2HHHE

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2hhhE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2hhhE02
3VYYA 5FLXQ 4LF9E 4DR3I 4P7AA 3H4LA 4X64E 4ED4A 4JI7I 3J80Q 2YT4A 4KHPI 1N32E 4FWGA 1YZ9A 4NXMI 1Z0TA 1HR0I 1FWLA 1J5EE 2UUCI 4LFAE 1ELOA 1ZXNA 4DKKA 4DV7I 1DARA 2LUQA 4WFTA 4RPFA 2L3JA 4MYUA 4AQYE 3ADIA 2JY9A 1Z5BA 2UXBI 4B3RE 4LF4E 4DR5I 1HNZE 5CFFE 4JV5I 2V2QA 3HULA 4GKJE 4KQVA 5LMNI 1FI4A 4USMA 1H74A 5L3JA 2BM0A 1HNWE 4X66E 4WUDA 1YYWA 4JI8I 5IWAE 4XTJA 1YYKA 1T4LB 4M30A 3QT6A 1D6TA 5GMEA 1X49A 2DIXA 4LF8I 1EKZA 1STUA 1XMOI 4JYAI 3ZZUA 4DUYE 2GS8A 4GKKI 1S4EA 4DV5E 4JI4I 4DR6I 2CZ9A 2AJ4A 2X7IA 3D4JA 2L2NA 3ZZTA 4LF5I 1HNXE 1U2RA 4DV6I 1H72C 1IBLE 2E5LI 1MG7A 1Z0VA 4K0KE 4DR4I 2VQEE 1FKAE 4LF6I 2V2VA 4HY1A 3T1YI 2WW4A 3GONA 4UT4A 4DV0I 2EZ6A 4JI6I 2B3TB 4X64I 4OX9I 1XMQE 4JI2E 4DU8A 1KVKA 4DUZI 2UXDI 1K47A 4P52A 3OTOI 4JI5E 1Z0BA 2HFSA 4DV3I 2R42A 2L2KB 4R1FA 4PRVA 3WU4A 1ZXMA 4LFAI 3T1HE 4JI3E 1T4NA 1IBMI 3J81C 4LF7I 4FW9A 4DV2I 3LLHA 3K1JA 5IT9C 4M2ZA 4AQYI 1ZBTA 4B3TI 2HHHE 4LF4I 4LFBE 4DXLA 1HNZI 4JI1E 1NHHA 2F4VI 1H73A 3F0NA 3LPSA 2UUBE 1PVGA 2V2ZA 4DV4E 4HACB 2OI2A 4DR2E 4URLA 4DR1E 5LMUI 2VF3A 1N0VC 2VQFE 1EA6A 1N34I 4DPWA 3QT5A 1N36E 2L2MA 3ZZ0A 1IBKI 1FJGE 4DUYI 1KKHA 3LTOA 4X62I 1XNRI 4I3HA 3JAMC 3LNUA 4DR3E 2E1RA 2UUAI 4JI7E 4X65I 4DV1I 1IBLI 2N3GA 1PKPA 1H7SA 2Q2EB 3PYEA 4OOGC 2VQEI 1EI1A 3J81Q 3M6AA 1KIJA 1ZM9A 4YY3E 4NXME 3PYFA 4NXNI 2DMYA 1Z0GA 1RQ0A 1A6FA 4LFCI 1HR0E 2UU9I 1I94I 2UXCI 4PU9A 4X8WA 2N3HA 3J7Yp 2LTRA 2R3VA 2NA2A 3ADJA 4HXZA 4DV7E 4JI5I 1XNQI 4B3ME 1H7UA 4WYQB 2BM1A 2EFGA 2ZM6E 2LTSA 2NUEA 4USKA 2LRSA 3T1HI 4DPTA 4DPUA 4JI3I 3WU6A 1OJ4A 4Z7CA 4LF9I 1B63A 3J7AG 2IHR1 3C4TA 2HK3A 3B8HA 2JVAA 2HKEA 4DR7E 4B3SE 4JI8E 1N32I 5BR8E 2X36A 2HHHI 2NPFA 4UTGA 2KHXA 4LF8E 3PYGA 1PIEA 3ADLA 1J5EI 2V34A 1Z0EA 4JI0E 1XMOE 1N33E 4JYAE 2B7TA 2B7VA 4GKKE 4DR2I 4JI4E 1QZRA 4DR6E 1FNMA 4LF5E 4DV6E 4YHHE 2V8PA 2E5LE 1UHZA 1X47A 4B3RI 1FJGI 4ZVIA 1MX0A 3WU5A 2HKJA 3J7AM 4GKJI 4LF6E 3B82A 3T1YE 4WUCA 4DV0E 1WHNA 4JI6E 4OX9E 1HNWI 4X66I 1WUUA 3HTXA 3QT8A 4DU7A 1O0WA 5IWAI 1KTVA 4DUZE 2UXDE 3B78A 1XHKA 2LJPA 3ZKDA 3OTOE 1Z5AA 4YY3I 2L3CA 4DV3E 1NZ0A 1NHIA 1UEKA 2HK2A 3ZM7A 5LL6R 4DV5I 1S16A 1DI2A 1ZM4A 1IBME 5A2QC 2NUGA 2L33A 4LF7E 1HNXI 4DV2E 3Q1QA 3P1XA 4B3MI 2ZM6I 4Z7YA 1N0UA 4KHPE 4K0KI 4B3TE 4HYMA 1Z59A 1NHJA 2F4VE 3C4BA 5IT9Q 4DPYA 1XMQI 4JI2I 3V2UC 3VYXA 2UUCE 4FN5A 1T4OA 4DR7I 4FWHA 4B3SI 3PYDA 1B62A 5BR8I 2DEIA 2DB2A 1Z0CA 5FLXC 4M1KA 2J7KA 1UILA 1RR9A 5LMUE 2RTXA 1J26A 2NUFA 4WUBA 1N34E 3J80C 1QU6A 3WU3A 4HACA 2UXBE 4JI0I 2A2DA 1N33I 1IBKE 4DR5E 1RREA 4X62E 2BV3A 2HFUA 1XNRE 2LUPB 3K17A 4JV5E 2RSMA 4PRXA 3QT7A 5LMNE 2UUAE 2LBSB 1YYOA 3ZKBA 2LJHA 4X65E 4DV1E 4YHHI 1RC7A 2DEJA 4LFBI 2MDRA 4DPXA 4JI1I 2ZBKB 4EMDA 5A2QQ 3ADGA 3JAMQ 1BKNA 1VISA 4NXNE 2RS7A 2RS6A 2UUBI 1FWKA 2UU9E 4LFCE 2ZITA 5GMDA 1I94E 2UXCE 4DV4I 4MYTA 1ZM2A 4DR1I 1GQEA 3V5RA 1MU5A 1ZM3A 4JG4A 3CWVA 4FWDA 1Z5CA 2VQFI 1X48A 1XNQE 1N36I 1WHQA 2CPNA 2A2CA 4DR4E 2XEXA 1Z0WA
chains in the Genus database with same CATH superfamily
3VYYA 5FLXQ 4LF9E 4DR3I 4MDTA 4P7AA 3H4LA 4HEIA 5JEAB 3VK6A 4X64E 4ED4A 4JI7I 1UDQA 1F2IG 2YRMA 4OO1A 2EN6A 3J80Q 2EPRA 2YT4A 1X6FA 2LCEA 1G2DC 4KHPI 2NABA 4O5GA 3PS2A 1N32E 2EMWA 2CTDA 2EOZA 2LMZA 4FWGA 3PS1A 2LV2A 2MKNA 2E1MA 1YZ9A 4NXMI 4O24A 1A1FA 3M85D 4R03A 1Z0TA 1HR0I 1FWLA 3M7ND 3B4TA 2YU8A 2M7QA 2ADRA 1J5EE 2AE8A 1R6MA 2DSYA 4ZYHA 2JEBB 3L7ZB 2UUCI 4F9AB 3ECRA 4LFAE 2YTOA 2EM9A 1ELOA 5KL5A 1ZXNA 4DKKA 4DV7I 1DARA 5FWKA 2LUQA 4IFDD 1YHCA 2ENAA 3HPSA 2EOQA 4R2EA 5DNXA 4WFTA 1IQOA 3CDIA 4RPFA 2EQ1A 2D9HA 2L3JA 1TF6A 4MYUA 2FV4B 3BBGA 4AQYE 1YUJA 2V8QB 3ADIA 2PNMA 2JY9A 1PJQA 1Z5BA 2UXBI 1X6HA 4L5NC 4B3RE 4LF4E 5ELWA 4DR5I 5A6AA 1A1JA 1USUA 3VHTB 1HNZE 4NHRA 2VRDA 4NZVA 4WXCA 5CFFE 4BC9A 5DROA 2JEAA 1PJTA 4JV5I 3P3CA 2V2QA 3HULA 1TN9A 4GKJE 2ELYA 1N3GA 1A1LA 4KQVA 2EL4A 5LMNI 4GZNC 1FI4A 2BA1D 1H74A 1A1HA 4USMA 5L3JA 2BM0A 4WXDA 5T6JA 1HNWE 2EPLX 4X66E 4WUDA 1YYWA 4JI8I 5IWAE 2C38B 4XTJA 1YYKA 1T4LB 4M30A 2O3ZA 1MEYC 2EN7A 3ZOQB 2K4VA 3QT6A 2EJ4A 5GMEA 1D6TA 1X49A 2LO3A 1DGCA 2DIXA 5KL3A 4LF8I 2EMGA 1BB8A 5JEAA 1NEIA 1EKZA 2EN4A 3FIGA 2A25A 4IS1C 1Z1BA 1STUA 5KL4A 