2HHHE

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2hhhE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2hhhE02
1B63A 4DR7E 3PYGA 1FNMA 2BM0A 3ADIA 2XEXA 4HY1A 1GQEA 4LF5I 5BR8I 2CPNA 2X7IA 2BM1A 2NUFA 2YT4A 3T1HI 4JI6E 4X8WA 2LBSB 1XNQE 4DPXA 4K0KE 2F4VI 3PYFA 2UXBE 1IBLI 4JYAE 4DPWA 3Q1QA 5IT9C 4DPUA 1KKHA 3J7AG 4NXNE 2NUEA 1HNZI 4DV3E 4HXZA 1XNRI 3ZKDA 2LTSA 1HR0I 4JV5I 2L33A 5A2QQ 1KTVA 4DV7E 3JAMQ 4LFAI 3P1XA 4LF7I 4WUCA 4WYQB 4KHPI 1N0VC 1ELOA 4DUYE 4LF6E 1X47A 4LF4I 1I94E 1IBMI 1XMQI 1N32I 2L3JA 2DMYA 4P7AA 1Z0WA 1HNXI 1PVGA 4AQYI 2ZM6E 3B78A 1S4EA 1N33E 4JI2I 4USKA 1WUUA 2VF3A 4FWGA 2VQEE 4NXME 1RQ0A 2RS7A 4OOGC 1XMOI 1HNWE 1J26A 5LMNI 2E5LI 4GKKE 3F0NA 2B7TA 2KHXA 2UUBI 3ZZ0A 4X62I 2B7VA 4JI0E 4YHHI 4X66I 1Z0EA 4B3SI 4JI5E 2AJ4A 4DV5E 2UUCE 4LFCE 2LUPB 4JI4I 3J7Yp 1ZM4A 4FW9A 3C4BA 2HFSA 1YYKA 3J80Q 4OX9E 2HHHE 1Z0GA 1J5EI 4B3TE 5IWAE 1T4LB 4PRXA 1FJGI 4DUZE 1QU6A 4LF9I 2L2KB 4X64I 1N0UA 4JI7E 4DR1E 3K17A 3WU5A 2LJHA 3QT7A 1X49A 4DR2I 2UUAE 1Z0VA 4M1KA 4MYTA 2DEJA 4DR3I 4DV0E 1OJ4A 3V2UC 3ZKBA 4WUBA 3T1HE 5IT9Q 1ZXMA 2Q2EB 1X48A 1IBLE 4DV1I 3B82A 2R3VA 2UXDE 4DU8A 4DUYI 1NHHA 1RREA 4JI3I 1DARA 4DR7I 1ZXNA 3T1YI 1PIEA 4HACA 5LL6R 2ZITA 3J81C 2LUQA 1HNZE 1XNRE 4B3RI 4K0KI 2UXBI 1ZM9A 4DXLA 4LFAE 3K1JA 1FWKA 4GKJI 4DV4E 4DV2E 2HK3A 2LRSA 5FLXC 1EI1A 5GMDA 1T4OA 4DU7A 4WUDA 4DR4I 4YY3E 1Z5CA 3HULA 3ZM7A 2WW4A 2GS8A 4AQYE 3H4LA 1FKAE 2HKEA 4JI2E 1IBKI 3GONA 4LF6I 2V8PA 1I94I 3QT5A 1FI4A 5A2QC 5LMUE 1H72C 3JAMC 2UUBE 4B3ME 4X62E 2X36A 2HFUA 1Z5BA 4X66E 3PYEA 4R1FA 2LTRA 4B3SE 1N36I 2RTXA 2VQFE 4ED4A 1UHZA 3QT6A 3WU3A 2VQEI 4NXMI 2EZ6A 4JI4E 4DR5I 3OTOE 4X65I 3ZZUA 1Z0BA 1Z59A 3C4TA 1KIJA 4DV6E 1H73A 2JY9A 4JI8I 1A6FA 3PYDA 1MX0A 1J5EE 4JI5I 1QZRA 3QT8A 3B8HA 4DV5I 4LFBI 4LFCI 4DR6E 3D4JA 1N34E 4JI1E 3LLHA 2N3HA 2E1RA 3M6AA 1MG7A 1MU5A 3ADJA 3V5RA 1KVKA 1WHQA 3WU4A 3LTOA 4OX9I 4DR2E 3LNUA 2HHHI 4Z7CA 2UXCI 4JG4A 2DB2A 1NHJA 4B3TI 5IWAI 4DR3E 5L3JA 4UT4A 2R42A 4RPFA 4LF5E 3CWVA 5BR8E 4DUZI 4UTGA 1ZM2A 4LF8I 2UU9I 2J7KA 4JI7I 3J7AM 3ZZTA 2F4VE 2BV3A 2L3CA 2NUGA 2HKJA 2OI2A 4DPTA 2UUAI 4JI3E 1T4NA 5GMEA 3HTXA 3T1YE 4DPYA 4DV0I 2IHR1 3WU6A 4Z7YA 4JI6I 2DEIA 1XNQI 4I3HA 5FLXQ 4B3RE 2LJPA 1UILA 1HR0E 1RC7A 4JV5E 2EFGA 4JYAI 2UXDI 1PKPA 4LF7E 4M2ZA 4GKJE 4KHPE 1H7UA 1K47A 1Z5AA 4LF4E 1ZM3A 4NXNI 2L2MA 4DV3I 1DI2A 4DR4E 1B62A 1IBME 1XMQE 1UEKA 1N32E 4ZVIA 4HYMA 4USMA 4URLA 2A2CA 1HNXE 1STUA 4DV7I 1YYWA 2MDRA 1Z0CA 4DV4I 4DV2I 1IBKE 5CFFE 1NHIA 2ZBKB 1EA6A 3ADGA 4FN5A 4XTJA 1Z0TA 2N3GA 1XMOE 3ADLA 4YY3I 5LMNE 2B3TB 2E5LE 4FWDA 1H74A 1VISA 4HACB 1ZBTA 2ZM6I 4YHHE 1FWLA 1N36E 1N33I 1D6TA 4PRVA 1RR9A 2V2QA 3VYYA 4DR5E 2DIXA 2JVAA 4X65E 4EMDA 1HNWI 5LMUI 4PU9A 1BKNA 2NPFA 4GKKI 4M30A 2NA2A 3VYXA 1H7SA 4MYUA 4B3MI 1U2RA 2L2NA 4JI0I 4JI8E 4FWHA 2VQFI 1FJGE 2V34A 4LFBE 2UUCI 2RS6A 4KQVA 4WFTA 4LF9E 1S16A 4X64E 3OTOI 2RSMA 4P52A 2V2VA 4DV6I 3LPSA 2UXCE 1XHKA 2V2ZA 2HK2A 4DR6I 4DKKA 1WHNA 1N34I 4LF8E 1O0WA 4JI1I 3J80C 2UU9E 1YZ9A 1NZ0A 4DR1I 3J81Q 1EKZA 4DV1E 2CZ9A 1YYOA 2A2DA
chains in the Genus database with same CATH superfamily
4TUGA 1B63A 2VF1A 4DR7E 2NN6A 5A69A 3PYGA 4BS9A 2EN3A 4F2JC 2Z5EA 1FNMA 5C0XB 2JOXA 2BM0A 2EM5A 2EN2A 1WRJA 3ADIA 2BA1D 2EM4A 2YSPA 4GZNC 2XEXA 4HY1A 2MKDA 1GQEA 4LF5I 2BBGA 5BR8I 2CPNA 2X7IA 2BM1A 2NUFA 2O1WA 2YT4A 3T1HI 4JI6E 2CVEA 4X8WA 2LBSB 1XNQE 2GO3A 4DMIA 2YRKA 4BBYA 3Q6NA 3DF6A 4DPXA 2RSIA 4K0KE 2F4VI 2C39B 2DMIA 3PYFA 2EPRA 5AE3A 2UXBE 3JU0A 1IBLI 2YZTA 3VK6A 4JYAE 1Y5YA 4IS1C 4DPWA 4WPYA 3Q1QA 2HC5A 4GQUA 4R2SA 3EPJA 2EOYA 2EN1A 1A1GA 1E3PA 3EPLA 5IT9C 4DPUA 4RHBB 2YTDA 1KKHA 1WXRA 4I8OA 2I13A 4BA1A 4O4KA 3J7AG 3KZYA 4NXNE 2VESA 2NUEA 2EPZA 4DV3E 1HNZI 4HXZA 2EPKX 2JYAA 3ZKDA 5TSEA 2LTSA 3B4TA 2Z5BA 1XNRI 1WJPA 4U3BA 1HR0I 2PNZB 4JV5I 1GZ6A 2L33A 4R2RA 5A2QQ 2EPUA 3HJCA 1KTVA 4DV7E 3U1YA 2LCEA 3L7ZB 3P1XA 4U3DA 2I9IA 3JAMQ 4LFAI 3LMLA 4LF7I 4WUCA 2BB8A 4IZKA 4WYQB 4KHPI 1N0VC 5A6JA 1ELOA 2WNRA 2FTXB 4LF6E 1BB8A 2IESA 5DRQA 1X47A 4BMJA 4LF4I 1VI7A 2ODRC 1I94E 2YTQA 1ZAAC 1IBMI 1XMQI 5A6KA 1N32I 1JK2A 2WZOA 2DMYA 2L3JA 4FK5C 4ZYHA 4P7AA 4QNJA 3AUZA 2WBTA 1Z0WA 2PO2A 3MHHC 1PVGA 1HNXI 4AQYI 2EM0A 2ZM6E 2O1TA 2C38B 4NZVA 2Z5CB 1P47A 3B78A 2B9DA 1N33E 1S4EA 4JI2I 