3J7AG

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
224
Chain Sequence
KNWVPVTKLGRLVKEGKIVSIEEIYLHSLPIKEYQIIDYFFQPNECSHPLKDDVVKIMPVQKQTRAGQRTRFKAFVAIGDGNGHCGLGVKCAKEVATAIRGAIISAKLSLIPVRRGYWGNKIGDPHTVPMKVSGKCGSVRIRLVPAPRGTQIVGAPTTKKMLNFAGIKDCFSSSCGKTKTKGNFLRAIFNALSKTYGYLTPDLWKVTNFDKSPYEEWSDFLETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 46
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
G PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j7aG01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j7aG02
3F0NA 1UEKA 4JI7I 3K17A 1I94E 5GMDA 4DR5I 3PYFA 4JYAI 4NXNI 2DEIA 2UUBI 4DV3E 1FJGE 4DU7A 1MX0A 2V2VA 4DV7E 3J7AM 4X65E 5BR8E 1KIJA 1B62A 2X36A 1XNQE 1PKPA 1ZM9A 3B82A 1XMQE 1IBMI 2UXBI 4DV2I 4FWHA 2X7IA 1IBKI 5LMUE 4LF9I 1S4EA 4DV4E 3M6AA 4LFCI 5A2QQ 1H73A 4P7AA 2ZM6I 4JI1I 2HHHE 1FNMA 4JI2E 4LF8I 2DEJA 2BM1A 4DR6I 5IWAI 1Z5AA 4X62E 4AQYI 4JI7E 1KVKA 4DR5E 3PYDA 4DPYA 4JYAE 3Q1QA 4HYMA 4DR3I 4NXNE 2UUBE 4WUBA 4PRVA 1ZXMA 4DPWA 1N33I 2EFGA 1IBME 2UXBE 4DV2E 1D6TA 1IBKE 4LF9E 3J81Q 4GKKI 1S16A 2LJPA 4WUCA 3PYGA 3ZM7A 4LFCE 2ZM6E 4JI1E 3J81C 2UUCI 4YHHI 4LF8E 1H7UA 4X66I 5IT9C 1HNZI 4DR6E 1H72C 5IWAE 1FKAE 2Q2EB 2V2ZA 4AQYE 4X65I 3WU4A 4B3SI 3PYEA 1ZXNA 3B8HA 2VQFI 3WU5A 4DR3E 4B3MI 4KQVA 3OTOI 2CZ9A 4YY3I 1MG7A 1ELOA 4DR2I 1N33E 2HKEA 4DXLA 4K0KI 2HKJA 3LNUA 4LF5I 4DUZI 4GKKE 4X62I 4FWDA 4URLA 2UUCE 4YHHE 1NHJA 3QT5A 1Z0WA 4X66E 1HNZE 1DARA 5GMEA 2A2CA 3B78A 4JI3I 4JI5I 4B3SE 2ZBKB 2VQFE 4JI8I 4LF7I 1XHKA 4Z7CA 4B3ME 3OTOE 2OI2A 4UTGA 1XMOI 4YY3E 4DR7I 4DR2E 1B63A 1Z5BA 1Z0BA 4K0KE 4LF5E 4DUZE 1KKHA 2E5LE 4X64I 1Z5CA 3QT7A 4LFBI 4DV5I 2VQEI 4JV5I 4B3RI 4JI6I 1Z0TA 4FW9A 4UT4A 4P52A 4NXMI 4GKJI 3QT8A 4JI3E 4EMDA 4JI5E 1BKNA 4DUYI 4DR4I 4JI8E 4LF7E 1ZM3A 1IBLI 5IT9Q 2HK3A 1N0UA 3WU6A 1XMOE 4DR7E 1VISA 5LMNI 4DV1I 2HK2A 1QZRA 4DV6I 1N32I 4R1FA 4X64E 1U2RA 1MU5A 4MYUA 2BM0A 2AJ4A 4LFBE 4DV5E 1ZM2A 2VQEE 4DPXA 4JV5E 1Z0EA 4B3RE 4JI6E 2E1RA 1N34I 1Z0GA 2V8PA 2V2QA 2WW4A 4NXME 4GKJE 5LL6R 4DV0I 3JAMC 1J5EI 4DUYE 4DR4E 1NZ0A 4DPUA 4OX9I 2E5LI 2F4VI 1IBLE 4WUDA 1OJ4A 3T1HI 4USKA 4JI4I 2R42A 4XTJA 3LTOA 3J80C 4HY1A 2NPFA 5LMNE 4DV1E 2UXCI 1H7SA 1HNWI 4DV6E 1N32E 4HACA 4DU8A 1EI1A 1FI4A 3V2UC 4M1KA 4I3HA 5FLXC 1N0VC 2J7KA 2HFSA 1Z59A 1EA6A 1XNRI 1N34E 1K47A 2BV3A 3ZZ0A 2UUAI 3ZZUA 4DV0E 1J5EE 1A6FA 4LF6E 4KHPI 4OX9E 2V34A 2F4VE 1RREA 3T1HE 4ZVIA 4JI4E 4Z7YA 1NHIA 4HXZA 4PRXA 3ZKBA 2UXCE 4LF4I 3HULA 1FWKA 4DPTA 5A2QC 3T1YI 4LFAI 1HNWE 1NHHA 1HR0I 3K1JA 1RR9A 1H74A 1ZM4A 4DR1I 1N36I 1WUUA 1XNRE 2UXDI 2A2DA 4RPFA 1PIEA 4FN5A 1Z0CA 2UUAE 1Z0VA 2UU9I 4JI0I 2R3VA 3H4LA 4B3TI 4KHPE 4FWGA 1HNXI 4JG4A 2ZITA 2XEXA 4USMA 1I94I 3ZKDA 2GS8A 3GONA 4LF4E 3T1YE 4LFAE 3J7AG 4ED4A 3JAMQ 1HR0E 4MYTA 3WU3A 3QT6A 4DV3I 1FJGI 4DV7I 5BR8I 4DR1E 4LF6I 1FWLA 1N36E 1XNQI 1KTVA 2HFUA 2UXDE 1XMQI 5L3JA 3J80Q 3D4JA 5LMUI 4DV4I 2UU9E 4JI0E 3V5RA 2HHHI 1PVGA 3LPSA 2VF3A 4B3TE 4JI2I 4HACB 5FLXQ 4PU9A 1HNXE 3CWVA 3ZZTA
chains in the Genus database with same CATH superfamily