1XMOI 4JYAI 4O43A 3ZZUA 4DUYE 2C37B 2GS8A 2EMIA 2YTIA 2EOSA 4GKKI 4ZYDA 4OKGA 1S4EA 4DV5E 4JI4I 4DR6I 2CZ9A 2AJ4A 2X7IA 2J7JA 3D4JA 2L2NA 2R1FA 3ZZTA 4OO1F 4LF5I 1HNXE 1U2RA 5K36C 3UHMA 5A6BD 2LT7A 4DV6I 1H72C 1IBLE 3P06A 2E5LI 2Z5EA 1DQ3A 2NN6B 2JEBA 2EMXA 2EN8A 3RMPA 1MG7A 4LU9A 4K0KE 2JR1A 5A6BA 2EM3A 1Z0VA 2CG9A 4DR4I 2KOUA 2VQEE 2EE8A 1UDOA 1FKAE 1G2FC 4LF6I 2V2VA 4HY1A 3T1YI 2WW4A 3GONA 2JP9A 3C6MA 2Z5CB 4UT4A 2CSHA 2EZ6A 4DV0I 2B3TB 4X64I 4JI6I 4OX9I 2E72A 1XMQE 4QNJA 2PO2B 1UDNA 4JI2E 4DU8A 4IJDA 2EOFA 1KVKA 4DUZI 2UXDI 2GO3A 1GZ6A 1K47A 2EPPA 3JTZA 1OYSA 4P52A 3OTOI 3F6GA 3L00A 4AIMA 2EN1A 4JI5E 1Z0BA 2HFSA 4IFDC 2EL6A 2EPAA 4DV3I 2BA0D 2G7HA 2YTFA 4LPFA 1A1IA 3QG5C 3MHSC 2R42A 2YSOA 1PJSA 2EQ3A 2L2KB 4R1FA 2C38A 4PRVA 3WU4A 1ZXMA 3M85G 2MC5A 3T1HE 4LFAI 3M7NG 4JI3E 1T4NA 5EL9A 2EM0A 1IBMI 3J81C 4LF7I 1IQSA 5IV8B 2EPZA 4FW9A 4MU4A 4DV2I 3LLHA 3K1JA 4GQUA 2EN2A 2Q8UA 2EMKA 4FK5C 5IT9C 3IWDA 4M2ZA 2EPNA 2N8XA 4AQYI 4FW5A 2C37A 2BR2B 2KONA 2C39A 3C6KA 1ZBTA 4B3TI 2EOIA 2HHHE 4LFBE 4LF4I 4DXLA 2WNRB 3U1KA 1HNZI 4P7DA 4JI1E 1Y5YA 2NN6D 1NHHA 3KZYA 5JEAF 4M0VA 2F4VI 2EWLA 2EOOA 2FGGA 1H73A 1HK7A 3F0NA 5JEAE 4BC7A 3THNA 3LPSA 5TSEA 2UUBE 2NN6A 1PVGA 3DD6A 5IXMB 2V83A 2V2ZA 2V87A 2JYAA 2R76A 4DV4E 4O4KA 4F9CB 4HACB 2L8TA 2DRPA 2OI2A 5AE2A 4DR2E 2EMHA 1KYQA 5C0XC 4URLA 4DR1E 2BA1G 3PS3A 3UK3C 2M4IA 5LMUI 2IOPA 4L8NA 4ZYEA 2PO1B 2VF3A 1N0VC 1RMDA 1SFEA 2Z5CA 2VQFE 4R2QA 1EH6A 1EA6A 1N34I 4DPWA 3QT5A 2RPCA 4WSGA 1N36E 1E3HA 2PO2A 4MU1A 2L6MA 5C0XB 2B9DA 4KWYA 2L2MA 1AAYA 4FW7A 3ZZ0A 1IBKI 1FJGE 4DUYI 1KKHA 3LTOA 4X62I 4MU3A 1XNRI 1KJKA 3KWRA 4I3HA 3JAMC 3LNUA 2ODRD 4DR3E 2YPNA 2E1RA 2UUAI 2Z5BB 4JI7E 4X65I 2EMZA 4R2RA 4DV1I 2EOYA 4LCFA 1IBLI 1B69A 2WCC3 2N3GA 2VE7C 5JEAD 1PKPA 2HGHA 2EM2A 4I8OA 4P78A 4Q28A 1Y6ZA 2YTNA 1H7SA 2Q2EB 1WJPA 4OOGC 2EM4A 3PYEA 2VQEI 2EMAA 1EI1A 1AH5A 3DF6A 2JE6B 3J81Q 3M6AA 1KIJA 1ZM9A 4YY3E 4NXME 3P3EA 3PYFA 2DMYA 4R2SA 4NXNI 1Z0GA 1MGTA 4FW3A 4R2DA 1RQ0A 1A6FA 4LFCI 1HR0E 2UU9I 1I94I 2UXCI 2VF1A 4PU9A 2BR2A 4X8WA 2BB8A 2JXPA 2V88A 5LLQA 5A6KA 2N3HA 1A1GA 3GCMA 4N3OA 3J7Yp 2LTRA 4N4RB 2WNRA 3GMEA 3U1YA 2WBTA 1BBGA 2NA2A 3ADJA 4TUGA 2R3VA 3Q6MA 4HXZA 4OO1C 4J8ZA 2EPMX 4DMIA 4DV7E 1Y4SA 4LOMA 4JI5I 1XNQI 5AE3A 3H09A 4B3ME 1H7UA 4WYQB 5AC5A 5DNLA 1GTKA 2EM7A 1EH7A 4F2JC 2IOQA 2BM1A 2EFGA 3L7ZA 5AE1A 2ZM6E 4R2AA 1LLMC 2LTSA 4R2CA 2NUEA 3AUZA 1X3CA 1USVA 4USKA 3JU0A 5K36B 2LRSA 3T1HI 4DPTA 2BA0G 4DPUA 2JT2A 2EPKX 4JI3I 3WU6A 4BCAA 2EOXA 1X5WA 1OJ4A 4Z7CA 4LF9I 2YTJA 2PO1A 1B63A 3THOB 2NN6F 3J7AG 4BA2B 2IHR1 4WSPA 4MU0A 2GPIA 1EH8A 2WBSA 2YRKA 3C4TA 2F8BA 2HK3A 5C0XA 2NN6E 2YTEA 2PRTA 2M9AA 3B8HA 4F6NA 2PO0B 1UBDC 2JVAA 2HKEA 5DNYA 4DR7E 4FW4A 4B3SE 4F54A 4JI8E 1N32I 5BR8E 2X36A 2HHHI 2RSIA 2WZOA 1P47A 1Y4UA 2NPFA 4UTGA 2KHXA 2EL5A 2EM8A 4LF8E 2CGEA 2Z5BA 3PRYA 4MLVA 3IWCA 1PIEA 3PYGA 3ADLA 4BHBA 2EQ0A 4IS9A 1J5EI 4BHCA 2V34A 1YH8A 1Z0EA 4JI0E 2EORA 5KL2A 1XMOE 2EPUA 3BIDA 4LTYA 4JYAE 2B7TA 1N33E 5DRPA 4IFDB 2J65A 2B7VA 1YUIA 3H1CA 3MSWA 4GKKE 4DR2I 3K85A 2JE6A 2YTDA 4JI4E 1QZRA 4DR6E 2EMCA 1FNMA 4FW6A 1NCSA 3MHHC 2O1TA 4TUIA 3GLLA 4LF5E 4DV6E 4U3DA 4YHHE 2V8PA 1RHYA 2E5LE 1UHZA 1OYPA 4F9BB 2M1SA 1X47A 2EOHA 4BA1B 2EMBA 1E3PA 4B3RI 1FJGI 4MQYA 2EPCA 2GHFA 3LMLA 1OYRA 2CT1A 4ZVIA 1MX0A 3WU5A 3OMLA 1Z0WA 2HKJA 3J7AM 2V86A 4GKJI 4LF6E 2EMYA 2WBUA 3T1YE 3B82A 4F6MA 4WUCA 5K36D 1WRJA 4DV0E 1WHNA 4JI6E 4OX9E 1HNWI 1UDSA 4X66I 1WUUA 4AIDA 3BF2A 5ADZA 3HTXA 3QT8A 4DU7A 1O0WA 2O1UA 5IWAI 4HTGA 1KTVA 4DUZE 5K36A 2K7IA 2UXDE 4IZKB 2BBGA 3B78A 2MKDA 2LVHA 1XHKA 2LJPA 4LCGA 3ZKDA 4RHBB 5AASA 3OTOE 1TF3A 2L92A 3EQ1A 2EM5A 3HPZA 1Z5AA 4YY3I 2L3CA 3BGHA 5F3WA 4NBQA 4BA2A 2LJUA 2HC5A 1YFHA 3P76A 4DV3E 2EP3A 2IESA 1NZ0A 2PO0A 2LE2A 1NHIA 1UEKA 2HK2A 2IERA 4U3BA 5KL7A 2YTQA 3ZM7A 5LL6R 4DV5I 4GEQB 1S16A 2EOEA 2V89A 3AV0A 1DI2A 1IBME 1ZM4A 5A2QC 3CDJA 2NUGA 2L33A 4LF7E 1HNXI 5KL6A 5C0XF 4DV2E 4AM3A 3Q1QA 3P1XA 4B3MI 2YSPA 5C0XE 2ZM6I 3DJWA 1A1KA 4Z7YA 1N0UA 4IFDA 1T39A 4KHPE 4K0KI 2EMLA 2GQ0A 2FTXB 3K6QA 4B3TE 4BS9A 2GO4A 3KRNA 4HYMA 2I13A 1Z59A 2ENHA 5DRRA 4X9JA 1NHJA 2F4VE 3EPLA 3C4BA 1YPNA 5IT9Q 3KZZA 5EKWA 3F6HA 4DPYA 2JPAA 2DGCA 3EPHA 2WP8B 4IZJB 2PNZB 1XMQI 4JI2I 3V2UC 3VYXA 2UUCE 1IMUA 