2HHHE

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2hhhE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2hhhE02
3QT6A 1K47A 1IBLI 3B78A 1VISA 3ADIA 2VQFI 2UXCE 4DV3E 4NXMI 4DR5E 2DMYA 1YZ9A 4JI5I 1XMQI 4B3TE 3CWVA 2V8PA 4DV4E 4R1FA 1XNQE 4OOGC 2L2MA 5A2QC 5FLXQ 2ZM6I 5IT9C 3LTOA 4DXLA 1YYOA 5LMNI 2N3HA 2X7IA 4YY3E 1N34E 2UU9E 1Z5BA 2V34A 4LF4E 4M2ZA 4AQYE 1QU6A 2RTXA 5GMEA 4DPWA 3WU6A 4X65E 1KIJA 4P52A 1J26A 4DKKA 1X48A 1N32I 4JYAE 4JV5E 2GS8A 4DV5E 4B3RE 4M30A 2V2QA 4DV2E 1MX0A 2E1RA 4JI0E 3PYFA 3ZKBA 3Q1QA 2RSMA 3ZZUA 3JAMC 2NA2A 4LF5E 4DUZI 1FJGE 4LF6I 1Z0BA 1Z5AA 4JI1E 1Z0GA 2MDRA 1GQEA 2HK3A 1RR9A 2RS6A 4GKKI 5CFFE 4DV7E 3PYEA 4KHPI 4WFTA 1ZM9A 3V5RA 3QT7A 2HK2A 3LLHA 1O0WA 4LF8I 4JG4A 4DPUA 1FWKA 3T1YI 2E5LI 1KVKA 4JI6E 2R3VA 2UUBE 4HACA 4EMDA 1H74A 2B7TA 4LFAE 1X47A 1Z5CA 1N0VC 1YYKA 4FW9A 1HNWE 3B8HA 2Q2EB 5IWAI 4GKJI 5LMUE 1ZBTA 4NXNE 1XHKA 1Z0CA 1HNXE 1J5EI 1PKPA 3H4LA 2A2DA 2NUFA 4DR2I 4DR7I 2VQEE 2HKJA 4B3SI 1FKAE 2F4VE 4DPYA 4UT4A 1BKNA 2V2VA 5GMDA 4DV0E 3J7Yp 2KHXA 3LNUA 2L2NA 1FI4A 3WU4A 1IBKI 2JVAA 1NHHA 5BR8I 2UUCI 1DARA 5A2QQ 2EFGA 1RQ0A 1ZM2A 5IT9Q 1S4EA 4B3ME 4DV3I 4JI3E 4DR5I 3T1HI 3K1JA 1N33E 1NHIA 3WU5A 4B3TI 4DR4I 1N0UA 3OTOE 4DR6E 4DV4I 4JI2E 1KKHA 3ZKDA 1WHQA 4DV1E 3B82A 4LFCE 4JI7E 4LF7E 2LTRA 2HFUA 4FN5A 5LL6R 3ADLA 4WUCA 4HACB 4USMA 4JI5E 1XMQE 1B63A 1D6TA 4YY3I 3HULA 1N34I 2UU9I 4LF4I 4AQYI 1RREA 3JAMQ 2V2ZA 2BM1A 2R42A 3WU3A 1UEKA 3ZZTA 4DU7A 2LUQA 1ZM3A 4X65I 1ZM4A 1Z0WA 1Z0EA 1S16A 4JI8E 4JV5I 4JYAI 4RPFA 4DV5I 4B3RI 1IBMI 4DV2I 4PU9A 3J7AM 4UTGA 4X66I 4JI0I 1FNMA 2CPNA 1QZRA 4X62E 4YHHE 2UUAE 3J81Q 4LF5I 2NUEA 1FJGI 4DR1E 5FLXC 4WUBA 4P7AA 4JI4E 4LF9E 2BV3A 4DV7I 3PYGA 2DEIA 2J7KA 1U2RA 2YT4A 1WUUA 1T4OA 1EI1A 2A2CA 1H72C 1XMOI 4ED4A 3ZM7A 4MYUA 1N36E 4FWHA 4PRXA 4DUYI 4JI6I 2UXDE 2UXBE 2B7VA 4X64E 1HNZI 1EKZA 1HR0I 1I94I 2WW4A 4OX9I 4DV6E 1STUA 2AJ4A 1HNWI 5LMUI 4URLA 4NXNI 2LUPB 4FWGA 1HNXI 4X8WA 1MG7A 4DR3I 2VQEI 3K17A 2F4VI 4HYMA 1XNRE 1Z0VA 2CZ9A 1Z0TA 4DV0I 2L2KB 2OI2A 2NUGA 1H7UA 2EZ6A 5IWAE 4GKJE 3P1XA 2N3GA 4B3MI 1A6FA 2UXCI 4DR2E 4JI3I 2HHHE 4K0KE 4WYQB 1RC7A 1NHJA 3GONA 4DR6I 2VF3A 4JI2I 1XNQI 2B3TB 4LFBE 4DV1I 2UUCE 1T4LB 4LFCI 4JI7I 4LF7I 3J80C 1ELOA 2LTSA 1IBLE 4M1KA 2VQFE 2HKEA 3T1HE 4NXME 3QT8A 2XEXA 2DEJA 4KQVA 4DR4E 1T4NA 2LBSB 3VYXA 2ZM6E 4DU8A 1ZXMA 1Z59A 5LMNE 4JI8I 2LRSA 1UHZA 3F0NA 4DPXA 1WHNA 2DIXA 3ZZ0A 3C4BA 4XTJA 3VYYA 1NZ0A 4X62I 4YHHI 2UUAI 3PYDA 1EA6A 1H73A 4DR1I 4JI1I 1YYWA 3LPSA 4FWDA 1N32E 4JI4I 4LF9I 4I3HA 3HTXA 4HXZA 2JY9A 1IBME 2L3CA 4X66E 1N36I 1FWLA 1PIEA 2DB2A 4DUZE 4LF6E 2LJPA 2UXDI 2UXBI 2UUBI 1X49A 4Z7CA 4X64I 3ADJA 1KTVA 3C4TA 4GKKE 4LFAI 3M6AA 4KHPE 1MU5A 4DV6I 1XMOE 4DPTA 4PRVA 4LF8E 2ZBKB 2E5LE 3T1YE 1B62A 2ZITA 4DUYE 3J81C 4MYTA 1UILA 1HNZE 4ZVIA 1H7SA 1HR0E 2BM0A 1I94E 2L3JA 5L3JA 1XNRI 1ZXNA 4OX9E 2L33A 4USKA 3J80Q 3QT5A 1PVGA 2RS7A 2LJHA 2X36A 2HFSA 4WUDA 1J5EE 4DR7E 4DR3E 3J7AG 4B3SE 4Z7YA 1N33I 1OJ4A 2HHHI 4K0KI 2NPFA 3OTOI 3V2UC 3ADGA 1IBKE 4LFBI 2IHR1 5BR8E 3D4JA 4HY1A 1DI2A
chains in the Genus database with same CATH superfamily
4RHBB 1K47A 3QT6A 3VK6A 4GQUA 1IBLI 5FWKA 3B78A 1VISA 3ADIA 4BHBA 2VQFI 1AH5A 2UXCE 4AM3A 3HPZA 4DV3E 1P47A 4NXMI 5TSEA 4DR5E 1RMDA 3BGHA 4BA1A 2DMYA 2A25A 2EPLX 1YZ9A 2M1SA 4N3OA 1SFEA 1KYQA 4JI5I 1G2FC 1XMQI 3DF6A 5A6KA 5ADZA 4B3TE 3CWVA 2V8PA 4DV4E 2DLKA 4FW7A 4R1FA 1XNQE 2EM0A 1IQSA 2YTIA 1YUJA 2GPIA 4OOGC 5DNYA 4BC7A 2O1UA 2L2MA 5A2QC 2IERA 1ZAAC 5FLXQ 2ZM6I 2L92A 3EPKA 5IT9C 4P7DA 3LTOA 3MHSC 4DXLA 3Q6NA 1YYOA 4ZYGA 5DRRA 5LMNI 3M7NG 2N3HA 3P3CA 2EMWA 1ZU1A 3H09A 5AE1A 2JEBB 2X7IA 4IS1C 4YY3E 1N34E 2UU9E 1Z5BA 2V34A 5JEAE 1MGTA 3TQMA 4I8OA 4LF4E 4M2ZA 4AQYE 1QU6A 2WP8A 1YSAC 5AC5A 2RTXA 1Y60A 2C38A 5DNLA 2NN6C 4Q28A 4IFDE 5DRQA 4OZEA 5GMEA 1X6FA 4DPWA 1NEIA 3WU6A 2YWQA 4X65E 4OO1A 1KIJA 1UDOA 4P52A 2M4IA 2YPNA 1J26A 1X48A 4DKKA 1TN9A 1N32I 2EOOA 4JYAE 4JV5E 2GS8A 2ODRD 3IWDA 2J7JA 4DV5E 4B3RE 4M30A 1X3CA 2MKNA 2V2QA 3M99B 4DV2E 5LLQA 3AUZA 2EMGA 4BHCA 1MX0A 2E1RA 4JI0E 3PYFA 3ZKBA 2PO0A 2YTPA 2EQ1A 2LT7A 2RSMA 2NN6F 2MDGA 4O24A 3ZZUA 3Q1QA 3JAMC 2NA2A 4LF5E 5JEAF 4DUZI 4R2DA 1FJGE 4LF6I 1Z0BA 1Z5AA 2HJJA 4JI1E 1Z0GA 2MDRA 1GQEA 2HK3A 1RR9A 2RS6A 2CTDA 2I9IA 2EPNA 