2EOEA 3F0NA 4AIMA 5DROA 2NN6A 1WXRA 2WP8B 5JEAC 1BBGA 5A6AA 5JEAE 1UEKA 3JU0A 4JI7I 1SFEA 3K17A 4BC7A 3ADJA 1I94E 2Z5BB 2LRSA 5GMDA 4DR5I 2F1DA 3ADGA 4P7DA 3PYFA 1YYOA 5C0XA 1PDAA 4JYAI 1NCSA 2B9DA 4R2SA 2JVAA 2WBTA 1ZR9A 2C39B 2YTDA 4OO1B 4NXNI 2DEIA 3QG5C 4RH8A 2EL5A 3KZYA 3VYXA 2UUBI 3U1KA 2EMAA 4DV3E 3CDJA 1FJGE 3VYYA 3MHHC 4DU7A 3BBGA 1MX0A 4DV7E 2V2VA 4NHRA 4BBYA 3J7AM 4X65E 2EMLA 2YRMA 2LVHA 3F6HA 4HEIA 2DSYA 5BR8E 1B62A 1KIJA 2X36A 1XNQE 2EN1A 1PKPA 5DNXA 1ZM9A 3B82A 2Z5CB 1YFHA 1YH8A 5AE2A 2EMFA 1XMQE 2Z5EA 5ELWA 4DV2I 4FWHA 2X7IA 2EMYA 1IBMI 2UXBI 2JT2A 1RQ0A 2EPAA 4LTYA 1IBKI 5LMUE 4LF9I 2A25A 3HJCA 4QNJA 5K36A 1S4EA 4DV4E 2GHFA 3M6AA 2PO1A 4LFCI 5A2QQ 1H73A 4O43A 4P7AA 2ZM6I 5A69A 1R6LA 4JI1I 2EOSA 4R2RA 3ADLA 2GPIA 2HHHE 2EM8A 2PNZB 4IFDE 2RS7A 4JI2E 1FNMA 4RHBB 2L2MA 1UILA 4LF8I 2DEJA 3VK6A 3EPLA 3AUZA 2JEAA 1TN9A 3OMLA 4U3DA 2BM1A 3THOB 4DR6I 1AH5A 2NN6D 5IWAI 2YTJA 2LTRA 1Z5AA 2V83A 4X62E 2C38A 2I9IA 2EOMA 4AQYI 4JI7E 4IZKB 4BHBA 2EQ1A 2EPNA 1KVKA 4WSPA 1YPNA 4DR5E 3PYDA 1A1LA 2E72A 4DPYA 2YTQA 4JYAE 3Q1QA 4BA1B 2EN2A 4HYMA 4OO1C 2JR1A 2YTNA 4LU9A 4DR3I 4KZSA 1STUA 2EPCA 4F9BB 4NXNE 2JYAA 1O0WA 1T38A 2UUBE 2EPMX 3P76A 4M2ZA 1X49A 2L3CA 4WUBA 4PRVA 1ZXMA 1NEIA 1YYKA 1USUA 4DPWA 4J8ZA 1N33I 2RSIA 2EFGA 3MHSC 2L33A 1X47A 4DV2E 1IBME 2UXBE 4GQUA 1D6TA 3HPZA 1IBKE 4LF9E 1L4SA 3J81Q 4GKKI 4ZYEA 1S16A 2LJPA 2LV2A 4F9CB 1F2IG 2JP9A 3UK3C 2M7QA 3PYGA 1T39A 4LFCE 4BS9A 1OYRA 4WUCA 3ZM7A 2YTIA 2MKNA 2ZM6E 1ZU1A 4JI1E 4M9VC 2LO3A 1OYPA 2O1TA 3M85G 2M9AA 3P3GA 3J81C 2EMGA 1A1KA 5DRQA 2UUCI 4YHHI 1DQ3A 2EL6A 4LF8E 2CGEA 1H7UA 1OYSA 4X66I 5IT9C 2R1FA 1HNZI 5K36F 2V89A 4DR6E 2FTXB 1H72C 3PS2A 1BB8A 2EN3A 5IWAE 4R8OA 1FKAE 2Q2EB 2V2ZA 4AQYE 1AAYA 2L92A 4X65I 2ODRC 4IS1C 2N3HA 2EMIA 3KRNA 1EH7A 2DMYA 3C4TA 3C6KA 3FIGA 3C6MA 3M99B 2EOZA 2YWQA 4M30A 1R6MA 3WU4A 3PYEA 4B3SI 1ZXNA 1UDNA 3B8HA 3RMPA 2VQFI 1T4OA 2C37A 2MDRA 2EMCA 2EOIA 3WU5A 3JTZA 2V86A 2EPUA 2YRHA 4DR3E 1LLMC 4B3MI 4KQVA 4WSGA 2BR2A 3OTOI 1YHCA 4OKGA 2WCC3 2JEBB 4MU4A 2CZ9A 2K7IA 2EPXA 5AE3A 1EH6A 4IFDC 4KWYA 4YY3I 1MG7A 1ELOA 2N8XA 1N33E 4DR2I 2HKEA 4DXLA 4R2DA 3KZZA 4F54A 2NN6B 2HKJA 4K0KI 2EM2A 2ELZA 3LNUA 4LF5I 4DUZI 2EPOA 1EH8A 1XXEA 4GKKE 2DB2A 4X62I 5EL9A 2J65A 4WX9A 4ISAA 2CSHA 4MLVA 4OZEA 4FWDA 3J7Yp 5AC4A 4URLA 3H1CA 2EPLX 4F2JC 2UUCE 3GLLA 1ZAAC 3EQ1A 4YHHE 2JOXA 1NHJA 1Y6ZA 1E3PA 4BMJA 3QT5A 2CPNA 5DRPA 4X66E 1Z0WA 1HNZE 1UHZA 1G2FC 1DARA 5GMEA 4O5GA 2A2CA 4R2EA 2JE6A 4ZYDA 2EMWA 4MU0A 2EJ4A 3B78A 2V8QB 2PO2A 2ENCA 4M0VA 2NUFA 4JI3I 3ZOQB 4JI5I 2EM0A 4B3SE 1TF6A 2N3GA 2ZBKB 3NZKA 2VQFE 3M85D 1Z1BA 1G2DC 2EN8A 4DMIA 5AE1A 4JI8I 4LF7I 1WJPA 2PO1B 1IQSA 3P1XA 4B3ME 1XHKA 5DRRA 4Z7CA 3OTOE 2BA1G 2OI2A 2EOXA 1YYWA 4TUGA 4L8NA 4ZYHA 4U3BA 1B69A 4UTGA 1ZBTA 3EPHA 1UBDC 1XMOI 4YY3E 2R76A 3F6GA 4DR7I 5JEAF 4DR2E 1B63A 1Z5BA 1Z0BA 5A6KA 1IMUA 2NN6C 2L2KB 4K0KE 2NN6E 4LF5E 4DUZE 2C38B 2IERA 5IV8B 5KL5A 1KKHA 2E5LE 2YU5A 2ENHA 4IZJA 2DRPA 4FW6A 4X64I 2WNRA 3L00A 1GQEA 1Z5CA 2MC6A 2EOHA 2EORA 4NZVA 1YUJA 4Q28A 3QT7A 1YSAC 1UN6B 3HPSA 4LFBI 4DV5I 5C0XD 2RQLA 2VQEI 4JV5I 1X6HA 2JWOA 4B3RI 4FW5A 1MGTA 1MEYC 2NABA 4OO1E 1P47A 4JI6I 1Z0TA 4FW9A 3M7NG 4HTGA 4UT4A 1Y4UA 4LCHA 2L3JA 4P52A 2EM4A 2LUQA 4R2AA 4NXMI 4GKJI 