LSRA 2IIHA 4Q44A 3J80Q 4DOZA 2KM8C 3DLEA 5F8GA 2V0NA 1EI1A 5GAEU 3OXFA 3CXCR 4FXVA 2BR0A 1Z0VA 3RG6A 2HWHA 3SZ2A 3FJ2A 2ZBRA 2HURA 3DMJB 3QPIA 2ZBKB 4JI5I 2AYMA 2EG2A 2ZM6J 2XS5A 1Z5CA 4HXZA 3CCVS 1R6VA 1S1UB 1NXIA 3BH6B 4AL7A 3GP9A 1VHIA 1RWWB 1RT7A 1PSDA 1YRXA 2BM1A 3M8PA 2A3JA 1U09A 4RBVA 4TKTA 1BUXA 3P5BP 3T1YJ 3X3UA 1RREA 2J65A 2Q2EB 1FDNA 3BB5A 5JEAC 4CH7A 4QWEA 4DR4J 4DX6A 2NXNA 2PT0A 3D9BA 2IJRA 1VQLS 1EIYB 1F1BB 5CYQA 1A9NB 1PCAA 1YJ7A 2GA7A 3E3XA 4XDCA 1FTCA 2Y0SD 1RT6A 2Q6BA 5FDLA 3CGIA 1GXLA 5GVQA 3KK3A 2J0XA 1RU1A 2J8SA 1Q16B 1NAQA 3D6TB 3DRRB 4IQMA 5KAKA 3HPOA 3W62A 2DO4A 1H6KX 4KJIA 4MT1A 2YXLA 3M8SA 2E5JA 2DY1A 5HI7A 1WC5A 4WFAQ 3KK2B 4WU3A 5I3UA 1NKCA 3RR8A 3GILA 4KT0C 2CQBA 3ZZUA 1KRPA 2KDOA 4ECYA 3KNGA 3TA2A 3HVRA 3N6NA 5K8NA 1ZYQA 3TQEA 1N48A 2QA4S 5D3GA 1R0BG 1R8AA 4PKDB 1KQSR 3NOGA 3G6XA 1B7YB 1SCJB 1YZ6A 2GMLA 3B8HA 4ZPWR 4ZP8A 4DL3A 3DD6A 3M9OB 3QWUA 3DOKB 2XMUA 2JEFA 1T05A 1RHUB 2VG6A 1N34I 4I3HA 1TL1B 5H9FK 5HANA 1KHVA 1RT7B 3M8PB 4QR0A 1YVFA 4ECSA 3UD5A 1VQ7S 4K4VA 3L7ZB 2GIRA 1OSCA 4NLPA 1FWPA 1NUEA 4M5LA 3T6BA 3TVKA 3CCMS 1UWBA 4AL6A 2COLA 4IZJD 4DR3I 4OYBA 1GXUA 2DCUB 1EETA 1YX2A 2F40A 3K7RA 3V5RA 1RT5A 4NEYA 3MR5A 1HNZF 2IRUA 2JEJA 1RSCA 3UR3C 2GMJA 2HHHF 2W25A 4R25A 3OTOE 1A0OB 5KT3A 3J7AG 4LREA 2FJVA 1BC6A 4QPTA 1CQNA 5JVHQ 2DPJA 1V3ZA 3L7OA 3Q6NA 5F8MA 2DK2A 3HVAA 4GC6A 4X62J 1IBLJ 3DI6B 5C24A 4EBDA 4MU1A 3DOLB 1ZM4A 2PD1A 2QL9B 3B4DA 2UV8G 4GKJE 4K2XA 4QJVA 5KFDA 2AGQA 2HHPA 2D9OA 4K0KE 2E29A 2CZVC 1Z1ZA 3MMAA 3RW6A 3POTA 1I94I 1LXJA 1SXLA 2APOA 2UUBJ 4PQUB 3BSCA 5E3PA 1S0VA 3L7ZA 4ZN1A 1VDHA 3C8YA 1WI6A 2M9KA 5K36C 2IJNA 4J37A 3Q8RB 3T5LA 3MD1A 4M5DB 3D1QA 3MEKA 2R7TA 3ITHA 1EETB 2O1VA 4X65E 1T94A 4X64I 3B54A 4DR2I 3GR1A 5K14A 1LK5A 1TL7B 1RWVB 2IFXA 3PDNA 1KLMB 1FDAA 3TX0A 2DBBA 2KJVA 5CZVA 1YWXA 4N8OA 3A3NB 3V6DB 3R1LA 1KSPA 2R7XA 4F3MA 5IV4A 5DNXA 5L1JA 1U7LA 3W2WA 4LF6I 3FSYA 4I6YA 5EUHA 1HNXI 1GT8A 2ZBCA 3S1TA 4LR9A 4DHVA 1IBMI 2CNOB 1U0SA 3ICLA 5HROA 1JMTA 1N5YA 3RBEA 4DV4I 4JG4A 5K9FA 3MOZA 3QT5A 2AYEA 3I32A 4NPOA 4FF1A 5LMUI 1CJKA 4JI2E 1O0PA 3GSIA 4P9SA 2NSBA 2GV1A 2YWFA 1FFSB 1RT3A 5EWEA 1SV5B 5U47A 3V4MA 1VQ8S 5LJ3Y 4LF4I 3BR8A 1VC0A 2P9GA 3LW5C 4GMKA 4KGKA 4PAAA 5J1NA 4F4KA 2UUCJ 3JAMQ 4L72B 4X4TA 2VFSA 2JHEA 3V6KA 4OI1A 3OSPA 2PO0A 2D3ZA 2UUBI 2HNZB 2CUYA 2Y0BB 5K20B 2AP6A 2EBGA 3SI8A 3MOJB 2CPXA 4BA1B 3LUYA 3PRBA 5T41A 2AGOA 3WBZA 2XCAA 1XNQJ 2NN6F 5HVFA 2BE2B 1KTQA 1WOSA 1HNWE 2IA0A 1KEKA 4UF4A 2L9DA 3P4UB 1VBKA 2FHMA 4DL0C 4EBCA 1S10A 3I55S 1N36E 2NYHA 1FRKA 1RAIB 3CD0A 4GVBB 5HLFB 2IMWP 1VK3A 5A8RB 2W9BB 3JSMA 3OXLA 2V4QA 4P74A 1MU2A 4Y3CA 4DX8H 2B8QA 4KV8B 7FD1A 2F4VF 4AIDA 3I0RA 2IOQA 2W2PP 3HFKA 1Q5YA 2M88A 4IFVA 4TU7A 2OJ3A 2OTLS 3G8TA 1O5JA 4AQYJ 3DMJA 3OLAA 3WU5A 1RQ0A 2JC0A 1S6QB 3C46A 4AL5A 2AJQA 2GS8A 3VAFA 2AQ4A 2HVZA 1JXEA 4ED8A 3JAMU 2GO9A 1N6QA 2NN6E 2NCKL 3HJVA 1MN7A 1WWHA 1J5OB 3CO0P 3QZ7A 3ILIA 1JLCB 2J7UA 4DV1J 4NCBA 4C8MA 1ITPA 1NZ0A 3PW0A 2C2RA 4C6AA 1S0NA 2FHOB 3MHYA 1QVGR 1PJ5A 3NGSA 1OYPA 1RJJA 2YNIB 3QLHB 1R27B 3M6VA 2ZVSA 2OEJA 4DU8A 1U2FA 5IXUA 3G96A 2YKQA 2ZE2B 4IFYB 3ENQA 3OW2R 4ZJLA 5KT5A 5BR8J 2YVSA 4ES3A 2OPQA 3CJKA 2DGSA 4DV7F 3KJFB 5KT2A 1HYSB 3T5JA 2BJ1A 1VRQC 2MGZA 2MYFA 5F3TA 2X1AA 5HP1B 1XMBA 1U6ZA 2DR8A 4OMFG 4HLBA 4JV0A 3KRNA 3I87A 5LMUE 5KFPA 2XY6A 2UUWA 2HLTA 3DLGA 1ZZNA 2PNZB 2D41A 3IC1A 1SJ4P 2WNRA 1YBTA 2HS0A 2M70A 4YB7A 5AXLA 5DDRC 4NLTA 4XPEA 4YY3E 3J81Y 1UVKA 3FSIA 1LW0B 1PGZA 2CPFA 5L1LA 4B3ME 1HBMB 4RWWA 4WYLA 1XNQE 2J0WA 1FJ7A 3GG0A 2RQ4A 4S0MA 1WDDA 1XR6A 4DR6E 4ZVOB 2XNQA 4Q2LA 2QYGA 5KT6A 4H4OA 4ZCIA 3EPGA 1MN9A 3LP2A 2ZHBA 4ITSA 3BBCA 4IOBA 4WFXA 2QLFB 3TAQA 3PXGa 1SIZA 4NRTA 1YRUA 4MYTA 3CD7A 1LOUA 4ZVEA 4Y28C 2J9EA 4MK7A 4LFBF 1Y5NB 2VG6B 3CD5A 4YB6A 3ZKBA 1S76D 2G0IA 1WC1A 2GQ2A 3FQLA 1DRZA 