4ED4A

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
303
structure length
299
Chain Sequence
SDWVPTGAVTVRAPGKVNLYLAVGDLYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
total genus 97
structure length 299
sequence length 303
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4ed4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ed4A01
4HACA 5L3JA 1H7SA 1D6TA 2ZM6E 3T1YI 2V2QA 4X62E 3ZZ0A 3K17A 3ZKBA 3ZM7A 1U2RA 1N36E 4LFAE 3QT6A 1ZM3A 1ZM2A 5IT9C 4JI7I 1HNZE 1FJGI 4DR7E 3B78A 4YHHE 4USMA 4JV5I 4DR6E 4LF4E 4DR5E 2ZM6I 4X62I 4RPFA 1H7UA 4XTJA 3LPSA 3HULA 1NZ0A 1K47A 2V8PA 1N36I 1Z5BA 4LFAI 2BV3A 4PRVA 4P52A 4DR7I 2LJPA 5LMUE 4YHHI 4DR6I 1S16A 4LF4I 2HFUA 4DV3E 4DR5I 2A2DA 4DPWA 1WUUA 3PYFA 4JI5E 2VF3A 4URLA 4DR1E 1Z5AA 4LF8I 4LFBE 4X64E 1XMOE 1FKAE 2HKJA 4LF6E 1MX0A 2F4VE 5GMDA 4DV3I 3CWVA 4JI5I 1S4EA 1Z0CA 4K0KI 4DR1I 1XNQE 4KHPE 4JI0E 4DR3E 4LFBI 1RREA 4X64I 2NPFA 1XMOI 1Z0VA 3J7AG 3J7AM 1J5EE 4DPXA 4DV7I 4LF6I 1H74A 1DARA 2HFSA 2HK3A 1KTVA 5GMEA 3ZKDA 4JYAE 2E5LE 1B62A 4EMDA 2UUBE 4LF5E 1XNQI 4KHPI 4JI8E 4JI0I 2J7KA 1EI1A 4AQYE 1J5EI 4WUDA 1FWLA 3K1JA 3J81C 4JI1E 4JYAI 1UEKA 4FWGA 4USKA 3QT5A 2E5LI 1Z0EA 4B3TE 4DV1I 2UUBI 4LF5I 2BM1A 4MYUA 4JI8I 4DU7A 4NXME 4LF9E 1IBLE 4Z7YA 1ELOA 1Z0GA 2DEJA 1Z59A 4JI3E 1IBMI 4WUCA 1XMQE 4ZVIA 4JI1I 4DV5E 4OX9E 4B3TI 2Q2EB 4DV4E 4NXMI 3PYDA 4LF9I 1HR0E 1IBLI 4LF7E 1FWKA 2HKEA 1HNZI 1BKNA 4GKKE 4JI3I 4UT4A 2A2CA 1XMQI 4DR4E 4DV0E 1I94E 4DV5I 4OX9I 4DPUA 4JI2E 4DUYE 5LMNE 4DV4I 4P7AA 1HR0I 2UUCE 3V2UC 3JAMC 4LF7I 2UXBE 4FW9A 1PVGA 2OI2A 2UXDE 1H73A 1H72C 4GKKI 3B8HA 4B3ME 2V2ZA 1NHHA 4DR4I 2ZBKB 5LMUI 4DV0I 1I94I 4DV2E 1QZRA 5IT9Q 4JI2I 4I3HA 4DUYI 5LMNI 3T1HE 2UUCI 2UXBI 1FI4A 4Z7CA 2UXDI 3M6AA 4B3MI 2GS8A 1N0UA 4PRXA 3OTOE 4DV2I 2F4VI 3WU4A 3WU3A 1N33E 3PYGA 1NHJA 3LNUA 4YY3E 4DR2E 1Z0WA 1KIJA 3B82A 4DPTA 4HY1A 4HACB 5FLXQ 4DR3I 3PYEA 2UUAE 2UXCE 3OTOI 4M1KA 1Z0BA 3F0NA 3D4JA 4DXLA 1EA6A 3QT7A 3WU5A 1N33I 3V5RA 3WU6A 4HXZA 3J80Q 4YY3I 2HHHE 1ZM9A 1FNMA 2UUAI 1MU5A 2UXCI 4DPYA 4AQYI 4R1FA 5A2QQ 2R42A 1IBKE 1PKPA 1B63A 1N34E 2HHHI 2ZITA 5IWAE 2AJ4A 4GKJE 2V2VA 2VQFE 4JG4A 2EFGA 4JI6E 1ZM4A 4NXNE 1ZXNA 4X66E 4B3RE 1IBKI 4PU9A 1N34I 1RR9A 2BM0A 2XEXA 5IWAI 4JI4E 4GKJI 4UTGA 2VQFI 4B3SE 3J81Q 4JI6I 3QT8A 4FWHA 1N32E 4LF8E 4NXNI 4X66I 4B3RI 1PIEA 4DU8A 2VQEE 1KVKA 2WW4A 1XNRE 5FLXC 2X36A 4JI4I 5BR8E 3ZZTA 4B3SI 1A6FA 1HNWE 4K0KE 1N32I 1N0VC 3J80C 5LL6R 2R3VA 1Z5CA 4X65E 4DV7E 4DUZE 2VQEI 1MG7A 1XNRI 2UU9E 4FWDA 1HNXE 4MYTA 5BR8I 1KKHA 3GONA 1HNWI 3T1HI 5A2QC 3Q1QA 2X7IA 1OJ4A 1Z0TA 2V34A 4FN5A 4X65I 3H4LA 4LFCE 1VISA 4DUZI 3JAMQ 1ZXMA 2UU9I 4DV6E 4KQVA 1HNXI 3ZZUA 2HK2A 4DR2I 3LTOA 4HYMA 4DV1E 3T1YE 4WUBA 2DEIA 1XHKA 2E1RA 2CZ9A 4JI7E 4LFCI 1FJGE 1IBME 1NHIA 4ED4A 4JV5E 4DV6I
chains in the Genus database with same CATH superfamily
3W2VA 4HYKA 2OTJS 4GC7A 1HWIA 3JTPA 5CD4H 3IS9B 2BQ3A 3RAXA 2RD5C 4LF6J 4NLRA 2CFXA 3VZIA 2OSRA 4QR0A 3WC2A 1T94A 2CZVC 5HATA 2EPIA 1S6OA 1X9MA 2ZM6F 5HMYA 4ZDNA 5L1IA 3DNCA 2YNIB 4KO0B 2HBZB 5LMUE 2HWIA 2FVSA 2WP8B 2QIFA 4LF4I 2MKCA 7AT1B 2A2DA 5HP1B 4QQBA 4OMFG 3KLFB 2UUAJ 5F8MA 3KLHB 4O4GA 4W92B 4LFBE 2KVIA 4JV2A 2WOMA 3V6DB 4E0DA 1RWKB 2DGUA 1R6LA 1MX0A 2OLWA 4I2QB 2ALZA 1WOSA 2LFVA 4CM0A 5AE2A 4QIEA 2PE8A 2JNJA 2KRBA 4WZMA 1X9WA 4RW7B 1QUPA 1VK3A 1N34J 1EETB 2Z5CB 4DPXA 4LF6I 4JYAE 4G1QB 1QLNA 5A8RB 2RS2A 4NCAA 3JQMA 1XNQF 4EMDA 3KMSA 5KT4A 2DH7A 2QJ3A 1NK7A 3S7RA 4J9OA 2J0XA 3DDKA 5LM7E 3J81C 2RUGA 4TLQA 2K3KA 1CBKA 2C2EA 5H9EJ 2BM1A 2ASJA 2FPHX 2LXUA 2RKIB 1XNRJ 1Z0GA 4RW8B 4ECVA 4YOEA 1D8ZA 3Q86A 1VJQA 2OPQA 3SQOP 1VI7A 4HH0A 3GCWP 2B4UA 4X65J 5LSOA 3C8YA 4U8YA 3OVBA 3UW1A 3ZNJ1 3LWMA 1IKWB 5B0BA 1VHFA 1JJ2R 4H54A 4USIA 1QSYA 2AGQA 4JP8A 1RT7B 4C11B 3GJQB 5KFGA 4QPTA 2CPZA 4L72B 3TNVA 2GQ2A 3HHNB 1SQGA 2FVCA 2OI2A 1H73A 3K5MA 3X3UA 5GAEI 1QAXA 4F7VA 5KFYA 4RUHA 3MM8B 2C2KB 3MM9A 4F0KA 2LQ9A 2O67A 4WU3A 2UXBF 3NBPA 5KFKA 1QTMA 4HR2A 2W8KA 1FI4A 3BO3A 2HHPA 3M6AA 1YJWS 4I2PA 4BS2A 1YLXA 2E7WA 2NLWA 5KG1A 3WU4A 3J7A1 1NHJA 1TTHB 2R7OA 2M70A 2ADCA 1RT4B 5A8WB 3TA2A 5F8JA 1RT2B 3D4JA 4K4VA 2YWEA 5I3QA 2NN6B 3HFKA 1UWBB 4J9MA 1R8PA 2PO0A 4DPYA 3IFEA 3LP2B 1Y7PA 1Q4RA 2B43A 2ZH5A 1SL1A 4ILMA 2NN6F 4X64J 4QU7A 3KFWX 4Q5VA 2ROEA 3CCVS 4JI6E 1NKEA 1GK8A 1MWQA 2YPYA 3OR2A 5IT9U 2R2SA 3MEEB 3T5KA 3TVKA 2P9GA 4N7TA 3D54A 3UN5A 4OZJA 1SKSA 1UEVA 4URQU 3IRWP 4TN2A 2ERRA 5KFQA 4G1IA 4Y0FA 2ZBPA 4F4XA 2C2ZB 1RTJA 3G6XA 3K7RA 1X5SA 2XMJA 4LRFA 4ICLA 4OYOA 4NXMJ 1CS4B 2CQ4A 4KGKA 2BMBA 1D9DA 3VALA 1C0TA 1OY6A 3CD0A 4ZOSA 5CXTA 5KT7A 4LFCE 1NH8A 3ZZYA 1K1SA 2W2PP 4UW2A 4FZVA 2AYMA 1U02A 4AXIA 1QTNB 3MR3A 4HYMA 4ZN1A 2C2RA 1KSPA 4HDHA 2B56A 2KXNB 2VESA 3N9UC 4MKAA 1FJGE 1SQFA 2B8QA 1HNIA 1WEZA 2HMIB 2R8JA 2GV1A 1SKUB 5GADI 2XLIA 3NEKA 3M32A 1APSA 5F0WA 3UN3A 5A6WA 1LWEA 2E29A 3DHWC 5J2PB 4ZCLA 1JXLA 1QAIA 3V4MA 1GMWD 3MAHA 2D1CA 4OL8A 2RDDA 2IM0A 2PO1B 1NZ0A 3C16B 1NSQA 5KFTA 3PY8A 5FDLA 3W9HA 2MQPA 3DHXA 4DV5F 4LF5J 4U96A 5C0XD 1PC4A 1JLQA 4WKRA 4LBIA 4JI5E 1HWUA 5DZ7A 4RW6A 5K9FA 3CCRS 4XK8C 3W5ZA 2DISA 1JX4A 4DR4F 2OMLA 5T7LB 5LMUF 3BKFA 2VOOA 1RAGB 2HKJA 5D4NA 2XYGB 3DN9A 3PVXA 3OHBA 3M8QA 3C6TB 2V69A 3I0RA 4PQUA 3BQ2A 2J76E 3KTQA 3C6UB 4LFBF 5DDPC 5J2MB 2QFJA 2DO0A 4ZVSB 3R2DJ 1D9FA 2BRLA 2PMHA 3JQKA 2UV8A 3ZKDA 1VQYA 4OYWA 2JX2A 2BR0A 3QPIA 4O44B 4F0MA 1XR7A 1PKUA 1T03B 4DN0A 2FJVA 2FJWA 2RIJA 3GQCA 4O23A 3JYTB 5GAHI 3CWJA 2E5LI 1V5VA 1Z0EA 3J81j 5F0UA 4LF5I 1NXIA 4F3OA 3H5UA 2ZBRA 3EDQB 1FTCA 2HIQA 3D6HB 5I3PA 3CDUA 1V5IB 4DG1B 2VU5A 2YH1A 4TYBA 3U1YA 4ED0A 3MCSA 1UWAA 3EGVA 5DLGA 1HBNB 4JV0A 2PDAA 1O5JA 1UKUA 2GIFA 2YX7A 5EUHA 1C1CB 2MZ1A 3VAHA 1SC3B 4JI2E 3VAFA 4NA3A 4OZ3A 1WEXA 1TL7B 5K36A 3KK2A 2K2PA 4O4RA 1UDQA 3NAIA 4X4PA 5M2UA 1YJ7A 4CCHA 4OHVA 2FJXA 1HWJA 4DL5A 4NLGA 4MJKA 4V1Ak 4ZVQB 1VQ5S 4ZLPA 2XMTA 2B3TB 5J1NA 2QLJB 2HVIA 1VQSA 3SEOA 4F4WA 1CJKA 5C25B 2FVRA 4PXBA 1JLBA 1LW0A 3W2WA 3QWPA 4MT1A 1U7LA 2BE7D 4F4ZA 4NLYA 3KK1A 4YY3E 1YH8A 2Z56B 1LKZA 2FVPA 3B82A 2FC8A 4YHHJ 3Q23A 1J27A 2HVEA 2HFOA 4DHVA 4L76A 1AROP 3N79A 5BYSA 1VQ9S 1TFYA 3QT7A 3QGGA 3GYGA 3O3LA 1AT1B 2CG4A 3ILLA 4BLGA 5IOLA 1RT3B 4A47A 3KHRA 2YKNB 4UZCA 2EC0A 4KV8A 2FGOA 2Q6BA 1TKZB 4HT5A 2OPSB 3M8YA 1FXRA 1R31A 2IYIA 1B64A 2XCAA 3CTRA 2W4PA 5AJ3J 3KLIA 4C3KA 5EHHA 2KM8B 1ZXNA 2BA1D 4ZVTB 2XMUA 1RQ0A 3HSJA 2EK1A 2BA9A 1RTIA 4XO0A 2IY5B 1VBKA 4DOZA 4ZP9A 2XY7A 1AFIA 4JI6F 1XC9A 5IC4B 1FNXH 5IC6B 4QIVA 3US5A 1SJRA 4Y2KA 1MWZA 1PIEA 4K7QA 5CAAA 2B8PA 1KVKA 3MUTP 1TELA 3UD5A 1KLMA 3DC2A 1Z2LA 2NPIA 4MMOA 2CVEA 2FJEB 4F3MA 4K4TA 3N5FA 2BR2B 1S99A 3QATA 2XZWA 3ZNUA 2ZH3A 2OTLS 