2HHHE

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2hhhE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2hhhE02
2BM0A 4DU7A 4DR1E 4NXME 2E5LE 2B7TA 1S16A 2GS8A 3QT6A 2BV3A 4OX9E 4DR7I 3VYXA 1ZM4A 2LRSA 1J26A 4JI5I 1XNQI 4DUYI 4DR7E 4EMDA 4M1KA 4JI5E 4P7AA 1XNQE 4DXLA 4DUYE 4PRXA 1N0UA 4DKKA 2HK2A 3HULA 1ZXNA 1N0VC 2MDRA 1YYKA 2AJ4A 1XHKA 3HTXA 4B3MI 4MYTA 1FNMA 3F0NA 1WHQA 1X49A 3J81C 4HACB 2Q2EB 5LMUI 2VQEI 4B3ME 4X62I 4OOGC 3CWVA 4JI0I 2JVAA 1STUA 5LMUE 2VQEE 3J81Q 2DMYA 2YT4A 1N34I 4X62E 4JI0E 2UUCI 4KHPI 2NUEA 4Z7CA 1DI2A 1Z5AA 4FWDA 3P1XA 5IT9C 1N34E 5LL6R 4JI2I 2CPNA 1XMOI 2UUCE 4LF5I 4KHPE 1K47A 2R42A 1EKZA 5GMDA 4HY1A 4JI2E 5IT9Q 2X7IA 1XMOE 4LF5E 3H4LA 4WYQB 4DR4I 2A2DA 3QT7A 3ADGA 4JI1I 1YYWA 1I94I 4DR4E 2DEIA 3WU5A 2HK3A 4JI1E 1NHHA 1RR9A 4HYMA 1FJGI 4R1FA 1FWLA 1I94E 4DUZI 4LF9I 2LJHA 1EA6A 5GMEA 4WFTA 1FJGE 4WUDA 2N3GA 4DUZE 2X36A 4LF9E 1NHIA 1U2RA 1X48A 4AQYI 4LF4I 1H73A 4USKA 2UXBI 3WU6A 4AQYE 2RS6A 4LF4E 4X65I 2L3JA 2UXBE 1PKPA 2RTXA 4JI7I 3ZKDA 3ZM7A 1HR0I 2V34A 2OI2A 2RSMA 1UHZA 4X8WA 4X65E 4JI7E 1Z59A 2EFGA 4YY3I 1HR0E 4WUCA 5L3JA 2HKJA 1KVKA 1ZM9A 4LF7I 1Z5CA 4WUBA 4I3HA 3ADJA 5LMNI 4YY3E 1HNXI 4DV7I 4DPWA 1Z5BA 4LF7E 2UUAI 2CZ9A 1HNXE 4DV7E 1UEKA 1RC7A 4XTJA 4Z7YA 2UUAE 4DV5I 2KHXA 1Z0VA 4P52A 4HACA 1D6TA 3PYDA 1UILA 4DV5E 4MYUA 4JYAI 2L2MA 2LUPB 1GQEA 4K0KI 1X47A 4DV1I 3JAMC 3Q1QA 3VYYA 1FWKA 4JYAE 4K0KE 2HFSA 4JI3I 1ZM3A 4DV1E 2L3CA 2J7KA 1VISA 3JAMQ 4B3RI 2ZM6I 4JI3E 4FW9A 4DV2I 2E1RA 4NXNI 5FLXC 2V2ZA 3J7Yp 2B7VA 4DPXA 1YYOA 4B3RE 2ZM6E 1BKNA 4DV2E 1ZBTA 4NXNE 1QU6A 2LBSB 2V8PA 5FLXQ 2HFUA 2WW4A 2LTSA 1IBLI 2UU9I 1N33I 3J80C 2RS7A 2L33A 3C4TA 4DV4I 1PVGA 3PYEA 1FI4A 4JI6I 2NPFA 2NUFA 2DIXA 1IBLE 4FWHA 2UU9E 1N33E 3QT5A 4HXZA 2A2CA 4DV4E 4JI6E 4PRVA 2NUGA 1ZM2A 3B78A 1HNZI 2L2NA 1RQ0A 2DB2A 3D4JA 1Z0BA 1XNRI 4GKKI 1HNZE 3GONA 5IWAI 3ZKBA 4PU9A 5A2QC 1O0WA 2HKEA 4FWGA 2BM1A 1ZXMA 3LNUA 4JG4A 1XNRE 4GKKE 3WU4A 4RPFA 1N32I 4KQVA 1WHNA 3ZZUA 4DR6I 5IWAE 1KTVA 1T4NA 1Z0WA 1IBMI 1N32E 5A2QQ 3J7AM 1B62A 4DU8A 4DR6E 1OJ4A 1Z0GA 1IBME 3ZZTA 2VQFI 1T4LB 2L2KB 2JY9A 2UXCI 2VQFE 4LF6I 4UTGA 4M30A 1H72C 2UXCE 3M6AA 1B63A 4B3SI 4DR2I 1MU5A 4URLA 5LMNE 4LF6E 1Z0CA 4OX9I 4B3SE 3PYGA 4DR2E 1IBKI 3B8HA 3V5RA 1NHJA 3T1HI 1QZRA 1KIJA 1T4OA 1A6FA 3B82A 3PYFA 3ZZ0A 3V2UC 1IBKE 3T1HE 3OTOI 1H7UA 3OTOE 4DV6I 1HNWI 4LF8I 1MG7A 2ZITA 1PIEA 3ADLA 4DV6E 1HNWE 2V2VA 4LF8E 4M2ZA 4X64I 3K17A 4DV0I 3K1JA 3LPSA 4X64E 1DARA 2ZBKB 4DV0E 3T1YI 4LFCI 2F4VI 1S4EA 2R3VA 5BR8I 4ED4A 2XEXA 4B3TI 3J7AG 3WU3A 1XMQI 4UT4A 4JI4I 2UUBI 2DEJA 3T1YE 4LFCE 2F4VE 5BR8E 1MX0A 4DPYA 4YHHI 4B3TE 4LFBI 1XMQE 4JI4E 2UUBE 1Z0EA 2HHHI 2B3TB 4YHHE 2IHR1 4LFBE 2N3HA 1Z0TA 2NA2A 3J80Q 2HHHE 2LTRA 2EZ6A 2LJPA 4GKJI 4DV3I 4JV5I 4USMA 2UXDI 4GKJE 4X66I 4DR3I 3C4BA 1H74A 4DV3E 2LUQA 4JV5E 4JI8I 4FN5A 1NZ0A 1FKAE 2UXDE 4X66E 4DR3E 4ZVIA 4JI8E 4DPUA 1KKHA 2V2QA 3LLHA 1EI1A 4LFAI 3QT8A 3ADIA 2VF3A 1ELOA 1YZ9A 4DR5I 4LFAE 1N36I 4DPTA 3LTOA 1RREA 1H7SA 1J5EI 5CFFE 4DR5E 1N36E 1WUUA 4DR1I 4NXMI 2E5LI 1J5EE
chains in the Genus database with same CATH superfamily
1HK7A 4F54A 5KL5A 2BM0A 4DU7A 2LMZA 4DR1E 2J65A 4NXME 2E5LE 2EPZA 2B7TA 2BR2B 1S16A 2GS8A 3QT6A 3VHTB 3HQ1A 2BV3A 3JTZA 4OX9E 1UDOA 4R2CA 2M1SA 3PRYA 2Z5CA 4DR7I 4BCAA 1WJPA 3VYXA 1R6LA 1ZM4A 2LRSA 2EL4A 1J26A 4JI5I 2R1FA 1XNQI 4DUYI 2EPPA 2Z5BA 3M85G 4IFDF 4DR7E 2WBUA 4EMDA 2EL5A 2EP3A 2YSOA 2EN7A 4M1KA 4JI5E 4P7AA 1XNQE 4DXLA 4DUYE 2MKDA 2F1DA 1NEIA 1UDNA 4PRXA 1N0UA 4DKKA 2HK2A 2EMXA 2O1TA 3HULA 1ZXNA 2ODRC 1N0VC 2BA1G 2PNLA 2MDRA 2IOPA 3GMEA 1YYKA 2AJ4A 2EOYA 4BBYA 2BB8A 3KZZA 1XHKA 3HTXA 1Y5YA 3B4TA 3UHMA 4X65I 1YSAC 4B3MI 4MYTA 4OO1C 1FNMA 3F0NA 1WHQA 1X49A 1YH8A 5DNLA 3J81C 3EQ1A 4HACB 3IWBA 2V89A 2Q2EB 4TUGA 2I13A 4MU4A 2JWOA 5LMUI 2VQEI 4B3ME 4BA1B 4X62I 4F9BB 2MKNA 4OOGC 2N8XA 3CWVA 4JI0I 2JVAA 3PS1A 5DNXA 1STUA 5LMUE 2VQEE 5A6AA 3J81Q 2DMYA 2YT4A 1N34I 1G2DC 2K7IA 4X62E 4R2PA 4JI0E 5TSEA 2JR1A 2VRDA 2UUCI 4KHPI 2NUEA 1KJKA 1DI2A 1Z5AA 4Z7CA 2JXPA 3P1XA 5IT9C 2BA1D 4FWDA 1N34E 4AM3A 5DRPA 5LL6R 3P06A 2CPNA 4JI2I 2RSIA 2EWLA 5FWKA 1PDAA 5A6BA 4RH8A 1XMOI 2UUCE 4LF5I 4KHPE 4IZJA 1K47A 2R42A 1EKZA 5GMDA 4BA2B 4HY1A 4JI2E 4X9JA 5IT9Q 5AE3A 2X7IA 2YRMA 1XMOE 4LF5E 