3J7AG

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
224
Chain Sequence
KNWVPVTKLGRLVKEGKIVSIEEIYLHSLPIKEYQIIDYFFQPNECSHPLKDDVVKIMPVQKQTRAGQRTRFKAFVAIGDGNGHCGLGVKCAKEVATAIRGAIISAKLSLIPVRRGYWGNKIGDPHTVPMKVSGKCGSVRIRLVPAPRGTQIVGAPTTKKMLNFAGIKDCFSSSCGKTKTKGNFLRAIFNALSKTYGYLTPDLWKVTNFDKSPYEEWSDFLETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
total genus 46
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
G PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j7aG01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j7aG02
2VF3A 4B3MI 3JAMQ 3J80C 2VQEE 5IT9C 2HFSA 4DUYI 1N0VC 4YHHE 1IBLI 2Q2EB 4FWGA 4GKKE 4JI7E 2NPFA 4DU7A 2HK2A 1PVGA 1NHHA 4JI5E 4DV3E 4JI3I 1XMOE 4LF4E 5IWAE 1HR0E 3QT6A 2UXCI 5L3JA 4GKJE 3J81Q 4B3TE 3H4LA 4JI1E 1HNZI 3T1HI 4DV6I 1IBKI 4DR5I 1XNRI 1WUUA 4DV4I 1OJ4A 4RPFA 2E1RA 1HNXE 4OX9E 5FLXC 4Z7CA 3F0NA 2BM1A 1RREA 4NXMI 4DV1E 3WU4A 3T1HE 4JI2I 3LNUA 1Z5AA 4B3RI 4MYUA 1Z0VA 3ZZ0A 4X65E 4LFCE 2F4VE 3LPSA 1KVKA 4KHPI 4DR7I 1RR9A 4JG4A 4JI4I 4DR6E 1KTVA 4JI8E 4WUDA 4DR4E 2UU9I 1IBME 2OI2A 4DV0E 3V5RA 2UXDI 1PIEA 2UU9E 1UEKA 4B3SI 5LMUE 4USKA 4DV3I 1Z0EA 3GONA 3D4JA 1I94E 2EFGA 4B3ME 4DR6I 4JI5I 4P52A 2GS8A 2V34A 3B8HA 2A2CA 1N34E 1HNWE 1Z5BA 1U2RA 2WW4A 3WU6A 4DV5I 1ELOA 1NHIA 1J5EI 4JI1I 3QT5A 4B3RE 4GKJI 3LTOA 2LJPA 1MX0A 1N33I 3K17A 1EA6A 2UUCE 4LFAI 1FWLA 4DPXA 4DUYE 4NXME 2ZM6I 4DPYA 1VISA 4JI7I 4K0KI 1FWKA 1MG7A 4LF7E 4DR1I 4UT4A 4X62I 4ZVIA 4PRVA 2E5LI 1XHKA 4DV2E 4X62E 4JI6I 2J7KA 2V8PA 3T1YI 4X65I 4P7AA 2UXDE 2E5LE 1XMQE 1Z5CA 1N32I 2ZITA 3J7AG 3PYEA 4MYTA 1DARA 1BKNA 4R1FA 4LF7I 1FI4A 2F4VI 1H74A 1XNQI 4HYMA 1Z0CA 1K47A 3OTOI 4JI0E 2UXBI 4WUBA 1HR0I 1XMOI 4LF4I 1KIJA 4USMA 2HFUA 2UUCI 1HNZE 3J81C 1Z0GA 4LF6E 4LF8E 3J7AM 1N36E 1ZM2A 1QZRA 2V2ZA 4NXNE 4HACA 2DEJA 1N34I 2HKJA 4NXNI 4M1KA 3ZZUA 1A6FA 4DR4I 2VQFI 4DUZE 5IT9Q 4LF6I 1N36I 1ZM4A 2HKEA 4WUCA 2UUBE 5A2QQ 4DPTA 4JYAE 1H73A 2R3VA 2BM0A 3J80Q 1XMQI 4X66I 2ZBKB 4KQVA 3K1JA 4DV2I 2X7IA 4KHPE 1IBMI 3B78A 4FWDA 1N32E 2BV3A 5LL6R 3QT8A 1FJGE 1FKAE 3T1YE 1ZM3A 1EI1A 3ZM7A 5IWAI 1ZXNA 5LMNI 4AQYE 4LF5E 3OTOE 5BR8E 5GMDA 1ZXMA 1D6TA 4YY3E 1XNQE 1FJGI 4DPUA 4DUZI 2X36A 4DV7I 2A2DA 1N0UA 1N33E 1Z0BA 1Z59A 4DV6E 4FW9A 2HHHI 5BR8I 3WU3A 4JI6E 4DXLA 3PYGA 5GMEA 2UUAE 4DR3E 4FN5A 4LF9I 1S16A 4B3TI 4X64E 3V2UC 3ZKDA 1KKHA 3PYDA 4JI4E 1S4EA 1IBKE 4DR1E 4YHHI 4DR2E 1H72C 4HXZA 3WU5A 4DV4E 1ZM9A 3ZKBA 4DPWA 4DU8A 1PKPA 2V2VA 2DEIA 1NZ0A 3HULA 1B62A 3M6AA 2UUBI 4JYAI 2UUAI 4LFCI 4JI3E 1IBLE 4JI8I 1MU5A 2XEXA 2VQEI 3ZZTA 4DV0I 4JV5I 5LMUI 4DR2I 4HY1A 4YY3I 4LFBE 1HNWI 3CWVA 4GKKI 4JI0I 2UXBE 4AQYI 4HACB 1HNXI 1Z0WA 5FLXQ 1I94I 4JV5E 4LF5I 4Z7YA 4DR5E 2V2QA 4FWHA 4LF8I 2UXCE 1B63A 2HK3A 4ED4A 5LMNE 4X66E 4EMDA 1NHJA 1J5EE 3QT7A 2R42A 4URLA 2HHHE 1H7UA 4PRXA 2AJ4A 4JI2E 4LFAE 3B82A 2VQFE 2ZM6E 3PYFA 1Z0TA 4DV7E 4DR7E 1FNMA 4I3HA 4X64I 2CZ9A 1XNRE 4K0KE 4DV1I 3Q1QA 4PU9A 4DV5E 4UTGA 1H7SA 4LFBI 4OX9I 5A2QC 3JAMC 4DR3I 4B3SE 4LF9E 4XTJA
chains in the Genus database with same CATH superfamily
2Q8UA 1YYKA 2VF3A 1Z1BA 1YUIA 3EQ1A 4B3MI 2WP8B 3JAMQ 4LPFA 3J80C 2VQEE 3P76A 5IT9C 2HFSA 4RHBB 4DUYI 1N0VC 4YHHE 4R03A 4AIDA 1IBLI 4ZYEA 1YPNA 3HKMA 2Q2EB 4GZNC 4FWGA 4GKKE 4JI7E 2NPFA 4DU7A 2ENCA 2HK2A 1KJKA 5LLQA 1PVGA 4OKGA 1NHHA 4JI5E 5T6JA 3ADLA 1A1LA 4DV3E 4XTJA 5C0XF 2YU8A 2K7IA 3RMPA 2H36X 4MU4A 2JR1A 1WRJA 2R76A 1XMOE 4LF4E 1X48A 3DF6A 4OO1A 4JI3I 5IWAE 1UHZA 2EN6A 1HR0E 3QT6A 1ZU1A 2YRMA 5DRPA 1PJQA 2UXCI 2EL6A 5L3JA 2EM3A 4GKJE 1UDOA 4TUIA 4B3TE 3J81Q 2LCEA 4BMJA 3H4LA 5DNXA 4JI1E 1HNZI 3KWRA 3PS3A 1BBOA 3T1HI 2JOXA 3AUZA 4R2EA 1RHYA 3L7ZA 4DV6I 2DB2A 2BB8A 4DR5I 1IBKI 1ZAAC 1XNRI 1WUUA 3F6HA 3ECRA 3M7ND 4F6MA 4DV4I 1OJ4A 4RPFA 2E1RA 2YTIA 4IZKB 1HNXE 2WBSA 3GCMA 2YTNA 1TF6A 2WNRA 2V8QB 4HTGA 4GQUA 4OO1C 1X6HA 4M2ZA 4OX9E 5FLXC 2DIXA 1OYSA 2NUGA 2VRDA 4Z7CA 3F0NA 2JE6A 1QNTA 2BM1A 4BHCA 2FGGA 1ZBQA 1RREA 5JEAE 4NXMI 4DV1E 3HTXA 3WU4A 2EN4A 3VYXA 3T1HE 4X8WA 4JI2I 2MDGA 2V88A 2EMCA 2EPLX 1IMUA 2WBTA 2I13A 1P47A 2WCC3 3EPKA 2YRKA 5DRQA 2HGHA 4MQYA 1EH6A 3UHMA 1ZR9A 2MC5A 2IOQA 5K36A 3LNUA 1WHNA 1Z5AA 2EPMX 1Z0VA 1YZ9A 4MYUA 