4ED4A

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
303
structure length
299
Chain Sequence
SDWVPTGAVTVRAPGKVNLYLAVGDLYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 97
structure length 299
sequence length 303
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4ed4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ed4A01
2ZITA 1J5EI 2V34A 1H7SA 4FW9A 3J81Q 4JI3I 4DR7E 4XTJA 3PYDA 4DR3I 4JI5I 3ZKBA 4B3RI 1DARA 1HNXI 4NXNI 4B3TI 1XMOI 4LFAI 5LMUE 4B3ME 4JI7I 4OX9I 4KHPE 2X7IA 3B8HA 2VQEI 1ZM2A 4DV5I 3J7AG 1FWLA 3QT8A 3PYEA 4LF5I 4X62E 2UU9E 4LF8I 1B62A 4DUYI 1D6TA 4YHHE 1XNQI 4LF6E 4Z7YA 4DV7I 1ZM4A 1KVKA 2AJ4A 2A2DA 3OTOE 1PVGA 1H7UA 4DR6E 4X64E 4GKKI 1A6FA 4DV3I 2R42A 3K17A 2UXBI 1OJ4A 3T1HI 2UXCE 3V5RA 4DV6I 4JI6E 5IT9Q 3ZM7A 1NZ0A 4DR1E 4DUZI 2UUCI 4DV4I 3J80C 1WUUA 4DR4I 4JI1I 3ZKDA 2HHHI 4DPTA 4DXLA 1HR0E 4M1KA 4HACB 2HFUA 2HK3A 1ZM9A 1N0VC 3V2UC 3J81C 4DV1E 1N33E 4DU7A 3QT5A 4LF9E 4K0KI 1MU5A 4K0KE 1H72C 5IWAI 3WU6A 4JI0E 4X65E 4HYMA 1QZRA 1EA6A 4HXZA 1HR0I 4MYTA 2UUAE 2HHHE 3PYGA 4JI1E 1IBME 4GKJE 2R3VA 4DV4E 2UUCE 4RPFA 4DPWA 5FLXQ 4UT4A 3HULA 2UXCI 4JI2I 2J7KA 2X36A 5GMEA 4DV3E 1Z5CA 2E5LE 2ZBKB 3LNUA 2VF3A 4GKKE 3WU4A 4USKA 4DR6I 2V2ZA 2VQFI 1KKHA 4DV7E 4DR5E 3F0NA 4YHHI 1XNQE 4DUYE 4LF8E 4X62I 2UU9I 1H74A 4LF5E 4DPXA 2HFSA 3ZZ0A 1Z5BA 4JG4A 4X66E 3LTOA 4Z7CA 3WU5A 4FWDA 4WUBA 4LFCI 3J7AM 2VQEE 2LJPA 4JI7E 4KHPI 3ZZTA 1UEKA 5LMUI 1Z0TA 5BR8E 2V2QA 2ZM6I 3WU3A 1RR9A 1HNXE 4B3TE 1PKPA 1Z0VA 4NXME 4NXMI 1FI4A 2ZM6E 5BR8I 4DR7I 1K47A 5A2QC 2CZ9A 4P7AA 3GONA 1J5EE 4LFCE 1S16A 1ELOA 1ZXNA 4X66I 3H4LA 1XNRI 4FWGA 3Q1QA 4DR5I 3B78A 4PRVA 2VQFE 2GS8A 1Z0WA 4WUCA 1Z59A 4PU9A 2A2CA 2E5LI 4USMA 4AQYI 3K1JA 4JI2E 1HNZE 3M6AA 4URLA 4P52A 3T1YI 4LF4I 1Z0CA 1VISA 1FKAE 2BM1A 4GKJI 1IBMI 4DV2I 2F4VE 4UTGA 4DR2I 2UUAI 1Z0BA 1XMQE 1NHIA 2E1RA 4PRXA 4B3SI 4X65I 2HKEA 2BV3A 4YY3I 4JI0I 3JAMQ 4JI4E 4DU8A 5IWAE 4JYAE 4LF7I 3PYFA 2UUBE 1N36E 4LF9I 2UXDI 4DV0I 3QT7A 2Q2EB 1N33I 4DV1I 1KIJA 5GMDA 5A2QQ 2V2VA 5LMNI 1IBKI 1U2RA 4DPYA 4ED4A 1I94E 5IT9C 2WW4A 4DR4E 4DUZE 4DR1I 3QT6A 4JI6I 4DV6E 1MX0A 3T1HE 2EFGA 2UXBE 1IBLI 1BKNA 1N34E 4X64I 2DEJA 4EMDA 4LFBI 3OTOI 4R1FA 4LFBE 4LF6I 1B63A 1N34I 1IBLE 2OI2A 5LL6R 2HKJA 1KTVA 1Z5AA 3LPSA 4DV5E 4HACA 2HK2A 4OX9E 4B3MI 4HY1A 5FLXC 4LFAE 1I94I 4WUDA 1XMOE 3D4JA 4NXNE 3CWVA 5LMNE 1IBKE 1EI1A 1PIEA 4B3RE 4DR3E 4JI5E 4ZVIA 1FNMA 4DPUA 4DV0E 1ZM3A 4I3HA 4JI3E 1N36I 2UXDE 2UUBI 2BM0A 1MG7A 4LF7E 4JYAI 1N32I 2DEIA 4JI4I 4MYUA 4JV5I 4JI8I 4YY3E 4B3SE 1NHJA 1XMQI 3JAMC 4DR2E 2F4VI 4DV2E 4FN5A 1HNWE 1S4EA 2V8PA 1XHKA 1FJGI 1Z0GA 4LF4E 3T1YE 2XEXA 1FWKA 1ZXMA 1H73A 1HNZI 3B82A 3J80Q 4AQYE 1N0UA 1FJGE 5L3JA 4FWHA 1HNWI 1RREA 3ZZUA 2NPFA 4KQVA 1NHHA 1Z0EA 4JI8E 4JV5E 1N32E 1XNRE
chains in the Genus database with same CATH superfamily
4K5RA 4Z37A 4K0KJ 1WG5A 2WNRB 1U26A 2PNZB 2MHEA 1RDRA 1VHIA 2HHUA 1I5OB 2ZNZA 1JJCB 4CT8A 4OL8A 2GCFA 1H7SA 4FW9A 4WWSA 3MTJA 3CSKA 4WE1A 4JV0A 4FS1A 4PUOA 4CO2A 4GKKF 4KR0B 3Q22A 5F3ZA 1U1QA 4JI3I 3NGRA 3DOLA 3GG1A 3LOUA 3NOCA 3D68A 1H98A 3EGWB 5HK4A 4X4TA 3MUMP 3KJVA 1U6BA 3HJFA 5DDRC 3FC9A 4OHVA 3SI8A 4O0IA 1VFJA 4PABA 4Y0FA 1WF0A 2LVWA 2FJWA 1CC8A 2BANB 3HJVA 2Z5BB 2B7BB 2I5JA 3PDNA 3OTEA 3HKMA 1WELA 2BX6A 4B3RI 2MHNA 3OHAA 1R3NA 3X3UA 2HHSA 2KFNA 4NXNI 5KFEA 2M3DA 3RBZA 4DR5F 4ED5A 4M63A 3VGUA 2BYCA 4DUZJ 1KQGB 1XMOI 2KVQE 5LMUE 2WSEC 1HA1A 3SDEA 5J2QA 5DO2A 1PBUA 4C98A 1IKYA 2W2NP 4AQYJ 2RRNA 3MPYA 1T8EA 3AQOA 1XJWB 5CZXA 1RTHA 5KG1A 3AODA 4OX9I 4QOTA 3UWTA 4U6PA 3GWCA 2GAGC 1V3RA 2K06A 3HHDA 4F4WA 2ZHBA 1KVIA 1ZM2A 4HI2A 4B9MA 2V4QA 5K8MA 2BABA 1Q81T 1CULA 2OPQA 2W1BA 3M30A 1FWLA 3QQCD 3OFEA 4E8UA 2LEPA 3TW0A 3CCSS 1HI8A 5LM7E 4DX8H 2JLGA 4BBYA 4DPOA 1NHKL 2LQ9A 1RP5A 2MPUA 3SV3A 1IJEB 3TQ1A 3IM8A 2AJ1A 1BD6A 3NAHA 3NBPB 4DR5J 3NMRA 4IQMA 5J2PB 1GMUA 3M9NB 3EICA 1RABB 2N7CA 3GMGA 1RHJB 2ALZA 4ZHRB 2DHXA 2PI5A 4LCGA 3D6FB 4DV7J 3M32B 4NPOA 4YB6A 2CADA 3MMJA 2I5JB 3H5UA 4LRAA 3CC7S 4J9VA 4J9PA 4IR9A 1AFJA 3MM7B 2PO2B 3OTOE 2LMIA 3TO8A 3U1MA 5CYQB 5B0BA 3CIMA 4O44A 2OH2A 3OR1B 4P2FA 1QVGR 2GC8A 4C4WA 1SH3A 1SI9A 3QIDA 3VAGA 4F02A 3LNUA 4RW4B 3GJSB 1SJ4P 1A6FA 1FXDA 5AE2A 4J9QA 1RWVB 2CVIA 1HNVA 4KFBA 3FDSA 2C3UA 2UUBE 2HNYB 2ZD1A 2Q6CA 1NKCA 4CLPA 1FRLA 4JI6F 4DR7J 3O44A 4QW8A 2UXCE 1X4AA 1HWJA 5CXTA 2JL9A 4J90A 1WJ9A 1IBMJ 1T3OA 2DH7A 2HHXA 4OMFG 2DXEA 4CLLA 4NLUA 1ZTWA 4DR1E 1U09A 4DV4I 2J5AA 2QL7B 2XZDB 3GYGA 4UW2A 2E9TA 2G2YA 4ZCLA 1IKVB 1GMWA 2PA8D 4WP8A 2LU1A 1KFSA 1N54B 3L7PA 5IFMA 1XMOF 5DNLA 5T41A 2NN6E 4DR3J 2DGVA 4ZPCA 1F2GA 5ETQA 2GJ2A 5E3PA 3RW7A 3GFZA 3P96A 1S72S 1C4CA 1BC6A 4OZEA 1RB0A 2JC1A 5JUMA 2XGQA 1PYTA 2HFUA 1ZM9A 5E5NA 3KLHB 4G1QB 4OZ3A 2VJUA 4AL7A 1XNQF 4C9DA 2DB1A 2XY6A 2CQ0A 4QYZJ 5DRQA 5ETLA 2G2ZA 5KG4A 1VBXA 4QWEA 4O0NA 1F9FA 3GZ7A 4DV1E 2DIVA 2JVOA 1P1TA 2XMVA 2J8AA 2RHQB 2YNGA 4ZLJA 4PR6A 4JI4J 4OZ1A 3FSIA 2EC2A 2V63A 3RTVA 5IV3A 4DFPA 2VQEI 2HVIA 1ZZFA 5HSPA 2DGUA 2P9GA 4DFMA 1Y5LB 2FQQB 1UVKA 1DQ8A 2D7SA 2GGPB 1U7LA 4QWAA 2PD1A 2B8QA 3R5DA 4IG0B 5I3UA 2G2OA 3OVAA 2UV8A 1S1XA 3BBBA 2U1AA 1FE0A 2YWFA 1GQEA 3WU6A 2DK2A 3EX7B 2CJ9A 3GCWP 1QSSA 1YJTA 4FW3A 2FC9A 4QIVA 4JI0E 3JTPA 4OFZA 4HH1A 4X65E 4TY8A 4LIWA 1S1XB 4RNOA 1QZRA 4DFJA 1JLCA 2EFVA 4HXZA 1WC3A 1MWZA 2FJEB 3U27A 5IT9U 3FCWA 3K57A 1JK9B 1S5ZA 1VQSA 2CRLA 2QMUB 4J9UE 4M5KA 4LFBF 1IQZA 3NY0A 1U1NA 3ZFVA 3M1VA 2ZEJA 3GV8B 1WKKA 1VQ4S 2R8GA 2B9EA 2R3VA 2DR6A 4OYZA 4DR4F 3PRDA 4DV4E 3BGUA 2V9WA 2YNGB 4V1Ak 1USUA 3PW5A 3D3CJ 1EX8A 2J7WA 3HFZB 2XCAA 1RUSA 4JV2A 4UT4A 1CG2A 2BR2B 2UXCI 2CVEA 4NYOA 3CCJS 1W25A 2QL5B 1B70B 4TN2A 2CFXA 4F0MA 4WYWA 4WYLA 1XR5A 2AEFA 2M2BA 2ZOFA 4QQBA 1UWBB 4DV3E 1YSJA 3HXMA 1RKJA 2BE2A 4IG3B 3D1OA 2FGCA 1FXLA 2YKMA 1E6VA 1S9GB 4ZPBA 3NL0A 4DR6I 3R27A 1VC5A 1JJ4A 1F2HA 3BBFA 3OXFA 2OUGA 3U1LA 2OPRB 1FVSA 3TJ8A 3HHLB 3EGVA 3LANA 5DGAA 2XCPA 5DM6Q 2VQFI 3V81B 4DR2F 2JEAB 4DR5E 1TL1A 3G8SA 2EBGA 4YHHI 4IFYA 1KD1T 3DRPB 2EWHA 3W9IA 3D7SB 1FHTA 1BXNA 3AXKA 4X62I 3HP6A 1H74A 2ZBRA 5CD4A 3C15A 2BKOA 1HNVB 2BE9B 2HFSA 2HVZA 2HZCA 4ZLLA 4X64J 4EZ6A 5KFDA 3PTWA 3TA1A 1TTHB 2OKQA 4YQWA 4DLEA 4JG4A 2Z2LA 3QIPA 1FRHA 2B0GA 2Z2MA 3D0GE 3DOKA 3P3DA 2B9YA 1AA1B 4YDXA 5EWFA 3Q2TC 5THWA 3J7AM 3SFUA 1T94A 4B17A 1EJ7L 4HYKA 3AJDA 4YOEA 6AT1B 3WQPA 2LU2A 4LOMA 4C8NA 4ZN3A 3ZZTA 4DR1F 2BZ2A 4X4OA 1UEKA 2G0IA 3ILIA 3M8QB 2DR8A 3CD5A 1QLNA 2C39A 5LMUI 4J9KA 1H2TZ 2F5GA 3BGFA 1V6HA 4JI1J 1NUEA 1SQEA 2AW0A 2J76E 2LLZA 3I9V9 3LP2B 3QNWB 4OI3A 3ENQA 5KFUA 3C6TB 1X5PA 2MSSA 1EHWA 1I94J 5GADU 3DFEA 3MM8A 3T5KA 2LYVA 4NXMI 3KWMA 2N7YA 4ZCKA 1Q82T 2GJFA 1FK9A 4F4ZA 3KNAA 1XK8A 