5AASA 3H4LA 2EPOA 4WYQB 4DR4I 1R6MA 4GZNC 4OO1A 4KZSA 2A2DA 2EOHA 3QT7A 3ADGA 2GHFA 4JI1I 5A6KA 2V83A 5A6BD 2JEBA 5AC4A 1YYWA 4IZJD 4DR4E 2RQLA 2DEIA 2EMIA 1I94I 3WU5A 2HK3A 2YTOA 3AV0A 4WSPA 2EOMA 4JI1E 2MC6A 1NHHA 2ODRD 1RR9A 2ENAA 4R8OA 5AE2A 2PNZA 4HYMA 2EOFA 1FWLA 4R1FA 1FJGI 5F3WA 1I94E 2NN6E 4DUZI 2EPXA 4LF9I 4KWYA 4R2EA 4OO1D 2LJHA 2YTIA 4BC7A 4M9VC 1EA6A 2LCEA 2DGCA 5GMEA 2WP8B 4WFTA 2PO1B 2WBTA 1FJGE 1AH5A 2N3GA 4WUDA 2NN6A 4WX9A 4DUZE 2X36A 4LF9E 3UK3C 3GLLA 1WXRA 1L4SA 3AUZA 2C37B 1X3CA 3Q6MA 1ZR9A 1NHIA 3U1KA 1U2RA 1X48A 2EQ0A 3DF6A 4AQYI 5ADZA 1P47A 4LF4I 1H73A 1RMDA 2EMLA 4USKA 2E72A 2UXBI 3WU6A 2EN3A 3MHHC 4F6NA 2MC5A 5IV8B 2CGEA 2F8BA 4AQYE 2EOSA 2PO2B 2EQ1A 3EPKA 4OZEA 2RS6A 3MSWA 4LF4E 1BBOA 2L3JA 2UXBE 1PKPA 2RTXA 4R2DA 4R2RA 4IZKB 5DROA 3F6GA 3ZKDA 4NHRA 3ZM7A 1HR0I 2Q8UA 2WBSA 2R76A 2CG9A 2V34A 2G7HA 2OI2A 2V85A 2O1VA 1UHZA 2RSMA 3IWCA 2JE6B 3EPHA 4ZYDA 5DRRA 4X8WA 1UN6B 1IQOA 2PRTA 2PNMA 4X65E 4JI7E 1Z59A 1A1GA 2DRPA 1HR0E 2EFGA 3L7ZB 4OKGA 4WUCA 5L3JA 2VE7C 1TN9A 2HKJA 1KVKA 4BHBA 2C38B 1ZM9A 4LF7I 4WSGA 2C39B 5KL4A 1Z5CA 4WUBA 4I3HA 3ADJA 3BF2A 1A1KA 5LMNI 4YY3E 2IOQA 1HNXI 2EOZA 4DV7I 2O1UA 4DPWA 2J7JA 4OO1F 1Z5BA 3DJWA 4LF7E 4U3BA 2EM7A 4R03A 5KL7A 2UUAI 2CZ9A 3BIDA 1HNXE 2EN6A 4DV7E 3KWRA 4P7DA 1UEKA 1RC7A 1Y60A 3L00A 2V88A 2LT7A 2FTXB 4XTJA 4Z7YA 2UUAE 4LTYA 4DV5I 1GTKA 2KHXA 1Z0VA 2YTGA 4P52A 4GEQB 4HACA 4BS9A 1BBGA 1D6TA 1SR9A 3ZOQB 1JK1A 3PYDA 1UILA 3THOB 1X6FA 4N4RB 2EM0A 4DV5E 1BB8A 4MYUA 2DLQA 5ELWA 3THNA 1DQ3A 2EMAA 3RMPA 3Q6NA 4BC9A 1T38A 3PS2A 3HPSA 2Z5CB 2EJ4A 2H36X 1KYQA 2LO3A 4JYAI 2L2MA 2LUPB 1GQEA 4K0KI 2EMGA 3M85D 1X47A 2EPNA 4IS9A 4DV1I 3H1CA 2EOIA 3P3EA 3JAMC 3Q1QA 3QG5C 3VYYA 1FWKA 2I9IA 4IJDA 4JYAE 2FGGA 1YFHA 4K0KE 4U3DA 2HFSA 4JI3I 1A1HA 1T39A 2KONA 1ZM3A 4DV1E 5JEAE 2LE2A 2L3CA 2PO0A 2KOUA 2NN6C 4BA2A 2J7KA 1VISA 2EN4A 2ADRA 2EPKX 4WXCA 3U1YA 3JAMQ 3BBGA 4B3RI 2ZM6I 4JI3E 4FW9A 4DV2I 5K36E 5FLXC 2E1RA 4NXNI 2V2ZA 4JI7I 2EPLX 2YZTA 5IXMB 3HJCA 3J7Yp 2B7VA 2EOOA 4F6MA 4DPXA 1YYOA 3BGHA 1ZU1A 4B3RE 1SFEA 2ZM6E 1BKNA 5C0XE 1EH8A 4DV2E 1ZBTA 4NXNE 1QU6A 5JEAB 4Q35B 2LBSB 1X6EA 2M4IA 2V8PA 5FLXQ 2HFUA 2WW4A 3P3CA 3CDJA 5EL9A 2LTSA 4R2QA 4ZYGA 1IBLI 2UU9I 2V86A 1N33I 3J80C 2RS7A 2L33A 4MLQA 5K36B 3C4TA 4DV4I 1PVGA 3PYEA 2WP8A 4RHBB 1FI4A 4JI6I 2NPFA 2NUFA 3P76A 4FW7A 3C6KA 2DIXA 2B9DA 2ELYA 1IBLE 2UU9E 4FWHA 5C0XB 1N33E 3QT5A 4FK5C 2GLIA 1UDQA 2A2CA 2YTNA 4DV4E 4HXZA 4AIMA 2CT1A 1EH7A 4JI6E 1DGCA 4PRVA 4IFDE 2CSHA 2NUGA 1ZM2A 1VI7A 3B78A 2M9AA 2WCC3 3PS3A 1HNZI 1A1JA 2L2NA 3F6HA 2EN8A 2O1WA 1RQ0A 2EOQA 2DB2A 4O4KA 4F9AB 3D4JA 3KRNA 1Z0BA 1XNRI 4GKKI 2EN1A 2ENHA 1HNZE 1EH6A 3GONA 2YRKA 5IWAI 3ZKBA 2PO2A 4PU9A 4LCGA 2A25A 1O0WA 5A2QC 2HKEA 4FWGA 2JEAA 2BM1A 1ZXMA 1E3HA 3LNUA 1XNRE 4GKKE 4IZKA 4JG4A 4RPFA 3WU4A 4IFDB 1N32I 2NN6D 4KQVA 1WHNA 3ZZUA 4DR6I 5IWAE 1KTVA 3DD6A 2JE6A 1T4NA 2EMCA 3M99B 2GQ0A 3GCMA 3OMLA 4O43A 1Z0WA 1IBMI 1N32E 5A2QQ 3J7AM 4F2JC 3L7ZA 1B62A 4DU8A 1OYSA 4DR6E 1OJ4A 2C38A 2EPRA 2YTQA 2BR2A 1Z0GA 2VESA 2EPUA 2YTPA 1IBME 1P42A 1GZ6A 1PJQA 3ZZTA 2VQFI 4AIDA 1AAYA 1T4LB 4NZVA 4HEIA 2L2KB 3K85A 2EMYA 2JY9A 2YWQA 4Q28A 1USVA 1X6HA 1IQSA 2DSYA 2UXCI 5LLQA 2WNRB 2VQFE 2EM3A 4LF6I 4UTGA 2FV4B 4M30A 1Y4SA 1MEYC 2JPAA 1H72C 1WRJA 2BA0G 2UXCE 2EPAA 1B63A 3M6AA 4B3SI 4DR2I 2IERA 1MU5A 4URLA 5DNYA 5LMNE 4LF6E 1ZBQA 2L92A 2YPNA 1F2IG 1Z0CA 4TUIA 4BMJA 1TF3A 3P3GA 4OX9I 4B3SE 3PYGA 4DR2E 1Y4UA 2YTDA 4QNJA 1IMUA 5A6JA 2JYAA 2YTJA 5JEAC 3B8HA 1IBKI 4MLVA 1NHJA 5DRQA 3V5RA 3T1HI 1QZRA 3C6MA 5KL2A 4LPFA 4WPYA 1KIJA 2GO4A 1T4OA 1A6FA 3B82A 3PYFA 3ZZ0A 4P78A 2YSPA 5K36C 3V2UC 1IBKE 4BA1A 4R2SA 3T1HE 5AC5A 2NN6F 3OTOI 2EN2A 2GO3A 2EOXA 4MU3A 2EPCA 5C0XC 2BA0D 1H7UA 2O3ZA 1MGTA 4HTGA 4WXDA 1PJTA 2YTEA 2BBGA 1YUJA 2CTDA 3OTOE 2EM5A 2DMIA 5EKWA 4DV6I 1HNWI 4LF8I 1MG7A 1X5WA 2ZITA 2HJJA 2EMWA 2Z5BB 1PIEA 3HKMA 3ADLA 2EMHA 4ZYHA 4DV6E 1HNWE 4YY3I 2HC5A 2V2VA 4LF8E 4O5GA 2JP9A 4ISAA 4M2ZA 4X64I 2IESA 2EOEA 3K17A 1QNTA 4DV0I 2K4VA 4J8ZA 1A1FA 1YHCA 4N3OA 2HGHA 3K1JA 4IFDC 5JEAA 2EOJA 4M0VA 1OYPA 4BHCA 3LPSA 4X64E 1DARA 3M7NG 1PJSA 2ZBKB 4DV0E 1NCSA 2EM8A 2L6MA 3T1YI 3IWDA 4LFCI 4YHHI 3K6QA 1S4EA 2F4VI 2EPMX 2R3VA 5BR8I 2M7QA 3J7AG 2XEXA 4ED4A 4B3TI 5K36A 4DMIA 