2JPAA 4BCAA 2E1MA 5CFFE 4DV7E 3P3EA 3PYEA 2HGHA 4M0VA 4R2SA 3P76A 4IFDA 2EE8A 4KHPI 4F9AB 4WFTA 5DNXA 4WSGA 1ZM9A 5JEAD 2YU8A 3V5RA 3QT7A 4IFDD 1YH8A 2HK2A 5A6AA 4U3BA 2RSIA 3LLHA 1O0WA 4LF8I 4JG4A 4DPUA 2MKDA 1FWKA 2GO4A 3T1YI 1KVKA 2E5LI 2Q8UA 1DGCA 4FW4A 2JEAB 4JI6E 2R3VA 2UUBE 1MEYC 4WX9A 2WBUA 2V87A 4HACA 2C37A 3EPLA 4EMDA 1H74A 2B7TA 4LFAE 1RHYA 4IZJD 1X47A 1Z5CA 2YTJA 2EM4A 2JEBA 2WP8B 2YTQA 2EMLA 2GQ0A 1YYKA 1N0VC 2C38B 3LMLA 2EM5A 2EMBA 2O3ZA 4FW9A 3PRYA 1PJSA 2EM9A 1HNWE 5KL4A 2Q2EB 3EQ1A 2LE2A 5LMUE 3B8HA 4FW6A 5IWAI 4GKJI 4FW5A 1ZBTA 5K36E 2EM7A 1Z1BA 4NXNE 1XHKA 1L4SA 1Z0CA 4J3DA 5KL2A 1HNXE 1J5EI 1PKPA 3L00A 3H4LA 2A2DA 5A6BA 2NUFA 4DR2I 4DR7I 2ELYA 2LJUA 2VQEE 4KWYA 1UBDC 2HKJA 4B3SI 1FKAE 2EM8A 2F4VE 1HK7A 3Q6MA 3DJWA 2BA0D 4DPYA 4UT4A 2EPKX 3ECRA 3PS1A 1BKNA 2V2VA 2C39B 5GMDA 2EMFA 4DV0E 2DRPA 3J7Yp 2KHXA 1N3GA 3LNUA 2MC5A 2L2NA 1FI4A 3WU4A 1IBKI 2JVAA 2EQ0A 1NHHA 2YTOA 3PS2A 5BR8I 2F1DA 1DARA 2UUCI 5A2QQ 3KZZA 2EFGA 2NABA 1RQ0A 2EMYA 4O43A 1UDSA 1ZM2A 5JEAB 5IT9Q 2YRMA 1S4EA 4BC9A 4B3ME 3PS3A 2EOSA 3EPHA 1USVA 5EKWA 4JI3E 4DV3I 3P06A 4DR5I 3T1HI 2EPXA 4MLQA 3K1JA 1N33E 1NHIA 4IFDB 2BBGA 3WU5A 2EMXA 5K36F 1ZBQA 4B3TI 4DR4I 3AV0A 2N8XA 2YTNA 1UN6B 1N0UA 3OTOE 4DR6E 4LTYA 4DV4I 4JI2E 1KKHA 1DQ3A 3ZKDA 1WHQA 4DV1E 3B82A 4DMIA 4U3DA 3VHTB 4LFCE 4JI7E 4LCFA 4P78A 2JWOA 4J8ZA 2YTFA 2LTRA 2ENAA 4LF7E 2HFUA 1A1GA 4N4RB 5LL6R 4FN5A 2EOMA 3ADLA 2DMIA 4IZJB 1E3HA 4LOMA 1BBGA 4WUCA 2YU5A 3CDJA 4HACB 2R76A 2C37B 2JEAA 2ENCA 2K4VA 3HQ1A 2Z5BA 1A1LA 2YZTA 2NN6E 4JI5E 4USMA 2DLQA 1KJKA 2JOXA 1XMQE 1B63A 4YY3I 3HKMA 3HULA 1N34I 2F8BA 3F6GA 2UU9I 3NZKA 1A1FA 4LF4I 1IMUA 4AQYI 2EOQA 2EPZA 1EH6A 1GZ6A 3THNA 1RREA 3M7ND 3JAMQ 2V2ZA 2BM1A 2EL6A 2R42A 3WU3A 2PRTA 3U1KA 1UEKA 3ZZTA 2DGCA 1UDQA 2CVEA 4DU7A 4OO1C 2LUQA 1ZM3A 4X65I 1WXRA 1QNTA 1ZM4A 2ODRC 2EOYA 3RMPA 2YTDA 2EPRA 4Q35B 2KOUA 1SR9A 1Z0WA 1Z0EA 5KL6A 1S16A 2GLIA 5C0XC 2PO1B 1D6TA 4JI8E 4JV5I 4JYAI 5AC4A 3JU0A 2Z5CB 4NBQA 4RPFA 3GCMA 2L6MA 4DV5I 4B3RI 4FW3A 1BB8A 2C39A 1IBMI 2PNZB 4DV2I 4ISAA 2M9AA 1JK2A 2CGEA 4PU9A 3J7AM 2LO3A 4UTGA 4X66I 4JI0I 2WNRB 4MU3A 1FNMA 2CPNA 2JOBA 4WPYA 1QZRA 4X62E 2EN2A 4YHHE 2UUAE 3J81Q 4LF5I 4OO1F 2EMAA 3IWBA 2JP9A 4ZYEA 4DR1E 2NUEA 5JEAA 1FJGI 1YUIA 5FLXC 2NN6D 4WUBA 1AAYA 5C0XF 1ZR9A 2H36X 4P7AA 5T6JA 4JI4E 4LF9E 2BV3A 4DV7I 4IFDC 2O1VA 3PYGA 5K36B 2EN1A 4ZYHA 2DEIA 4MDTA 5A69A 2J7KA 1U2RA 2YT4A 1WUUA 1PDAA 1T4OA 1EI1A 1OYPA 1R6MA 2A2CA 5A6JA 1H72C 1XMOI 4ED4A 3ZM7A 2VF1A 4BMJA 4O4KA 4MYUA 1N36E 2EOJA 3GLLA 4WXDA 4FWHA 2RQLA 3IWCA 4PRXA 4DUYI 5DROA 2Z5BB 1A1KA 2UXDE 2UXBE 4IZJA 2EOZA 4JI6I 2B7VA 4X64E 1HNZI 1EKZA 3KZYA 1HR0I 2EL4A 3KWRA 1I94I 4R8OA 1E3PA 4M9VC 2JXPA 3EPJA 2WW4A 1PJQA 2O1WA 4NZVA 4OX9I 2EM2A 2YSOA 4DV6E 1STUA 2AJ4A 2VE7C 3UHMA 2G7HA 2JR1A 1HNWI 5AE3A 5LMUI 2LCEA 4URLA 4NXNI 2LUPB 2EMIA 4FWGA 1HNXI 2BR2A 3M85G 4X8WA 3UK3C 2LVHA 2EQ3A 1MG7A 4DR3I 3BF2A 2VQEI 4MU4A 1X6HA 4L8NA 3FIGA 1WRJA 4GEQB 4GZNC 3K17A 4MU0A 2F4VI 2PO1A 4HYMA 4NHRA 1A1JA 2V85A 2FV4B 2EMHA 2ENHA 2EOFA 1XNRE 2V8QB 2I13A 1Z0VA 1Z0TA 2CZ9A 2Z5CA 3B4TA 3P3GA 2L2KB 3M85D 3ZOQB 4DV0I 4F6MA 2GO3A 2FGGA 2OI2A 2NUGA 2PNZA 3HPSA 4TUGA 1H7UA 4MLVA 2EZ6A 5IWAE 2EPMX 2NN6B 4GKJE 4IS9A 2WNRA 3P1XA 2N3GA 2EOHA 3GMEA 2EOXA 4B3MI 1A6FA 2UXCI 4DR2E 1P42A 4JI3I 5ELWA 2VRDA 2EN7A 1TF6A 2UUAI 2WCC3 1B69A 2BB8A 4F2JC 2HHHE 4K0KE 3MHHC 4WYQB 1RC7A 5K36A 4GKKI 2B9DA 1F2IG 1NHJA 3F6HA 3GONA 4DR6I 3MSWA 2EPPA 2CG9A 2ADRA 2VF3A 4IZKB 4QNKA 4JI2I 2B3TB 1XNQI 4LFBE 4R2EA 4DV1I 5K36D 4BA2A 2UUCE 2FTXB 4R03A 1T4LB 1LLMC 4LFCI 1YHCA 4JI7I 2V89A 3J80C 2MC6A 1ELOA 5EL9A 2LTSA 4LF7I 2R1FA 1IBLE 4M1KA 2VQFE 2HKEA 3T1HE 4NXME 3QT8A 2XEXA 4MQYA 5AE2A 1UDNA 2DEJA 4F9BB 2PO2A 2L8TA 5F3WA 4KQVA 4QNJA 4DR4E 4R2PA 3HJCA 4OO1E 1EH8A 4F6NA 2E72A 1T4NA 3OMLA 2YTEA 5C0XE 2PNMA 2IOPA 2EORA 2LBSB 3VYXA 2V83A 2BR2B 3HXLA 2ZM6E 2CSHA 4BS9A 1ZXMA 4DU8A 1Z59A 4BBYA 4IJDA 5LMNE 2UUBI 2VESA 2D9HA 3THOB 4AIDA 2BA1G 4JI8I 2LRSA 1UHZA 3F0NA 5IXMB 4R2AA 1X5WA 4DPXA 1WHNA 2DIXA 3ZZ0A 3H1CA 2JE6B 1Y4UA 3C4BA 1X6EA 4XTJA 5KL5A 2J65A 2RPCA 2LV2A 2M7QA 3VYYA 2BA1D 1NZ0A 2V86A 3L7ZB 2YRKA 1WJPA 4TUIA 2NN6A 4KZSA 4X62I 4YHHI 3BIDA 3K6QA 1EA6A 1USUA 1XXEA 3PYDA 2EN6A 4LPFA 2EPAA 1H73A 5JEAC 