4BA1A 1QNTA 2EPOA 4FN5A 1T4OA 4DR7I 4FWHA 4B3SI 3PYDA 2DLKA 3TQMA 1B62A 5BR8I 3M99B 2DB2A 2DEIA 5A6JA 1Z0CA 1VI7A 5FLXC 4M1KA 1R6LA 2J7KA 2YTGA 1UILA 1RR9A 2EOJA 3IWBA 5LMUE 2HJJA 2RTXA 2YTPA 2H36X 3HQ1A 2NUFA 1J26A 2CVEA 1PDAA 4WUBA 1ZU1A 1N34E 3J80C 1QU6A 2F1DA 3P3GA 3WU3A 4OO1B 4HACA 5A69A 2YU5A 2DMIA 5DRQA 2RQLA 2UXBE 4JI0I 2A2DA 1Y60A 1SR9A 1IBKE 1N33I 4DR5E 1RREA 4IZKA 4ZYGA 2EOMA 5C0XD 4X62E 2C39B 2NN6C 2BV3A 2HFUA 1XNRE 1P42A 2LUPB 2PNLA 4JV5E 3K17A 3Q6NA 3HXLA 2RSMA 2EN3A 4PRXA 2EMFA 5AC4A 5LMNE 4R2PA 3QT7A 2UUAE 2LBSB 1YYOA 2I9IA 3HKMA 2LJHA 4X65E 3ZKBA 4DV1E 4YHHI 4ISAA 4OO1E 5K36F 1X6EA 3NZKA 1L4SA 4RH8A 1RC7A 5K36E 2DEJA 4LFBI 2MDRA 1XXEA 4DPXA 4JI1I 2ZBKB 2O1VA 1JK1A 4EMDA 2ELZA 4WPYA 3ADGA 2DLQA 1BKNA 2VESA 1BBOA 3JAMQ 5A2QQ 1VISA 2YWQA 4NXNE 1YSAC 2RS7A 2RS6A 4R8OA 2UUBI 1FWKA 2UU9E 4LFCE 1ZAAC 4Q35B 2ZITA 3EPJA 2MC6A 1I94E 2UXCE 2YRHA 3HJCA 5GMDA 4MLQA 3EPKA 4DV4I 2EPXA 1T38A 4WX9A 1WXRA 1JK2A 2O1WA 4MYTA 4OZEA 1ZM2A 4DR1I 2JOXA 2JOBA 4IZJD 1GQEA 3V5RA 1MU5A 1ZM3A 4JG4A 2JEAB 3CWVA 4FWDA 1Z5CA 2ODRC 2VQFI 1X48A 2MDGA 1UN6B 2JWOA 4BMJA 1XNQE 2PNZA 4KZSA 2WP8A 4IZJA 4QNKA 1N36I 2EM6A 4IFDF 4BBYA 2GLIA 1ZBQA 5JEAC 1WHQA 2CPNA 2V85A 2YZTA 4LCHA 4IFDE 4M9VC 2A2CA 4J3DA 4DR4E 2XEXA 1ZR9A 4OO1D 2ENCA
chains in the Genus database with same CATH topology
3VYYA 5FLXQ 4LF9E 4DR3I 4P7AA 3H4LA 3VK6A 4X64E 4ED4A 4JI7I 3J80Q 2YT4A 4KHPI 1N32E 2LMZA 4FWGA 1YZ9A 2E1MA 4NXMI 4R03A 1Z0TA 1HR0I 1FWLA 2M7QA 1J5EE 2UUCI 2DSYA 4F9AB 4LFAE 1ELOA 1ZXNA 4DKKA 4DV7I 1DARA 5FWKA 2LUQA 3HPSA 4WFTA 4RPFA 2L3JA 4MYUA 2FV4B 4AQYE 2V8QB 3ADIA 2PNMA 2JY9A 1Z5BA 2UXBI 4L5NC 4B3RE 4LF4E 4DR5I 1USUA 1HNZE 5CFFE 4BC9A 4JV5I 2V2QA 3HULA 4GKJE 4KQVA 5LMNI 1FI4A 4USMA 1H74A 5L3JA 2BM0A 1HNWE 5T6JA 4X66E 4WUDA 1YYWA 4JI8I 5IWAE 4XTJA 1YYKA 1T4LB 4M30A 3ZOQB 2K4VA 3QT6A 1D6TA 5GMEA 1X49A 2DIXA 4LF8I 1EKZA 3FIGA 1STUA 1XMOI 4JYAI 3ZZUA 4DUYE 2GS8A 4GKKI 1S4EA 4DV5E 4JI4I 4DR6I 2CZ9A 2AJ4A 2X7IA 3D4JA 2L2NA 3ZZTA 4LF5I 1HNXE 1U2RA 4DV6I 1H72C 1IBLE 3P06A 2E5LI 2Z5EA 1DQ3A 3RMPA 1MG7A 4LU9A 4K0KE 2JR1A 1Z0VA 2CG9A 4DR4I 2KOUA 2VQEE 1FKAE 4LF6I 2V2VA 4HY1A 3T1YI 2WW4A 3GONA 2Z5CB 4UT4A 4DV0I 2EZ6A 4JI6I 2B3TB 4X64I 4OX9I 1XMQE 4JI2E 4DU8A 1KVKA 4DUZI 2UXDI 1GZ6A 1K47A 3JTZA 4P52A 3OTOI 3F6GA 4JI5E 1Z0BA 2HFSA 4DV3I 2G7HA 2R42A 2L2KB 4R1FA 4PRVA 3WU4A 1ZXMA 2MC5A 3T1HE 4LFAI 4JI3E 1T4NA 1IBMI 3J81C 4LF7I 4FW9A 4DV2I 3LLHA 3K1JA 5IT9C 3IWDA 4M2ZA 4AQYI 2KONA 1ZBTA 4B3TI 2HHHE 4LF4I 4LFBE 4DXLA 1HNZI 4P7DA 4JI1E 1NHHA 4M0VA 2F4VI 2EWLA 2FGGA 1H73A 1HK7A 3F0NA 4BC7A 3LPSA 2UUBE 1PVGA 2V83A 2V2ZA 2V87A 4DV4E 4F9CB 4HACB 2L8TA 2OI2A 5AE2A 4DR2E 4URLA 4DR1E 2M4IA 5LMUI 2IOPA 4L8NA 2VF3A 1N0VC 2Z5CA 2VQFE 1EA6A 1N34I 4DPWA 3QT5A 1N36E 2L6MA 2B9DA 2L2MA 3ZZ0A 1IBKI 1FJGE 4DUYI 1KKHA 3LTOA 4X62I 1XNRI 3KWRA 4I3HA 3JAMC 3LNUA 2ODRD 4DR3E 2E1RA 2UUAI 2Z5BB 4JI7E 4X65I 4DV1I 1IBLI 2N3GA 2VE7C 1PKPA 4I8OA 4P78A 4Q28A 1Y6ZA 1H7SA 2Q2EB 3PYEA 4OOGC 2VQEI 1EI1A 3DF6A 3J81Q 3M6AA 1KIJA 1ZM9A 4YY3E 4NXME 3PYFA 4NXNI 2DMYA 1Z0GA 1RQ0A 1A6FA 4LFCI 1HR0E 2UU9I 1I94I 2UXCI 2VF1A 4PU9A 4X8WA 2V88A 2N3HA 4N3OA 3J7Yp 2LTRA 2R3VA 2NA2A 3ADJA 4TUGA 3Q6MA 4HXZA 4J8ZA 4DMIA 4DV7E 1Y4SA 4JI5I 1XNQI 5AE3A 3H09A 4B3ME 1H7UA 4WYQB 2IOQA 2BM1A 2EFGA 5AE1A 2ZM6E 2LTSA 2NUEA 3AUZA 1USVA 4USKA 3JU0A 2LRSA 3T1HI 4DPTA 4DPUA 4JI3I 3WU6A 4BCAA 1OJ4A 4Z7CA 4LF9I 1B63A 3J7AG 2IHR1 4WSPA 3C4TA 2HK3A 2F8BA 3B8HA 2JVAA 2HKEA 5DNYA 4DR7E 4B3SE 4F54A 4JI8E 1N32I 5BR8E 2X36A 2HHHI 2WZOA 1Y4UA 2NPFA 4UTGA 2KHXA 4LF8E 3PRYA 3PYGA 2CGEA 2Z5BA 3IWCA 1PIEA 3ADLA 1J5EI 2V34A 1Z0EA 4JI0E 1XMOE 4LTYA 4JYAE 1N33E 2B7TA 2B7VA 3MSWA 4GKKE 4DR2I 3K85A 4JI4E 1QZRA 4DR6E 1FNMA 2O1TA 4TUIA 4LF5E 4DV6E 4YHHE 2V8PA 2E5LE 1UHZA 4F9BB 2M1SA 1X47A 4B3RI 1FJGI 3LMLA 4ZVIA 1MX0A 3WU5A 3OMLA 2HKJA 3J7AM 2V86A 4GKJI 4LF6E 3B82A 3T1YE 4WUCA 4DV0E 1WHNA 4JI6E 4OX9E 1HNWI 4X66I 1WUUA 5ADZA 3HTXA 3QT8A 4DU7A 1O0WA 2O1UA 5IWAI 1KTVA 4DUZE 2UXDE 4IZKB 3B78A 1XHKA 2LJPA 3ZKDA 5AASA 3OTOE 2L92A 1Z5AA 3HPZA 4YY3I 2L3CA 5F3WA 4DV3E 1NZ0A 2LE2A 1NHIA 1UEKA 2HK2A 3ZM7A 5LL6R 4DV5I 4GEQB 1S16A 2V89A 3AV0A 1DI2A 1ZM4A 1IBME 5A2QC 2NUGA 2L33A 4LF7E 1HNXI 4DV2E 3Q1QA 3P1XA 4B3MI 2ZM6I 3DJWA 4Z7YA 1N0UA 4KHPE 