4RH8A 2EMLA 4USKA 1WUUA 2N8XA 2VF3A 4FWGA 3M85D 2VQEE 4NXME 1P42A 3ECRA 1RQ0A 2RS7A 2EMKA 2MKNA 3P3EA 4OOGC 1XMOI 1HNWE 1J26A 1HK7A 5LMNI 2E5LI 4GKKE 3C6MA 5JEAA 4QNKA 3KWRA 4F6NA 4BCAA 3F0NA 3K85A 3P06A 2B7TA 2KHXA 3IWDA 5C0XF 5EL9A 2UUBI 3ZZ0A 2YRHA 4X62I 2EM8A 2B7VA 4JI0E 4YHHI 4X66I 5AC5A 3THNA 4BHBA 1MU5A 4IFDE 1Z0EA 4B3SI 4JI5E 2LT7A 2AJ4A 2JEBA 4WSPA 2Z5BB 2JT2A 2EJ4A 4DV5E 2UUCE 1QNTA 4LFCE 2LUPB 4JI4I 3J7Yp 2F1DA 5DRRA 1IQSA 1ZM4A 4IJDA 4FW9A 2WCC3 3IWCA 4OO1A 3C4BA 3UHMA 2HFSA 2EM7A 2FV4B 1YYKA 1ZR9A 2CTDA 2ELZA 1Y6ZA 2J7JA 4AIMA 3J80Q 4OX9E 2HHHE 2EMYA 4OO1E 2JWOA 3DJWA 1Z0GA 1J5EI 4IFDD 1USUA 4B3TE 5IWAE 1T4LB 2CG9A 4PRXA 5A6BA 2K7IA 1G2DC 2WP8B 3GLLA 4MQYA 1FJGI 4M9VC 2YRMA 4DUZE 1QU6A 3M7ND 1AH5A 4LF9I 2L2KB 4X64I 1N0UA 1NEIA 2C37B 4JI7E 2EQ1A 2GPIA 2YTJA 4DR1E 1A1JA 3K17A 2EOQA 3KRNA 3WU5A 2LJHA 2L92A 3QT7A 1X49A 3KZZA 4DR2I 4J8ZA 2UUAE 2LO3A 4IZJD 1TN9A 4OO1D 4MU1A 1Z0VA 2YWQA 4M1KA 4MYTA 2HGHA 2DEJA 4IFDB 2ENAA 4DR3I 5K36E 2PO0B 3ZOQB 4DV0E 1OJ4A 3V2UC 4IS9A 2JPAA 3PS1A 3ZKBA 4WUBA 3T1HE 4AIDA 2NN6E 1ZXMA 1YPNA 2Q2EB 5DROA 5IT9Q 1YHCA 3EPKA 2WBSA 1R6LA 2V86A 3F6GA 2CGEA 1X48A 4Q35B 1IBLE 4LCGA 4DV1I 1L4SA 3B82A 2R3VA 2UXDE 4DU8A 2HJJA 3C6KA 4DUYI 2PO1A 1NHHA 1RREA 4JI3I 1DARA 2YTPA 5AASA 4IZJB 4DR7I 2DGCA 4FW4A 1ZXNA 3T1YI 1EH7A 1PIEA 4HACA 5LL6R 2ZITA 2M7QA 5K36D 1ZBQA 4WXDA 3J81C 2EPXA 4FW3A 2LUQA 1HNZE 2NN6D 3BF2A 1XNRE 4B3RI 2EM6A 3P3CA 2EPLX 4K0KI 2JEAB 3RMPA 4LCHA 2VE7C 2UXBI 1ZM9A 4MLVA 4ZYDA 4DXLA 1BBGA 3CDIA 4LFAE 2Q8UA 3K1JA 2LE2A 1FWKA 3HKMA 4GKJI 4DV4E 1YSAC 4DV2E 2HK3A 2CT1A 2LRSA 5FLXC 5KL2A 5K36B 2YTIA 2EE8A 1JK1A 1GTKA 1EI1A 5GMDA 1T4OA 5AE2A 3THOB 2EQ0A 4LPFA 2V85A 4NBQA 4WUDA 4DU7A 2DRPA 3JTZA 4F9CB 4R2AA 2NN6B 4YY3E 4DR4I 1Z5CA 2EMIA 1UDQA 3HULA 3ZM7A 2WW4A 2GS8A 2EM3A 1G2FC 4AQYE 2BR2A 3DD6A 3H4LA 1FKAE 1TF3A 4BA2A 2HKEA 3P3GA 1NCSA 4LOMA 2F8BA 4JI2E 2O3ZA 1IBKI 4NHRA 3GONA 3BBGA 4LF6I 2EP3A 3EPHA 2V8PA 1I94I 2EOHA 4F6MA 1Y4SA 3QT5A 3EQ1A 2GLIA 1FI4A 5A2QC 5LMUE 5T6JA 1H72C 3JAMC 2CSHA 1Y4UA 4LU9A 4LCFA 2JE6A 1AAYA 2UUBE 4B3ME 2LV2A 4IFDF 4BA1B 4X62E 2X36A 4P7DA 2K4VA 2EOMA 2HFUA 1Z5BA 4X66E 2EN7A 2WBUA 3PYEA 2EPOA 4R1FA 2LTRA 4B3SE 5JEAE 2EMXA 2EMGA 2M9AA 4HTGA 1UBDC 5ELWA 1N36I 2RTXA 4FW7A 2VQFE 4ED4A 2EMCA 2EPMX 1UHZA 3QT6A 3WU3A 2VQEI 4NXMI 2EZ6A 2A25A 2EL6A 4JI4E 4O5GA 1KYQA 4DR5I 4WXCA 4HEIA 3OTOE 2PO1B 4X65I 2LMZA 5C0XA 3ZZUA 3L00A 2EOIA 1Z0BA 4IZKB 1Z59A 3C4TA 1KIJA 4OO1F 2WNRB 4F54A 4DV6E 1H73A 2JY9A 1UDNA 5AE1A 2BA0G 4JI8I 5DRPA 1A6FA 1OYPA 4Q28A 3PYDA 1MX0A 2MDGA 1J5EE 2EMBA 3QG5C 1QZRA 5JEAD 4MLQA 4JI5I 4R8OA 5IXMB 1A1LA 2C39A 3QT8A 5KL3A 2YU5A 3B8HA 4FW5A 4DV5I 1X6HA 5IV8B 4LFBI 4LFCI 2EQ3A 2BA1G 2PO2B 4DR6E 1EH6A 3D4JA 1N34E 2EOFA 4JI1E 2YU8A 4F9BB 2EPAA 3F6HA 3LLHA 5KL5A 2N3HA 2E1RA 3M6AA 3HPZA 4ZYGA 1T38A 1MG7A 2EL4A 1F2IG 3ADJA 2EMZA 5KL4A 1KJKA 1WHQA 1KVKA 2AE8A 3V5RA 5C0XC 2YTEA 3WU4A 4IFDC 3LTOA 5ADZA 4OX9I 3U1KA 2NABA 3BGHA 4DR2E 2EWLA 1A1FA 3LNUA 2HHHI 5K36F 4Z7CA 2YPNA 2UXCI 4JG4A 2DB2A 2V89A 1NHJA 2LJUA 2PNZA 5JEAB 4DR3E 1MEYC 5L3JA 5IWAI 4B3TI 2NN6F 2JXPA 4UT4A 2R42A 3Q6MA 4RPFA 4LF5E 3CWVA 5BR8E 5FWKA 4DUZI 2EORA 4TUIA 2EN8A 2V83A 4UTGA 2V8QB 3L7ZA 4KWYA 4N4RB 1ZM2A 2LVHA 4LF8I 2JR1A 1Y60A 2UU9I 2J7KA 4JI7I 3J7AM 3PS3A 3ZZTA 2JEBB 5A6BD 2F4VE 2BV3A 4OO1C 2E72A 2IERA 2L3CA 2FGGA 5DNYA 2NUGA 2PNLA 2HKJA 2M1SA 2OI2A 4DPTA 5KL6A 1T4NA 2DLQA 2EMHA 2JP9A 4JI3E 2UUAI 3MSWA 4N3OA 4OO1B 5GMEA 3HTXA 2E1MA 3T1YE 2MC6A 4DPYA 1SR9A 1X6FA 1XXEA 4DV0I 5A6AA 1MGTA 2IHR1 1UDSA 2G7HA 3WU6A 2C38A 4Z7YA 2EM9A 2Z5CA 2VRDA 4JI6I 1PJSA 2DEIA 3PRYA 4I3HA 1XNQI 5FLXQ 4B3RE 2LJPA 1SFEA 4L5NC 1UILA 1HR0E 1RC7A 2EMAA 4JV5E 1BBOA 2EM2A 2PRTA 4KZSA 4AM3A 2EFGA 4JYAI 2GQ0A 2UXDI 2GHFA 1RMDA 5K36C 2ADRA 1PKPA 4LF7E 4M2ZA 4GKJE 4WX9A 4KHPE 2A2DA 1YUJA 5DNLA 1H7UA 1K47A 2NN6C 1Z5AA 2EN6A 2EPCA 3VHTB 2R76A 3CDJA 4DV3I 4LF4E 3P76A 1ZM3A 1R6MA 2YTFA 2ELYA 4NXNI 2L2MA 4P78A 3M85G 1DI2A 4DR4E 2O1VA 3NZKA 4MU3A 1B62A 4R2DA 1IBME 1XMQE 2GO4A 1UEKA 1N32E 1IQOA 4HYMA 4MU4A 2EPNA 3H1CA 4R2CA 4ZVIA 4URLA 4USMA 2ODRD 2A2CA 3GCMA 1PJQA 1LLMC 4BC7A 1HNXE 2ENCA 2M4IA 1STUA 1A1IA 4R2PA 4DV7I 1YYWA 4OKGA 2MC5A 2MDRA 1Z0CA 2EMFA 2JOBA 4DV4I 3OMLA 4DV2I 2V87A 1IBKE 2EOEA 2IOQA 5CFFE 