3QT8A 4MU1A 4JI3E 2EZ6A 3MSWA 2EOOA 4JI5E 4J3DA 4EMDA 1BKNA 2EM6A 2NA2A 4IFDF 4DUYI 4DR4I 3IWBA 2EQ0A 4JI8E 4LF7E 2YTOA 1ZM3A 3HKMA 5K36D 1IBLI 2CG9A 2RPCA 2B7VA 4IJDA 3L7ZB 5IT9Q 2HK3A 1N0UA 3WU6A 1XMOE 3LMLA 4DR7E 2WZOA 4BC9A 2M1SA 4R2PA 1VISA 1KYQA 2CVEA 4LPFA 2FGGA 5LMNI 4DV1I 2HK2A 2EMBA 2CT1A 1QZRA 4QNKA 4DV6I 1N32I 4FW4A 3IWDA 4IZJD 2PNLA 4R1FA 4X64E 2O1UA 4I8OA 1U2RA 2VESA 2EN7A 1MU5A 4OO1F 4MYUA 2BM0A 4R03A 2AJ4A 4LFBE 2C37B 1A1IA 2GLIA 4DV5E 1T4NA 1ZM2A 5JEAA 5KL3A 2VQEE 4JV5E 4LCFA 4DPXA 2WBUA 1Z0EA 5KL2A 2BR2B 1JK1A 4B3RE 4LOMA 2IHR1 2VF1A 2BBGA 2JOBA 3UHMA 3HTXA 4JI6E 2E1RA 2YTGA 1N34I 2Q8UA 1Z0GA 2PO0A 2YTPA 3DF6A 2GO4A 2V8PA 2V2QA 2WW4A 4NXME 5KL7A 4GKJE 1UDQA 1P42A 2DIXA 2PNMA 5LL6R 2DLQA 2EE8A 5DNYA 4DV0I 3JAMC 4O4KA 1J5EI 1UDOA 4DUYE 2EM5A 2G7HA 4DR4E 1NZ0A 3KWRA 4BA2A 4DPUA 4OX9I 2LMZA 2E5LI 2F4VI 2KHXA 4DKKA 5A6BA 1IBLE 2YRKA 2EMXA 3GCMA 2EP3A 4WUDA 3BIDA 1WRJA 2H36X 1OJ4A 3T1HI 5C0XB 4R2QA 2KOUA 2DGCA 4LCGA 4USKA 3M7ND 1X6FA 2V88A 2LUPB 2R42A 4XTJA 4JI4I 3LTOA 3U1YA 1DGCA 2LJHA 3J80C 2VE7C 2WBSA 4HY1A 2EMZA 2NPFA 5LMNE 2JEBA 4AM3A 2NUGA 4MDTA 1PJSA 4BHCA 1VI7A 4DV1E 2UXCI 1H7SA 3IWCA 4IFDA 1HNWI 5AC5A 1PJTA 2YTEA 4DV6E 1N32E 1X3CA 4HACA 5FWKA 2MKDA 2O3ZA 4DU8A 1EI1A 4WXDA 1FI4A 3V2UC 2F8BA 3K6QA 4M1KA 4I3HA 2V85A 5FLXC 5ADZA 3EPKA 5EKWA 2CTDA 3DJWA 2WP8A 2K4VA 1N0VC 4OOGC 2J7KA 5JEAD 1A1GA 2HFSA 3BF2A 1Z59A 5K36B 3ADIA 2AE8A 2BB8A 4ZYGA 2JXPA 1EA6A 2Z5BA 2O1WA 1XNRI 2EWLA 2RTXA 3C4BA 4IS9A 1N34E 3P3EA 1K47A 4X8WA 2DMIA 1BBOA 2BV3A 3ZZ0A 3AV0A 2LE2A 1A1HA 2C39A 2O1VA 4OO1A 2UUAI 2HC5A 1T4LB 3ZZUA 4DV0E 1A1JA 2JEAB 3ECRA 1TF3A 5A6JA 3Q6NA 5DNLA 2YTFA 1J5EE 2BA0G 2YZTA 2B3TB 2RS6A 4X9JA 4LF6E 1A6FA 4KHPI 2EQ3A 4TUIA 4IZJB 2EN4A 4OX9E 2WNRB 2EMKA 2V34A 2YSPA 3BGHA 5A6BD 2B7TA 5KL4A 3HXLA 2F4VE 1RREA 4FW3A 4F6MA 2Z5CA 2MC5A 3T1HE 5C0XC 4ZVIA 5C0XE 4F9AB 4JI4E 2RSMA 4Z7YA 1NHIA 1QNTA 1EKZA 1GTKA 2YPNA 3Q6MA 2EM3A 1X48A 4HXZA 4PRXA 4WFTA 3ZKBA 2UXCE 4FW7A 4IFDD 2PNZA 2L2NA 2V87A 1YZ9A 3P3CA 3HULA 3H09A 1FWKA 4DPTA 5A2QC 3T1YI 1HNWE 4LF4I 4LFAI 1RMDA 1NHHA 2EPKX 1HR0I 4GEQB 3K1JA 2NUEA 1RR9A 4R2CA 1PJQA 2L6MA 1X5WA 5T6JA 3TQMA 2EOYA 1H74A 1DI2A 1IQOA 1ZM4A 1SR9A 2IESA 2KONA 4O24A 5AASA 5F3WA 4DR1I 5TSEA 1WHNA 1N36I 1RC7A 4IZKA 5K36C 5K36E 1WUUA 2LBSB 2JY9A 1ZBQA 2EN6A 1XNRE 2UXDI 4P78A 2A2DA 3THNA 2FV4B 2NN6F 4RPFA 1PIEA 1KJKA 2EM7A 4BA1A 2EOQA 4FN5A 2MDGA 2YT4A 5LLQA 1Z0CA 2UUAE 1JK2A 4OO1D 2EOJA 1Z0VA 2UU9I 4JI0I 2R3VA 4MU3A 1A1FA 3H4LA 5CFFE 4B3TI 5C0XF 2J7JA 2HGHA 4BCAA 4KHPE 1YUIA 1N3GA 4FWGA 2EMHA 4L5NC 1HNXI 1USVA 4JG4A 3PRYA 4WXCA 2LTSA 4N4RB 1Y5YA 3K85A 2YSOA 4WPYA 2ZITA 1Y4SA 2BA1D 2XEXA 3VHTB 1GZ6A 5JEAB 4MQYA 4USMA 2JPAA 3PS3A 4WYQB 1E3HA 1I94I 3ZKDA 3B4TA 2GS8A 3P06A 3GONA 2ADRA 3L7ZA 1RHYA 2PO0B 2GQ0A 3DD6A 4LF4E 2BA0D 2L8TA 2DLKA 3T1YE 4LFAE 4FK5C 3CDIA 3J7AG 4ED4A 3JAMQ 4Q35B 2D9HA 1HR0E 4MYTA 3PS1A 3QT6A 2M4IA 3WU3A 2VRDA 2LCEA 2EPZA 4DV3I 2IOPA 2ENAA 3LLHA 2EL4A 3GMEA 1FJGI 4DV7I 2LT7A 5BR8I 2GO3A 2EPRA 4DR1E 4BA2B 1Y60A 4LF6I 4AIDA 2EOFA 1FWLA 2YU8A 1N36E 1XNQI 1QU6A 2ODRD 2ELYA 1HK7A 1KTVA 4NBQA 3EPJA 2HFUA 2UXDE 1XMQI 2PRTA 5L3JA 3J80Q 2HJJA 5IXMB 1WHQA 2LJUA 3D4JA 5LMUI 1X6EA 2IOQA 4DV4I 2EM9A 4MLQA 2EPPA 2UU9E 4JI0E 4IFDB 5KL6A 3V5RA 2HHHI 1PVGA 4B3TE 2VF3A 3LPSA 2JE6B 4F6NA 1J26A 4N3OA 4HACB 4JI2I 4GZNC 2E1MA 1UDSA 1HNXE 4PU9A 5FLXQ 2I13A 3HQ1A 2PO2B 3CWVA 3ZZTA