3ZZ0A 4B3RI 2B9DA 4X65E 1O0WA 2V86A 4LFCE 2F4VE 1T4NA 3LPSA 4IFDB 3BBGA 1KVKA 4KHPI 4DR7I 1RR9A 2VF1A 1SFEA 1JK2A 4I8OA 3HXLA 2PO2B 4JG4A 4JI4I 4DR6E 5K36F 1HK7A 2HJJA 2YTQA 4WPYA 1KTVA 4JI8E 3LMLA 1KYQA 2JP9A 4J3DA 2CG9A 3J7Yp 2PRTA 4U3DA 4WUDA 5TSEA 4DR4E 2UU9I 1X5WA 2N3HA 1IBME 2OI2A 4DV0E 3V5RA 2UXDI 1YFHA 2E1MA 3HPZA 4KWYA 5AC5A 4ZYDA 1PIEA 2M1SA 3DJWA 5IXMB 2UU9E 5AASA 2C39A 4FW5A 1UEKA 4B3SI 5LMUE 4Q35B 1XXEA 2IERA 2EOQA 2JYAA 4USKA 4DV3I 1Z0EA 3GONA 1YHCA 1UDSA 3D4JA 3BF2A 1LLMC 1TN9A 3GMEA 1X47A 1I94E 3P3EA 2DGCA 2EFGA 4B3ME 3FIGA 2M4IA 4P78A 4DR6I 4JI5I 5A6BD 4P52A 2L2MA 1A1GA 2GS8A 2PNZB 4FW7A 2JEBA 4IZJA 4Q28A 2EPPA 3MHHC 5C0XB 1IQSA 1IQOA 2V34A 2J7JA 2C38A 3B8HA 2A2CA 1N34E 2DLQA 1RC7A 3H09A 1HNWE 1JK1A 1Z5BA 2YSOA 4WFTA 2O3ZA 1U2RA 2LTSA 2DRPA 2WW4A 3WU6A 5FWKA 4DV5I 1A1IA 1ELOA 2GO4A 4BA2A 1NHIA 1J5EI 1AH5A 4JI1I 4R2AA 2A25A 2PO2A 4F9AB 3QT5A 4WXDA 4B3RE 3H1CA 4GKJI 2YRHA 3M85G 3LTOA 2LJPA 2L2NA 1UILA 1MX0A 2YPNA 2JEBB 4IZJB 5JEAB 5C0XA 2Z5EA 3GLLA 1ZBTA 3M85D 4M0VA 1N33I 2UUCE 1EA6A 1OYPA 3K17A 2B7TA 2ELYA 2EOJA 3EPHA 4LFAI 1FWLA 4NHRA 4DPXA 4DUYE 2EOOA 4NXME 5DNLA 2ZM6I 2NUFA 2IESA 4DPYA 3NZKA 1VISA 4JI7I 5EKWA 3P1XA 4K0KI 1FWKA 1N3GA 2LTRA 2YWQA 4IJDA 1T4LB 4BHBA 4LF7E 2IHR1 1MG7A 4DR1I 2EM2A 2EM7A 2EM6A 2ODRC 2NN6B 3M99B 4UT4A 5IV8B 1T4OA 2YTEA 4X62I 2N3GA 4R2DA 3KZZA 4ZVIA 1DI2A 1T39A 2WNRB 4PRVA 2E5LI 1L4SA 1XHKA 2PNZA 3Q6NA 4DV2E 2LUPB 2MDRA 2NABA 4X62E 1A1JA 4JI6I 2EJ4A 2J7KA 2V8PA 3T1YI 1EH8A 4X65I 4P7AA 2UXDE 2E5LE 4F9CB 2WBUA 1XMQE 2D9HA 1Z5CA 1N32I 2ZITA 3J7AG 4IZJD 2NN6A 1X6EA 3IWDA 2O1WA 3THOB 2EN3A 1X3CA 5KL6A 3PYEA 4ISAA 2BBGA 4R2PA 4MYTA 4DU8A 1BKNA 1DARA 4AM3A 2RTXA 5F3WA 3PS1A 5KL2A 4R1FA 3HPSA 4LF7I 1FI4A 2EN2A 2F4VI 2V85A 2RSMA 2YT4A 1H74A 3CDJA 4IS9A 1XNQI 5DRRA 4IFDE 4IFDA 2EPRA 4HYMA 1QU6A 1Z0CA 1K47A 3OTOI 4M9VC 4JI0E 2UXBI 2MKDA 4KZSA 1E3HA 1HR0I 2EMLA 1YSAC 4OOGC 3B4TA 1XMOI 2LRSA 2EWLA 2EMKA 2EPNA 2L6MA 1KIJA 4LF4I 4USMA 4BA1A 2FTXB 4P7DA 2HFUA 5A6BA 2UUCI 2EM0A 1Y5YA 1HNZE 1GZ6A 3J81C 1A1HA 3P3CA 2EOIA 2V87A 2YTDA 3BIDA 4FW4A 2EPKX 2YSPA 4L8NA 1Z0GA 1YYWA 1R6LA 2PO0A 4LF6E 4O4KA 2EQ1A 4LF8E 4TUGA 2ENAA 2PNMA 3J7AM 5ELWA 2E72A 3C4TA 3ADJA 3ZOQB 1N36E 3L7ZB 1SR9A 4O24A 1ZM2A 1QZRA 2V2ZA 3UK3C 4NXNE 2Z5CA 3VYYA 4MU0A 4QNKA 4HACA 2PO0B 2DEJA 4LCFA 1N34I 2MC6A 4X9JA 2HKJA 2LV2A 4NXNI 2EPOA 3U1KA 1STUA 5C0XD 5K36D 1G2DC 2BR2B 2L3JA 2EOZA 3BGHA 4M1KA 3K6QA 3ZZUA 2VE7C 1DQ3A 4M30A 4LOMA 5JEAF 1A6FA 1BBGA 2YZTA 2O1VA 4DR4I 3IWCA 2VQFI 4DUZE 5IT9Q 2NN6D 1Y4SA 4LF6I 1N36I 1ZM4A 1UBDC 2HKEA 2J65A 3HQ1A 3P06A 4WUCA 2JE6B 2NN6E 2BR2A 2EMYA 2GHFA 2KONA 2UUBE 4JYAE 1H73A 2R3VA 4DPTA 5A2QQ 2BM0A 2RPCA 5KL4A 2EMGA 4F6NA 1DGCA 3C4BA 3VHTB 2I9IA 4AIMA 4WX9A 2EM8A 3J80Q 1XMQI 2RQLA 4X66I 2ZBKB 4FK5C 5JEAD 2EN8A 2YU5A 2EE8A 4KQVA 5JEAC 2O1TA 3K1JA 5KL3A 2JWOA 4BC7A 3VK6A 4DV2I 2F8BA 2K4VA 2EMIA 3JTZA 4L5NC 2X7IA 4KHPE 1IBMI 2JY9A 1USUA 1RMDA 1USVA 3B78A 4O5GA 4FWDA 1N32E 2F1DA 2BV3A 5LL6R 3QT8A 1FJGE 2KHXA 2DSYA 1FKAE 3T1YE 1BB8A 2ENHA 2EL4A 1UDQA 3OMLA 3K85A 5A6KA 1ZM3A 4MDTA 2L92A 1EI1A 1EH7A 2YTJA 2BA0G 3ZM7A 5C0XE 2EMFA 3ADIA 2DLKA 4F54A 2BA0D 5IWAI 1Y6ZA 1ZXNA 4LCGA 5LMNI 2JEAB 2N8XA 3THNA 2NN6F 4AQYE 1WHQA 4LF5E 5DROA 4U3BA 1UDNA 2V83A 2NA2A 5BR8E 3OTOE 5GMDA 3MSWA 1X6FA 3QG5C 1ZXMA 1D6TA 4YY3E 2JPAA 1XNQE 3KRNA 1FJGI 2WP8A 2Z5BA 4DPUA 1T38A 2JXPA 2LBSB 4DUZI 2X36A 3L00A 4DV7I 2A2DA 2EM5A 2EMWA 5A6AA 1P42A 3M7NG 1OYRA 2PO1B 2LUQA 2CTDA 2NUEA 1N33E 1N0UA 1Z0BA 1Z59A 4MU3A 1PJTA 2B3TB 4DV6E 4FW9A 2HHHI 1TF3A 1YYOA 5BR8I 2EOHA 2YTPA 4JI6E 3WU3A 5C0XC 2EOYA 4WXCA 4BS9A 1F2IG 2GO3A 4OO1B 5K36C 1B69A 2EOXA 4DXLA 3C6MA 3PYGA 4IFDD 2M7QA 5GMEA 4MLVA 2LT7A 2CSHA 4IFDC 2UUAE 5EL9A 4DR3E 2DMIA 4FN5A 4LF9I 2EN1A 4ZYHA 2EMHA 2EPCA 4DKKA 5A69A 1S16A 5AC4A 4B3TI 1PJSA 2LJUA 1WXRA 4X64E 2CPNA 2EZ6A 4FW3A 3V2UC 3ZKDA 1KKHA 2O1UA 2EOMA 2RS6A 3JU0A 5KL5A 3PYDA 1A1KA 4JI4E 2EQ3A 2CGEA 1S4EA 4LCHA 5AE3A 4R2RA 1IBKE 4DR1E 2L8TA 2EPZA 4J8ZA 4MU1A 4YHHI 4R2QA 4DR2E 3LLHA 2C37B 1H72C 3ADGA 4HXZA 3WU5A 4DV4E 2EOSA 1GTKA 1UN6B 1VI7A 1ZM9A 1AAYA 3ZKBA 4HEIA 2KOUA 1Y60A 2L2KB 1PKPA 4DPWA 2V2VA 