4K0KI 2GQ0A 2FTXB 3K6QA 4B3TE 4BS9A 4HYMA 1Z59A 1NHJA 2F4VE 3C4BA 5IT9Q 4DPYA 3F6HA 1XMQI 4IZJB 4JI2I 3V2UC 3VYXA 2UUCE 4FN5A 1T4OA 4DR7I 4FWHA 4B3SI 3PYDA 1B62A 5BR8I 2DEIA 2DB2A 1Z0CA 5FLXC 4M1KA 2J7KA 1UILA 1RR9A 3IWBA 5LMUE 2RTXA 1J26A 3HQ1A 2H36X 2NUFA 4WUBA 1N34E 3J80C 1QU6A 3WU3A 4HACA 2UXBE 4JI0I 2A2DA 1N33I 1SR9A 1IBKE 4DR5E 1RREA 4IZKA 4X62E 2BV3A 2HFUA 1XNRE 2PNLA 2LUPB 3K17A 4JV5E 3Q6NA 3HXLA 2RSMA 4PRXA 3QT7A 5LMNE 2UUAE 2LBSB 1YYOA 3ZKBA 2LJHA 4X65E 4DV1E 4YHHI 1RC7A 2DEJA 4LFBI 2MDRA 4DPXA 4JI1I 2ZBKB 2O1VA 4EMDA 4WPYA 3ADGA 3JAMQ 1BKNA 5A2QQ 1VISA 4NXNE 2RS7A 2RS6A 4R8OA 2UUBI 1FWKA 2UU9E 4LFCE 2ZITA 3HJCA 2MC6A 1I94E 2UXCE 5GMDA 4DV4I 1WXRA 4MYTA 2O1WA 1ZM2A 4DR1I 2JOXA 2JOBA 4IZJD 1GQEA 3V5RA 1MU5A 1ZM3A 4JG4A 3CWVA 4FWDA 1Z5CA 2ODRC 2VQFI 1X48A 1XNQE 2JWOA 4BMJA 4KZSA 4IZJA 1N36I 4BBYA 1ZBQA 1WHQA 2CPNA 2V85A 2YZTA 2A2CA 4DR4E 2XEXA 1Z0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYY A;  5FLX Q;  4LF9 E;  4DR3 I;  4P7A A;  3H4L A;  4X64 E;  4ED4 A;  4JI7 I;  3J80 Q;  2YT4 A;  4KHP I;  1N32 E;  4FWG A;  1YZ9 A;  4NXM I;  1Z0T A;  1HR0 I;  1FWL A;  1J5E E;  2UUC I;  4LFA E;  1ELO A;  1ZXN A;  4DKK A;  4DV7 I;  1DAR A;  2LUQ A;  4WFT A;  4RPF A;  2L3J A;  4MYU A;  4AQY E;  3ADI A;  2JY9 A;  1Z5B A;  2UXB I;  4B3R E;  4LF4 E;  4DR5 I;  1HNZ E;  5CFF E;  4JV5 I;  2V2Q A;  3HUL A;  4GKJ E;  4KQV A;  5LMN I;  1FI4 A;  4USM A;  1H74 A;  5L3J A;  2BM0 A;  1HNW E;  4X66 E;  4WUD A;  1YYW A;  4JI8 I;  5IWA E;  4XTJ A;  1YYK A;  1T4L B;  4M30 A;  3QT6 A;  1D6T A;  5GME A;  1X49 A;  2DIX A;  4LF8 I;  1EKZ A;  1STU A;  1XMO I;  4JYA I;  3ZZU A;  4DUY E;  2GS8 A;  4GKK I;  1S4E A;  4DV5 E;  4JI4 I;  4DR6 I;  2CZ9 A;  2AJ4 A;  2X7I A;  3D4J A;  2L2N A;  3ZZT A;  4LF5 I;  1HNX E;  1U2R A;  4DV6 I;  1H72 C;  1IBL E;  2E5L I;  1MG7 A;  1Z0V A;  4K0K E;  4DR4 I;  2VQE E;  1FKA E;  4LF6 I;  2V2V A;  4HY1 A;  3T1Y I;  2WW4 A;  3GON A;  4UT4 A;  4DV0 I;  2EZ6 A;  4JI6 I;  2B3T B;  4X64 I;  4OX9 I;  1XMQ E;  4JI2 E;  4DU8 A;  1KVK A;  4DUZ I;  2UXD I;  1K47 A;  4P52 A;  3OTO I;  4JI5 E;  1Z0B A;  2HFS A;  4DV3 I;  2R42 A;  2L2K B;  4R1F A;  4PRV A;  3WU4 A;  1ZXM A;  4LFA I;  3T1H E;  4JI3 E;  1T4N A;  1IBM I;  3J81 C;  4LF7 I;  4FW9 A;  4DV2 I;  3LLH A;  3K1J A;  5IT9 C;  4M2Z A;  4AQY I;  1ZBT A;  4B3T I;  2HHH E;  4LF4 I;  4LFB E;  4DXL A;  1HNZ I;  4JI1 E;  1NHH A;  2F4V I;  1H73 A;  3F0N A;  3LPS A;  2UUB E;  1PVG A;  2V2Z A;  4DV4 E;  4HAC B;  2OI2 A;  4DR2 E;  4URL A;  4DR1 E;  5LMU I;  2VF3 A;  1N0V C;  2VQF E;  1EA6 A;  1N34 I;  4DPW A;  3QT5 A;  1N36 E;  2L2M A;  3ZZ0 A;  1IBK I;  1FJG E;  4DUY I;  1KKH A;  3LTO A;  4X62 I;  1XNR I;  4I3H A;  3JAM C;  3LNU A;  4DR3 E;  2E1R A;  2UUA I;  4JI7 E;  4X65 I;  4DV1 I;  1IBL I;  2N3G A;  1PKP A;  1H7S A;  2Q2E B;  3PYE A;  4OOG C;  2VQE I;  1EI1 A;  3J81 Q;  3M6A A;  1KIJ A;  1ZM9 A;  4YY3 E;  4NXM E;  3PYF A;  4NXN I;  2DMY A;  1Z0G A;  1RQ0 A;  1A6F A;  4LFC I;  1HR0 E;  2UU9 I;  1I94 I;  2UXC I;  4PU9 A;  4X8W A;  2N3H A;  3J7Y p;  2LTR A;  2R3V A;  2NA2 A;  3ADJ A;  4HXZ A;  4DV7 E;  4JI5 I;  1XNQ I;  4B3M E;  1H7U A;  4WYQ B;  2BM1 A;  2EFG A;  2ZM6 E;  2LTS A;  2NUE A;  4USK A;  2LRS A;  3T1H I;  4DPT A;  4DPU A;  4JI3 I;  3WU6 A;  1OJ4 A;  4Z7C A;  4LF9 I;  1B63 A;  3J7A G;  2IHR 1;  3C4T A;  2HK3 A;  3B8H A;  2JVA A;  2HKE A;  4DR7 E;  4B3S E;  4JI8 E;  1N32 I;  5BR8 E;  2X36 A;  2HHH I;  2NPF A;  4UTG A;  2KHX A;  4LF8 E;  3PYG A;  1PIE A;  3ADL A;  1J5E I;  2V34 A;  1Z0E A;  4JI0 E;  1XMO E;  1N33 E;  4JYA E;  2B7T A;  2B7V A;  4GKK E;  4DR2 I;  4JI4 E;  1QZR A;  4DR6 E;  1FNM A;  4LF5 E;  4DV6 E;  4YHH E;  2V8P A;  2E5L E;  1UHZ A;  1X47 A;  4B3R I;  1FJG I;  4ZVI A;  1MX0 A;  3WU5 A;  2HKJ A;  3J7A M;  4GKJ I;  4LF6 E;  3B82 A;  3T1Y E;  4WUC A;  4DV0 E;  1WHN A;  4JI6 E;  4OX9 E;  1HNW I;  4X66 I;  1WUU A;  3HTX A;  3QT8 A;  4DU7 A;  1O0W A;  5IWA I;  1KTV A;  4DUZ E;  2UXD E;  3B78 A;  1XHK A;  2LJP A;  3ZKD A;  3OTO E;  1Z5A A;  4YY3 I;  2L3C A;  4DV3 E;  1NZ0 A;  1NHI A;  1UEK A;  2HK2 A;  3ZM7 A;  5LL6 R;  4DV5 I;  1S16 A;  1DI2 A;  1ZM4 A;  1IBM E;  5A2Q C;  2NUG A;  2L33 A;  4LF7 E;  1HNX I;  4DV2 E;  3Q1Q A;  3P1X A;  