4QCLA 2CVIA 2QT7A 3J80Y 4CO2A 3IO1A 1H72C 2CPYA 2VG7B 5D0RA 3W5ZA 3S7RA 2MGZB 5HP1A 2P9EA 1K73T 1Q79A 1SQGA 1JXLA 4PWDB 3NEKA 1RB0A 3G6ES 1TKZB 4LF9F 4IFYA 4NI2B 5GAEI 3OVAA 3ZZPA 4G65A 3FUYA 4QBUA 3KLFA 4LCGA 3LTOA 3NCPA 3ZZZA 3I6PA 1NKEA 3RR7A 2VQFI 1N88A 4GO5X 4EEYA 1VBZA 2FQQB 1W2IA 1OPZA 1QSSA 2ZH7A 1FNMA 2VA2A 1U1KA 2DKOB 2WTFA 1RT5B 1IWAA 1NU4A 3HVTA 3FSXA 4CM2A 1RHMB 4L73A 2VV5A 4Y2AA 1BXNA 2DRAA 4CNZA 1WEXA 4AFFA 4RW9A 4ZCLA 1SKUB 3TP2A 3HM9A 1H7SA 3WU3A 2JL9A 4RNNA 4ZP6A 3IR5B 4JV5I 1S4FA 4DV3E 4WXWA 3SQGA 4V19X 1S1XA 2AKWB 2OEMA 4O3OA 3EVWA 2M4MA 3UHMA 3PVXA 1K9MT 2R7QA 2UUCF 2Z2ZA 4E98A 5LXYA 2AJ4A 3UQSA 2IM0A 5F8JA 1RT4A 4ERDA 2VQEE 2AJ0A 2MPUA 2WZ1A 1VLYA 3CDWA 5FLXQ 1MSWD 4J90A 3BBFA 4O3NA 1MMLA 2AU0A 4ZVIA 3MM8A 1ZH5A 1UZHA 4KGXB 3N0VA 3VGVA 4B3SI 4DFMA 2G9OA 4ZHRB 3A8KA 2CQ0A 1U8WA 2AW0A 4ZJOA 2VJVA 4IFDA 1TP7A 1LWCA 3R5AA 3W65A 1FFGB 4R1FA 1U0HA 1RAEB 5DG8A 3U1KA 1S12A 4F50A 3K59A 1XMQJ 1QE1A 4OHXA 2W7PA 5ADZA 5C5JA 1XMOJ 4UY8T 2EC0A 1GX5A 1REGX 1NK0A 3Q23A 3NBPB 1SV5A 4URLA 2W9CA 3FCVA 3JQKA 3HVTB 2OPSA 3G4SS 2BOPA 4FW5A 1UVNA 2BR2B 3WZ0A 1H7UA 3MPYA 5KT7A 3M8YA 1OYRA 4DR3E 4JI8E 1WNEA 3I4HX 1VMBA 4LF8E 2F7VA 4JI6I 2VQFF 4DPXA 2B4OA 1RHQB 1RTIB 5HMXA 2HHVA 4ISAA 4I6WA 2KT3A 3O1LA 3O6QA 4ANEA 1OQ3A 1TK8A 3FMBA 2GIQA 3U27A 4OZ1A 2PEHA 1XR7A 1KS2A 3MEDA 4YDXA 3Q8PB 3ENAA 3BO2A 2E1CA 4LF6J 2GCFA 3Q83A 1ZZFA 2ZC4A 4RL1A 4DQSA 4TLQA 3B4MA 4CP5A 1JLQA 1FFWB 4QIGA 3VV2B 1JJCB 1J2VA 2P6SA 2WSCC 3W9HA 3PX6A 3UCUP 3PEHA 4IRKA 3WIVA 4JI6J 4ZJQA 3CT9A 4FDFA 4HTJA 4USIA 4J7CA 5HN0A 1RR9A 3MMAB 4G1QA 3ZXWA 5DRQA 2A10A 3HD1A 1A7GE 3M7VA 2AV5A 4YOEA 4TVAB 4NRUA 3GPAA 5KOWA 2GGPA 1N33F 3RBXA 1OWXA 2GIFA 4WWSA 1SL2A 5IWAE 2RHSB 2YWGA 1IBKJ 3WC2A 1XNRF 4YFUA 2CQ4A 3DN9A 2E9ZA 4B3SE 4QQBA 2H1YA 1VFJA 2Q3PA 1KLNA 5J2PB 4DWIA 2R9LA 1XMQI 3NAIA 5ETNA 4LRFA 3TJ9A 1CBKA 3MFHA 2VJUA 1PJ7A 1BGXT 2WRMA 2YNGA 5C0XE 5E0OA 2V69A 3OSNA 1IJFB 1M0SA 1REVA 3B78A 1NHIA 1ZA1B 2HVIA 1R8CA 1GX6A 1U4BA 1KKHA 2EI5A 2ZE2A 4U95A 2O3ZA 5DROA 2VFTA 4USJC 3OT9A 4MU0A 2BJ3A 4QOTA 2BJEA 3HP6A 1JJHA 2LCWA 2MY8A 2W7OA 4LFAF 4ECWA 5LT5A 3KWMA 2OO4A 4OZJA 4DV5F 1T9VA 3TNVA 2ROGA 1KIJA 2I0XA 3AD9C 4B9LA 3HHLC 4RNOA 2YQ1A 4C8KA 2HKJA 3SFUA 4F25A 2ZZTA 4TY8A 4MH8A 5IFMA 3VALA 3J7A1 1HBMA 5DRPA 1AW0A 4I2QB 2FLNA 2ZH8A 4J9QA 1S5ZA 3QJLA 3SQOP 1TR0A 1MMNA 2PN6A 2LECA 4KGVB 1NZ8A 4QWCA 2KO1A 2W01A 3IM9A 4HH1A 3T6JA 4X4QA 4N76A 2HFVA 4K2JA 4DV1I 4U9RA 2MHNA 3CDUA 3VAMA 3UDLA 3FEXB 1Z0EA 5KFKA 2LQ9A 4ZVSB 3MM5B 5HJXA 2V67A 2GO4A 3Q2SC 1R43A 5IT9Q 1VQYA 1ZM2A 5M2RA 3LQVA 1NJZA 1S97A 3H2LA 2G0CA 4RW4B 3P45B 4ED2A 3QGGA 2VKRA 1U24A 3PX0A 4DV4E 1CJTA 1NJIT 4B9TA 4F3OA 4JI5F 5K36A 4YY3I 4U8YA 4ZVRB 5A2QQ 3IRWP 2O01C 3OTOJ 2HS4A 3BGUA 3ETOA 4I1TA 2BE7D 3KLFB 1UVJA 4ELVA 2JC1A 3AAWB 1S1VB 2DEJA 2YBVA 3RRHA 1IKXB 2ADCA 2BYCA 4A8QA 1XNRI 1N6QB 4JI1F 3UW1A 1T9TA 2AEFA 4WFNQ 4I2QA 5E3RA 5AE3A 1HL6A 1YIJS 1TK5A 2XSFA 4V19J 1WHXA 2GQCA 4PPZA 4TY8B 5H9FJ 2NN6D 4N3OA 1BHNA 3D1OA 3T1YI 5F8HA 4OO1B 3HHKA 5T7LA 7FDRA 4EI2A 4P2MA 3DHWC 2QLWA 3T19A 2B4PA 2MLYA 4RW6B 5DDQC 4DFKA 4RUAA 5E41A 1F9EB 2UU9J 4Q0BA 4U7UK 4V1Ak 3VZIA 4CO0A 3PX4A 1NHJA 2CWKA 4R0EA 1N32E 1FE0A 2AGPA 2Z5BB 4LR7A 2YX4A 2Z4PA 3LANA 1NH7A 1RT4B 2Z57B 2YKMA 1X4CA 2OD4A 2XMMA 2VFUA 2YQ0A 2FDNA 3GJQB 5FLXU 3T9ZA 4DV7J 3C15B 1WTFA 3C14B 3S8SA 4F02A 3J81j 5HL7Q 1NCLA 4HY1A 3DLGB 1N52B 4OLPA 1D3WA 2DXEA 5KT4A 2GVDB 2U1AA 4TN2A 3J7AN 2YWKA 3KLVA 2XMWA 2GJIA 2L9NA 4M5KA 4P2FA 2DGXA 1UDSA 3N9UC 1XERA 3RB3A 1HR0F 3C6UB 2A2CA 3MM7A 4BWMA 2RUGA 4CLYA 2UU9E 3AOAA 5DS7A 4CLTA 3G9CA 1HR0I 2H5EA 1HNIB 2GHPA 2NYIA 1OO0B 2ACYA 5F8NA 3UCGA 2UZAA 1AT1B 3M32A 1SH3A 2RE1A 3NGTA 4HT5A 4PG7A 5LMNJ 4AQYF 4ED6A 1K8AT 5EN1A 4MU4A 4RW8B 4DPTA 2UXDE 3GIMA 1BWEA 4FW9A 5GMDA 4DR2E 1HNZI 2EFQA 1TKZA 5GADI 1VBYA 4LF7J 