2G7HA 2EP3A 1MEYC 1NZ0A 2DEIA 3HULA 4BA2B 4R2SA 2JOBA 5K36E 2EMXA 2IOPA 4OZEA 1B62A 3M6AA 2UUBI 4JYAI 2EPUA 2UUAI 1YUJA 1A1FA 4LFCI 4JI3E 1IBLE 2EM9A 4JI8I 1MU5A 2XEXA 4OO1D 2VQEI 5A6JA 4BCAA 3C6KA 2GQ0A 4OO1E 2YTOA 2EOFA 1RQ0A 3EPJA 3ZZTA 2C39B 3MHSC 3HJCA 1EKZA 4DV0I 2MKNA 4JV5I 5JEAA 1WJPA 5LMUI 3DD6A 2M9AA 4DR2I 3KZYA 4IFDF 2EL5A 2LJHA 4HY1A 4QNJA 2EPAA 4YY3I 4LFBE 3Q6MA 4R8OA 1HNWI 2C38B 3CWVA 2JEAA 4DMIA 4LTYA 2PNLA 2VESA 4GKKI 2UXBE 2JT2A 4IZKA 4JI0I 4DR3I 2NN6C 4AQYI 2EPXA 4BC9A 2CVEA 3IWBA 3TQMA 4HACB 2EMZA 2L33A 5ADZA 1MGTA 2DMYA 3PRYA 2EOEA 2ODRD 1HNXI 2EMBA 3P3GA 1Z0WA 5FLXQ 1I94I 4JV5E 4LF5I 3U1YA 2YTGA 2LE2A 4WSPA 2WZOA 4Z7YA 4DR5E 2V2QA 4FWHA 1X49A 5KL7A 2PO1A 5K36B 4LF8I 2UXCE 2ELZA 4O43A 4N4RB 1B63A 2HK3A 4ED4A 3CDIA 2LVHA 4BBYA 5LMNE 4X66E 4EMDA 1NHJA 2RSIA 2FV4B 1J5EE 4ZYGA 1E3PA 4IS1C 3QT7A 2JVAA 2R42A 4URLA 5AE1A 4OO1F 2HHHE 1G2FC 1H7UA 2B7VA 2CT1A 4PRXA 5DNYA 4NZVA 2L3CA 2AJ4A 2Z5CB 4JI2E 4LFAE 2RS7A 3B82A 1R6MA 1GQEA 2VQFE 4NBQA 2ZM6E 1YH8A 4DV7E 4DR7E 1Z0TA 3PS2A 3PYFA 3EPLA 4LU9A 1NEIA 2V89A 2Z5BB 3F6GA 2EM4A 5AE2A 1FNMA 2HC5A 2AE8A 4WSGA 4FW6A 4I3HA 4X64I 4F9BB 2CZ9A 1XNRE 2EQ0A 2LMZA 1PDAA 4K0KE 4DV1I 3Q1QA 4PU9A 4DV5E 4N3OA 4F2JC 4GEQB 4BA1B 2C37A 4WYQB 1J26A 4UTGA 3AV0A 2ADRA 1H7SA 2EORA 4LFBI 2EMAA 1Y4UA 1NCSA 4OX9I 5A2QC 2BA1D 2LO3A 4MLQA 2GPIA 3JAMC 2GLIA 4B3SE 4LF9E 2EN7A 2R1FA 4RH8A 5CFFE 2BA1G 4WUBA 4R2CA 2YTFA
chains in the Genus database with same CATH topology
2VF3A 1YYKA 4B3MI 3JAMQ 3J80C 2VQEE 5IT9C 2HFSA 4DUYI 1N0VC 4YHHE 4R03A 1IBLI 2Q2EB 4FWGA 4GKKE 4JI7E 2NPFA 4DU7A 2HK2A 1PVGA 1NHHA 4JI5E 5T6JA 3ADLA 4DV3E 4XTJA 3RMPA 2H36X 4JI3I 2JR1A 1XMOE 4LF4E 1X48A 3DF6A 5IWAE 1UHZA 1HR0E 3QT6A 2UXCI 5L3JA 4GKJE 4TUIA 4B3TE 3J81Q 4BMJA 3H4LA 4JI1E 1HNZI 3KWRA 3T1HI 2JOXA 3AUZA 4DV6I 2DB2A 1IBKI 4DR5I 1XNRI 1WUUA 3F6HA 4DV4I 1OJ4A 4RPFA 2E1RA 4IZKB 1HNXE 2V8QB 4M2ZA 4OX9E 5FLXC 2DIXA 2NUGA 4Z7CA 3F0NA 2BM1A 2FGGA 1ZBQA 1RREA 4NXMI 4DV1E 3HTXA 3WU4A 3VYXA 3T1HE 4X8WA 4JI2I 2V88A 2MC5A 2IOQA 3LNUA 1WHNA 1Z5AA 4MYUA 1Z0VA 1YZ9A 4B3RI 3ZZ0A 2B9DA 4X65E 1O0WA 2V86A 4LFCE 2F4VE 1T4NA 3LPSA 1KVKA 4KHPI 4DR7I 1RR9A 2VF1A 4I8OA 3HXLA 4JG4A 4JI4I 4DR6E 1HK7A 4WPYA 1KTVA 4JI8E 3LMLA 2CG9A 3J7Yp 4WUDA 4DR4E 2UU9I 2N3HA 1IBME 2OI2A 4DV0E 3V5RA 2UXDI 2E1MA 3HPZA 1PIEA 2M1SA 3DJWA 2UU9E 5AASA 1UEKA 4B3SI 5LMUE 4USKA 4DV3I 1Z0EA 3GONA 3D4JA 1X47A 1I94E 2EFGA 4B3ME 3FIGA 2M4IA 4P78A 4DR6I 4JI5I 4P52A 2L2MA 2GS8A 4IZJA 4Q28A 2V34A 3B8HA 2A2CA 1N34E 1RC7A 3H09A 1HNWE 1Z5BA 4WFTA 1U2RA 2LTSA 2WW4A 3WU6A 5FWKA 4DV5I 1ELOA 1NHIA 1J5EI 4JI1I 4F9AB 3QT5A 4B3RE 4GKJI 3LTOA 2LJPA 2L2NA 1UILA 1MX0A 4IZJB 2Z5EA 1ZBTA 4M0VA 1N33I 2UUCE 1EA6A 3K17A 4LFAI 2B7TA 1FWLA 4DPXA 4DUYE 4NXME 2ZM6I 2NUFA 4DPYA 1VISA 4JI7I 3P1XA 4K0KI 1FWKA 2LTRA 1T4LB 1MG7A 4LF7E 2IHR1 4DR1I 2ODRC 4UT4A 1T4OA 4X62I 2N3GA 4ZVIA 1DI2A 4PRVA 2E5LI 1XHKA 3Q6NA 4DV2E 2LUPB 2MDRA 4X62E 4JI6I 2J7KA 2V8PA 3T1YI 4X65I 4P7AA 2UXDE 2E5LE 4F9CB 1XMQE 1Z5CA 1N32I 2ZITA 3J7AG 4IZJD 3IWDA 2O1WA 3PYEA 4MYTA 1BKNA 1DARA 2RTXA 5F3WA 4R1FA 3HPSA 4LF7I 1FI4A 2F4VI 2V85A 2RSMA 2YT4A 1H74A 1XNQI 4HYMA 1QU6A 1Z0CA 1K47A 3OTOI 4JI0E 2UXBI 4KZSA 1HR0I 4OOGC 1XMOI 2LRSA 2EWLA 4LF4I 2L6MA 1KIJA 4USMA 2FTXB 4P7DA 2HFUA 2UUCI 1HNZE 1GZ6A 3J81C 2V87A 4L8NA 1Z0GA 1YYWA 4LF6E 4LF8E 4TUGA 2PNMA 3J7AM 3C4TA 3ADJA 3ZOQB 1N36E 1SR9A 1ZM2A 1QZRA 2V2ZA 4NXNE 2Z5CA 3VYYA 4HACA 2DEJA 1N34I 2MC6A 2HKJA 4NXNI 1STUA 2L3JA 4M1KA 3K6QA 3ZZUA 2VE7C 1DQ3A 4M30A 1A6FA 2YZTA 2O1VA 4DR4I 3IWCA 2VQFI 4DUZE 5IT9Q 1Y4SA 4LF6I 1N36I 1ZM4A 2HKEA 3HQ1A 3P06A 4WUCA 2KONA 2UUBE 4JYAE 4DPTA 5A2QQ 1H73A 2R3VA 2BM0A 3C4BA 3J80Q 1XMQI 4X66I 2ZBKB 4KQVA 2O1TA 3K1JA 2JWOA 4BC7A 3VK6A 4DV2I 2F8BA 2K4VA 3JTZA 4L5NC 2X7IA 4KHPE 1IBMI 2JY9A 1USUA 1USVA 3B78A 4FWDA 1N32E 2BV3A 5LL6R 3QT8A 1FJGE 2KHXA 2DSYA 1FKAE 3T1YE 3OMLA 3K85A 1ZM3A 2L92A 1EI1A 3ZM7A 3ADIA 4F54A 5IWAI 1Y6ZA 1ZXNA 5LMNI 4AQYE 1WHQA 4LF5E 2V83A 2NA2A 5BR8E 3OTOE 5GMDA 3MSWA 1ZXMA 1D6TA 4YY3E 1XNQE 1FJGI 2Z5BA 4DPUA 2LBSB 4DUZI 2X36A 4DV7I 2A2DA 2LUQA 2NUEA 1N33E 1N0UA 1Z0BA 1Z59A 2B3TB 4DV6E 4FW9A 2HHHI 1YYOA 5BR8I 4JI6E 