2FHKA 2FDNA 4DV2F 2GJIA 3HVAA 2XS7A 5FLXY 4J9NA 1FI4A 3A8EA 2ZM6E 1IKWA 3CMQA 2QIFA 3P4UB 4DV1F 4ZCMA 3EXCX 5D3GA 3HKWA 3SXLA 1KLMA 4DCPB 1NK0A 2E9ZA 3MR3A 2WHOA 1GX6A 4GVLA 3C14B 4KB7A 5T7LA 4L73A 3H2UB 2CPHA 4IH6A 1XWLA 4DF8A 2D3O1 4GKKJ 2FLOA 2CA9A 1Z1ZA 2KJWA 2DISA 1AB8A 4R0JA 2HIQA 1E3HA 4LIRA 1LXNA 2ABYA 2IDEA 3GIJA 2F8HA 3J81U 1U45A 2BJ8A 3M2UA 4DQPA 4ERDA 2CJKA 1XNRI 4L3NA 3QLHA 1CQMA 3E2EA 1JXLA 1S1VA 1S6QA 3FEXB 2MZ1A 4IZKA 1QTMA 4ZITA 4F2SA 3GSDA 1KN6A 1N8RT 3RZAA 2A18A 1PJ7A 2I0XA 2BJ9A 5M2RA 3EWGA 2OFGX 2MQOA 4ZK7M 2XYPB 3TEHB 3JTNA 2AYEA 4O23A 5KT3A 5H9EJ 1KBRA 3KLVA 3VAIA 2V67A 5DLFA 4JI8J 2F1DA 1M90T 4F8RA 1S57A 5D0HA 1RTDB 2CJQA 3M1VB 4C8ZA 1LW2A 2F9DA 1TMMA 2VPYB 3OJSA 1SIWB 3PIPQ 1Z59A 2GVDA 4ECSA 4DS4A 2OD4A 4U95A 3P5TL 2VQEJ 3GFHA 2M0GB 2J6TA 4GKJI 4MKBA 3I82A 4KY3A 3U02A 5HROA 2CPIA 1WACA 4ED8A 3FCVA 2VQEF 4K50A 2C3YA 3MCOA 2HBYB 5B0FA 1ZH5A 4U8YA 4J9MA 2F65A 3S1TA 3TAMB 2LQBA 4F3OA 2C2OB 5KFLA 4DR4J 2PNZA 3T1YI 4NOHA 3MEEB 2CUYA 1WORA 3H8YA 1FJ7A 5FWKA 3QAUA 2ZDPA 2C37B 4K8RA 1DY3A 2VB6A 4X62F 2PN6A 4YR2A 3MEDA 2VESA 1FKAE 4BDPA 2GQQA 2B5JB 4DV2I 2F4VE 1ZOTA 3M8PA 4I69A 4ANDA 2LCWA 3DXBA 1U4BA 3DRRA 2UXBJ 3E8OA 2YY3A 1Z0BA 3PY8A 3K85A 2YX1A 5H9FJ 4X65I 2YWGA 3D54A 4MJKA 1ZTTA 3DC2A 2E7XA 1QUVA 3JAMQ 3MOZA 4I64A 3US5A 4A8XA 5SZTA 2H48B 3CCZA 2E9RX 2ACYA 4DU8A 1PILA 4TQSA 1SBRA 3RU0A 3VWSA 3H4BA 3CMES 1UETA 3BDPA 1YWXA 2QE5A 2YTCA 1IKXB 2DTJA 5C7PA 4WTOB 5K9FA 2VFTA 2HS3A 2LKZA 3PFEA 3SYZA 1HWIA 1JLAB 2IRUA 5DDPC 2D3ZA 2ZH4A 2VFVA 1X9SA 2R7OA 4M94A 1PCAA 1UKUA 1OMSA 2HS0A 2KT2A 5U47A 3RJMB 1QSLA 1RTIA 1RGVA 2YH0A 3EE3A 1OSCA 4RW4A 4ZVHA 3JAMU 1LWEB 1UL3A 3DNCA 2Z56B 3IP0A 4DV1I 3KJFB 3BPSP 2GIRA 3TZWA 5CA5A 4P74A 2HRTA 1RISA 1S77D 3MZIA 5HMZA 5AJ3J 3NS7B 1TZ0A 3G6VA 2UUAJ 1D9AA 3SMZA 5HVGA 1WOPA 4DR2J 2B3TB 5AXKA 3G96A 2C2DA 2ZWPA 4LFAF 4ED6A 5LMNI 3AD7C 2R8JA 3QMQA 3FSXA 3I0SB 4NLOA 4TLQA 3UDLA 4DWIA 2OPPA 2VASA 4MMOA 4FP9A 5KFQA 4OZJA 2QA4S 1W2BR 5IT9C 2A10A 2WW4A 2ASLA 4K4VA 3MM7A 3A8JA 1SXLA 5RUBA 2IMWP 2DNQA 2PO0A 3Q8QB 4LCFA 4AIMA 1LWFA 4EI2A 3IR6B 1RBLA 1RWMB 2ZOGA 2V94A 3QT6A 4LF9F 2QLFB 4DV6E 4L75A 5F0WA 4DSFA 2M5YA 1YZ6A 1KQFB 1EKRA 1J5EF 4AE5A 2ACMA 3FUYA 1MX0A 1C0TB 2KZZA 4EFAC 1NPRA 3OR2A 2YKPA 1RWWB 4QIEA 2RDIA 3I0RA 1TKXB 4HL9A 3PIOQ 1DTTA 4FZVA 4LFCJ 2KRRA 3KHLA 3T1HF 1QUPA 4LPFA 1IBLI 2AV5A 4BA1B 2COLA 1N34E 2L9DA 2JEAA 1V9OA 1U25A 2P6TA 3MM9B 5A8KA 2W01A 2CKWA 3IR5B 3OTOI 3DGPA 1X9WA 3HJCA 3VAKA 1KS2A 3LPYA 4M5NA 3SDEB 5AJ3F 5J2QB 4DN0A 3K5NA 5L1JA 4OI4A 3JQKA 3IS9A 2E7WA 3ZZPA 1Q5VA 3UDCA 4CTAB 4WFZA 4X4QA 2NZ4A 2P6SA 2GO3A 4LF6I 4UOFA 3PRBA 5L9XA 3KJVB 4K4TA 1IBLE 2OI2A 3V6HA 1GMVA 2NYIA 4J37A 1WD6A 1LFWA 3LP0A 3M8QA 2FZGB 5M2UA 4RNMA 5JEAE 1APSA 1BUXA 2GO9A 4MKAA 1WI6A 2VV5A 5SUHA 3LPSA 2LQJA 2D69A 2ZDOA 1NPPA 1UTAA 3CJQA 3J7Z5 1S0NA 1X4DA 5LOQA 2LP4A 1S1TA 2C37A 4IR1A 2MZRA 4U3BA 5F9LA 4OIXA 2XMKA 3Q8UA 2QLBB 1K9MT 1M5VC 1U8WA 3IBFB 1UVNA 4U7UK 2KG1A 2CPFA 2XHWA 2FIUA 3M32A 4QYZK 5FLXC 4NASA 5KFCA 1PO6A 3IAM9 1XMOE 5ETPA 4QW9A 1GX5A 3KTQA 3RBXA 2FC8A 2AX1A 4O4GA 3GV7B 4NXNE 4ZVQB 3IGVA 3NCPA 3PV8A 2GIQA 2H51B 2O67A 2CNNB 1D0EA 1IBKE 4A8MP 4B3RE 4PG6A 4DR3E 3W2VA 3QBCA 1TKDA 1FFWB 4LSNB 3M30B 4IFDE 1CS4B 5CAAA 1SB6A 3EPGA 2QMWA 2NLWA 5DZ7A 4LMZA 3Q83A 1M5SA 4P6QA 4RWXA 2Z4PA 4WKYA 4N3OA 4KH0B 2C2RA 5AE3A 3VV2B 2WP8A 1N36I 3BN7A 1FKPB 2DR9A 2B8PA 5L1LA 2UUBI 1J5OB 3MEGA 4EYIB 2Y9HA 4Q43A 3PJWA 3IA0A 3AB4B 4XPEA 4QJVA 2W8LA 1CLFA 3AD8C 1ZA2B 5HANA 2GIFA 5KFIA 3SV4A 1RU2A 1P9QC 4ZCIA 3PKMA 4JYAJ 3IO1A 3OL8A 5J2MB 1O8BA 1CJTB 3I96A 2BW7A 2K7KA 2JEJA 1FEHA 4JYAI 4L76A 1UWAA 3R5GA 4I6WA 1T03A 3GCMA 2CDQA 2W7AA 3V4IB 4MYUA 2MQ8A 2VHGA 4LF6F 1HPZA 1D1UA 4IZJB 5DROA 4JV5I 4LR8A 2JVRA 1SKRA 1Q16B 3RAMA 5GAGI 5HVHA 5B0AA 1FE4A 4F2RA 3OLBA 3PS2A 3HHLC 4X4UA 4H4OB 5HP1B 1MW7A 3H90A 4KKOA 4N47A 2UV8G 4M5DB 2MQQA 4FN5A 4KIAA 2WW8A 3LALA 1S4EA 3MPUB 1UVMA 2KTQA 2V8PA 1YRUA 2BRLA 4W4MA 3J80Y 2VKRA 4DL7A 2DR5A 4JI6J 4ILRA 4JI2J 1FK9B 1XHKA 2Z57B 4R5PB 1GEHA 1FESA 3GB0A 1FDBA 5C42A 3T1YE 4DOZA 4JV1A 4DL2A 2FLPA 5CYMA 2MGZB 3D0HE 3W60A 4U96A 3TX0A 3DGVA 4A4JA 3D2WA 1SV5A 2G0CA 2Q3PA 4QR2A 4C11B 4DN9A 4P7VA 2WBRA 2NXEA 1QE1B 3RRHA 2DGQA 3RRGA 1Q95G 1YGYA 4TYAA 5J1NA 4ANEA 3DI6A 5L3JA 1JIHA 3VVUA 5F8IA 5F3TA 1X4BA 1TKZB 3B54A 2XI3A 3LH2S 3G4SS 2W9BA 2HWIA 3NLCA 3ZZUA 5FLXQ 3QPIA 1P8GA 1R8BA 2PA3A 3IWXA 4HT5A 4URQU 5I42B 2XYHB 2ZZMA 2FHJA 3EVOA 1O5JA 1UJ4A 1RA7A 1RT4B 4KT0C 5ETRA 4TLRA 4YS2A 1M5OC 4ATNA 3TAMA 1KHWA 2YKNB 3BH7B 3CDAA 4NCGB 4KQZA 3D6MB 3M6VA 4DR3F 1YKWA 2CPDA 1S7IA 2Y0SD 3ULHA 4ILLA 3MDFA 2BDPA 2E1PA 3DU5A 3IBWA 2R2TA 4ELVA 2A6MA 1N32E 3MAHA 2HPUA 4NLQA 3GFXA 3IRXA 1J27A 3QJPA 2ZITA 2FVRA 2RT3A 3NMAA 4OKGA 1Q8KA 2GVDB 3DRSB 2HNDB 1GAOA 4R8UB 4URGA 2DHGA 1FRXA 1JNZB 2W9BB 1LW2B 2QA4G 4QU6A 1IBLJ 4IRCA 4K0KF 4FF4A 4NZ6A 4B02A 2J7UA 1HYSB 2YXLA 2VJVA 5B0DA 3DLGA 5E3AA 2UXBF 1A7GE 1VR6A 2VD3A 4DR7E 2WTFA 4ES1A 3BQ1A 2AYGA 5ADZA 4XTJA 1R8AA 2C22A 4LQ9A 4EZ9A 4DQIA 1KR4A 3FGVA 1B3TA 3EVWA 5K36A 4JI5I 1HBUB 2HWTA 1H7XA 2CZVC 2LDYA 3DLEB 3OUYB 2HQGA 3B4TA 4X62E 3MAAB 4OQJA 4F04B 2B5JA 3CD0A 1DARA 2MKCA 1WDDA 2GVZB 5CCMA 4KPYA 4LF4J 1LKZA 2XGPA 4OX9E 1FX2A 1UPMB 1NDPA 2JDJA 3PJXA 3RGIA 5EWEA 4LFAI 1GNKA 3GTYX 3BDEA 3VVTA 5L38A 1JLFB 2OTJS 4QCLA 5EKWA 5CQGA 1IBLF 1VIOA 2PC6A 3L3CA 3MURP 2BOPA 3T5JA 4CYUB 4FXWA 2IBKA 4B3ME 4GRSA 4JI7I 1PGZA 1Y4SA 2JZ5A 3BN4A 4CZCA 1WHVA 2VFUA 4RW7B 4ZKAA 3IG1A 4RX6A 4OYAA 2JEFA 2CQDA 1Y60A 2MKJA 1SL2A 2FLNA 1U24A 3QT8A 4XAKA 2FY1A 2FZKB 5F8MA 1JLEB 2CDRB 5KT5A 3PW4A 5BR8F 3OVBA 2FD2A 4P71A 3C6TA 5KG6A 4YMEA 9ATCB 2ZC4A 2HBRB 2DD8S 3KUGA 4MK8A 5I3UB 1FTCA 4J9OA 2JEBB 1RT7B 5CH7B 3BZQA 4YHHE 2UU9E 1S79A 4V19X 1UCNA 2W4DA 2J0SD 3UNYA 4K4ZA 3I87A 4F0HA 4B3SF 4H4MB 4KV8B 1IBKF 2A2DA 5K8NA 4DUYJ 1Q7YT 5AE1A 4JI1F 1PVGA 1LWCB 4X66J 1R6VA 2XQCA 4DR6E 2AYBA 1UVLA 3NXZA 4IFDF 1RI7A 2X1GA 4EO8A 2UUCF 3G87A 3UCGA 2W2QP 2DIUA 4K4UA 4ZLNA 1RCXB 2KXFA 4DV3I 1YJ7A 3SQOP 2PO1B 2UXBI 3P45B 1OJ4A 2KN4A 3WX8A 1N4LA 4X4SA 4X4NA 2DGTA 4JI2F 2O1TA 2WOMB 4WXOA 1TL1B 1RWKB 5K8OA 4LRCA 4JI6E 4ELTA 3RB3A 3M8RA 3T9ZA 3TUIC 2WVBA 2DNZA 4OX9F 1K1SA 5D4PA 3BQ2A 2VG6B 2FHOB 4LUBA 4A8SA 2HYIB 4D3GA 2RH3A 4DR4I 3T6JA 3HFKA 5IZHA 1IBCB 1R31A 1SC1B 1Z2ZA 3HPOA 1S1WB 2E5LF 3GIRA 3ZKDA 3CJ5A 4ZDNA 1T9XA 1J2VA 4DXLA 5H1SV 1HR0E 2I8EA 4M1KA 1SUQA 3VGTA 4M5JA 4AM3A 1HWUA 2AJFE 2F40A 4MIAA 2OPRA 3LGNA 3V2UC 4F26A 1BLUA 4E0DA 1HHSA 3LUYA 5DNXA 1YIJS 4ZP8A 4FF3A 4HTJA 1FEEA 5D15A 2Z8QA 3TRGA 2W7OA 3UD4P 1N33E 3DXSX 1FDNA 4DU7A 4B3TI 2PO2A 2CAJA 4LF9E 3DGPB 2OIHA 3MF5A 1OO0B 3LAMA 4TXSA 1QTNB 3T1AA 4ED1A 