2WOMB 2YKMB 3KMSA 3CJTA 2QE5A 2QL7B 5DZ7A 5IV3A 1UEUA 2VG7A 3H8YA 4LF5F 1Y6ZA 1U1QA 1D9DA 4RJVA 4BS2A 1RWNB 1RTIA 1UWAA 3UPFA 1Y10A 5HJYA 3ETMA 2RRAA 5D3GB 3GIKA 1X9WA 1FCAA 2BQRA 1XNQF 4CLUA 4O3RA 4X4UA 1Y0HA 5HQ8A 3U02A 4KGZB 1Q8BA 1AUDA 4QW9A 2B8PA 1UVIA 3GIJA 2MKIA 4CRJA 3CULA 1ZTWA 2C38B 4HI2A 2F3JA 1RCOB 4NCAA 2VESA 2SXLA 1KVKA 3IFEA 3KOAA 4ZPAA 2DNZA 4MJKA 4IUFA 2Y8YA 2DGOA 2QIFA 1Y5IB 2BJ7A 4PG4A 4JI0E 3CB4A 2XSJB 4HACA 3OD2A 4CLLA 5KFMA 5AE1A 5KFEA 4DR2F 2CAJA 2RJZA 3DLLQ 2EKYA 2Z5CA 2H51B 1D09B 4MK8A 1WG1A 1S6PA 3R27A 4WE1A 3K85A 4KBIA 1SIWB 2B9YA 2VPWB 3GSDA 4NXNI 3R6LB 2YX7A 3IP0A 3MAHA 1FK9A 4ALZA 4X62E 4NXNF 1Z59A 3M2UA 1IBMJ 2QYCA 1DBDA 3K89A 4DF4A 4OYZA 1IWGA 2W8KA 2VQFJ 1UWBB 4WZMA 5LMUF 2DIUA 4URSA 2R8HA 3GU0A 3OR1B 1VRTA 1U0HB 1OIAA 3MEEB 4QIVA 3GFZA 4YR3A 1U26A 4TYAA 4N7TA 4Y0FA 1N8RT 2F4VE 1F0XA 2I5JA 3BGOP 1SJ1A 2R8IA 4DQQA 4QR1A 3G8SA 1X0FA 5LOQA 3GLJA 3CCLS 4B3TE 5L3JA 1WC6A 2HIYA 2VC1A 4IDKB 3MR2A 2D3UA 2UUBF 1K0TA 3J7AM 2DHXA 2ZH5A 2ZBQA 1GH8A 4TQSA 3MPWA 2DR9A 2ALYB 1FXLA 3ITHB 5ETMA 1N4LA 4RLEA 1HD1A 4O0NA 3ILOA 2LXIA 4LQ9A 4RNFA 3L95X 4FWGA 1P42A 5B0FA 2XQCA 4ZMMA 1R3NA 1NSPA 4MFBA 9RUBA 5IM0B 3QZ8A 1QSYA 2UXDF 1IXKA 1Q1KA 1Z4UA 3AHPA 3POTB 4HR2A 1ELOA 2KVQE 4PCQA 4WF9Q 3JQMA 1LXNA 3ET6B 4CTAA 2XMJA 3THVA 4HTIA 4OZNA 1VRTB 1EKRA 3IG1B 4M5JA 2ADBA 3I9V9 1R0AA 4LF8I 2NS1B 3M2VA 2FZGB 2HG4A 5AE2A 3BS9A 4ED0A 2OPQB 3CJKB 3SEOA 4R8UA 3CF5Q 2QJ3A 5FWKA 3ONQA 3EX7B 3HDSA 2PE8A 4B3TF 4DV5E 2JLEA 2QLBB 1WG4A 2XZTB 3MR7A 1D9FA 2DTJA 5KFCA 2VPZB 3M2RB 4WFBQ 4J9VA 4LSLA 5I42B 3QO9B 5LMNI 4IS9A 5CYMB 5F3ZA 2ZH2A 3JAMC 2HFZA 5KG2A 4ZPTR 2KFNA 2IDLA 4OJ1A 3PYGA 3W8GA 3OTCA 3EXYA 3P5TL 5F41A 2BW2A 2KXNB 3OVSA 4F4YA 3Q6MA 3RZAA 1R31A 2HGNA 3HVWA 1L5UA 2XS2A 1FD2A 4OO1E 3WX8A 3OUYA 1TKTB 3CD6S 1CQMA 4DSEA 3I5CA 4YEAA 5C25B 4ED1A 4OHWA 1E6YB 4ECVA 1U1NA 3KNAA 2LQ8A 1GMUA 1NHKL 5ETSA 5KFFA 4IRCA 3DGPA 2G2OA 3MAAA 4M5IA 3KHLA 2UVUA 2MLXA 3LP1A 3DLKB 1C1CB 2QV6A 3W64A 5HLFA 1Z5AA 1JQGA 1TTHB 4TLRA 1F3VA 2XI3A 2F5GA 5KFXA 2IVYA 2YPYA 4DR1I 4DL4A 4Y2KA 2DGTA 3L3CA 5EL9A 3AODA 4K4WA 4B3RI 2XG8A 4PZVA 2DH9A 1Q7YT 1Q81T 3C2PA 4G6VB 3NP5A 5A8WA 2UUAE 4BA2B 4ZPCA 5C42B 3FKBA 3BQ0A 4FYXB 4EYIB 1EARA 1GMWA 4FKYA 4G1IA 2ASYA 3J7Z5 2BX6A 4ECRA 2C22A 4H4MB 4ZVHA 4JI5E 4OJHA 3H25A 2DXDA 1RYSA 4LBPA 4LSNB 3IWNC 2BA9A 4MIWA 1S6QA 2O67A 4WPAA 2M2BA 1BQNA 5B7WA 2YWHA 5KG4A 2ERRA 4LF8F 2W1BA 1DTTB 1RHKB 3GR0A 5IWAJ 4E2FB 1RYRA 2XC9A 2XHWA 3SBMA 5CYJA 3A8JA 3TAPA 3G6YA 1ZAXA 2QA4G 2BKPA 4OX9F 2WAQD 3BJYA 4FWHA 3KDOA 1JLCA 1QVFR 4DR3F 4FW3A 3OR2B 1S9EB 1WF2A 2ZWOA 3IWXA 1UFKA 4C3KA 1RKIA 3QT7A 3BGRB 4MAKA 4C8ZA 1JKHA 1M5SA 3K8VA 5HO4A 4JI1E 3A8EA 2R4FA 3QGIA 1U8SA 2ATLA 4KQZA 4LQ3A 1SC1B 1QTNB 4C3LA 3RAXA 4HDHA 1BQMB 1NLKL 2EG1A 4U3BA 4IO9Q 1KD1T 1Y11A 1WOPA 2YY3A 2BA1G 1F2HA 2G4BA 2C2DA 3HD2A 2XNRA 1FRXA 3L9ZA 2AF6A 2C28A 2VONA 3R3TA 3LP2B 1F6TA 2ZM6F 1Q8IA 5KFLA 4A8WA 1JXVA 3PS1A 3CC2S 1ZAWA 3TEHB 2BOAA 3UVJB 4QWDA 4TU9A 2VASA 1CJVA 4NL5A 3N4WA 3NY0A 5G0RA 2FLLA 4ECTA 4UY85 4J3DA 4DR1E 3JXOA 3ZTOA 1V3RA 2PEBA 4BC7A 2NN6C 3TW0A 2VQEF 3D54A 1RWUA 3LPEA 5KOXA 3TZWA 1L3SA 1F3FA 2IM3A 4C4WA 1M1GA 2OSRA 2OP5A 4B3TI 1T02A 2HBQB 3EM1A 3FQKA 5EWFA 1Q8KA 3J81U 4ELTA 1S59A 1XMQE 2JE6A 3C14A 3C15A 3EZUA 3QYYA 2PMZD 5F9NA 1QAIA 3U7JA 4FVCA 5FDLB 4CNYA 4LFCF 2ZOFA 3A12A 5CYQB 3TYTA 4OZ5A 3BGRA 1KBRA 2B43A 4F4ZA 3M6UA 4ZIVA 1HNXF 2BA0G 1OSDA 3UDVA 4OZ3A 4YDDB 4IO1A 1PJ6A 4OZ2A 5MAOA 3M6XA 5D0GA 3FCHA 3CDIA 2IM2A 3DYAB 3M4XA 2ZJRQ 1R8HA 4DUYE 2QX0A 3OBIA 4OHZA 2GAHC 2LA6A 2VQEJ 2WBMA 1HNZJ 2R8JA 4OI0A 5K36E 2QA1A 1Y3KA 2ACMA 3ILLA 3F56A 3QFHA 1VS3A 3PM9A 3GB0A 4JV5J 1FD8A 1JLBA 1X4GA 2BABA 4Q43A 1MW7A 1ACMB 1TKXA 2OPRA 3HXMA 3PZPA 4ED7A 1SH2A 1Y5LB 1KONA 1Z2ZA 3RB4A 1HQEA 1I5OB 4KPCA 4RW8A 3SSQA 5J2QB 2HHXA 2QMXA 4C7QA 4DR5I 