3WU3A 2EORA 1XMQI 4UT4A 4JI4I 1USUA 2UUBI 2RPCA 2YRHA 4L8NA 1A1LA 2L8TA 3T1YE 2DEJA 4LFCE 2F4VE 2GPIA 5BR8E 4R2AA 3FIGA 1MX0A 4QNKA 4DPYA 4B3TE 5C0XA 2DLKA 5JEAD 4FW5A 4FW6A 4LFBI 1XMQE 4JI4E 3VK6A 2EM2A 2UUBE 2EM9A 2EM4A 2EMFA 1JK2A 1Z0EA 2HHHI 2PO1A 2B3TB 2E1MA 4YHHE 1E3PA 5K36D 2IHR1 2PO0B 4OO1E 4IS1C 4LFBE 1A1IA 4GQUA 3HPZA 1UDSA 2N3HA 1Z0TA 4F9CB 2NA2A 3J80Q 3LMLA 1UBDC 2HHHE 4MQYA 2CVEA 2C37A 5AE1A 3M7ND 5C0XD 4MDTA 4IZJB 2LTRA 2NABA 3HXLA 4MU1A 2EZ6A 1ZAAC 2LJPA 2YU5A 3CDIA 4LCHA 4LOMA 1OYRA 2EQ3A 4MU0A 2JOBA 4IFDA 4GKJI 2LJUA 1LLMC 1B69A 4O24A 4OO1B 1XXEA 4DV3I 4JV5I 2JT2A 4USMA 3H09A 2JEBB 2UXDI 4J3DA 2LV2A 4L5NC 4GKJE 1Z1BA 4X66I 4DR3I 3C4BA 1H74A 2V87A 2VF1A 4DV3E 1YPNA 2LUQA 3EPJA 4JV5E 4LCFA 4JI8I 1N3GA 4FN5A 1NZ0A 3MHSC 1FKAE 2UXDE 1RHYA 2PNZB 2ELZA 4IFDD 3KZYA 4X66E 4DR3E 4ZYEA 3NZKA 5A69A 4NBQA 4ZVIA 2JOXA 4JI8E 4DPUA 2WZOA 2EMZA 2LVHA 1KKHA 2V2QA 3LLHA 2C39A 1EI1A 4LFAI 4LU9A 2ENCA 4I8OA 3JU0A 2NN6B 2WNRA 3QT8A 3ADIA 3TQMA 2VF3A 1Y6ZA 5JEAF 2EL6A 1ELOA 1YZ9A 4FW3A 2AE8A 1G2FC 4DR5I 2D9HA 4LFAE 4FW4A 1N36I 4DPTA 3LTOA 3ECRA 2Z5EA 1RREA 5K36F 1H7SA 1J5EI 5CFFE 2JEAB 4DR5E 2MDGA 1TF6A 5KL6A 1N36E 1YUIA 1WUUA 4DR1I 2YU8A 3EPLA 2EMBA 4NXMI 2YTFA 2E5LI 2EE8A 2EM6A 5C0XF 2EMKA 1J5EE 5T6JA 5KL3A 2V8QB
chains in the Genus database with same CATH topology
1HK7A 4F54A 2BM0A 4DU7A 2LMZA 4DR1E 4NXME 2E5LE 2B7TA 1S16A 2GS8A 3QT6A 3HQ1A 2BV3A 3JTZA 4OX9E 2M1SA 3PRYA 2Z5CA 4DR7I 4BCAA 3VYXA 1ZM4A 2LRSA 1J26A 4JI5I 1XNQI 4DUYI 2Z5BA 4DR7E 4EMDA 4M1KA 4JI5E 4P7AA 1XNQE 4DXLA 4DUYE 4PRXA 1N0UA 4DKKA 2HK2A 2O1TA 3HULA 1ZXNA 2ODRC 1N0VC 2PNLA 2MDRA 2IOPA 1YYKA 2AJ4A 4BBYA 1XHKA 3HTXA 4B3MI 4MYTA 1FNMA 3F0NA 1WHQA 1X49A 3J81C 4HACB 3IWBA 2V89A 2Q2EB 4TUGA 5LMUI 2JWOA 2VQEI 4B3ME 4X62I 4F9BB 4OOGC 3CWVA 4JI0I 2JVAA 1STUA 5LMUE 2VQEE 3J81Q 2DMYA 2YT4A 1N34I 4X62E 4JI0E 2JR1A 2UUCI 4KHPI 2NUEA 4Z7CA 1DI2A 1Z5AA 4FWDA 3P1XA 5IT9C 1N34E 5LL6R 3P06A 2CPNA 4JI2I 2EWLA 5FWKA 1XMOI 2UUCE 4LF5I 4KHPE 4IZJA 1K47A 2R42A 1EKZA 5GMDA 4HY1A 4JI2E 5IT9Q 5AE3A 2X7IA 1XMOE 4LF5E 5AASA 3H4LA 4WYQB 4DR4I 4KZSA 2A2DA 3QT7A 3ADGA 4JI1I 2V83A 1YYWA 4IZJD 4DR4E 2DEIA 1I94I 3WU5A 2HK3A 3AV0A 4WSPA 4JI1E 2MC6A 1NHHA 2ODRD 1RR9A 4HYMA 4R8OA 5AE2A 1FJGI 4R1FA 1FWLA 5F3WA 1I94E 4DUZI 4LF9I 2LJHA 4BC7A 1EA6A 5GMEA 4WFTA 1FJGE 4WUDA 2N3GA 4DUZE 2X36A 4LF9E 1WXRA 3AUZA 3Q6MA 1NHIA 1U2RA 1X48A 3DF6A 4AQYI 5ADZA 4LF4I 1H73A 4USKA 2UXBI 3WU6A 2MC5A 2CGEA 2F8BA 4AQYE 2RS6A 3MSWA 4LF4E 4X65I 2L3JA 2UXBE 1PKPA 2RTXA 4IZKB 4JI7I 3F6GA 3ZKDA 3ZM7A 1HR0I 2CG9A 2V34A 2G7HA 2OI2A 2V85A 2O1VA 2RSMA 1UHZA 3IWCA 4X8WA 2PNMA 4X65E 4JI7E 1Z59A 2EFGA 4YY3I 1HR0E 4WUCA 5L3JA 2VE7C 2HKJA 1KVKA 1ZM9A 4LF7I 1Z5CA 4WUBA 4I3HA 3ADJA 5LMNI 4YY3E 2IOQA 1HNXI 4DV7I 2O1UA 4DPWA 1Z5BA 3DJWA 4LF7E 4R03A 2UUAI 2CZ9A 1HNXE 4DV7E 3KWRA 4P7DA 1UEKA 1RC7A 2V88A 2FTXB 4XTJA 4Z7YA 2UUAE 4LTYA 4DV5I 2KHXA 1Z0VA 4P52A 4GEQB 4HACA 4BS9A 1D6TA 1SR9A 3ZOQB 3PYDA 1UILA 4DV5E 4MYUA 1DQ3A 3RMPA 3Q6NA 4BC9A 3HPSA 2Z5CB 2H36X 4JYAI 2L2MA 2LUPB 1GQEA 4K0KI 1X47A 4DV1I 3JAMC 3Q1QA 3VYYA 1FWKA 4JYAE 2FGGA 4K0KE 2HFSA 4JI3I 2KONA 1ZM3A 4DV1E 2LE2A 2L3CA 2KOUA 2J7KA 1VISA 3JAMQ 4B3RI 2ZM6I 4JI3E 4FW9A 4DV2I 5FLXC 2E1RA 4NXNI 2V2ZA 3HJCA 2YZTA 3J7Yp 2B7VA 4DPXA 1YYOA 4B3RE 2ZM6E 1BKNA 4DV2E 1ZBTA 4NXNE 1QU6A 2LBSB 2M4IA 2V8PA 5FLXQ 2HFUA 2WW4A 2LTSA 1IBLI 2UU9I 2V86A 1N33I 3J80C 2RS7A 2L33A 3C4TA 4DV4I 1PVGA 3PYEA 1FI4A 4JI6I 2NPFA 2NUFA 2DIXA 2B9DA 1IBLE 2UU9E 4FWHA 1N33E 3QT5A 4HXZA 2A2CA 4DV4E 4JI6E 4PRVA 2NUGA 1ZM2A 3B78A 1HNZI 2L2NA 3F6HA 2O1WA 1RQ0A 2DB2A 4F9AB 3D4JA 1Z0BA 1XNRI 4GKKI 1HNZE 3GONA 5IWAI 3ZKBA 4PU9A 5A2QC 1O0WA 2HKEA 4FWGA 2BM1A 1ZXMA 3LNUA 4JG4A 1XNRE 4GKKE 4IZKA 3WU4A 4RPFA 1N32I 4KQVA 1WHNA 3ZZUA 4DR6I 5IWAE 1KTVA 1T4NA 2GQ0A 3OMLA 1Z0WA 1IBMI 1N32E 5A2QQ 3J7AM 1B62A 4DU8A 4DR6E 1OJ4A 1Z0GA 1IBME 1GZ6A 3ZZTA 2VQFI 1T4LB 2L2KB 3K85A 2JY9A 1USVA 4Q28A 2UXCI 2DSYA 2VQFE 4LF6I 4UTGA 2FV4B 4M30A 1Y4SA 1H72C 2UXCE 3M6AA 1B63A 4B3SI 4DR2I 1MU5A 4URLA 5DNYA 5LMNE 4LF6E 1ZBQA 2L92A 1Z0CA 4TUIA 4BMJA 4OX9I 4B3SE 3PYGA 4DR2E 1Y4UA 1IBKI 3B8HA 3V5RA 1NHJA 3T1HI 1QZRA 4WPYA 1KIJA 1T4OA 1A6FA 3B82A 3PYFA 3ZZ0A 4P78A 3V2UC 1IBKE 3T1HE 3OTOI 1H7UA 3OTOE 4DV6I 1HNWI 4LF8I 