4IFVB 2HIYA 5L9NA 1D8YA 5J2PA 4MU4A 2HW3A 4JB8B 4NRTA 1PC5A 4LREA 4HLBA 2W9CA 4K0KE 2OEMA 3M05A 1FF2A 3MMAA 4N5SA 1XXEA 4IKAA 1XNRJ 2ZE2B 5C0XA 2XZTB 1CC7A 2K7JA 4OJ3A 2L3MA 3I0RB 4PXBA 4Q45A 3R7NB 2ZH1A 1VLYA 1CULB 2OPQB 2IM2A 3ZNJ1 1S6UA 2HZVA 4BS2A 4OYBA 5KOXA 1WWHA 4KYZA 4NLXA 2D3OR 4Y2KA 5E2QA 2X3GA 4HYMA 4WXWA 3DM2A 3A3PB 4F4AA 3UE2A 4ZVGA 2CPJA 3NS6A 5K14A 3UD3P 3ZTQA 1W26A 2HLUA 3BKTA 1X0PA 3TAQA 2J0XA 4Q8EA 1IVZA 3VAMA 2HVEA 5DG7A 4JI1E 4YFUA 2MZTA 3KJNB 2ERRA 2BA1G 4I2QB 4NXMJ 2HKJA 3N28A 4ID5B 2B9XA 4RPFA 4DCJB 4QZVB 1WEXA 2V8GA 2VPZB 1MMLA 1FVQA 4HDGA 2CNKB 1YJUA 1DQAA 2BANA 2QA2A 3T5LA 4O3RA 2J7KA 5K20B 1FJGJ 1Y5YA 5LMUJ 2Z5BA 1XBWA 4AQYF 5GMEA 5ETOA 4BA2B 1VI7A 2BKNA 4P2SA 4CLUA 2V2KA 2DCUB 2DNKA 2HHPA 4BWJA 4D3HA 2WP8B 1RKIA 2ZBPA 4GKKE 4ZS6A 4YEAA 4DG1A 3KFWX 5KT2A 1NK4A 4DZ6A 5KFHA 2Z5EA 5EUHA 2PT0A 3N9UC 1VQPS 4ECVA 1RAFB 5JEAB 3FJ2A 1CVJA 2YWKA 3CGIA 4IZJD 1N56A 1GXTA 3IRXB 4B3RF 1TV6B 2CQCA 3OJUA 3CCMS 2R7VA 4X62J 1YBTA 3AFGA 1Z2LA 4G1PA 3FBFA 1X60A 1TV6A 4NMXA 4R8UA 2R2SA 3DRSA 1WNEA 2CWXA 2QJ3A 2EKYA 2EFQA 3F0NA 2IERA 3CDUA 3EZOA 5E7OB 4C48A 3KG4A 3MUTP 4ETXA 5DETA 2VQFJ 3ISZA 1CJUA 1N6QB 4LF5E 4DPXA 2R7RA 3CF5Q 2JE6A 3FRZA 1F5BA 4UUXA 5F8GA 3ZZ0A 2B9WA 1Z5BA 1Z4UA 2ZVIA 3LTOA 2A0FB 2MQMA 1CSJA 1NU4A 4X84A 3G6XA 3A3OB 3H4DA 3LF0A 2R9LA 4DR6J 1QVFR 4FWDA 4LFCI 5K36F 4IH7A 2R7QA 2BA0G 4OHWA 3AA8A 2AEMA 4O44B 4S0MA 3BPDA 1D3WA 1K8AT 2ZBQA 4HDHA 1N36F 5HJXA 2VA3A 3CJ0A 2XB2D 1KOOA 5IV4A 1P6TA 1YZ7A 1HKAA 2M9KA 2QYCA 3MFIA 2H54B 3GLLA 1Z0TA 1KQKA 2UXCJ 4OYIA 2FB0A 1HBNB 1LWFB 5A0YB 3HVTA 1KOHA 1R7IA 1YLXA 3CDWA 3E51A 3TZZA 1VRTB 2Y1IA 1A9NB 3CC4S 3Q6NA 1MN9A 2DRDA 5AT1B 1HHTP 1Z0VA 3DMJA 2RU3A 5C0XC 1TL3B 2JC0A 1H2VZ 2M88A 3M7ND 3AT1B 1S6PB 5KT7A 3JSMB 2FLLA 4DR6F 2KI2A 3CJ3A 4UZBA 5BR8I 1L3KA 1UZHA 3FEZA 2J6SA 3CCQS 4FXDA 5E41A 1HR0J 3CCWA 4LR7A 1NK5A 1RXOB 2CZ9A 1D9FA 5ETTA 4P75A 4DX6A 4LF4F 2KG0A 2BBEA 3U1YA 3KLEA 1SJ1A 4WFAQ 2ZJPQ 4OZ2A 3KK2A 3DLHA 3GONA 4DV5F 1YJVA 2X3DA 3MCNA 3QGIA 4W90B 2UVUA 5MLCV 1VGYA 2WAQD 5KFAA 4OO1F 2H4YB 4CLKA 2KJVA 1WEYA 5IC4B 4OHYA 4OO1B 2GMLA 2YWEA 1VYAA 2QN6B 3EVMA 3SEOA 4NI2A 3PCOB 3PX0A 4PXCA 5IQ6A 2J6UA 2UP1A 3KLHA 1NKBA 1HMVA 4C8LA 3B78A 3UDVA 1VQKS 2BXJA 3FQLA 4FF1A 4CM0A 2XLJA 1RWUA 3GP9A 2AD9A 3KLEB 3UR3C 4UOGA 4EBEA 1JWWA 3BYPA 5C2GA 1SCJB 2RSQA 3LGHA 4OV1A 3MUVP 2P2CB 4BC7A 1RE1B 1VK3A 1IR0A 1HWKA 1JLEA 3G82A 4FDFA 1L3TA 3R1HA 3M9MB 3N4WA 4GVBB 2F4FA 3OR2B 2OELA 2APOA 3R5BA 3K0JA 2E5LI 3A12A 5JXSA 4DV2J 1M5HA 4X4PA 4NA3A 3IAS9 3K1JA 4ZJQA 4WE1B 1HNXE 3CCLS 5KFGA 2VG6A 2ROGA 1U2CA 1TK0A 5I3PA 4DUZF 4B3OA 3OTBA 4O3QA 1K0VA 3OFFA 3W2VB 4XDCA 3QWUA 3M6AA 1OY8A 2V8VA 1NSPA 1UEUA 4L6V3 2XWXA 3A1YG 4K4WA 3T1YJ 1G2EA 1JLFA 1YQHA 4OZNA 4DV4J 3RBDA 4MTPA 2L41A 1BMQB 1VISA 1HK7A 1Q8IA 2YNHB 2DCLA 4Y00A 2GNKA 1IBMI 4L72B 1HLWA 1OYPA 4YDDB 1S1TB 5IT9Y 4GVBA 2IPOB 5GAHI 2BMBA 1MLAA 2F8EX 4KGZB 2AKWB 1XMQE 1X0FA 3HFVA 1NB2A 1RTJA 4B08A 2FJAB 3OL7A 5K5MA 5C0XD 1HNXF 2QYGA 4QR0A 4B3TF 4FXVA 1U1PA 2RRAA 1EETB 1HQ2A 3ZZYA 4AT1B 1Q86T 1J5EJ 4PUOB 2I6WA 1QY7A 3TUZC 2J9DA 1OIAA 4DJBA 2RKIB 4LRDA 4FVMA 1HBMB 1U48A 5IWAE 1UEVA 5D8HB 3JSRA 3S01A 5CYJA 2DVIA 5H9EK 3LP1A 2HQIA 2WONB 1DRZA 4RWWA 4HEA9 3J7ZT 3BH6B 2HRYA 5E0OA 3TWZA 4A8WA 4OO1E 3Q24A 3V6KA 3AJ1A 2UXCF 4B3OB 1FD8A 4WFNQ 5DRRA 3PR4A 4X4RA 5E33A 1X4HA 3PHTA 4DG1B 1S4FA 3IG1B 2PMZD 2ZH2A 2ZH3A 4LSZB 4JI7F 4NYPA 1FDDA 1R6LA 4ITSA 4EGLA 3AXMA 1VBYA 3UHMA 2IRXA 2E5HA 4KSEB 3Q0AA 5B08A 4ECZA 1BE4A 2DGSA 4FW7A 1IM6A 2IY5B 5GMDA 4YY3F 3VALA 4JI0F 4OJHA 5D3GB 1JKHB 1MROA 2E29A 5KFRA 3WHIA 5A6PA 3GV5B 4I0WA 1RTDA 2Q79A 4IFDB 4OJ1A 3NGUA 4URSA 1Y4UA 2NUUG 4LSLB 5KFSA 1ZYQA 4DPYA 2VQFF 3MEDB 4I2QA 3QRRA 3TZXA 3DU6A 4KGXB 2DPJA 1VQ6S 2CPZA 2JNJA 2MZQA 2YWWA 2V50A 3CJRA 4DMZA 5BYSA 1VIXA 4ZPTR 2C3MA 3RYLA 1T9VA 2M7SA 3QGGA 3ZTRA 1S1VB 4MH8A 4DUZE 4WTYA 4F3MA 1RLCL 2R7SA 3M6XA 2J0QD 1ZAWA 3I32A 3DN9A 5HAOA 3K5LA 3UVJB 4AFFA 2DKOB 1GFWB 3OQ2A 4HHUA 1RWNB 1VMBA 4BLGA 2E5LJ 4DV6F 3UI3A 2XBPA 5KFKA 1D09B 2OEJA 1ZA1B 3QGHA 5G0RA 2XM3A 4DV3F 2DY1A 3OTDA 1Q7LB 1X4EA 2WVCA 3SBMA 1YHQS 2YNIB 3KG1A 1UMJA 2CQ4A 3DLKA 4R25A 1NBEB 1IKWB 3JXOA 4AXIA 3MM5A 4X64I 2VC1A 2HAFA 4PXEA 1NAQA 4KHMA 4ZPVR 3HVWA 4DF4A 1TL3A 5GAEU 1RT3B 2NZCA 5BYRA 1OYEA 1NSAA 1YRTA 2ROEA 3VHQA 4EK2A 4RW8A 2DH8A 2W9CB 2MKSA 1NK8A 1VQ8S 4NXMF 4R1FA 3HF5A 3EDRB 2FGOA 2AMCB 2QZ8A 4LFBE 4JI8F 3N0VA 1WHWA 1FFGB 1Y3KA 1WI8A 2GO8A 2RVJA 3HSZA 5J1EB 5LL6R 1IBMF 3EGZA 3PS3A 2B7CB 1KTVA 2VOPA 4PG4A 3TVKA 3GR1A 4UF4A 2NN6D 3DI6B 2KL8A 1HFEL 3NCQA 4NZ0A 4PWDA 4DV5E 4DL4A 1JXEA 2W25A 3M8PB 2MKIA 4HACA 5K36C 1SV5B 2JHEA 1SIZA 3ET6A 3KK1B 3G8QA 3J7YU 1S6PA 3JSMA 1V3ZA 4HY1A 3FZBA 2NPIA 2D41A 4CLFA 1N5QA 2CQ2A 1HQUB 2KXHA 4OZLA 4FF2A 4I67A 4KTQA 5ETNA 3H2VE 5DJBA 5HLFB 3CWVA 3TVYA 2Q1LA 4DL6A 3J7YI 1PIEA 1H6KX 3BM7A 3FVYA 3IGNA 3J80U 3D1HA 4F4YA 3PO4A 1GH8A 4BA2A 4E98A 4ZVIA 2XWYA 2XY7A 1FNMA 4DPUA 5EDWA 1DTQB 2F4VJ 1GTHA 1U8SA 1BWVA 4HKQA 3P8BB 4ED2A 3OR1A 2B6AB 2AWZA 3PZPA 4DV0E 2XHCA 3CJKB 4RBUA 4DUTA 3DOKB 4KHPF 1HBOA 3C2PA 2UXDE 3W7BA 2W2PP 3AY0A 2GW8A 1RT5B 3JTOA 4Y34A 1DFDA 1LWCA 1VCTA 1RACB 3AB2B 4K59A 2P9EA 2VONA 2RRBA 1MG7A 4OV6A 3P3CA 4LF7E 3NNHA 3TR5A 2ASYA 5HBMB 4KO0A 2MTLA 1GK8A 5EX0A 1HMVB 3UCZP 2NN6A 3OXLA 4NL5A 4I1TA 2Q66A 1RT7A 2KM8C 1HW9A 2OD6A 4JI4I 4JI8I 4YY3E 1YHCA 1SQGA 2FY8A 1S6QB 2VH7A 5KFTA 1Y5IB 2R8IA 2V69A 2KU7A 3UN5A 3WC2A 1LQ9A 1KLNA 1WG4A 2IA0A 1IKYB 1N5VA 1L3UA 2Z0GA 2AF6A 2O1UA 2AJ0A 2LDIA 1NJXA 4MQYA 4C0BA 2XYGB 3OTCA 3H0PA 1LXJA 3C14A 5DZ6A 4OZ0A 2VIHA 4KO0B 3PEJA 2UZAA 3H59A 2D1CA 3BGLA 1FJGI 4RR5A 1HARA 2XEXA 1WC1A 4PYAA 1FWKA 1H73A 1ULRA 1KFDA 3ISNC 4MK7A 4CO1A 2GHWA 4B9LA 4NCAA 1OQ6A 1RT5A 2RU9A 1HNZI 3I56S 3MR5A 4U7CA 4PG5A 2OO4A 3M8WA 4I2PB 2AZ3A 3RW6A 4AQYE 1NDKA 5JMNA 1HBUA 2CPEA 2EG1A 1XN9A 2K2PA 1T9TA 3RBEA 1FJGE 2JX2A 4KJIA 2IESA 3A4TA 4ZP9A 1FKAF 1VQNS 1VQ5S 2XSFA 2RQKA 3CCES 3CCTA 2Y8WA 4N76A 5K14B 1RT1B 4ED3A 1FRMA 2ZKUA 1UW4A 4PKDB 3MD3A 5KG2A 2VKZG 4NLDA 2ASJA 1A0OB 1TFWA 4OHXA 1C1CA 1SJQA 4CRJA 4IFDC 4RNNA 1Z5CA 2ZFHA 3JQJA 3FEYB 3KJQB 3PRYA 2RF2B 2LA6A 2BVZA 2RQMA 3KKFA 1Z0EA 3KK3B 2IVMA 5EHHA 2QSWA 4RU9A 2ZE2A 3AHPA 1S1WA 4BHQA 4H4MA 3JYTA 2JH3A 3RB0A 2X1FA 4JI8E 1BHNA 2KH9A 2OMLA 2KM8B 4F4XA 2XSJA 1YK9A 1S0OA 2HWHA 1WHXA 4M5MA 2RD5C 3C19A 1FT8A 3L09A 4Q2MA 2XSJB 5IM0A 3V81A 4X66E 5D78A 3GG0A 3CC2S 3BSAA 4QWCA 2G0JA 3LQVA 4USWA 3VTIA 1Q8LA 2G9OA 3V4MA 3Q86A 4K2XA 2B4VA 2QLJB 1LK7A 3EGNA 4WP9A 4WJBA 3PX4A 1IXKA 2H1YA 2BRKA 2PEHA 1J5EI 4OI0A 4KAIA 2PGCA 3SSSA 1NMEB 2XNQA 3QJLA 5EX3A 1AUSL 3OBIA 3MOJB 1WDTA 4KGKA 1JQGA 3W8GA 3AOAA 4LQ3A 3NOGA 5GMKa 