4GVLA 1JLGB 1D1UA 3BM7A 5AJ3J 3D4JA 1FKOA 3H2UB 1YK9A 2V2VA 3HHLD 3CJ3A 3NXZA 1HI8A 1H74A 2G1HA 1NH8A 3THPA 4ES2A 2CJ9A 3MMCA 4DR5F 4NLGA 2QLXA 1N54B 2HBZB 4CLKA 1I94J 2QO3A 5CD4A 3M2VB 4N41A 1Z2LA 4HT7A 2Q79A 3I5BA 3RRKA 4WKYA 4DV6J 2N7YA 4ZN3A 3M30A 5DDOC 1FEHA 1C1BA 2AWZA 4OYWA 2C3OA 2YH1A 3MM9B 4UZCA 1VR6A 4RU2A 1OYSA 3AD8C 2D1CA 4ZCKA 2HVHA 4NYOA 3KG0A 4N77A 1HW8A 2FHKA 4USKA 4CLZA 1CS4A 3UDCA 4CYUB 3UN2A 4DF8A 1URRA 2ZFHA 3L7PA 2JDJA 2I2YA 2V8GA 4F0HA 4C11B 5GMKa 2QGFB 3JTNA 3KJVB 3R5CA 4X62F 2PC6A 4IH6A 3OL6A 2W4DA 4X4NA 4P7AA 1X8DA 1S9GB 2OKQA 1ZETA 3GJRB 4FBTA 2A2DA 4L75A 2XGPA 2A1BA 2H4WB 3SMZA 4X62I 3V6HA 3U1NA 1Y3JA 4DSIA 4DR7F 4DV0I 3Q1QA 4DR7E 1RWOB 3O5TB 4I2PA 2WW4A 4P2SA 3VCDA 4B3SJ 3H4DA 2JH3A 3T1AA 2DIVA 1NK5A 4YY3J 1APSA 1D8ZA 4HVZA 2V9WA 1ZOTA 4JP8A 1WEYA 3V6DA 3FDSA 3UCZP 4J91A 2PI5A 1GXTA 2HRTA 2WVDA 3CJQA 3CJ0A 3KK3B 1GK8A 4QYZJ 3OQ2A 3R8YA 4CLWA 5CAAA 4OV1A 3CCUS 4JI7I 3VQSA 5HMZA 5DG7A 3DDKA 4DV6E 2J9CA 1H2UX 3MM9A 1U1PA 2NN6B 4FKXA 4JB8B 4WTOB 2C2OB 1UTAA 3AA9A 2Z2MA 4LBHA 3KG4A 5ETOA 3TR5A 4ZLNA 3QGPA 1VJWA 2UP1A 3V6JA 1YH8A 1RT3B 3D66A 2BANA 1E6VB 2OFGX 4WP3A 4URQU 4WYWA 3LGNA 3RU0A 3KKFA 2XLIA 3CJSA 3PHTA 4DCJB 3CCJS 4LSNA 4FYWB 1CJUA 2HWIA 5K36D 2IY5B 6AT1B 4CDIA 4AM3A 2PGCA 4PRFA 4M8LA 3NGRA 3TJAA 3ZZTA 2VQFE 3D0IE 3DRPA 3CW2C 4JI7J 2X1FA 2KRRA 3HK2A 2HHTA 4AQYI 5C7PA 1YJ9S 4LFBI 4HEA9 1NNDA 1DARA 4MTPA 3KUGA 3IN5A 2M5YA 1F9FA 4XIUA 3ISZA 1DAXA 5T7LB 2MZ1A 1UJ4A 2X36A 3EUNA 5F0WA 5FD1A 4BHQA 4RUBA 3WDOA 1SKRA 2JZ5A 1UETA 2IVFB 2FJXA 1X0PA 2NR0A 4IR9A 1NJXA 2IAJA 5IT0A 1JIHA 3HSZA 1Q95G 2FUG9 3NS7B 4TY9A 5KFGA 2W4CA 2Q1LA 2CG8A 3D7SB 3PNIA 4DI6A 5DGBA 2UXCI 3S01A 1U1LA 1FDDA 2EFGA 4GVBA 1WELA 1KWMA 2HHUA 1XNQI 1W26A 2HEKA 4USHA 3SCIE 3CC4S 3Q24A 1RBAA 1SQFA 2DRDA 3VVUA 4ZP9A 2YNHB 3P76A 4JYAF 3J80C 2R2SA 1CJUB 4KO0B 4ZVUB 4BLGA 3ISND 5C24B 3CC7S 3BO3A 1FJGE 1AROP 3MWBA 4KRWA 5E33A 3IAM9 3UD3P 2CNKB 5L46A 4JV5F 2UUCE 2ATCB 4ZVTB 1XHKA 2LXFA 3IRXA 1P27B 1N0VC 4GC7A 1S77D 3MXHP 2GHVC 4DR1J 3M7ND 4JI7F 2YWWA 4OI6A 2V4JB 2NSCA 3CDAA 3HHDA 3NS6A 1PKUA 1VISA 3I96A 4NLYA 1IBKE 4LF7E 2CPZA 3FZBA 1HMVA 4RW4A 2R7SA 1RBLA 5C0XB 1FESA 3HI9A 2XWXA 4DR5J 3M9MB 5LSLA 2ALZA 2Y1LB 4M5HA 2HKEA 5DLGA 3LP1B 1W25A 5KG5A 2MKKA 2W9AA 1YHCA 2VUGA 1Y4ZB 2WVBA 3IS9B 5GMEA 3BO4A 5BYSA 2PNZA 3DYAA 1U48A 1M1KT 1B3TA 1Z0GA 4F0MA 3R1HA 2IC3A 2WP8B 1HQUA 3CJ2A 3KFWX 3QT8A 2D7SA 4I0WA 1XQIA 1PAUB 1H38A 5HK4A 1VQMS 2HYIB 2Q66A 5A8KA 5KG1A 1N5SA 3PR4A 5H9EJ 2VODA 1IQTA 1RTJB 4JV1A 2LQJA 4UQGA 1AZSA 1KOOA 2V8DA 1DY3A 1RAOA 1TL4A 3Q8SB 4FXDA 2DR7A 4IH5A 1RLDA 2VA3A 1UCNA 2CZ9A 3PW4A 4Q8FA 2UVVA 2W2NP 3HHLB 1UMJA 2JEBA 3TO8A 2IRYA 5BXIA 2KXFA 5JEAF 4ZKAA 2CFXA 2VKZG 2Z56B 2JRSA 4XPCA 1G2EA 1YJVA 3PRDA 2OPRB 1RTZA 4YR2A 2E1RA 3WC0A 1PYOB 1R8BA 4JOUA 5GADU 2FVRA 5D78A 3MM7B 1Y5YA 4U3DA 2ZNZA 3M85D 3DRSB 4NEZA 1FRJA 1HBNA 1H7WA 1UA0A 4KH1B 1TMJA 4KQVA 1HA1A 4K59A 3TI0A 2W9BA 2C2KB 1K47A 2D74B 3T1HJ 3R97A 4KY3A 4L74A 4C0HA 5EHHA 1IN0A 2HK2A 4RWXA 5LMNF
chains in the Genus database with same CATH topology
1Z0CA 4HACB 4DV6I 1HNXE 2UXBE 1BKNA 1U2RA 4DV1I 1Z0EA 4JI7E 4DR7I 1Z0TA 4DXLA 1Y4SA 4PU9A 1XNRE 1ZM2A 4ED4A 1QZRA 4IZKB 4DV4E 4JI0I 4DV0E 4YY3I 5A2QQ 2V8PA 2PNMA 4JI1I 1B62A 2DEJA 2HHHE 1XNRI 4GKJI 1ZXNA 4N3OA 1J5EE 3T1YI 4NXMI 2X7IA 1NHJA 2UUCI 4DV3I 1N32E 2Z5BB 3J81C 4LF5I 2IOPA 1B63A 4HY1A 4LFAE 4DUZI 1XNQE 4XTJA 4YHHE 4DUZE 2A2CA 4PRXA 2UU9E 1HR0I 3WU4A 2XEXA 4DUYI 2UU9I 4DPTA 2UXDE 4FW9A 5GMDA 4IZKA 1N36I 3ZZ0A 2HFSA 4DR4I 1Y6ZA 2O1UA 4WUDA 1IBLI 1S16A 3LNUA 4DV3E 1A6FA 1KVKA 4LFCE 4JI3I 4JI0E 4HACA 2LJPA 1OJ4A 4X64E 1FKAE 2Z5CA 1N33I 3K85A 4NXNI 1Z0BA 4PRVA 4UTGA 2NPFA 4X62E 1Z59A 4DR6I 2CGEA 2J7KA 1UEKA 4X66I 2OI2A 4DPYA 4JI1E 2F4VE 3J80Q 4B3TE 2Z5EA 5L3JA 2VQEI 1N0UA 4FWDA 4UT4A 1EI1A 4LF9E 3J7AM 1Z0VA 