4B3M I;  2ZM6 I;  4Z7Y A;  1N0U A;  4KHP E;  4K0K I;  4B3T E;  4HYM A;  1Z59 A;  1NHJ A;  2F4V E;  3C4B A;  5IT9 Q;  4DPY A;  1XMQ I;  4JI2 I;  3V2U C;  3VYX A;  2UUC E;  4FN5 A;  1T4O A;  4DR7 I;  4FWH A;  4B3S I;  3PYD A;  1B62 A;  5BR8 I;  2DEI A;  2DB2 A;  1Z0C A;  5FLX C;  4M1K A;  2J7K A;  1UIL A;  1RR9 A;  5LMU E;  2RTX A;  1J26 A;  2NUF A;  4WUB A;  1N34 E;  3J80 C;  1QU6 A;  3WU3 A;  4HAC A;  2UXB E;  4JI0 I;  2A2D A;  1N33 I;  1IBK E;  4DR5 E;  1RRE A;  4X62 E;  2BV3 A;  2HFU A;  1XNR E;  2LUP B;  3K17 A;  4JV5 E;  2RSM A;  4PRX A;  3QT7 A;  5LMN E;  2UUA E;  2LBS B;  1YYO A;  3ZKB A;  2LJH A;  4X65 E;  4DV1 E;  4YHH I;  1RC7 A;  2DEJ A;  4LFB I;  2MDR A;  4DPX A;  4JI1 I;  2ZBK B;  4EMD A;  5A2Q Q;  3ADG A;  3JAM Q;  1BKN A;  1VIS A;  4NXN E;  2RS7 A;  2RS6 A;  2UUB I;  1FWK A;  2UU9 E;  4LFC E;  2ZIT A;  5GMD A;  1I94 E;  2UXC E;  4DV4 I;  4MYT A;  1ZM2 A;  4DR1 I;  1GQE A;  3V5R A;  1MU5 A;  1ZM3 A;  4JG4 A;  3CWV A;  4FWD A;  1Z5C A;  2VQF I;  1X48 A;  1XNQ E;  1N36 I;  1WHQ A;  2CPN A;  2A2C A;  4DR4 E;  2XEX A;  1Z0W A; 
#chains in the Genus database with same CATH topology
 3VYY A;  5FLX Q;  4LF9 E;  4DR3 I;  4MDT A;  4P7A A;  3H4L A;  4HEI A;  5JEA B;  3VK6 A;  4X64 E;  4ED4 A;  4JI7 I;  1UDQ A;  1F2I G;  2YRM A;  4OO1 A;  2EN6 A;  3J80 Q;  2EPR A;  2YT4 A;  1X6F A;  2LCE A;  1G2D C;  4KHP I;  2NAB A;  4O5G A;  3PS2 A;  1N32 E;  2EMW A;  2CTD A;  2EOZ A;  2LMZ A;  4FWG A;  3PS1 A;  2LV2 A;  2MKN A;  2E1M A;  1YZ9 A;  4NXM I;  4O24 A;  1A1F A;  3M85 D;  4R03 A;  1Z0T A;  1HR0 I;  1FWL A;  3M7N D;  3B4T A;  2YU8 A;  2M7Q A;  2ADR A;  1J5E E;  2AE8 A;  1R6M A;  2DSY A;  4ZYH A;  2JEB B;  3L7Z B;  2UUC I;  4F9A B;  3ECR A;  4LFA E;  2YTO A;  2EM9 A;  1ELO A;  5KL5 A;  1ZXN A;  4DKK A;  4DV7 I;  1DAR A;  5FWK A;  2LUQ A;  4IFD D;  1YHC A;  2ENA A;  3HPS A;  2EOQ A;  4R2E A;  5DNX A;  4WFT A;  1IQO A;  3CDI A;  4RPF A;  2EQ1 A;  2D9H A;  2L3J A;  1TF6 A;  4MYU A;  2FV4 B;  3BBG A;  4AQY E;  1YUJ A;  2V8Q B;  3ADI A;  2PNM A;  2JY9 A;  1PJQ A;  1Z5B A;  2UXB I;  1X6H A;  4L5N C;  4B3R E;  4LF4 E;  5ELW A;  4DR5 I;  5A6A A;  1A1J A;  1USU A;  3VHT B;  1HNZ E;  4NHR A;  2VRD A;  4NZV A;  4WXC A;  5CFF E;  4BC9 A;  5DRO A;  2JEA A;  1PJT A;  4JV5 I;  3P3C A;  2V2Q A;  3HUL A;  1TN9 A;  4GKJ E;  2ELY A;  1N3G A;  1A1L A;  4KQV A;  2EL4 A;  5LMN I;  4GZN C;  1FI4 A;  2BA1 D;  1H74 A;  1A1H A;  4USM A;  5L3J A;  2BM0 A;  4WXD A;  5T6J A;  1HNW E;  2EPL X;  4X66 E;  4WUD A;  1YYW A;  4JI8 I;  5IWA E;  2C38 B;  4XTJ A;  1YYK A;  1T4L B;  4M30 A;  2O3Z A;  1MEY C;  2EN7 A;  3ZOQ B;  2K4V A;  3QT6 A;  2EJ4 A;  5GME A;  1D6T A;  1X49 A;  2LO3 A;  1DGC A;  2DIX A;  5KL3 A;  4LF8 I;  2EMG A;  1BB8 A;  5JEA A;  1NEI A;  1EKZ A;  2EN4 A;  3FIG A;  2A25 A;  4IS1 C;  1Z1B A;  1STU A;  5KL4 A;  1XMO I;  4JYA I;  4O43 A;  3ZZU A;  4DUY E;  2C37 B;  2GS8 A;  2EMI A;  2YTI A;  2EOS A;  4GKK I;  4ZYD A;  4OKG A;  1S4E A;  4DV5 E;  4JI4 I;  4DR6 I;  2CZ9 A;  2AJ4 A;  2X7I A;  2J7J A;  3D4J A;  2L2N A;  2R1F A;  3ZZT A;  4OO1 F;  4LF5 I;  1HNX E;  1U2R A;  5K36 C;  3UHM A;  5A6B D;  2LT7 A;  4DV6 I;  1H72 C;  1IBL E;  3P06 A;  2E5L I;  2Z5E A;  1DQ3 A;  2NN6 B;  2JEB A;  2EMX A;  2EN8 A;  3RMP A;  1MG7 A;  4LU9 A;  4K0K E;  2JR1 A;  5A6B A;  2EM3 A;  1Z0V A;  2CG9 A;  4DR4 I;  2KOU A;  2VQE E;  2EE8 A;  1UDO A;  1FKA E;  1G2F C;  4LF6 I;  2V2V A;  4HY1 A;  3T1Y I;  2WW4 A;  3GON A;  2JP9 A;  3C6M A;  2Z5C B;  4UT4 A;  2CSH A;  2EZ6 A;  4DV0 I;  2B3T B;  4X64 I;  4JI6 I;  4OX9 I;  2E72 A;  1XMQ E;  4QNJ A;  2PO2 B;  1UDN A;  4JI2 E;  4DU8 A;  4IJD A;  2EOF A;  1KVK A;  4DUZ I;  2UXD I;  2GO3 A;  1GZ6 A;  1K47 A;  2EPP A;  3JTZ A;  1OYS A;  4P52 A;  3OTO I;  3F6G A;  3L00 A;  4AIM A;  2EN1 A;  4JI5 E;  1Z0B A;  2HFS A;  4IFD C;  2EL6 A;  2EPA A;  4DV3 I;  2BA0 D;  2G7H A;  2YTF A;  4LPF A;  1A1I A;  3QG5 C;  3MHS C;  2R42 A;  2YSO A;  1PJS A;  2EQ3 A;  2L2K B;  4R1F A;  2C38 A;  4PRV A;  3WU4 A;  1ZXM A;  3M85 G;  2MC5 A;  3T1H E;  4LFA I;  3M7N G;  4JI3 E;  1T4N A;  5EL9 A;  2EM0 A;  1IBM I;  3J81 C;  4LF7 I;  1IQS A;  5IV8 B;  2EPZ A;  4FW9 A;  4MU4 A;  4DV2 I;  3LLH A;  3K1J A;  4GQU A;  2EN2 A;  2Q8U