1EQ0A 5JEAA 2VBWA 4OX8A 4OZ5A 4PWDB 4UUWA 4F36A 2NXCA 1AW0A 4OX9J 5E3RA 1PKUA 1M1KT 2DRBA 4C11A 2DXDA 3MI7X 2NSBA 2GQ2A 3DLBA 1BWEA 4IG3A 3N79A 2CQGA 3QZ7A 5DGBA 2HAIA 4OYOA 3ZKBA 3GU0A 3IMQJ 2NN6F 2NXJA 5ETVA 1JLBA 3IWLA 1T0TV 1QAYA 2YKQA 1HD1A 1NK7A 4FBTA 2GO4A 1TELA 2EFNA 3A3NB 4RUBA 3W5YA 2DNYA 2HHHF 2HFVA 5KG7A 4B3RJ 3PO5A 5C42B 1P1LA 1RHMB 3QO9A 4ID5A 1KNZA 1WTFA 5G0RB 5KTQA 2BJEA 4KKOB 1B0PA 4V19J 1WSRA 1RYSA 2UXDF 4KHPE 4X66F 1H2UX 3IR7B 1B7FA 1EAYC 3SIPB 3DOLB 5K36B 4XIUA 1CJKA 4PG8A 2PO1A 3POTB 4DSIA 1RTIB 2J65A 1E6YB 4BCAA 2V6AA 1HPZB 1CJKB 5HI7A 5LSOA 2N82B 3J7AG 3RB4A 1S12A 1USVA 4P72A 1MU2A 1RTHB 1NSQA 2ZJRQ 3FNNA 1EKSA 4ZP6A 3OW2R 5J2MA 1FCAA 3LWLA 1NJZA 1B62A 4DUYI 4USVA 3X1LB 1UVJA 1S59A 4F3QA 3HX9A 3QSIA 1ZM4A 5J1PA 2HMIB 1E3PA 5C0XB 3O6QA 1FX4A 2AJ4A 5IT4A 5LMNF 2YKNA 4NCGA 5D0EA 4MIWA 4R0EA 4ZVEA 4X64F 2Y8YA 2E7VA 1RSCA 3OFHA 4IZKB 4IFDD 1XERA 2BA9A 4Q7AA 3A13A 3QJJA 3TUPA 2BA0D 2MXYA 5BYQA 2OLWA 4CLSA 4YY3J 2JT2A 2V4JB 5HN0A 1QSYA 4WIIA 3AQPA 1RU1A 1BQMB 1U6FA 2F3JA 2BOAA 2IYGA 4LSLA 1H0HB 2O5DA 2YPZA 3FSYA 3UN2A 3CJSA 5LXYA 3O3LA 3PRVA 4IDKA 2R42A 2XG8A 1TUGB 4PWWA 4ZVOB 4EWTA 4DSJA 2XMJA 1DQ9A 1DTQA 4C8MA 4ELUA 3VCDA 4J9SA 3C3LA 5BR8J 3K2YA 4I7FA 5T7LB 2EVZA 4B9TA 4RW6B 2C28A 3LP1B 2LECA 1M1GA 3SZ2A 4QR1A 4LFAJ 1NZ0A 1M5KC 2GAHC 3NGSA 2UUCI 2JWNA 3W5XA 4ZN1A 1OYRA 1F5AA 1HQEA 2R7XA 2YVSA 4R5PA 3OSPA 2HHHI 1ZPVA 2E1AA 4OHZA 1D9DA 3C6UB 4JI5J 2MZJA 3S6EA 4ECTA 3IBCB 3THPA 1Y9OA 3P49B 3L7ZB 3BQ0A 5D6GA 1OQ3A 1OPIA 2HK3A 1YRXA 2E5GA 2I1RA 3D5MA 3I4HX 3NCRA 2CJXB 3C16A 3TA2A 1NKEA 4Y6IA 3UN3A 3J81C 3UD5A 4O4RA 3H5XA 2B56A 3F41A 1OPZA 3AAWB 3BBCA 4WU3A 1RYRA 3ETMA 1B7YB 4NI2B 5KAKA 1URRA 1X8DA 4LF8F 4WK3A 1KTQA 4I2PA 2KB2A 2J9EA 4AD6A 2N3OA 4IH5A 5A8KB 1N32J 1MU5A 2OPSA 4NLVA 2WB4A 1X9MA 1UFLA 2BW2A 5C25A 3LAKA 1FXRA 3SQGB 2Q43A 1H72C 1RK8A 2XO6A 3DHWC 4DL0C 2G1DA 1Y10A 1N5TA 1UFWA 3G82B 1HW8A 2FVSA 3P06A 5F0UA 2ZUAA 5C24A 3RR8A 2VC0A 4FPRA 2LEAA 2BQRA 1XMQF 4UY8T 1XMBA 2V5HG 5DM7Q 3J7A1 1U1MA 2QX0A 1EA6A 1X4CA 2W4PA 4MU3A 1TKZA 1HL6A 3VQTA 4EBDA 4JI4F 1Q1KA 4LF2A 3CCUS 2UUAE 4YUDA 2OMOA 2HHHE 3CJ2A 3PYGA 1S0VA 1UDOA 4QPTA 4LBHA 5LL6d 4Q44A 3DKDA 2UVRA 5EL9A 1IBME 2NN6B 4GKJE 4Q2LA 2C3OA 4NMLA 1EZZB 2GV1A 5DQIA 4OO1C 1C2PA 5A6WA 2HGMA 2IFXA 3KNGA 1Q79A 1RBAA 2AYMA 2QEXS 2C2ZB 2IRYA 4JBCA 2ZM6J 4JI2I 5LSLA 4B3MJ 2GVZA 4IOAQ 3MAAA 4C97A 1BQXA 1HBOB 3UFCX 3PNIA 5I4MA 4IS9A 4IOBA 1LNQA 1MROB 4TYBA 1WEZA 1EQMA 2B6AA 1NNDA 2IAJA 4WIQA 2J9CA 5F8LA 3VAHA 2AZ1A 5C5JA 4ZVFA 1F9EB 4C8YA 2MKHA 4FYYB 3VZHA 3ZTPA 1VQ9S 3DLLQ 2CQPA 3WU4A 3W65A 5GVQA 3LP0B 2NS1B 3ZC4A 3JAMY 4CIOA 3GJQB 3VGVA 1PAEX 1I3OB 3D66A 1F60B 3DRPA 3CPWR 2H9ZA 4AYBD 3IN5A 4K4SA 2V2ZA 2Z5CA 4K5SA 2NREA 2XZWA 3GFYA 1RAHB 3OTOF 2V68A 1UJ6A 2QTWA 3OSNA 2F8MA 1KKHA 3N01A 2DNMA 4DV7E 4A8FA 1O6XA 1XNQE 1X4FA 5KT6A 1TFYA 4DUYE 4LF8E 2UU9I 4A8YA 4UY85 2DGOA 3PHEA 3EXYA 3S8SA 8ATCB 1KP6A 3O1LA 1AZSA 4ID8A 4CT9A 2RS2A 1U1RA 2UUBJ 2IHR1 4DSLA 4LF5F 4HI1A 1N36J 3WU5A 5FDLA 5KG0A 2FYXA 4WUBA 3HLUA 2W24A 3M8YA 2OSRA 1TUVA 4ECWA 7FD1A 2RJZA 5GAEI 4PWUA 4RZRA 3JQMA 2VQEE 2LJPA 4WBFA 4EEYA 4GQUA 1C0TA 4KHPI 3DRRB 2R7UA 3KRNA 4F4KA 1FERA 2WVEA 3B6BA 5GAHU 2HMIA 1TVRB 2V2QA 1Y7PA 1Q53A 2KFZA 3BGRB 3SCKE 5BR8E 2HFNA 3VR1A 3WU3A 1LV5A 1LOUA 2DNLA 4ZVTB 1R0CB 1PKPA 2YBVA 5HQ8A 4DL5A 2RILA 3I5BA 4USTA 4RO0A 2ZHOA 3K8WA 2PDAA 2NCKL 4YN3B 5A8RA 3BO2A 1ZZNA 1JMTA 1G3OA 1TP7A 3MM9A 3GQCA 5F8NA 1K0TA 3CDBA 4WU2A 3CD6S 2V0NA 4P2MA 3BSOA 1X5TA 3PVXA 4C3KA 4DDFA 2VICA 2IMOA 3D67A 3POTA 4OI1A 2RF2A 4YB5A 3R97A 1K47A 3BSNA 4K4YA 3CT9A 3MPVA 4Y2IA 4DV3J 2VA2A 4P7AA 4YR3A 5KFBA 2CZ4A 4ECXA 1RTZA 1B4SA 1S99A 2QV6A 1T9WA 3HHEA 2VBYA 3PACA 3SFGA 3ZXWA 2AQ4A 3NNCA 2PNMA 1J5EE 4LFCE 1FNXH 1S16A 2GGPA 6FD1A 2PMHA 1ELOA 3G71S 4EYHB 1N48A 1L3SA 4C8KA 1N5SA 2YQ1A 1ZXNA 1FKOB 2WVFA 1TK8A 2WB1D 2ZBCA 4LF6J 3OL9A 4X66I 2ZNYA 4U8VA 5A8RB 4CP5A 4ZIVA 2HRUA 4JI3J 1T02A 5CYQA 1RHYA 2EK6A 2ROPA 3NNAA 4XK8C 4FWGA 3LO3A 2OPPB 3Q1QA 1HIYA 1BQNA 3QLHB 4ED7A 5HJYA 2GS8A 4CLTA 1FRKA 3CXCR 1WC6A 1RLDA 2HG4A 3JB9k 1RQ0A 2IDLA 3OPKA 2FJBB 3AOCA 4EO6A 3HM9A 1JKHA 3VAFA 1FWPA 4JI0J 2ZVSA 4DS5A 2XY5A 1N5YA 1SC3B 2BQ3A 3IWNC 1FD2A 3QWPA 4ZLPA 1A6LA 4B9NA 2GHPA 1YBAA 2D9PA 3BYRA 3HD1A 3H5SA 3HO1A 1R27B 1XQIA 3R6LB 1HR0I 3L95X 4Y3CA 3ISND 8RUCA 4JI7J 3CDEA 5A8WA 4USMA 3H7HB 2OPSB 2D3UA 1NDCA 3ZZRA 4ISAA 3R5CA 3DOMB 4JI2E 1HNZE 2Y0BB 3MEEA 2EC0A 3BO4A 1HNIA 1F0XA 3THTA 4P52A 2O1WA 2DNPA 4LF4I 3MPDA 4U67Q 3JSYA 1YVFA 4M8LA 4UQTA 4F0KA 3OV7A 1Z0CA 2AE8A 3ONQA 4NEZA 5J2NB 3T9NA 4Y2CA 4DV6J 1LFPA 1HBNA 2DNRA 2UU9F 1SH2A 2I9SA 2KKHA 3AD9C 2CPXA 1WC0A 2I2YA 3HHKA 2KYXA 1MN7A 2MZSA 3WBZA 1WC5A 3ZTSA 4A8OA 5LMNJ 5H9FK 1T7PA 3MTKA 3T19A 4DR2I 5D4LA 2A3JA 2UUAI 4CLWA 3PW2A 1GMWD 4H54A 4XTTA 4USHA 4ZIWA 3KOAA 2E1RA 2N3LA 2ZH9A 4PRXA 1M5PC 4B3SI 5JVGQ 5HO4A 2IYIA 1VC6A 2BV3A 2HKEA 3NAIA 1CQNA 3Q8PB 3FMWA 4Y2MA 5EWGA 2ZZNA 1RWOB 3JSBA 1DBDA 1SC6A 4NRUA 2ZH8A 5J2NA 5HLFA 1K44A 3T1YF 3HHNB 1UJ5A 2DO0A 2K3IA 4UQGA 2JEBA 2WOMA 2WVDA 3C6UA 5D0RA 4DFKA 4LF7I 2QMXA 3K5OA 2XMTA 3PYFA 4DLGA 2IM3A 1OYDA 4LF8J 4NLGA 4MK9A 4P9SA 3OVSA 2MLYA 4IDKB 4FBUA 2YKMB 4C3LA 2ZOMA 4LF5J 3GMEA 4LF9I 3ETOA 6FDRA 1R8CA 2UXDI 1BQMA 5T14A 4DV0I 4J9RA 3NGKA 5EN1A 1P9YA 2DBBA 2J9DE 1SKUB 2M52A 2QC3A 4X65J 2W8KA 3WX4A 1ROFA 2YKOA 3KG0A 2LQ5A 4ZVSB 2QO3A 5KFXA 3ENWA 1KIJA 1TMJA 2MMYA 5HVFA 3M2VB 4N8NA 3JS9A 5A2QQ 1UWBA 1GXUA 1TKTA 2V2VA 1RT2B 1HR0F 3M7VA 2JEGA 3H42A 4W92B 3CMAS 5HBMA 3QGPA 1L3VA 4PQUA 2MDAA 2BR2A 3ILLA 3L4BC 3TOQA 4ED4A 3M9OB 2FHJD 3NS5A 1I94E 1T11A 3PXGa 2H5JB 4DQSA 3V6DA 4QBUA 2PNLA 1HNXJ 4B3TJ 1SJRA 2B4OA 2GFFA 3MMCA 4AL6A 1TK5A 4WCEQ 2SXLA 2VG7B 3CO0P 3NEKA 4Y65A 5CZVA 1MMDA 2K1RA 4LVOP 3T6BA 2EPIA 1RBOB 3DLGB 3TUJC 1JB0C 4WF9Q 2LXIA 4JI6I 3ADAC 4RBVA 3NWGA 4LFCF 4C7QA 3HKZD 1FA0A 4OX6A 2O3ZA 1JLCB 1OY9A 3QFHA 1VS3A 2JJ4D 2I38A 2UUWA 3FFIA 4LBPA 2HNDA 4ZPAA 4CH0S 2V4RA 3LPEA 1AXQA 3DCAA 3Q2SC 4LT6A 5E3CA 3EM1A 1R0AA 4ILMA 1NK9A 3W66A 4Z2XA 1YJRA 1YTYA 4P10A 2JRSA 4RW7A 1U0HA 4IO1A 4EMDA 4JV5J 4J3DA 4M5GA 1UAWA 3W9JA 3R2DJ 4GC7A 1HQEB 1Q78A 1O0PA 2RNEA 3HDSA 3MMCB 1GTEA 2XI2A 4IFYB 4KRWA 4NX9A 4CI0B 3QO9B 4USIA 4PYDA 4M5HA 1TL7A 3B4MA 1PC4A 1PBAA 1PSDA 3BS9A 3HVTB 3OD2A 4IFVA 3TZYA 3PX6A 1NZAA 5ELWA 2KHDA 3E01A 3O5TB 1F3VA 3ELHA 4F7VA 1S9GA 1RWPB 5DLGA 5C2CA 3W9HA 2HLTA 2IIHA 3MAQA 2W2MP 1JX4A 2KHCA 2YX7A 5EGYA 4MDTA 2YPYA 2HHVA 1ICEB 2EI5A 1HWLA 2L9NA 1O51A 1S9FA 4NE9C 4U3DA 1H7WA 3T1HI 2V8DA 4B3TE 3VZIA 1SQFA 2UUBF 1N33I 1RHRB 4K4XA 4PG7A 3RAXA 2IA6A 5CD4H 1VRUA 1UA1A 2XS5A 2YKAA 1I94I 4N56A 4MT1A 4FYVB 4ZJLA 4QYRA 4LFAE 3TQEA 3M2RA 