1Q5YA 1UVLA 3B6BA 1VS3A 9RUBA 1S9EB 2PA3A 2HNDB 4ZVUB 4IS9A 1FDNA 1LQ9A 2HGLA 5K8NA 2OELA 4DR7J 5HL7Q 4IH7A 1CQMA 2AEMA 2X7IA 1F60B 2C2OB 3I55S 4RW4B 2MDAA 5CH7B 3R7NB 2J9CA 1ZXMA 2IC3A 5F8LA 4KQVA 2BX6A 4DR2I 2F7VA 2XULA 4LFCF 2B7BB 2BW7A 5BJRA 2ALYB 4IZJA 5IV4A 2BE9B 4DUYJ 4RW9A 1M5SA 3SBMA 3PTWA 2CQDA 1NLKL 2JE6B 2MYFA 2AJ0A 3E51A 2VONA 3G71S 3UD3P 3W9IA 4M5LA 3GMGA 2W9CA 2WAQD 2ROGA 1KP6A 4EU0A 3OLAA 4LF4E 2NN6C 3RBZA 4DR3J 3PW0A 2HAIA 3IP0A 1HI0P 4HT7A 5LT5A 1MW7A 2KFNA 2POKA 4DR7I 2WVCA 3NLCA 3EX7B 2YY3A 2O01C 1EJ7L 5L8RC 3LP1B 3PFOA 2CPDA 2W01A 4DR5I 3BGRA 2PO4A 4UOFA 2PFDA 3QZ7A 5KG2A 1TKDA 2E9TA 1GAOA 2E1AA 1IKXB 4LF6E 1NPKA 1RT5B 2AJFE 4JI5F 3L7PA 1CC8A 2VB6A 1H3DA 2Y1JA 1IBKJ 1RHJB 1FKOA 3PW5A 1NMEB 1FDAA 3FC9A 1N5YA 3D0GE 2B0GA 4FYXB 1YSJA 3VVTA 3QQCD 2RNEA 4J37A 4TY9A 4ANDA 3H2VE 2BEFA 4N77A 3I87A 4NXNJ 2HNZB 3FEYB 1R6VA 4B9TA 3AH6A 5D8HB 5J2QB 4DFPA 1NHUA 4L6V3 1HHSA 1QJHA 4RWWA 2X3DA 1F6TA 2F8EX 3MAAB 1RCOB 1S49A 3C15B 4NA1A 2MHNA 3TUPA 2C3OA 3TUZC 1FJEB 3E01A 1FFGB 3NWRA 2XBPA 4OZ1A 3D66A 3T1HJ 2DR6A 1X7VA 3SQGB 4C48A 4EO6A 2N3LA 4FW6A 4ECQA 2RU3A 4Y34A 2L9DA 3TA1A 4DX7A 1RTHA 2KJWA 5DRPA 1Q0NA 2ZBQA 1TV6B 4BA1B 2FJBB 4K4WA 3MR6A 2CJKA 1SJ3P 3K0JA 2ZHAA 4OO1A 2OO4A 4F0HA 1R0CB 5KFNA 1S7IA 4NLOA 4WE1A 4B3RF 4NZ7A 2FHJD 3ILJA 2CQIA 2G0IA 4PYDA 5KFIA 1NK5A 2OUGA 4JI2F 2C2NA 4ZPAA 4I3HA 5DM7Q 4IFVB 4LIWA 1S1XB 3BO4A 1HPZA 4QR1A 4JV5J 2BUNA 3D2WA 5KFHA 2HRYA 3I4HX 1CJUA 3IG1A 1FTRA 3FZBA 2FJAB 1U25A 4Y2MA 1N36J 4QPXA 1BUXA 4KT0C 4WPAA 4W90B 4DMZA 3T1AA 2CPEA 4NMXA 2YXLA 1NK0A 3CJ4A 4XTTA 1FVQA 4M1KA 5KFWA 1N33I 2DGXA 1ACMB 3QIPB 2VV5A 3DOMA 1CPZA 1UPMB 2ZJRQ 2V9WA 1FNMA 1Y4SA 4LSLB 3TUJC 3CC4S 3UHMA 2BRKA 3ZZRA 3QRPA 3RBXA 4TXSA 2C2DA 4I6YA 2M5YA 2CG8A 4MTPA 1QSLA 2HHHI 2XTJP 1KTQA 2QMXA 1A0OB 1UJ5A 1REVA 2VFUA 3JSRA 2OPPA 2F40A 4RX6A 3O8WA 2AW0A 3MFIA 1U6BA 4YQWA 1FERA 3VQSA 4PYAA 5F41A 4UY8T 3RAMA 3GV5B 1HBMB 1TK0A 1S72S 2RUSA 3QT8A 3T5HA 4DS4A 3JSMB 2W2NP 4KGMA 3AJ1A 4F3QA 2NSCA 3C46A 4ZJLA 1S1WA 2CQCA 3CDAA 1GTHA 2YX4A 3NGRA 3FDSA 5IZHA 2CAJA 1RTDB 1PYTA 5IT0A 5CZXA 5BYQA 2DHGA 4CH1A 1VRUA 4NLTA 1GXLA 3PG9A 4DEZA 1ZH5A 2RRAA 4R8UB 4KIAA 4ERDA 4OHZA 4USWA 2HS0A 3CJTA 3SCJE 2W1BA 2W9BB 3R7BB 1EKRA 4X4OA 2HQGA 1L3VA 1B4SA 3POTB 2GX8A 3DI6B 3TARA 1AB8A 3H4LA 3K59A 1VISA 2DNQA 5HO4A 3WDOA 1OQ6A 4TU8A 1RTZA 1FO1A 4PABA 2JLGA 4KB7A 5DDQC 1LFPA 1OPIA 4PUOB 1IM6A 4L74A 4DV0J 2NCKL 3B4MA 3OFGA 4F04B 1JLFB 1U1MA 2D69A 3RJMB 3MR5A 3H4DA 3EGNA 3DLEA 4AYBD 2VPXB 1MU2B 3J7YU 3LP0B 3VHQA 3ZKBA 1ZM3A 3UNYA 4JI1F 1SVDA 1XQIA 2E1PA 3MXHP 4P75A 4USMA 1RYSA 1V6HA 4ZP8A 4B3TF 2KFZA 3P3CA 4GVBA 3KDNA 1HYSA 1NNDA 2DH8A 4LFAI 4C98A 3MPDA 1Y3KA 4RL1A 3G96A 4ZK7M 1VQPS 2F4FA 2JRSA 3IWXA 2LQJA 1R43A 4LF4F 1U1NA 2UUTA 1VQKS 2FUG9 4PWDB 2IRXA 1U24A 1T05A 3CJ5A 4LVNP 2R7WA 1RUSA 2AP6A 1Q7YT 1FKAE 1TKXA 4QWEA 4RBUA 2V4RA 2QL7B 5A8KA 2XY6A 3OVSA 1P6TA 1HHTP 1PAEX 3W8GA 3M9OB 2MKSA 2GMJA 4DR1I 4JI3J 1SKWA 2ASYA 3WZ0A 2NPFA 1XMOI 4LF6F 4AL5A 4QWAA 3OFEA 2PIIA 1HL6A 3Q8QB 2E5LE 4OI3A 1CLFA 1B62A 5HBMB 1QUVA 4LF5E 3DGVA 2KTQA 3H42A 2YWKA 1AXQA 1YBUA 4FKXA 1C1BA 1G7CB 3GJRB 2FC9A 3M6XA 4USKA 5HSPA 2EFNA 1MROA 1W7WA 4PCQA 4DV1I 3PS2A 2WNRA 1KONA 2UUAF 1AA1B 2WVDA 3RZAA 3CCMS 2O1UA 2NUHA 1FEHA 2O66A 4IRCA 1SI9A 3A8KA 1JB0C 4DL0C 2Q2EB 3PS1A 4YR2A 4WYWA 2VPZB 1SXLA 4JI3I 1UFLA 1N34F 2CIMA 1ZPVA 2V8HA 4NI2B 2JEBA 4Q7AA 3R7SB 2JOQA 2YQ0A 3U7JA 4F25A 1YKWA 5IT9Q 2YNHB 1J5OB 2RRBA 1D09B 1E6VB 3ZTRA 3QZ8A 1XIQA 1T11A 2RE1A 4NLSA 4ID5B 1IBCB 1V3RA 1JLCB 1XNRF 3EICA 2RF2B 1LWCA 4S0MA 1CC7A 3S1TA 3UVJA 3LNUA 1JLGB 3TANA 3PJ9A 1H98A 5CYQA 3W2VB 4X65F 1RYRA 2GO3A 5A2QU 1DLOA 1YHQS 2KL8A 1HIYA 1DJ0A 3UE2A 2KZZA 2PI4A 1IWAA 4ELTA 2AU0A 1OY8A 2L08A 2JEJA 3M9MB 2W24A 3RYLA 4TU7A 4ED1A 2AX1A 1UTAA 3FQKA 1OQ3A 2LU1A 1S0OA 3PXGa 3HFZB 3H4BA 4ES3A 1UA0A 4K4YA 4NCBA 2O5DA 4ECYA 1SL2A 2YKQA 1FEEA 3ZTQA 4O4GB 4MK8A 3DRSA 1XNQJ 4HL9A 2AF6A 3CD7A 2BM0A 4K4UA 2WOMB 2IJFA 4I4BA 4FDFA 3CD5A 1XEZA 4BCAA 2DRAA 3BPDA 2HIYA 5H9EK 1HBUA 4ZPCA 4K2JA 1NJIT 2HBQB 3FSXA 3BO2A 1UDSA 3GFZA 3P3GA 3IC1A 3MECA 3RR7A 2ZJPQ 1FRIA 2V8GA 2VQEI 3G8QA 4FWDA 2BJ1A 1IBLJ 1F9FA 2J6UA 3HDSA 5KFSA 2QZ8A 3H40A 2LP4A 2KO1A 1X0FA 3UQSA 1KVJA 4KC5A 2MY8A 4ZCIA 5LXYA 3GSIA 6FD1A 3PX4A 3GG1A 1NO8A 2GO9A 5JEAA 1F5CA 1HNXI 3ZZUA 1WWHA 2OPQB 1TUWA 4J9RA 1I6JA 2DR9A 3OXGA 1NJYA 1BHNA 3EUNA 4ZVFA 2UXBJ 4HACA 2LEAA 2CPIA 1A7GE 3IRXA 5LXRA 2ZKUA 2J9DA 3EM1A 4DV2J 3FCHA 5EGYA 1S6UA 3G86A 4DR7E 5K36E 3I6PA 2WSFC 3FBEA 3MCOA 3DOKA 1Q5VA 3FJ2A 4DR5E 2C3PA 2H1YA 2CJXB 1HQEA 1N54B 4MKBA 1KQGB 2IA0A 3MM9B 3P49B 1PJ5A 3NBPB 2CRLA 3AJ2A 3QLHA 2UVWA 4IRDA 4JI8J 1YBTA 4I2PB 5KFVA 4WFYA 2RJZA 2VG5A 3R8YA 3FFIA 3GMEA 2RRNA 4PG8A 1X5OA 1VBYA 3JAMU 1U2FA 1SIZA 4MKYA 3AD7C 5GMKa 4U7UK 3FEZA 2XB2D 2AKWB 5L1KA 4M95A 2R7UA 4DR3E 1FKAF 1RREA 4C7QA 1S1TA 2GNKA 3N28A 5K5MA 4HKQA 2ASLA 3BB5A 4PXEA 5E3RA 1WKKA 2ACYA 2PO0B 2LQBA 4F26A 3P5BP 3IAM9 4KHPI 5K8MA 3QWUA 1B0TA 2EG2A 2AJ1A 2HBYB 1EX8A 3QMQA 4MKVA 3CCQS 4K50A 1SJQA 2IAJA 2E5LF 3KNGA 2YVSA 2F1FA 3QT5A 4LF5F 2ZD1A 3SZ2A 1RP5A 4I6WA 2UUBI 4FW7A 3NP5A 3OR2B 4JI8I 1KD1T 4Q8EA 2HAFA 4ZLNA 5GAGI 3HCXA 2DHAA 4OZNA 1YG0A 4A48A 4ZVIA 4EEYA 1CJVA 4QW8A 3E8OA 4PZVA 1IM4A 4ECTA 3GIJA 2HHVA 1RTJB 2CPFA 4KY3A 4LSZB 1FXLA 3GB0A 1S6PA 2CGEA 3G6VA 2B9WA 4ICLB 4OHXA 1M1KT 2XNQA 2Q1LA 4ER8A 4DL4A 4DV6J 3H0PA 2HLTA 1DRZA 4NPOA 1ROFA 5C42A 2AIRB 2IA6A 1C0TB 4RNMA 5DROA 5D77A 4LT6A 1RT6A 5F9NA 2HPUA 3T1HE 4KQZA 4Q45A 4KRWA 2AV5A 4OI0A 4B3MI 2GS8A 3EXCX 1NJXA 3BBFA 3UN2A 4I7FA 4CNYA 1TL4A 3WU3A 2QL5B 1N33E 4DN9A 1MLAA 1GMVA 1Z0WA 4LBHA 1HNIB 4LIRA 1Z2ZA 2GHVC 1VHIA 1T02A 1RLCL 2ZBCA 3T9NA 4OV6A 5F8IA 4Z2XA 5T41A 3BZQA 3MM7A 3OR1A 3M32B 4QIFA 3VWSA 4NLQA 1N6QA 2LCWA 3CO0P 1LWEB 4M5MA 1VBZA 4HXZA 2HHHE 4B9SA 1TMJA 1NU4A 4DSJA 2DNNA 5LSLA 4WXWA 2UXCI 2MY7A 4AQYI 2QMUB 4ZPBA 2V8VA 4EZ9A 2DXFA 1HNWJ 4V19X 3BKUA 3ISZA 1X4GA 5FDLB 2WSEC 3NAHA 5JJBA 3G6YA 3N6NA 2LYVA 4UOHA 3CDIA 1OYSA 1JLQB 2C37A 4NL5A 3D6MB 4RW6B 1RAIB 4QYRA 3CCZA 3Q8PB 2R8IA 4QW9A 2DNRA 2FLLA 3V6HA 2MQOA 3HKMA 3NKYA 3GCMA 4GKJI 4DPOA 1X60A 4QYZJ 4UTGA 1AUSL 4IKAA 3SDEA 3M8QB 4JYAJ 2KZMA 3I0RB 4I69A 4PQUB 3H20A 2VPWB 4K5SA 2OP5A 4DZDA 4KAIA 5CYMA 3GZ7A 2D9PA 4ZJOA 5IM0A 1FWPA 5JUMA 3EE3A 2VG6A 1VQ8S 2PT0A 1G4CA 3J80C 3CEDA 2LEBA 4DJBA 1N88A 3HT3A 1NSAA 5ETQA 3L95X 1MG7A 5GAEU 5KG4A 4G1PA 1HNWI 2BE2A 3ET6A 5C24B 1YRUA 1Z0TA 5AJ3F 4UQGA 4DUZI 1DQ8A 2O3ZA 2GQCA 1ZAWA 1QAJA 2OH2A 1NEEA 2CYYA 4U7CA 1H38A 4J9SA 2QLFB 1Q95G 4ZHRB 2Z2YB 4M63A 2CZ9A 2B6AA 3SV3A 2AJ2A 2Z4PA 1BGXT 5J1PA 3BSOA 3TQEA 5DDOC 2EBEA 3PHEA 3KJVA 4LQ9A 2CVIA 4LFAE 2NUUG 