4M1KA 2ZBKB 1XMOI 1I94E 4JI5I 4HXZA 1Z5CA 4FWGA 2BM1A 4NXNE 1RREA 3PYFA 2Q2EB 2BM0A 4IZJA 1ELOA 4LF7I 4LF8I 4JI8I 5FWKA 1PIEA 4DV5E 3T1HE 2R3VA 3ZZUA 5LMNI 2V34A 3JAMC 4GKKE 3PYGA 1PKPA 3Q6MA 3HULA 3B82A 3B8HA 4P52A 2R42A 3PRYA 2UXDI 4LFBE 1N34I 4I3HA 2E5LE 1Z5AA 3T1HI 4IZJD 4DV5I 4DR3I 4DR1I 1FI4A 2UUBE 3V5RA 4YHHI 5LMNE 4B3RI 4JYAE 1FJGI 2UUAE 3OTOE 3J7AG 3Q6NA 4JI5E 1EA6A 1ZM4A 1J5EI 4GKJE 4X65I 4K0KE 2F4VI 1IBKI 5FLXC 2DEIA 4FWHA 3T1YE 4DR2E 2O1VA 3PYDA 1N33E 4X65E 1I94I 3QT7A 4X64I 3CWVA 4DR2I 3F0NA 3PYEA 2PNLA 3H4LA 4LF6I 1HNXI 1IBMI 4X66E 2CG9A 4DV4I 4JG4A 3QT5A 5LMUI 4JI2E 3ZKDA 4DR1E 4LF4I 3JAMQ 4RPFA 2UUBI 4IZJB 1N34E 1XMQE 4DR4E 4DU7A 1HR0E 1HNWE 2UUAI 4LFBI 4KHPE 4DPUA 2ZITA 1N36E 3M6AA 4B3RE 2O1WA 4DUYE 2ZM6I 4LFAI 2IOQA 4DV2I 3WU5A 2GS8A 2HK3A 5BR8I 4B3MI 1NZ0A 3K17A 4DR5I 1ZM9A 3D4JA 3QT6A 2V2VA 1WUUA 2V2QA 4NXME 5LL6R 1H74A 2Z5CB 4DU8A 4USMA 1USUA 1N32I 3J81Q 3P06A 4LF9I 3GONA 1HK7A 4B3TI 5LMUE 3ZM7A 4USKA 4YY3E 5BR8E 4B3ME 2HHHI 4P7AA 4LF6E 4DR6E 4JI4E 2A2DA 4X62I 4FN5A 1MU5A 3Q1QA 4DR5E 4DV0I 4DR7E 4MYTA 2WW4A 3ZKBA 1H72C 4JV5E 1MG7A 1Y4UA 4JI7I 4EMDA 4DV6E 3LTOA 2ZM6E 4JI2I 2VQFI 4LFCI 1KTVA 1FNMA 3LPSA 1H73A 1ZXMA 3WU3A 1H7SA 3WU6A 4JV5I 3ZZTA 2VQFE 2VF3A 4AQYI 1USVA 2BV3A 2UXBI 1DARA 2AJ4A 3HJCA 2X36A 5IWAI 2VQEE 5FLXQ 1HNZI 4Z7CA 4ZVIA 1Z0WA 2UXCI 4B3SI 1XNQI 2EFGA 4R1FA 3OTOI 3J80C 4DV7E 5IT9C 4LF5E 4URLA 1FJGE 4JI4I 2V2ZA 4K0KI 2UUCE 1XHKA 4OX9E 4DPWA 1N0VC 1H7UA 4DR3E 4JI8E 1VISA 1IBKE 4LF7E 4LF8E 4JI6I 4DPXA 5A2QC 3V2UC 2Z5BA 1IBLE 2HKEA 1NHHA 5IT9Q 4WUCA 4JI6E 1Z5BA 5GMEA 1XMOE 1Z0GA 3K1JA 4JYAI 4Z7YA 3QT8A 1RR9A 4DV7I 4OX9I 1HNWI 2O1TA 5IWAE 2CZ9A 1ZM3A 2E5LI 4B3SE 4HYMA 2HFUA 4DV2E 1XMQI 4GKKI 4AQYE 4MYUA 4KHPI 1FWKA 2HKJA 2E1RA 3B78A 1NHIA 1PVGA 4WUBA 1KKHA 4DV1E 1MX0A 1FWLA 4KQVA 4JI3E 2UXCE 1S4EA 2GQ0A 1K47A 1KIJA 1D6TA 1IBME 2HK2A 4LF4E 1HNZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0C A;  4HAC B;  4DV6 I;  1HNX E;  2UXB E;  1BKN A;  1U2R A;  4DV1 I;  1Z0E A;  4JI7 E;  4DR7 I;  1Z0T A;  4DXL A;  4PU9 A;  1XNR E;  1ZM2 A;  4ED4 A;  1QZR A;  4DV4 E;  4JI0 I;  4DV0 E;  4YY3 I;  5A2Q Q;  2V8P A;  4JI1 I;  1B62 A;  2DEJ A;  2HHH E;  1XNR I;  4GKJ I;  1ZXN A;  1J5E E;  3T1Y I;  4NXM I;  2X7I A;  1NHJ A;  2UUC I;  4DV3 I;  1N32 E;  3J81 C;  4LF5 I;  1B63 A;  4HY1 A;  4LFA E;  4DUZ I;  1XNQ E;  4XTJ A;  4YHH E;  4DUZ E;  2A2C A;  4PRX A;  2UU9 E;  1HR0 I;  3WU4 A;  2XEX A;  4DUY I;  2UU9 I;  4DPT A;  2UXD E;  4FW9 A;  5GMD A;  1N36 I;  3ZZ0 A;  2HFS A;  4DR4 I;  4WUD A;  1IBL I;  1S16 A;  3LNU A;  4DV3 E;  1A6F A;  1KVK A;  4LFC E;  4JI3 I;  4JI0 E;  4HAC A;  2LJP A;  1OJ4 A;  4X64 E;  1FKA E;  1N33 I;  4NXN I;  1Z0B A;  4PRV A;  4UTG A;  2NPF A;  4X62 E;  1Z59 A;  4DR6 I;  2J7K A;  1UEK A;  4X66 I;  2OI2 A;  4DPY A;  4JI1 E;  2F4V E;  3J80 Q;  4B3T E;  5L3J A;  2VQE I;  1N0U A;  4FWD A;  4UT4 A;  1EI1 A;  4LF9 E;  3J7A M;  1Z0V A;  4M1K A;  2ZBK B;  1XMO I;  1I94 E;  4JI5 I;  4HXZ A;  1Z5C A;  4FWG A;  2BM1 A;  4NXN E;  1RRE A;  3PYF A;  2Q2E B;  2BM0 A;  1ELO A;  4LF7 I;  4LF8 I;  4JI8 I;  1PIE A;  4DV5 E;  3T1H E;  2R3V A;  3ZZU A;  5LMN I;  2V34 A;  3JAM C;  4GKK E;  3PYG A;  1PKP A;  3HUL A;  3B82 A;  3B8H A;  4P52 A;  2R42 A;  2UXD I;  4LFB E;  1N34 I;  4I3H A;  2E5L E;  1Z5A A;  3T1H I;  4DR3 I;  4DV5 I;  4DR1 I;  1FI4 A;  2UUB E;  3V5R A;  4YHH I;  5LMN E;  4B3R I;  4JYA E;  1FJG I;  2UUA E;  3OTO E;  3J7A G;  4JI5 E;  1EA6 A;  1ZM4 A;  1J5E I;  4GKJ E;  4X65 I;  4K0K E;  2F4V I;  1IBK I;  5FLX C;  2DEI A;  4FWH A;  3T1Y E;  4DR2 E;  3PYD A;  1N33 E;  4X65 E;  1I94 I;  3QT7 A;  4X64 I;  3CWV A;  4DR2 I;  3F0N A;  3PYE A;  3H4L A;  4LF6 I;  1HNX I;  1IBM I;  4X66 E;  4DV4 I;  4JG4 A;  3QT5 A;  5LMU I;  4JI2 E;  3ZKD A;  4DR1 E;  4LF4 I;  3JAM Q;  4RPF