1MG7A 2ZITA 2Z5BB 1PIEA 3ADLA 4DV6E 1HNWE 2V2VA 4LF8E 4M2ZA 4X64I 3K17A 4DV0I 2K4VA 4J8ZA 4N3OA 3K1JA 4M0VA 3LPSA 4X64E 1DARA 2ZBKB 4DV0E 2L6MA 3T1YI 3IWDA 4LFCI 2F4VI 3K6QA 1S4EA 2R3VA 5BR8I 2M7QA 3J7AG 2XEXA 4ED4A 4B3TI 4DMIA 3WU3A 1XMQI 4UT4A 4JI4I 1USUA 2UUBI 4L8NA 2DEJA 2L8TA 3T1YE 4LFCE 2F4VE 5BR8E 1MX0A 3FIGA 4DPYA 4YHHI 4B3TE 4LFBI 1XMQE 4JI4E 3VK6A 2UUBE 1Z0EA 2HHHI 2B3TB 2E1MA 4YHHE 2IHR1 4LFBE 3HPZA 2N3HA 1Z0TA 4F9CB 2NA2A 3J80Q 3LMLA 2HHHE 5AE1A 4IZJB 2LTRA 3HXLA 2EZ6A 2LJPA 2JOBA 4GKJI 4DV3I 4JV5I 4USMA 3H09A 2UXDI 4L5NC 4GKJE 4X66I 4DR3I 3C4BA 1H74A 2V87A 2VF1A 4DV3E 2LUQA 4JV5E 4JI8I 4FN5A 1NZ0A 1FKAE 2UXDE 4X66E 4DR3E 4ZVIA 2JOXA 4JI8E 4DPUA 2WZOA 1KKHA 2V2QA 3LLHA 1EI1A 4LFAI 4LU9A 4I8OA 3JU0A 3QT8A 3ADIA 2VF3A 1Y6ZA 1ELOA 1YZ9A 4DR5I 4LFAE 1N36I 4DPTA 3LTOA 2Z5EA 1RREA 1H7SA 1J5EI 5CFFE 4DR5E 1N36E 1WUUA 4DR1I 4NXMI 2E5LI 1J5EE 5T6JA 2V8QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM0 A;  4DU7 A;  4DR1 E;  4NXM E;  2E5L E;  2B7T A;  1S16 A;  2GS8 A;  3QT6 A;  2BV3 A;  4OX9 E;  4DR7 I;  3VYX A;  1ZM4 A;  2LRS A;  1J26 A;  4JI5 I;  1XNQ I;  4DUY I;  4DR7 E;  4EMD A;  4M1K A;  4JI5 E;  4P7A A;  1XNQ E;  4DXL A;  4DUY E;  4PRX A;  1N0U A;  4DKK A;  2HK2 A;  3HUL A;  1ZXN A;  1N0V C;  2MDR A;  1YYK A;  2AJ4 A;  1XHK A;  3HTX A;  4B3M I;  4MYT A;  1FNM A;  3F0N A;  1WHQ A;  1X49 A;  3J81 C;  4HAC B;  2Q2E B;  5LMU I;  2VQE I;  4B3M E;  4X62 I;  4OOG C;  3CWV A;  4JI0 I;  2JVA A;  1STU A;  5LMU E;  2VQE E;  3J81 Q;  2DMY A;  2YT4 A;  1N34 I;  4X62 E;  4JI0 E;  2UUC I;  4KHP I;  2NUE A;  4Z7C A;  1DI2 A;  1Z5A A;  4FWD A;  3P1X A;  5IT9 C;  1N34 E;  5LL6 R;  4JI2 I;  2CPN A;  1XMO I;  2UUC E;  4LF5 I;  4KHP E;  1K47 A;  2R42 A;  1EKZ A;  5GMD A;  4HY1 A;  4JI2 E;  5IT9 Q;  2X7I A;  1XMO E;  4LF5 E;  3H4L A;  4WYQ B;  4DR4 I;  2A2D A;  3QT7 A;  3ADG A;  4JI1 I;  1YYW A;  1I94 I;  4DR4 E;  2DEI A;  3WU5 A;  2HK3 A;  4JI1 E;  1NHH A;  1RR9 A;  4HYM A;  1FJG I;  4R1F A;  1FWL A;  1I94 E;  4DUZ I;  4LF9 I;  2LJH A;  1EA6 A;  5GME A;  4WFT A;  1FJG E;  4WUD A;  2N3G A;  4DUZ E;  2X36 A;  4LF9 E;  1NHI A;  1U2R A;  1X48 A;  4AQY I;  4LF4 I;  1H73 A;  4USK A;  2UXB I;  3WU6 A;  4AQY E;  2RS6 A;  4LF4 E;  4X65 I;  2L3J A;  2UXB E;  1PKP A;  2RTX A;  4JI7 I;  3ZKD A;  3ZM7 A;  1HR0 I;  2V34 A;  2OI2 A;  2RSM A;  1UHZ A;  4X8W A;  4X65 E;  4JI7 E;  1Z59 A;  2EFG A;  4YY3 I;  1HR0 E;  4WUC A;  5L3J A;  2HKJ A;  1KVK A;  1ZM9 A;  4LF7 I;  1Z5C A;  4WUB A;  4I3H A;  3ADJ A;  5LMN I;  4YY3 E;  1HNX I;  4DV7 I;  4DPW A;  1Z5B A;  4LF7 E;  2UUA I;  2CZ9 A;  1HNX E;  4DV7 E;  1UEK A;  1RC7 A;  4XTJ A;  4Z7Y A;  2UUA E;  4DV5 I;  2KHX A;  1Z0V A;  4P52 A;  4HAC A;  1D6T A;  3PYD A;  1UIL A;  4DV5 E;  4MYU A;  4JYA I;  2L2M A;  2LUP B;  1GQE A;  4K0K I;  1X47 A;  4DV1 I;  3JAM C;  3Q1Q A;  3VYY A;  1FWK A;  4JYA E;  4K0K E;  2HFS A;  4JI3 I;  1ZM3 A;  4DV1 E;  2L3C A;  2J7K A;  1VIS A;  3JAM Q;  4B3R I;  2ZM6 I;  4JI3 E;  4FW9 A;  4DV2 I;  2E1R A;  4NXN I;  5FLX C;  2V2Z A;  3J7Y p;  2B7V A;  4DPX A;  1YYO A;  4B3R E;  2ZM6 E;  1BKN A;  4DV2 E;  1ZBT A;  4NXN E;  1QU6 A;  2LBS B;  2V8P A;  5FLX Q;  2HFU A;  2WW4 A;  2LTS A;  1IBL I;  2UU9 I;  1N33 I;  3J80 C;  2RS7 A;  2L33 A;  3C4T A;  4DV4 I;  1PVG A;  3PYE A;  1FI4 A;  4JI6 I;  2NPF A;  2NUF A;  2DIX A;  1IBL E;  4FWH A;  2UU9 E;  1N33 E;  3QT5 A;  4HXZ A;  2A2C A;  4DV4 E;  4JI6 E;  4PRV A;  2NUG A;  1ZM2 A;  3B78 A;  1HNZ I;  2L2N A;  1RQ0 A;  2DB2 A;  3D4J A;  1Z0B A;  1XNR I;  4GKK I;  1HNZ E;  3GON A;  5IWA I;  3ZKB A;  4PU9 A;  5A2Q C;  1O0W A;  2HKE A;  4FWG A;  2BM1 A;  1ZXM A;  3LNU A;  4JG4 A;  1XNR E;  4GKK E;  3WU4 A;  4RPF A;  1N32 I;  4KQV A;  1WHN A;  3ZZU A;  4DR6 I;  5IWA E;  1KTV A;  1T4N A;  1Z0W A;  1IBM I;  1N32 E;  5A2Q Q;  3J7A M;  1B62 A;  4DU8 A;  4DR6 E;  1OJ4 A;  1Z0G A;  1IBM E;  3ZZT A;  2VQF I;  1T4L B;  2L2K B;  2JY9 A;  2UXC I;  2VQF E;  4LF6 I;  4UTG A;  4M30 A;  1H72 C;  2UXC E;  3M6A A;  1B63 A;  4B3S I;  4DR2 I;  1MU5 A;  4URL A;  5LMN E;  4LF6 E;  1Z0C A;  4OX9 I;  4B3S E;  3PYG A;  4DR2 E;  1IBK I;  3B8H A;  3V5R A;  1NHJ A;  3T1H I;  1QZR A;  1KIJ A;  1T4O A;  1A6F A;  3B82 A;  3PYF A;  3ZZ0 A;  3V2U