1NHIA 2ZBKB 2L8TA 1EA6A 2EOSA 3ADGA 3K6QA 4FN5A 4XTJA 2EPPA 1Z0TA 2N3GA 1XMOE 1OYSA 3ADLA 2YSOA 3M99B 4YY3I 5LMNE 2B3TB 2E5LE 4FWDA 2DSYA 1EH8A 1TF6A 1H74A 2WP8A 1VISA 4HACB 2RQLA 3TQMA 3UK3C 1B69A 4MU0A 1ZBTA 2D9HA 1DQ3A 3AV0A 2EOZA 5JEAF 2ZM6I 1X5WA 4YHHE 3HQ1A 2RPCA 4ZYEA 2C37A 1IMUA 1FWLA 1N36E 1N33I 1D6TA 1UDOA 1RR9A 1X6EA 4PRVA 2KOUA 4MDTA 1A1HA 2V2QA 4ISAA 1PDAA 3VYYA 2EN4A 4DR5E 1YH8A 4BC9A 4OZEA 3MHSC 2DIXA 2JVAA 4X65E 4EMDA 1HNWI 1YUIA 1DGCA 5LMUI 4PU9A 1X3CA 3M7NG 1BKNA 2EOJA 2NPFA 4IFDA 4M30A 4GKKI 4R2QA 3BIDA 2YTGA 2PO0A 2NA2A 4FW6A 3HPSA 3VYXA 1H7SA 4MYUA 4B3MI 1U2RA 2L2NA 4BHCA 4JI0I 4JI8E 2PNMA 1OYRA 5C0XE 4O24A 1E3HA 3FIGA 2L6MA 4FWHA 2EOOA 2O1UA 3HXLA 2J65A 2VQFI 1PJTA 1FJGE 2V34A 4LFBE 2V88A 2EL5A 2YTOA 2UUCI 3H09A 2RS6A 2DLKA 3PS2A 4WFTA 2BR2B 4LF9E 4KQVA 4GEQB 4X64E 1S16A 4M0VA 3OTOI 2R1FA 2RSMA 1T39A 4IZJA 4P52A 5DNXA 4BA2B 2ENHA 1RHYA 5LLQA 2EOXA 1N3GA 4WSGA 2V2VA 5JEAC 4LTYA 5EKWA 4R2EA 4DV6I 1YFHA 2H36X 4L8NA 1UN6B 1USVA 3LPSA 2UXCE 5C0XD 1XHKA 4J3DA 2V2ZA 2JEAA 1ZU1A 5AC4A 2JE6B 2HK2A 2IOPA 5KL7A 4R03A 4DR6I 4DKKA 4F9AB 1WHNA 1N34I 4LF8E 2EMWA 1O0WA 3J80C 4O43A 4JI1I 5F3WA 2UU9E 2KONA 2BA0D 1YZ9A 3IWBA 4X9JA 1NZ0A 3J81Q 1EKZA 4DV1E 2CZ9A 4DR1I 5K36A 1A1KA 3GMEA 2YTNA 1Z1BA 1YYOA 4DUYE
chains in the Genus database with same CATH topology
4TUGA 1B63A 2VF1A 4DR7E 3PYGA 4BS9A 2Z5EA 1FNMA 2JOXA 2BM0A 3ADIA 2XEXA 4HY1A 1GQEA 4LF5I 5BR8I 2CPNA 2X7IA 2BM1A 2NUFA 2O1WA 2YT4A 3T1HI 4JI6E 4X8WA 2LBSB 1XNQE 3Q6NA 4DMIA 4BBYA 3DF6A 4DPXA 4K0KE 2F4VI 3PYFA 2UXBE 5AE3A 3JU0A 1IBLI 2YZTA 3VK6A 4JYAE 4DPWA 4WPYA 3Q1QA 5IT9C 4DPUA 1KKHA 1WXRA 4I8OA 3J7AG 4NXNE 2NUEA 1HNZI 4DV3E 4HXZA 1XNRI 3ZKDA 2LTSA 2Z5BA 1HR0I 4JV5I 1GZ6A 2L33A 5A2QQ 3HJCA 1KTVA 4DV7E 3JAMQ 4LFAI 3P1XA 3LMLA 4LF7I 4WUCA 4IZKA 4WYQB 4KHPI 1N0VC 1ELOA 2FTXB 4LF6E 1X47A 4BMJA 4LF4I 2ODRC 1I94E 1IBMI 1XMQI 1N32I 2WZOA 2DMYA 2L3JA 4P7AA 3AUZA 1Z0WA 1HNXI 1PVGA 4AQYI 2ZM6E 2O1TA 2Z5CB 3B78A 2B9DA 1N33E 1S4EA 4JI2I 4USKA 1WUUA 2VF3A 4FWGA 2VQEE 4NXME 1RQ0A 2RS7A 4OOGC 1XMOI 1HNWE 1J26A 1HK7A 5LMNI 2E5LI 4GKKE 3KWRA 4BCAA 3F0NA 3K85A 3P06A 2B7TA 2KHXA 3IWDA 2UUBI 3ZZ0A 4X62I 2B7VA 4JI0E 4YHHI 4X66I 1Z0EA 4B3SI 4JI5E 2AJ4A 2Z5BB 4WSPA 4DV5E 2UUCE 4LFCE 2LUPB 4JI4I 3J7Yp 1ZM4A 4FW9A 3IWCA 3C4BA 2HFSA 2FV4B 1YYKA 1Y6ZA 3J80Q 4OX9E 2HHHE 2JWOA 3DJWA 1Z0GA 1J5EI 1USUA 4B3TE 5IWAE 1T4LB 2CG9A 4PRXA 1FJGI 4DUZE 1QU6A 4LF9I 2L2KB 4X64I 1N0UA 4JI7E 4DR1E 3K17A 3WU5A 2LJHA 2L92A 3QT7A 1X49A 4DR2I 4J8ZA 2UUAE 4IZJD 1Z0VA 4M1KA 4MYTA 2DEJA 4DR3I 3ZOQB 4DV0E 1OJ4A 3V2UC 3ZKBA 4WUBA 3T1HE 5IT9Q 1ZXMA 2Q2EB 2V86A 3F6GA 2CGEA 1X48A 1IBLE 4DV1I 3B82A 2R3VA 2UXDE 4DU8A 4DUYI 1NHHA 1RREA 4JI3I 1DARA 5AASA 4IZJB 4DR7I 1ZXNA 3T1YI 1PIEA 4HACA 5LL6R 2ZITA 2M7QA 1ZBQA 3J81C 2LUQA 1HNZE 1XNRE 4B3RI 4K0KI 3RMPA 2VE7C 2UXBI 1ZM9A 4DXLA 4LFAE 3K1JA 2LE2A 1FWKA 4GKJI 4DV4E 4DV2E 2HK3A 2LRSA 5FLXC 1EI1A 5GMDA 1T4OA 5AE2A 4DU7A 2V85A 4WUDA 3JTZA 4F9CB 4DR4I 4YY3E 1Z5CA 3HULA 3ZM7A 2WW4A 2GS8A 4AQYE 3H4LA 1FKAE 2HKEA 2F8BA 4JI2E 1IBKI 3GONA 4LF6I 2V8PA 1I94I 1Y4SA 3QT5A 1FI4A 5A2QC 5LMUE 5T6JA 1H72C 3JAMC 1Y4UA 4LU9A 2UUBE 4B3ME 4X62E 2X36A 4P7DA 2K4VA 2HFUA 1Z5BA 4X66E 3PYEA 4R1FA 2LTRA 4B3SE 1N36I 2RTXA 2VQFE 4ED4A 1UHZA 3QT6A 3WU3A 2VQEI 4NXMI 2EZ6A 4JI4E 4DR5I 3OTOE 4X65I 2LMZA 3ZZUA 1Z0BA 4IZKB 1Z59A 3C4TA 1KIJA 4F54A 4DV6E 1H73A 2JY9A 5AE1A 4JI8I 1A6FA 3PYDA 4Q28A 1MX0A 1J5EE 4JI5I 1QZRA 4R8OA 3QT8A 3B8HA 4DV5I 4LFBI 4LFCI 4DR6E 3D4JA 1N34E 4JI1E 4F9BB 3F6HA 3LLHA 2N3HA 2E1RA 3M6AA 3HPZA 1MG7A 1MU5A 3ADJA 3V5RA 1KVKA 1WHQA 3WU4A 3LTOA 5ADZA 4OX9I 4DR2E 3LNUA 2HHHI 2EWLA 4Z7CA 2UXCI 4JG4A 2DB2A 2V89A 1NHJA 4B3TI 5IWAI 4DR3E 5L3JA 4UT4A 2R42A 3Q6MA 4RPFA 4LF5E 3CWVA 5BR8E 5FWKA 4DUZI 4TUIA 2V83A 4UTGA 2V8QB 1ZM2A 4LF8I 2JR1A 2UU9I 2J7KA 4JI7I 3J7AM 3ZZTA 2F4VE 2BV3A 2L3CA 2FGGA 5DNYA 2NUGA 2PNLA 2HKJA 2M1SA 2OI2A 4DPTA 4JI3E 1T4NA 2UUAI 3MSWA 4N3OA 5GMEA 3HTXA 2E1MA 3T1YE 2MC6A 4DPYA 1SR9A 4DV0I 2IHR1 2G7HA 3WU6A 4Z7YA 2Z5CA 4JI6I 2DEIA 3PRYA 4I3HA 1XNQI 5FLXQ 4B3RE 2LJPA 4L5NC 1UILA 1HR0E 1RC7A 4JV5E 4KZSA 2EFGA 4JYAI 2GQ0A 2UXDI 1PKPA 4LF7E 4M2ZA 4GKJE 4KHPE 2A2DA 1H7UA 1K47A 1Z5AA 4LF4E 1ZM3A 4NXNI 2L2MA 4P78A 4DV3I 1DI2A 4DR4E 2O1VA 1B62A 1IBME 