3WU3A 4BS9A 4DXLA 3PYGA 2M7QA 5GMEA 2UUAE 4DR3E 4FN5A 4LF9I 4DKKA 1S16A 4B3TI 1WXRA 4X64E 2CPNA 2EZ6A 3V2UC 3ZKDA 1KKHA 2O1UA 3JU0A 2RS6A 3PYDA 4JI4E 2CGEA 1S4EA 5AE3A 1IBKE 4DR1E 2L8TA 4YHHI 4J8ZA 4DR2E 3LLHA 1H72C 3ADGA 4HXZA 3WU5A 4DV4E 1ZM9A 3ZKBA 4DPWA 2KOUA 4DU8A 2L2KB 1PKPA 2V2VA 2G7HA 2DEIA 1NZ0A 3HULA 2JOBA 2IOPA 1B62A 3M6AA 2UUBI 4JYAI 2UUAI 4LFCI 4JI3E 1IBLE 4JI8I 1MU5A 2XEXA 2VQEI 4BCAA 2GQ0A 1RQ0A 3ZZTA 3HJCA 4DV0I 1EKZA 4JV5I 5LMUI 4DR2I 2LJHA 4HY1A 4YY3I 4LFBE 3Q6MA 4R8OA 1HNWI 3CWVA 4DMIA 4LTYA 2PNLA 4GKKI 2UXBE 4IZKA 4JI0I 4AQYI 4BC9A 4HACB 3IWBA 2L33A 5ADZA 2DMYA 3PRYA 2ODRD 1HNXI 1Z0WA 5FLXQ 1I94I 4JV5E 4LF5I 2LE2A 4WSPA 2WZOA 4Z7YA 4DR5E 2V2QA 4FWHA 1X49A 4LF8I 2UXCE 1B63A 2HK3A 4ED4A 4BBYA 5LMNE 4X66E 4EMDA 1NHJA 2FV4B 1J5EE 3QT7A 2JVAA 2R42A 4URLA 5AE1A 2HHHE 1H7UA 2B7VA 4PRXA 5DNYA 2L3CA 2AJ4A 2Z5CB 4JI2E 4LFAE 2RS7A 3B82A 1GQEA 2VQFE 2ZM6E 4DV7E 4DR7E 1Z0TA 3PYFA 4LU9A 2V89A 2Z5BB 3F6GA 5AE2A 1FNMA 4I3HA 4X64I 4F9BB 2CZ9A 1XNRE 2LMZA 4K0KE 4DV1I 3Q1QA 4PU9A 4DV5E 4N3OA 4GEQB 4WYQB 1J26A 4UTGA 3AV0A 1H7SA 4LFBI 1Y4UA 4OX9I 5A2QC 3JAMC 4B3SE 4LF9E 4DR3I 5CFFE 4WUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VF3 A;  4B3M I;  3JAM Q;  3J80 C;  2VQE E;  5IT9 C;  2HFS A;  4DUY I;  1N0V C;  4YHH E;  1IBL I;  2Q2E B;  4FWG A;  4GKK E;  4JI7 E;  2NPF A;  4DU7 A;  2HK2 A;  1PVG A;  1NHH A;  4JI5 E;  4DV3 E;  4JI3 I;  1XMO E;  4LF4 E;  5IWA E;  1HR0 E;  3QT6 A;  2UXC I;  5L3J A;  4GKJ E;  3J81 Q;  4B3T E;  3H4L A;  4JI1 E;  1HNZ I;  3T1H I;  4DV6 I;  1IBK I;  4DR5 I;  1XNR I;  1WUU A;  4DV4 I;  1OJ4 A;  4RPF A;  2E1R A;  1HNX E;  4OX9 E;  5FLX C;  4Z7C A;  3F0N A;  2BM1 A;  1RRE A;  4NXM I;  4DV1 E;  3WU4 A;  3T1H E;  4JI2 I;  3LNU A;  1Z5A A;  4B3R I;  4MYU A;  1Z0V A;  3ZZ0 A;  4X65 E;  4LFC E;  2F4V E;  3LPS A;  1KVK A;  4KHP I;  4DR7 I;  1RR9 A;  4JG4 A;  4JI4 I;  4DR6 E;  1KTV A;  4JI8 E;  4WUD A;  4DR4 E;  2UU9 I;  1IBM E;  2OI2 A;  4DV0 E;  3V5R A;  2UXD I;  1PIE A;  2UU9 E;  1UEK A;  4B3S I;  5LMU E;  4USK A;  4DV3 I;  1Z0E A;  3GON A;  3D4J A;  1I94 E;  2EFG A;  4B3M E;  4DR6 I;  4JI5 I;  4P52 A;  2GS8 A;  2V34 A;  3B8H A;  2A2C A;  1N34 E;  1HNW E;  1Z5B A;  1U2R A;  2WW4 A;  3WU6 A;  4DV5 I;  1ELO A;  1NHI A;  1J5E I;  4JI1 I;  3QT5 A;  4B3R E;  4GKJ I;  3LTO A;  2LJP A;  1MX0 A;  1N33 I;  3K17 A;  1EA6 A;  2UUC E;  4LFA I;  1FWL A;  4DPX A;  4DUY E;  4NXM E;  2ZM6 I;  4DPY A;  1VIS A;  4JI7 I;  4K0K I;  1FWK A;  1MG7 A;  4LF7 E;  4DR1 I;  4UT4 A;  4X62 I;  4ZVI A;  4PRV A;  2E5L I;  1XHK A;  4DV2 E;  4X62 E;  4JI6 I;  2J7K A;  2V8P A;  3T1Y I;  4X65 I;  4P7A A;  2UXD E;  2E5L E;  1XMQ E;  1Z5C A;  1N32 I;  2ZIT A;  3J7A G;  3PYE A;  4MYT A;  1DAR A;  1BKN A;  4R1F A;  4LF7 I;  1FI4 A;  2F4V I;  1H74 A;  1XNQ I;  4HYM A;  1Z0C A;  1K47 A;  3OTO I;  4JI0 E;  2UXB I;  4WUB A;  1HR0 I;  1XMO I;  4LF4 I;  1KIJ A;  4USM A;  2HFU A;  2UUC I;  1HNZ E;  3J81 C;  1Z0G A;  4LF6 E;  4LF8 E;  3J7A M;  1N36 E;  1ZM2 A;  1QZR A;  2V2Z A;  4NXN E;  4HAC A;  2DEJ A;  1N34 I;  2HKJ A;  4NXN I;  4M1K A;  3ZZU A;  1A6F A;  4DR4 I;  2VQF I;  4DUZ E;  5IT9 Q;  4LF6 I;  1N36 I;  1ZM4 A;  2HKE A;  4WUC A;  2UUB E;  5A2Q Q;  4DPT A;  4JYA E;  1H73 A;  2R3V A;  2BM0 A;  3J80 Q;  1XMQ I;  4X66 I;  2ZBK B;  4KQV A;  3K1J A;  4DV2 I;  2X7I A;  4KHP E;  1IBM I;  3B78 A;  4FWD A;  1N32 E;  2BV3 A;  5LL6 R;  3QT8 A;  1FJG E;  1FKA E;  3T1Y E;  1ZM3 A;  1EI1 A;  3ZM7 A;  5IWA I;  1ZXN A;  5LMN I;  4AQY E;  4LF5 E;  3OTO E;  5BR8 E;  5GMD A;  1ZXM A;  1D6T A;  4YY3 E;  1XNQ E;  1FJG I;  4DPU A;  4DUZ I;  2X36 A;  4DV7 I;  2A2D A;  1N0U A;  1N33 E;  1Z0B A;  1Z59 A;  4DV6 E;  4FW9 A;  2HHH I;  5BR8 I;  3WU3 A;  4JI6 E;  4DXL A;  3PYG A;  5GME A;  2UUA E;  4DR3 E;  4FN5 A;  4LF9 I;  1S16 A;  4B3T I;  4X64 E;  3V2U C;  3ZKD A;  1KKH A;  3PYD A;  4JI4 E;  1S4E A;  1IBK E;  4DR1 E;  4YHH I;  4DR2 E;  1H72 C;  4HXZ A;  3WU5 A;  4DV4 E;  1ZM9 A;  3ZKB A;  4DPW A;  4DU8 A;  1PKP A;  2V2V A;  2DEI A;  1NZ0 A;  3HUL A;  1B62 A;  3M6A A;  2UUB I;  4JYA I;  2UUA I;  4LFC I;  4JI3 E;  1IBL E;  4JI8 I;  1MU5 A;  