C;  1IBK E;  3T1H E;  3OTO I;  1H7U A;  3OTO E;  4DV6 I;  1HNW I;  4LF8 I;  1MG7 A;  2ZIT A;  1PIE A;  3ADL A;  4DV6 E;  1HNW E;  2V2V A;  4LF8 E;  4M2Z A;  4X64 I;  3K17 A;  4DV0 I;  3K1J A;  3LPS A;  4X64 E;  1DAR A;  2ZBK B;  4DV0 E;  3T1Y I;  4LFC I;  2F4V I;  1S4E A;  2R3V A;  5BR8 I;  4ED4 A;  2XEX A;  4B3T I;  3J7A G;  3WU3 A;  1XMQ I;  4UT4 A;  4JI4 I;  2UUB I;  2DEJ A;  3T1Y E;  4LFC E;  2F4V E;  5BR8 E;  1MX0 A;  4DPY A;  4YHH I;  4B3T E;  4LFB I;  1XMQ E;  4JI4 E;  2UUB E;  1Z0E A;  2HHH I;  2B3T B;  4YHH E;  2IHR 1;  4LFB E;  2N3H A;  1Z0T A;  2NA2 A;  3J80 Q;  2HHH E;  2LTR A;  2EZ6 A;  2LJP A;  4GKJ I;  4DV3 I;  4JV5 I;  4USM A;  2UXD I;  4GKJ E;  4X66 I;  4DR3 I;  3C4B A;  1H74 A;  4DV3 E;  2LUQ A;  4JV5 E;  4JI8 I;  4FN5 A;  1NZ0 A;  1FKA E;  2UXD E;  4X66 E;  4DR3 E;  4ZVI A;  4JI8 E;  4DPU A;  1KKH A;  2V2Q A;  3LLH A;  1EI1 A;  4LFA I;  3QT8 A;  3ADI A;  2VF3 A;  1ELO A;  1YZ9 A;  4DR5 I;  4LFA E;  1N36 I;  4DPT A;  3LTO A;  1RRE A;  1H7S A;  1J5E I;  5CFF E;  4DR5 E;  1N36 E;  1WUU A;  4DR1 I;  4NXM I;  2E5L I;  1J5E E; 
#chains in the Genus database with same CATH topology
 1HK7 A;  4F54 A;  5KL5 A;  2BM0 A;  4DU7 A;  2LMZ A;  4DR1 E;  2J65 A;  4NXM E;  2E5L E;  2EPZ A;  2B7T A;  2BR2 B;  1S16 A;  2GS8 A;  3QT6 A;  3VHT B;  3HQ1 A;  2BV3 A;  3JTZ A;  4OX9 E;  1UDO A;  4R2C A;  2M1S A;  3PRY A;  2Z5C A;  4DR7 I;  4BCA A;  1WJP A;  3VYX A;  1R6L A;  1ZM4 A;  2LRS A;  2EL4 A;  1J26 A;  4JI5 I;  2R1F A;  1XNQ I;  4DUY I;  2EPP A;  2Z5B A;  3M85 G;  4IFD F;  4DR7 E;  2WBU A;  4EMD A;  2EL5 A;  2EP3 A;  2YSO A;  2EN7 A;  4M1K A;  4JI5 E;  4P7A A;  1XNQ E;  4DXL A;  4DUY E;  2MKD A;  2F1D A;  1NEI A;  1UDN A;  4PRX A;  1N0U A;  4DKK A;  2HK2 A;  2EMX A;  2O1T A;  3HUL A;  1ZXN A;  2ODR C;  1N0V C;  2BA1 G;  2PNL A;  2MDR A;  2IOP A;  3GME A;  1YYK A;  2AJ4 A;  2EOY A;  4BBY A;  2BB8 A;  3KZZ A;  1XHK A;  3HTX A;  1Y5Y A;  3B4T A;  3UHM A;  4X65 I;  1YSA C;  4B3M I;  4MYT A;  4OO1 C;  1FNM A;  3F0N A;  1WHQ A;  1X49 A;  1YH8 A;  5DNL A;  3J81 C;  3EQ1 A;  4HAC B;  3IWB A;  2V89 A;  2Q2E B;  4TUG A;  2I13 A;  4MU4 A;  2JWO A;  5LMU I;  2VQE I;  4B3M E;  4BA1 B;  4X62 I;  4F9B B;  2MKN A;  4OOG C;  2N8X A;  3CWV A;  4JI0 I;  2JVA A;  3PS1 A;  5DNX A;  1STU A;  5LMU E;  2VQE E;  5A6A A;  3J81 Q;  2DMY A;  2YT4 A;  1N34 I;  1G2D C;  2K7I A;  4X62 E;  4R2P A;  4JI0 E;  5TSE A;  2JR1 A;  2VRD A;  2UUC I;  4KHP I;  2NUE A;  1KJK A;  1DI2 A;  1Z5A A;  4Z7C A;  2JXP A;  3P1X A;  5IT9 C;  2BA1 D;  4FWD A;  1N34 E;  4AM3 A;  5DRP A;  5LL6 R;  3P06 A;  2CPN A;  4JI2 I;  2RSI A;  2EWL A;  5FWK A;  1PDA A;  5A6B A;  4RH8 A;  1XMO I;  2UUC E;  4LF5 I;  4KHP E;  4IZJ A;  1K47 A;  2R42 A;  1EKZ A;  5GMD A;  4BA2 B;  4HY1 A;  4JI2 E;  4X9J A;  5IT9 Q;  5AE3 A;  2X7I A;  2YRM A;  1XMO E;  4LF5 E;  5AAS A;  3H4L A;  2EPO A;  4WYQ B;  4DR4 I;  1R6M A;  4GZN C;  4OO1 A;  4KZS A;  2A2D A;  2EOH A;  3QT7 A;  3ADG A;  2GHF A;  4JI1 I;  5A6K A;  2V83 A;  5A6B D;  2JEB A;  5AC4 A;  1YYW A;  4IZJ D;  4DR4 E;  2RQL A;  2DEI A;  2EMI A;  1I94 I;  3WU5 A;  2HK3 A;  2YTO A;  3AV0 A;  4WSP A;  2EOM A;  4JI1 E;  2MC6 A;  1NHH A;  2ODR D;  1RR9 A;  2ENA A;  4R8O A;  5AE2 A;  2PNZ A;  4HYM A;  2EOF A;  1FWL A;  4R1F A;  1FJG I;  5F3W A;  1I94 E;  2NN6 E;  4DUZ I;  2EPX A;  4LF9 I;  4KWY A;  4R2E A;  4OO1 D;  2LJH A;  2YTI A;  4BC7 A;  4M9V C;  1EA6 A;  2LCE A;  2DGC A;  5GME A;  2WP8 B;  4WFT A;  2PO1 B;  2WBT A;  1FJG E;  1AH5 A;  2N3G A;  4WUD A;  2NN6 A;  4WX9 A;  4DUZ E;  2X36 A;  4LF9 E;  3UK3 C;  3GLL A;  1WXR A;  1L4S A;  3AUZ A;  2C37 B;  1X3C A;  3Q6M A;  1ZR9 A;  1NHI A;  3U1K A;  1U2R A;  1X48 A;  2EQ0 A;  3DF6 A;  4AQY I;  5ADZ A;  1P47 A;  4LF4 I;  1H73 A;  1RMD A;  2EML A;  4USK A;  2E72 A;  2UXB I;  3WU6 A;  2EN3 A;  3MHH C;  4F6N A;  2MC5 A;  5IV8 B;  2CGE A;  2F8B A;  4AQY E;  2EOS A;  2PO2 B;  2EQ1 A;  3EPK A;  4OZE A;  2RS6 A;  3MSW A;  4LF4 E;  1BBO A;  2L3J A;  2UXB E;  1PKP A;  2RTX A;  4R2D A;  4R2R A;  4IZK B;  5DRO A;  3F6G A;  3ZKD A;  4NHR A;  3ZM7 A;  1HR0 I;  2Q8U A;  2WBS A;  2R76 A;  2CG9 A;  2V34 A;  2G7H A;  2OI2 A;  2V85 A;  2O1V A;  1UHZ A;  2RSM A;  3IWC A;  2JE6 B;  3EPH A;  4ZYD