chains in the Genus database with same CATH topology
3F0NA 1WXRA 1UEKA 3JU0A 4JI7I 3K17A 4BC7A 3ADJA 1I94E 2Z5BB 2LRSA 5GMDA 4DR5I 3ADGA 4P7DA 3PYFA 1YYOA 4JYAI 2B9DA 2JVAA 4NXNI 2DEIA 3VYXA 2UUBI 4DV3E 1FJGE 3VYYA 4DU7A 1MX0A 2V2VA 4DV7E 4BBYA 3J7AM 4X65E 5BR8E 3F6HA 2DSYA 1B62A 1KIJA 2X36A 1XNQE 1PKPA 1ZM9A 3B82A 2Z5CB 5AE2A 2Z5EA 1XMQE 1IBMI 2UXBI 4DV2I 4FWHA 2X7IA 1RQ0A 4LTYA 1IBKI 5LMUE 4LF9I 3HJCA 1S4EA 4DV4E 3M6AA 4LFCI 5A2QQ 1H73A 4P7AA 2ZM6I 4JI1I 3ADLA 2HHHE 2RS7A 4JI2E 1FNMA 2L2MA 1UILA 4LF8I 2DEJA 3VK6A 3AUZA 3OMLA 2BM1A 4DR6I 5IWAI 2LTRA 1Z5AA 2V83A 4X62E 4AQYI 4JI7E 4IZKB 1KVKA 4WSPA 4DR5E 3PYDA 4DPYA 4JYAE 3Q1QA 4HYMA 2JR1A 4DR3I 4LU9A 4KZSA 1STUA 4F9BB 4NXNE 1O0WA 2UUBE 4M2ZA 1X49A 2L3CA 4WUBA 4PRVA 1ZXMA 1YYKA 1USUA 4DPWA 4J8ZA 1N33I 2EFGA 1IBME 2L33A 1X47A 4DV2E 2UXBE 1D6TA 3HPZA 1IBKE 4LF9E 3J81Q 4GKKI 1S16A 2LJPA 4F9CB 4WUCA 2M7QA 3PYGA 4LFCE 3ZM7A 4BS9A 2ZM6E 4JI1E 2O1TA 3J81C 2UUCI 4YHHI 1DQ3A 4LF8E 2CGEA 1H7UA 4X66I 5IT9C 1HNZI 2V89A 4DR6E 2FTXB 1H72C 5IWAE 4R8OA 1FKAE 2Q2EB 2V2ZA 4AQYE 2L92A 4X65I 2ODRC 2N3HA 2DMYA 3C4TA 3FIGA 4M30A 3WU4A 4B3SI 3PYEA 1ZXNA 3B8HA 3RMPA 2VQFI 1T4OA 2MDRA 3WU5A 3JTZA 2V86A 4DR3E 4B3MI 4KQVA 3OTOI 2CZ9A 5AE3A 4YY3I 1MG7A 1ELOA 1N33E 4DR2I 2HKEA 4DXLA 4F54A 4K0KI 2HKJA 3LNUA 4LF5I 4DUZI 4GKKE 2DB2A 4X62I 4FWDA 3J7Yp 4URLA 2UUCE 4YHHE 2JOXA 1NHJA 1Y6ZA 4BMJA 3QT5A 2CPNA 4X66E 1Z0WA 1HNZE 1UHZA 1DARA 5GMEA 2A2CA 3B78A 2V8QB 4M0VA 2NUFA 4JI3I 3ZOQB 4JI5I 4B3SE 2N3GA 2ZBKB 2VQFE 4DMIA 5AE1A 4JI8I 4LF7I 3P1XA 4B3ME 1XHKA 4Z7CA 3OTOE 2OI2A 1YYWA 4TUGA 4L8NA 4UTGA 1ZBTA 1XMOI 4YY3E 4DR7I 3F6GA 4DR2E 1B63A 1Z5BA 1Z0BA 2L2KB 4K0KE 4LF5E 4DUZE 1KKHA 2E5LE 4IZJA 4X64I 1GQEA 1Z5CA 2MC6A 4Q28A 3QT7A 4LFBI 3HPSA 4DV5I 2VQEI 4JV5I 2JWOA 4B3RI 4JI6I 1Z0TA 4FW9A 4UT4A 1Y4UA 2L3JA 4P52A 2LUQA 4NXMI 4GKJI 3QT8A 2EZ6A 4JI3E 3MSWA 4EMDA 4JI5E 1BKNA 2NA2A 4DUYI 4DR4I 3IWBA 4JI8E 4LF7E 1ZM3A 1IBLI 2CG9A 2B7VA 5IT9Q 2HK3A 1N0UA 3WU6A 1XMOE 3LMLA 4DR7E 2WZOA 4BC9A 2M1SA 1VISA 2FGGA 5LMNI 4DV1I 2HK2A 1QZRA 4DV6I 1N32I 3IWDA 4IZJD 2PNLA 4R1FA 4X64E 2O1UA 4I8OA 1U2RA 1MU5A 4MYUA 2BM0A 4R03A 2AJ4A 4LFBE 4DV5E 1T4NA 1ZM2A 2VQEE 4JV5E 4DPXA 1Z0EA 4B3RE 2IHR1 2VF1A 2JOBA 3HTXA 4JI6E 2E1RA 1N34I 1Z0GA 3DF6A 2V8PA 2V2QA 2WW4A 4NXME 4GKJE 2DIXA 2PNMA 5LL6R 4DV0I 5DNYA 3JAMC 1J5EI 4DUYE 2G7HA 4DR4E 1NZ0A 3KWRA 4DPUA 4OX9I 2LMZA 2E5LI 2F4VI 2KHXA 4DKKA 1IBLE 4WUDA 2H36X 1OJ4A 3T1HI 4USKA 2KOUA 2LUPB 2V88A 2R42A 4XTJA 4JI4I 3LTOA 2LJHA 3J80C 2VE7C 4HY1A 2NPFA 5LMNE 2NUGA 4DV1E 2UXCI 1H7SA 3IWCA 1HNWI 4DV6E 1N32E 4HACA 5FWKA 4DU8A 1EI1A 1FI4A 3V2UC 2F8BA 3K6QA 4M1KA 4I3HA 2V85A 5FLXC 5ADZA 3DJWA 2K4VA 1N0VC 4OOGC 2J7KA 2HFSA 1Z59A 3ADIA 2Z5BA 1EA6A 2O1WA 1XNRI 2EWLA 2RTXA 3C4BA 1N34E 1K47A 4X8WA 2BV3A 3ZZ0A 3AV0A 2LE2A 2O1VA 2UUAI 1T4LB 3ZZUA 4DV0E 3Q6NA 1J5EE 2YZTA 2B3TB 4LF6E 2RS6A 1A6FA 4KHPI 4TUIA 4IZJB 