3NGKA 1QE1A 3DFEA 5K36B 3MTKA 3KK2B 4OO1E 3HZGA 4IO1A 5HVFA 3HXMA 4DUTA 3AOBA 1HHQA 3HULA 4Y6IA 4TQRA 4DR7F 3IGNA 5KG6A 5K36F 2VA3A 3CCSS 1RU1A 3QFWA 2KKHA 1CJKB 2OMOA 1JLBB 1LW0B 3W2WB 1S16A 1SH0A 4P73A 2V94A 3PYFA 1LFWA 1QDUB 3C2PA 3I96A 1KQKA 4R0EA 4DR1E 4FP9A 3KK1B 5THWA 4IO9Q 4LF8I 4TU9A 2B9EA 5KFJA 1XMOE 3TO8A 3MCNA 3IA0A 3DKDA 1S9FA 1H2VZ 2IJRA 4ED3A 4FW4A 3PIPQ 2ADBA 3HZEA 3CWVA 1IJEB 4BWJA 4K0KI 4PEOA 3CXCR 3AQPA 3PRDA 3JS9A 1WOOA 3H8YA 1NK8A 3NCQA 3PW2A 4DV7I 1PBUA 4U7UD 3M2VA 1NM2A 8AT1B 1OY9A 5ETOA 4Y2AA 3JAMY 1GX5A 3GILA 1NKCA 4XPCA 3X1LB 4KV8B 3R1LA 4A8XA 2LXIA 2GJFA 4DR3F 1FX2A 1CEZA 3ADAC 4C0HA 4R5PA 2CQGA 5ETPA 1TVRA 4OLOA 1JQGA 4WFZA 3KLIB 3W61A 4LRCA 4P2FA 4YR0A 3ZTPA 3T9ZA 1SH3A 1DTQA 1XWLA 3MGJA 3AD8C 3FCWA 1GTEA 1G2EA 4JI3E 4WUCA 1ZA1B 3TZWA 2LECA 2ZZTA 1DZ5A 2P6TA 3PV8A 2DRBA 2CADA 4USJC 4L73A 1KLMB 4OZ0A 4MIAA 1BKNA 1IBKF 2JFKA 4UT4A 1S76D 3LOUA 1GMWA 3DLLQ 3MOJB 1UJ6A 4LFCJ 2XI2A 1U1OA 1KDNA 2ZDOA 2Z5BA 1NHHA 1D8YA 4OYXA 1R8BA 5D0HA 3MFHA 3DXSX 5C0XA 3FBBA 2VD3A 3GG0A 1SB6A 4B02A 2P9EA 1FJGJ 1FFSB 1T95A 2IC3B 2MQMA 1X4CA 4RBVA 3W5XA 1VYAA 2AZ3A 2VQFJ 2F4VI 4IUFA 4IZJB 3RU0A 3T1HF 3IM8A 1RKJA 3NNCA 4RW9B 4DPTA 3TRGA 4K5RA 1HMVA 2B4PA 4C0OC 1UFWA 2R9LA 3PRYA 5FJ4A 3OTOI 1NHKL 3W7BA 2FZGB 4CO1A 1WSVA 4B3SJ 2G0JA 2ZH9A 2V50A 2XGPA 4IH6A 2OD4A 4NE9C 2E44A 3OL9A 3QGHA 2JSXA 3FMWA 2VIHA 3VAMA 3P6YC 4ZVGA 1HNVA 1B63A 4GO7X 2RVJA 1S10A 2HZCA 2MEWA 3RB0A 4XPEA 4RO0A 5HVHA 1YK9A 2LKZA 1H0HB 1U26A 2DTJA 4FF1A 3BGRB 3QYYA 1UVKA 1UPPA 2UU9J 1JJ4A 3DXBA 4ZITA 4JV5F 4QWDA 4QNKA 2I6WA 4AL6A 3QAEA 5DQHA 2HQFA 4I67A 1JNRB 1N36F 2VQFI 1RAJA 2R7VA 3IM9A 2LQ8A 3GSDA 1WHXA 5M2PA 2P5VA 2WSCC 1SUQA 1NSKL 1FX4A 1FXDA 3DRPA 3CO9A 2VQEE 2MLYA 1FKOB 3KUEA 1N5YB 4AE5A 4B3SI 5HMXA 1IBMJ 4PPDA 1N32I 2QX0A 2KT3A 3Q6MA 1OO0B 3I32A 2RQMA 3ITHA 1LK7A 1HNXE 1F3FA 3MOZA 4F67A 2E9RX 1EP4A 1VJWA 3GONA 1HNZJ 1VFJA 2QGFB 3RB6A 4FN5A 1X31C 1YVFA 4ZVRB 5EDWA 2DR7A 2UU9I 2ZHOA 4M5NA 2VKZG 3J80Y 3E01B 3LTOA 3IR5B 3RB4A 4DDFA 3MM5A 4C8YA 4J3DA 5T14A 2QA4S 1U2CA 1RAAB 4J9PA 1K0TA 3DCAA 3CMES 2XHCA 2DPIA 3I5BA 1RTHB 2FLNA 4XDCA 2F1DA 3T1YI 2KXHA 4WYLA 1YDLA 2QLWA 2NXUA 1UP1A 3T3FA 4M5HA 1P1LA 1YJNS 1YJTA 3BN4A 4FXDA 3LO3A 2A3JA 3KUHA 2R7TA 3QFHA 1MN9A 7FD1A 4RPFA 3HHLD 4C8KA 1IQZA 2BV3A 3FBCA 2XO7A 1Y4ZB 4YY3J 1KOHA 5KT6A 5E33A 1HPZB 2G0CA 1Q53A 4OYMA 1GXTA 4BBYA 1CJUB 3IG1B 2YX1A 4DCJB 2WK4A 4O0IA 3K2YA 2NXEA 3PW4A 4EWTA 1Q82T 2B7CB 4BA2A 4FNIA 4DV0F 4IOAQ 1NZAA 1BC6A 3GWCA 5KTQA 1TMMA 2BJ3A 4DR1F 1VDHA 4KHPE 3MEGA 1XMOF 3HM9A 2P2CB 1WF2A 4A8YA 3DOMB 2CWXA 2AWZA 4FW5A 5KFRA 2UUBE 2DGOA 4M5KA 2ZH1A 4JI8E 3BM7A 2AYBA 5RUBA 4DCPB 3JXOA 4RNHA 1T9UA 4CO4A 4P7VA 1REVB 3WIVA 3CCWA 3EVMA 4JOUA 1C4AA 4ED2A 5DRQA 4DBQA 2PO2A 1KHVA 4C8MA 4CTAA 1OSCA 2CPJA 1ZPWX 3CF5Q 1WC3A 4Z7YA 2DR8A 2JEGA 2DEJA 2E7XA 2W7OA 1S0MA 1SPBP 3CB4A 1NJWA 1JXVA 4DSKA 3CDJA 5DLFA 1AUDA 3K5OA 5L46A 4KE5A 3R97A 3PYDA 2XCPA 4ED6A 3AOCA 2X51A 1S1WB 3CCTA 2HKEA 4JI3F 3BV8A 2XYPB 1RXOB 1FRJA 2M8HA 4YB1P 1VRUB 2ZC4A 3OV7A 3BSAA 2DNLA 4B9UA 5HJYA 2N82B 5K36C 1PVGA 3CSKA 3IBWA 1YJRA 1W2BR 3B8HA 4B3ME 3BN7A 5CCLA 1BQMA 3K5LA 3HFVA 3MEKA 3GU0A 1S1VA 2DCUB 2VFVA 1EKSA 3TI0A 5JEAE 2UXDI 5DRRA 4HHJA 1PYSB 2KRRA 2VFRA 3CJ8A 1F0XA 1RA6A 2D41A 1N0UA 4NYOA 2IMWP 3TAMA 2GFFA 3MMCA 3DLEB 2ZZMA 2I9SA 4EBDA 5AT1B 3HLUA 2UXCE 2ZKTA 3RBEA 4Y65A 3U1KA 1X4BA 2J9DE 2XC9A 2G9OA 4LR7A 2CNKB 4A8QA 4EBEA 1U0SA 3OXLA 5K8OA 4GVBB 4TKTA 4OKGA 2G4BA 1HYSB 1MU5A 4J5OA 4M5JA 1BLUA 5ITHA 1IVZA 1XBWA 3G6ES 2DNZA 4GKJE 3G4SS 1FF2A 2IM2A 1FK9A 1YBAA 3ENQA 5B0CA 3EZOA 2PC6A 4F50A 3AFGA 5E3CA 2Q66A 1XERA 2PMWA 2A10A 2ZH7A 3DMJA 1TKXB 1YZ7A 2MLXA 2KB2A 3LALA 1CSJA 5A8KB 2B4VA 3U02A 1KOOA 3AAWB 4F4AA 4DU8A 2PO1A 2PNLA 3G87A 5FLXC 3P45B 2L9WA 5E3QA 1RSCA 1NK4A 1SCJB 1RT1A 1A6FA 1HNWE 2HS3A 1U49A 2IOPA 3VAKA 3KOAA 3HJVA 4GO5X 3HP6A 2FHJA 3GJTB 2XG8A 4U67Q 3BH6B 3L7ZA 4DUZE 3ZO7A 5LOQA 3IAS9 1QVFR 1C1BB 3LQVA 2GW8A 5DGBA 3HF5A 2DO4A 4IFDD 3BR8A 2XY5A 3LGMA 4ZPDA 2Z58B 3AA8A 1C0UA 1MROB 4ZS6A 3ENAA 4NLWA 2WNRB 1HNXF 3JAMQ 1KBRA 5CA5A 5K8PA 4OI2A 3PRBA 3HKWA 3PFEA 1NPPA 4OFZA 2GAHC 4FYYB 4DZ6A 1T9TA 2WB1D 3HD1A 2RT3A 3I5CA 2V2QA 2EK6A 3J81U 4B9MA 1X4DA 4AFFA 3Q6NA 3K17A 2JEBB 1WEYA 4M5GA 1I51B 3BGLA 2IFXA 3GCXP 3THTA 3G82A 3Q8RB 4ISAA 3CJKA 1OIAA 1IBLF 3V6KA 2ASDA 5CYJA 1RBAA 1PGZA 2FVQA 5DQGA 3ZTSA 2D9OA 2LA4A 3CNQP 5HROA 4DR6I 3WIUA 4CLFA 3CJ0A 1FA0A 1N52B 3E2EA 2ZE2A 4KPCA 4ZPWR 2KU7A 5FD1A 5E7OB 3NWGA 1LWCB 5LL6d 2XZDB 4YDXA 2IVYA 4NRUA 3EPIA 1X4HA 3UVJB 3KWMA 3UNGC 3SSSA 5CYQB 4PQAA 3LUYA 2D3UA 4OHWA 3DU5A 1Q78A 3AT1B 2VG7A 5MLCV 2V5HG 1WHVA 3M8RA 4X4QA 1Y60A 2NXJA 4DV2F 2P8IA 1DARA 2HK3A 1AFJA 4RZRA 1U48A 3MUMP 2BABA 1SV5A 4A4JA 4KHPF 1RHYA 1TFWA 4KBIA 2RHQB 2VC0A 1I94J 4CDIA 2FDNA 4C0BA 2FD2A 3K1JA 1RWNB 4LCHA 3NOGA 4F2RA 4JI8F 5CHCB 1WC0A 3DRSB 4QBUA 2I5JA 3GYXB 2XLKA 1HW9A 2VPYB 2WVFA 1HBUB 1SKRA 8RUCA 1FHTA 4ELUA 4LF9I 4A8FA 2XGQA 2QLXA 5KFLA 2WTFA 4ATNA 1RWPB 4ZVOB 1IR1A 3MECB 4EFAC 1DY3A 1YQHA 1FJCA 2K06A 4DV5I 3PX0A 1RHUB 4Y2CA 3S8SA 4B17A 2U1AA 2GIQA 4OO1C 1M5PC 2M7SA 1I3OB 1Z1ZA 2MJNA 4BC9A 3H5SA 5D3GA 3OPKA 4DR4I 5E5NA 5LMUI 1I94I 1RE1B 2ZWPA 1BD6A 1NJZA 1QZRA 3SFGA 2CQ1A 3D68A 3ZXWA 3D1HA 2DNKA 5JEAB 2CDQA 4B3MF 5A6PA 4J7CA 4X4NA 1AZSA 2VJVA 3QJPA 3OTOE 1HBOA 3AB4B 3U1NA 1NZ8A 5JEAF 4USTA 1HKAA 4M5IA 1YIJS 1X5TA 4HACB 2KN4A 3IRXB 4JI4J 2YWHA 3AXKA 3PO4A 2V2KA 3WU6A 1NB2A 3J80Q 2YKOA 3UDEA 4RW4A 1NBEB 4ZLJA 2MQQA 2NYHA 4C6AA 2Z57B 2Z2ZA 4L75A 3AQOA 3LA0A 3Q8SB 1HQEB 2UVVA 4DV6F 5C5JA 1Q1KA 1HA1A 1KC8T 1W25A 2ROPA 3A8JA 4B08A 1H6KX 1T9XA 5DQIA 2EG1A 2VQFE 4O3SA 3QLHB 3QNWB 3A8IA 3HVRA 3FFIB 1WJ9A 1RACB 3R5DA 4GKJF 1WI8A 1Y11A 1R8AA 4UY85 1BXNA 4B3SE 4PG7A 3R27A 1N32E 1S6QA 2XS2A 2E5LJ 1E6YA 2PSZA 5A0YA 5IQQA 3U1LA 4WCEQ 4FYDA 3F56A 1S1TB 2ZVSA 2QN6B 4O3NA 4JI4I 1RADB 2JJ4D 4I64A 1RHKB 1U09A 2FYXA 5ETVA 5I4MA 2ZH4A 2MHEA 4U6PA 4FYWB 2IVMA 3A3OB 4CO0A 2PNMA 4X62J 2HQ3A 1PYOB 2UU9E 4HTJA 1YI2S 1HNWF 4WTOB 4LQ3A 2W7AA 2IAJB 2FTRA 2ATCB 2ZD1B 1RDRA 4NZ6A 5FLXY 4R25A 4F4YA 2K8GA 3L9ZA 4X2BA 3UCGA 1Q86T 2RILA 1MNEA 5EWGA 5HN0A 1K0VA 2B5JA 3KMQA 1J2VA 3T1YE 3J7YI 4AUKA 1CJVB 3IBCB 4PG6A 4HEA9 1WORA 3AY0A 3Q24A 2KT5A 5LJ3Y 4ZPTR 1S4FA 2EW9A 4JYAF 5KT3A 1IBME 1S9GA 3OBIA 2MSSA 3CCES 4Q0BA 2HHQA 2ZH6A 3KHLA 1P9YA 1S6PB 5KFDA 2AYEA 3BREA 1HNZE 5DETA 4KHRA 5D0GA 1VIOA 4KTQA 2HHSA 2IDEA 3VV2B 1NDCA 4CLTA 4X62I 4DSIA 5C42B 5C0XE 5A76A 3J81Y 2FY1A 4P2XA 2YNFA 1RT6B 2ZWOA 4A8SA 3CDEA 4A8WA 4URGA 4CO3A 2J65A 4ZMMA 3FKBA 3TA0A 4TQSA 3RAQA 3VAJA 4I7FB 1Y10A 3BSNA 1FE0A 2KG0A 1OMSA 2IHR1 2F5GA 3ILOA 3D0HE 3GIIA 1UA1A 5B7WA 