2XEX A;  2VQE I;  3ZZT A;  4DV0 I;  4JV5 I;  5LMU I;  4DR2 I;  4HY1 A;  4YY3 I;  4LFB E;  1HNW I;  3CWV A;  4GKK I;  4JI0 I;  2UXB E;  4AQY I;  4HAC B;  1HNX I;  1Z0W A;  5FLX Q;  1I94 I;  4JV5 E;  4LF5 I;  4Z7Y A;  4DR5 E;  2V2Q A;  4FWH A;  4LF8 I;  2UXC E;  1B63 A;  2HK3 A;  4ED4 A;  5LMN E;  4X66 E;  4EMD A;  1NHJ A;  1J5E E;  3QT7 A;  2R42 A;  4URL A;  2HHH E;  1H7U A;  4PRX A;  2AJ4 A;  4JI2 E;  4LFA E;  3B82 A;  2VQF E;  2ZM6 E;  3PYF A;  1Z0T A;  4DV7 E;  4DR7 E;  1FNM A;  4I3H A;  4X64 I;  2CZ9 A;  1XNR E;  4K0K E;  4DV1 I;  3Q1Q A;  4PU9 A;  4DV5 E;  4UTG A;  1H7S A;  4LFB I;  4OX9 I;  5A2Q C;  3JAM C;  4DR3 I;  4B3S E;  4LF9 E;  4XTJ A; 
#chains in the Genus database with same CATH topology
 2Q8U A;  1YYK A;  2VF3 A;  1Z1B A;  1YUI A;  3EQ1 A;  4B3M I;  2WP8 B;  3JAM Q;  4LPF A;  3J80 C;  2VQE E;  3P76 A;  5IT9 C;  2HFS A;  4RHB B;  4DUY I;  1N0V C;  4YHH E;  4R03 A;  4AID A;  1IBL I;  4ZYE A;  1YPN A;  3HKM A;  2Q2E B;  4GZN C;  4FWG A;  4GKK E;  4JI7 E;  2NPF A;  4DU7 A;  2ENC A;  2HK2 A;  1KJK A;  5LLQ A;  1PVG A;  4OKG A;  1NHH A;  4JI5 E;  5T6J A;  3ADL A;  1A1L A;  4DV3 E;  4XTJ A;  5C0X F;  2YU8 A;  2K7I A;  3RMP A;  2H36 X;  4MU4 A;  2JR1 A;  1WRJ A;  2R76 A;  1XMO E;  4LF4 E;  1X48 A;  3DF6 A;  4OO1 A;  4JI3 I;  5IWA E;  1UHZ A;  2EN6 A;  1HR0 E;  3QT6 A;  1ZU1 A;  2YRM A;  5DRP A;  1PJQ A;  2UXC I;  2EL6 A;  5L3J A;  2EM3 A;  4GKJ E;  1UDO A;  4TUI A;  4B3T E;  3J81 Q;  2LCE A;  4BMJ A;  3H4L A;  5DNX A;  4JI1 E;  1HNZ I;  3KWR A;  3PS3 A;  1BBO A;  3T1H I;  2JOX A;  3AUZ A;  4R2E A;  1RHY A;  3L7Z A;  4DV6 I;  2DB2 A;  2BB8 A;  4DR5 I;  1IBK I;  1ZAA C;  1XNR I;  1WUU A;  3F6H A;  3ECR A;  3M7N D;  4F6M A;  4DV4 I;  1OJ4 A;  4RPF A;  2E1R A;  2YTI A;  4IZK B;  1HNX E;  2WBS A;  3GCM A;  2YTN A;  1TF6 A;  2WNR A;  2V8Q B;  4HTG A;  4GQU A;  4OO1 C;  1X6H A;  4M2Z A;  4OX9 E;  5FLX C;  2DIX A;  1OYS A;  2NUG A;  2VRD A;  4Z7C A;  3F0N A;  2JE6 A;  1QNT A;  2BM1 A;  4BHC A;  2FGG A;  1ZBQ A;  1RRE A;  5JEA E;  4NXM I;  4DV1 E;  3HTX A;  3WU4 A;  2EN4 A;  3VYX A;  3T1H E;  4X8W A;  4JI2 I;  2MDG A;  2V88 A;  2EMC A;  2EPL X;  1IMU A;  2WBT A;  2I13 A;  1P47 A;  2WCC 3;  3EPK A;  2YRK A;  5DRQ A;  2HGH A;  4MQY A;  1EH6 A;  3UHM A;  1ZR9 A;  2MC5 A;  2IOQ A;  5K36 A;  3LNU A;  1WHN A;  1Z5A A;  2EPM X;  1Z0V A;  1YZ9 A;  4MYU A;  3ZZ0 A;  4B3R I;  2B9D A;  4X65 E;  1O0W A;  2V86 A;  4LFC E;  2F4V E;  1T4N A;  3LPS A;  4IFD B;  3BBG A;  1KVK A;  4KHP I;  4DR7 I;  1RR9 A;  2VF1 A;  1SFE A;  1JK2 A;  4I8O A;  3HXL A;  2PO2 B;  4JG4 A;  4JI4 I;  4DR6 E;  5K36 F;  1HK7 A;  2HJJ A;  2YTQ A;  4WPY A;  1KTV A;  4JI8 E;  3LML A;  1KYQ A;  2JP9 A;  4J3D A;  2CG9 A;  3J7Y p;  2PRT A;  4U3D A;  4WUD A;  5TSE A;  4DR4 E;  2UU9 I;  1X5W A;  2N3H A;  1IBM E;  2OI2 A;  4DV0 E;  3V5R A;  2UXD I;  1YFH A;  2E1M A;  3HPZ A;  4KWY A;  5AC5 A;  4ZYD A;  1PIE A;  2M1S A;  3DJW A;  5IXM B;  2UU9 E;  5AAS A;  2C39 A;  4FW5 A;  1UEK A;  4B3S I;  5LMU E;  4Q35 B;  1XXE A;  2IER A;  2EOQ A;  2JYA A;  4USK A;  4DV3 I;  1Z0E A;  3GON A;  1YHC A;  1UDS A;  3D4J A;  3BF2 A;  1LLM C;  1TN9 A;  3GME A;  1X47 A;  1I94 E;  3P3E A;  2DGC A;  2EFG A;  4B3M E;  3FIG A;  2M4I A;  4P78 A;  4DR6 I;  4JI5 I;  5A6B D;  4P52 A;  2L2M A;  1A1G A;  2GS8 A;  2PNZ B;  4FW7 A;  2JEB A;  4IZJ A;  4Q28 A;  2EPP A;  3MHH C;  5C0X B;  1IQS A;  1IQO A;  2V34 A;  2J7J A;  2C38 A;  3B8H A;  2A2C A;  1N34 E;  2DLQ A;  1RC7 A;  3H09 A;  1HNW E;  1JK1 A;  1Z5B A;  2YSO A;  4WFT A;  2O3Z A;  1U2R A;  2LTS A;  2DRP A;  2WW4 A;  3WU6 A;  5FWK A;  4DV5 I;  1A1I A;  1ELO A;  2GO4 A;  4BA2 A;  1NHI A;  1J5E I;  1AH5 A;  4JI1 I;  4R2A A;  2A25 A;  2PO2 A;  4F9A B;  3QT5 A;  4WXD A;  4B3R E;  3H1C A;  4GKJ I;  2YRH A;  3M85 G;  3LTO A;  2LJP A;  2L2N A;  1UIL A;  1MX0 A;  2YPN A;  2JEB B;  4IZJ B;  5JEA B;  5C0X A;  2Z5E A;  3GLL A;  1ZBT A;  3M85 D;  4M0V A;  1N33 I;  2UUC E;  1EA6 A;  1OYP A;  3K17 A;  2B7T A;  2ELY A;  2EOJ A;  3EPH A;  4LFA I;  1FWL A;  4NHR A;  4DPX A;  4DUY E;  2EOO A;  4NXM E;  5DNL A;  2ZM6 I;  2NUF A;  2IES A;  4DPY