A;  5DRR A;  4X8W A;  1UN6 B;  1IQO A;  2PRT A;  2PNM A;  4X65 E;  4JI7 E;  1Z59 A;  1A1G A;  2DRP A;  1HR0 E;  2EFG A;  3L7Z B;  4OKG A;  4WUC A;  5L3J A;  2VE7 C;  1TN9 A;  2HKJ A;  1KVK A;  4BHB A;  2C38 B;  1ZM9 A;  4LF7 I;  4WSG A;  2C39 B;  5KL4 A;  1Z5C A;  4WUB A;  4I3H A;  3ADJ A;  3BF2 A;  1A1K A;  5LMN I;  4YY3 E;  2IOQ A;  1HNX I;  2EOZ A;  4DV7 I;  2O1U A;  4DPW A;  2J7J A;  4OO1 F;  1Z5B A;  3DJW A;  4LF7 E;  4U3B A;  2EM7 A;  4R03 A;  5KL7 A;  2UUA I;  2CZ9 A;  3BID A;  1HNX E;  2EN6 A;  4DV7 E;  3KWR A;  4P7D A;  1UEK A;  1RC7 A;  1Y60 A;  3L00 A;  2V88 A;  2LT7 A;  2FTX B;  4XTJ A;  4Z7Y A;  2UUA E;  4LTY A;  4DV5 I;  1GTK A;  2KHX A;  1Z0V A;  2YTG A;  4P52 A;  4GEQ B;  4HAC A;  4BS9 A;  1BBG A;  1D6T A;  1SR9 A;  3ZOQ B;  1JK1 A;  3PYD A;  1UIL A;  3THO B;  1X6F A;  4N4R B;  2EM0 A;  4DV5 E;  1BB8 A;  4MYU A;  2DLQ A;  5ELW A;  3THN A;  1DQ3 A;  2EMA A;  3RMP A;  3Q6N A;  4BC9 A;  1T38 A;  3PS2 A;  3HPS A;  2Z5C B;  2EJ4 A;  2H36 X;  1KYQ A;  2LO3 A;  4JYA I;  2L2M A;  2LUP B;  1GQE A;  4K0K I;  2EMG A;  3M85 D;  1X47 A;  2EPN A;  4IS9 A;  4DV1 I;  3H1C A;  2EOI A;  3P3E A;  3JAM C;  3Q1Q A;  3QG5 C;  3VYY A;  1FWK A;  2I9I A;  4IJD A;  4JYA E;  2FGG A;  1YFH A;  4K0K E;  4U3D A;  2HFS A;  4JI3 I;  1A1H A;  1T39 A;  2KON A;  1ZM3 A;  4DV1 E;  5JEA E;  2LE2 A;  2L3C A;  2PO0 A;  2KOU A;  2NN6 C;  4BA2 A;  2J7K A;  1VIS A;  2EN4 A;  2ADR A;  2EPK X;  4WXC A;  3U1Y A;  3JAM Q;  3BBG A;  4B3R I;  2ZM6 I;  4JI3 E;  4FW9 A;  4DV2 I;  5K36 E;  5FLX C;  2E1R A;  4NXN I;  2V2Z A;  4JI7 I;  2EPL X;  2YZT A;  5IXM B;  3HJC A;  3J7Y p;  2B7V A;  2EOO A;  4F6M A;  4DPX A;  1YYO A;  3BGH A;  1ZU1 A;  4B3R E;  1SFE A;  2ZM6 E;  1BKN A;  5C0X E;  1EH8 A;  4DV2 E;  1ZBT A;  4NXN E;  1QU6 A;  5JEA B;  4Q35 B;  2LBS B;  1X6E A;  2M4I A;  2V8P A;  5FLX Q;  2HFU A;  2WW4 A;  3P3C A;  3CDJ A;  5EL9 A;  2LTS A;  4R2Q A;  4ZYG A;  1IBL I;  2UU9 I;  2V86 A;  1N33 I;  3J80 C;  2RS7 A;  2L33 A;  4MLQ A;  5K36 B;  3C4T A;  4DV4 I;  1PVG A;  3PYE A;  2WP8 A;  4RHB B;  1FI4 A;  4JI6 I;  2NPF A;  2NUF A;  3P76 A;  4FW7 A;  3C6K A;  2DIX A;  2B9D A;  2ELY A;  1IBL E;  2UU9 E;  4FWH A;  5C0X B;  1N33 E;  3QT5 A;  4FK5 C;  2GLI A;  1UDQ A;  2A2C A;  2YTN A;  4DV4 E;  4HXZ A;  4AIM A;  2CT1 A;  1EH7 A;  4JI6 E;  1DGC A;  4PRV A;  4IFD E;  2CSH A;  2NUG A;  1ZM2 A;  1VI7 A;  3B78 A;  2M9A A;  2WCC 3;  3PS3 A;  1HNZ I;  1A1J A;  2L2N A;  3F6H A;  2EN8 A;  2O1W A;  1RQ0 A;  2EOQ A;  2DB2 A;  4O4K A;  4F9A B;  3D4J A;  3KRN A;  1Z0B A;  1XNR I;  4GKK I;  2EN1 A;  2ENH A;  1HNZ E;  1EH6 A;  3GON A;  2YRK A;  5IWA I;  3ZKB A;  2PO2 A;  4PU9 A;  4LCG A;  2A25 A;  1O0W A;  5A2Q C;  2HKE A;  4FWG A;  2JEA A;  2BM1 A;  1ZXM A;  1E3H A;  3LNU A;  1XNR E;  4GKK E;  4IZK A;  4JG4 A;  4RPF A;  3WU4 A;  4IFD B;  1N32 I;  2NN6 D;  4KQV A;  1WHN A;  3ZZU A;  4DR6 I;  5IWA E;  1KTV A;  3DD6 A;  2JE6 A;  1T4N A;  2EMC A;  3M99 B;  2GQ0 A;  3GCM A;  3OML A;  4O43 A;  1Z0W A;  1IBM I;  1N32 E;  5A2Q Q;  3J7A M;  4F2J C;  3L7Z A;  1B62 A;  4DU8 A;  1OYS A;  4DR6 E;  1OJ4 A;  2C38 A;  2EPR A;  2YTQ A;  2BR2 A;  1Z0G A;  2VES A;  2EPU A;  2YTP A;  1IBM E;  1P42 A;  1GZ6 A;  1PJQ A;  3ZZT A;  2VQF I;  4AID A;  1AAY A;  1T4L B;  4NZV A;  4HEI A;  2L2K B;  3K85 A;  2EMY A;  2JY9 A;  2YWQ A;  4Q28 A;  1USV A;  1X6H A;  1IQS A;  2DSY A;  2UXC I;  5LLQ A;  2WNR B;  2VQF E;  2EM3 A;  4LF6 I;  4UTG A;  2FV4 B;  4M30 A;  1Y4S A;  1MEY C;  2JPA A;  1H72 C;  1WRJ A;  2BA0 G;  2UXC E;  2EPA A;  1B63 A;  3M6A A;  4B3S I;  4DR2 I;  2IER A;  1MU5 A;  4URL A;  5DNY A;  5LMN E;  4LF6 E;  1ZBQ A;  2L92 A;  2YPN A;  1F2I G;  1Z0C A;  4TUI A;  4BMJ A;  1TF3 A;  3P3G A;  4OX9 I;  4B3S E;  3PYG A;  4DR2 E;  1Y4U A;  2YTD A;  4QNJ A;  1IMU A;  5A6J A;  2JYA A;  2YTJ A;  5JEA C;  3B8H A;  1IBK I;  4MLV A;  1NHJ A;  5DRQ A;  3V5R A;  3T1H I;  1QZR A;  3C6M A;  5KL2 A;  4LPF A;  4WPY A;  1KIJ A;  2GO4 A;  1T4O A;  1A6F A;  3B82 A;  3PYF A;  3ZZ0 A;  4P78 A;  2YSP A;  5K36 C;  3V2U C;  1IBK E;  4BA1 A;  4R2S A;  3T1H E;  5AC5 A;  2NN6 F;  3OTO I;  2EN2 A;  2GO3 A;  2EOX A;  4MU3 A;  2EPC A;  5C0X C;  2BA0 D;  1H7U A;  2O3Z A;  1MGT A;  4HTG A;  4WXD A;  1PJT