4DR1I 1Y5YA 4JI1I 1YYWA 3LPSA 1GTKA 1A1IA 2EPCA 4HEIA 1NCSA 2EN8A 1N32E 4FWDA 5C0XA 4JI4I 2EM6A 4LF9I 4I3HA 1VI7A 4OO1D 3HTXA 4HTGA 4HXZA 2JY9A 1BBOA 4WXCA 1IBME 5C0XD 2EMCA 2L3CA 4BA2B 4X66E 2GHFA 4IZKA 2WBSA 3JTZA 2JT2A 1N36I 1FWLA 3BBGA 3C6MA 1YPNA 4R2RA 2DB2A 4DUZE 1PIEA 4AIMA 4LF6E 2LJPA 2UXDI 2UXBI 1T39A 1X49A 4BA1B 4Z7CA 2PO2B 3ADJA 1KTVA 4X64I 4OKGA 2WZOA 1JK1A 3C4TA 1R6LA 4GKKE 4IFDF 4LFAI 3M6AA 1Y6ZA 2IESA 4KHPE 2ELZA 4R2CA 4R2QA 5AASA 1MU5A 2Z5EA 3DD6A 2HC5A 4DV6I 2K7IA 1IQOA 1XMOE 1A1HA 3U1YA 2EN4A 4DPTA 2EM3A 4O5GA 2PNLA 4PRVA 4LCGA 4LF8E 2ZBKB 2E5LE 3T1YE 1B62A 2V88A 2EPUA 1TF3A 1T38A 4LU9A 2IOQA 2ZITA 3J81C 4DUYE 4MYTA 3QG5C 1UILA 1HNZE 3K85A 4L5NC 1H7SA 4ZVIA 1HR0E 4X9JA 1I94E 2LMZA 2EN3A 2BM0A 4LCHA 2EPOA 5KL7A 2L3JA 5L3JA 1XNRI 1ZXNA 1OYSA 4WSPA 4OX9E 2JE6A 2L33A 4USKA 2AE8A 2YTGA 3J80Q 3QT5A 1PVGA 2BA0G 2RS7A 1G2DC 3L7ZA 2LJHA 2EP3A 2EMZA 1OYRA 5KL3A 2X36A 4ZYDA 2HFSA 4WUDA 4OO1B 1J5EE 2O1TA 2DSYA 2JYAA 1EH7A 2KONA 2EL5A 4RH8A 4DR3E 3J7AG 4DR7E 4FK5C 5IV8B 5C0XB 4B3SE 4Z7YA 1N33I 2EJ4A 3KRNA 2EOEA 1PJTA 5DRPA 1OJ4A 5A6BD 4MU1A 2EWLA 1Y4SA 2HHHI 4K0KI 4F9CB 2NPFA 5K36C 2YSPA 2EMKA 2CT1A 2YRHA 3OTOI 3V2UC 3ADGA 3C6KA 2WBTA 2PO0B 1IBKE 2EOIA 2IHR1 5BR8E 4F54A 4LFBI 3D4JA 4HY1A 1DI2A 3CDIA 1YFHA
chains in the Genus database with same CATH topology
3QT6A 1K47A 3VK6A 1IBLI 5FWKA 3B78A 1VISA 3ADIA 2VQFI 2UXCE 3HPZA 4DV3E 4NXMI 4DR5E 2DMYA 1YZ9A 2M1SA 4N3OA 4JI5I 1XMQI 3DF6A 4B3TE 5ADZA 3CWVA 2V8PA 4DV4E 4R1FA 1XNQE 4OOGC 5DNYA 4BC7A 2O1UA 2L2MA 5A2QC 5FLXQ 2ZM6I 2L92A 5IT9C 4P7DA 3LTOA 4DXLA 3Q6NA 1YYOA 5LMNI 2N3HA 3H09A 5AE1A 2X7IA 4YY3E 1N34E 2UU9E 1Z5BA 2V34A 4I8OA 4LF4E 4M2ZA 4AQYE 1QU6A 2RTXA 4Q28A 5GMEA 4DPWA 3WU6A 4X65E 1KIJA 4P52A 2M4IA 1J26A 1X48A 4DKKA 1N32I 4JYAE 4JV5E 2GS8A 2ODRD 3IWDA 4DV5E 4B3RE 4M30A 2V2QA 4DV2E 3AUZA 1MX0A 2E1RA 4JI0E 3PYFA 3ZKBA 3Q1QA 2RSMA 3ZZUA 3JAMC 2NA2A 4LF5E 4DUZI 1FJGE 4LF6I 1Z0BA 1Z5AA 4JI1E 1Z0GA 2MDRA 1GQEA 2HK3A 1RR9A 2RS6A 4GKKI 4BCAA 2E1MA 5CFFE 4DV7E 3PYEA 4M0VA 4KHPI 4F9AB 4WFTA 1ZM9A 3V5RA 3QT7A 2HK2A 3LLHA 1O0WA 4LF8I 4JG4A 4DPUA 1FWKA 3T1YI 2E5LI 1KVKA 4JI6E 2R3VA 2UUBE 2V87A 4HACA 4EMDA 1H74A 2B7TA 4LFAE 4IZJD 1X47A 1Z5CA 2GQ0A 1YYKA 1N0VC 3LMLA 4FW9A 3PRYA 1HNWE 3B8HA 2Q2EB 5IWAI 2LE2A 5LMUE 4GKJI 1ZBTA 4NXNE 1XHKA 1Z0CA 1HNXE 1J5EI 1PKPA 3H4LA 2A2DA 2NUFA 4DR2I 4DR7I 2VQEE 2HKJA 4B3SI 1FKAE 3Q6MA 2F4VE 1HK7A 3DJWA 4DPYA 4UT4A 1BKNA 2V2VA 5GMDA 4DV0E 3J7Yp 2KHXA 3LNUA 2MC5A 2L2NA 1FI4A 3WU4A 1IBKI 2JVAA 1NHHA 5BR8I 2UUCI 1DARA 5A2QQ 2EFGA 1RQ0A 1ZM2A 5IT9Q 1S4EA 4BC9A 4B3ME 1USVA 4DV3I 4JI3E 4DR5I 3P06A 3T1HI 3K1JA 1N33E 1NHIA 3WU5A 1ZBQA 4B3TI 4DR4I 3AV0A 1N0UA 3OTOE 4DR6E 4LTYA 4DV4I 4JI2E 1KKHA 1DQ3A 3ZKDA 1WHQA 4DV1E 3B82A 4DMIA 4LFCE 4JI7E 4P78A 2JWOA 4J8ZA 4LF7E 2LTRA 2HFUA 4FN5A 5LL6R 3ADLA 4IZJB 4WUCA 4HACB 3HQ1A 2K4VA 2Z5BA 2YZTA 4USMA 4JI5E 2JOXA 1XMQE 1B63A 4YY3I 3HULA 1D6TA 1N34I 2F8BA 3F6GA 2UU9I 4LF4I 4AQYI 1GZ6A 1RREA 3JAMQ 2V2ZA 2BM1A 2R42A 3WU3A 1UEKA 3ZZTA 4DU7A 2LUQA 1ZM3A 4X65I 1WXRA 1ZM4A 2ODRC 3RMPA 2KOUA 1SR9A 1Z0WA 1Z0EA 1S16A 4JI8E 4JV5I 4JYAI 3JU0A 2Z5CB 4RPFA 2L6MA 4DV5I 4B3RI 1IBMI 4DV2I 4PU9A 2CGEA 3J7AM 4UTGA 4X66I 4JI0I 1FNMA 2CPNA 2JOBA 4WPYA 1QZRA 4X62E 4YHHE 2UUAE 3J81Q 4LF5I 3IWBA 2NUEA 1FJGI 4DR1E 5FLXC 4WUBA 2H36X 4P7AA 5T6JA 4JI4E 4LF9E 2BV3A 4DV7I 2O1VA 3PYGA 2DEIA 2J7KA 1U2RA 2YT4A 1WUUA 1T4OA 1EI1A 2A2CA 1H72C 1XMOI 4ED4A 3ZM7A 2VF1A 4BMJA 4MYUA 1N36E 4FWHA 3IWCA 4PRXA 4DUYI 2Z5BB 2UXDE 2UXBE 4IZJA 4JI6I 2B7VA 4X64E 1HNZI 1EKZA 1HR0I 3KWRA 1I94I 4R8OA 2WW4A 2O1WA 4OX9I 4DV6E 1STUA 2AJ4A 2VE7C 2G7HA 2JR1A 1HNWI 5AE3A 5LMUI 4URLA 4NXNI 2LUPB 4FWGA 1HNXI 4X8WA 1MG7A 4DR3I 2VQEI 4L8NA 3FIGA 4GEQB 3K17A 2F4VI 4HYMA 2FV4B 2V85A 1XNRE 2V8QB 1Z0VA 2CZ9A 1Z0TA 2Z5CA 4DV0I 2L2KB 3ZOQB 2FGGA 2OI2A 2NUGA 3HPSA 4TUGA 1H7UA 2EZ6A 5IWAE 4GKJE 3P1XA 2N3GA 4B3MI 1A6FA 2UXCI 4DR2E 4JI3I 2HHHE 4K0KE 4WYQB 1RC7A 2B9DA 1NHJA 3F6HA 3GONA 4DR6I 3MSWA 2CG9A 2VF3A 4IZKB 4JI2I 1XNQI 2B3TB 4LFBE 4DV1I 2UUCE 1T4LB 2FTXB 4R03A 4LFCI 4JI7I 2V89A 3J80C 2MC6A 1ELOA 4LF7I 2LTSA 1IBLE 4M1KA 2VQFE 2HKEA 3T1HE 4NXME 3QT8A 2XEXA 5AE2A 2DEJA 4F9BB 2L8TA 5F3WA 4KQVA 4DR4E 3HJCA 1T4NA 3OMLA 2PNMA 2IOPA 2LBSB 3VYXA 2V83A 3HXLA 