2QT7A 3PR5B 3BEGB 3R3TA 4OI6A 1HBMA 3FCHA 4M5LA 5KG5A 2XC9A 3VF0B 4ZPDA 2IM0A 2HVDA 1G1XA 2HHTA 1Q4RA 1TUWA 1EI1A 5JEAD 1VRUB 4JV5F 1MU2B 3G2XA 4JI5E 3UDEA 2DHAA 2AGQA 2G13A 3K8VA 2EW9A 3RG6A 2CYYA 4DV0F 4FS2A 1KDNA 2FVCA 5HROB 1WKLA 3KK3A 2ZZTA 4IRDA 3P6YC 1N32F 3EZUA 3PFOA 5D4NA 5K8PA 3H40A 2W9AA 1F5CA 2K3KA 5F41A 4FVCA 4FKYA 3R1LA 3Q8YA 4QNJA 3ENVA 5AXLA 4LF5I 4L3KA 1YJWS 4ZHRA 1IR1A 1PJ6A 2CJAA 3ICLA 1RT1A 2LXUA 4F67A 5IWAJ 3C15B 4CWBA 2A6OA 3R6GB 4WP3A 4NCBA 2MJNA 3EYZA 4ANCA 4YHHJ 1QDUB 1DJ0A 4KC5A 4I6YA 4U9RA 1VK8A 2DH9A 2MYFA 3T3FA 1EP4A 3OTOJ 4J7CA 2BJ1A 3DLEA 5KT4A 3OUYA 2NN6C 2C38A 1DHMA 1S9EB 1T05A 4MKVA 3TJ9A 1NM2A 1CJVB 4PQAA 4CLYA 3TVZA 3KLFB 2DPIA 3EDQB 3HMJG 3AJ2A 3R7SB 1XEZA 2KT5A 4B3SE 2OJ3A 2VDHA 3BGOP 1E6VB 4FNIA 1UDSA 3H2LA 4K2JA 2CQ3A 4GO5X 2LEBA 4HVZA 3JAMC 4NLSA 4DR2E 2EBEA 3K89A 3MMBB 4L74A 5IQQA 2MKKA 2MLZA 4ECRA 4O3SA 4Q0BA 3M6UA 2VU5A 4B3MF 2BACA 1Q5YA 4GKJF 3P5BP 2QGFB 4CNZA 4TNOA 4P7TA 4ENOA 3KDNA 4RLEA 4LF4E 4XDDA 5F8HA 1Y00A 4JYAF 4FW4A 4ECYA 3H25A 3MEGB 3B82A 3V4IA 1VBZA 4CO5A 3J80Q 2RUGA 3BF4A 2MQNA 1K1QA 1GXLA 2V9KA 2JEIA 3CJKA 4JP8A 4USUA 2IOPA 4IUFA 1RADB 2ASDA 3EJMA 4DSEA 4FWHA 4KFBB 3PG9A 2CG9A 1FJGF 4NXNF 2WSCC 2GHVC 1I1GA 4NLYA 4OJGA 3SCJE 1RREA 4DCOB 1H38A 1EIYB 5LJ3Y 2C39B 5KFNA 1YG0A 4DV1J 4KQVA 1NHHA 4YP3A 3W2WB 1UP1A 3I31A 5B0GA 4UOHA 2L9WA 4CTAA 3MECA 1EARA 4JUZA 5FJ4A 4JI5F 4IG0A 5FIIA 2FJDB 2Z2ZA 4DUYF 3CCVS 1SL1A 2CJYB 5C0XF 3ILOA 4TVAB 1N33F 2E1MC 1KEKA 5KFFA 3IRWP 2R2RA 3D9BA 2NXUA 1JJHA 2C2MB 4DX5A 3MPWA 3GIMA 4I4BA 3HCXA 1YJNS 2Y1LB 3O8WA 1XNQJ 4QU7A 2VPWB 1HQUA 3LGMA 4J91A 5GAGU 1DTTB 2QFIA 1T9YA 2CQHA 2V34A 1SPBP 4KGVB 2HNYA 2ZD1B 3TP2A 5DG8A 3RAQA 1NJWA 4CO0A 2IJFA 1VHFA 3J81Q 3UNGC 2DRAA 4A8QA 4RL1A 4DV5J 2FPHX 5JJBA 4LRFA 4Y2AA 3BO3A 1AROP 4G1QA 4WFXA 4UZCA 2DHHA 1SH0A 2JFDA 2M70A 3E3XA 3A8IA 4TY9A 3T41A 4I6AA 3PYDA 3W62A 1I6JA 4OYWA 2HHQA 4KV8A 4CDIA 1B64A 2NYHA 4DR3I 2HBZB 4OI2A 1T3NA 2QLWA 2O1PA 2V8HA 3EMTA 3HD2A 1IKVA 3D0IE 4ZVRB 4DBQA 5KFPA 4ECQA 4G6VB 3GR0A 4M5IA 4OO1A 1FRIA 1HNXI 2RDJA 4PRVA 3KLGA 2KT3A 3BR8A 2VG5A 4B9SA 2HVHA 2O3DA 1EB0A 2VFSA 2YWHA 3SCIE 3MR6A 2KDOA 4RW8B 2UUTA 4DHVA 5L46A 2N4CA 1UVIA 2K8GA 2F1FA 2R4FA 4OYPA 3VGSA 2GMJA 2OEKA 1OS5A 2RE1A 3M8SA 3T1HJ 2X7IA 3B8HA 4ZPWR 4A48A 1NH7A 2CNLB 1NHUA 2DNOA 2HGNA 7FDRA 1VQOS 3KLIB 3I9ZA 2MB0B 1AFIA 1TAQA 3NG8A 1R6MA 4DV5I 3KLIA 1N33J 3CD7A 2VPXB 3Q6MA 2AEJA 1YX2A 3CJ4A 3DRYA 3QFWA 1X5SA 3I5AA 4LR9A 4CYUA 3PYEA 3KYLA 1JLAA 3DYAA 1FRJA 3KDOA 4A8KA 2WK4A 1DZ5A 4LF9J 2PO0B 3C8YA 4NLPA 1URNA 2BJ7A 1RHUB 4IOCQ 1CEZA 2WNRA 3SQGA 4LF8I 2PO4A 4O4GB 1MSWD 1XNQI 1D6TA 1YBUA 3MCSA 1JJ2R 2VG5B 4Z7YA 2RQ4A 1B0TA 4IQXA 4DV7I 4LF7J 2EEYA 4LF6E 1RT6B 2ZKTA 4ES2A 1RA6A 1RAIB 3R5JB 1KVKA 3FKBA 1S10A 1S48A 2ILZA 4TU8A 2IBOA 4FYXB 1TAUA 1F9HA 1SC4B 4DZDA 2XO7A 5HQMA 3HVRA 1VRTA 1H7UA 1SKWA 1I51B 2FHMA 2P9CA 4X64E 1S49A 4GKKI 1U1OA 4QWDA 1WKJA 4OYMA 2DGWA 2M4MA 2MSTA 2CQIA 3KHHA 1F6TA 2RUSA 2Z58B 3MEKA 3Q23A 1FJEB 3EZ5A 1JLGB 4WUCA 3K17A 5HMXA 2G1HA 2CJBA 3CUNA 4A46A 2FVQA 4NLRA 5C24B 3SCLE 2IVYA 2QFJA 1N52B 4GKJJ 3PS1A 3KUHA 2PFDA 3V5RA 4DV6I 5IT9Q 3ZM7A 4WPAA 5IT0A 4DI6A 1W7WA 2R8KA 4DUZI 3J80C 3UPFA 1WUUA 1S76D 3HI9A 3R8YA 4PCQA 2QL9B 4GC6A 2MEWA 1FNOA 2OSQA 4JI1I 2E44A 1IJFB 4J5OA 5L39A 5AXNA 5DG9A 2JSXA 1X4GA 3F73A 2F4VF 1WF1A 2EXUA 3L7ZA 4DPTA 5CHCB 5DDOC 2FVPA 1JLGA 2N4DA 3IM9A 2ATLA 1N0VC 1U47A 1KVJA 4DL3A 2RAQA 4GO7X 3RUBL 3L7UA 2QSFA 1DAXA 2BJDA 3FBCA 1SUQB 4KE5A 5ITHA 1TL7B 1RTJB 2Q6BA 1X31C 5L1IA 4FPIA 3GYNA 3QT5A 3G6YA 2C38B 4K0KI 4HR2A 1F1BB 2IJNA 2HQFA 4PPZA 1R43A 1IWGA 2Z30B 4WFYA 5D4OA 3GSIA 1LEOA 1WOOA 3CTRA 2RQCA 4AL5A 4QIGA 5HATA 5B0CA 2AJ2A 3RRKA 1AYEA 4LJMA 4Q5VA 2EG2A 2MLXA 3K59A 2ZH6A 3WDOA 1XR6A 4ZA1A 3NZKA 5IWAI 3DM2B 4CQ1A 2XMUA 3O2IA 2JFKA 4DR7F 2EKNA 1WC4A 3TANA 4WZQA 4M5DA 3U1NA 3P76A 2YQ0A 1RAEB 2XULA 4IYQA 1P42A 2O01C 2NSCA 3MMBA 4YHHF 1TU0B 3DYAB 2W4CA 3UW1A 1IR2A 3Q8SB 4FNHA 3FZ2A 5AXMA 1HNWJ 3MFHA 1UA0A 3M8ZA 3MR7A 1UPPA 3BKFA 2V4JA 4X65F 2CQ1A 2W7PA 4MYTA 5M2PA 1S6OA 5KFJA 3QRPA 1FTRA 1Y11A 3MM8B 2RS8A 3ZNUA 3BREA 2XS2A 1VQLS 1SJ3P 3LP2A 1T03B 2UUAF 1RHKB 1S9EA 4QWBA 5BXIA 3VQSA 5IXUA 3ZZOA 2B51A 2UUCE 2H4WB 2OHDA 1TQLA 3M2UB 3N5BA 3AH6A 4JI3F 4URLA 4P2XA 5E3QA 4RU2A 4CH1A 4DPWA 2RKIA 1ZBTA 3HULA 3GIKA 4RW9A 4RJVA 3Q89A 2J8SA 3I5CA 5LT5A 4GMKA 4NBQA 3HT3A 2DY9A 2X36A 1FKPA 3L9ZA 3VAJA 1C4AA 3BR9A 4QPXA 2BE7D 4Q0BB 1M0SA 4K7QA 2E5LE 4KHPJ 3FRYA 2AU0A 1VOMA 2ZBKB 5KFMA 2VF3A 2M8DB 2YNFA 2IOQA 4PPDA 2PMWA 1MWYA 3CDJA 1R0BG 4USJC 4F25A 1NEEA 1AUDA 5F8JA 4H4KA 4USKA 3ENAA 1K73T 1VRQC 2AP6A 3LW5C 3OL6A 5F9NA 1WSVA 2QA1A 1NH8A 2ZUGA 3GJTB 2LQ8A 2MKYA 3C16B 4TU9A 3E01B 3R5AA 4IO9Q 2WBMA 3CWJA 3CCRS 4U7UD 4MKYA 1HHQA 3CB4A 2RIJA 4NLTA 2L08A 3BV8A 2UU9J 1ZPWX 4N7TA 1EP4B 2DHSA 2YH1A 1DURA 3IFEA 2A1BA 5B09A 3BSCA 4CO3A 4LVNP 3DDIA 3D3BJ 1JLBB 3K5MA 3T5HA 1QM9A 5C25B 3HSJA 1NSKL 5B0EA 5LMUF 1U1KA 2BQUA 3EPIA 5LXRA 3J81Y 4W98A 2WCXA 1V3SA 4NA1A 3TA0A 3M6WA 3W2WA 4Z7CA 2HQDA 4MU1A 1FO1A 4N8OA 2VBXA 1HI0P 1OWXA 3MECB 1BGXT 2VOOA 3GPAA 1VLOA 3D28A 4CO4A 1PYOB 1SKSA 2JE6B 2HURA 4JI7E 3FBEA 3R9LA 3QSYB 2CNOB 3W64A 2HNZB 1N34F 2KO1A 2JLEA 5KFWA 3MM6A 1BY9A 1V5IB 2XLIA 4Q8FA 4X4VA 3SSQA 2ZM6I 3TAPA 5D0GA 3MR2A 1RR9A 2PIIA 4FYWB 2KYZA 3TNVA 1QAJA 5KFOA 3KUEA 1S7HA 3TJAA 3WZ0A 5BJRA 2U2FA 4LRBA 4NXME 2C2EA 2FUG9 5A8WB 2AJQA 1N88A 3KHGA 2MJUA 1NZ8A 1U0SA 4KGMA 1C0UB 1YDLA 3GYXB 3MCMA 2YX4A 2WSFC 3Q8RB 1W2IA 5JVHQ 3GCXP 1NJIT 3GJRB 3W63A 5IWAF 4I56A 3NGDA 2KZMA 1ITPA 4BA1A 5JEAF 3CO9A 4DR7I 1RT4A 4DQRA 4ICLB 5G4DA 5K36D 2MY7A 2OFHX 3HHLA 3U7JA 1PJ5A 3KK2B 2ZHAA 3MD1A 1LW0B 3OT9A 1B0VA 2E5IA 3QAEA 2HS4A 2UVWA 1IN0A 2GZOA 4H4KC 1NK6A 1OYSA 1VQYA 3K58A 4NZ7A 4ALZA 4NLWA 4DV0J 4CCHA 2KVIA 1IQTA 2HQ3A 3UVJA 3HSDA 2UXDJ 3IXQA 2BE2B 2VL1A 3AOBA 3H4LA 4MFBA 2HGLA 1QJHA 3WIUA 4CLZA 2VG7A 1VJWA 1KC8T 2PFFB 3TX8A 3ILJA 2Y3YA 3S7RA 4MFBB 3N6LA 3QATA 1Y4ZB 2DO4A 1JNRB 2HFZA 1S0MA 3H20A 4DSKA 3M85D 3C46A 1RAGB 4NA2A 1X5OA 4DR5I 4RUCA 3MXHP 1NXIA 5A0YA 3N6NA 1SL0A 5ETKA 1CBKA 4CNYA 2OAUA 4ECUA 2IC3A 4MAKA 4PEOA 1RZMA 2NUHA 1RAOA 3HZEA 4KH1B 4RKUC 1VBKA 4TY8B 2ZH5A 2DR7A 1LW0A 4YR0A 1U02A 1U6ZA 1RT2A 4TKTA 1CPZA 3R7BB 1R0AB 1TKTB 1Z0WA 3U1KA 3KMSA 3KXDA 2C42A 2M8HA 3FK4A 3NGTA 4G65A 4B3SJ 1X7VA 4OX7A 5L8RC 4CH7A 1Y6ZA 2WRMA 4PU9A 2HZAA 1JLQA 2C2NA 1V5VA 2DJWA 1KLMB 3MWBA 3N6MA 3QIPB 2A2CA 3OXGA 1NJYA 4ICLA 3UQSA 4YB7A 1E6YA 5DQHA 1U49A 2XTJP 5FD1A 1RJJA 4AQYI 5IS2A 2IJRA 3PM9A 3MHYA 2F63A 2L48A 3NKYA 2HHHJ 2R2UA 1XMOJ 1REVA 2CGEA 2Z2YB 2ALYB 1FDAA 1ZAVA 2Y1RI 3BGRA 3CW2C 3JYTB 4NXNJ 1WOSA 1REVB 5MAOA 1HNZF 3ITHB 2G4BA 4PRFA 