A;  3NZK A;  1VIS A;  4JI7 I;  5EKW A;  3P1X A;  4K0K I;  1FWK A;  1N3G A;  2LTR A;  2YWQ A;  4IJD A;  1T4L B;  4BHB A;  4LF7 E;  2IHR 1;  1MG7 A;  4DR1 I;  2EM2 A;  2EM7 A;  2EM6 A;  2ODR C;  2NN6 B;  3M99 B;  4UT4 A;  5IV8 B;  1T4O A;  2YTE A;  4X62 I;  2N3G A;  4R2D A;  3KZZ A;  4ZVI A;  1DI2 A;  1T39 A;  2WNR B;  4PRV A;  2E5L I;  1L4S A;  1XHK A;  2PNZ A;  3Q6N A;  4DV2 E;  2LUP B;  2MDR A;  2NAB A;  4X62 E;  1A1J A;  4JI6 I;  2EJ4 A;  2J7K A;  2V8P A;  3T1Y I;  1EH8 A;  4X65 I;  4P7A A;  2UXD E;  2E5L E;  4F9C B;  2WBU A;  1XMQ E;  2D9H A;  1Z5C A;  1N32 I;  2ZIT A;  3J7A G;  4IZJ D;  2NN6 A;  1X6E A;  3IWD A;  2O1W A;  3THO B;  2EN3 A;  1X3C A;  5KL6 A;  3PYE A;  4ISA A;  2BBG A;  4R2P A;  4MYT A;  4DU8 A;  1BKN A;  1DAR A;  4AM3 A;  2RTX A;  5F3W A;  3PS1 A;  5KL2 A;  4R1F A;  3HPS A;  4LF7 I;  1FI4 A;  2EN2 A;  2F4V I;  2V85 A;  2RSM A;  2YT4 A;  1H74 A;  3CDJ A;  4IS9 A;  1XNQ I;  5DRR A;  4IFD E;  4IFD A;  2EPR A;  4HYM A;  1QU6 A;  1Z0C A;  1K47 A;  3OTO I;  4M9V C;  4JI0 E;  2UXB I;  2MKD A;  4KZS A;  1E3H A;  1HR0 I;  2EML A;  1YSA C;  4OOG C;  3B4T A;  1XMO I;  2LRS A;  2EWL A;  2EMK A;  2EPN A;  2L6M A;  1KIJ A;  4LF4 I;  4USM A;  4BA1 A;  2FTX B;  4P7D A;  2HFU A;  5A6B A;  2UUC I;  2EM0 A;  1Y5Y A;  1HNZ E;  1GZ6 A;  3J81 C;  1A1H A;  3P3C A;  2EOI A;  2V87 A;  2YTD A;  3BID A;  4FW4 A;  2EPK X;  2YSP A;  4L8N A;  1Z0G A;  1YYW A;  1R6L A;  2PO0 A;  4LF6 E;  4O4K A;  2EQ1 A;  4LF8 E;  4TUG A;  2ENA A;  2PNM A;  3J7A M;  5ELW A;  2E72 A;  3C4T A;  3ADJ A;  3ZOQ B;  1N36 E;  3L7Z B;  1SR9 A;  4O24 A;  1ZM2 A;  1QZR A;  2V2Z A;  3UK3 C;  4NXN E;  2Z5C A;  3VYY A;  4MU0 A;  4QNK A;  4HAC A;  2PO0 B;  2DEJ A;  4LCF A;  1N34 I;  2MC6 A;  4X9J A;  2HKJ A;  2LV2 A;  4NXN I;  2EPO A;  3U1K A;  1STU A;  5C0X D;  5K36 D;  1G2D C;  2BR2 B;  2L3J A;  2EOZ A;  3BGH A;  4M1K A;  3K6Q A;  3ZZU A;  2VE7 C;  1DQ3 A;  4M30 A;  4LOM A;  5JEA F;  1A6F A;  1BBG A;  2YZT A;  2O1V A;  4DR4 I;  3IWC A;  2VQF I;  4DUZ E;  5IT9 Q;  2NN6 D;  1Y4S A;  4LF6 I;  1N36 I;  1ZM4 A;  1UBD C;  2HKE A;  2J65 A;  3HQ1 A;  3P06 A;  4WUC A;  2JE6 B;  2NN6 E;  2BR2 A;  2EMY A;  2GHF A;  2KON A;  2UUB E;  4JYA E;  1H73 A;  2R3V A;  4DPT A;  5A2Q Q;  2BM0 A;  2RPC A;  5KL4 A;  2EMG A;  4F6N A;  1DGC A;  3C4B A;  3VHT B;  2I9I A;  4AIM A;  4WX9 A;  2EM8 A;  3J80 Q;  1XMQ I;  2RQL A;  4X66 I;  2ZBK B;  4FK5 C;  5JEA D;  2EN8 A;  2YU5 A;  2EE8 A;  4KQV A;  5JEA C;  2O1T A;  3K1J A;  5KL3 A;  2JWO A;  4BC7 A;  3VK6 A;  4DV2 I;  2F8B A;  2K4V A;  2EMI A;  3JTZ A;  4L5N C;  2X7I A;  4KHP E;  1IBM I;  2JY9 A;  1USU A;  1RMD A;  1USV A;  3B78 A;  4O5G A;  4FWD A;  1N32 E;  2F1D A;  2BV3 A;  5LL6 R;  3QT8 A;  1FJG E;  2KHX A;  2DSY A;  1FKA E;  3T1Y E;  1BB8 A;  2ENH A;  2EL4 A;  1UDQ A;  3OML A;  3K85 A;  5A6K A;  1ZM3 A;  4MDT A;  2L92 A;  1EI1 A;  1EH7 A;  2YTJ A;  2BA0 G;  3ZM7 A;  5C0X E;  2EMF A;  3ADI A;  2DLK A;  4F54 A;  2BA0 D;  5IWA I;  1Y6Z A;  1ZXN A;  4LCG A;  5LMN I;  2JEA B;  2N8X A;  3THN A;  2NN6 F;  4AQY E;  1WHQ A;  4LF5 E;  5DRO A;  4U3B A;  1UDN A;  2V83 A;  2NA2 A;  5BR8 E;  3OTO E;  5GMD A;  3MSW A;  1X6F A;  3QG5 C;  1ZXM A;  1D6T A;  4YY3 E;  2JPA A;  1XNQ E;  3KRN A;  1FJG I;  2WP8 A;  2Z5B A;  4DPU A;  1T38 A;  2JXP A;  2LBS B;  4DUZ I;  2X36 A;  3L00 A;  4DV7 I;  2A2D A;  2EM5 A;  2EMW A;  5A6A A;  1P42 A;  3M7N G;  1OYR A;  2PO1 B;  2LUQ A;  2CTD A;  2NUE A;  1N33 E;  1N0U A;  1Z0B A;  1Z59 A;  4MU3 A;  1PJT A;  2B3T B;  4DV6 E;  4FW9 A;  2HHH I;  1TF3 A;  1YYO A;  5BR8 I;  2EOH A;  2YTP A;  4JI6 E;  3WU3 A;  5C0X C;  2EOY A;  4WXC A;  4BS9 A;  1F2I G;  2GO3 A;  4OO1 B;  5K36 C;  1B69 A;  2EOX A;  4DXL A;  3C6M A;  3PYG A;  4IFD D;  2M7Q A;  5GME A;  4MLV A;  2LT7 A;  2CSH A;  4IFD C;  2UUA E;  5EL9 A;  4DR3 E;  2DMI A;  4FN5 A;  4LF9 I;  2EN1 A;  4ZYH A;  2EMH A;  2EPC A;  4DKK A;  5A69 A;  1S16 A;  5AC4 A;  4B3T I;  1PJS A;  2LJU A;  1WXR A;  4X64 E;  2CPN A;  2EZ6 A;  4FW3 A;  3V2U C;  3ZKD A;  1KKH A;  2O1U A;  2EOM A;  2RS6 A;  3JU0 A;  5KL5 A;  3PYD A;  1A1K A;  4JI4 E;  2EQ3 A;  2CGE A;  1S4E