A;  2UUB I;  1N34 E;  1XMQ E;  4DR4 E;  4DU7 A;  1HR0 E;  1HNW E;  2UUA I;  4LFB I;  4KHP E;  4DPU A;  2ZIT A;  1N36 E;  3M6A A;  4B3R E;  4DUY E;  2ZM6 I;  4LFA I;  4DV2 I;  3WU5 A;  2GS8 A;  2HK3 A;  5BR8 I;  4B3M I;  1NZ0 A;  3K17 A;  4DR5 I;  1ZM9 A;  3D4J A;  3QT6 A;  2V2V A;  1WUU A;  2V2Q A;  4NXM E;  5LL6 R;  1H74 A;  4DU8 A;  4USM A;  1N32 I;  3J81 Q;  4LF9 I;  3GON A;  4B3T I;  5LMU E;  3ZM7 A;  4USK A;  4YY3 E;  5BR8 E;  4B3M E;  2HHH I;  4P7A A;  4LF6 E;  4DR6 E;  4JI4 E;  2A2D A;  4X62 I;  4FN5 A;  1MU5 A;  3Q1Q A;  4DR5 E;  4DV0 I;  4DR7 E;  4MYT A;  2WW4 A;  3ZKB A;  1H72 C;  4JV5 E;  1MG7 A;  4JI7 I;  4EMD A;  4DV6 E;  3LTO A;  2ZM6 E;  4JI2 I;  2VQF I;  4LFC I;  1KTV A;  1FNM A;  3LPS A;  1H73 A;  1ZXM A;  3WU3 A;  1H7S A;  3WU6 A;  4JV5 I;  3ZZT A;  2VQF E;  2VF3 A;  4AQY I;  2BV3 A;  2UXB I;  1DAR A;  2AJ4 A;  2X36 A;  5IWA I;  2VQE E;  5FLX Q;  1HNZ I;  4Z7C A;  4ZVI A;  1Z0W A;  2UXC I;  4B3S I;  1XNQ I;  2EFG A;  4R1F A;  3OTO I;  3J80 C;  4DV7 E;  5IT9 C;  4LF5 E;  4URL A;  1FJG E;  4JI4 I;  2V2Z A;  4K0K I;  2UUC E;  1XHK A;  4OX9 E;  4DPW A;  1N0V C;  1H7U A;  4DR3 E;  4JI8 E;  1VIS A;  1IBK E;  4LF7 E;  4LF8 E;  4JI6 I;  4DPX A;  5A2Q C;  3V2U C;  1IBL E;  2HKE A;  1NHH A;  5IT9 Q;  4WUC A;  4JI6 E;  1Z5B A;  5GME A;  1XMO E;  1Z0G A;  3K1J A;  4JYA I;  4Z7Y A;  3QT8 A;  1RR9 A;  4DV7 I;  4OX9 I;  1HNW I;  5IWA E;  2CZ9 A;  1ZM3 A;  2E5L I;  4B3S E;  4HYM A;  2HFU A;  4DV2 E;  1XMQ I;  4GKK I;  4AQY E;  4MYU A;  4KHP I;  1FWK A;  2HKJ A;  2E1R A;  3B78 A;  1NHI A;  1PVG A;  4WUB A;  1KKH A;  4DV1 E;  1MX0 A;  1FWL A;  4KQV A;  4JI3 E;  2UXC E;  1S4E A;  1K47 A;  1KIJ A;  1D6T A;  1IBM E;  2HK2 A;  4LF4 E;  1HNZ E; 
#chains in the Genus database with same CATH topology
 5CZX A;  3OFE A;  1YRT A;  2NXU A;  1TV6 B;  4USV A;  2AE8 A;  4KAI A;  4PG5 A;  2E5H A;  1NK4 A;  1N34 J;  4DV6 I;  1S6O A;  3TAM A;  5D4N A;  1TAQ A;  1R6M A;  1B64 A;  5BYQ A;  3UFC X;  5E3A A;  5B0A A;  4B3O B;  3UD4 P;  2AX1 A;  5C2G A;  1P1T A;  5F0U A;  4DV4 J;  1SJQ A;  3PEJ A;  4HDG A;  1NRK A;  5DJB A;  4RNM A;  4J9M A;  1U2R A;  2JE6 B;  5C0X F;  2IES A;  4F0K A;  5CCM A;  1GTH A;  1ZPW X;  3CMA S;  2ZD1 A;  3C6T A;  4JI7 E;  2NUH A;  3SDE B;  4KIA A;  1H2V Z;  1NK6 A;  1LWX A;  3MR6 A;  5E3C A;  5DO2 A;  1UKU A;  1BLU A;  4HI1 A;  4NA3 A;  4QWA A;  2MKS A;  3Q22 A;  2RF2 A;  3VAG A;  4J9K A;  1WSV A;  4ED3 A;  5B0E A;  4R8U B;  4YQW A;  1QZR A;  4WKR A;  3GCM A;  2RDD A;  2RD5 C;  1VQN S;  4IZK B;  4M5N A;  2L41 A;  4JI0 I;  3GJS B;  4DV0 E;  1M1H A;  4O0I A;  1T03 A;  3M2R A;  1WI8 A;  3KUE A;  1AB8 A;  2LDY A;  2B7C B;  4OLO A;  3TEG A;  2F8E X;  4H54 A;  2HRY A;  3ZO7 A;  4PR6 A;  2HHH J;  1B62 A;  1ZBT A;  3QAU A;  2GZO A;  4ZLL A;  3Q8Q B;  1VYA A;  4GKJ I;  4NXM J;  3US5 A;  3NBP A;  5EX0 A;  3MAQ A;  4RNH A;  1JWW A;  1SB6 A;  3PCO B;  1JLF B;  2DHH A;  2IJF A;  4B08 A;  5DM7 Q;  2MDA A;  1OPI A;  2F9J A;  3BBB A;  3BYP A;  3C16 B;  1TV6 A;  3EVO A;  4ZLP A;  2LVW A;  2EKN A;  5GAH U;  4DL2 A;  1NJY A;  1AUS L;  1HWL A;  3LOU A;  4M5D A;  3V4I A;  4KV8 A;  4OZ0 A;  1QUP A;  3I4P A;  1FNO A;  2E7X A;  2MQN A;  1P9Y A;  2X7I A;  2NPI A;  3BRE A;  2CWX A;  1X4F A;  2MQL A;  4LRC A;  2HND B;  1T0T V;  1NB7 A;  2E5L J;  3A8I A;  1KQF B;  3K57 A;  1FX2 A;  4OQJ A;  2EPI A;  2FJE B;  2MST A;  5KTQ A;  3MED B;  4C2M A;  5LJ5 Y;  3TRG A;  4JI4 F;  1FDB A;  2ZEJ A;  4U8V A;  2ZKU A;  2HWT A;  3OR1 A;  4D3H A;  4B3T J;  3Q2T C;  4ILM A;  1KLM A;  2DH7 A;  3BKF A;  1TL5 A;  1X5S A;  2IYI A;  2Z2L A;  1K44 A;  3SDE A;  1FRI A;  3SCJ E;  4YY3 F;  4NLU A;  2YTC A;  3OV7 A;  2CQ2 A;  4GKK F;  4JI2 F;  4NYZ A;  2JLG A;  1S1V A;  3BEG B;  3H59 A;  3SFG A;  3KHR A;  2ZH3 A;  3Q8Y A;  1HR0 J;  4ES1 A;  3DXB