1XMQE 1UEKA 1N32E 4ZVIA 4HYMA 4USMA 4URLA 2ODRD 2A2CA 4BC7A 1HNXE 2M4IA 1STUA 4DV7I 1YYWA 2MC5A 2MDRA 1Z0CA 2JOBA 4DV4I 3OMLA 4DV2I 2V87A 1IBKE 2IOQA 5CFFE 1NHIA 2ZBKB 2L8TA 1EA6A 3ADGA 3K6QA 4FN5A 4XTJA 1Z0TA 2N3GA 1XMOE 3ADLA 4YY3I 5LMNE 2B3TB 2E5LE 4FWDA 2DSYA 1H74A 1VISA 4HACB 1ZBTA 3AV0A 1DQ3A 2ZM6I 4YHHE 3HQ1A 1FWLA 1N36E 1N33I 1D6TA 4PRVA 1RR9A 2KOUA 2V2QA 3VYYA 4DR5E 4BC9A 2DIXA 2JVAA 4X65E 4EMDA 1HNWI 5LMUI 4PU9A 1BKNA 2NPFA 4GKKI 4M30A 2NA2A 3HPSA 3VYXA 1H7SA 4MYUA 4B3MI 1U2RA 2L2NA 4JI0I 4JI8E 2PNMA 3FIGA 2L6MA 4FWHA 2O1UA 3HXLA 2VQFI 1FJGE 2V34A 4LFBE 2V88A 2UUCI 3H09A 2RS6A 4KQVA 4WFTA 4LF9E 4GEQB 4X64E 1S16A 4M0VA 3OTOI 4IZJA 2RSMA 4P52A 2V2VA 4LTYA 4DV6I 2H36X 4L8NA 1USVA 3LPSA 2UXCE 1XHKA 2V2ZA 2HK2A 2IOPA 4R03A 4DR6I 4DKKA 4F9AB 1WHNA 1N34I 4LF8E 1O0WA 3J80C 4JI1I 5F3WA 2UU9E 2KONA 1YZ9A 3IWBA 1NZ0A 3J81Q 4DR1I 1EKZA 4DV1E 2CZ9A 1YYOA 4DUYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B63 A;  4DR7 E;  3PYG A;  1FNM A;  2BM0 A;  3ADI A;  2XEX A;  4HY1 A;  1GQE A;  4LF5 I;  5BR8 I;  2CPN A;  2X7I A;  2BM1 A;  2NUF A;  2YT4 A;  3T1H I;  4JI6 E;  4X8W A;  2LBS B;  1XNQ E;  4DPX A;  4K0K E;  2F4V I;  3PYF A;  2UXB E;  1IBL I;  4JYA E;  4DPW A;  3Q1Q A;  5IT9 C;  4DPU A;  1KKH A;  3J7A G;  4NXN E;  2NUE A;  1HNZ I;  4DV3 E;  4HXZ A;  1XNR I;  3ZKD A;  2LTS A;  1HR0 I;  4JV5 I;  2L33 A;  5A2Q Q;  1KTV A;  4DV7 E;  3JAM Q;  4LFA I;  3P1X A;  4LF7 I;  4WUC A;  4WYQ B;  4KHP I;  1N0V C;  1ELO A;  4DUY E;  4LF6 E;  1X47 A;  4LF4 I;  1I94 E;  1IBM I;  1XMQ I;  1N32 I;  2L3J A;  2DMY A;  4P7A A;  1Z0W A;  1HNX I;  1PVG A;  4AQY I;  2ZM6 E;  3B78 A;  1S4E A;  1N33 E;  4JI2 I;  4USK A;  1WUU A;  2VF3 A;  4FWG A;  2VQE E;  4NXM E;  1RQ0 A;  2RS7 A;  4OOG C;  1XMO I;  1HNW E;  1J26 A;  5LMN I;  2E5L I;  4GKK E;  3F0N A;  2B7T A;  2KHX A;  2UUB I;  3ZZ0 A;  4X62 I;  2B7V A;  4JI0 E;  4YHH I;  4X66 I;  1Z0E A;  4B3S I;  4JI5 E;  2AJ4 A;  4DV5 E;  2UUC E;  4LFC E;  2LUP B;  4JI4 I;  3J7Y p;  1ZM4 A;  4FW9 A;  3C4B A;  2HFS A;  1YYK A;  3J80 Q;  4OX9 E;  2HHH E;  1Z0G A;  1J5E I;  4B3T E;  5IWA E;  1T4L B;  4PRX A;  1FJG I;  4DUZ E;  1QU6 A;  4LF9 I;  2L2K B;  4X64 I;  1N0U A;  4JI7 E;  4DR1 E;  3K17 A;  3WU5 A;  2LJH A;  3QT7 A;  1X49 A;  4DR2 I;  2UUA E;  1Z0V A;  4M1K A;  4MYT A;  2DEJ A;  4DR3 I;  4DV0 E;  1OJ4 A;  3V2U C;  3ZKB A;  4WUB A;  3T1H E;  5IT9 Q;  1ZXM A;  2Q2E B;  1X48 A;  1IBL E;  4DV1 I;  3B82 A;  2R3V A;  2UXD E;  4DU8 A;  4DUY I;  1NHH A;  1RRE A;  4JI3 I;  1DAR A;  4DR7 I;  1ZXN A;  3T1Y I;  1PIE A;  4HAC A;  5LL6 R;  2ZIT A;  3J81 C;  2LUQ A;  1HNZ E;  1XNR E;  4B3R I;  4K0K I;  2UXB I;  1ZM9 A;  4DXL A;  4LFA E;  3K1J A;  1FWK A;  4GKJ I;  4DV4 E;  4DV2 E;  2HK3 A;  2LRS A;  5FLX C;  1EI1 A;  5GMD A;  1T4O A;  4DU7 A;  4WUD A;  4DR4 I;  4YY3 E;  1Z5C A;  3HUL A;  3ZM7 A;  2WW4 A;  2GS8 A;  4AQY E;  3H4L A;  1FKA E;  2HKE A;  4JI2 E;  1IBK I;  3GON A;  4LF6 I;  2V8P A;  1I94 I;  3QT5 A;  1FI4 A;  5A2Q C;  5LMU E;  1H72 C;  3JAM C;  2UUB E;  4B3M E;  4X62 E;  2X36 A;  2HFU A;  1Z5B A;  4X66 E;  3PYE A;  4R1F A;  2LTR A;  4B3S E;  1N36 I;  2RTX A;  2VQF E;  4ED4 A;  1UHZ A;  3QT6 A;  3WU3 A;  2VQE I;  4NXM I;  2EZ6 A;  4JI4 E;  4DR5 I;  3OTO E;  4X65 I;  3ZZU A;  1Z0B A;  1Z59 A;  3C4T A;  1KIJ A;  4DV6 E;  1H73 A;  2JY9 A;  4JI8 I;  1A6F A;  3PYD A;  1MX0 A;  1J5E E;  4JI5 I;  1QZR A;  3QT8 A;  3B8H A;  4DV5 I;  4LFB I;  4LFC I;  4DR6 E;  3D4J A;  1N34 E;  4JI1 E;  3LLH A;  2N3H A;  2E1R A;  3M6A A;  1MG7 A;  1MU5 A;  3ADJ A;  3V5R A;  1KVK A;  1WHQ A;  3WU4 A;  3LTO A;  4OX9 I;  4DR2 E;  3LNU A;  2HHH I;  4Z7C A;  2UXC I;  4JG4 A;  2DB2 A;  1NHJ A;  4B3T I;  5IWA I;  4DR3 E;  5L3J A;  4UT4 A;  2R42 A;  4RPF A;  4LF5 E;  3CWV A;  5BR8 E;  4DUZ I;  4UTG A;  1ZM2 A;  4LF8 I;  2UU9 I;  2J7K A;  4JI7 I;  3J7A M;  3ZZT A;  2F4V E;  2BV3 A;  2L3C A;  2NUG A;  2HKJ A;  2OI2 A;  4DPT A;  2UUA I;  4JI3 E;  1T4N A;  5GME A;  3HTX A;  3T1Y E;  4DPY A;  4DV0 I;  2IHR 1;  3WU6 A;  4Z7Y A;  4JI6 I;  2DEI A;  1XNQ I;  4I3H A;  5FLX Q;  4B3R E;  2LJP A;  1UIL A;  1HR0 E;  1RC7 A;  4JV5 E;  2EFG A;  4JYA I;  2UXD I;  1PKP A;  4LF7 E;  4M2Z A;  4GKJ E;  4KHP E;  1H7U A;  1K47 A;  1Z5A