2ZM6E 4BS9A 1ZXMA 4DU8A 1Z59A 4BBYA 5LMNE 4JI8I 2LRSA 1UHZA 3F0NA 4DPXA 1WHNA 2DIXA 3ZZ0A 1Y4UA 3C4BA 4XTJA 2M7QA 3VYYA 1NZ0A 2V86A 4TUIA 4KZSA 4X62I 4YHHI 3K6QA 1USUA 1EA6A 3PYDA 2UUAI 1H73A 4DR1I 4JI1I 1YYWA 3LPSA 4FWDA 1N32E 4JI4I 4LF9I 4I3HA 3HTXA 4HXZA 2JY9A 1IBME 2L3CA 4X66E 4IZKA 3JTZA 1N36I 1FWLA 1PIEA 2DB2A 4DUZE 4LF6E 2LJPA 2UXDI 2UXBI 2UUBI 1X49A 4Z7CA 4X64I 3ADJA 1KTVA 2WZOA 3C4TA 4GKKE 4LFAI 3M6AA 1Y6ZA 4KHPE 5AASA 1MU5A 2Z5EA 4DV6I 1XMOE 4DPTA 2PNLA 4PRVA 4LF8E 2ZBKB 2E5LE 3T1YE 1B62A 2V88A 2IOQA 4LU9A 2ZITA 3J81C 4DUYE 4MYTA 3K85A 1UILA 1HNZE 4ZVIA 4L5NC 1H7SA 1HR0E 2BM0A 1I94E 2LMZA 2L3JA 5L3JA 1XNRI 1ZXNA 4WSPA 4OX9E 2L33A 4USKA 3J80Q 3QT5A 1PVGA 2RS7A 2LJHA 2X36A 2HFSA 4WUDA 1J5EE 2O1TA 2DSYA 2KONA 4DR7E 4DR3E 3J7AG 4B3SE 4Z7YA 1N33I 1OJ4A 2HHHI 4K0KI 2EWLA 1Y4SA 4F9CB 2NPFA 3OTOI 3V2UC 3ADGA 1IBKE 4LFBI 2IHR1 5BR8E 4F54A 3D4JA 4HY1A 1DI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT6 A;  1K47 A;  1IBL I;  3B78 A;  1VIS A;  3ADI A;  2VQF I;  2UXC E;  4DV3 E;  4NXM I;  4DR5 E;  2DMY A;  1YZ9 A;  4JI5 I;  1XMQ I;  4B3T E;  3CWV A;  2V8P A;  4DV4 E;  4R1F A;  1XNQ E;  4OOG C;  2L2M A;  5A2Q C;  5FLX Q;  2ZM6 I;  5IT9 C;  3LTO A;  4DXL A;  1YYO A;  5LMN I;  2N3H A;  2X7I A;  4YY3 E;  1N34 E;  2UU9 E;  1Z5B A;  2V34 A;  4LF4 E;  4M2Z A;  4AQY E;  1QU6 A;  2RTX A;  5GME A;  4DPW A;  3WU6 A;  4X65 E;  1KIJ A;  4P52 A;  1J26 A;  4DKK A;  1X48 A;  1N32 I;  4JYA E;  4JV5 E;  2GS8 A;  4DV5 E;  4B3R E;  4M30 A;  2V2Q A;  4DV2 E;  1MX0 A;  2E1R A;  4JI0 E;  3PYF A;  3ZKB A;  3Q1Q A;  2RSM A;  3ZZU A;  3JAM C;  2NA2 A;  4LF5 E;  4DUZ I;  1FJG E;  4LF6 I;  1Z0B A;  1Z5A A;  4JI1 E;  1Z0G A;  2MDR A;  1GQE A;  2HK3 A;  1RR9 A;  2RS6 A;  4GKK I;  5CFF E;  4DV7 E;  3PYE A;  4KHP I;  4WFT A;  1ZM9 A;  3V5R A;  3QT7 A;  2HK2 A;  3LLH A;  1O0W A;  4LF8 I;  4JG4 A;  4DPU A;  1FWK A;  3T1Y I;  2E5L I;  1KVK A;  4JI6 E;  2R3V A;  2UUB E;  4HAC A;  4EMD A;  1H74 A;  2B7T A;  4LFA E;  1X47 A;  1Z5C A;  1N0V C;  1YYK A;  4FW9 A;  1HNW E;  3B8H A;  2Q2E B;  5IWA I;  4GKJ I;  5LMU E;  1ZBT A;  4NXN E;  1XHK A;  1Z0C A;  1HNX E;  1J5E I;  1PKP A;  3H4L A;  2A2D A;  2NUF A;  4DR2 I;  4DR7 I;  2VQE E;  2HKJ A;  4B3S I;  1FKA E;  2F4V E;  4DPY A;  4UT4 A;  1BKN A;  2V2V A;  5GMD A;  4DV0 E;  3J7Y p;  2KHX A;  3LNU A;  2L2N A;  1FI4 A;  3WU4 A;  1IBK I;  2JVA A;  1NHH A;  5BR8 I;  2UUC I;  1DAR A;  5A2Q Q;  2EFG A;  1RQ0 A;  1ZM2 A;  5IT9 Q;  1S4E A;  4B3M E;  4DV3 I;  4JI3 E;  4DR5 I;  3T1H I;  3K1J A;  1N33 E;  1NHI A;  3WU5 A;  4B3T I;  4DR4 I;  1N0U A;  3OTO E;  4DR6 E;  4DV4 I;  4JI2 E;  1KKH A;  3ZKD A;  1WHQ A;  4DV1 E;  3B82 A;  4LFC E;  4JI7 E;  4LF7 E;  2LTR A;  2HFU A;  4FN5 A;  5LL6 R;  3ADL A;  4WUC A;  4HAC B;  4USM A;  4JI5 E;  1XMQ E;  1B63 A;  1D6T A;  4YY3 I;  3HUL A;  1N34 I;  2UU9 I;  4LF4 I;  4AQY I;  1RRE A;  3JAM Q;  2V2Z A;  2BM1 A;  2R42 A;  3WU3 A;  1UEK A;  3ZZT A;  4DU7 A;  2LUQ A;  1ZM3 A;  4X65 I;  1ZM4 A;  1Z0W A;  1Z0E A;  1S16 A;  4JI8 E;  4JV5 I;  4JYA I;  4RPF A;  4DV5 I;  4B3R I;  1IBM I;  4DV2 I;  4PU9 A;  3J7A M;  4UTG A;  4X66 I;  4JI0 I;  1FNM A;  2CPN A;  1QZR A;  4X62 E;  4YHH E;  2UUA E;  3J81 Q;  4LF5 I;  2NUE A;  1FJG I;  4DR1 E;  5FLX C;  4WUB A;  4P7A A;  4JI4 E;  4LF9 E;  2BV3 A;  4DV7 I;  3PYG A;  2DEI A;  2J7K A;  1U2R A;  2YT4 A;  1WUU A;  1T4O A;  1EI1 A;  2A2C A;  1H72 C;  1XMO I;  4ED4 A;  3ZM7 A;  4MYU A;  1N36 E;  4FWH A;  4PRX A;  4DUY I;  4JI6 I;  2UXD E;  2UXB E;  2B7V A;  4X64 E;  1HNZ I;  1EKZ A;  1HR0 I;  1I94 I;  2WW4 A;  4OX9 I;  4DV6 E;  1STU A;  2AJ4 A;  1HNW I;  5LMU I;  4URL A;  4NXN I;  2LUP B;  4FWG A;  1HNX I;  4X8W A;  1MG7 A;  4DR3 I;  2VQE I;  3K17 A;  2F4V I;  4HYM A;  1XNR E;  1Z0V A;  2CZ9 A;  1Z0T A;  4DV0 I;  2L2K B;  2OI2 A;  2NUG A;  1H7U A;  2EZ6 A;  5IWA E;  4GKJ E;  3P1X A;  2N3G A;  4B3M I;  1A6F A;  2UXC I;  4DR2 E;  4JI3 I;  2HHH E;  4K0K E;  4WYQ B;  1RC7 A;  1NHJ A;  3GON A;  4DR6 I;  2VF3 A;  4JI2 I;  1XNQ I;  2B3T B;  4LFB E;  4DV1 I;  2UUC E;  1T4L B;  4LFC I;  4JI7 I;  4LF7 I;  3J80 C;  1ELO A;  2LTS A;  1IBL E;  4M1K A;  2VQF E;  2HKE A;  3T1H E;  4NXM E;  3QT8 A;  2XEX A;  2DEJ A;  4KQV A;  4DR4 E;  1T4N A;  