A;  1KDN A;  2VDH A;  1RXO B;  4X66 J;  3NG8 A;  1IKY B;  4LFA E;  3MEE A;  1L3K A;  2FJA B;  2DGW A;  4L3N A;  3DU6 A;  2XO6 A;  5I4M A;  2Y8W A;  2RS8 A;  5JUM A;  2VBW A;  3MCN A;  4EK2 A;  1AA1 B;  3NRB A;  3OLB A;  4PRX A;  3BN4 A;  1TU0 B;  3PHE A;  4PXB A;  1TZ0 A;  1U49 A;  3OJS A;  4G1Q B;  4KO0 A;  1GMW D;  2XEX A;  4NLD A;  1TQL A;  3SV3 A;  2YNG B;  4ZIT A;  1FHT A;  2LDI A;  1JLE B;  5KFY A;  3QSI A;  3MI7 X;  1QDU B;  1BWV A;  4B9V A;  2DXF A;  3OTE A;  2HFO A;  1UFW A;  2MZT A;  2HW3 A;  2PO0 B;  4JI1 I;  1SI9 A;  1Q5V A;  2QZ8 A;  3MPU B;  4WFZ A;  1LWF B;  1FA0 A;  4OYX A;  3BH7 B;  4X64 F;  4LF8 J;  1N36 I;  1Q4R A;  5L1I A;  3K5N A;  4KHR A;  2NUU G;  3CCZ A;  3NWR A;  3PRV A;  4NX9 A;  3PR5 B;  4CLP A;  4DSL A;  4KPY A;  1W7W A;  2FC9 A;  1DQ9 A;  3BF4 A;  3VHQ A;  2LP4 A;  2C37 B;  5DLF A;  2IER A;  3OR2 A;  5KFR A;  2NLW A;  4TNO A;  3SCL E;  5AJ3 F;  1RU2 A;  1UVL A;  1D9A A;  1IBM F;  1S16 A;  4ZVQ B;  2JNJ A;  4Z2X A;  2JWN A;  3N79 A;  3LNU A;  2XY5 A;  1U2C A;  4LSL B;  4LRA A;  4O44 A;  1A6F A;  2FJD B;  4KHP F;  2OSQ A;  1DZ5 A;  1BQM A;  3PS2 A;  1XNR J;  3KLH B;  4K4Z A;  3BZQ A;  3VAH A;  4EZ6 A;  2W2M P;  4W4M A;  3QRQ A;  2CQH A;  3RB0 A;  1U02 A;  4C97 A;  4FPI A;  2BJ9 A;  1FF2 A;  2CJK A;  4RW9 B;  4IFD F;  1EAY C;  1DFD A;  3IBF B;  1CEZ A;  1HBU A;  2FC8 A;  2I38 A;  3TWZ A;  2KB2 A;  5BJR A;  2LJP A;  4OO1 D;  3M05 A;  3BKU A;  1U1O A;  1YI2 S;  4LBI A;  3MD3 A;  2BAC A;  3E8O A;  3PV8 A;  3K5P A;  4KH0 B;  1FVQ A;  3UO0 A;  1HI0 P;  1I1G A;  1DQA A;  4FYV B;  3HT3 A;  2QA2 A;  3BQ1 A;  1HNX J;  3MDF A;  4DBQ A;  2V9K A;  2IA6 A;  3T9N A;  4RZR A;  1J5O A;  1RT1 B;  1UJ6 A;  4UUW A;  4EBE A;  1UEK A;  4LPF A;  4BBY A;  4OI4 A;  4LFC J;  4OJ3 A;  4NXN J;  2XLJ A;  1F2G A;  1LFW A;  1X4H A;  5JEA B;  3H5S A;  3R7S B;  4O4G A;  2ZJP Q;  1JJ4 A;  1EQM A;  1QAY A;  3Q8U A;  3GE9 A;  3DLE B;  2C38 A;  4QNJ A;  1HBO B;  4DV3 J;  5C42 A;  4G3I A;  3EXC X;  2GO3 A;  5L9X A;  1QUV A;  2Z5E A;  2VQE I;  4FWD A;  3G8Q A;  1VC5 A;  3DGV A;  2RS2 A;  2LEP A;  5D8H B;  2MXY A;  5EGY A;  1CUL B;  1YKW A;  2KHC A;  3MM8 B;  3I0S A;  4CWB A;  3C3L A;  4UZB A;  4C9D A;  2KJW A;  1XMO I;  1PO6 A;  3OFH A;  1B70 B;  1MRO B;  2MQM A;  2EK6 A;  3LAL A;  3QAT A;  5A6P A;  4NLV A;  7AT1 B;  2HHQ A;  4NXN E;  4MKY A;  2K06 A;  3KDN A;  2B7B B;  4Z37 A;  4NLR A;  4OHV A;  4HKQ A;  4IZJ A;  3QJP A;  2UV8 A;  4DN0 A;  2CQ1 A;  4IG0 A;  4FNH A;  3QIP A;  3MPV A;  3CWJ A;  4Y00 A;  4CZC A;  1J5E F;  1KP6 A;  4RW7 B;  2C39 B;  4LF7 I;  3O3L A;  5J1P A;  2AT1 B;  2KM8 B;  1YJN S;  2F63 A;  2VFR A;  4ICL B;  2YKN A;  3OFF A;  3CCQ S;  4QW8 A;  2JLF A;  4ID5 B;  2FJW A;  5KFN A;  1E3H A;  4OZE A;  1PIE A;  3TZX A;  1RTD A;  2FPH X;  2X3G A;  4FXW A;  2FYX A;  3T1H E;  4IFD D;  4LF4 F;  2LKZ A;  2FY8 A;  2R3V A;  2FVQ A;  4PWW A;  2XY7 A;  4H4K C;  3GIR A;  1U47 A;  2BKN A;  4CO1 A;  3CJ5 A;  5B0G A;  2V34 A;  6FDR A;  1TEL A;  4GKK E;  1R7I A;  2WBR A;  1R89 A;  3W2W B;  5LMU J;  2OIH A;  5L1K A;  2H48 B;  1A6L A;  3UVJ A;  1PKP A;  3AJ2 A;  3HUL A;  1FO1 A;  1HWU A;  2DYA A;  2F65 A;  3QQC D;  4I67 A;  1OMS A;  3B82 A;  1H98 A;  2RQM A;  4Y2C A;  2HGL A;  2E1A A;  4JBC A;  2Z58 B;  4P52 A;  2IC3 B;  1OYE A;  4CYU A;  3JYT B;  2C39 A;  2WP8 A;  4ZPD A;  4ED5 A;  2DNG A;  3DRY A;  4NWB A;  2UXD I;  4LFB E;  2I8E A;  3D6H B;  2CPH A;  3EMT A;  3GJT B;  3MM6 B;  4I68 A;  4I2P B;  3ZTQ A;  2HND A;  1HFE L;  2KU7 A;  3DC2 A;  5D6G A;  2P5V A;  1X9S A;  1G1X A;  1KOH A;  4TQR A;  3P3E A;  1PBU A;  2QTW A;  4A48 A;  5B08 A;  4DR2 J;  4A8K A;  2Y3Y A;  3CDE A;  2HZC A;  4I7F B;  3DHX A;  2CXE A;  3QBC A;  2KFZ A;  2PO2 B;  2EFV A;  2UUB E;  2YQ3 A;  4YHH I;  2PA3 A;  2UU9 F;  1D8Y A;  5IOL A;  2WHO