A;  4LF4 E;  1ZM3 A;  4NXN I;  2L2M A;  4DV3 I;  1DI2 A;  4DR4 E;  1B62 A;  1IBM E;  1XMQ E;  1UEK A;  1N32 E;  4ZVI A;  4HYM A;  4USM A;  4URL A;  2A2C A;  1HNX E;  1STU A;  4DV7 I;  1YYW A;  2MDR A;  1Z0C A;  4DV4 I;  4DV2 I;  1IBK E;  5CFF E;  1NHI A;  2ZBK B;  1EA6 A;  3ADG A;  4FN5 A;  4XTJ A;  1Z0T A;  2N3G A;  1XMO E;  3ADL A;  4YY3 I;  5LMN E;  2B3T B;  2E5L E;  4FWD A;  1H74 A;  1VIS A;  4HAC B;  1ZBT A;  2ZM6 I;  4YHH E;  1FWL A;  1N36 E;  1N33 I;  1D6T A;  4PRV A;  1RR9 A;  2V2Q A;  3VYY A;  4DR5 E;  2DIX A;  2JVA A;  4X65 E;  4EMD A;  1HNW I;  5LMU I;  4PU9 A;  1BKN A;  2NPF A;  4GKK I;  4M30 A;  2NA2 A;  3VYX A;  1H7S A;  4MYU A;  4B3M I;  1U2R A;  2L2N A;  4JI0 I;  4JI8 E;  4FWH A;  2VQF I;  1FJG E;  2V34 A;  4LFB E;  2UUC I;  2RS6 A;  4KQV A;  4WFT A;  4LF9 E;  1S16 A;  4X64 E;  3OTO I;  2RSM A;  4P52 A;  2V2V A;  4DV6 I;  3LPS A;  2UXC E;  1XHK A;  2V2Z A;  2HK2 A;  4DR6 I;  4DKK A;  1WHN A;  1N34 I;  4LF8 E;  1O0W A;  4JI1 I;  3J80 C;  2UU9 E;  1YZ9 A;  1NZ0 A;  4DR1 I;  3J81 Q;  1EKZ A;  4DV1 E;  2CZ9 A;  1YYO A;  2A2D A; 
#chains in the Genus database with same CATH topology
 4TUG A;  1B63 A;  2VF1 A;  4DR7 E;  2NN6 A;  5A69 A;  3PYG A;  4BS9 A;  2EN3 A;  4F2J C;  2Z5E A;  1FNM A;  5C0X B;  2JOX A;  2BM0 A;  2EM5 A;  2EN2 A;  1WRJ A;  3ADI A;  2BA1 D;  2EM4 A;  2YSP A;  4GZN C;  2XEX A;  4HY1 A;  2MKD A;  1GQE A;  4LF5 I;  2BBG A;  5BR8 I;  2CPN A;  2X7I A;  2BM1 A;  2NUF A;  2O1W A;  2YT4 A;  3T1H I;  4JI6 E;  2CVE A;  4X8W A;  2LBS B;  1XNQ E;  2GO3 A;  4DMI A;  2YRK A;  4BBY A;  3Q6N A;  3DF6 A;  4DPX A;  2RSI A;  4K0K E;  2F4V I;  2C39 B;  2DMI A;  3PYF A;  2EPR A;  5AE3 A;  2UXB E;  3JU0 A;  1IBL I;  2YZT A;  3VK6 A;  4JYA E;  1Y5Y A;  4IS1 C;  4DPW A;  4WPY A;  3Q1Q A;  2HC5 A;  4GQU A;  4R2S A;  3EPJ A;  2EOY A;  2EN1 A;  1A1G A;  1E3P A;  3EPL A;  5IT9 C;  4DPU A;  4RHB B;  2YTD A;  1KKH A;  1WXR A;  4I8O A;  2I13 A;  4BA1 A;  4O4K A;  3J7A G;  3KZY A;  4NXN E;  2VES A;  2NUE A;  2EPZ A;  4DV3 E;  1HNZ I;  4HXZ A;  2EPK X;  2JYA A;  3ZKD A;  5TSE A;  2LTS A;  3B4T A;  2Z5B A;  1XNR I;  1WJP A;  4U3B A;  1HR0 I;  2PNZ B;  4JV5 I;  1GZ6 A;  2L33 A;  4R2R A;  5A2Q Q;  2EPU A;  3HJC A;  1KTV A;  4DV7 E;  3U1Y A;  2LCE A;  3L7Z B;  3P1X A;  4U3D A;  2I9I A;  3JAM Q;  4LFA I;  3LML A;  4LF7 I;  4WUC A;  2BB8 A;  4IZK A;  4WYQ B;  4KHP I;  1N0V C;  5A6J A;  1ELO A;  2WNR A;  2FTX B;  4LF6 E;  1BB8 A;  2IES A;  5DRQ A;  1X47 A;  4BMJ A;  4LF4 I;  1VI7 A;  2ODR C;  1I94 E;  2YTQ A;  1ZAA C;  1IBM I;  1XMQ I;  5A6K A;  1N32 I;  1JK2 A;  2WZO A;  2DMY A;  2L3J A;  4FK5 C;  4ZYH A;  4P7A A;  4QNJ A;  3AUZ A;  2WBT A;  1Z0W A;  2PO2 A;  3MHH C;  1PVG A;  1HNX I;  4AQY I;  2EM0 A;  2ZM6 E;  2O1T A;  2C38 B;  4NZV A;  2Z5C B;  1P47 A;  3B78 A;  2B9D A;  1N33 E;  1S4E A;  4JI2 I;  4RH8 A;  2EML A;  4USK A;  1WUU A;  2N8X A;  2VF3 A;  4FWG A;  3M85 D;  2VQE E;  4NXM E;  1P42 A;  3ECR A;  1RQ0 A;  2RS7 A;  2EMK A;  2MKN A;  3P3E A;  4OOG C;  1XMO I;  1HNW E;  1J26 A;  1HK7 A;  5LMN I;  2E5L I;  4GKK E;  3C6M A;  5JEA A;  4QNK A;  3KWR A;  4F6N A;  4BCA A;  3F0N A;  3K85 A;  3P06 A;  2B7T A;  2KHX A;  3IWD A;  5C0X F;  5EL9 A;  2UUB I;  3ZZ0 A;  2YRH A;  4X62 I;  2EM8 A;  2B7V A;  4JI0 E;  4YHH I;  4X66 I;  5AC5 A;  3THN A;  4BHB A;  1MU5 A;  4IFD E;  1Z0E A;  4B3S I;  4JI5 E;  2LT7 A;  2AJ4 A;  2JEB A;  4WSP A;  2Z5B B;  2JT2 A;  2EJ4 A;  4DV5 E;  2UUC E;  1QNT A;  4LFC E;  2LUP B;  4JI4 I;  3J7Y p;  2F1D A;  5DRR A;  1IQS A;  1ZM4 A;  4IJD A;  4FW9 A;  2WCC 3;  3IWC A;  4OO1 A;  3C4B A;  3UHM A;  2HFS A;  2EM7 A;  2FV4 B;  1YYK A;  1ZR9 A;  2CTD A;  2ELZ A;  1Y6Z A;  2J7J A;  4AIM A;  3J80 Q;  4OX9 E;  2HHH E;  2EMY A;  4OO1 E;  2JWO A;  3DJW A;  1Z0G A;  1J5E I;  4IFD D;  1USU A;  4B3T E;  5IWA E;  1T4L B;  2CG9 A;  4PRX A;  5A6B A;  2K7I A;  1G2D C;  2WP8 B;  3GLL A;  4MQY A;  1FJG I;  4M9V C;  2YRM A;  4DUZ E;  1QU6 A;  3M7N D;  1AH5 A;  4LF9 I;  2L2K B;  4X64 I;  1N0U A;  1NEI A;  2C37 B;  4JI7 E;  2EQ1 A;  2GPI A;  2YTJ A;  4DR1 E;  1A1J A;  3K17 A;  2EOQ A;  3KRN A;  3WU5 A;  2LJH A;  2L92 A;  3QT7 A;  1X49 A;  3KZZ A;  4DR2 I;  4J8Z A;  2UUA E;  2LO3 A;  4IZJ D;  1TN9 A;  4OO1 