3H1CA 3IC1A 4QIWD 1VQ7S 2ZWOA 1Y3JA 2BM1A 4NEYA 5I42A 1Y0HA 1WG1A 4PQUB 1YITS 2MQLA 2E1CA 4O3OA 3K5PA 1IBKJ 4KPCA 4B9VA 4ED0A 4UTGA 4HHJA 2DGXA 3W3SA 1JLQB 1QAIA 3M2VA 2ZH7A 2C2KB 4RNHA 1AZSB 2NXNA 1MNEA 1GT8A 3HK2A 1NHIA 1ACMB 1ZETA 1S97A 1N5YB 2X51A 4ZMMA 3Q8VA 2ADCA 5DDQC 3NP5A 3WIVA 1CS4A 4JI0I 4YY3I 1C1CB 1XC9A 5KFVA 4FW5A 1QAXA 2KFYA 4XO0A 1R8HA 1TR0A 2PEBA 4TU7A 4JI4E 1AT1B 2DNHA 1BQNB 4C3MA 4NWBA 1FFSB 4ER8A 3BJYA 1YI2S 3C66A 5C0XE 2EK1A 4MIBA 1PYSB 2XMMA 2YQ3A 3ITHA 2FJXA 2CG8A 1VC0A 1NB7A 1NO8A 3H5YA 3D1QA 1OY6A 4OLOA 3PW0A 1PAUB 4AUKA 4DV4F 2PI4A 2B43A 4ETZA 2GQ0A 2VFRA 3DHXA 1U0HB 4YB1P 3OLAA 5IOLA 3KMQA 5A2QC 2VQFE 1N36E 1WF2A 2YNFB 4JV5E 5A2QY 2FTRA 3CIZA 2D9OA 2LXFA 2YNIA 3UO0A 3QT7A 1NLKL 4G1IA 5D77A 3ZZZA 4C6AA 5HL7Q 1KHVA 5CABA 4A47A 2HFOA 4UOCA 1C1BA 4WK1A 2HSEB 5KFYA 4EUVA 4QNKA 3TARA 4AXJA 4EU0A 2IM1A 4IZJA 1RAJA 2CG4A 3G9CA 2UVVA 4J9LA 1YJ9S 4JYAE 1MWQA 4KBIA 1DLOA 5FLXU 4BC9A 1FJCA 1IBKI 3RR7A 4H4OA 1CJTA 5HP1A 2ZC3A 2Q2EB 1U2RA 1C0UA 3CJTA 1G6BA 4KHRA 2RMLA 2R7TA 3MMAB 2B4UA 2DT9A 2H5EA 1NRKA 2AX0A 2F7VA 4LBIA 3IS9B 4HTIA 2H65B 5HMWA 4B9UA 2AGOA 1U2FA 5DRKA 3W61A 3FBBA 4EBCA 3L7OA 4I68A 1I94F 4FYDA 1HNIB 4DR4E 5HMYA 4E2FB 2RB7A 1IM4A 1RT3A 3J7AN 2ZJQQ 2VUGA 1TVRA 3DOMA 5ETSA 1MMNA 2NQPA 4DR1I 2D74B 3G86A 1UDNA 1Q8BA 3DLKB 3CE8A 3OFGA 2KXNB 2H5IB 3SSRA 4CM2A 2AIRB 3T1HE 2EFGA 3KHRA 1RCOB 3CNQP 3QZ8A 1J5OA 4M95A 1LWXA 3DDNA 2XNRA 1DLOB 2UXBE 1XMQJ 1ZAXA 4LF7F 5FDLB 5L1KA 1BKNA 3I6PA 1RWXB 2QG9B 2PE8A 1C1BB 2POKA 3GE9A 4N77A 2DEJA 4O3PA 3CDIA 4LFBI 2IC3B 2C1EB 4IRKA 2HQCA 1Y5NB 3EUNA 5DQGA 3ZO7A 2BA1D 3KLFA 2DNNA 1CJVA 4PXDA 3KK1A 4NYZA 5K36E 3CULA 3W8PA 3DD6A 1T05B 5B7WA 9RUBA 1R89A 2B4PA 2CQBA 2GX8A 4WFBQ 1B63A 3UCUP 1OSDA 5DS7A 2OGUA 2BKPA 5CCLA 2Z5CB 1N34I 3RB6A 2BR0A 3W5ZA 1XTZA 1LK5A 2HNZA 3P3EA 3R2CJ 2HHWA 1NHVA 2ZM6F 3W1YC 1WTBA 2HBQB 4DEZA 3M4XA 1HNWF 1XNRF 3ET6B 2OTLS 1Z5AA 2AGPA 2F9JA 2FZCB 2C3PA 2XMAA 1LWEA 3BB5A 3H98A 5KG3A 1WHYA 2BUNA 2HK2A 4ZJOA 3I55S 1KONA 2VDIA 4DQQA 2NR0A 2YNHA 1HYSA 4B3MI 1REGX 2P5VA 4C2MA 3J81j 3GIIA 4OLPA 1CJUB 1F3FA 1SJFA 1N6QA 4RUHA 2R7WA 2LA4A 5J1EA 2VZ9A 1HNZJ 1UDQA 4WUDA 3MM5B 1VJQA 3D4JA 4I7FB 3K7RA 2Y1JA 1KSPA 3NBPA 2DITA 1IKXA 3THVA 1NPKA 2H3EB 4LCHA 2VODA 2MQPA 5LMNE 4FKXA 3CJ8A 1R6YA 2O1VA 2EFOA 4WKRA 3TI0A 2MY8A 4DV7F 2DYAA 3HT0A 3F56A 2GA7A 3FMBA 2ILYA 3WC0A 3PJ9A 1ZM3A 2ATCB 1QE1A 2IAJB 1R8PA 2J0WA 4PZVA 5KOWA 1VQMS 4I3HA 4JI3E 8AT1B 1HI1A 5A2QU 1TKXA 1UFKA 4QIFA 1RT6A 2BM0A 4DX7A 4TQRA 1ZS6A 1N34J 5CYMB 2MGZA 3LWMA 1VDHA 2XMWA 1KRPA 3G6ES 3M85G 5DRPA 5GADI 1YH8A 3P3GA 4FW6A 2GMHA 2R8HA 2E66A 5KFZA 3B4DA 1N32I 3I0SA 2DEIA 3TYTA 2CIMA 4G3IA 4N41A 1IUJA 4HH0A 2IVFB 2X1AA 3CEDA 1KQSR 1FKOA 3A8KA 1S1UA 2W2OP 2ADBA 3DRXA 4C8OA 2XLKA 5A76A 4LFBJ 1HD0A 3LA0A 5I3QA 4RBTA 2AHOB 2X1BA 2WZ1A 3I4PA 3F44A 2OP5A 2P8IA 3NWRA 1NHJA 1XMQI 2CXEA 1XIQA 3AA9A 2JOQA 4PAAA 1QD1A 4JOUA 2AT1B 4Y28C 5JEAC 3QRQA 2F4VI 3MGJA 3FQKA 4DV2E 1HNWE 3DDKA 3M2RB 1SVDA 2CPYA 3FFIB 4O3NA 1TL4A 3N5FA 1RHQB 5LJ5Y 5LSRA 4HT7A 4RW9B 3ZTOA 4RNFA 1NCLA 1H3DA 3GILA 4DR1J 1Z0GA 2PSZA 3PW7A 2BJ3A 3DMJB 4ZP7A 1D8ZA 3OHBA 3KLGB 1Q0NA 2K1RB 4WZMA 1ZXMA 1S1UB 1XR7A 3CVKA 2UUCJ 2RHSB 3BKUA 2LFVA 1P27B 3NRBA 4F50A 4OYXA 4RW6A 4C0HA 1B99A 4C0OC 3UR0A 2WONA 1NDLA 1N0UA 1T9UA 2JLFA 4ES3A 3V6DB 4X2BA 2EFPA 2QLXA 3HSGA 4OO1D 4BWMA 4HACB 7AT1B 4XPCA 3G8TA 2HEKA 1KWMA 3V6JA 2KRBA 2QRRA 2ZBIA 1HNWI 1IWAA 4LSNA 1G4CA 2DXFA 3MM6B 1L5UA 3DLJA 4ZOSA 3D6HB 4AIDA 4IFDA 1EETA 4P73A 2NPFA 1TL5A 1PG5B 1M1HA 5HQLA 2DNGA 2RDDA 5IM0B 4HHHA 3HHLD 1T95A 1UZDA 2BEFA 3GLJA 2VBZA 3QYYA 1G7CB 1U1LA 2E5JA 4LF1A 4ZVUB 1UW9A 3TEGA 1RAAB 5IC6B 3D6TB 4ZVPB 3M7NG 1JXVA 2FJVA 4RUAA 4MU0A 2CWKA 2O66A 3HZGA 3PEHA 1XNRE 2GQCA 5ETMA 3PKYA
chains in the Genus database with same CATH topology
2ZITA 1J5EI 2V34A 1H7SA 4FW9A 3J81Q 4JI3I 4DR7E 4XTJA 2Z5BB 3PYDA 4DR3I 4JI5I 3ZKBA 4B3RI 1DARA 1HNXI 4NXNI 4B3TI 1XMOI 4LFAI 5LMUE 4B3ME 4JI7I 4OX9I 4KHPE 2X7IA 3B8HA 1Y4SA 2VQEI 1ZM2A 4DV5I 3J7AG 1FWLA 3QT8A 1USVA 3PYEA 4LF5I 4X62E 2UU9E 4LF8I 1B62A 4DUYI 1D6TA 4YHHE 1XNQI 4LF6E 4Z7YA 4DV7I 1ZM4A 1KVKA 2AJ4A 2A2DA 3OTOE 1PVGA 4IZKB 1H7UA 4DR6E 4X64E 4GKKI 1A6FA 4DV3I 2R42A 3K17A 2UXBI 1OJ4A 3T1HI 2UXCE 2O1TA 3V5RA 4DV6I 4JI6E 5IT9Q 3ZM7A 1NZ0A 4DR1E 4DUZI 2UUCI 4DV4I 3J80C 1WUUA 4DR4I 4JI1I 3ZKDA 2HHHI 4DPTA 4DXLA 1HR0E 4M1KA 4HACB 2HFUA 2HK3A 1ZM9A 1N0VC 3V2UC 3J81C 4DV1E 1N33E 4DU7A 3QT5A 4LF9E 4K0KI 1MU5A 4K0KE 1H72C 5IWAI 3P06A 3WU6A 4JI0E 4X65E 4HYMA 1QZRA 1EA6A 4HXZA 1HR0I 4MYTA 2UUAE 2HHHE 3PYGA 4JI1E 1IBME 4GKJE 2R3VA 4DV4E 2UUCE 4RPFA 1USUA 4DPWA 5FLXQ 4UT4A 3HULA 2Z5BA 4JI2I 2UXCI 2J7KA 2X36A 5GMEA 4DV3E 1Z5CA 2E5LE 2ZBKB 3LNUA 2VF3A 2IOQA 4GKKE 3WU4A 4USKA 4DR6I 4IZJD 2Z5CA 2V2ZA 2VQFI 1KKHA 4DV7E 4DR5E 3F0NA 4YHHI 1XNQE 4DUYE 4LF8E 4X62I 2UU9I 1H74A 4LF5E 4DPXA 2HFSA 3ZZ0A 1Z5BA 4JG4A 4X66E 3LTOA 4Z7CA 3WU5A 4FWDA 4WUBA 4LFCI 3J7AM 2VQEE 2LJPA 4JI7E 4KHPI 3ZZTA 1UEKA 5LMUI 1Z0TA 5BR8E 2V2QA 2ZM6I 3WU3A 1RR9A 1HNXE 4B3TE 1PKPA 3Q6NA 1Z0VA 4NXME 4NXMI 1FI4A 2ZM6E 5BR8I 4DR7I 1K47A 5A2QC 2CZ9A 4P7AA 3GONA 1J5EE 4LFCE 1S16A 1ELOA 1ZXNA 4X66I 3H4LA 1XNRI 4IZKA 3PRYA 4FWGA 3Q1QA 4DR5I 3B78A 4PRVA 2VQFE 2GS8A 1Z0WA 4WUCA 1Y6ZA 1Z59A 4PU9A 2A2CA 2E5LI 4USMA 4AQYI 3K1JA 4JI2E 1HNZE 2CGEA 3M6AA 4URLA 4P52A 2O1WA 3T1YI 4LF4I 1Z0CA 5FWKA 1HK7A 1VISA 1FKAE 2BM1A 4GKJI 1IBMI 4DV2I 2F4VE 4UTGA 4DR2I 2UUAI 1Z0BA 1XMQE 1NHIA 2E1RA 3K85A 4PRXA 4B3SI 4X65I 2HKEA 2BV3A 4YY3I 4JI0I 3JAMQ 4JI4E 4DU8A 5IWAE 4JYAE 4LF7I 3PYFA 2GQ0A 2PNMA 3Q6MA 2UUBE 1N36E 4LF9I 2UXDI 4DV0I 3QT7A 2Q2EB 1N33I 4DV1I 4IZJA 1KIJA 5GMDA 5A2QQ 2V2VA 5LMNI 1IBKI 1Y4UA 1U2RA 4DPYA 4ED4A 1I94E 5IT9C 2PNLA 2WW4A 4DR4E 4DUZE 4DR1I 3QT6A 4DV6E 4JI6I 1MX0A 3T1HE 2EFGA 2UXBE 1IBLI 1BKNA 1N34E 4X64I 2DEJA 4EMDA 4LFBI 3OTOI 3HJCA 4R1FA 4LFBE 4LF6I 1B63A 2Z5CB 1N34I 1IBLE 2OI2A 5LL6R 2HKJA 1KTVA 1Z5AA 3LPSA 4DV5E 4HACA 2HK2A 4OX9E 4B3MI 4HY1A 5FLXC 4LFAE 1I94I 4WUDA 1XMOE 3D4JA 4NXNE 3CWVA 5LMNE 1IBKE 1EI1A 1PIEA 4B3RE 2O1VA 4DR3E 4JI5E 4ZVIA 1FNMA 4DPUA 4N3OA 4DV0E 1ZM3A 4I3HA 4JI3E 1N36I 2UXDE 2UUBI 2BM0A 1MG7A 4LF7E 4JYAI 1N32I 2DEIA 4JI4I 4MYUA 4JV5I 4JI8I 4IZJB 4YY3E 4B3SE 1NHJA 1XMQI 2O1UA 3JAMC 4DR2E 2F4VI 4DV2E 4FN5A 1HNWE 1S4EA 2V8PA 2Z5EA 1XHKA 1FJGI 1Z0GA 4LF4E 3T1YE 2XEXA 1FWKA 1ZXMA 1H73A 1HNZI 3B82A 3J80Q 4AQYE 1N0UA 5L3JA 1FJGE 2IOPA 4FWHA 2CG9A 1HNWI 1RREA 3ZZUA 2NPFA 4KQVA 1NHHA 1Z0EA 4JI8E 4JV5E 1N32E 1XNRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIT A;  1J5E I;  2V34 A;  1H7S A;  4FW9 A;  3J81 Q;  4JI3 I;  4DR7 E;  4XTJ A;  3PYD A;  4DR3 I;  4JI5 I;  3ZKB A;  4B3R