3MM7B 4CWBA 3OR1B 4K4SA 1N6QB 3KK3A 3QSIA 2IDLA 3H98A 4QYZK 5HQLA 4QWBA 5D78A 3UDCA 3QBCA 1R27B 1B0PA 2OD6A 2XM3A 1PJ7A 3SXLA 1CQNA 2DGTA 3QJJA 2JT2A 2ILZA 1XR5A 3LPEA 4Q8FA 1ZTWA 4D3GA 1B99A 2KVQE 3VZHA 3TQ1A 4QWCA 1IKVA 2RQKA 4IG0A 3UDLA 3M6VA 2JFDA 2C37B 2GVZA 4K8RA 5K14A 2JLEA 3EYZA 3TAPA 1XXEA 1BWEA 2B4OA 1Z59A 1FD8A 3SDEB 2VBYA 3UPFA 1UEUA 5IXUA 2H9ZA 4KKOA 1Q7LB 4ANEA 2G2ZA 4WWSA 3TUIC 1M5KC 2EFVA 5CYMB 2XI3A 2BKPA 1S1UA 3QGIA 5LSRA 2ZNZA 5JXSA 2VG6B 4DR2J 5CCMA 3V81A 3GJSB 1F5BA 3P4UB 3GFXA 4EGLA 1UZHA 3HVTA 1LW2A 1Z4UA 3AD9C 2E5GA 1HR0I 3V2UC 5CQGA 2UXDE 4DL2A 1H72C 2BE2B 1YRXA 4NZ0A 3ET6B 2JWNA 1FRXA 3VTIA 4WK1A 4IR9A 3TP2A 3P5TL 1RGVA 2A1BA 1NK6A 2UVRA 5ETMA 4LF1A 3PR4A 2OFGX 3PYGA 1RLDA 2B6AB 2CWKA 2XWXA 1G1XA 4HY1A 3JB9k 5HLFA 3PYEA 3M2RA 5F8GA 4DR5J 1S7HA 4IDKA 3KJVB 2E66A 2LEPA 5C2GA 2DIUA 4B9NA 1QE1B 2Z5EA 1USVA 1RZMA 1GMUA 1X4FA 2JVOA 3G8SA 4J9LA 1VQLS 4KGXB 3L7UA 4H4OA 5EWEA 3PHTA 5KG5A 3TYTA 2NN6D 1RKIA 5L9NA 1R0AA 3IMQJ 3AA9A 2EI5A 3SV4A 4AXJA 3R5GA 1WC6A 4JG4A 4FKYA 2EFGA 3EPGA 1FJGF 2QA2A 2HHUA 4NEYA 1TZ0A 2QO3A 4G65A 3CIMA 1CG2A 2B9XA 1RR9A 4DX8H 3LP0A 2EXUA 2VQFF 3MWBA 2H5EA 4FWHA 3Q8YA 3IO1A 4KPYA 4B3RI 4O3QA 1F1BB 2K7KA 2WW4A 4RNNA 2VFTA 3GE9A 4B3SF 3M2VB 1N32F 3BS9A 3MEDA 3EWGA 1L3UA 1Q8BA 3M7NG 4UOGA 2DH9A 4P74A 2XYHB 4ZJQA 4N56A 3SSQA 5AXKA 1JLAA 2H54B 1IQTA 4R5PB 4PPZA 1U8WA 5B0EA 4LR9A 2BJEA 1TVRB 1MN7A 1KKHA 3M7VA 3Q1QA 5DO2A 1RAHB 3D1OA 2BXJA 1DTQB 4Q2LA 4NMLA 3PACA 4ITSA 2UU9F 2CJ9A 4QIWD 5KOWA 5JEAC 1P9QC 2CQ0A 3AHPA 2DEIA 4CLKA 4DV3J 4GQUA 2ZOMA 1VR6A 1CVJA 1VQ6S 3T1YF 2BQUA 1H7SA 2OSQA 1N8RT 2AMCB 3M6WA 1R8HA 1N5QA 2CQHA 3BKTA 1Y6ZA 1ZM2A 4JI7I 1IBMF 4OX7A 2MKHA 2HWTA 3PCOB 2Z5BB 4DR6E 3OT9A 2RQ4A 4ZCMA 3O2IA 3D5MA 2M52A 4QR2A 4U3BA 3I5AA 2E5IA 3LPSA 5B0AA 5C0XB 3PIOQ 1HNZF 3ETOA 3FMBA 1EIYB 1N33J 1FRKA 1DAXA 2EC2A 1ZOTA 3ISNC 3CDWA 4IG3B 5L38A 2VODA 5HANA 4DPWA 5G4DA 1WUUA 1WNEA 5C0XF 2VICA 4DWIA 2R2TA 2C3UA 2C2MB 2GA7A 2HHHJ 4CT9A 4CT8A 4ELVA 5ETTA 1HMVB 4DV3I 3E3XA 3MF5A 3IWLA 1U47A 1A6LA 3M05A 4CI0B 3DRYA 2G1HA 3H5XA 2Y8WA 4DQSA 1UVJA 1Y0HA 2LDYA 2IVFB 3KG4A 3DRRA 4O0NA 3LH2S 4N3OA 1X4EA 4HDGA 5SZTA 1T0TV 3KUGA 4H4KA 6FDRA 2CA9A 3DDNA 2VHGA 1HNVB 3K5PA 2RS8A 4JI0I 1TU0B 3CT9A 5B0GA 2EFOA 3M8PA 4WF9Q 1WELA 2DHHA 4YY3F 3I82A 2GMLA 3W3SA 1YGYA 2GHWA 1FRMA 4MYUA 3KG1A 4RU2A 4LF9E 3OL7A 4P10A 2HFVA 4PR6A 2W2QP 5U47A 2ZDPA 2E9ZA 4JI1I 3N6MA 1UJ4A 4F2SA 1OYPA 4DV5E 3MMAB 1SUQB 4WP8A 4B3TI 3DRPB 2HRTA 1BY9A 2AD9A 2G1DA 2D3OR 4ILRA 1ZYQA 2JHEA 2F9JA 5SUHA 4M5DA 3J7ZT 4DR4E 1I94E 2ABYA 4USUA 3NS7B 2J8AA 3HSDA 2QT7A 4LF7I 3ITHB 3DYAA 2AX0A 4NX9A 3DLGA 1ZBTA 2BYCA 1EP4B 2PNZA 1TK8A 4USHA 5KFUA 2OPRA 1VIXA 2Y9HA 2Q43A 1JIHA 3SMZA 3NY0A 1VOMA 3M2UA 2L48A 2HWHA 2UXDF 3EJMA 3KKFA 1R3NA 5E41A 1Q8KA 2UV8G 3OTCA 3MTJA 2XMMA 4RKUC 3MM5B 3D6FB 4FW3A 4X4VA 3VF0B 4PRXA 3CJSA 1PO6A 4LFAJ 2LU2A 2FIUA 3OTDA 4X66J 3CMAS 5FLXQ 4IFDC 1RU2A 3NG8A 2IOQA 1JKHA 4EBCA 2V4JA 1H7XA 4CLUA 5DZ6A 3PS3A 2Z0GA 5DS7A 2V8DA 2GCFA 5JVGQ 2ZVIA 1X0PA 3P76A 2HVDA 5ETNA 2L41A 2UUAI 3P3DA 2HFNA 1PJ6A 2WW8A 2PN6A 3FUYA 4DR1J 1PKPA 1GNKA 4TY8B 2KYXA 4HTIA 2ZITA 3DGPA 3H2LA 2MTLA 4PG4A 1XMOJ 1HI1A 4K4XA 5D0RA 1K73T 4DL6A 2X3GA 4C2MA 3DOLB 3DM2A 3GYNA 2VZ9A 3ENWA 1N34I 4BA2B 2HGMA 4JI4E 2CJQA 3IBFB 2M0GB 3J81Q 2R8GA 2JC0A 1VGYA 1S0VA 4FS2A 4PWUA 4N76A 4X66I 2KFYA 4LVOP 4DV1J 3OTBA 2DVIA 3MEGB 2FJDB 3H90A 2BA0G 2AQ4A 1UETA 4RUBA 3K85A 4FXWA 4ZVPB 1GH8A 1ZA2B 2YKAA 5LL6R 4B3OA 4DX5A 3M8SA 2BJ9A 2H48B 1XMBA 2F3JA 1FD2A 1N5SA 1XNRI 3MZIA 2J9EA 4HH1A 2WVEA 2RDIA 2XSJA 4CLZA 2PO2B 1BQXA 4CTAB 1VQ4S 4BHQA 4X65I 4YB6A 1RABB 3AJDA 3LANA 2RB7A 2ZFHA 1FRLA 3Q83A 2BANB 4CYUA 4I1TA 3RRKA 1TL1A 1Y3JA 2HHXA 1VQ7S 1RWUA 3MR7A 4LUBA 2KH9A 2FZCB 3LW5C 1D6TA 2IM3A 4X62E 3VR1A 1X4AA 5IT9C 2DNPA 3QRQA 2XLJA 4C3LA 4WFNQ 1BE4A 1Q81T 1HW8A 1O6XA 2VC1A 3B78A 3UR0A 1RHQB 5IFMA 2HFZA 4EI2A 1CULA 3R3TA 1IUJA 5DG9A 1BQMB 2I2YA 1T9WA 4G3IA 5HK4A 2AGPA 1S1VB 4DR6F 2ZH2A 2NQPA 2FLOA 3ZFVA 2KYZA 1RK8A 2VOPA 2F8HA 3K57A 4FVMA 4URSA 1LXJA 6AT1B 2LQ5A 3TAMB 2XWYA 1Y5LB 2MZTA 4EZ6A 4ZP7A 3T6BA 3MMCB 1RI7A 4JB8B 2YKMA 1QY7A 3OLBA 4MK9A 3VVUA 4AM3A 5GMDA 1U1QA 2DGSA 2YBVA 1OYDA 3DLKA 1T3OA 3OUYA 1AW0A 3M6UA 4KHMA 2GO4A 3ETMA 2DHXA 1N4LA 3KRNA 2C38A 2HZAA 1XMQJ 2O1WA 1T8EA 2N3OA 3PNIA 2NZ4A 4X64I 2H51B 4WBFA 3J7AG 2R8HA 2GIRA 1GXUA 2NXNA 1WSRA 1FKPA 3A3PB 2A0FB 4DLGA 1IN0A 3M85G 2MGZA 3TZXA 2DY1A 2YPZA 3A8EA 2AZ1A 2IERA 1F5AA 2WZ1A 1UCNA 2QV6A 4FWGA 1FK9B 3HK2A 2NYIA 3TVYA 3Q2TC 2MZJA 2HVHA 5IT4A 4DU7A 2F8MA 3FRZA 2VQEJ 4OJGA 2QYCA 4QU6A 2EWHA 3DMJB 1NB7A 4ID8A 2Y1RI 4OZLA 3PJXA 2DT9A 1DFDA 4F02A 2YTCA 3D0IE 3A13A 2YWWA 1LXNA 1HD0A 4LF9F 3RB3A 2W8LA 2Q3PA 1NAQA 4PXCA 1S77D 4NXMI 1HR0E 5J2NA 1RT1B 1HK7A 1HNXJ 1XMQI 2HGNA 2QSWA 5L1LA 1HQUA 4XAKA 3L7ZB 4NCGA 3GFHA 4P7AA 3HHLA 4FPIA 5HJXA 1F2HA 2J0SD 3TJ9A 4IOCQ 2V2ZA 3B4TA 1I94F 2ZBKB 4CRJA 2QRRA 1C0UB 1NDLA 2J7UA 2X1GA 5J1EA 5C0XC 4OZ5A 1RHRB 1U1LA 3D7SB 1URRA 4Z7CA 1EAYC 3T41A 2IM1A 4RJVA 3C66A 1S48A 3LGNA 4DR2E 3CCJS 1RAFB 4AIMA 3RRGA 4B9VA 1P1TA 1JNZB 4IFYA 3V4IA 2ZOFA 3AB2B 1Z0BA 3F0NA 4OJ1A 4DQRA 4MU0A 3BBCA 3HJFA 8ATCB 1JJHA 2JZ5A 5C24A 3O1LA 4N47A 5KFEA 3G82B 3CJKB 4ZLLA 3GV7B 1P27B 1FT8A 3CDBA 3G9CA 2J8SA 1W26A 4ZHRA 3HHEA 2YWFA 4OZEA 5HROB 4DF8A 2W9AA 2ZE2B 3B4DA 1RWOB 3LWLA 2ZOGA 2WVBA 1WACA 4B3RE 4LRBA 4J9QA 4PU9A 4M94A 1UFKA 4KHPJ 1YJ9S 3MHYA 4CZCA 2H5JB 2AJQA 5G0RA 4YB7A 3CCUS 2EVZA 2PMZD 2CXEA 2QLBB 2JH3A 3JSYA 1FESA 2DK2A 2RU9A 1CJTA 3HPOA 4LSNA 2UUBJ 2VG7B 3QO9A 4JI4F 4FVCA 2YQ1A 1JLEA 4WKYA 1SC6A 2QA1A 2HNYA 3H1CA 1SJ4P 1U1PA 1N0VC 2CNLB 2CDRB 1SV5B 3OJSA 2R7RA 2K1RA 1GX6A 4DFKA 5KFBA 4DQQA 5B0FA 2E1MC 4KFBA 2WONA 4OX8A 1QSSA 2MJUA 1HARA 2C22A 3EMTA 1N56A 5KFOA 1DHMA 4ES2A 3GR1A 2MQ8A 2I5JB 4WFBQ 1IKYA 1U0HA 2FQQB 2LDIA 4JI7E 3SFUA 5L1JA 2KHCA 1P42A 3WC0A 1P8GA 3V6JA 3GIMA 1RBOB 1FDBA 3NNAA 3IR7B 4FYVB 2GJIA 4C8OA 4B3MJ 2IPOB 1BMQB 1RAEB 1RJJA 1U2RA 1T7PA 3ENVA 3CCLS 4KH0B 4YUDA 2OEMA 3TJAA 3NCPA 5ADZA 4ECRA 5KG7A 4X84A 4X62F 1ZZNA 5D3GB 3TX0A 1H7UA 2CQ3A 4NLPA 4XTJA 4P2MA 1Z5BA 4PRVA 5I42A 1S59A 5KOXA 1F3VA 4YHHI 3N01A 4DV3E 1AZSB 1H7WA 1GEHA 3W5YA 3LAKA 5IT9Y 3SYZA 2UXCJ 2MSTA 2VF3A 3ULHA 5JMNA 4AQYJ 1LK5A 1C2PA 1Z5AA 3PZPA 1HBOB 2V68A 3NNHA 2GVDA 2HLUA 1VRTA 3VAGA 1FE4A 4ED8A 4ECXA 5JVHQ 4ED7A 1FDDA 1S4EA 4N8NA 2RAQA 1WTFA 2AHOB 4CLPA 4JI0E 4KGVB 3OQ2A 4H4MA 2RDJA 4GKJJ 4ZPVR 2M4MA 5KG3A 2RMLA 1KTVA 5E2QA 5D6GA 4ZIVA 5D15A 2K7JA 3SSRA 4KYZA 4QCLA 4OI4A 1WKLA 4GKKJ 3UFCX 3M9NB 4IFDA 3M30A 2R2UA 2Y0SD 1DQAA 4X4UA 3DD6A 4YS2A 5EL9A 4I0WA 4DL3A 5LMNJ 4JI1E 2C3MA 2UUCJ 3I0SA 5KFPA 2A6MA 2PFFB 4B3TE 2AE8A 