4OX9E 2V34A 2F4VE 1RREA 2B7TA 3HXLA 2Z5CA 2MC5A 3T1HE 4ZVIA 4F9AB 4JI4E 2RSMA 4Z7YA 1NHIA 1EKZA 3Q6MA 1X48A 4HXZA 4PRXA 4WFTA 3ZKBA 2UXCE 2L2NA 2V87A 1YZ9A 4LF4I 3HULA 3H09A 1FWKA 4DPTA 5A2QC 3T1YI 1HNWE 4LFAI 1NHHA 1HR0I 4GEQB 3K1JA 2NUEA 1RR9A 2L6MA 5T6JA 1H74A 1DI2A 1ZM4A 1SR9A 2KONA 5F3WA 5AASA 4DR1I 1WHNA 1N36I 1RC7A 4IZKA 1WUUA 2LBSB 2JY9A 1ZBQA 1XNRE 2UXDI 4P78A 2A2DA 2FV4B 4RPFA 1PIEA 4FN5A 2YT4A 1Z0CA 2UUAE 1Z0VA 2UU9I 4JI0I 2R3VA 3H4LA 5CFFE 4B3TI 4BCAA 4KHPE 4FWGA 4L5NC 1HNXI 1USVA 4JG4A 3PRYA 2LTSA 3K85A 4WPYA 2ZITA 1Y4SA 2XEXA 1GZ6A 4USMA 4WYQB 1I94I 3ZKDA 2GS8A 3P06A 3GONA 2GQ0A 4LF4E 2L8TA 3T1YE 4LFAE 3J7AG 4ED4A 3JAMQ 1HR0E 4MYTA 3WU3A 3QT6A 2M4IA 4DV3I 2IOPA 3LLHA 1FJGI 4DV7I 5BR8I 4DR1E 4LF6I 1FWLA 1N36E 1XNQI 1QU6A 2ODRD 1KTVA 1HK7A 2HFUA 2UXDE 1XMQI 5L3JA 3J80Q 1WHQA 3D4JA 5LMUI 2IOQA 4DV4I 2UU9E 4JI0E 3V5RA 2HHHI 1PVGA 4B3TE 2VF3A 3LPSA 4N3OA 1J26A 4JI2I 4HACB 2E1MA 5FLXQ 1HNXE 4PU9A 3HQ1A 3CWVA 3ZZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0N A;  1UEK A;  4JI7 I;  3K17 A;  1I94 E;  5GMD A;  4DR5 I;  3PYF A;  4JYA I;  4NXN I;  2DEI A;  2UUB I;  4DV3 E;  1FJG E;  4DU7 A;  1MX0 A;  2V2V A;  4DV7 E;  3J7A M;  4X65 E;  5BR8 E;  1KIJ A;  1B62 A;  2X36 A;  1XNQ E;  1PKP A;  1ZM9 A;  3B82 A;  1XMQ E;  1IBM I;  2UXB I;  4DV2 I;  4FWH A;  2X7I A;  1IBK I;  5LMU E;  4LF9 I;  1S4E A;  4DV4 E;  3M6A A;  4LFC I;  5A2Q Q;  1H73 A;  4P7A A;  2ZM6 I;  4JI1 I;  2HHH E;  1FNM A;  4JI2 E;  4LF8 I;  2DEJ A;  2BM1 A;  4DR6 I;  5IWA I;  1Z5A A;  4X62 E;  4AQY I;  4JI7 E;  1KVK A;  4DR5 E;  3PYD A;  4DPY A;  4JYA E;  3Q1Q A;  4HYM A;  4DR3 I;  4NXN E;  2UUB E;  4WUB A;  4PRV A;  1ZXM A;  4DPW A;  1N33 I;  2EFG A;  1IBM E;  2UXB E;  4DV2 E;  1D6T A;  1IBK E;  4LF9 E;  3J81 Q;  4GKK I;  1S16 A;  2LJP A;  4WUC A;  3PYG A;  3ZM7 A;  4LFC E;  2ZM6 E;  4JI1 E;  3J81 C;  2UUC I;  4YHH I;  4LF8 E;  1H7U A;  4X66 I;  5IT9 C;  1HNZ I;  4DR6 E;  1H72 C;  5IWA E;  1FKA E;  2Q2E B;  2V2Z A;  4AQY E;  4X65 I;  3WU4 A;  4B3S I;  3PYE A;  1ZXN A;  3B8H A;  2VQF I;  3WU5 A;  4DR3 E;  4B3M I;  4KQV A;  3OTO I;  2CZ9 A;  4YY3 I;  1MG7 A;  1ELO A;  4DR2 I;  1N33 E;  2HKE A;  4DXL A;  4K0K I;  2HKJ A;  3LNU A;  4LF5 I;  4DUZ I;  4GKK E;  4X62 I;  4FWD A;  4URL A;  2UUC E;  4YHH E;  1NHJ A;  3QT5 A;  1Z0W A;  4X66 E;  1HNZ E;  1DAR A;  5GME A;  2A2C A;  3B78 A;  4JI3 I;  4JI5 I;  4B3S E;  2ZBK B;  2VQF E;  4JI8 I;  4LF7 I;  1XHK A;  4Z7C A;  4B3M E;  3OTO E;  2OI2 A;  4UTG A;  1XMO I;  4YY3 E;  4DR7 I;  4DR2 E;  1B63 A;  1Z5B A;  1Z0B A;  4K0K E;  4LF5 E;  4DUZ E;  1KKH A;  2E5L E;  4X64 I;  1Z5C A;  3QT7 A;  4LFB I;  4DV5 I;  2VQE I;  4JV5 I;  4B3R I;  4JI6 I;  1Z0T A;  4FW9 A;  4UT4 A;  4P52 A;  4NXM I;  4GKJ I;  3QT8 A;  4JI3 E;  4EMD A;  4JI5 E;  1BKN A;  4DUY I;  4DR4 I;  4JI8 E;  4LF7 E;  1ZM3 A;  1IBL I;  5IT9 Q;  2HK3 A;  1N0U A;  3WU6 A;  1XMO E;  4DR7 E;  1VIS A;  5LMN I;  4DV1 I;  2HK2 A;  1QZR A;  4DV6 I;  1N32 I;  4R1F A;  4X64 E;  1U2R A;  1MU5 A;  4MYU A;  2BM0 A;  2AJ4 A;  4LFB E;  4DV5 E;  1ZM2 A;  2VQE E;  4DPX A;  4JV5 E;  1Z0E A;  4B3R E;  4JI6 E;  2E1R A;  