A;  2YTE A;  2BBG A;  1YUJ A;  2CTD A;  3OTO E;  2EM5 A;  2DMI A;  5EKW A;  4DV6 I;  1HNW I;  4LF8 I;  1MG7 A;  1X5W A;  2ZIT A;  2HJJ A;  2EMW A;  2Z5B B;  1PIE A;  3HKM A;  3ADL A;  2EMH A;  4ZYH A;  4DV6 E;  1HNW E;  4YY3 I;  2HC5 A;  2V2V A;  4LF8 E;  4O5G A;  2JP9 A;  4ISA A;  4M2Z A;  4X64 I;  2IES A;  2EOE A;  3K17 A;  1QNT A;  4DV0 I;  2K4V A;  4J8Z A;  1A1F A;  1YHC A;  4N3O A;  2HGH A;  3K1J A;  4IFD C;  5JEA A;  2EOJ A;  4M0V A;  1OYP A;  4BHC A;  3LPS A;  4X64 E;  1DAR A;  3M7N G;  1PJS A;  2ZBK B;  4DV0 E;  1NCS A;  2EM8 A;  2L6M A;  3T1Y I;  3IWD A;  4LFC I;  4YHH I;  3K6Q A;  1S4E A;  2F4V I;  2EPM X;  2R3V A;  5BR8 I;  2M7Q A;  3J7A G;  2XEX A;  4ED4 A;  4B3T I;  5K36 A;  4DMI A;  3WU3 A;  2EOR A;  1XMQ I;  4UT4 A;  4JI4 I;  1USU A;  2UUB I;  2RPC A;  2YRH A;  4L8N A;  1A1L A;  2L8T A;  3T1Y E;  2DEJ A;  4LFC E;  2F4V E;  2GPI A;  5BR8 E;  4R2A A;  3FIG A;  1MX0 A;  4QNK A;  4DPY A;  4B3T E;  5C0X A;  2DLK A;  5JEA D;  4FW5 A;  4FW6 A;  4LFB I;  1XMQ E;  4JI4 E;  3VK6 A;  2EM2 A;  2UUB E;  2EM9 A;  2EM4 A;  2EMF A;  1JK2 A;  1Z0E A;  2HHH I;  2PO1 A;  2B3T B;  2E1M A;  4YHH E;  1E3P A;  5K36 D;  2IHR 1;  2PO0 B;  4OO1 E;  4IS1 C;  4LFB E;  1A1I A;  4GQU A;  3HPZ A;  1UDS A;  2N3H A;  1Z0T A;  4F9C B;  2NA2 A;  3J80 Q;  3LML A;  1UBD C;  2HHH E;  4MQY A;  2CVE A;  2C37 A;  5AE1 A;  3M7N D;  5C0X D;  4MDT A;  4IZJ B;  2LTR A;  2NAB A;  3HXL A;  4MU1 A;  2EZ6 A;  1ZAA C;  2LJP A;  2YU5 A;  3CDI A;  4LCH A;  4LOM A;  1OYR A;  2EQ3 A;  4MU0 A;  2JOB A;  4IFD A;  4GKJ I;  2LJU A;  1LLM C;  1B69 A;  4O24 A;  4OO1 B;  1XXE A;  4DV3 I;  4JV5 I;  2JT2 A;  4USM A;  3H09 A;  2JEB B;  2UXD I;  4J3D A;  2LV2 A;  4L5N C;  4GKJ E;  1Z1B A;  4X66 I;  4DR3 I;  3C4B A;  1H74 A;  2V87 A;  2VF1 A;  4DV3 E;  1YPN A;  2LUQ A;  3EPJ A;  4JV5 E;  4LCF A;  4JI8 I;  1N3G A;  4FN5 A;  1NZ0 A;  3MHS C;  1FKA E;  2UXD E;  1RHY A;  2PNZ B;  2ELZ A;  4IFD D;  3KZY A;  4X66 E;  4DR3 E;  4ZYE A;  3NZK A;  5A69 A;  4NBQ A;  4ZVI A;  2JOX A;  4JI8 E;  4DPU A;  2WZO A;  2EMZ A;  2LVH A;  1KKH A;  2V2Q A;  3LLH A;  2C39 A;  1EI1 A;  4LFA I;  4LU9 A;  2ENC A;  4I8O A;  3JU0 A;  2NN6 B;  2WNR A;  3QT8 A;  3ADI A;  3TQM A;  2VF3 A;  1Y6Z A;  5JEA F;  2EL6 A;  1ELO A;  1YZ9 A;  4FW3 A;  2AE8 A;  1G2F C;  4DR5 I;  2D9H A;  4LFA E;  4FW4 A;  1N36 I;  4DPT A;  3LTO A;  3ECR A;  2Z5E A;  1RRE A;  5K36 F;  1H7S A;  1J5E I;  5CFF E;  2JEA B;  4DR5 E;  2MDG A;  1TF6 A;  5KL6 A;  1N36 E;  1YUI A;  1WUU A;  4DR1 I;  2YU8 A;  3EPL A;  2EMB A;  4NXM I;  2YTF A;  2E5L I;  2EE8 A;  2EM6 A;  5C0X F;  2EMK A;  1J5E E;  5T6J A;  5KL3 A;  2V8Q B; 
#chains in the Genus database with same CATH homology
 1HK7 A;  4F54 A;  2BM0 A;  4DU7 A;  2LMZ A;  4DR1 E;  4NXM E;  2E5L E;  2B7T A;  1S16 A;  2GS8 A;  3QT6 A;  3HQ1 A;  2BV3 A;  3JTZ A;  4OX9 E;  2M1S A;  3PRY A;  2Z5C A;  4DR7 I;  4BCA A;  3VYX A;  1ZM4 A;  2LRS A;  1J26 A;  4JI5 I;  1XNQ I;  4DUY I;  2Z5B A;  4DR7 E;  4EMD A;  4M1K A;  4JI5 E;  4P7A A;  1XNQ E;  4DXL A;  4DUY E;  4PRX A;  1N0U A;  4DKK A;  2HK2 A;  2O1T A;  3HUL A;  1ZXN A;  2ODR C;  1N0V C;  2PNL A;  2MDR A;  2IOP A;  1YYK A;  2AJ4 A;  4BBY A;  1XHK A;  3HTX A;  4B3M I;  4MYT A;  1FNM A;  3F0N A;  1WHQ A;  1X49 A;  3J81 C;  4HAC B;  3IWB A;  2V89 A;  2Q2E B;  4TUG A;  5LMU I;  2JWO A;  2VQE I;  4B3M E;  4X62 I;  4F9B B;  4OOG C;  3CWV A;  4JI0 I;  2JVA A;  1STU A;  5LMU E;  2VQE E;  3J81 Q;  2DMY A;  2YT4 A;  1N34 I;  4X62 E;  4JI0 E;  2JR1 A;  2UUC I;  4KHP I;  2NUE A;  4Z7C A;  1DI2 A;  1Z5A A;  4FWD A;  3P1X A;  5IT9 C;  1N34 E;  5LL6 R;  3P06 A;  2CPN A;  4JI2 I;  2EWL A;  5FWK A;  1XMO I;  2UUC E;  4LF5 I;  4KHP E;  4IZJ A;  1K47 A;  2R42 A;  1EKZ A;  5GMD A;  4HY1 A;  4JI2 E;  5IT9 Q;  5AE3 A;  2X7I A;  1XMO E;  4LF5 E;  5AAS A;  3H4L A;  4WYQ B;  4DR4 I;  4KZS A;  2A2D A;  3QT7 A;  3ADG A;  4JI1 I;  2V83 A;  1YYW A;  4IZJ D;  4DR4 E;  2DEI A;  1I94 I;  3WU5 A;  2HK3 A;  3AV0 A;  4WSP A;  4JI1 E;  2MC6 A;  1NHH A;  2ODR D;  1RR9 A;  4HYM A;  4R8O A;  5AE2 A;  1FJG I;  4R1F A;  1FWL A;  5F3W A;  1I94 E;  4DUZ I;  4LF9 I;  2LJH A;  4BC7 A;  1EA6 A;  5GME A;  4WFT A;  1FJG E;  4WUD A;  2N3G A;  4DUZ E;  2X36 A;  4LF9 