D;  4MU1 A;  1Z0V A;  2YWQ A;  4M1K A;  4MYT A;  2HGH A;  2DEJ A;  4IFD B;  2ENA A;  4DR3 I;  5K36 E;  2PO0 B;  3ZOQ B;  4DV0 E;  1OJ4 A;  3V2U C;  4IS9 A;  2JPA A;  3PS1 A;  3ZKB A;  4WUB A;  3T1H E;  4AID A;  2NN6 E;  1ZXM A;  1YPN A;  2Q2E B;  5DRO A;  5IT9 Q;  1YHC A;  3EPK A;  2WBS A;  1R6L A;  2V86 A;  3F6G A;  2CGE A;  1X48 A;  4Q35 B;  1IBL E;  4LCG A;  4DV1 I;  1L4S A;  3B82 A;  2R3V A;  2UXD E;  4DU8 A;  2HJJ A;  3C6K A;  4DUY I;  2PO1 A;  1NHH A;  1RRE A;  4JI3 I;  1DAR A;  2YTP A;  5AAS A;  4IZJ B;  4DR7 I;  2DGC A;  4FW4 A;  1ZXN A;  3T1Y I;  1EH7 A;  1PIE A;  4HAC A;  5LL6 R;  2ZIT A;  2M7Q A;  5K36 D;  1ZBQ A;  4WXD A;  3J81 C;  2EPX A;  4FW3 A;  2LUQ A;  1HNZ E;  2NN6 D;  3BF2 A;  1XNR E;  4B3R I;  2EM6 A;  3P3C A;  2EPL X;  4K0K I;  2JEA B;  3RMP A;  4LCH A;  2VE7 C;  2UXB I;  1ZM9 A;  4MLV A;  4ZYD A;  4DXL A;  1BBG A;  3CDI A;  4LFA E;  2Q8U A;  3K1J A;  2LE2 A;  1FWK A;  3HKM A;  4GKJ I;  4DV4 E;  1YSA C;  4DV2 E;  2HK3 A;  2CT1 A;  2LRS A;  5FLX C;  5KL2 A;  5K36 B;  2YTI A;  2EE8 A;  1JK1 A;  1GTK A;  1EI1 A;  5GMD A;  1T4O A;  5AE2 A;  3THO B;  2EQ0 A;  4LPF A;  2V85 A;  4NBQ A;  4WUD A;  4DU7 A;  2DRP A;  3JTZ A;  4F9C B;  4R2A A;  2NN6 B;  4YY3 E;  4DR4 I;  1Z5C A;  2EMI A;  1UDQ A;  3HUL A;  3ZM7 A;  2WW4 A;  2GS8 A;  2EM3 A;  1G2F C;  4AQY E;  2BR2 A;  3DD6 A;  3H4L A;  1FKA E;  1TF3 A;  4BA2 A;  2HKE A;  3P3G A;  1NCS A;  4LOM A;  2F8B A;  4JI2 E;  2O3Z A;  1IBK I;  4NHR A;  3GON A;  3BBG A;  4LF6 I;  2EP3 A;  3EPH A;  2V8P A;  1I94 I;  2EOH A;  4F6M A;  1Y4S A;  3QT5 A;  3EQ1 A;  2GLI A;  1FI4 A;  5A2Q C;  5LMU E;  5T6J A;  1H72 C;  3JAM C;  2CSH A;  1Y4U A;  4LU9 A;  4LCF A;  2JE6 A;  1AAY A;  2UUB E;  4B3M E;  2LV2 A;  4IFD F;  4BA1 B;  4X62 E;  2X36 A;  4P7D A;  2K4V A;  2EOM A;  2HFU A;  1Z5B A;  4X66 E;  2EN7 A;  2WBU A;  3PYE A;  2EPO A;  4R1F A;  2LTR A;  4B3S E;  5JEA E;  2EMX A;  2EMG A;  2M9A A;  4HTG A;  1UBD C;  5ELW A;  1N36 I;  2RTX A;  4FW7 A;  2VQF E;  4ED4 A;  2EMC A;  2EPM X;  1UHZ A;  3QT6 A;  3WU3 A;  2VQE I;  4NXM I;  2EZ6 A;  2A25 A;  2EL6 A;  4JI4 E;  4O5G A;  1KYQ A;  4DR5 I;  4WXC A;  4HEI A;  3OTO E;  2PO1 B;  4X65 I;  2LMZ A;  5C0X A;  3ZZU A;  3L00 A;  2EOI A;  1Z0B A;  4IZK B;  1Z59 A;  3C4T A;  1KIJ A;  4OO1 F;  2WNR B;  4F54 A;  4DV6 E;  1H73 A;  2JY9 A;  1UDN A;  5AE1 A;  2BA0 G;  4JI8 I;  5DRP A;  1A6F A;  1OYP A;  4Q28 A;  3PYD A;  1MX0 A;  2MDG A;  1J5E E;  2EMB A;  3QG5 C;  1QZR A;  5JEA D;  4MLQ A;  4JI5 I;  4R8O A;  5IXM B;  1A1L A;  2C39 A;  3QT8 A;  5KL3 A;  2YU5 A;  3B8H A;  4FW5 A;  4DV5 I;  1X6H A;  5IV8 B;  4LFB I;  4LFC I;  2EQ3 A;  2BA1 G;  2PO2 B;  4DR6 E;  1EH6 A;  3D4J A;  1N34 E;  2EOF A;  4JI1 E;  2YU8 A;  4F9B B;  2EPA A;  3F6H A;  3LLH A;  5KL5 A;  2N3H A;  2E1R A;  3M6A A;  3HPZ A;  4ZYG A;  1T38 A;  1MG7 A;  2EL4 A;  1F2I G;  3ADJ A;  2EMZ A;  5KL4 A;  1KJK A;  1WHQ A;  1KVK A;  2AE8 A;  3V5R A;  5C0X C;  2YTE A;  3WU4 A;  4IFD C;  3LTO A;  5ADZ A;  4OX9 I;  3U1K A;  2NAB A;  3BGH A;  4DR2 E;  2EWL A;  1A1F A;  3LNU A;  2HHH I;  5K36 F;  4Z7C A;  2YPN A;  2UXC I;  4JG4 A;  2DB2 A;  2V89 A;  1NHJ A;  2LJU A;  2PNZ A;  5JEA B;  4DR3 E;  1MEY C;  5L3J A;  5IWA I;  4B3T I;  2NN6 F;  2JXP A;  4UT4 A;  2R42 A;  3Q6M A;  4RPF A;  4LF5 E;  3CWV A;  5BR8 E;  5FWK A;  4DUZ I;  2EOR A;  4TUI A;  2EN8 A;  2V83 A;  4UTG A;  2V8Q B;  3L7Z A;  4KWY A;  4N4R B;  1ZM2 A;  2LVH A;  4LF8 I;  2JR1 A;  1Y60 A;  2UU9 I;  2J7K A;  4JI7 I;  3J7A M;  3PS3 A;  3ZZT A;  2JEB B;  5A6B D;  2F4V E;  2BV3 A;  4OO1 C;  2E72 A;  2IER A;  2L3C A;  2FGG A;  5DNY A;  2NUG A;  2PNL A;  2HKJ A;  2M1S A;  2OI2 A;  4DPT A;  5KL6 A;  1T4N A;  2DLQ A;  2EMH A;  2JP9 A;  4JI3 E;  2UUA I;  3MSW A;  4N3O A;  4OO1 B;  5GME A;  3HTX A;  2E1M A;  3T1Y E;  2MC6 A;  4DPY A;  1SR9 A;  1X6F A;  1XXE A;  4DV0 I;  5A6A A;  1MGT A;  2IHR 1;  1UDS A;  2G7H A;  3WU6 A;  2C38 A;  4Z7Y A;  2EM9 A;  2Z5C A;  2VRD A;  4JI6 I;  1PJS A;  2DEI A;  3PRY A;  4I3H A;  1XNQ I;  5FLX Q;  4B3R E;  2LJP A;  1SFE A;  4L5N C;  1UIL A;  1HR0 E;  1RC7 A;  2EMA A;  4JV5 E;  1BBO A;  2EM2 A;  2PRT A;  4KZS A;  4AM3 A;  2EFG A;  4JYA I;  2GQ0 A;  2UXD I;  2GHF A;  1RMD A;  5K36 C;  2ADR