1A9NB 3NGSA 1YJVA 3OXFA 3OSPA 4OX6A 1TKTA 2W2MP 5L9XA 1EQ0A 2HHTA 3M4XA 5IV3A 3EDRB 3JQJA 1WKJA 1TUGB 1S6QB 5HMWA 1E6YB 5A0YB 2YQ3A 1S79A 4ZVEA 4DUZJ 1K44A 4LF7E 1VBXA 2EKYA 4E98A 1VLOA 3T19A 2JEFA 3FEXB 3PRVA 4IYQA 1WG1A 2YNGA 5DDRC 1G3OA 1HR0F 2QSFA 4ED5A 3C14A 3OSNA 3I56S 3CJRA 5H9FJ 4GKKI 3MPWA 1EARA 4ANCA 1B3TA 2FZKB 4DUYI 1D0EA 1R89A 5LMNI 1HI8A 2UUCI 3BGUA 5ETKA 3RGIA 1X5PA 4NWBA 1JMTA 2B5JB 2BDPA 4YEAA 1KEKA 5IWAJ 4K2XA 4ZN3A 3J80U 1KWMA 2H4YB 1NK9A 2DNMA 1S9GB 1K9MT 4ECSA 2GO8A 4DR3I 4Q0BB 5E3PA 2UUAE 1FVSA 1TUVA 3FQLA 1N5VA 4LRDA 2XS5A 2DYAA 4DXLA 4DR2F 2PA8D 3WU5A 3IGVA 3M8ZA 2CQ2A 4LF8J 1L3KA 1L5UA 1WC4A 4U8VA 4MIWA 1BQNA 3CIZA 4OYZA 4ZA1A 1MSWD 2JEAA 2GGPA 5BR8J 1EQMA 1WD6A 4K0KJ 2YNFB 5HQ8A 3D67A 5I3UA 4IR1A 1N34E 1RHMB 4CO2A 3HSZA 1KFSA 3CC2S 4QJVA 4DV7J 1PAUB 2FHMA 1NUEA 3MPYA 3MM6A 2MQLA 3N5BA 1ZM4A 1WC1A 4X66E 3FGVA 2XSFA 1IBKI 1S0NA 4R0JA 4LJMA 2NR0A 3TJ8A 5IWAI 3BGOP 5CD4A 1TL3A 1R0BG 3KLGA 4XIUA 1ZS6A 2DHSA 2DBBA 3LGHA 4NXNI 4DQPA 2QFIA 3RTVA 2DKOB 3KK3B 4DR5F 4F8RA 1XNRE 3F44A 3BF4A 3IWNC 3Q8VA 4ILLA 2LXFA 2V6AA 4ENOA 4WIIA 3DLHA 4XDDA 1FNOA 3SCKE 4X65E 4IZKA 1B7FA 4DX6A 4U9RA 2IMOA 1DURA 3MDFA 1IKVB 5BR8I 2BKOA 4IG0B 2IRYA 2XMAA 4P9SA 3T1HI 3M1VA 1M5VC 5F9LA 4DFJA 4UZBA 2GVZB 5K14B 1LWFA 1DTTA 1JJCB 1VRQC 2C42A 3VCDA 4DCOB 5EN1A 1TP7A 1UZDA 1WC5A 5B09A 2Z2LA 3MMBA 2C39A 3I9V9 1X8DA 2ZC3A 4DV1E 4CM2A 4KKOB 4IRKA 3UD4P 2Q79A 1SBRA 3VGVA 2E1RA 3PKMA 3NS5A 2EKNA 1S1UB 3NMRA 3V81B 3L4BC 2WBMA 1RTIB 1B7YB 4JI7F 2FLPA 3HVTB 1LW2B 2F4VJ 3K8WA 2GMHA 1TQLA 3EZ5A 1UVMA 2DY9A 4JV5I 1LOUA 1VCTA 2VDIA 3QIDA 4NYPA 4J9NA 4MQYA 3KHGA 2CPHA 1J5EJ 2UP1A 1N36I 3OTOJ 5GADU 4FNHA 2VL1A 4L3KA 4P52A 1VQNS 2HG4A 2GHPA 2DXDA 1OWXA 3RG6A 3Q89A 4DSFA 2LJPA 4CIOA 1YZ6A 5CABA 1E3HA 2N4CA 3FVYA 2OIHA 3N0VA 2R8KA 4E8UA 3MCMA 2IBOA 3WX4A 3MMJA 4URLA 1ULRA 4NASA 4USVA 2SXLA 3D28A 3JTNA 3CUNA 4X64E 1RWWB 4EYIB 2R7QA 4DV3F 3RW6A 1RWMB 5HLFB 3M7ND 3M2RB 4RBTA 4C97A 1MMLA 4IDKB 1Z0CA 2DITA 4LF2A 1HD1A 4NLDA 5E3AA 4OX9J 1T9VA 3TEGA 2WB4A 5K20B 2DXEA 1YJUA 3W8PA 4DV4J 4H4OB 2MKYA 2CQPA 4J90A 4HHUA 4OZ2A 2BACA 4JI0F 4MFBA 1R0AB 1FRHA 3UDVA 2V9KA 3ZZOA 1J5EI 2J7WA 4WUDA 5ELWA 1N33F 3KLEA 3ICLA 1S97A 4FBUA 1UEKA 1KVIA 2W9CB 4C9DA 4O3PA 1N32J 3TZYA 1RISA 3R1HA 1SJFA 5KFXA 1SQEA 3HMJG 4NXME 1D9AA 5KFFA 4RNOA 4A46A 1XMQE 2HHHF 2FY8A 3OFFA 5GAHU 4MH8A 3MR2A 3BQ0A 1NKBA 3OJUA 4MAKA 1FWKA 4AL7A 1WHWA 4U3DA 2MKKA 3FBFA 3RUBL 2IRUA 3MEDB 5HMZA 2A2CA 2DNOA 1WF1A 5DNLA 2ATLA 2JEIA 3IS9A 4C8LA 1M1HA 4OX9I 3FZ2A 2RHSB 5DNXA 1JLAB 2EFQA 4LF7F 4DV4I 2KM8C 2XNRA 2ZEJA 4ES1A 3T1YJ 1NHVA 3CW2C 4DV0I 1WF0A 2YNIA 4KO0A 2OGUA 1URNA 3IR6B 5B0DA 2WP8A 2DB1A 3TWZA 5F3ZA 2E5JA 3IXQA 4EYHB 5HP1A 5BYRA 3KLFA 1IR0A 1OYEA 3K58A 2CNOB 3KLHA 3DLBA 2I0XA 1KIJA 2XS7A 3V6DA 2MKJA 1M5OC 1Q79A 2DIVA 4I2QA 4I56A 4Y00A 2A18A 3EGZA 3D6TB 2IYGA 1TR0A 5IQ6A 1IJFB 4LR8A 4P2SA 1W2IA 1EA6A 2J0WA 4CNZA 3TR5A 4RW7A 3ELHA 3U1MA 3A12A 2PD1A 3CE8A 1EETA 2Z5CA 2KDOA 4G1QA 5A8RA 1HQ2A 2F63A 4J9KA 4R1FA 3K5NA 3DLJA 3OD2A 1PILA 5KG0A 3M8WA 2HEKA 2AJ4A 4DSEA 4PKDB 1F9HA 1XR6A 4HLBA 1KS2A 4OO1B 4CH7A 4WE1B 2RKIA 4FF4A 1UAWA 2ZZNA 4LFAF 5D4LA 4RW8A 2D7SA 3ILIA 3ZZZA 4OO1F 4X66F 4P6QA 2Y8YA 3TVZA 4TYAA 4N41A 1QD1A 3I31A 1REGX 3PM9A 2X36A 1IKWA 4RLEA 2X1FA 4GVLA 3DRRB 1SJ1A 4P72A 1MWYA 3BYRA 2MZSA 2D74B 3F73A 2R2RA 3CMQA 1Q8IA 1RT7A 4C11A 4LCGA 2P9CA 1HWLA 2ZM6J 1M90T 3S01A 3HVAA 4OLPA 4MU3A 2W2OP 3R5BA 1XK8A 3W1YC 3M8PB 4NBQA 1ITPA 3UO0A 2AEFA 5A2QC 3VGUA 3BDEA 2R7SA 3MM8A 1QVGR 4I68A 1H2TZ 4IH5A 2DGWA 1FCAA 3UWTA 4DLEA 2C28A 3THVA 2HK2A 2Y0BB 2I8EA 4L3NA 4WP9A 3W65A 2DD8S 3KJNB 3AOAA 1ICEB 1U45A 4O3RA 1NHIA 1B0VA 2OPPB 2AEJA 2BBEA 4UF4A 4DV1F 1WTBA 2UXDJ 4M5DB 1RT4A 5A8WA 4DQIA 1YWXA 3PKYA 3JSBA 2FHKA 1RT2A 2N4DA 3NCRA 3A3NB 2HURA 5ETRA 4X4TA 4YHHE 3DYAB 2NN6A 3DLGB 2E1CA 2PNZB 1UWBA 2ZM6I 2QYGA 2OPRB 1Q8LA 1IR2A 5K36D 3QRRA 3LP2A 2J6SA 3O5TB 3M2UB 5EKWA 1UMJA 2H5IB 4OI1A 2HFUA 1UDOA 2XQCA 3JTOA 4DI6A 1KR4A 3S6EA 3F41A 4FXVA 1WG5A 1YITS 4MK7A 4OYPA 2BA0D 2EFPA 2M88A 4FF3A 3MEEA 2I1RA 4FF2A 1UL3A 2PI5A 5GVQA 3Q2SC 2HVZA 1JKHB 3OTEA 1RCXB 2V4JB 2OKQA 1V3SA 2OEJA 4X64F 2ZH8A 4FS1A 5H1SV 3R5JB 4OQJA 1UW9A 4WZQA 3J7AM 4ETZA 2DGQA 2C3YA 3TEHB 2HS4A 3TAQA 3GFYA 2BW2A 3BPSP 3FCVA 1XNQI 1WHYA 2E7VA 3LAMA 3DGPB 2QMWA 2E5HA 3MI7X 4AQYE 1CS4A 1FWLA 1HWKA 4O3OA 3DM2B 3HO1A 4Q2MA 3R6LB 5KFZA 2MMYA 2XO6A 2RH3A 1U4BA 1R6YA 3RR8A 1GQEA 3KJFB 4QOTA 2VUGA 3NL0A 1D3WA 4HI1A 3HHDA 4NEZA 4LRAA 5ETLA 4NXMF 2DNYA 3EZUA 1UVNA 1IBLI 3BYPA 3ZZPA 2HMIA 1XMQF 4GKKE 1T3NA 3HX9A 1SL0A 1T05B 4J91A 2DRDA 2Y3YA 3TW0A 3PO5A 2OJ3A 4W4MA 4B3OB 2XMKA 2O1PA 3T5JA 2B51A 4DUYE 4WK3A 4YP3A 5LMNE 2OEKA 2UUCE 5J2PA 3JAMC 3KXDA 4FW9A 4PXDA 3BBBA 1FJ7A 2Z30B 2XSJB 4OHYA 3C16A 3NOCA 2YWGA 4HVZA 2VKRA 5HVGA 4X4RA 4A8MP 1WOPA 5FLXU 3VAIA 2UXBI 1JWWA 4MIBA 2COLA 2VH7A 4HHHA 2VQEF 4OYBA 2LLZA 4CYUB 3A1YG 1NDKA 4B9LA 3H5YA 1TL1B 4DV2I 1DQ9A 4K59A 5T7LA 4UQTA 2WBRA 1U8SA 4NOHA 4RWXA 4F36A 4DR6J 4IZJD 3UR3C 5EX0A 3C6TA 1ZTTA 5AE3A 2MKIA 3M85D 4WFAQ 2V0NA 3C6UA 3V5RA 5J2MA 3PDNA 4LMZA 4GC6A 1PCAA 1V3ZA 3RW7A 5DGAA 4KJIA 2G13A 3W9JA 1RBLA 1CULB 4DS5A 4O44A 3T5LA 1VQOS 1JK9B 1IBKE 1T03A 1N5TA 4DL7A 3BJYA 1OPZA 1KQFB 5IWAE 2VBWA 5F3TA 2QEXS 3VGTA 3JYTA 4NXNE 4RUCA 3MD3A 2HW3A 3WQPA 2Q6CA 4EO8A 2HBRB 4KSEB 2YKMB 4WJBA 2BOPA 4NYZA 2GZOA 1LV5A 2UVUA 3TZZA 2AYGA 2R4FA 4LF8E 3DLKB 4DG1A 3OUYB 2BJ7A 3GPAA 2C38B 2ZJQQ 2JVRA 3HD2A 1QAYA 2MXYA 1M1GA 3C19A 2WHOA 1HBNA 4YMEA 1NPRA 1U1KA 5BR8E 2GQ0A 3ZZTA 2MB0B 4K0KE 4OJHA 1G6BA 3OL6A 2R3VA 3DRXA 1FKPB 3H59A 1Z5CA 1C1CA 3NXZA 4C8ZA 4DV7E 2MZRA 4IFDE 2MGZB 1TL7A 2HRUA 4LF9J 1DLOB 3BEGB 4KR0B 1RWXB 1VC6A 2LVWA 1U6FA 3W62A 2V34A 3K89A 4FPRA 3IN5A 4DV5J 5EWFA 3KLVA 3GP9A 4OYIA 2FHOB 2I38A 5C25A 2PEBA 2M3DA 4HI2A 4DR4J 5LMUJ 1UDNA 4QZVB 2BQRA 3TOQA 3H2UB 2MLZA 5J2NB 4D3HA 5IS2A 3G2XA 4JV5E 5A2QY 4DV6I 2HQCA 2UUBF 3W64A 4DSLA 3SCIE 3NMAA 2CKWA 3CGIA 4LFBJ 3ONQA 3BDPA 3ZZ0A 4M8LA 1HQUB 4JUZA 1N36E 3QT6A 4NCGB 3HHLB 1PBAA 4N5SA 2Z8QA 5AE1A 2MPUA 4NLUA 1VLYA 3VGSA 3W66A 1RT3A 1Y5NB 5AXMA 2YKNA 4OO1D 5HI7A 4KGZB 2V8PA 4BDPA 1C4CA 5J1EB 2ZUAA 2D3ZA 1TKZA 2OPSA 4YHHF 4PWWA 2AT1B 2OFHX 2CUYA 4YDDB 3FRYA 4PRFA 1O0PA 2V4QA 4ZIWA 4MU1A 1LWXA 2K3IA 4WIQA 2JDJA 4I6AA 1YRTA 1V9OA 1R8CA 3HHKA 4IFYB 3KYLA 2F4VE 3V4IB 1NSPA 1DBDA 1F2GA 4LCFA 1WDDA 3OL8A 4IQXA 3HT0A 1B70B 3GIKA 4LPFA 4LFBI 1Z0VA 7FDRA 4ECUA 1J5EE 5C7PA 1H74A 4Z37A 3Q8UA 4ZKAA 2BR2A 4CLWA 2DJWA 4H4KC 2O1VA 2M9KA 2J7KA 4BC7A 4GMKA 1S9EA 3R2CJ 2HNDA 2XZTB 1KHWA 3HJCA 2DNHA 5KT5A 4JYAI 4NRTA 4QNJA 3QAUA 3DOKB 1U6ZA 1LNQA 3PR5B 2UXCF 2G2YA 4AQYF 5G0RB 2WCXA 4X4SA 2IBKA 