A;  4LCH A;  5AE3 A;  4R2R A;  1IBK E;  4DR1 E;  2L8T A;  2EPZ A;  4J8Z A;  4MU1 A;  4YHH I;  4R2Q A;  4DR2 E;  3LLH A;  2C37 B;  1H72 C;  3ADG A;  4HXZ A;  3WU5 A;  4DV4 E;  2EOS A;  1GTK A;  1UN6 B;  1VI7 A;  1ZM9 A;  1AAY A;  3ZKB A;  4HEI A;  2KOU A;  1Y60 A;  2L2K B;  1PKP A;  4DPW A;  2V2V A;  2G7H A;  2EP3 A;  1MEY C;  1NZ0 A;  2DEI A;  3HUL A;  4BA2 B;  4R2S A;  2JOB A;  5K36 E;  2EMX A;  2IOP A;  4OZE A;  1B62 A;  3M6A A;  2UUB I;  4JYA I;  2EPU A;  2UUA I;  1YUJ A;  1A1F A;  4LFC I;  4JI3 E;  1IBL E;  2EM9 A;  4JI8 I;  1MU5 A;  2XEX A;  4OO1 D;  2VQE I;  5A6J A;  4BCA A;  3C6K A;  2GQ0 A;  4OO1 E;  2YTO A;  2EOF A;  1RQ0 A;  3EPJ A;  3ZZT A;  2C39 B;  3MHS C;  3HJC A;  1EKZ A;  4DV0 I;  2MKN A;  4JV5 I;  5JEA A;  1WJP A;  5LMU I;  3DD6 A;  2M9A A;  4DR2 I;  3KZY A;  4IFD F;  2EL5 A;  2LJH A;  4HY1 A;  4QNJ A;  2EPA A;  4YY3 I;  4LFB E;  3Q6M A;  4R8O A;  1HNW I;  2C38 B;  3CWV A;  2JEA A;  4DMI A;  4LTY A;  2PNL A;  2VES A;  4GKK I;  2UXB E;  2JT2 A;  4IZK A;  4JI0 I;  4DR3 I;  2NN6 C;  4AQY I;  2EPX A;  4BC9 A;  2CVE A;  3IWB A;  3TQM A;  4HAC B;  2EMZ A;  2L33 A;  5ADZ A;  1MGT A;  2DMY A;  3PRY A;  2EOE A;  2ODR D;  1HNX I;  2EMB A;  3P3G A;  1Z0W A;  5FLX Q;  1I94 I;  4JV5 E;  4LF5 I;  3U1Y A;  2YTG A;  2LE2 A;  4WSP A;  2WZO A;  4Z7Y A;  4DR5 E;  2V2Q A;  4FWH A;  1X49 A;  5KL7 A;  2PO1 A;  5K36 B;  4LF8 I;  2UXC E;  2ELZ A;  4O43 A;  4N4R B;  1B63 A;  2HK3 A;  4ED4 A;  3CDI A;  2LVH A;  4BBY A;  5LMN E;  4X66 E;  4EMD A;  1NHJ A;  2RSI A;  2FV4 B;  1J5E E;  4ZYG A;  1E3P A;  4IS1 C;  3QT7 A;  2JVA A;  2R42 A;  4URL A;  5AE1 A;  4OO1 F;  2HHH E;  1G2F C;  1H7U A;  2B7V A;  2CT1 A;  4PRX A;  5DNY A;  4NZV A;  2L3C A;  2AJ4 A;  2Z5C B;  4JI2 E;  4LFA E;  2RS7 A;  3B82 A;  1R6M A;  1GQE A;  2VQF E;  4NBQ A;  2ZM6 E;  1YH8 A;  4DV7 E;  4DR7 E;  1Z0T A;  3PS2 A;  3PYF A;  3EPL A;  4LU9 A;  1NEI A;  2V89 A;  2Z5B B;  3F6G A;  2EM4 A;  5AE2 A;  1FNM A;  2HC5 A;  2AE8 A;  4WSG A;  4FW6 A;  4I3H A;  4X64 I;  4F9B B;  2CZ9 A;  1XNR E;  2EQ0 A;  2LMZ A;  1PDA A;  4K0K E;  4DV1 I;  3Q1Q A;  4PU9 A;  4DV5 E;  4N3O A;  4F2J C;  4GEQ B;  4BA1 B;  2C37 A;  4WYQ B;  1J26 A;  4UTG A;  3AV0 A;  2ADR A;  1H7S A;  2EOR A;  4LFB I;  2EMA A;  1Y4U A;  1NCS A;  4OX9 I;  5A2Q C;  2BA1 D;  2LO3 A;  4MLQ A;  2GPI A;  3JAM C;  2GLI A;  4B3S E;  4LF9 E;  2EN7 A;  2R1F A;  4RH8 A;  5CFF E;  2BA1 G;  4WUB A;  4R2C A;  2YTF A; 
#chains in the Genus database with same CATH homology
 2VF3 A;  1YYK A;  4B3M I;  3JAM Q;  3J80 C;  2VQE E;  5IT9 C;  2HFS A;  4DUY I;  1N0V C;  4YHH E;  4R03 A;  1IBL I;  2Q2E B;  4FWG A;  4GKK E;  4JI7 E;  2NPF A;  4DU7 A;  2HK2 A;  1PVG A;  1NHH A;  4JI5 E;  5T6J A;  3ADL A;  4DV3 E;  4XTJ A;  3RMP A;  2H36 X;  4JI3 I;  2JR1 A;  1XMO E;  4LF4 E;  1X48 A;  3DF6 A;  5IWA E;  1UHZ A;  1HR0 E;  3QT6 A;  2UXC I;  5L3J A;  4GKJ E;  4TUI A;  4B3T E;  3J81 Q;  4BMJ A;  3H4L A;  4JI1 E;  1HNZ I;  3KWR A;  3T1H I;  2JOX A;  3AUZ A;  4DV6 I;  2DB2 A;  1IBK I;  4DR5 I;  1XNR I;  1WUU A;  3F6H A;  4DV4 I;  1OJ4 A;  4RPF A;  2E1R A;  4IZK B;  1HNX E;  2V8Q B;  4M2Z A;  4OX9 E;  5FLX C;  2DIX A;  2NUG A;  4Z7C A;  3F0N A;  2BM1 A;  2FGG A;  1ZBQ A;  1RRE A;  4NXM I;  4DV1 E;  3HTX A;  3WU4 A;  3VYX A;  3T1H E;  4X8W A;  4JI2 I;  2V88 A;  2MC5 A;  2IOQ A;  3LNU A;  1WHN A;  1Z5A A;  4MYU A;  1Z0V A;  1YZ9 A;  4B3R I;  3ZZ0 A;  2B9D A;  4X65 E;  1O0W A;  2V86 A;  4LFC E;  2F4V E;  1T4N A;  3LPS A;  1KVK A;  4KHP I;  4DR7 I;  1RR9 A;  2VF1 A;  4I8O A;  3HXL A;  4JG4 A;  4JI4 I;  4DR6 E;  1HK7 A;  4WPY A;  1KTV A;  4JI8 E;  3LML A;  2CG9 A;  3J7Y p;  4WUD A;  4DR4 E;  2UU9 I;  2N3H A;  1IBM E;  2OI2 A;  4DV0 E;  3V5R A;  2UXD I;  2E1M A;  3HPZ A;  1PIE A;  2M1S A;  3DJW A;  2UU9 E;  5AAS A;  1UEK A;  4B3S I;  5LMU E;  4USK A;  4DV3 I;  1Z0E A;  3GON A;  3D4J A;  1X47 A;  1I94 E;  2EFG A;  4B3M E;  3FIG A;  2M4I A;  4P78 A;  4DR6 I;  4JI5 I;  4P52 A;  2L2M A;  2GS8 A;  4IZJ A;  4Q28 A;  2V34 A;  3B8H A;  2A2C A;  1N34 E;  1RC7 A;  3H09 A;  1HNW E;  1Z5B A;  4WFT A;  1U2R A;  2LTS A;  2WW4 A;  3WU6 A;  5FWK