2LBS B;  3VYX A;  2ZM6 E;  4DU8 A;  1ZXM A;  1Z59 A;  5LMN E;  4JI8 I;  2LRS A;  1UHZ A;  3F0N A;  4DPX A;  1WHN A;  2DIX A;  3ZZ0 A;  3C4B A;  4XTJ A;  3VYY A;  1NZ0 A;  4X62 I;  4YHH I;  2UUA I;  3PYD A;  1EA6 A;  1H73 A;  4DR1 I;  4JI1 I;  1YYW A;  3LPS A;  4FWD A;  1N32 E;  4JI4 I;  4LF9 I;  4I3H A;  3HTX A;  4HXZ A;  2JY9 A;  1IBM E;  2L3C A;  4X66 E;  1N36 I;  1FWL A;  1PIE A;  2DB2 A;  4DUZ E;  4LF6 E;  2LJP A;  2UXD I;  2UXB I;  2UUB I;  1X49 A;  4Z7C A;  4X64 I;  3ADJ A;  1KTV A;  3C4T A;  4GKK E;  4LFA I;  3M6A A;  4KHP E;  1MU5 A;  4DV6 I;  1XMO E;  4DPT A;  4PRV A;  4LF8 E;  2ZBK B;  2E5L E;  3T1Y E;  1B62 A;  2ZIT A;  4DUY E;  3J81 C;  4MYT A;  1UIL A;  1HNZ E;  4ZVI A;  1H7S A;  1HR0 E;  2BM0 A;  1I94 E;  2L3J A;  5L3J A;  1XNR I;  1ZXN A;  4OX9 E;  2L33 A;  4USK A;  3J80 Q;  3QT5 A;  1PVG A;  2RS7 A;  2LJH A;  2X36 A;  2HFS A;  4WUD A;  1J5E E;  4DR7 E;  4DR3 E;  3J7A G;  4B3S E;  4Z7Y A;  1N33 I;  1OJ4 A;  2HHH I;  4K0K I;  2NPF A;  3OTO I;  3V2U C;  3ADG A;  1IBK E;  4LFB I;  2IHR 1;  5BR8 E;  3D4J A;  4HY1 A;  1DI2 A; 
#chains in the Genus database with same CATH topology
 4RHB B;  1K47 A;  3QT6 A;  3VK6 A;  4GQU A;  1IBL I;  5FWK A;  3B78 A;  1VIS A;  3ADI A;  4BHB A;  2VQF I;  1AH5 A;  2UXC E;  4AM3 A;  3HPZ A;  4DV3 E;  1P47 A;  4NXM I;  5TSE A;  4DR5 E;  1RMD A;  3BGH A;  4BA1 A;  2DMY A;  2A25 A;  2EPL X;  1YZ9 A;  2M1S A;  4N3O A;  1SFE A;  1KYQ A;  4JI5 I;  1G2F C;  1XMQ I;  3DF6 A;  5A6K A;  5ADZ A;  4B3T E;  3CWV A;  2V8P A;  4DV4 E;  2DLK A;  4FW7 A;  4R1F A;  1XNQ E;  2EM0 A;  1IQS A;  2YTI A;  1YUJ A;  2GPI A;  4OOG C;  5DNY A;  4BC7 A;  2O1U A;  2L2M A;  5A2Q C;  2IER A;  1ZAA C;  5FLX Q;  2ZM6 I;  2L92 A;  3EPK A;  5IT9 C;  4P7D A;  3LTO A;  3MHS C;  4DXL A;  3Q6N A;  1YYO A;  4ZYG A;  5DRR A;  5LMN I;  3M7N G;  2N3H A;  3P3C A;  2EMW A;  1ZU1 A;  3H09 A;  5AE1 A;  2JEB B;  2X7I A;  4IS1 C;  4YY3 E;  1N34 E;  2UU9 E;  1Z5B A;  2V34 A;  5JEA E;  1MGT A;  3TQM A;  4I8O A;  4LF4 E;  4M2Z A;  4AQY E;  1QU6 A;  2WP8 A;  1YSA C;  5AC5 A;  2RTX A;  1Y60 A;  2C38 A;  5DNL A;  2NN6 C;  4Q28 A;  4IFD E;  5DRQ A;  4OZE A;  5GME A;  1X6F A;  4DPW A;  1NEI A;  3WU6 A;  2YWQ A;  4X65 E;  4OO1 A;  1KIJ A;  1UDO A;  4P52 A;  2M4I A;  2YPN A;  1J26 A;  1X48 A;  4DKK A;  1TN9 A;  1N32 I;  2EOO A;  4JYA E;  4JV5 E;  2GS8 A;  2ODR D;  3IWD A;  2J7J A;  4DV5 E;  4B3R E;  4M30 A;  1X3C A;  2MKN A;  2V2Q A;  3M99 B;  4DV2 E;  5LLQ A;  3AUZ A;  2EMG A;  4BHC A;  1MX0 A;  2E1R A;  4JI0 E;  3PYF A;  3ZKB A;  2PO0 A;  2YTP A;  2EQ1 A;  2LT7 A;  2RSM A;  2NN6 F;  2MDG A;  4O24 A;  3ZZU A;  3Q1Q A;  3JAM C;  2NA2 A;  4LF5 E;  5JEA F;  4DUZ I;  4R2D A;  1FJG E;  4LF6 I;  1Z0B A;  1Z5A A;  2HJJ A;  4JI1 E;  1Z0G A;  2MDR A;  1GQE A;  2HK3 A;  1RR9 A;  2RS6 A;  2CTD A;  2I9I A;  2EPN A;  2JPA A;  4BCA A;  2E1M A;  5CFF E;  4DV7 E;  3P3E A;  3PYE A;  2HGH A;  4M0V A;  4R2S A;  3P76 A;  4IFD A;  2EE8 A;  4KHP I;  4F9A B;  4WFT A;  5DNX A;  4WSG A;  1ZM9 A;  5JEA D;  2YU8 A;  3V5R A;  3QT7 A;  4IFD D;  1YH8 A;  2HK2 A;  5A6A A;  4U3B A;  2RSI A;  3LLH A;  1O0W A;  4LF8 I;  4JG4 A;  4DPU A;  2MKD A;  1FWK A;  2GO4 A;  3T1Y I;  1KVK A;  2E5L I;  2Q8U A;  1DGC A;  4FW4 A;  2JEA B;  4JI6 E;  2R3V A;  2UUB E;  1MEY C;  4WX9 A;  2WBU A;  2V87 A;  4HAC A;  2C37 A;  3EPL A;  4EMD A;  1H74 A;  2B7T A;  4LFA E;  1RHY A;  4IZJ D;  1X47 A;  1Z5C A;  2YTJ A;  2EM4 A;  2JEB A;  2WP8 B;  2YTQ A;  2EML A;  2GQ0 A;  1YYK A;  1N0V C;  2C38 B;  3LML A;  2EM5 A;  2EMB A;  2O3Z A;  4FW9 A;  3PRY A;  1PJS A;  2EM9 A;  1HNW E;  5KL4 A;  2Q2E B;  3EQ1 A;  2LE2 A;  5LMU E;  3B8H A;  4FW6 A;  5IWA I;  4GKJ I;  4FW5 A;  1ZBT A;  5K36 E;  2EM7 A;  1Z1B A;  4NXN E;  1XHK A;  1L4S A;  1Z0C A;  4J3D A;  5KL2 A;  1HNX E;  1J5E I;  1PKP A;  3L00 A;  3H4L A;  2A2D A;  5A6B A;  2NUF A;  4DR2 I;  4DR7 I;  2ELY A;  2LJU A;  2VQE E;  4KWY A;  1UBD C;  2HKJ A;  4B3S I;  1FKA E;  2EM8 A;  2F4V E;  1HK7 A;  3Q6M A;  3DJW A;  2BA0 D;  4DPY A;  4UT4 A;  2EPK X;  3ECR A;  3PS1 A;  1BKN A;  2V2V A;  2C39 B;  5GMD A;  2EMF A;  4DV0 E;  2DRP A;  3J7Y p;  2KHX A;  1N3G A;  3LNU A;  2MC5 A;  2L2N A;  1FI4 A;  3WU4 A;  1IBK I;  2JVA A;  2EQ0 