1N34 I;  1Z0G A;  2V8P A;  2V2Q A;  2WW4 A;  4NXM E;  4GKJ E;  5LL6 R;  4DV0 I;  3JAM C;  1J5E I;  4DUY E;  4DR4 E;  1NZ0 A;  4DPU A;  4OX9 I;  2E5L I;  2F4V I;  1IBL E;  4WUD A;  1OJ4 A;  3T1H I;  4USK A;  4JI4 I;  2R42 A;  4XTJ A;  3LTO A;  3J80 C;  4HY1 A;  2NPF A;  5LMN E;  4DV1 E;  2UXC I;  1H7S A;  1HNW I;  4DV6 E;  1N32 E;  4HAC A;  4DU8 A;  1EI1 A;  1FI4 A;  3V2U C;  4M1K A;  4I3H A;  5FLX C;  1N0V C;  2J7K A;  2HFS A;  1Z59 A;  1EA6 A;  1XNR I;  1N34 E;  1K47 A;  2BV3 A;  3ZZ0 A;  2UUA I;  3ZZU A;  4DV0 E;  1J5E E;  1A6F A;  4LF6 E;  4KHP I;  4OX9 E;  2V34 A;  2F4V E;  1RRE A;  3T1H E;  4ZVI A;  4JI4 E;  4Z7Y A;  1NHI A;  4HXZ A;  4PRX A;  3ZKB A;  2UXC E;  4LF4 I;  3HUL A;  1FWK A;  4DPT A;  5A2Q C;  3T1Y I;  4LFA I;  1HNW E;  1NHH A;  1HR0 I;  3K1J A;  1RR9 A;  1H74 A;  1ZM4 A;  4DR1 I;  1N36 I;  1WUU A;  1XNR E;  2UXD I;  2A2D A;  4RPF A;  1PIE A;  4FN5 A;  1Z0C A;  2UUA E;  1Z0V A;  2UU9 I;  4JI0 I;  2R3V A;  3H4L A;  4B3T I;  4KHP E;  4FWG A;  1HNX I;  4JG4 A;  2ZIT A;  2XEX A;  4USM A;  1I94 I;  3ZKD A;  2GS8 A;  3GON A;  4LF4 E;  3T1Y E;  4LFA E;  3J7A G;  4ED4 A;  3JAM Q;  1HR0 E;  4MYT A;  3WU3 A;  3QT6 A;  4DV3 I;  1FJG I;  4DV7 I;  5BR8 I;  4DR1 E;  4LF6 I;  1FWL A;  1N36 E;  1XNQ I;  1KTV A;  2HFU A;  2UXD E;  1XMQ I;  5L3J A;  3J80 Q;  3D4J A;  5LMU I;  4DV4 I;  2UU9 E;  4JI0 E;  3V5R A;  2HHH I;  1PVG A;  3LPS A;  2VF3 A;  4B3T E;  4JI2 I;  4HAC B;  5FLX Q;  4PU9 A;  1HNX E;  3CWV A;  3ZZT A; 
#chains in the Genus database with same CATH topology
 2EOE A;  3F0N A;  4AIM A;  5DRO A;  2NN6 A;  1WXR A;  2WP8 B;  5JEA C;  1BBG A;  5A6A A;  5JEA E;  1UEK A;  3JU0 A;  4JI7 I;  1SFE A;  3K17 A;  4BC7 A;  3ADJ A;  1I94 E;  2Z5B B;  2LRS A;  5GMD A;  4DR5 I;  2F1D A;  3ADG A;  4P7D A;  3PYF A;  1YYO A;  5C0X A;  1PDA A;  4JYA I;  1NCS A;  2B9D A;  4R2S A;  2JVA A;  2WBT A;  1ZR9 A;  2C39 B;  2YTD A;  4OO1 B;  4NXN I;  2DEI A;  3QG5 C;  4RH8 A;  2EL5 A;  3KZY A;  3VYX A;  2UUB I;  3U1K A;  2EMA A;  4DV3 E;  3CDJ A;  1FJG E;  3VYY A;  3MHH C;  4DU7 A;  3BBG A;  1MX0 A;  4DV7 E;  2V2V A;  4NHR A;  4BBY A;  3J7A M;  4X65 E;  2EML A;  2YRM A;  2LVH A;  3F6H A;  4HEI A;  2DSY A;  5BR8 E;  1B62 A;  1KIJ A;  2X36 A;  1XNQ E;  2EN1 A;  1PKP A;  5DNX A;  1ZM9 A;  3B82 A;  2Z5C B;  1YFH A;  1YH8 A;  5AE2 A;  2EMF A;  1XMQ E;  2Z5E A;  5ELW A;  4DV2 I;  4FWH A;  2X7I A;  2EMY A;  1IBM I;  2UXB I;  2JT2 A;  1RQ0 A;  2EPA A;  4LTY A;  1IBK I;  5LMU E;  4LF9 I;  2A25 A;  3HJC A;  4QNJ A;  5K36 A;  1S4E A;  4DV4 E;  2GHF A;  3M6A A;  2PO1 A;  4LFC I;  5A2Q Q;  1H73 A;  4O43 A;  4P7A A;  2ZM6 I;  5A69 A;  1R6L A;  4JI1 I;  2EOS A;  4R2R A;  3ADL A;  2GPI A;  2HHH E;  2EM8 A;  2PNZ B;  4IFD E;  2RS7 A;  4JI2 E;  1FNM A;  4RHB B;  2L2M A;  1UIL A;  4LF8 I;  2DEJ A;  3VK6 A;  3EPL A;  3AUZ A;  2JEA A;  1TN9 A;  3OML A;  4U3D A;  2BM1 A;  3THO B;  4DR6 I;  1AH5 A;  2NN6 D;  5IWA I;  2YTJ A;  2LTR A;  1Z5A A;  2V83 A;  4X62 E;  2C38 A;  2I9I A;  2EOM A;  4AQY I;  4JI7 E;  4IZK B;  4BHB A;  2EQ1 A;  2EPN A;  1KVK A;  4WSP A;  1YPN A;  4DR5 E;  3PYD A;  1A1L A;  2E72 A;  