A;  4DV5 I;  1ELO A;  1NHI A;  1J5E I;  4JI1 I;  4F9A B;  3QT5 A;  4B3R E;  4GKJ I;  3LTO A;  2LJP A;  2L2N A;  1UIL A;  1MX0 A;  4IZJ B;  2Z5E A;  1ZBT A;  4M0V A;  1N33 I;  2UUC E;  1EA6 A;  3K17 A;  4LFA I;  2B7T A;  1FWL A;  4DPX A;  4DUY E;  4NXM E;  2ZM6 I;  2NUF A;  4DPY A;  1VIS A;  4JI7 I;  3P1X A;  4K0K I;  1FWK A;  2LTR A;  1T4L B;  1MG7 A;  4LF7 E;  2IHR 1;  4DR1 I;  2ODR C;  4UT4 A;  1T4O A;  4X62 I;  2N3G A;  4ZVI A;  1DI2 A;  4PRV A;  2E5L I;  1XHK A;  3Q6N A;  4DV2 E;  2LUP B;  2MDR A;  4X62 E;  4JI6 I;  2J7K A;  2V8P A;  3T1Y I;  4X65 I;  4P7A A;  2UXD E;  2E5L E;  4F9C B;  1XMQ E;  1Z5C A;  1N32 I;  2ZIT A;  3J7A G;  4IZJ D;  3IWD A;  2O1W A;  3PYE A;  4MYT A;  1BKN A;  1DAR A;  2RTX A;  5F3W A;  4R1F A;  3HPS A;  4LF7 I;  1FI4 A;  2F4V I;  2V85 A;  2RSM A;  2YT4 A;  1H74 A;  1XNQ I;  4HYM A;  1QU6 A;  1Z0C A;  1K47 A;  3OTO I;  4JI0 E;  2UXB I;  4KZS A;  1HR0 I;  4OOG C;  1XMO I;  2LRS A;  2EWL A;  4LF4 I;  2L6M A;  1KIJ A;  4USM A;  2FTX B;  4P7D A;  2HFU A;  2UUC I;  1HNZ E;  1GZ6 A;  3J81 C;  2V87 A;  4L8N A;  1Z0G A;  1YYW A;  4LF6 E;  4LF8 E;  4TUG A;  2PNM A;  3J7A M;  3C4T A;  3ADJ A;  3ZOQ B;  1N36 E;  1SR9 A;  1ZM2 A;  1QZR A;  2V2Z A;  4NXN E;  2Z5C A;  3VYY A;  4HAC A;  2DEJ A;  1N34 I;  2MC6 A;  2HKJ A;  4NXN I;  1STU A;  2L3J A;  4M1K A;  3K6Q A;  3ZZU A;  2VE7 C;  1DQ3 A;  4M30 A;  1A6F A;  2YZT A;  2O1V A;  4DR4 I;  3IWC A;  2VQF I;  4DUZ E;  5IT9 Q;  1Y4S A;  4LF6 I;  1N36 I;  1ZM4 A;  2HKE A;  3HQ1 A;  3P06 A;  4WUC A;  2KON A;  2UUB E;  4JYA E;  4DPT A;  5A2Q Q;  1H73 A;  2R3V A;  2BM0 A;  3C4B A;  3J80 Q;  1XMQ I;  4X66 I;  2ZBK B;  4KQV A;  2O1T A;  3K1J A;  2JWO A;  4BC7 A;  3VK6 A;  4DV2 I;  2F8B A;  2K4V A;  3JTZ A;  4L5N C;  2X7I A;  4KHP E;  1IBM I;  2JY9 A;  1USU A;  1USV A;  3B78 A;  4FWD A;  1N32 E;  2BV3 A;  5LL6 R;  3QT8 A;  1FJG E;  2KHX A;  2DSY A;  1FKA E;  3T1Y E;  3OML A;  3K85 A;  1ZM3 A;  2L92 A;  1EI1 A;  3ZM7 A;  3ADI A;  4F54 A;  5IWA I;  1Y6Z A;  1ZXN A;  5LMN I;  4AQY E;  1WHQ A;  4LF5 E;  2V83 A;  2NA2 A;  5BR8 E;  3OTO E;  5GMD A;  3MSW A;  1ZXM A;  1D6T A;  4YY3 E;  1XNQ E;  1FJG I;  2Z5B A;  4DPU A;  2LBS B;  4DUZ I;  2X36 A;  4DV7 I;  2A2D A;  2LUQ A;  2NUE A;  1N33 E;  1N0U A;  1Z0B A;  1Z59 A;  2B3T B;  4DV6 E;  4FW9 A;  2HHH I;  1YYO A;  5BR8 I;  4JI6 E;  3WU3 A;  4BS9 A;  4DXL A;  3PYG A;  2M7Q A;  5GME A;  2UUA E;  4DR3 E;  4FN5 A;  4LF9 I;  4DKK A;  1S16 A;  4B3T I;  1WXR A;  4X64 E;  2CPN A;  2EZ6 A;  3V2U C;  3ZKD A;  1KKH A;  2O1U A;  3JU0 A;  2RS6 A;  3PYD A;  4JI4 E;  2CGE A;  1S4E A;  5AE3 A;  1IBK E;  4DR1 E;  2L8T A;  4YHH I;  4J8Z A;  4DR2 E;  3LLH A;  1H72 C;  3ADG A;  4HXZ A;  3WU5 A;  4DV4 E;  1ZM9 A;  3ZKB A;  4DPW A;  2KOU A;  4DU8 A;  2L2K B;  1PKP A;  2V2V A;  2G7H A;  2DEI A;  1NZ0 A;  3HUL A;  2JOB A;  2IOP A;  1B62 A;  3M6A A;  2UUB I;  4JYA I;  2UUA I;  4LFC I;  4JI3 E;  1IBL E;  4JI8 I;  1MU5 A;  2XEX A;  2VQE I;  4BCA A;  2GQ0 A;  1RQ0 A;  3ZZT A;  3HJC A;  4DV0 I;  1EKZ A;  4JV5 I;  5LMU I;  4DR2 I;  2LJH A;  4HY1 A;  4YY3 I;  4LFB E;  3Q6M A;  4R8O A;  1HNW I;  3CWV A;  4DMI A;  4LTY A;  2PNL A;  4GKK I;  2UXB E;  4IZK A;  4JI0 I;  4AQY I;  4BC9 A;  4HAC B;  3IWB A;  2L33 A;  5ADZ A;  2DMY A;  3PRY A;  2ODR D;  1HNX I;  1Z0W A;  5FLX Q;  1I94 I;  4JV5 E;  4LF5 I;  2LE2 A;  4WSP A;  2WZO A;  4Z7Y A;  4DR5 E;  2V2Q A;  4FWH A;  1X49 A;  4LF8 I;  2UXC E;  1B63 A;  2HK3 A;  4ED4 A;  4BBY A;  5LMN E;  4X66 E;  4EMD A;  1NHJ A;  2FV4 B;  1J5E E;  3QT7 A;  2JVA A;  2R42 A;  4URL A;  5AE1 A;  2HHH E;  1H7U A;  2B7V A;  4PRX A;  5DNY A;  2L3C A;  2AJ4 A;  2Z5C B;  4JI2 E;  4LFA E;  2RS7 A;  3B82 A;  1GQE A;  2VQF E;  2ZM6 E;  4DV7 E;  4DR7 E;  1Z0T A;  3PYF A;  4LU9 A;  2V89 A;  2Z5B B;  3F6G A;  5AE2 A;  1FNM A;  4I3H A;  4X64 I;  4F9B B;  2CZ9 A;  1XNR E;  2LMZ A;  4K0K E;  4DV1 I;  3Q1Q A;  4PU9 A;  4DV5 E;  4N3O A;  4GEQ B;  4WYQ B;  1J26 A;  4UTG A;  3AV0 A;  1H7S A;  4LFB I;  1Y4U A;  4OX9 I;  5A2Q C;  3JAM C;  4B3S E;  4LF9 E;  4DR3 I;  5CFF E;  4WUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...