A;  1PKP A;  4LF7 E;  4M2Z A;  4GKJ E;  4WX9 A;  4KHP E;  2A2D A;  1YUJ A;  5DNL A;  1H7U A;  1K47 A;  2NN6 C;  1Z5A A;  2EN6 A;  2EPC A;  3VHT B;  2R76 A;  3CDJ A;  4DV3 I;  4LF4 E;  3P76 A;  1ZM3 A;  1R6M A;  2YTF A;  2ELY A;  4NXN I;  2L2M A;  4P78 A;  3M85 G;  1DI2 A;  4DR4 E;  2O1V A;  3NZK A;  4MU3 A;  1B62 A;  4R2D A;  1IBM E;  1XMQ E;  2GO4 A;  1UEK A;  1N32 E;  1IQO A;  4HYM A;  4MU4 A;  2EPN A;  3H1C A;  4R2C A;  4ZVI A;  4URL A;  4USM A;  2ODR D;  2A2C A;  3GCM A;  1PJQ A;  1LLM C;  4BC7 A;  1HNX E;  2ENC A;  2M4I A;  1STU A;  1A1I A;  4R2P A;  4DV7 I;  1YYW A;  4OKG A;  2MC5 A;  2MDR A;  1Z0C A;  2EMF A;  2JOB A;  4DV4 I;  3OML A;  4DV2 I;  2V87 A;  1IBK E;  2EOE A;  2IOQ A;  5CFF E;  1NHI A;  2ZBK B;  2L8T A;  1EA6 A;  2EOS A;  3ADG A;  3K6Q A;  4FN5 A;  4XTJ A;  2EPP A;  1Z0T A;  2N3G A;  1XMO E;  1OYS A;  3ADL A;  2YSO A;  3M99 B;  4YY3 I;  5LMN E;  2B3T B;  2E5L E;  4FWD A;  2DSY A;  1EH8 A;  1TF6 A;  1H74 A;  2WP8 A;  1VIS A;  4HAC B;  2RQL A;  3TQM A;  3UK3 C;  1B69 A;  4MU0 A;  1ZBT A;  2D9H A;  1DQ3 A;  3AV0 A;  2EOZ A;  5JEA F;  2ZM6 I;  1X5W A;  4YHH E;  3HQ1 A;  2RPC A;  4ZYE A;  2C37 A;  1IMU A;  1FWL A;  1N36 E;  1N33 I;  1D6T A;  1UDO A;  1RR9 A;  1X6E A;  4PRV A;  2KOU A;  4MDT A;  1A1H A;  2V2Q A;  4ISA A;  1PDA A;  3VYY A;  2EN4 A;  4DR5 E;  1YH8 A;  4BC9 A;  4OZE A;  3MHS C;  2DIX A;  2JVA A;  4X65 E;  4EMD A;  1HNW I;  1YUI A;  1DGC A;  5LMU I;  4PU9 A;  1X3C A;  3M7N G;  1BKN A;  2EOJ A;  2NPF A;  4IFD A;  4M30 A;  4GKK I;  4R2Q A;  3BID A;  2YTG A;  2PO0 A;  2NA2 A;  4FW6 A;  3HPS A;  3VYX A;  1H7S A;  4MYU A;  4B3M I;  1U2R A;  2L2N A;  4BHC A;  4JI0 I;  4JI8 E;  2PNM A;  1OYR A;  5C0X E;  4O24 A;  1E3H A;  3FIG A;  2L6M A;  4FWH A;  2EOO A;  2O1U A;  3HXL A;  2J65 A;  2VQF I;  1PJT A;  1FJG E;  2V34 A;  4LFB E;  2V88 A;  2EL5 A;  2YTO A;  2UUC I;  3H09 A;  2RS6 A;  2DLK A;  3PS2 A;  4WFT A;  2BR2 B;  4LF9 E;  4KQV A;  4GEQ B;  4X64 E;  1S16 A;  4M0V A;  3OTO I;  2R1F A;  2RSM A;  1T39 A;  4IZJ A;  4P52 A;  5DNX A;  4BA2 B;  2ENH A;  1RHY A;  5LLQ A;  2EOX A;  1N3G A;  4WSG A;  2V2V A;  5JEA C;  4LTY A;  5EKW A;  4R2E A;  4DV6 I;  1YFH A;  2H36 X;  4L8N A;  1UN6 B;  1USV A;  3LPS A;  2UXC E;  5C0X D;  1XHK A;  4J3D A;  2V2Z A;  2JEA A;  1ZU1 A;  5AC4 A;  2JE6 B;  2HK2 A;  2IOP A;  5KL7 A;  4R03 A;  4DR6 I;  4DKK A;  4F9A B;  1WHN A;  1N34 I;  4LF8 E;  2EMW A;  1O0W A;  3J80 C;  4O43 A;  4JI1 I;  5F3W A;  2UU9 E;  2KON A;  2BA0 D;  1YZ9 A;  3IWB A;  4X9J A;  1NZ0 A;  3J81 Q;  1EKZ A;  4DV1 E;  2CZ9 A;  4DR1 I;  5K36 A;  1A1K A;  3GME A;  2YTN A;  1Z1B A;  1YYO A;  4DUY E; 
#chains in the Genus database with same CATH homology
 4TUG A;  1B63 A;  2VF1 A;  4DR7 E;  3PYG A;  4BS9 A;  2Z5E A;  1FNM A;  2JOX A;  2BM0 A;  3ADI A;  2XEX A;  4HY1 A;  1GQE A;  4LF5 I;  5BR8 I;  2CPN A;  2X7I A;  2BM1 A;  2NUF A;  2O1W A;  2YT4 A;  3T1H I;  4JI6 E;  4X8W A;  2LBS B;  1XNQ E;  3Q6N A;  4DMI A;  4BBY A;  3DF6 A;  4DPX A;  4K0K E;  2F4V I;  3PYF A;  2UXB E;  5AE3 A;  3JU0 A;  1IBL I;  2YZT A;  3VK6 A;  4JYA E;  4DPW A;  4WPY A;  3Q1Q A;  5IT9 C;  4DPU A;  1KKH A;  1WXR A;  4I8O A;  3J7A G;  4NXN E;  2NUE A;  1HNZ I;  4DV3 E;  4HXZ A;  1XNR I;  3ZKD A;  2LTS A;  2Z5B A;  1HR0 I;  4JV5 I;  1GZ6 A;  2L33 A;  5A2Q Q;  3HJC A;  1KTV A;  4DV7 E;  3JAM Q;  4LFA I;  3P1X A;  3LML A;  4LF7 I;  4WUC A;  4IZK A;  4WYQ B;  4KHP I;  1N0V C;  1ELO A;  2FTX B;  4LF6 E;  1X47 A;  4BMJ A;  4LF4 I;  2ODR C;  1I94 E;  1IBM I;  1XMQ I;  1N32 I;  2WZO A;  2DMY A;  2L3J A;  4P7A A;  3AUZ A;  1Z0W A;  1HNX I;  1PVG A;  4AQY I;  2ZM6 E;  2O1T A;  2Z5C B;  3B78 A;  2B9D A;  1N33 E;  1S4E A;  4JI2 I;  4USK A;  1WUU A;  2VF3 A;  4FWG A;  2VQE E;  4NXM E;  1RQ0 A;  2RS7 A;  4OOG C;  1XMO I;  1HNW E;  1J26 A;  1HK7 A;  5LMN I;  2E5L I;  4GKK E;  3KWR A;  4BCA A;  3F0N A;  3K85 A;  3P06 A;  2B7T A;  2KHX A;  3IWD A;  2UUB I;  3ZZ0 A;  4X62 I;  2B7V A;  4JI0 E;  4YHH I;  4X66 I;  1Z0E A;  4B3S I;  4JI5 E;  2AJ4 A;  2Z5B B;  4WSP A;  4DV5 E;  2UUC E;  4LFC E;  2LUP B;  4JI4 I;  3J7Y p;  1ZM4 A;  4FW9 A;  3IWC A;  3C4B A;  2HFS A;  2FV4 B;  1YYK A;  1Y6Z A;  3J80 Q;  4OX9 E;  2HHH E;  2JWO A;  3DJW A;  1Z0G