2J0QD 2EEYA 4CLYA 2VJUA 1CJTB 4OX9E 2B9YA 2CNNB 2X1BA 4LSNB 4AIDA 3QO9B 4DV4E 2BA1G 4LOMA 3L3CA 1JLEB 4P71A 2VG5B 4NLXA 2HNYB 3MUVP 2JE6A 5KAKA 1R7IA 3J7Z5 2NS1B 3UI3A 4DV0E 4WFXA 5F8HA 3D3BJ 3BSCA 2CQBA 3LPYA 2GQQA 3EVWA 4BWMA 2K1RB 3SIPB 4QIGA 4MDTA 3A4TA 3HI9A 4C8NA 5D4OA 3WHIA 4GKKF 4KFBB 1E3PA 2WONB 2ILYA 4ALZA 3NGTA 4A8OA 2KT2A 3BH7B 4DUYF 1M5HA 5LMNF 1K8AT 4J9UE 2UUCF 2HQDA 3LP1A 1ZZFA 1XTZA 1PSDA 1IKYB 2W4CA 1T9YA 1U0HB 4Q43A 2Y1LB 4OJ3A 1VQMS 3O44A 4RR5A 1YTYA 3AODA 2DCLA 3UCUP 2V63A 2BVZA 2C1EB 4JI6J 1IKXA 4F4KA 3N6LA 2HYIB 3I4PA 3LF0A 4DUZF 1RT5A 2KJVA 4PG5A 4Y2IA 2HZVA 5E0OA 3P8BB 1VC5A 1VMBA 4C3MA 4WXOA 1K1QA 2IESA 3L7OA 3MPVA 3EXYA 1EHWA 2KHDA 3KHHA 2VASA 2ZNYA 1L3SA 4MU4A 3RBDA 4A8KA 2R42A 2HNZA 5I42B 4U95A 4EUVA 4E2FB 3P96A 1WDTA 3EVOA 1X9SA 5J2QA 1IXKA 4Y28C 4UUXA 5B08A 2DNGA 4TVAB 3NRBA 3CPWR 2J6TA 3H25A 2CJBA 3MAAA 2W25A 3R6GB 1VK8A 2F65A 2GVDB 3C15A 2W7PA 5IWAF 4AT1B 2XEXA 1VRTB 1OSDA 4ECZA 5DRKA 5L39A 4NXNF 1EB0A 4JI6I 3SQGA 2DR5A 1Y4UA 2NXCA 1NH7A 1OYRA 2H65B 3G8TA 2NSBA 2GJ2A 9ATCB 3R9LA 1WG4A 3BQ1A 1HLWA 4H4MB 1BWVA 1TV6A 4BA1A 4LF8F 4IG3A 2BJ8A 2QE5A 1F9EB 2GC8A 5F8NA 2ZBIA 4IFDB 5M2RA 3M30B 2HQIA 3I9ZA 2M2BA 5BR8F 4K0KF 3FSIA 1OS5A 5KFCA 1KNZA 5CZVA 4TLRA 4TNOA 3I0SB 3MD1A 2N7YA 1ZAVA 4DV7F 2Z2MA 4IFDF 4IFVA 5H9FK 1S1XA 1TKTB 1HR0J 3HKZD 1NCLA 2PEHA 1Q16B 4WP3A 3R5CA 4WUBA 1FFWB 4LFCI 3Q0AA 2HHWA 2BJDA 1NDPA 3FNNA 4JI5J 1R6MA 1O51A 3SCLE 3BGFA 5L3JA 2W4DA 2ZM6E 1HFEL 2IJNA 3ZM7A 3ZC4A 2YNGB 4YN3B 3CULA 3R5AA 1FJGI 2YKPA 3C14B 5AXLA 3QIPA 2CPXA 3WX8A 3PEJA 3K8VA 4JBCA 4LSLA 3J7AN 5HAOA 1PC5A 1XN9A 2F9DA 2QTWA 3D1QA 1K47A 5IM0B 4CLLA 5BXIA 1JXEA 4GRSA 3P3EA 3MMAA 2CJYB 3FSYA 2EBGA 3HVWA 4RU9A 1I5OB 2Y1IA 3KNAA 3PEHA 1D1UA 4OV1A 3EGWB 2OHDA 5AXNA 1HBMA 1SH2A 3C3LA 2QA4G 1RB0A 2NREA 3JSMA 2H3EB 2APOA 4NA2A 2D3O1 3O6QA 4JI5I 1XNQE 1SC4B 2CG9A 3CJ3A 1ZAXA 2F4VF 1Y5YA 3ZTOA 2MZQA 3GLLA 3QJLA 2HFSA 5GMEA 1RTDA 2J5AA 1BQNB 5D4PA 1Y9OA 3FK4A 5KT2A 1KFDA 1WI6A 2JEAB 2GGPB 4R8UA 2N7CA 4B3RJ 4C4WA 5I3UB 1GT8A 4Y3CA 4ZP6A 1EI1A 3KDOA 1J5EF 5LJ5Y 3OTOF 4OIXA 4JI2J 2W9BA 2O3DA 2V67A 5DG7A 2AGOA 2KI2A 3MM6B 1RAOA 5FWKA 5HQMA 2QG9B 4CO5A 3POTA 1YX2A 1M0SA 3DI6A 1IBLE 4N8OA 2ZHBA 1ELOA 1TL3B 3KLGB 5C2CA 2RSQA 4PUOA 1IBMI 2A6OA 4WTYA 2L3MA 3GR0A 4CQ1A 4AD6A 5D0EA 3MPUB 3GTYX 1JLFA 1KRPA 1LEOA 3H7HB 3KG0A 1ZETA 4CLSA 3NGDA 5GAGU 1HNZI 4TY8A 3DU6A 1UVIA 2JC1A 2LMIA 1MU2A 2ACMA 3MURP 2O1TA 4OX9F 2JLFA 4JV1A 3DOLA 2MQNA 1PG5B 4DPUA 4DV4F 4IZKB 2UZAA 3PX6A 1TK5A 1TAUA 4DFMA 4UUWA 4YFUA 2UXBE 1MMNA 3HHLC 1UW4A 1S57A 1GFWB 3NGUA 3M1VB 3DDIA 2LA6A 4G6VB 3QSYB 5DM6Q 2RQCA 4DV2E 1LWFB 1DTTB 4JI2I 2VDHA 3N4WA 4JI7J 4OYAA 1QM9A 3BR9A 2VBZA 3CD6S 3MMBB 4V19J 2C39B 3GIRA 1VC0A 2G2OA 4PWDA 3OVAA 4EK2A 1Y00A 1IWGA 1EZZB 3QGPA 5JEAD 2OAUA 5KFMA 4IOBA 4DF4A 3PW7A 3B54A 1NRKA 2DGVA 4CP5A 3WBZA 3D3CJ 3D9BA 2P6SA 2VBXA 4LBPA 3U27A 2FGCA 3VQTA 1O8BA 2BOAA 1U1RA 3MAQA 3Q22A 5KFAA 4YY3I 1Y5IB 2NN6E 4CH0S 1ZM9A 5DG8A 3RRHA 1H2UX 4PAAA 4J9VA 2BKNA 2YH0A 3SI8A 3T6JA 5HBMA 4IQMA 3CJ2A 3OW2R 5A2QQ 2BANA 4FBTA 3CC7S 2R7XA 3HSGA 5MAOA 4ETXA 2V2VA 2XMWA 2U2FA 3ISND 5DJBA 1TAQA 3NS6A 1SIWB 2XMVA 3GV8B 4JI0J 3OHAA 1N48A 3CVKA 3P06A 1RA7A 4ZVHA 2X1AA 1USUA 3UCZP 2KXFA 4RUAA 3W63A 2M8DB 3PJWA 1I1GA 5EX3A 1TL5A 4ECWA 1L3TA 4ZCKA 2CZ4A 2IIHA 2XHWA 2GAGC 5FIIA 4RNFA 2HSEB 1S5ZA 4WU2A 4KH1B 2H4WB 3TX8A 4YR3A 1S12A 2QC3A 3W60A 4JI1J 4OI6A 4LREA 4NI2A 3OFHA 4B3TJ 4Q44A 4MFBB 2DPJA 3CJQA 2QL9B 2WRMA 4MYTA 3NZKA 3KLEB 2JL9A 2UUWA 3KJQB 3THPA 1KQSR 2CPYA 4W98A 4K4ZA 4UOCA 1OJ4A 3L09A 4LF4J 1AYEA 4YB5A 2YNHA 1J5OA 1SC1B 1KLNA 5ETSA 2VA2A 4DV6E 1MMDA 4LF7J 1E6VA 2PGCA 3AXMA 4ID5A 1RWVB 1JLCA 2RF2A 2ZUGA 2BZ2A 2VFSA 2NZCA 2FB0A 3GLJA 1KN6A 1YHCA 2L9NA 1XHKA 1XJWB 4NLVA 2KG1A 2CJAA 4P7TA 1JLGA 4ED4A
chains in the Genus database with same CATH topology
4HACA 5L3JA 1H7SA 1D6TA 2ZM6E 3T1YI 2V2QA 4X62E 3ZZ0A 3Q6NA 3K17A 3ZKBA 3ZM7A 1Y6ZA 1U2RA 1N36E 4LFAE 3QT6A 1ZM3A 1ZM2A 5IT9C 4JI7I 1HNZE 1FJGI 4DR7E 3B78A 4YHHE 4USMA 4JV5I 2Z5BB 4DR6E 4LF4E 4DR5E 2ZM6I 4X62I 4RPFA 1H7UA 4XTJA 3LPSA 3HULA 1NZ0A 1K47A 2V8PA 1N36I 1Z5BA 4LFAI 2BV3A 4PRVA 4P52A 4DR7I 2LJPA 5LMUE 4YHHI 4DR6I 1S16A 4LF4I 2HFUA 4DV3E 4DR5I 2A2DA 4DPWA 1WUUA 3PYFA 4JI5E 2VF3A 4URLA 4DR1E 1Z5AA 4LF8I 4LFBE 4X64E 1XMOE 1FKAE 2HKJA 4LF6E 1MX0A 2F4VE 5GMDA 4DV3I 3CWVA 4JI5I 1S4EA 1Z0CA 4K0KI 4DR1I 1XNQE 4KHPE 2O1WA 4JI0E 4DR3E 4LFBI 1RREA 4X64I 2CG9A 2NPFA 1XMOI 1Z0VA 3J7AG 2Z5CB 3J7AM 1J5EE 4DPXA 4DV7I 4LF6I 1H74A 4N3OA 1DARA 2HFSA 2HK3A 1KTVA 5GMEA 3ZKDA 4JYAE 2E5LE 1B62A 4EMDA 2UUBE 4LF5E 1XNQI 4KHPI 4JI8E 2O1VA 4JI0I 2J7KA 1EI1A 4AQYE 1J5EI 3HJCA 4WUDA 1FWLA 3K1JA 3J81C 4JI1E 4JYAI 1UEKA 4FWGA 4USKA 5FWKA 3QT5A 2E5LI 1Z0EA 4B3TE 4DV1I 2UUBI 4LF5I 2BM1A 4MYUA 4JI8I 4DU7A 4NXME 4LF9E 1IBLE 4Z7YA 1ELOA 1Z0GA 2DEJA 1Z59A 2O1UA 4JI3E 1IBMI 4WUCA 1XMQE 4ZVIA 4JI1I 4DV5E 4OX9E 4B3TI 2Q2EB 4DV4E 4NXMI 3PYDA 4LF9I 1HR0E 1IBLI 4LF7E 1FWKA 2HKEA 1HK7A 1HNZI 1BKNA 4GKKE 4JI3I 4UT4A 2A2CA 1XMQI 4DR4E 2O1TA 4DV0E 1I94E 2CGEA 4DV5I 4OX9I 4DPUA 4IZKB 4JI2E 4DUYE 5LMNE 4DV4I 4P7AA 1HR0I 2UUCE 3V2UC 3JAMC 4LF7I 2UXBE 4FW9A 1PVGA 2Z5BA 2OI2A 2UXDE 1H73A 1H72C 4GKKI 3B8HA 4B3ME 2V2ZA 1NHHA 4DR4I 2ZBKB 5LMUI 4DV0I 1I94I 4DV2E 1QZRA 5IT9Q 4JI2I 4I3HA 4DUYI 5LMNI 3T1HE 2UUCI 2UXBI 1FI4A 4Z7CA 2UXDI 3M6AA 4B3MI 2GS8A 1N0UA 4PRXA 3OTOE 4DV2I 2F4VI 3WU4A 3WU3A 4IZJB 1N33E 3PYGA 1NHJA 3LNUA 4YY3E 4DR2E 1Z0WA 1KIJA 3B82A 4DPTA 4HY1A 4HACB 5FLXQ 4DR3I 3PYEA 4IZJD 2IOQA 2UUAE 2UXCE 3PRYA 3OTOI 4M1KA 1Z0BA 3F0NA 3D4JA 4DXLA 1EA6A 3QT7A 3WU5A 1N33I 2Z5EA 3V5RA 1USVA 3WU6A 4HXZA 3J80Q 4YY3I 2HHHE 2Z5CA 1ZM9A 1FNMA 1Y4SA 2UUAI 1MU5A 2UXCI 4DPYA 4AQYI 4R1FA 5A2QQ 2R42A 1IBKE 1PKPA 1B63A 1N34E 2HHHI 2ZITA 5IWAE 2AJ4A 4GKJE 2V2VA 2VQFE 4JG4A 2EFGA 4JI6E 1ZM4A 4NXNE 1ZXNA 4X66E 4B3RE 1IBKI 4PU9A 1N34I 1RR9A 2BM0A 2XEXA 5IWAI 4JI4E 3P06A 4GKJI 4UTGA 2VQFI 4B3SE 1USUA 3J81Q 4JI6I 3QT8A 4FWHA 1N32E 4LF8E 4NXNI 1Y4UA 4X66I 4B3RI 1PIEA 4DU8A 2VQEE 1KVKA 2WW4A 2PNLA 5FLXC 1XNRE 2X36A 4JI4I 3K85A 5BR8E 2GQ0A 3ZZTA 4B3SI 1A6FA 1HNWE 4K0KE 2IOPA 1N32I 1N0VC 3J80C 5LL6R 2R3VA 3Q6MA 1Z5CA 4X65E 4IZKA 4DV7E 4DUZE 2VQEI 2PNMA 1MG7A 1XNRI 2UU9E 4FWDA 1HNXE 4MYTA 5BR8I 1KKHA 3GONA 1HNWI 3T1HI 5A2QC 3Q1QA 2X7IA 1OJ4A 1Z0TA 2V34A 4FN5A 4X65I 3H4LA 4LFCE 1VISA 4DUZI 3JAMQ 1ZXMA 2UU9I 4DV6E 4KQVA 1HNXI 3ZZUA 2HK2A 4DR2I 3LTOA 4HYMA 4DV1E 3T1YE 4WUBA 2DEIA 1XHKA 2E1RA 4IZJA 2CZ9A 4JI7E 4LFCI 1FJGE 1IBME 1NHIA 4ED4A 4JV5E 4DV6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAC A;  5L3J A;  1H7S A;  1D6T A;  2ZM6 E;  3T1Y I;  2V2Q A;  4X62 E;  3ZZ0 A;  