A;  2EMK A;  4FK5 C;  5IT9 C;  3IWD A;  4M2Z A;  2EPN A;  2N8X A;  4AQY I;  4FW5 A;  2C37 A;  2BR2 B;  2KON A;  2C39 A;  3C6K A;  1ZBT A;  4B3T I;  2EOI A;  2HHH E;  4LFB E;  4LF4 I;  4DXL A;  2WNR B;  3U1K A;  1HNZ I;  4P7D A;  4JI1 E;  1Y5Y A;  2NN6 D;  1NHH A;  3KZY A;  5JEA F;  4M0V A;  2F4V I;  2EWL A;  2EOO A;  2FGG A;  1H73 A;  1HK7 A;  3F0N A;  5JEA E;  4BC7 A;  3THN A;  3LPS A;  5TSE A;  2UUB E;  2NN6 A;  1PVG A;  3DD6 A;  5IXM B;  2V83 A;  2V2Z A;  2V87 A;  2JYA A;  2R76 A;  4DV4 E;  4O4K A;  4F9C B;  4HAC B;  2L8T A;  2DRP A;  2OI2 A;  5AE2 A;  4DR2 E;  2EMH A;  1KYQ A;  5C0X C;  4URL A;  4DR1 E;  2BA1 G;  3PS3 A;  3UK3 C;  2M4I A;  5LMU I;  2IOP A;  4L8N A;  4ZYE A;  2PO1 B;  2VF3 A;  1N0V C;  1RMD A;  1SFE A;  2Z5C A;  2VQF E;  4R2Q A;  1EH6 A;  1EA6 A;  1N34 I;  4DPW A;  3QT5 A;  2RPC A;  4WSG A;  1N36 E;  1E3H A;  2PO2 A;  4MU1 A;  2L6M A;  5C0X B;  2B9D A;  4KWY A;  2L2M A;  1AAY A;  4FW7 A;  3ZZ0 A;  1IBK I;  1FJG E;  4DUY I;  1KKH A;  3LTO A;  4X62 I;  4MU3 A;  1XNR I;  1KJK A;  3KWR A;  4I3H A;  3JAM C;  3LNU A;  2ODR D;  4DR3 E;  2YPN A;  2E1R A;  2UUA I;  2Z5B B;  4JI7 E;  4X65 I;  2EMZ A;  4R2R A;  4DV1 I;  2EOY A;  4LCF A;  1IBL I;  1B69 A;  2WCC 3;  2N3G A;  2VE7 C;  5JEA D;  1PKP A;  2HGH A;  2EM2 A;  4I8O A;  4P78 A;  4Q28 A;  1Y6Z A;  2YTN A;  1H7S A;  2Q2E B;  1WJP A;  4OOG C;  2EM4 A;  3PYE A;  2VQE I;  2EMA A;  1EI1 A;  1AH5 A;  3DF6 A;  2JE6 B;  3J81 Q;  3M6A A;  1KIJ A;  1ZM9 A;  4YY3 E;  4NXM E;  3P3E A;  3PYF A;  2DMY A;  4R2S A;  4NXN I;  1Z0G A;  1MGT A;  4FW3 A;  4R2D A;  1RQ0 A;  1A6F A;  4LFC I;  1HR0 E;  2UU9 I;  1I94 I;  2UXC I;  2VF1 A;  4PU9 A;  2BR2 A;  4X8W A;  2BB8 A;  2JXP A;  2V88 A;  5LLQ A;  5A6K A;  2N3H A;  1A1G A;  3GCM A;  4N3O A;  3J7Y p;  2LTR A;  4N4R B;  2WNR A;  3GME A;  3U1Y A;  2WBT A;  1BBG A;  2NA2 A;  3ADJ A;  4TUG A;  2R3V A;  3Q6M A;  4HXZ A;  4OO1 C;  4J8Z A;  2EPM X;  4DMI A;  4DV7 E;  1Y4S A;  4LOM A;  4JI5 I;  1XNQ I;  5AE3 A;  3H09 A;  4B3M E;  1H7U A;  4WYQ B;  5AC5 A;  5DNL A;  1GTK A;  2EM7 A;  1EH7 A;  4F2J C;  2IOQ A;  2BM1 A;  2EFG A;  3L7Z A;  5AE1 A;  2ZM6 E;  4R2A A;  1LLM C;  2LTS A;  4R2C A;  2NUE A;  3AUZ A;  1X3C A;  1USV A;  4USK A;  3JU0 A;  5K36 B;  2LRS A;  3T1H I;  4DPT A;  2BA0 G;  4DPU A;  2JT2 A;  2EPK X;  4JI3 I;  3WU6 A;  4BCA A;  2EOX A;  1X5W A;  1OJ4 A;  4Z7C A;  4LF9 I;  2YTJ A;  2PO1 A;  1B63 A;  3THO B;  2NN6 F;  3J7A G;  4BA2 B;  2IHR 1;  4WSP A;  4MU0 A;  2GPI A;  1EH8 A;  2WBS A;  2YRK A;  3C4T A;  2F8B A;  2HK3 A;  5C0X A;  2NN6 E;  2YTE A;  2PRT A;  2M9A A;  3B8H A;  4F6N A;  2PO0 B;  1UBD C;  2JVA A;  2HKE A;  5DNY A;  4DR7 E;  4FW4 A;  4B3S E;  4F54 A;  4JI8 E;  1N32 I;  5BR8 E;  2X36 A;  2HHH I;  2RSI A;  2WZO A;  1P47 A;  1Y4U A;  2NPF A;  4UTG A;  2KHX A;  2EL5 A;  2EM8 A;  4LF8 E;  2CGE A;  2Z5B A;  3PRY A;  4MLV A;  3IWC A;  1PIE A;  3PYG A;  3ADL A;  4BHB A;  2EQ0 A;  4IS9 A;  1J5E I;  4BHC A;  2V34 A;  1YH8 A;  1Z0E A;  4JI0 E;  2EOR A;  5KL2 A;  1XMO E;  2EPU A;  3BID A;  4LTY A;  4JYA E;  2B7T A;  1N33 E;  5DRP A;  4IFD B;  2J65 A;  2B7V A;  1YUI A;  3H1C A;  3MSW A;  4GKK E;  4DR2 I;  3K85 A;  2JE6 A;  2YTD A;  4JI4 E;  1QZR A;  4DR6 E;  2EMC A;  1FNM A;  4FW6 A;  1NCS A;  3MHH C;  2O1T A;  4TUI A;  3GLL A;  4LF5 E;  4DV6 E;  4U3D A;  4YHH E;  2V8P A;  1RHY A;  2E5L E;  1UHZ A;  1OYP A;  4F9B B;  2M1S A;  1X47 A;  2EOH A;  4BA1 B;  2EMB A;  1E3P A;  4B3R I;  1FJG I;  4MQY A;  2EPC A;  2GHF A;  3LML A;  1OYR A;  2CT1 A;  4ZVI A;  1MX0 A;  3WU5 A;  3OML A;  1Z0W A;  2HKJ A;  3J7A M;  2V86 A;  4GKJ I;  4LF6 E;  2EMY A;  2WBU A;  3T1Y E;  3B82 A;  4F6M A;  4WUC A;  5K36 D;  1WRJ A;  4DV0 E;  1WHN A;  4JI6 E;  4OX9 E;  1HNW I;  1UDS A;  4X66 I;  1WUU A;  4AID A;  3BF2 A;  5ADZ A;  3HTX A;  3QT8 A;  4DU7 A;  1O0W A;  2O1U A;  5IWA I;  4HTG A;  1KTV A;  4DUZ E;  5K36 A;  2K7I A;  2UXD E;  4IZK B;  2BBG A;  3B78 A;  2MKD A;  2LVH A;  1XHK A;  2LJP A;  4LCG A;  3ZKD A;  4RHB B;  5AAS A;  3OTO E;  1TF3 A;  2L92 A;  3EQ1 A;  2EM5 A;  3HPZ A;  1Z5A A;  4YY3 I;  2L3C A;  3BGH A;  5F3W A;  4NBQ A;  4BA2 A;  2LJU A;  2HC5 A;  1YFH A;  3P76 A;  4DV3 E;  2EP3 A;  2IES A;  1NZ0 A;  2PO0 A;  2LE2 