E;  1WXR A;  3AUZ A;  3Q6M A;  1NHI A;  1U2R A;  1X48 A;  3DF6 A;  4AQY I;  5ADZ A;  4LF4 I;  1H73 A;  4USK A;  2UXB I;  3WU6 A;  2MC5 A;  2CGE A;  2F8B A;  4AQY E;  2RS6 A;  3MSW A;  4LF4 E;  4X65 I;  2L3J A;  2UXB E;  1PKP A;  2RTX A;  4IZK B;  4JI7 I;  3F6G A;  3ZKD A;  3ZM7 A;  1HR0 I;  2CG9 A;  2V34 A;  2G7H A;  2OI2 A;  2V85 A;  2O1V A;  2RSM A;  1UHZ A;  3IWC A;  4X8W A;  2PNM A;  4X65 E;  4JI7 E;  1Z59 A;  2EFG A;  4YY3 I;  1HR0 E;  4WUC A;  5L3J A;  2VE7 C;  2HKJ A;  1KVK A;  1ZM9 A;  4LF7 I;  1Z5C A;  4WUB A;  4I3H A;  3ADJ A;  5LMN I;  4YY3 E;  2IOQ A;  1HNX I;  4DV7 I;  2O1U A;  4DPW A;  1Z5B A;  3DJW A;  4LF7 E;  4R03 A;  2UUA I;  2CZ9 A;  1HNX E;  4DV7 E;  3KWR A;  4P7D A;  1UEK A;  1RC7 A;  2V88 A;  2FTX B;  4XTJ A;  4Z7Y A;  2UUA E;  4LTY A;  4DV5 I;  2KHX A;  1Z0V A;  4P52 A;  4GEQ B;  4HAC A;  4BS9 A;  1D6T A;  1SR9 A;  3ZOQ B;  3PYD A;  1UIL A;  4DV5 E;  4MYU A;  1DQ3 A;  3RMP A;  3Q6N A;  4BC9 A;  3HPS A;  2Z5C B;  2H36 X;  4JYA I;  2L2M A;  2LUP B;  1GQE A;  4K0K I;  1X47 A;  4DV1 I;  3JAM C;  3Q1Q A;  3VYY A;  1FWK A;  4JYA E;  2FGG A;  4K0K E;  2HFS A;  4JI3 I;  2KON A;  1ZM3 A;  4DV1 E;  2LE2 A;  2L3C A;  2KOU A;  2J7K A;  1VIS A;  3JAM Q;  4B3R I;  2ZM6 I;  4JI3 E;  4FW9 A;  4DV2 I;  5FLX C;  2E1R A;  4NXN I;  2V2Z A;  3HJC A;  2YZT A;  3J7Y p;  2B7V A;  4DPX A;  1YYO A;  4B3R E;  2ZM6 E;  1BKN A;  4DV2 E;  1ZBT A;  4NXN E;  1QU6 A;  2LBS B;  2M4I A;  2V8P A;  5FLX Q;  2HFU A;  2WW4 A;  2LTS A;  1IBL I;  2UU9 I;  2V86 A;  1N33 I;  3J80 C;  2RS7 A;  2L33 A;  3C4T A;  4DV4 I;  1PVG A;  3PYE A;  1FI4 A;  4JI6 I;  2NPF A;  2NUF A;  2DIX A;  2B9D A;  1IBL E;  2UU9 E;  4FWH A;  1N33 E;  3QT5 A;  4HXZ A;  2A2C A;  4DV4 E;  4JI6 E;  4PRV A;  2NUG A;  1ZM2 A;  3B78 A;  1HNZ I;  2L2N A;  3F6H A;  2O1W A;  1RQ0 A;  2DB2 A;  4F9A B;  3D4J A;  1Z0B A;  1XNR I;  4GKK I;  1HNZ E;  3GON A;  5IWA I;  3ZKB A;  4PU9 A;  5A2Q C;  1O0W A;  2HKE A;  4FWG A;  2BM1 A;  1ZXM A;  3LNU A;  4JG4 A;  1XNR E;  4GKK E;  4IZK A;  3WU4 A;  4RPF A;  1N32 I;  4KQV A;  1WHN A;  3ZZU A;  4DR6 I;  5IWA E;  1KTV A;  1T4N A;  2GQ0 A;  3OML A;  1Z0W A;  1IBM I;  1N32 E;  5A2Q Q;  3J7A M;  1B62 A;  4DU8 A;  4DR6 E;  1OJ4 A;  1Z0G A;  1IBM E;  1GZ6 A;  3ZZT A;  2VQF I;  1T4L B;  2L2K B;  3K85 A;  2JY9 A;  1USV A;  4Q28 A;  2UXC I;  2DSY A;  2VQF E;  4LF6 I;  4UTG A;  2FV4 B;  4M30 A;  1Y4S A;  1H72 C;  2UXC E;  3M6A A;  1B63 A;  4B3S I;  4DR2 I;  1MU5 A;  4URL A;  5DNY A;  5LMN E;  4LF6 E;  1ZBQ A;  2L92 A;  1Z0C A;  4TUI A;  4BMJ A;  4OX9 I;  4B3S E;  3PYG A;  4DR2 E;  1Y4U A;  1IBK I;  3B8H A;  3V5R A;  1NHJ A;  3T1H I;  1QZR A;  4WPY A;  1KIJ A;  1T4O A;  1A6F A;  3B82 A;  3PYF A;  3ZZ0 A;  4P78 A;  3V2U C;  1IBK E;  3T1H E;  3OTO I;  1H7U A;  3OTO E;  4DV6 I;  1HNW I;  4LF8 I;  1MG7 A;  2ZIT A;  2Z5B B;  1PIE A;  3ADL A;  4DV6 E;  1HNW E;  2V2V A;  4LF8 E;  4M2Z A;  4X64 I;  3K17 A;  4DV0 I;  2K4V A;  4J8Z A;  4N3O A;  3K1J A;  4M0V A;  3LPS A;  4X64 E;  1DAR A;  2ZBK B;  4DV0 E;  2L6M A;  3T1Y I;  3IWD A;  4LFC I;  2F4V I;  3K6Q A;  1S4E A;  2R3V A;  5BR8 I;  2M7Q A;  3J7A G;  2XEX A;  4ED4 A;  4B3T I;  4DMI A;  3WU3 A;  1XMQ I;  4UT4 A;  4JI4 I;  1USU A;  2UUB I;  4L8N A;  2DEJ A;  2L8T A;  3T1Y E;  4LFC E;  2F4V E;  5BR8 E;  1MX0 A;  3FIG A;  4DPY A;  4YHH I;  4B3T E;  4LFB I;  1XMQ E;  4JI4 E;  3VK6 A;  2UUB E;  1Z0E A;  2HHH I;  2B3T B;  2E1M A;  4YHH E;  2IHR 1;  4LFB E;  3HPZ A;  2N3H A;  1Z0T A;  4F9C B;  2NA2 A;  3J80 Q;  3LML A;  2HHH E;  5AE1 A;  4IZJ B;  2LTR A;  3HXL A;  2EZ6 A;  2LJP A;  2JOB A;  4GKJ I;  4DV3 I;  4JV5 I;  4USM A;  3H09 A;  2UXD I;  4L5N C;  4GKJ E;  4X66 I;  4DR3 I;  3C4B A;  1H74 A;  2V87 A;  2VF1 A;  4DV3 E;  2LUQ A;  4JV5 E;  4JI8 I;  4FN5 A;  1NZ0 A;  1FKA E;  2UXD E;  4X66 E;  4DR3 E;  4ZVI A;  2JOX A;  4JI8 E;  4DPU A;  2WZO A;  1KKH A;  2V2Q A;  3LLH A;  1EI1 A;  4LFA I;  4LU9 A;  4I8O A;  3JU0 A;  3QT8 A;  3ADI A;  2VF3 A;  1Y6Z A;  1ELO A;  1YZ9 A;  4DR5 I;  4LFA E;  1N36 I;  4DPT A;  3LTO A;  2Z5E A;  1RRE A;  1H7S A;  1J5E I;  5CFF E;  4DR5 E;  1N36 E;  1WUU A;  4DR1 I;  4NXM I;  2E5L I;  1J5E E;  5T6J A;  2V8Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...