A;  1NHH A;  2YTO A;  3PS2 A;  5BR8 I;  2F1D A;  1DAR A;  2UUC I;  5A2Q Q;  3KZZ A;  2EFG A;  2NAB A;  1RQ0 A;  2EMY A;  4O43 A;  1UDS A;  1ZM2 A;  5JEA B;  5IT9 Q;  2YRM A;  1S4E A;  4BC9 A;  4B3M E;  3PS3 A;  2EOS A;  3EPH A;  1USV A;  5EKW A;  4JI3 E;  4DV3 I;  3P06 A;  4DR5 I;  3T1H I;  2EPX A;  4MLQ A;  3K1J A;  1N33 E;  1NHI A;  4IFD B;  2BBG A;  3WU5 A;  2EMX A;  5K36 F;  1ZBQ A;  4B3T I;  4DR4 I;  3AV0 A;  2N8X A;  2YTN A;  1UN6 B;  1N0U A;  3OTO E;  4DR6 E;  4LTY A;  4DV4 I;  4JI2 E;  1KKH A;  1DQ3 A;  3ZKD A;  1WHQ A;  4DV1 E;  3B82 A;  4DMI A;  4U3D A;  3VHT B;  4LFC E;  4JI7 E;  4LCF A;  4P78 A;  2JWO A;  4J8Z A;  2YTF A;  2LTR A;  2ENA A;  4LF7 E;  2HFU A;  1A1G A;  4N4R B;  5LL6 R;  4FN5 A;  2EOM A;  3ADL A;  2DMI A;  4IZJ B;  1E3H A;  4LOM A;  1BBG A;  4WUC A;  2YU5 A;  3CDJ A;  4HAC B;  2R76 A;  2C37 B;  2JEA A;  2ENC A;  2K4V A;  3HQ1 A;  2Z5B A;  1A1L A;  2YZT A;  2NN6 E;  4JI5 E;  4USM A;  2DLQ A;  1KJK A;  2JOX A;  1XMQ E;  1B63 A;  4YY3 I;  3HKM A;  3HUL A;  1N34 I;  2F8B A;  3F6G A;  2UU9 I;  3NZK A;  1A1F A;  4LF4 I;  1IMU A;  4AQY I;  2EOQ A;  2EPZ A;  1EH6 A;  1GZ6 A;  3THN A;  1RRE A;  3M7N D;  3JAM Q;  2V2Z A;  2BM1 A;  2EL6 A;  2R42 A;  3WU3 A;  2PRT A;  3U1K A;  1UEK A;  3ZZT A;  2DGC A;  1UDQ A;  2CVE A;  4DU7 A;  4OO1 C;  2LUQ A;  1ZM3 A;  4X65 I;  1WXR A;  1QNT A;  1ZM4 A;  2ODR C;  2EOY A;  3RMP A;  2YTD A;  2EPR A;  4Q35 B;  2KOU A;  1SR9 A;  1Z0W A;  1Z0E A;  5KL6 A;  1S16 A;  2GLI A;  5C0X C;  2PO1 B;  1D6T A;  4JI8 E;  4JV5 I;  4JYA I;  5AC4 A;  3JU0 A;  2Z5C B;  4NBQ A;  4RPF A;  3GCM A;  2L6M A;  4DV5 I;  4B3R I;  4FW3 A;  1BB8 A;  2C39 A;  1IBM I;  2PNZ B;  4DV2 I;  4ISA A;  2M9A A;  1JK2 A;  2CGE A;  4PU9 A;  3J7A M;  2LO3 A;  4UTG A;  4X66 I;  4JI0 I;  2WNR B;  4MU3 A;  1FNM A;  2CPN A;  2JOB A;  4WPY A;  1QZR A;  4X62 E;  2EN2 A;  4YHH E;  2UUA E;  3J81 Q;  4LF5 I;  4OO1 F;  2EMA A;  3IWB A;  2JP9 A;  4ZYE A;  4DR1 E;  2NUE A;  5JEA A;  1FJG I;  1YUI A;  5FLX C;  2NN6 D;  4WUB A;  1AAY A;  5C0X F;  1ZR9 A;  2H36 X;  4P7A A;  5T6J A;  4JI4 E;  4LF9 E;  2BV3 A;  4DV7 I;  4IFD C;  2O1V A;  3PYG A;  5K36 B;  2EN1 A;  4ZYH A;  2DEI A;  4MDT A;  5A69 A;  2J7K A;  1U2R A;  2YT4 A;  1WUU A;  1PDA A;  1T4O A;  1EI1 A;  1OYP A;  1R6M A;  2A2C A;  5A6J A;  1H72 C;  1XMO I;  4ED4 A;  3ZM7 A;  2VF1 A;  4BMJ A;  4O4K A;  4MYU A;  1N36 E;  2EOJ A;  3GLL A;  4WXD A;  4FWH A;  2RQL A;  3IWC A;  4PRX A;  4DUY I;  5DRO A;  2Z5B B;  1A1K A;  2UXD E;  2UXB E;  4IZJ A;  2EOZ A;  4JI6 I;  2B7V A;  4X64 E;  1HNZ I;  1EKZ A;  3KZY A;  1HR0 I;  2EL4 A;  3KWR A;  1I94 I;  4R8O A;  1E3P A;  4M9V C;  2JXP A;  3EPJ A;  2WW4 A;  1PJQ A;  2O1W A;  4NZV A;  4OX9 I;  2EM2 A;  2YSO A;  4DV6 E;  1STU A;  2AJ4 A;  2VE7 C;  3UHM A;  2G7H A;  2JR1 A;  1HNW I;  5AE3 A;  5LMU I;  2LCE A;  4URL A;  4NXN I;  2LUP B;  2EMI A;  4FWG A;  1HNX I;  2BR2 A;  3M85 G;  4X8W A;  3UK3 C;  2LVH A;  2EQ3 A;  1MG7 A;  4DR3 I;  3BF2 A;  2VQE I;  4MU4 A;  1X6H A;  4L8N A;  3FIG A;  1WRJ A;  4GEQ B;  4GZN C;  3K17 A;  4MU0 A;  2F4V I;  2PO1 A;  4HYM A;  4NHR A;  1A1J A;  2V85 A;  2FV4 B;  2EMH A;  2ENH A;  2EOF A;  1XNR E;  2V8Q B;  2I13 A;  1Z0V A;  1Z0T A;  2CZ9 A;  2Z5C A;  3B4T A;  3P3G A;  2L2K B;  3M85 D;  3ZOQ B;  4DV0 I;  4F6M A;  2GO3 A;  2FGG A;  2OI2 A;  2NUG A;  2PNZ A;  3HPS A;  4TUG A;  1H7U A;  4MLV A;  2EZ6 A;  5IWA E;  2EPM X;  2NN6 B;  4GKJ E;  4IS9 A;  2WNR A;  3P1X A;  2N3G A;  2EOH A;  3GME A;  2EOX A;  4B3M I;  1A6F A;  2UXC I;  4DR2 E;  1P42 A;  4JI3 I;  5ELW A;  2VRD A;  2EN7 A;  1TF6 A;  2UUA I;  2WCC 3;  1B69 A;  2BB8 A;  4F2J C;  2HHH E;  4K0K E;  3MHH C;  4WYQ B;  1RC7 A;  5K36 A;  4GKK I;  2B9D A;  1F2I G;  1NHJ A;  3F6H A;  3GON A;  4DR6 I;  3MSW A;  2EPP A;  2CG9 A;  2ADR A;  2VF3 A;  4IZK B;  4QNK A;  4JI2 I;  2B3T B;  1XNQ I;  4LFB E;  4R2E A;  4DV1 I;  5K36 D;  4BA2 A;  2UUC E;  2FTX B;  4R03 A;  1T4L B;  1LLM C;  4LFC I;  1YHC A;  4JI7 I;  2V89 A;  3J80 C;  2MC6 A;  1ELO A;  5EL9 A;  2LTS A;  4LF7 I;  2R1F A;  1IBL E;  4M1K A;  2VQF E;  2HKE A;  3T1H E;  4NXM E;  3QT8 A;  2XEX A;  4MQY A;  5AE2 A;  1UDN A;  2DEJ A;  4F9B B;  2PO2 A;  2L8T A;  5F3W A;  4KQV A;  4QNJ A;  4DR4 