I;  1DAR A;  1HNX I;  4NXN I;  4B3T I;  1XMO I;  4LFA I;  5LMU E;  4B3M E;  4JI7 I;  4OX9 I;  4KHP E;  2X7I A;  3B8H A;  2VQE I;  1ZM2 A;  4DV5 I;  3J7A G;  1FWL A;  3QT8 A;  3PYE A;  4LF5 I;  4X62 E;  2UU9 E;  4LF8 I;  1B62 A;  4DUY I;  1D6T A;  4YHH E;  1XNQ I;  4LF6 E;  4Z7Y A;  4DV7 I;  1ZM4 A;  1KVK A;  2AJ4 A;  2A2D A;  3OTO E;  1PVG A;  1H7U A;  4DR6 E;  4X64 E;  4GKK I;  1A6F A;  4DV3 I;  2R42 A;  3K17 A;  2UXB I;  1OJ4 A;  3T1H I;  2UXC E;  3V5R A;  4DV6 I;  4JI6 E;  5IT9 Q;  3ZM7 A;  1NZ0 A;  4DR1 E;  4DUZ I;  2UUC I;  4DV4 I;  3J80 C;  1WUU A;  4DR4 I;  4JI1 I;  3ZKD A;  2HHH I;  4DPT A;  4DXL A;  1HR0 E;  4M1K A;  4HAC B;  2HFU A;  2HK3 A;  1ZM9 A;  1N0V C;  3V2U C;  3J81 C;  4DV1 E;  1N33 E;  4DU7 A;  3QT5 A;  4LF9 E;  4K0K I;  1MU5 A;  4K0K E;  1H72 C;  5IWA I;  3WU6 A;  4JI0 E;  4X65 E;  4HYM A;  1QZR A;  1EA6 A;  4HXZ A;  1HR0 I;  4MYT A;  2UUA E;  2HHH E;  3PYG A;  4JI1 E;  1IBM E;  4GKJ E;  2R3V A;  4DV4 E;  2UUC E;  4RPF A;  4DPW A;  5FLX Q;  4UT4 A;  3HUL A;  2UXC I;  4JI2 I;  2J7K A;  2X36 A;  5GME A;  4DV3 E;  1Z5C A;  2E5L E;  2ZBK B;  3LNU A;  2VF3 A;  4GKK E;  3WU4 A;  4USK A;  4DR6 I;  2V2Z A;  2VQF I;  1KKH A;  4DV7 E;  4DR5 E;  3F0N A;  4YHH I;  1XNQ E;  4DUY E;  4LF8 E;  4X62 I;  2UU9 I;  1H74 A;  4LF5 E;  4DPX A;  2HFS A;  3ZZ0 A;  1Z5B A;  4JG4 A;  4X66 E;  3LTO A;  4Z7C A;  3WU5 A;  4FWD A;  4WUB A;  4LFC I;  3J7A M;  2VQE E;  2LJP A;  4JI7 E;  4KHP I;  3ZZT A;  1UEK A;  5LMU I;  1Z0T A;  5BR8 E;  2V2Q A;  2ZM6 I;  3WU3 A;  1RR9 A;  1HNX E;  4B3T E;  1PKP A;  1Z0V A;  4NXM E;  4NXM I;  1FI4 A;  2ZM6 E;  5BR8 I;  4DR7 I;  1K47 A;  5A2Q C;  2CZ9 A;  4P7A A;  3GON A;  1J5E E;  4LFC E;  1S16 A;  1ELO A;  1ZXN A;  4X66 I;  3H4L A;  1XNR I;  4FWG A;  3Q1Q A;  4DR5 I;  3B78 A;  4PRV A;  2VQF E;  2GS8 A;  1Z0W A;  4WUC A;  1Z59 A;  4PU9 A;  2A2C A;  2E5L I;  4USM A;  4AQY I;  3K1J A;  4JI2 E;  1HNZ E;  3M6A A;  4URL A;  4P52 A;  3T1Y I;  4LF4 I;  1Z0C A;  1VIS A;  1FKA E;  2BM1 A;  4GKJ I;  1IBM I;  4DV2 I;  2F4V E;  4UTG A;  4DR2 I;  2UUA I;  1Z0B A;  1XMQ E;  1NHI A;  2E1R A;  4PRX A;  4B3S I;  4X65 I;  2HKE A;  2BV3 A;  4YY3 I;  4JI0 I;  3JAM Q;  4JI4 E;  4DU8 A;  5IWA E;  4JYA E;  4LF7 I;  3PYF A;  2UUB E;  1N36 E;  4LF9 I;  2UXD I;  4DV0 I;  3QT7 A;  2Q2E B;  1N33 I;  4DV1 I;  1KIJ A;  5GMD A;  5A2Q Q;  2V2V A;  5LMN I;  1IBK I;  1U2R A;  4DPY A;  4ED4 A;  1I94 E;  5IT9 C;  2WW4 A;  4DR4 E;  4DUZ E;  4DR1 I;  3QT6 A;  4JI6 I;  4DV6 E;  1MX0 A;  3T1H E;  2EFG A;  2UXB E;  1IBL I;  1BKN A;  1N34 E;  4X64 I;  2DEJ A;  4EMD A;  4LFB I;  3OTO I;  4R1F A;  4LFB E;  4LF6 I;  1B63 A;  1N34 I;  1IBL E;  2OI2 A;  5LL6 R;  2HKJ A;  1KTV A;  1Z5A A;  3LPS A;  4DV5 E;  4HAC A;  2HK2 A;  4OX9 E;  4B3M I;  4HY1 A;  5FLX C;  4LFA E;  1I94 I;  4WUD A;  1XMO E;  3D4J A;  4NXN E;  3CWV A;  5LMN E;  1IBK E;  1EI1 A;  1PIE A;  4B3R E;  4DR3 E;  4JI5 E;  4ZVI A;  1FNM A;  4DPU A;  4DV0 E;  1ZM3 A;  4I3H A;  4JI3 E;  1N36 I;  2UXD E;  2UUB I;  2BM0 A;  1MG7 A;  4LF7 E;  4JYA I;  1N32 I;  2DEI A;  4JI4 I;  4MYU A;  4JV5 I;  4JI8 I;  4YY3 E;  4B3S E;  1NHJ A;  1XMQ I;  3JAM C;  4DR2 E;  2F4V I;  4DV2 E;  4FN5 A;  1HNW E;  1S4E A;  2V8P A;  1XHK A;  1FJG I;  1Z0G A;  4LF4 E;  3T1Y E;  2XEX A;  1FWK A;  1ZXM A;  1H73 A;  1HNZ I;  3B82 A;  3J80 Q;  4AQY E;  1N0U A;  1FJG E;  5L3J A;  4FWH A;  1HNW I;  1RRE A;  3ZZU A;  2NPF A;  4KQV A;  1NHH A;  1Z0E A;  4JI8 E;  4JV5 E;  1N32 E;  1XNR E; 
#chains in the Genus database with same CATH topology
 4K5R A;  4Z37 A;  4K0K J;  1WG5 A;  2WNR B;  1U26 A;  2PNZ B;  2MHE A;  1RDR A;  1VHI A;  2HHU A;  1I5O B;  2ZNZ A;  1JJC B;  4CT8 A;  4OL8 A;  2GCF A;  1H7S A;  4FW9 A;  4WWS A;  3MTJ A;  3CSK A;  4WE1 A;  4JV0 A;  4FS1 A;  4PUO A;  4CO2 A;  4GKK F;  4KR0 B;  3Q22 A;  5F3Z A;  1U1Q A;  4JI3 I;  3NGR A;  3DOL A;  3GG1 A;  3LOU A;  3NOC A;  3D68 A;  1H98 A;  3EGW B;  5HK4 A;  4X4T A;  3MUM P;  3KJV A;  1U6B A;  3HJF A;  5DDR C;  3FC9 A;  4OHV A;  3SI8 A;  4O0I A;  1VFJ A;  4PAB A;  4Y0F A;  1WF0 A;  2LVW A;  2FJW A;  1CC8 A;  2BAN B;  3HJV A;  2Z5B B;  2B7B B;  2I5J A;  3PDN A;  3OTE A;  3HKM A;  1WEL A;  2BX6 A;  4B3R I;  2MHN A;  3OHA A;  1R3N A;  3X3U A;  2HHS A;  2KFN A;  4NXN I;  5KFE A;  2M3D A;  3RBZ A;  4DR5 F;  4ED5 A;  4M63 A;  3VGU A;  2BYC A;  4DUZ J;  1KQG B;  1XMO I;  2KVQ E;  5LMU E;  2WSE C;  1HA1 A;  3SDE A;  5J2Q A;  5DO2 A;  1PBU A;  4C98 A;  1IKY A;  2W2N P;  4AQY J;  2RRN A;  3MPY A;  1T8E A;  3AQO A;  1XJW B;  5CZX A;  1RTH A;  5KG1 A;  3AOD A;  4OX9 I;  4QOT A;  3UWT A;  4U6P A;  3GWC A;  2GAG C;  1V3R A;  2K06 A;  3HHD A;  4F4W A;  2ZHB A;  1KVI A;  1ZM2 A;  4HI2 A;  4B9M A;  2V4Q A;  5K8M A;  2BAB A;  1Q81 T;  1CUL A;  2OPQ A;  2W1B A;  3M30 A;  1FWL A;  3QQC D;  3OFE A;  4E8U A;  2LEP A;  3TW0 A;  3CCS S;  1HI8 A;  5LM7 E;  4DX8 H;  2JLG A;  4BBY A;  4DPO A;  1NHK L;  2LQ9 A;  1RP5 A;  2MPU A;  3SV3 A;  1IJE B;  3TQ1 A;  3IM8 A;  2AJ1 A;  1BD6 A;  3NAH A;  3NBP B;  4DR5 J;  3NMR A;  4IQM A;  5J2P B;  1GMU A;  3M9N B;  3EIC A;  1RAB B;  2N7C A;  3GMG A;  1RHJ B;  2ALZ A;  4ZHR B;  2DHX A;  2PI5 A;  4LCG A;  3D6F B;  4DV7 J;  3M32 B;  4NPO A;  4YB6 A;  2CAD A;  3MMJ A;  2I5J B;  3H5U A;  4LRA A;  3CC7 S;  4J9V A;  4J9P A;  4IR9 A;  1AFJ A;  3MM7 B;  2PO2 B;  3OTO E;  2LMI A;  3TO8 A;  3U1M A;  5CYQ B;  5B0B A;  3CIM A;  4O44 A;  2OH2 A;  3OR1 B;  4P2F A;  1QVG R;  2GC8 A;  4C4W A;  1SH3 A;  1SI9 A;  3QID A;  3VAG A;  4F02 A;  3LNU A;  4RW4 B;  3GJS B;  1SJ4 P;  1A6F A;  1FXD A;  5AE2 A;  4J9Q A;  1RWV B;  2CVI A;  1HNV A;  4KFB A;  3FDS A;  2C3U A;  2UUB E;  2HNY B;  2ZD1 A;  2Q6C A;  1NKC A;  4CLP A;  1FRL A;  4JI6 F;  4DR7 J;  3O44 A;  4QW8 A;  2UXC E;  1X4A A;  1HWJ A;  5CXT A;  2JL9 A;  4J90 A;  1WJ9 A;  1IBM J;  1T3O A;  2DH7 A;  2HHX A;  4OMF G;  2DXE A;  4CLL A;  4NLU A;  1ZTW A;  4DR1 E;  1U09 A;  4DV4 I;  2J5A A;  2QL7 B;  2XZD B;  3GYG A;  4UW2 A;  2E9T A;  2G2Y A;  4ZCL A;  1IKV B;  1GMW A;  2PA8 D;  4WP8 A;  2LU1 A;  1KFS A;  1N54 B;  3L7P A;  5IFM A;  1XMO F;  5DNL A;  5T41 A;  2NN6 E;  4DR3 J;  2DGV A;  4ZPC A;  1F2G A;  5ETQ A;  2GJ2 A;  5E3P A;  3RW7 A;  3GFZ A;  3P96 A;  1S72 S;  1C4C A;  1BC6 A;  4OZE A;  1RB0 A;  2JC1 A;  5JUM A;  2XGQ A;  1PYT A;  2HFU A;  1ZM9 A;  5E5N A;  3KLH B;  4G1Q B;  4OZ3 A;  2VJU A;  4AL7 A;  1XNQ F;  4C9D A;  2DB1 A;  2XY6 A;  2CQ0 A;  4QYZ J;  5DRQ A;  5ETL A;  2G2Z A;  5KG4 A;  1VBX A;  4QWE A;  4O0N A;  1F9F A;  3GZ7 A;  4DV1 E;  2DIV A;  2JVO A;  1P1T A;  2XMV A;  2J8A A;  2RHQ B;  2YNG A;  4ZLJ A;  4PR6 