3K17 A;  3ZKB A;  3ZM7 A;  1U2R A;  1N36 E;  4LFA E;  3QT6 A;  1ZM3 A;  1ZM2 A;  5IT9 C;  4JI7 I;  1HNZ E;  1FJG I;  4DR7 E;  3B78 A;  4YHH E;  4USM A;  4JV5 I;  4DR6 E;  4LF4 E;  4DR5 E;  2ZM6 I;  4X62 I;  4RPF A;  1H7U A;  4XTJ A;  3LPS A;  3HUL A;  1NZ0 A;  1K47 A;  2V8P A;  1N36 I;  1Z5B A;  4LFA I;  2BV3 A;  4PRV A;  4P52 A;  4DR7 I;  2LJP A;  5LMU E;  4YHH I;  4DR6 I;  1S16 A;  4LF4 I;  2HFU A;  4DV3 E;  4DR5 I;  2A2D A;  4DPW A;  1WUU A;  3PYF A;  4JI5 E;  2VF3 A;  4URL A;  4DR1 E;  1Z5A A;  4LF8 I;  4LFB E;  4X64 E;  1XMO E;  1FKA E;  2HKJ A;  4LF6 E;  1MX0 A;  2F4V E;  5GMD A;  4DV3 I;  3CWV A;  4JI5 I;  1S4E A;  1Z0C A;  4K0K I;  4DR1 I;  1XNQ E;  4KHP E;  4JI0 E;  4DR3 E;  4LFB I;  1RRE A;  4X64 I;  2NPF A;  1XMO I;  1Z0V A;  3J7A G;  3J7A M;  1J5E E;  4DPX A;  4DV7 I;  4LF6 I;  1H74 A;  1DAR A;  2HFS A;  2HK3 A;  1KTV A;  5GME A;  3ZKD A;  4JYA E;  2E5L E;  1B62 A;  4EMD A;  2UUB E;  4LF5 E;  1XNQ I;  4KHP I;  4JI8 E;  4JI0 I;  2J7K A;  1EI1 A;  4AQY E;  1J5E I;  4WUD A;  1FWL A;  3K1J A;  3J81 C;  4JI1 E;  4JYA I;  1UEK A;  4FWG A;  4USK A;  3QT5 A;  2E5L I;  1Z0E A;  4B3T E;  4DV1 I;  2UUB I;  4LF5 I;  2BM1 A;  4MYU A;  4JI8 I;  4DU7 A;  4NXM E;  4LF9 E;  1IBL E;  4Z7Y A;  1ELO A;  1Z0G A;  2DEJ A;  1Z59 A;  4JI3 E;  1IBM I;  4WUC A;  1XMQ E;  4ZVI A;  4JI1 I;  4DV5 E;  4OX9 E;  4B3T I;  2Q2E B;  4DV4 E;  4NXM I;  3PYD A;  4LF9 I;  1HR0 E;  1IBL I;  4LF7 E;  1FWK A;  2HKE A;  1HNZ I;  1BKN A;  4GKK E;  4JI3 I;  4UT4 A;  2A2C A;  1XMQ I;  4DR4 E;  4DV0 E;  1I94 E;  4DV5 I;  4OX9 I;  4DPU A;  4JI2 E;  4DUY E;  5LMN E;  4DV4 I;  4P7A A;  1HR0 I;  2UUC E;  3V2U C;  3JAM C;  4LF7 I;  2UXB E;  4FW9 A;  1PVG A;  2OI2 A;  2UXD E;  1H73 A;  1H72 C;  4GKK I;  3B8H A;  4B3M E;  2V2Z A;  1NHH A;  4DR4 I;  2ZBK B;  5LMU I;  4DV0 I;  1I94 I;  4DV2 E;  1QZR A;  5IT9 Q;  4JI2 I;  4I3H A;  4DUY I;  5LMN I;  3T1H E;  2UUC I;  2UXB I;  1FI4 A;  4Z7C A;  2UXD I;  3M6A A;  4B3M I;  2GS8 A;  1N0U A;  4PRX A;  3OTO E;  4DV2 I;  2F4V I;  3WU4 A;  3WU3 A;  1N33 E;  3PYG A;  1NHJ A;  3LNU A;  4YY3 E;  4DR2 E;  1Z0W A;  1KIJ A;  3B82 A;  4DPT A;  4HY1 A;  4HAC B;  5FLX Q;  4DR3 I;  3PYE A;  2UUA E;  2UXC E;  3OTO I;  4M1K A;  1Z0B A;  3F0N A;  3D4J A;  4DXL A;  1EA6 A;  3QT7 A;  3WU5 A;  1N33 I;  3V5R A;  3WU6 A;  4HXZ A;  3J80 Q;  4YY3 I;  2HHH E;  1ZM9 A;  1FNM A;  2UUA I;  1MU5 A;  2UXC I;  4DPY A;  4AQY I;  4R1F A;  5A2Q Q;  2R42 A;  1IBK E;  1PKP A;  1B63 A;  1N34 E;  2HHH I;  2ZIT A;  5IWA E;  2AJ4 A;  4GKJ E;  2V2V A;  2VQF E;  4JG4 A;  2EFG A;  4JI6 E;  1ZM4 A;  4NXN E;  1ZXN A;  4X66 E;  4B3R E;  1IBK I;  4PU9 A;  1N34 I;  1RR9 A;  2BM0 A;  2XEX A;  5IWA I;  4JI4 E;  4GKJ I;  4UTG A;  2VQF I;  4B3S E;  3J81 Q;  4JI6 I;  3QT8 A;  4FWH A;  1N32 E;  4LF8 E;  4NXN I;  4X66 I;  4B3R I;  1PIE A;  4DU8 A;  2VQE E;  1KVK A;  2WW4 A;  1XNR E;  5FLX C;  2X36 A;  4JI4 I;  5BR8 E;  3ZZT A;  4B3S I;  1A6F A;  1HNW E;  4K0K E;  1N32 I;  1N0V C;  3J80 C;  5LL6 R;  2R3V A;  1Z5C A;  4X65 E;  4DV7 E;  4DUZ E;  2VQE I;  1MG7 A;  1XNR I;  2UU9 E;  4FWD A;  1HNX E;  4MYT A;  5BR8 I;  1KKH A;  3GON A;  1HNW I;  3T1H I;  5A2Q C;  3Q1Q A;  2X7I A;  1OJ4 A;  1Z0T A;  2V34 A;  4FN5 A;  4X65 I;  3H4L A;  4LFC E;  1VIS A;  4DUZ I;  3JAM Q;  1ZXM A;  2UU9 I;  4DV6 E;  4KQV A;  1HNX I;  3ZZU A;  2HK2 A;  4DR2 I;  3LTO A;  4HYM A;  4DV1 E;  3T1Y E;  4WUB A;  2DEI A;  1XHK A;  2E1R A;  2CZ9 A;  4JI7 E;  4LFC I;  1FJG E;  1IBM E;  1NHI A;  4ED4 A;  4JV5 E;  4DV6 I; 
#chains in the Genus database with same CATH topology
 3W2V A;  4HYK A;  2OTJ S;  4GC7 A;  1HWI A;  3JTP A;  5CD4 H;  3IS9 B;  2BQ3 A;  3RAX A;  2RD5 C;  4LF6 J;  4NLR A;  2CFX A;  3VZI A;  2OSR A;  4QR0 A;  3WC2 A;  1T94 A;  2CZV C;  5HAT A;  2EPI A;  1S6O A;  1X9M A;  2ZM6 F;  5HMY A;  4ZDN A;  5L1I A;  3DNC A;  2YNI B;  4KO0 B;  2HBZ B;  5LMU E;  2HWI A;  2FVS A;  2WP8 B;  2QIF A;  4LF4 I;  2MKC A;  7AT1 B;  2A2D A;  5HP1 B;  4QQB A;  4OMF G;  3KLF B;  2UUA J;  5F8M A;  3KLH B;  4O4G A;  4W92 B;  4LFB E;  2KVI A;  4JV2 A;  2WOM A;  3V6D B;  4E0D A;  1RWK B;  2DGU A;  1R6L A;  1MX0 A;  2OLW A;  4I2Q B;  2ALZ A;  1WOS A;  2LFV A;  4CM0 A;  5AE2 A;  4QIE A;  2PE8 A;  2JNJ A;  2KRB A;  4WZM A;  1X9W A;  4RW7 B;  1QUP A;  1VK3 A;  1N34 J;  1EET B;  2Z5C B;  4DPX A;  4LF6 I;  4JYA E;  4G1Q B;  1QLN A;  5A8R B;  2RS2 A;  4NCA A;  3JQM A;  1XNQ F;  4EMD A;  3KMS A;  5KT4 A;  2DH7 A;  2QJ3 A;  1NK7 A;  3S7R A;  4J9O A;  2J0X A;  3DDK A;  5LM7 E;  3J81 C;  2RUG A;  4TLQ A;  2K3K A;  1CBK A;  2C2E A;  5H9E J;  2BM1 A;  2ASJ A;  2FPH X;  2LXU A;  2RKI B;  1XNR J;  1Z0G A;  4RW8 B;  4ECV A;  4YOE A;  1D8Z A;  3Q86 A;  1VJQ A;  2OPQ A;  3SQO P;  1VI7 A;  4HH0 A;  3GCW P;  2B4U A;  4X65 J;  5LSO A;  3C8Y A;  4U8Y A;  3OVB A;  3UW1 A;  3ZNJ 1;  3LWM A;  1IKW B;  5B0B A;  1VHF A;  1JJ2 R;  4H54 A;  4USI A;  1QSY A;  2AGQ A;  4JP8 A;  1RT7 B;  4C11 B;  3GJQ B;  5KFG A;  4QPT A;  2CPZ A;  4L72 B;  3TNV A;  2GQ2 A;  3HHN B;  1SQG A;  2FVC A;  2OI2 A;  1H73 A;  3K5M A;  3X3U A;  5GAE I;  1QAX A;  4F7V A;  5KFY A;  4RUH A;  3MM8 B;  2C2K B;  3MM9 A;  4F0K A;  2LQ9 A;  2O67 A;  4WU3 A;  2UXB F;  3NBP A;  5KFK A;  1QTM A;  4HR2 A;  2W8K A;  1FI4 A;  3BO3 A;  2HHP A;  3M6A A;  1YJW S;  4I2P A;  4BS2 A;  1YLX A;  2E7W A;  2NLW A;  5KG1 A;  3WU4 A;  3J7A 1;  1NHJ A;  1TTH B;  2R7O A;  2M70 A;  2ADC A;  1RT4 B;  5A8W B;  3TA2 A;  5F8J A;  1RT2 B;  3D4J A;  4K4V A;  2YWE A;  5I3Q A;  2NN6 B;  3HFK A;  1UWB B;  4J9M A;  1R8P A;  2PO0 A;  4DPY A;  3IFE A;  3LP2 B;  1Y7P A;  1Q4R A;  2B43 A;  2ZH5 A;  1SL1 A;  4ILM A;  2NN6 F;  4X64 J;  4QU7 A;  3KFW X;  4Q5V A;  2ROE A;  3CCV S;  4JI6 E;  1NKE A;  1GK8 A;  1MWQ A;  2YPY A;  3OR2 A;  5IT9 U;  2R2S A;  3MEE B;  3T5K A;  3TVK A;  2P9G A;  4N7T A;  3D54 A;  3UN5 A;  4OZJ A;  1SKS A;  1UEV A;  4URQ U;  3IRW P;  4TN2 A;  2ERR A;  5KFQ A;  4G1I A;  4Y0F A;  2ZBP A;  4F4X A;  2C2Z B;  1RTJ A;  3G6X A;  3K7R A;  1X5S A;  2XMJ A;  4LRF A;  4ICL A;  4OYO A;  4NXM J;  1CS4 B;  2CQ4 A;  4KGK A;  2BMB A;  1D9D A;  3VAL A;  1C0T A;  1OY6 A;  3CD0 A;  4ZOS A;  5CXT A;  5KT7 A;  4LFC E;  1NH8 A;  3ZZY A;  1K1S A;  2W2P P;  4UW2 A;  4FZV A;  2AYM A;  1U02 A;  4AXI A;  1QTN B;  3MR3 A;  4HYM A;  4ZN1 A;  2C2R A;  1KSP A;  4HDH A;  2B56 A;  2KXN B;  2VES A;  3N9U C;  4MKA A;  1FJG E;  1SQF A;  2B8Q A;  1HNI A;  1WEZ A;  2HMI B;  2R8J A;  2GV1 A;  1SKU B;  5GAD I;  2XLI A;  3NEK A;  3M32 A;  1APS A;  5F0W A;  3UN3 A;  5A6W A;  1LWE A;  2E29 A;  3DHW C;  5J2P B;  4ZCL A;  1JXL A;  1QAI