A;  1J5E I;  1USU A;  4B3T E;  5IWA E;  1T4L B;  2CG9 A;  4PRX A;  1FJG I;  4DUZ E;  1QU6 A;  4LF9 I;  2L2K B;  4X64 I;  1N0U A;  4JI7 E;  4DR1 E;  3K17 A;  3WU5 A;  2LJH A;  2L92 A;  3QT7 A;  1X49 A;  4DR2 I;  4J8Z A;  2UUA E;  4IZJ D;  1Z0V A;  4M1K A;  4MYT A;  2DEJ A;  4DR3 I;  3ZOQ B;  4DV0 E;  1OJ4 A;  3V2U C;  3ZKB A;  4WUB A;  3T1H E;  5IT9 Q;  1ZXM A;  2Q2E B;  2V86 A;  3F6G A;  2CGE A;  1X48 A;  1IBL E;  4DV1 I;  3B82 A;  2R3V A;  2UXD E;  4DU8 A;  4DUY I;  1NHH A;  1RRE A;  4JI3 I;  1DAR A;  5AAS A;  4IZJ B;  4DR7 I;  1ZXN A;  3T1Y I;  1PIE A;  4HAC A;  5LL6 R;  2ZIT A;  2M7Q A;  1ZBQ A;  3J81 C;  2LUQ A;  1HNZ E;  1XNR E;  4B3R I;  4K0K I;  3RMP A;  2VE7 C;  2UXB I;  1ZM9 A;  4DXL A;  4LFA E;  3K1J A;  2LE2 A;  1FWK A;  4GKJ I;  4DV4 E;  4DV2 E;  2HK3 A;  2LRS A;  5FLX C;  1EI1 A;  5GMD A;  1T4O A;  5AE2 A;  4DU7 A;  2V85 A;  4WUD A;  3JTZ A;  4F9C B;  4DR4 I;  4YY3 E;  1Z5C A;  3HUL A;  3ZM7 A;  2WW4 A;  2GS8 A;  4AQY E;  3H4L A;  1FKA E;  2HKE A;  2F8B A;  4JI2 E;  1IBK I;  3GON A;  4LF6 I;  2V8P A;  1I94 I;  1Y4S A;  3QT5 A;  1FI4 A;  5A2Q C;  5LMU E;  5T6J A;  1H72 C;  3JAM C;  1Y4U A;  4LU9 A;  2UUB E;  4B3M E;  4X62 E;  2X36 A;  4P7D A;  2K4V A;  2HFU A;  1Z5B A;  4X66 E;  3PYE A;  4R1F A;  2LTR A;  4B3S E;  1N36 I;  2RTX A;  2VQF E;  4ED4 A;  1UHZ A;  3QT6 A;  3WU3 A;  2VQE I;  4NXM I;  2EZ6 A;  4JI4 E;  4DR5 I;  3OTO E;  4X65 I;  2LMZ A;  3ZZU A;  1Z0B A;  4IZK B;  1Z59 A;  3C4T A;  1KIJ A;  4F54 A;  4DV6 E;  1H73 A;  2JY9 A;  5AE1 A;  4JI8 I;  1A6F A;  3PYD A;  4Q28 A;  1MX0 A;  1J5E E;  4JI5 I;  1QZR A;  4R8O A;  3QT8 A;  3B8H A;  4DV5 I;  4LFB I;  4LFC I;  4DR6 E;  3D4J A;  1N34 E;  4JI1 E;  4F9B B;  3F6H A;  3LLH A;  2N3H A;  2E1R A;  3M6A A;  3HPZ A;  1MG7 A;  1MU5 A;  3ADJ A;  3V5R A;  1KVK A;  1WHQ A;  3WU4 A;  3LTO A;  5ADZ A;  4OX9 I;  4DR2 E;  3LNU A;  2HHH I;  2EWL A;  4Z7C A;  2UXC I;  4JG4 A;  2DB2 A;  2V89 A;  1NHJ A;  4B3T I;  5IWA I;  4DR3 E;  5L3J A;  4UT4 A;  2R42 A;  3Q6M A;  4RPF A;  4LF5 E;  3CWV A;  5BR8 E;  5FWK A;  4DUZ I;  4TUI A;  2V83 A;  4UTG A;  2V8Q B;  1ZM2 A;  4LF8 I;  2JR1 A;  2UU9 I;  2J7K A;  4JI7 I;  3J7A M;  3ZZT A;  2F4V E;  2BV3 A;  2L3C A;  2FGG A;  5DNY A;  2NUG A;  2PNL A;  2HKJ A;  2M1S A;  2OI2 A;  4DPT A;  4JI3 E;  1T4N A;  2UUA I;  3MSW A;  4N3O A;  5GME A;  3HTX A;  2E1M A;  3T1Y E;  2MC6 A;  4DPY A;  1SR9 A;  4DV0 I;  2IHR 1;  2G7H A;  3WU6 A;  4Z7Y A;  2Z5C A;  4JI6 I;  2DEI A;  3PRY A;  4I3H A;  1XNQ I;  5FLX Q;  4B3R E;  2LJP A;  4L5N C;  1UIL A;  1HR0 E;  1RC7 A;  4JV5 E;  4KZS A;  2EFG A;  4JYA I;  2GQ0 A;  2UXD I;  1PKP A;  4LF7 E;  4M2Z A;  4GKJ E;  4KHP E;  2A2D A;  1H7U A;  1K47 A;  1Z5A A;  4LF4 E;  1ZM3 A;  4NXN I;  2L2M A;  4P78 A;  4DV3 I;  1DI2 A;  4DR4 E;  2O1V A;  1B62 A;  1IBM E;  1XMQ E;  1UEK A;  1N32 E;  4ZVI A;  4HYM A;  4USM A;  4URL A;  2ODR D;  2A2C A;  4BC7 A;  1HNX E;  2M4I A;  1STU A;  4DV7 I;  1YYW A;  2MC5 A;  2MDR A;  1Z0C A;  2JOB A;  4DV4 I;  3OML A;  4DV2 I;  2V87 A;  1IBK E;  2IOQ A;  5CFF E;  1NHI A;  2ZBK B;  2L8T A;  1EA6 A;  3ADG A;  3K6Q A;  4FN5 A;  4XTJ A;  1Z0T A;  2N3G A;  1XMO E;  3ADL A;  4YY3 I;  5LMN E;  2B3T B;  2E5L E;  4FWD A;  2DSY A;  1H74 A;  1VIS A;  4HAC B;  1ZBT A;  3AV0 A;  1DQ3 A;  2ZM6 I;  4YHH E;  3HQ1 A;  1FWL A;  1N36 E;  1N33 I;  1D6T A;  4PRV A;  1RR9 A;  2KOU A;  2V2Q A;  3VYY A;  4DR5 E;  4BC9 A;  2DIX A;  2JVA A;  4X65 E;  4EMD A;  1HNW I;  5LMU I;  4PU9 A;  1BKN A;  2NPF A;  4GKK I;  4M30 A;  2NA2 A;  3HPS A;  3VYX A;  1H7S A;  4MYU A;  4B3M I;  1U2R A;  2L2N A;  4JI0 I;  4JI8 E;  2PNM A;  3FIG A;  2L6M A;  4FWH A;  2O1U A;  3HXL A;  2VQF I;  1FJG E;  2V34 A;  4LFB E;  2V88 A;  2UUC I;  3H09 A;  2RS6 A;  4KQV A;  4WFT A;  4LF9 E;  4GEQ B;  4X64 E;  1S16 A;  4M0V A;  3OTO I;  4IZJ A;  2RSM A;  4P52 A;  2V2V A;  4LTY A;  4DV6 I;  2H36 X;  4L8N A;  1USV A;  3LPS A;  2UXC E;  1XHK A;  2V2Z A;  2HK2 A;  2IOP A;  4R03 A;  4DR6 I;  4DKK A;  4F9A B;  1WHN A;  1N34 I;  4LF8 E;  1O0W A;  3J80 C;  4JI1 I;  5F3W A;  2UU9 E;  2KON A;  1YZ9 A;  3IWB A;  1NZ0 A;  3J81 Q;  4DR1 I;  1EKZ A;  4DV1 E;  2CZ9 A;  1YYO A;  4DUY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...