E;  4R2P A;  3HJC A;  4OO1 E;  1EH8 A;  4F6N A;  2E72 A;  1T4N A;  3OML A;  2YTE A;  5C0X E;  2PNM A;  2IOP A;  2EOR A;  2LBS B;  3VYX A;  2V83 A;  2BR2 B;  3HXL A;  2ZM6 E;  2CSH A;  4BS9 A;  1ZXM A;  4DU8 A;  1Z59 A;  4BBY A;  4IJD A;  5LMN E;  2UUB I;  2VES A;  2D9H A;  3THO B;  4AID A;  2BA1 G;  4JI8 I;  2LRS A;  1UHZ A;  3F0N A;  5IXM B;  4R2A A;  1X5W A;  4DPX A;  1WHN A;  2DIX A;  3ZZ0 A;  3H1C A;  2JE6 B;  1Y4U A;  3C4B A;  1X6E A;  4XTJ A;  5KL5 A;  2J65 A;  2RPC A;  2LV2 A;  2M7Q A;  3VYY A;  2BA1 D;  1NZ0 A;  2V86 A;  3L7Z B;  2YRK A;  1WJP A;  4TUI A;  2NN6 A;  4KZS A;  4X62 I;  4YHH I;  3BID A;  3K6Q A;  1EA6 A;  1USU A;  1XXE A;  3PYD A;  2EN6 A;  4LPF A;  2EPA A;  1H73 A;  5JEA C;  4DR1 I;  1Y5Y A;  4JI1 I;  1YYW A;  3LPS A;  1GTK A;  1A1I A;  2EPC A;  4HEI A;  1NCS A;  2EN8 A;  1N32 E;  4FWD A;  5C0X A;  4JI4 I;  2EM6 A;  4LF9 I;  4I3H A;  1VI7 A;  4OO1 D;  3HTX A;  4HTG A;  4HXZ A;  2JY9 A;  1BBO A;  4WXC A;  1IBM E;  5C0X D;  2EMC A;  2L3C A;  4BA2 B;  4X66 E;  2GHF A;  4IZK A;  2WBS A;  3JTZ A;  2JT2 A;  1N36 I;  1FWL A;  3BBG A;  3C6M A;  1YPN A;  4R2R A;  2DB2 A;  4DUZ E;  1PIE A;  4AIM A;  4LF6 E;  2LJP A;  2UXD I;  2UXB I;  1T39 A;  1X49 A;  4BA1 B;  4Z7C A;  2PO2 B;  3ADJ A;  1KTV A;  4X64 I;  4OKG A;  2WZO A;  1JK1 A;  3C4T A;  1R6L A;  4GKK E;  4IFD F;  4LFA I;  3M6A A;  1Y6Z A;  2IES A;  4KHP E;  2ELZ A;  4R2C A;  4R2Q A;  5AAS A;  1MU5 A;  2Z5E A;  3DD6 A;  2HC5 A;  4DV6 I;  2K7I A;  1IQO A;  1XMO E;  1A1H A;  3U1Y A;  2EN4 A;  4DPT A;  2EM3 A;  4O5G A;  2PNL A;  4PRV A;  4LCG A;  4LF8 E;  2ZBK B;  2E5L E;  3T1Y E;  1B62 A;  2V88 A;  2EPU A;  1TF3 A;  1T38 A;  4LU9 A;  2IOQ A;  2ZIT A;  3J81 C;  4DUY E;  4MYT A;  3QG5 C;  1UIL A;  1HNZ E;  3K85 A;  4L5N C;  1H7S A;  4ZVI A;  1HR0 E;  4X9J A;  1I94 E;  2LMZ A;  2EN3 A;  2BM0 A;  4LCH A;  2EPO A;  5KL7 A;  2L3J A;  5L3J A;  1XNR I;  1ZXN A;  1OYS A;  4WSP A;  4OX9 E;  2JE6 A;  2L33 A;  4USK A;  2AE8 A;  2YTG A;  3J80 Q;  3QT5 A;  1PVG A;  2BA0 G;  2RS7 A;  1G2D C;  3L7Z A;  2LJH A;  2EP3 A;  2EMZ A;  1OYR A;  5KL3 A;  2X36 A;  4ZYD A;  2HFS A;  4WUD A;  4OO1 B;  1J5E E;  2O1T A;  2DSY A;  2JYA A;  1EH7 A;  2KON A;  2EL5 A;  4RH8 A;  4DR3 E;  3J7A G;  4DR7 E;  4FK5 C;  5IV8 B;  5C0X B;  4B3S E;  4Z7Y A;  1N33 I;  2EJ4 A;  3KRN A;  2EOE A;  1PJT A;  5DRP A;  1OJ4 A;  5A6B D;  4MU1 A;  2EWL A;  1Y4S A;  2HHH I;  4K0K I;  4F9C B;  2NPF A;  5K36 C;  2YSP A;  2EMK A;  2CT1 A;  2YRH A;  3OTO I;  3V2U C;  3ADG A;  3C6K A;  2WBT A;  2PO0 B;  1IBK E;  2EOI A;  2IHR 1;  5BR8 E;  4F54 A;  4LFB I;  3D4J A;  4HY1 A;  1DI2 A;  3CDI A;  1YFH A; 
#chains in the Genus database with same CATH homology
 3QT6 A;  1K47 A;  3VK6 A;  1IBL I;  5FWK A;  3B78 A;  1VIS A;  3ADI A;  2VQF I;  2UXC E;  3HPZ A;  4DV3 E;  4NXM I;  4DR5 E;  2DMY A;  1YZ9 A;  2M1S A;  4N3O A;  4JI5 I;  1XMQ I;  3DF6 A;  4B3T E;  5ADZ A;  3CWV A;  2V8P A;  4DV4 E;  4R1F A;  1XNQ E;  4OOG C;  5DNY A;  4BC7 A;  2O1U A;  2L2M A;  5A2Q C;  5FLX Q;  2ZM6 I;  2L92 A;  5IT9 C;  4P7D A;  3LTO A;  4DXL A;  3Q6N A;  1YYO A;  5LMN I;  2N3H A;  3H09 A;  5AE1 A;  2X7I A;  4YY3 E;  1N34 E;  2UU9 E;  1Z5B A;  2V34 A;  4I8O A;  4LF4 E;  4M2Z A;  4AQY E;  1QU6 A;  2RTX A;  4Q28 A;  5GME A;  4DPW A;  3WU6 A;  4X65 E;  1KIJ A;  4P52 A;  2M4I A;  1J26 A;  1X48 A;  4DKK A;  1N32 I;  4JYA E;  4JV5 E;  2GS8 A;  2ODR D;  3IWD A;  4DV5 E;  4B3R E;  4M30 A;  2V2Q A;  4DV2 E;  3AUZ A;  1MX0 A;  2E1R A;  4JI0 E;  3PYF A;  3ZKB A;  3Q1Q A;  2RSM A;  3ZZU A;  3JAM C;  2NA2 A;  4LF5 E;  4DUZ I;  1FJG E;  4LF6 I;  1Z0B A;  1Z5A A;  4JI1 E;  1Z0G A;  2MDR A;  1GQE A;  2HK3 A;  1RR9 A;  2RS6 A;  4GKK I;  4BCA A;  2E1M A;  5CFF E;  4DV7 E;  3PYE A;  4M0V A;  4KHP I;  4F9A B;  4WFT A;  1ZM9 A;  3V5R A;  3QT7 A;  2HK2 A;  3LLH A;  1O0W A;  4LF8 I;  4JG4 A;  4DPU A;  1FWK A;  3T1Y I;  2E5L I;  1KVK A;  4JI6 E;  2R3V A;  2UUB E;  2V87 A;  4HAC A;  4EMD A;  1H74 A;  2B7T A;  4LFA E;  4IZJ D;  1X47 A;  1Z5C A;  2GQ0 A;  1YYK A;  1N0V C;  3LML A;  4FW9 A;  3PRY A;  1HNW E;  3B8H A;  2Q2E B;  5IWA I;  2LE2 A;  5LMU E;  4GKJ I;  1ZBT A;  4NXN E;  1XHK A;  1Z0C A;  1HNX E;  1J5E I;  1PKP A;  3H4L A;  2A2D A;  2NUF