A;  1NHI A;  1UEK A;  2HK2 A;  2IER A;  4U3B A;  5KL7 A;  2YTQ A;  3ZM7 A;  5LL6 R;  4DV5 I;  4GEQ B;  1S16 A;  2EOE A;  2V89 A;  3AV0 A;  1DI2 A;  1IBM E;  1ZM4 A;  5A2Q C;  3CDJ A;  2NUG A;  2L33 A;  4LF7 E;  1HNX I;  5KL6 A;  5C0X F;  4DV2 E;  4AM3 A;  3Q1Q A;  3P1X A;  4B3M I;  2YSP A;  5C0X E;  2ZM6 I;  3DJW A;  1A1K A;  4Z7Y A;  1N0U A;  4IFD A;  1T39 A;  4KHP E;  4K0K I;  2EML A;  2GQ0 A;  2FTX B;  3K6Q A;  4B3T E;  4BS9 A;  2GO4 A;  3KRN A;  4HYM A;  2I13 A;  1Z59 A;  2ENH A;  5DRR A;  4X9J A;  1NHJ A;  2F4V E;  3EPL A;  3C4B A;  1YPN A;  5IT9 Q;  3KZZ A;  5EKW A;  3F6H A;  4DPY A;  2JPA A;  2DGC A;  3EPH A;  2WP8 B;  4IZJ B;  2PNZ B;  1XMQ I;  4JI2 I;  3V2U C;  3VYX A;  2UUC E;  1IMU A;  4BA1 A;  1QNT A;  2EPO A;  4FN5 A;  1T4O A;  4DR7 I;  4FWH A;  4B3S I;  3PYD A;  2DLK A;  3TQM A;  1B62 A;  5BR8 I;  3M99 B;  2DB2 A;  2DEI A;  5A6J A;  1Z0C A;  1VI7 A;  5FLX C;  4M1K A;  1R6L A;  2J7K A;  2YTG A;  1UIL A;  1RR9 A;  2EOJ A;  3IWB A;  5LMU E;  2HJJ A;  2RTX A;  2YTP A;  2H36 X;  3HQ1 A;  2NUF A;  1J26 A;  2CVE A;  1PDA A;  4WUB A;  1ZU1 A;  1N34 E;  3J80 C;  1QU6 A;  2F1D A;  3P3G A;  3WU3 A;  4OO1 B;  4HAC A;  5A69 A;  2YU5 A;  2DMI A;  5DRQ A;  2RQL A;  2UXB E;  4JI0 I;  2A2D A;  1Y60 A;  1SR9 A;  1IBK E;  1N33 I;  4DR5 E;  1RRE A;  4IZK A;  4ZYG A;  2EOM A;  5C0X D;  4X62 E;  2C39 B;  2NN6 C;  2BV3 A;  2HFU A;  1XNR E;  1P42 A;  2LUP B;  2PNL A;  4JV5 E;  3K17 A;  3Q6N A;  3HXL A;  2RSM A;  2EN3 A;  4PRX A;  2EMF A;  5AC4 A;  5LMN E;  4R2P A;  3QT7 A;  2UUA E;  2LBS B;  1YYO A;  2I9I A;  3HKM A;  2LJH A;  4X65 E;  3ZKB A;  4DV1 E;  4YHH I;  4ISA A;  4OO1 E;  5K36 F;  1X6E A;  3NZK A;  1L4S A;  4RH8 A;  1RC7 A;  5K36 E;  2DEJ A;  4LFB I;  2MDR A;  1XXE A;  4DPX A;  4JI1 I;  2ZBK B;  2O1V A;  1JK1 A;  4EMD A;  2ELZ A;  4WPY A;  3ADG A;  2DLQ A;  1BKN A;  2VES A;  1BBO A;  3JAM Q;  5A2Q Q;  1VIS A;  2YWQ A;  4NXN E;  1YSA C;  2RS7 A;  2RS6 A;  4R8O A;  2UUB I;  1FWK A;  2UU9 E;  4LFC E;  1ZAA C;  4Q35 B;  2ZIT A;  3EPJ A;  2MC6 A;  1I94 E;  2UXC E;  2YRH A;  3HJC A;  5GMD A;  4MLQ A;  3EPK A;  4DV4 I;  2EPX A;  1T38 A;  4WX9 A;  1WXR A;  1JK2 A;  2O1W A;  4MYT A;  4OZE A;  1ZM2 A;  4DR1 I;  2JOX A;  2JOB A;  4IZJ D;  1GQE A;  3V5R A;  1MU5 A;  1ZM3 A;  4JG4 A;  2JEA B;  3CWV A;  4FWD A;  1Z5C A;  2ODR C;  2VQF I;  1X48 A;  2MDG A;  1UN6 B;  2JWO A;  4BMJ A;  1XNQ E;  2PNZ A;  4KZS A;  2WP8 A;  4IZJ A;  4QNK A;  1N36 I;  2EM6 A;  4IFD F;  4BBY A;  2GLI A;  1ZBQ A;  5JEA C;  1WHQ A;  2CPN A;  2V85 A;  2YZT A;  4LCH A;  4IFD E;  4M9V C;  2A2C A;  4J3D A;  4DR4 E;  2XEX A;  1ZR9 A;  4OO1 D;  2ENC A; 
#chains in the Genus database with same CATH homology
 3VYY A;  5FLX Q;  4LF9 E;  4DR3 I;  4P7A A;  3H4L A;  3VK6 A;  4X64 E;  4ED4 A;  4JI7 I;  3J80 Q;  2YT4 A;  4KHP I;  1N32 E;  2LMZ A;  4FWG A;  1YZ9 A;  2E1M A;  4NXM I;  4R03 A;  1Z0T A;  1HR0 I;  1FWL A;  2M7Q A;  1J5E E;  2UUC I;  2DSY A;  4F9A B;  4LFA E;  1ELO A;  1ZXN A;  4DKK A;  4DV7 I;  1DAR A;  5FWK A;  2LUQ A;  3HPS A;  4WFT A;  4RPF A;  2L3J A;  4MYU A;  2FV4 B;  4AQY E;  2V8Q B;  3ADI A;  2PNM A;  2JY9 A;  1Z5B A;  2UXB I;  4L5N C;  4B3R E;  4LF4 E;  4DR5 I;  1USU A;  1HNZ E;  5CFF E;  4BC9 A;  4JV5 I;  2V2Q A;  3HUL A;  4GKJ E;  4KQV A;  5LMN I;  1FI4 A;  4USM A;  1H74 A;  5L3J A;  2BM0 A;  1HNW E;  5T6J A;  4X66 E;  4WUD A;  1YYW A;  4JI8 I;  5IWA E;  4XTJ A;  1YYK A;  1T4L B;  4M30 A;  3ZOQ B;  2K4V A;  3QT6 A;  1D6T A;  5GME A;  1X49 A;  2DIX A;  4LF8 I;  1EKZ A;  3FIG A;  1STU A;  1XMO I;  4JYA I;  3ZZU A;  4DUY E;  2GS8 A;  4GKK I;  1S4E A;  4DV5 E;  4JI4 I;  4DR6 I;  2CZ9 A;  2AJ4 A;  2X7I A;  3D4J A;  2L2N A;  3ZZT A;  4LF5 I;  1HNX E;  1U2R A;  4DV6 I;  1H72 C;  1IBL E;  3P06 A;  2E5L I;  2Z5E A;  1DQ3 A;  3RMP A;  1MG7 A;  4LU9 A;  4K0K E;  2JR1 A;  1Z0V A;  2CG9 A;  4DR4 I;  2KOU A;  2VQE E;  1FKA E;  4LF6 I;  2V2V A;  4HY1 A;  3T1Y I;  2WW4 A;  3GON A;  2Z5C B;  4UT4 A;  4DV0 I;  2EZ6 A;  4JI6 I;  2B3T B;  4X64 I;  4OX9 I;  1XMQ E;  4JI2 E;  4DU8 A;  1KVK A;  4DUZ I;  2UXD I;  1GZ6 A;  1K47 A;  3JTZ A;  4P52 A;  3OTO I;  3F6G A;  4JI5 E;  1Z0B A;  2HFS A;  4DV3 I;  2G7H A;  2R42 A;  2L2K B;  4R1F A;  4PRV A;  3WU4 