4DPY A;  2YTQ A;  4JYA E;  3Q1Q A;  4BA1 B;  2EN2 A;  4HYM A;  4OO1 C;  2JR1 A;  2YTN A;  4LU9 A;  4DR3 I;  4KZS A;  1STU A;  2EPC A;  4F9B B;  4NXN E;  2JYA A;  1O0W A;  1T38 A;  2UUB E;  2EPM X;  3P76 A;  4M2Z A;  1X49 A;  2L3C A;  4WUB A;  4PRV A;  1ZXM A;  1NEI A;  1YYK A;  1USU A;  4DPW A;  4J8Z A;  1N33 I;  2RSI A;  2EFG A;  3MHS C;  2L33 A;  1X47 A;  4DV2 E;  1IBM E;  2UXB E;  4GQU A;  1D6T A;  3HPZ A;  1IBK E;  4LF9 E;  1L4S A;  3J81 Q;  4GKK I;  4ZYE A;  1S16 A;  2LJP A;  2LV2 A;  4F9C B;  1F2I G;  2JP9 A;  3UK3 C;  2M7Q A;  3PYG A;  1T39 A;  4LFC E;  4BS9 A;  1OYR A;  4WUC A;  3ZM7 A;  2YTI A;  2MKN A;  2ZM6 E;  1ZU1 A;  4JI1 E;  4M9V C;  2LO3 A;  1OYP A;  2O1T A;  3M85 G;  2M9A A;  3P3G A;  3J81 C;  2EMG A;  1A1K A;  5DRQ A;  2UUC I;  4YHH I;  1DQ3 A;  2EL6 A;  4LF8 E;  2CGE A;  1H7U A;  1OYS A;  4X66 I;  5IT9 C;  2R1F A;  1HNZ I;  5K36 F;  2V89 A;  4DR6 E;  2FTX B;  1H72 C;  3PS2 A;  1BB8 A;  2EN3 A;  5IWA E;  4R8O A;  1FKA E;  2Q2E B;  2V2Z A;  4AQY E;  1AAY A;  2L92 A;  4X65 I;  2ODR C;  4IS1 C;  2N3H A;  2EMI A;  3KRN A;  1EH7 A;  2DMY A;  3C4T A;  3C6K A;  3FIG A;  3C6M A;  3M99 B;  2EOZ A;  2YWQ A;  4M30 A;  1R6M A;  3WU4 A;  3PYE A;  4B3S I;  1ZXN A;  1UDN A;  3B8H A;  3RMP A;  2VQF I;  1T4O A;  2C37 A;  2MDR A;  2EMC A;  2EOI A;  3WU5 A;  3JTZ A;  2V86 A;  2EPU A;  2YRH A;  4DR3 E;  1LLM C;  4B3M I;  4KQV A;  4WSG A;  2BR2 A;  3OTO I;  1YHC A;  4OKG A;  2WCC 3;  2JEB B;  4MU4 A;  2CZ9 A;  2K7I A;  2EPX A;  5AE3 A;  1EH6 A;  4IFD C;  4KWY A;  4YY3 I;  1MG7 A;  1ELO A;  2N8X A;  1N33 E;  4DR2 I;  2HKE A;  4DXL A;  4R2D A;  3KZZ A;  4F54 A;  2NN6 B;  2HKJ A;  4K0K I;  2EM2 A;  2ELZ A;  3LNU A;  4LF5 I;  4DUZ I;  2EPO A;  1EH8 A;  1XXE A;  4GKK E;  2DB2 A;  4X62 I;  5EL9 A;  2J65 A;  4WX9 A;  4ISA A;  2CSH A;  4MLV A;  4OZE A;  4FWD A;  3J7Y p;  5AC4 A;  4URL A;  3H1C A;  2EPL X;  4F2J C;  2UUC E;  3GLL A;  1ZAA C;  3EQ1 A;  4YHH E;  2JOX A;  1NHJ A;  1Y6Z A;  1E3P A;  4BMJ A;  3QT5 A;  2CPN A;  5DRP A;  4X66 E;  1Z0W A;  1HNZ E;  1UHZ A;  1G2F C;  1DAR A;  5GME A;  4O5G A;  2A2C A;  4R2E A;  2JE6 A;  4ZYD A;  2EMW A;  4MU0 A;  2EJ4 A;  3B78 A;  2V8Q B;  2PO2 A;  2ENC A;  4M0V A;  2NUF A;  4JI3 I;  3ZOQ B;  4JI5 I;  2EM0 A;  4B3S E;  1TF6 A;  2N3G A;  2ZBK B;  3NZK A;  2VQF E;  3M85 D;  1Z1B A;  1G2D C;  2EN8 A;  4DMI A;  5AE1 A;  4JI8 I;  4LF7 I;  1WJP A;  2PO1 B;  1IQS A;  3P1X A;  4B3M E;  1XHK A;  5DRR A;  4Z7C A;  3OTO E;  2BA1 G;  2OI2 A;  2EOX A;  1YYW A;  4TUG A;  4L8N A;  4ZYH A;  4U3B A;  1B69 A;  4UTG A;  1ZBT A;  3EPH A;  1UBD C;  1XMO I;  4YY3 E;  2R76 A;  3F6G A;  4DR7 I;  5JEA F;  4DR2 E;  1B63 A;  1Z5B A;  1Z0B A;  5A6K A;  1IMU A;  2NN6 C;  2L2K B;  4K0K E;  2NN6 E;  4LF5 E;  4DUZ E;  2C38 B;  2IER A;  5IV8 B;  5KL5 A;  1KKH A;  2E5L E;  2YU5 A;  2ENH A;  4IZJ A;  2DRP A;  4FW6 A;  4X64 I;  2WNR A;  3L00 A;  1GQE A;  1Z5C A;  2MC6 A;  2EOH A;  2EOR A;  4NZV A;  1YUJ A;  4Q28 A;  3QT7 A;  1YSA C;  1UN6 B;  3HPS A;  4LFB I;  4DV5 I;  5C0X D;  2RQL A;  2VQE I;  4JV5 I;  1X6H A;  2JWO A;  4B3R I;  4FW5 A;  1MGT A;  1MEY C;  2NAB A;  