A;  4JI4 J;  4OZ1 A;  3FSI A;  2EC2 A;  2V63 A;  3RTV A;  5IV3 A;  4DFP A;  2VQE I;  2HVI A;  1ZZF A;  5HSP A;  2DGU A;  2P9G A;  4DFM A;  1Y5L B;  2FQQ B;  1UVK A;  1DQ8 A;  2D7S A;  2GGP B;  1U7L A;  4QWA A;  2PD1 A;  2B8Q A;  3R5D A;  4IG0 B;  5I3U A;  2G2O A;  3OVA A;  2UV8 A;  1S1X A;  3BBB A;  2U1A A;  1FE0 A;  2YWF A;  1GQE A;  3WU6 A;  2DK2 A;  3EX7 B;  2CJ9 A;  3GCW P;  1QSS A;  1YJT A;  4FW3 A;  2FC9 A;  4QIV A;  4JI0 E;  3JTP A;  4OFZ A;  4HH1 A;  4X65 E;  4TY8 A;  4LIW A;  1S1X B;  4RNO A;  1QZR A;  4DFJ A;  1JLC A;  2EFV A;  4HXZ A;  1WC3 A;  1MWZ A;  2FJE B;  3U27 A;  5IT9 U;  3FCW A;  3K57 A;  1JK9 B;  1S5Z A;  1VQS A;  2CRL A;  2QMU B;  4J9U E;  4M5K A;  4LFB F;  1IQZ A;  3NY0 A;  1U1N A;  3ZFV A;  3M1V A;  2ZEJ A;  3GV8 B;  1WKK A;  1VQ4 S;  2R8G A;  2B9E A;  2R3V A;  2DR6 A;  4OYZ A;  4DR4 F;  3PRD A;  4DV4 E;  3BGU A;  2V9W A;  2YNG B;  4V1A k;  1USU A;  3PW5 A;  3D3C J;  1EX8 A;  2J7W A;  3HFZ B;  2XCA A;  1RUS A;  4JV2 A;  4UT4 A;  1CG2 A;  2BR2 B;  2UXC I;  2CVE A;  4NYO A;  3CCJ S;  1W25 A;  2QL5 B;  1B70 B;  4TN2 A;  2CFX A;  4F0M A;  4WYW A;  4WYL A;  1XR5 A;  2AEF A;  2M2B A;  2ZOF A;  4QQB A;  1UWB B;  4DV3 E;  1YSJ A;  3HXM A;  1RKJ A;  2BE2 A;  4IG3 B;  3D1O A;  2FGC A;  1FXL A;  2YKM A;  1E6V A;  1S9G B;  4ZPB A;  3NL0 A;  4DR6 I;  3R27 A;  1VC5 A;  1JJ4 A;  1F2H A;  3BBF A;  3OXF A;  2OUG A;  3U1L A;  2OPR B;  1FVS A;  3TJ8 A;  3HHL B;  3EGV A;  3LAN A;  5DGA A;  2XCP A;  5DM6 Q;  2VQF I;  3V81 B;  4DR2 F;  2JEA B;  4DR5 E;  1TL1 A;  3G8S A;  2EBG A;  4YHH I;  4IFY A;  1KD1 T;  3DRP B;  2EWH A;  3W9I A;  3D7S B;  1FHT A;  1BXN A;  3AXK A;  4X62 I;  3HP6 A;  1H74 A;  2ZBR A;  5CD4 A;  3C15 A;  2BKO A;  1HNV B;  2BE9 B;  2HFS A;  2HVZ A;  2HZC A;  4ZLL A;  4X64 J;  4EZ6 A;  5KFD A;  3PTW A;  3TA1 A;  1TTH B;  2OKQ A;  4YQW A;  4DLE A;  4JG4 A;  2Z2L A;  3QIP A;  1FRH A;  2B0G A;  2Z2M A;  3D0G E;  3DOK A;  3P3D A;  2B9Y A;  1AA1 B;  4YDX A;  5EWF A;  3Q2T C;  5THW A;  3J7A M;  3SFU A;  1T94 A;  4B17 A;  1EJ7 L;  4HYK A;  3AJD A;  4YOE A;  6AT1 B;  3WQP A;  2LU2 A;  4LOM A;  4C8N A;  4ZN3 A;  3ZZT A;  4DR1 F;  2BZ2 A;  4X4O A;  1UEK A;  2G0I A;  3ILI A;  3M8Q B;  2DR8 A;  3CD5 A;  1QLN A;  2C39 A;  5LMU I;  4J9K A;  1H2T Z;  2F5G A;  3BGF A;  1V6H A;  4JI1 J;  1NUE A;  1SQE A;  2AW0 A;  2J76 E;  2LLZ A;  3I9V 9;  3LP2 B;  3QNW B;  4OI3 A;  3ENQ A;  5KFU A;  3C6T B;  1X5P A;  2MSS A;  1EHW A;  1I94 J;  5GAD U;  3DFE A;  3MM8 A;  3T5K A;  2LYV A;  4NXM I;  3KWM A;  2N7Y A;  4ZCK A;  1Q82 T;  2GJF A;  1FK9 A;  4F4Z A;  3KNA A;  1XK8 A;  2FHK A;  2FDN A;  4DV2 F;  2GJI A;  3HVA A;  2XS7 A;  5FLX Y;  4J9N A;  1FI4 A;  3A8E A;  2ZM6 E;  1IKW A;  3CMQ A;  2QIF A;  3P4U B;  4DV1 F;  4ZCM A;  3EXC X;  5D3G A;  3HKW A;  3SXL A;  1KLM A;  4DCP B;  1NK0 A;  2E9Z A;  3MR3 A;  2WHO A;  1GX6 A;  4GVL A;  3C14 B;  4KB7 A;  5T7L A;  4L73 A;  3H2U B;  2CPH A;  4IH6 A;  1XWL A;  4DF8 A;  2D3O 1;  4GKK J;  2FLO A;  2CA9 A;  1Z1Z A;  2KJW A;  2DIS A;  1AB8 A;  4R0J A;  2HIQ A;  1E3H A;  4LIR A;  1LXN A;  2ABY A;  2IDE A;  3GIJ A;  2F8H A;  3J81 U;  1U45 A;  2BJ8 A;  3M2U A;  4DQP A;  4ERD A;  2CJK A;  1XNR I;  4L3N A;  3QLH A;  1CQM A;  3E2E A;  1JXL A;  1S1V A;  1S6Q A;  3FEX B;  2MZ1 A;  4IZK A;  1QTM A;  4ZIT A;  4F2S A;  3GSD A;  1KN6 A;  1N8R T;  3RZA A;  2A18 A;  1PJ7 A;  2I0X A;  2BJ9 A;  5M2R A;  3EWG A;  2OFG X;  2MQO A;  4ZK7 M;  2XYP B;  3TEH B;  3JTN A;  2AYE A;  4O23 A;  5KT3 A;  5H9E J;  1KBR A;  3KLV A;  3VAI A;  2V67 A;  5DLF A;  4JI8 J;  2F1D A;  1M90 T;  4F8R A;  1S57 A;  5D0H A;  1RTD B;  2CJQ A;  3M1V B;  4C8Z A;  1LW2 A;  2F9D A;  1TMM A;  2VPY B;  3OJS A;  1SIW B;  3PIP Q;  1Z59 A;  2GVD A;  4ECS A;  4DS4 A;  2OD4 A;  4U95 A;  3P5T L;  2VQE J;  3GFH A;  2M0G B;  2J6T A;  4GKJ I;  4MKB A;  3I82 A;  4KY3 A;  3U02 A;  5HRO A;  2CPI A;  1WAC A;  4ED8 A;  3FCV A;  2VQE F;  4K50 A;  2C3Y A;  3MCO A;  2HBY B;  5B0F A;  1ZH5 A;  4U8Y A;  4J9M A;  2F65 A;  3S1T A;  3TAM B;  2LQB A;  4F3O A;  2C2O B;  5KFL A;  4DR4 J;  2PNZ A;  3T1Y I;  4NOH A;  3MEE B;  2CUY A;  1WOR A;  3H8Y A;  1FJ7 A;  5FWK A;  3QAU A;  2ZDP A;  2C37 B;  4K8R A;  1DY3 A;  2VB6 A;  4X62 F;  2PN6 A;  4YR2 A;  3MED A;  2VES A;  1FKA E;  4BDP A;  2GQQ A;  2B5J B;  4DV2 I;  2F4V E;  1ZOT A;  3M8P A;  4I69 A;  4AND A;  2LCW A;  3DXB A;  1U4B A;  3DRR A;  2UXB J;  3E8O A;  2YY3 A;  1Z0B A;  3PY8 A;  3K85 A;  2YX1 A;  5H9F J;  4X65 I;  2YWG A;  3D54 A;  4MJK A;  1ZTT A;  3DC2 A;  2E7X A;  1QUV A;  3JAM Q;  3MOZ A;  4I64 A;  3US5 A;  4A8X A;  5SZT A;  2H48 B;  3CCZ A;  2E9R X;  2ACY A;  4DU8 A;  1PIL A;  4TQS A;  1SBR A;  3RU0 A;  3VWS A;  3H4B A;  3CME S;  1UET A;  3BDP A;  1YWX A;  2QE5 A;  2YTC A;  1IKX B;  2DTJ A;  5C7P A;  4WTO B;  5K9F A;  2VFT A;  2HS3 A;  2LKZ A;  3PFE A;  3SYZ A;  1HWI A;  1JLA B;  2IRU A;  5DDP C;  2D3Z A;  2ZH4 A;  2VFV A;  1X9S A;  2R7O A;  4M94 A;  1PCA A;  1UKU A;  1OMS A;  2HS0 A;  2KT2 A;  5U47 A;  3RJM B;  1QSL A;  1RTI A;  1RGV A;  2YH0 A;  3EE3 A;  1OSC A;  4RW4 A;  4ZVH A;  3JAM U;  1LWE B;  1UL3 A;  3DNC A;  2Z56 B;  3IP0 A;  4DV1 I;  3KJF B;  3BPS P;  2GIR A;  3TZW A;  5CA5 A;  4P74 A;  2HRT A;  1RIS A;  1S77 D;  3MZI A;  5HMZ A;  5AJ3 J;  3NS7 B;  1TZ0 A;  3G6V A;  2UUA J;  1D9A A;  3SMZ A;  5HVG A;  1WOP A;  4DR2 J;  2B3T B;  5AXK A;  3G96 A;  2C2D A;  2ZWP A;  4LFA F;  4ED6 A;  5LMN I;  3AD7 C;  2R8J A;  3QMQ A;  3FSX A;  3I0S B;  4NLO A;  4TLQ A;  3UDL A;  4DWI A;  2OPP A;  2VAS A;  4MMO A;  4FP9 A;  5KFQ A;  4OZJ A;  2QA4 S;  1W2B R;  5IT9 C;  2A10 A;  2WW4 A;  2ASL A;  4K4V A;  3MM7 A;  3A8J A;  1SXL A;  5RUB A;  2IMW P;  2DNQ A;  2PO0 A;  3Q8Q B;  4LCF A;  4AIM A;  1LWF A;  4EI2 A;  3IR6 B;  1RBL A;  1RWM B;  2ZOG A;  2V94 A;  3QT6 A;  4LF9 F;  2QLF B;  4DV6 E;  4L75 A;  5F0W A;  4DSF A;  2M5Y A;  1YZ6 A;  1KQF B;  1EKR A;  1J5E F;  4AE5 A;  2ACM A;  3FUY A;  1MX0 A;  1C0T B;  2KZZ A;  4EFA C;  1NPR A;  3OR2 A;  2YKP A;  1RWW B;  4QIE A;  2RDI A;  3I0R A;  1TKX B;  4HL9 A;  3PIO Q;  1DTT A;  4FZV A;  4LFC J;  2KRR A;  3KHL A;  3T1H F;  1QUP A;  4LPF A;  1IBL I;  2AV5 A;  4BA1 B;  2COL A;  1N34 E;  2L9D A;  2JEA A;  1V9O A;  1U25 A;  2P6T A;  3MM9 B;  5A8K A;  2W01 A;  2CKW A;  3IR5 B;  3OTO I;  3DGP A;  1X9W A;  3HJC A;  3VAK A;  1KS2 A;  3LPY A;  4M5N A;  3SDE B;  5AJ3 F;  5J2Q B;  4DN0 A;  3K5N A;  5L1J A;  4OI4 A;  3JQK A;  3IS9 A;  2E7W A;  3ZZP A;  1Q5V A;  3UDC A;  4CTA B;  4WFZ A;  4X4Q A;  2NZ4 A;  2P6S A;  2GO3 A;  4LF6 I;  4UOF A;  3PRB A;  5L9X A;  3KJV B;  4K4T A;  1IBL E;  2OI2 A;