A;  1ZXM A;  2MC5 A;  3T1H E;  4LFA I;  4JI3 E;  1T4N A;  1IBM I;  3J81 C;  4LF7 I;  4FW9 A;  4DV2 I;  3LLH A;  3K1J A;  5IT9 C;  3IWD A;  4M2Z A;  4AQY I;  2KON A;  1ZBT A;  4B3T I;  2HHH E;  4LF4 I;  4LFB E;  4DXL A;  1HNZ I;  4P7D A;  4JI1 E;  1NHH A;  4M0V A;  2F4V I;  2EWL A;  2FGG A;  1H73 A;  1HK7 A;  3F0N A;  4BC7 A;  3LPS A;  2UUB E;  1PVG A;  2V83 A;  2V2Z A;  2V87 A;  4DV4 E;  4F9C B;  4HAC B;  2L8T A;  2OI2 A;  5AE2 A;  4DR2 E;  4URL A;  4DR1 E;  2M4I A;  5LMU I;  2IOP A;  4L8N A;  2VF3 A;  1N0V C;  2Z5C A;  2VQF E;  1EA6 A;  1N34 I;  4DPW A;  3QT5 A;  1N36 E;  2L6M A;  2B9D A;  2L2M A;  3ZZ0 A;  1IBK I;  1FJG E;  4DUY I;  1KKH A;  3LTO A;  4X62 I;  1XNR I;  3KWR A;  4I3H A;  3JAM C;  3LNU A;  2ODR D;  4DR3 E;  2E1R A;  2UUA I;  2Z5B B;  4JI7 E;  4X65 I;  4DV1 I;  1IBL I;  2N3G A;  2VE7 C;  1PKP A;  4I8O A;  4P78 A;  4Q28 A;  1Y6Z A;  1H7S A;  2Q2E B;  3PYE A;  4OOG C;  2VQE I;  1EI1 A;  3DF6 A;  3J81 Q;  3M6A A;  1KIJ A;  1ZM9 A;  4YY3 E;  4NXM E;  3PYF A;  4NXN I;  2DMY A;  1Z0G A;  1RQ0 A;  1A6F A;  4LFC I;  1HR0 E;  2UU9 I;  1I94 I;  2UXC I;  2VF1 A;  4PU9 A;  4X8W A;  2V88 A;  2N3H A;  4N3O A;  3J7Y p;  2LTR A;  2R3V A;  2NA2 A;  3ADJ A;  4TUG A;  3Q6M A;  4HXZ A;  4J8Z A;  4DMI A;  4DV7 E;  1Y4S A;  4JI5 I;  1XNQ I;  5AE3 A;  3H09 A;  4B3M E;  1H7U A;  4WYQ B;  2IOQ A;  2BM1 A;  2EFG A;  5AE1 A;  2ZM6 E;  2LTS A;  2NUE A;  3AUZ A;  1USV A;  4USK A;  3JU0 A;  2LRS A;  3T1H I;  4DPT A;  4DPU A;  4JI3 I;  3WU6 A;  4BCA A;  1OJ4 A;  4Z7C A;  4LF9 I;  1B63 A;  3J7A G;  2IHR 1;  4WSP A;  3C4T A;  2HK3 A;  2F8B A;  3B8H A;  2JVA A;  2HKE A;  5DNY A;  4DR7 E;  4B3S E;  4F54 A;  4JI8 E;  1N32 I;  5BR8 E;  2X36 A;  2HHH I;  2WZO A;  1Y4U A;  2NPF A;  4UTG A;  2KHX A;  4LF8 E;  3PRY A;  3PYG A;  2CGE A;  2Z5B A;  3IWC A;  1PIE A;  3ADL A;  1J5E I;  2V34 A;  1Z0E A;  4JI0 E;  1XMO E;  4LTY A;  4JYA E;  1N33 E;  2B7T A;  2B7V A;  3MSW A;  4GKK E;  4DR2 I;  3K85 A;  4JI4 E;  1QZR A;  4DR6 E;  1FNM A;  2O1T A;  4TUI A;  4LF5 E;  4DV6 E;  4YHH E;  2V8P A;  2E5L E;  1UHZ A;  4F9B B;  2M1S A;  1X47 A;  4B3R I;  1FJG I;  3LML A;  4ZVI A;  1MX0 A;  3WU5 A;  3OML A;  2HKJ A;  3J7A M;  2V86 A;  4GKJ I;  4LF6 E;  3B82 A;  3T1Y E;  4WUC A;  4DV0 E;  1WHN A;  4JI6 E;  4OX9 E;  1HNW I;  4X66 I;  1WUU A;  5ADZ A;  3HTX A;  3QT8 A;  4DU7 A;  1O0W A;  2O1U A;  5IWA I;  1KTV A;  4DUZ E;  2UXD E;  4IZK B;  3B78 A;  1XHK A;  2LJP A;  3ZKD A;  5AAS A;  3OTO E;  2L92 A;  1Z5A A;  3HPZ A;  4YY3 I;  2L3C A;  5F3W A;  4DV3 E;  1NZ0 A;  2LE2 A;  1NHI A;  1UEK A;  2HK2 A;  3ZM7 A;  5LL6 R;  4DV5 I;  4GEQ B;  1S16 A;  2V89 A;  3AV0 A;  1DI2 A;  1ZM4 A;  1IBM E;  5A2Q C;  2NUG A;  2L33 A;  4LF7 E;  1HNX I;  4DV2 E;  3Q1Q A;  3P1X A;  4B3M I;  2ZM6 I;  3DJW A;  4Z7Y A;  1N0U A;  4KHP E;  4K0K I;  2GQ0 A;  2FTX B;  3K6Q A;  4B3T E;  4BS9 A;  4HYM A;  1Z59 A;  1NHJ A;  2F4V E;  3C4B A;  5IT9 Q;  4DPY A;  3F6H A;  1XMQ I;  4IZJ B;  4JI2 I;  3V2U C;  3VYX A;  2UUC E;  4FN5 A;  1T4O A;  4DR7 I;  4FWH A;  4B3S I;  3PYD A;  1B62 A;  5BR8 I;  2DEI A;  2DB2 A;  1Z0C A;  5FLX C;  4M1K A;  2J7K A;  1UIL A;  1RR9 A;  3IWB A;  5LMU E;  2RTX A;  1J26 A;  3HQ1 A;  2H36 X;  2NUF A;  4WUB A;  1N34 E;  3J80 C;  1QU6 A;  3WU3 A;  4HAC A;  2UXB E;  4JI0 I;  2A2D A;  1N33 I;  1SR9 A;  1IBK E;  4DR5 E;  1RRE A;  4IZK A;  4X62 E;  2BV3 A;  2HFU A;  1XNR E;  2PNL A;  2LUP B;  3K17 A;  4JV5 E;  3Q6N A;  3HXL A;  2RSM A;  4PRX A;  3QT7 A;  5LMN E;  2UUA E;  2LBS B;  1YYO A;  3ZKB A;  2LJH A;  4X65 E;  4DV1 E;  4YHH I;  1RC7 A;  2DEJ A;  4LFB I;  2MDR A;  4DPX A;  4JI1 I;  2ZBK B;  2O1V A;  4EMD A;  4WPY A;  3ADG A;  3JAM Q;  1BKN A;  5A2Q Q;  1VIS A;  4NXN E;  2RS7 A;  2RS6 A;  4R8O A;  2UUB I;  1FWK A;  2UU9 E;  4LFC E;  2ZIT A;  3HJC A;  2MC6 A;  1I94 E;  2UXC E;  5GMD A;  4DV4 I;  1WXR A;  4MYT A;  2O1W A;  1ZM2 A;  4DR1 I;  2JOX A;  2JOB A;  4IZJ D;  1GQE A;  3V5R A;  1MU5 A;  1ZM3 A;  4JG4 A;  3CWV A;  4FWD A;  1Z5C A;  2ODR C;  2VQF I;  1X48 A;  1XNQ E;  2JWO A;  4BMJ A;  4KZS A;  4IZJ A;  1N36 I;  4BBY A;  1ZBQ A;  1WHQ A;  2CPN A;  2V85 A;  2YZT A;  2A2C A;  4DR4 E;  2XEX A;  1Z0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...