A;  4DR2 I;  4DR7 I;  2VQE E;  2HKJ A;  4B3S I;  1FKA E;  3Q6M A;  2F4V E;  1HK7 A;  3DJW A;  4DPY A;  4UT4 A;  1BKN A;  2V2V A;  5GMD A;  4DV0 E;  3J7Y p;  2KHX A;  3LNU A;  2MC5 A;  2L2N A;  1FI4 A;  3WU4 A;  1IBK I;  2JVA A;  1NHH A;  5BR8 I;  2UUC I;  1DAR A;  5A2Q Q;  2EFG A;  1RQ0 A;  1ZM2 A;  5IT9 Q;  1S4E A;  4BC9 A;  4B3M E;  1USV A;  4DV3 I;  4JI3 E;  4DR5 I;  3P06 A;  3T1H I;  3K1J A;  1N33 E;  1NHI A;  3WU5 A;  1ZBQ A;  4B3T I;  4DR4 I;  3AV0 A;  1N0U A;  3OTO E;  4DR6 E;  4LTY A;  4DV4 I;  4JI2 E;  1KKH A;  1DQ3 A;  3ZKD A;  1WHQ A;  4DV1 E;  3B82 A;  4DMI A;  4LFC E;  4JI7 E;  4P78 A;  2JWO A;  4J8Z A;  4LF7 E;  2LTR A;  2HFU A;  4FN5 A;  5LL6 R;  3ADL A;  4IZJ B;  4WUC A;  4HAC B;  3HQ1 A;  2K4V A;  2Z5B A;  2YZT A;  4USM A;  4JI5 E;  2JOX A;  1XMQ E;  1B63 A;  4YY3 I;  3HUL A;  1D6T A;  1N34 I;  2F8B A;  3F6G A;  2UU9 I;  4LF4 I;  4AQY I;  1GZ6 A;  1RRE A;  3JAM Q;  2V2Z A;  2BM1 A;  2R42 A;  3WU3 A;  1UEK A;  3ZZT A;  4DU7 A;  2LUQ A;  1ZM3 A;  4X65 I;  1WXR A;  1ZM4 A;  2ODR C;  3RMP A;  2KOU A;  1SR9 A;  1Z0W A;  1Z0E A;  1S16 A;  4JI8 E;  4JV5 I;  4JYA I;  3JU0 A;  2Z5C B;  4RPF A;  2L6M A;  4DV5 I;  4B3R I;  1IBM I;  4DV2 I;  4PU9 A;  2CGE A;  3J7A M;  4UTG A;  4X66 I;  4JI0 I;  1FNM A;  2CPN A;  2JOB A;  4WPY A;  1QZR A;  4X62 E;  4YHH E;  2UUA E;  3J81 Q;  4LF5 I;  3IWB A;  2NUE A;  1FJG I;  4DR1 E;  5FLX C;  4WUB A;  2H36 X;  4P7A A;  5T6J A;  4JI4 E;  4LF9 E;  2BV3 A;  4DV7 I;  2O1V A;  3PYG A;  2DEI A;  2J7K A;  1U2R A;  2YT4 A;  1WUU A;  1T4O A;  1EI1 A;  2A2C A;  1H72 C;  1XMO I;  4ED4 A;  3ZM7 A;  2VF1 A;  4BMJ A;  4MYU A;  1N36 E;  4FWH A;  3IWC A;  4PRX A;  4DUY I;  2Z5B B;  2UXD E;  2UXB E;  4IZJ A;  4JI6 I;  2B7V A;  4X64 E;  1HNZ I;  1EKZ A;  1HR0 I;  3KWR A;  1I94 I;  4R8O A;  2WW4 A;  2O1W A;  4OX9 I;  4DV6 E;  1STU A;  2AJ4 A;  2VE7 C;  2G7H A;  2JR1 A;  1HNW I;  5AE3 A;  5LMU I;  4URL A;  4NXN I;  2LUP B;  4FWG A;  1HNX I;  4X8W A;  1MG7 A;  4DR3 I;  2VQE I;  4L8N A;  3FIG A;  4GEQ B;  3K17 A;  2F4V I;  4HYM A;  2FV4 B;  2V85 A;  1XNR E;  2V8Q B;  1Z0V A;  2CZ9 A;  1Z0T A;  2Z5C A;  4DV0 I;  2L2K B;  3ZOQ B;  2FGG A;  2OI2 A;  2NUG A;  3HPS A;  4TUG A;  1H7U A;  2EZ6 A;  5IWA E;  4GKJ E;  3P1X A;  2N3G A;  4B3M I;  1A6F A;  2UXC I;  4DR2 E;  4JI3 I;  2HHH E;  4K0K E;  4WYQ B;  1RC7 A;  2B9D A;  1NHJ A;  3F6H A;  3GON A;  4DR6 I;  3MSW A;  2CG9 A;  2VF3 A;  4IZK B;  4JI2 I;  1XNQ I;  2B3T B;  4LFB E;  4DV1 I;  2UUC E;  1T4L B;  2FTX B;  4R03 A;  4LFC I;  4JI7 I;  2V89 A;  3J80 C;  2MC6 A;  1ELO A;  4LF7 I;  2LTS A;  1IBL E;  4M1K A;  2VQF E;  2HKE A;  3T1H E;  4NXM E;  3QT8 A;  2XEX A;  5AE2 A;  2DEJ A;  4F9B B;  2L8T A;  5F3W A;  4KQV A;  4DR4 E;  3HJC A;  1T4N A;  3OML A;  2PNM A;  2IOP A;  2LBS B;  3VYX A;  2V83 A;  3HXL A;  2ZM6 E;  4BS9 A;  1ZXM A;  4DU8 A;  1Z59 A;  4BBY A;  5LMN E;  4JI8 I;  2LRS A;  1UHZ A;  3F0N A;  4DPX A;  1WHN A;  2DIX A;  3ZZ0 A;  1Y4U A;  3C4B A;  4XTJ A;  2M7Q A;  3VYY A;  1NZ0 A;  2V86 A;  4TUI A;  4KZS A;  4X62 I;  4YHH I;  3K6Q A;  1USU A;  1EA6 A;  3PYD A;  2UUA I;  1H73 A;  4DR1 I;  4JI1 I;  1YYW A;  3LPS A;  4FWD A;  1N32 E;  4JI4 I;  4LF9 I;  4I3H A;  3HTX A;  4HXZ A;  2JY9 A;  1IBM E;  2L3C A;  4X66 E;  4IZK A;  3JTZ A;  1N36 I;  1FWL A;  1PIE A;  2DB2 A;  4DUZ E;  4LF6 E;  2LJP A;  2UXD I;  2UXB I;  2UUB I;  1X49 A;  4Z7C A;  4X64 I;  3ADJ A;  1KTV A;  2WZO A;  3C4T A;  4GKK E;  4LFA I;  3M6A A;  1Y6Z A;  4KHP E;  5AAS A;  1MU5 A;  2Z5E A;  4DV6 I;  1XMO E;  4DPT A;  2PNL A;  4PRV A;  4LF8 E;  2ZBK B;  2E5L E;  3T1Y E;  1B62 A;  2V88 A;  2IOQ A;  4LU9 A;  2ZIT A;  3J81 C;  4DUY E;  4MYT A;  3K85 A;  1UIL A;  1HNZ E;  4ZVI A;  4L5N C;  1H7S A;  1HR0 E;  2BM0 A;  1I94 E;  2LMZ A;  2L3J A;  5L3J A;  1XNR I;  1ZXN A;  4WSP A;  4OX9 E;  2L33 A;  4USK A;  3J80 Q;  3QT5 A;  1PVG A;  2RS7 A;  2LJH A;  2X36 A;  2HFS A;  4WUD A;  1J5E E;  2O1T A;  2DSY A;  2KON A;  4DR7 E;  4DR3 E;  3J7A G;  4B3S E;  4Z7Y A;  1N33 I;  1OJ4 A;  2HHH I;  4K0K I;  2EWL A;  1Y4S A;  4F9C B;  2NPF A;  3OTO I;  3V2U C;  3ADG A;  1IBK E;  4LFB I;  2IHR 1;  5BR8 E;  4F54 A;  3D4J A;  4HY1 A;  1DI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...