A;  4K8R A;  4CT9 A;  3LAK A;  3ZZR A;  1IQZ A;  2BRL A;  2U2F A;  1IKY A;  4IG3 B;  4K4X A;  3KLG B;  2H65 B;  1O6X A;  1YJT A;  4QPX A;  1S1T B;  5GAG U;  1U45 A;  1VRU A;  2H9Z A;  2J9D E;  2RAQ A;  3BGF A;  2WVF A;  3FEZ A;  3JTP A;  2W9C B;  4B9M A;  2BVZ A;  5HSP A;  2MEW A;  3D5M A;  3GMG A;  4OYO A;  5DQG A;  4X65 F;  4JI1 J;  1J5E I;  4E0D A;  4PUO A;  4LF7 F;  1B0V A;  4I64 A;  4XDD A;  4X65 I;  1G6B A;  1C0U B;  4ELU A;  1Q7L B;  1ZAV A;  4DV2 F;  1HPZ A;  3DLK A;  4J9N A;  5FLX C;  4LF4 E;  4PXC A;  2DEI A;  1RUS A;  3T1Y E;  1RLC L;  2Y1J A;  3AXK A;  1RAJ A;  3FBE A;  2OH2 A;  4LVO P;  3PKY A;  4DSK A;  2K1R B;  2RIJ A;  3MMB B;  3PYD A;  4HHJ A;  2DPI A;  4I7F A;  4FF3 A;  1YBU A;  2UVR A;  1FX4 A;  3OFG A;  5K5M A;  1Q82 T;  3PYE A;  2XWY A;  5H1S V;  5BR8 F;  2DIS A;  3D1H A;  3H5U A;  5K14 B;  1UEV A;  2E5G A;  2OEK A;  4MQY A;  2J9D A;  2EWH A;  3PIO Q;  1NB2 A;  3DKD A;  3GV5 B;  1GAO A;  5KFW A;  4X84 A;  1X7V A;  3MCM A;  1OYD A;  1G4C A;  4FW7 A;  4HHU A;  4KFB A;  1HAR A;  2HHW A;  3RW7 A;  3M30 B;  4J5O A;  5KFA A;  3VGT A;  2F8M A;  1NHU A;  4U96 A;  4TYB A;  2ROE A;  3LH2 S;  1VIO A;  4F67 A;  2RU9 A;  2ZUA A;  1RP5 A;  2DNY A;  3K2Y A;  3PFE A;  4PUO B;  2WW8 A;  3HLU A;  1JLF A;  2KYZ A;  3HF5 A;  4C11 A;  2CQG A;  4YS2 A;  1K0V A;  3M8W A;  1CJK B;  3MPD A;  2VIH A;  2YNF A;  4A8F A;  3G82 A;  3ZTP A;  3H4B A;  4WBF A;  4U7U D;  2UXB F;  3IG1 A;  2GVZ B;  1IKX A;  1NK7 A;  3P96 A;  2B9X A;  4ID8 A;  3NNA A;  2P6T A;  3ET6 A;  1TVR B;  2MLZ A;  4CLF A;  5B0C A;  3FFI B;  5J2P A;  3OPK A;  1IBK I;  4NLS A;  4ILR A;  5KFO A;  4LFB J;  1QM9 A;  2NXJ A;  1N34 E;  2JOQ A;  2KHD A;  3G87 A;  3KJN B;  3N5B A;  5SUH A;  3VWS A;  4YP3 A;  4DR4 E;  1KFD A;  1DTQ B;  1OY9 A;  1VCT A;  1JKH B;  2K7K A;  4MKB A;  1HR0 E;  2NXE A;  4WFY A;  2UUA I;  3R5D A;  2B4U A;  2CQC A;  4Q0B B;  4UOC A;  1MU2 B;  1Q8L A;  3FZ2 A;  4KHP E;  3M6A A;  4B3R E;  1UL3 A;  2QLJ B;  4ETZ A;  2UUA F;  3TA1 A;  4UOG A;  2O1W A;  1EJ7 L;  1C2P A;  2V94 A;  2ZM6 I;  4M63 A;  4PG8 A;  5IS2 A;  4O3S A;  5HMY A;  4JI5 J;  4DV2 I;  4LF4 J;  1EX8 A;  4YHH J;  4WK1 A;  5KFJ A;  2A6M A;  1P6T A;  5IC4 B;  5K8P A;  4DSJ A;  1TL3 A;  1RAF B;  5JEA A;  3LP0 A;  5D4P A;  1XBW A;  4LIR A;  1CUL A;  3RJM B;  2C3P A;  3W2V B;  1XR5 A;  1T7P A;  1BY9 A;  1F9H A;  3A3P B;  4WU2 A;  1LWF A;  2MKH A;  1VQ4 S;  4LMZ A;  2JT2 A;  2HK3 A;  1SUQ A;  3GZ7 A;  3VVT A;  4YUD A;  3G71 S;  1BMQ B;  3KXD A;  1XMQ F;  5BR8 I;  3DRP B;  3R2C J;  5F8I A;  1JNZ B;  2MTL A;  3H0P A;  2UXD J;  4PPD A;  3TUZ C;  1WKK A;  3TZY A;  4ZS6 A;  1ZM9 A;  2GVZ A;  2CJX B;  2QL5 B;  5MLC V;  1KVJ A;  4F4W A;  2HQC A;  2V2Q A;  4N56 A;  5LL6 R;  5J2M B;  2CJA A;  2VOO A;  4LCH A;  1LQ9 A;  2VB6 A;  2OLW A;  1QY7 A;  1Y9O A;  2EBE A;  2X1G A;  2YKN B;  3MGJ A;  4OYA A;  4D3G A;  4LF5 J;  3AH6 A;  4NA1 A;  4USM A;  4B9N A;  4OI2 A;  2PMH A;  1USU A;  5L9N A;  3J81 Q;  3P06 A;  1WC3 A;  2FHJ A;  3AQO A;  4JI3 F;  4HH0 A;  2VIC A;  4LFA J;  2D3O R;  1IUJ A;  4LF1 A;  2CDR B;  1IJE B;  2F4V J;  3K5O A;  3IBC B;  4JI3 J;  5SZT A;  1JX4 A;  1CJT B;  4DSF A;  2HZA A;  3CSK A;  5K36 B;  3GME A;  1JLB B;  5DQH A;  1RAA B;  3A3O B;  4P71 A;  1VOM A;  2DB1 A;  2GGP B;  2N3L A;  3TAM B;  1CVJ A;  2DHG A;  2VFV A;  3G6V A;  4ECU A;  2BZ2 A;  3EDQ B;  4AT1 B;  1DLO B;  1WHV A;  5JXS A;  3NGU A;  5L39 A;  1OY8 A;  1V3S A;  4JI4 E;  4EU0 A;  1HIY A;  1VQO S;  2OHD A;  3MEG B;  4C8N A;  4DR5 E;  1KR4 A;  2DGU A;  2PDA A;  4H4O B;  1HWK A;  4N47 A;  4PQU A;  3MM6 A;  1IKW B;  3QMQ A;  2W8L A;  2OPS B;  4F26 A;  5FJ4 A;  1SKS A;  2F4V I;  4O4G B;  2KT2 A;  4A8M P;  2DY9 A;  4B17 A;  2KYX A;  3W9J A;  1V5I B;  1Y4U A;  2MJN A;  1Q78 A;  1C0T A;  5C0X A;  1URN A;  3VF0 B;