A;  3V4M A;  1GMW D;  3MAH A;  2D1C A;  4OL8 A;  2RDD A;  2IM0 A;  2PO1 B;  1NZ0 A;  3C16 B;  1NSQ A;  5KFT A;  3PY8 A;  5FDL A;  3W9H A;  2MQP A;  3DHX A;  4DV5 F;  4LF5 J;  4U96 A;  5C0X D;  1PC4 A;  1JLQ A;  4WKR A;  4LBI A;  4JI5 E;  1HWU A;  5DZ7 A;  4RW6 A;  5K9F A;  3CCR S;  4XK8 C;  3W5Z A;  2DIS A;  1JX4 A;  4DR4 F;  2OML A;  5T7L B;  5LMU F;  3BKF A;  2VOO A;  1RAG B;  2HKJ A;  5D4N A;  2XYG B;  3DN9 A;  3PVX A;  3OHB A;  3M8Q A;  3C6T B;  2V69 A;  3I0R A;  4PQU A;  3BQ2 A;  2J76 E;  3KTQ A;  3C6U B;  4LFB F;  5DDP C;  5J2M B;  2QFJ A;  2DO0 A;  4ZVS B;  3R2D J;  1D9F A;  2BRL A;  2PMH A;  3JQK A;  2UV8 A;  3ZKD A;  1VQY A;  4OYW A;  2JX2 A;  2BR0 A;  3QPI A;  4O44 B;  4F0M A;  1XR7 A;  1PKU A;  1T03 B;  4DN0 A;  2FJV A;  2FJW A;  2RIJ A;  3GQC A;  4O23 A;  3JYT B;  5GAH I;  3CWJ A;  2E5L I;  1V5V A;  1Z0E A;  3J81 j;  5F0U A;  4LF5 I;  1NXI A;  4F3O A;  3H5U A;  2ZBR A;  3EDQ B;  1FTC A;  2HIQ A;  3D6H B;  5I3P A;  3CDU A;  1V5I B;  4DG1 B;  2VU5 A;  2YH1 A;  4TYB A;  3U1Y A;  4ED0 A;  3MCS A;  1UWA A;  3EGV A;  5DLG A;  1HBN B;  4JV0 A;  2PDA A;  1O5J A;  1UKU A;  2GIF A;  2YX7 A;  5EUH A;  1C1C B;  2MZ1 A;  3VAH A;  1SC3 B;  4JI2 E;  3VAF A;  4NA3 A;  4OZ3 A;  1WEX A;  1TL7 B;  5K36 A;  3KK2 A;  2K2P A;  4O4R A;  1UDQ A;  3NAI A;  4X4P A;  5M2U A;  1YJ7 A;  4CCH A;  4OHV A;  2FJX A;  1HWJ A;  4DL5 A;  4NLG A;  4MJK A;  4V1A k;  4ZVQ B;  1VQ5 S;  4ZLP A;  2XMT A;  2B3T B;  5J1N A;  2QLJ B;  2HVI A;  1VQS A;  3SEO A;  4F4W A;  1CJK A;  5C25 B;  2FVR A;  4PXB A;  1JLB A;  1LW0 A;  3W2W A;  3QWP A;  4MT1 A;  1U7L A;  2BE7 D;  4F4Z A;  4NLY A;  3KK1 A;  4YY3 E;  1YH8 A;  2Z56 B;  1LKZ A;  2FVP A;  3B82 A;  2FC8 A;  4YHH J;  3Q23 A;  1J27 A;  2HVE A;  2HFO A;  4DHV A;  4L76 A;  1ARO P;  3N79 A;  5BYS A;  1VQ9 S;  1TFY A;  3QT7 A;  3QGG A;  3GYG A;  3O3L A;  1AT1 B;  2CG4 A;  3ILL A;  4BLG A;  5IOL A;  1RT3 B;  4A47 A;  3KHR A;  2YKN B;  4UZC A;  2EC0 A;  4KV8 A;  2FGO A;  2Q6B A;  1TKZ B;  4HT5 A;  2OPS B;  3M8Y A;  1FXR A;  1R31 A;  2IYI A;  1B64 A;  2XCA A;  3CTR A;  2W4P A;  5AJ3 J;  3KLI A;  4C3K A;  5EHH A;  2KM8 B;  1ZXN A;  2BA1 D;  4ZVT B;  2XMU A;  1RQ0 A;  3HSJ A;  2EK1 A;  2BA9 A;  1RTI A;  4XO0 A;  2IY5 B;  1VBK A;  4DOZ A;  4ZP9 A;  2XY7 A;  1AFI A;  4JI6 F;  1XC9 A;  5IC4 B;  1FNX H;  5IC6 B;  4QIV A;  3US5 A;  1SJR A;  4Y2K A;  1MWZ A;  1PIE A;  4K7Q A;  5CAA A;  2B8P A;  1KVK A;  3MUT P;  1TEL A;  3UD5 A;  1KLM A;  3DC2 A;  1Z2L A;  2NPI A;  4MMO A;  2CVE A;  2FJE B;  4F3M A;  4K4T A;  3N5F A;  2BR2 B;  1S99 A;  3QAT A;  2XZW A;  3ZNU A;  2ZH3 A;  2OTL S;  1Q5Y A;  1UVL A;  3B6B A;  1VS3 A;  9RUB A;  1S9E B;  2PA3 A;  2HND B;  4ZVU B;  4IS9 A;  1FDN A;  1LQ9 A;  2HGL A;  5K8N A;  2OEL A;  4DR7 J;  5HL7 Q;  4IH7 A;  1CQM A;  2AEM A;  2X7I A;  1F60 B;  2C2O B;  3I55 S;  4RW4 B;  2MDA A;  5CH7 B;  3R7N B;  2J9C A;  1ZXM A;  2IC3 A;  5F8L A;  4KQV A;  2BX6 A;  4DR2 I;  2F7V A;  2XUL A;  4LFC F;  2B7B B;  2BW7 A;  5BJR A;  2ALY B;  4IZJ A;  5IV4 A;  2BE9 B;  4DUY J;  4RW9 A;  1M5S A;  3SBM A;  3PTW A;  2CQD A;  1NLK L;  2JE6 B;  2MYF A;  2AJ0 A;  3E51 A;  2VON A;  3G71 S;  3UD3 P;  3W9I A;  4M5L A;  3GMG A;  2W9C A;  2WAQ D;  2ROG A;  1KP6 A;  4EU0 A;  3OLA A;  4LF4 E;  2NN6 C;  3RBZ A;  4DR3 J;  3PW0 A;  2HAI A;  3IP0 A;  1HI0 P;  4HT7 A;  5LT5 A;  1MW7 A;  2KFN A;  2POK A;  4DR7 I;  2WVC A;  3NLC A;  3EX7 B;  2YY3 A;  2O01 C;  1EJ7 L;  5L8R C;  3LP1 B;  3PFO A;  2CPD A;  2W01 A;  4DR5 I;  3BGR A;  2PO4 A;  4UOF A;  2PFD A;  3QZ7 A;  5KG2 A;  1TKD A;  2E9T A;  1GAO A;  2E1A A;  1IKX B;  4LF6 E;  1NPK A;  1RT5 B;  2AJF E;  4JI5 F;  3L7P A;  1CC8 A;  2VB6 A;  1H3D A;  2Y1J A;  1IBK J;  1RHJ B;  1FKO A;  3PW5 A;  1NME B;  1FDA A;  3FC9 A;  1N5Y A;  3D0G E;  2B0G A;  4FYX B;  1YSJ A;  3VVT A;  3QQC D;  2RNE A;  4J37 A;  4TY9 A;  4AND A;  3H2V E;  2BEF A;  4N77 A;  3I87 A;  4NXN J;  2HNZ B;  3FEY B;  1R6V A;  4B9T A;  3AH6 A;  5D8H B;  5J2Q B;  4DFP A;  1NHU A;  4L6V 3;  1HHS A;  1QJH A;  4RWW A;  2X3D A;  1F6T A;  2F8E X;  3MAA B;  1RCO B;  1S49 A;  3C15 B;  4NA1 A;  2MHN A;  3TUP A;  2C3O A;  3TUZ C;  1FJE B;  3E01 A;  1FFG B;  3NWR A;  2XBP A;  4OZ1 A;  3D66 A;  3T1H J;  2DR6 A;  1X7V A;  3SQG B;  4C48 A;  4EO6 A;  2N3L A;  4FW6 A;  4ECQ A;  2RU3 A;  4Y34 A;  2L9D A;  3TA1 A;  4DX7 A;  1RTH A;  2KJW A;  5DRP A;  1Q0N A;  2ZBQ A;  1TV6 B;  4BA1 B;  2FJB B;  4K4W A;  3MR6 A;  2CJK A;  1SJ3 P;  3K0J A;  2ZHA A;  4OO1 A;  2OO4 A;  4F0H A;  1R0C B;  5KFN A;  1S7I A;  4NLO A;  4WE1 A;  4B3R F;  4NZ7 A;  2FHJ D;  3ILJ A;  2CQI A;  2G0I A;  4PYD A;  5KFI A;  1NK5 A;  2OUG A;  4JI2 F;  2C2N A;  4ZPA A;  4I3H A;  5DM7 Q;  4IFV B;  4LIW A;  1S1X B;  3BO4 A;  1HPZ A;  4QR1 A;  4JV5 J;  2BUN A;  3D2W A;  5KFH A;  2HRY A;  3I4H X;  1CJU A;  3IG1 A;  1FTR A;  3FZB A;  2FJA B;  1U25 A;  4Y2M A;  1N36 J;  4QPX A;  1BUX A;  4KT0 C;  4WPA A;  4W90 B;  4DMZ A;  3T1A A;  2CPE A;  4NMX A;  2YXL A;  1NK0 A;  3CJ4 A;  4XTT A;  1FVQ A;  4M1K A;  5KFW A;  1N33 I;  2DGX A;  1ACM B;  3QIP B;  2VV5 A;  3DOM A;  1CPZ A;  1UPM B;  2ZJR Q;  2V9W A;  1FNM A;  1Y4S A;  4LSL B;  3TUJ C;  3CC4 S;  3UHM A;  2BRK A;  3ZZR A;  3QRP A;  3RBX A;  4TXS A;  2C2D A;  4I6Y A;  2M5Y A;  2CG8 A;  4MTP A;  1QSL A;  2HHH I;  2XTJ P;  1KTQ A;  2QMX A;  1A0O B;  1UJ5 A;  1REV A;  2VFU A;  3JSR A;  2OPP A;  2F40 A;  4RX6 A;  3O8W A;  2AW0 A;  3MFI A;  1U6B A;  4YQW A;  1FER A;  3VQS A;  4PYA A;  5F41 A;  4UY8 T;  3RAM A;  3GV5 B;  1HBM B;  1TK0 A;  1S72 S;  2RUS A;  3QT8 A;  3T5H A;  4DS4 A;  3JSM B;  2W2N P;  4KGM A;  3AJ1 A;  4F3Q A;  2NSC A;  3C46 A;  4ZJL A;  1S1W A;  2CQC A;  3CDA A;  1GTH A;  2YX4 A;  3NGR A;  3FDS A;  5IZH A;  2CAJ A;  1RTD B;  1PYT A;  5IT0 A;  5CZX A;  5BYQ A;  2DHG A;  4CH1 A;  1VRU A;  4NLT A;  1GXL A;  3PG9 A;  4DEZ A;  1ZH5 A;  2RRA A;  4R8U B;  4KIA A;  4ERD A;  4OHZ A;  4USW A;  2HS0 A;  3CJT A;  3SCJ E;  2W1B A;  2W9B B;  3R7B B;  1EKR A;  4X4O A;  2HQG A;  1L3V A;  1B4S A;  3POT B;  2GX8 A;  3DI6 B;  3TAR A;  1AB8 A;  3H4L A;  3K59 A;  1VIS A;  2DNQ A;  5HO4 A;  3WDO A;  1OQ6 A;  4TU8 A;  1RTZ A;  1FO1 A;  4PAB A;  2JLG A;  4KB7 A;  5DDQ C;  1LFP A;  1OPI A;  4PUO B;  1IM6 A;  4L74 A;  4DV0 J;  2NCK L;  3B4M A;  3OFG A;  4F04 B;  1JLF B;  1U1M A;  2D69 A;  3RJM B;  3MR5 A;  3H4D A;  3EGN A;  3DLE A;  4AYB D;  2VPX B;  1MU2 B;  3J7Y U;  3LP0 B;  3VHQ A;  3ZKB A;  1ZM3 A;  3UNY A;  4JI1 F;  1SVD A;  1XQI A;  2E1P A;  3MXH P;  4P75 A;  4USM A;  1RYS A;  1V6H A;  4ZP8 A;  4B3T F;  2KFZ A;  3P3C A;  4GVB A;  3KDN A;  1HYS