4OO1 E;  1P47 A;  4JI6 I;  1Z0T A;  4FW9 A;  3M7N G;  4HTG A;  4UT4 A;  1Y4U A;  4LCH A;  2L3J A;  4P52 A;  2EM4 A;  2LUQ A;  4R2A A;  4NXM I;  4GKJ I;  3QT8 A;  4MU1 A;  4JI3 E;  2EZ6 A;  3MSW A;  2EOO A;  4JI5 E;  4J3D A;  4EMD A;  1BKN A;  2EM6 A;  2NA2 A;  4IFD F;  4DUY I;  4DR4 I;  3IWB A;  2EQ0 A;  4JI8 E;  4LF7 E;  2YTO A;  1ZM3 A;  3HKM A;  5K36 D;  1IBL I;  2CG9 A;  2RPC A;  2B7V A;  4IJD A;  3L7Z B;  5IT9 Q;  2HK3 A;  1N0U A;  3WU6 A;  1XMO E;  3LML A;  4DR7 E;  2WZO A;  4BC9 A;  2M1S A;  4R2P A;  1VIS A;  1KYQ A;  2CVE A;  4LPF A;  2FGG A;  5LMN I;  4DV1 I;  2HK2 A;  2EMB A;  2CT1 A;  1QZR A;  4QNK A;  4DV6 I;  1N32 I;  4FW4 A;  3IWD A;  4IZJ D;  2PNL A;  4R1F A;  4X64 E;  2O1U A;  4I8O A;  1U2R A;  2VES A;  2EN7 A;  1MU5 A;  4OO1 F;  4MYU A;  2BM0 A;  4R03 A;  2AJ4 A;  4LFB E;  2C37 B;  1A1I A;  2GLI A;  4DV5 E;  1T4N A;  1ZM2 A;  5JEA A;  5KL3 A;  2VQE E;  4JV5 E;  4LCF A;  4DPX A;  2WBU A;  1Z0E A;  5KL2 A;  2BR2 B;  1JK1 A;  4B3R E;  4LOM A;  2IHR 1;  2VF1 A;  2BBG A;  2JOB A;  3UHM A;  3HTX A;  4JI6 E;  2E1R A;  2YTG A;  1N34 I;  2Q8U A;  1Z0G A;  2PO0 A;  2YTP A;  3DF6 A;  2GO4 A;  2V8P A;  2V2Q A;  2WW4 A;  4NXM E;  5KL7 A;  4GKJ E;  1UDQ A;  1P42 A;  2DIX A;  2PNM A;  5LL6 R;  2DLQ A;  2EE8 A;  5DNY A;  4DV0 I;  3JAM C;  4O4K A;  1J5E I;  1UDO A;  4DUY E;  2EM5 A;  2G7H A;  4DR4 E;  1NZ0 A;  3KWR A;  4BA2 A;  4DPU A;  4OX9 I;  2LMZ A;  2E5L I;  2F4V I;  2KHX A;  4DKK A;  5A6B A;  1IBL E;  2YRK A;  2EMX A;  3GCM A;  2EP3 A;  4WUD A;  3BID A;  1WRJ A;  2H36 X;  1OJ4 A;  3T1H I;  5C0X B;  4R2Q A;  2KOU A;  2DGC A;  4LCG A;  4USK A;  3M7N D;  1X6F A;  2V88 A;  2LUP B;  2R42 A;  4XTJ A;  4JI4 I;  3LTO A;  3U1Y A;  1DGC A;  2LJH A;  3J80 C;  2VE7 C;  2WBS A;  4HY1 A;  2EMZ A;  2NPF A;  5LMN E;  2JEB A;  4AM3 A;  2NUG A;  4MDT A;  1PJS A;  4BHC A;  1VI7 A;  4DV1 E;  2UXC I;  1H7S A;  3IWC A;  4IFD A;  1HNW I;  5AC5 A;  1PJT A;  2YTE A;  4DV6 E;  1N32 E;  1X3C A;  4HAC A;  5FWK A;  2MKD A;  2O3Z A;  4DU8 A;  1EI1 A;  4WXD A;  1FI4 A;  3V2U C;  2F8B A;  3K6Q A;  4M1K A;  4I3H A;  2V85 A;  5FLX C;  5ADZ A;  3EPK A;  5EKW A;  2CTD A;  3DJW A;  2WP8 A;  2K4V A;  1N0V C;  4OOG C;  2J7K A;  5JEA D;  1A1G A;  2HFS A;  3BF2 A;  1Z59 A;  5K36 B;  3ADI A;  2AE8 A;  2BB8 A;  4ZYG A;  2JXP A;  1EA6 A;  2Z5B A;  2O1W A;  1XNR I;  2EWL A;  2RTX A;  3C4B A;  4IS9 A;  1N34 E;  3P3E A;  1K47 A;  4X8W A;  2DMI A;  1BBO A;  2BV3 A;  3ZZ0 A;  3AV0 A;  2LE2 A;  1A1H A;  2C39 A;  2O1V A;  4OO1 A;  2UUA I;  2HC5 A;  1T4L B;  3ZZU A;  4DV0 E;  1A1J A;  2JEA B;  3ECR A;  1TF3 A;  5A6J A;  3Q6N A;  5DNL A;  2YTF A;  1J5E E;  2BA0 G;  2YZT A;  2B3T B;  2RS6 A;  4X9J A;  4LF6 E;  1A6F A;  4KHP I;  2EQ3 A;  4TUI A;  4IZJ B;  2EN4 A;  4OX9 E;  2WNR B;  2EMK A;  2V34 A;  2YSP A;  3BGH A;  5A6B D;  2B7T A;  5KL4 A;  3HXL A;  2F4V E;  1RRE A;  4FW3 A;  4F6M A;  2Z5C A;  2MC5 A;  3T1H E;  5C0X C;  4ZVI A;  5C0X E;  4F9A B;  4JI4 E;  2RSM A;  4Z7Y A;  1NHI A;  1QNT A;  1EKZ A;  1GTK A;  2YPN A;  3Q6M A;  2EM3 A;  1X48 A;  4HXZ A;  4PRX A;  4WFT A;  3ZKB A;  2UXC E;  4FW7 A;  4IFD D;  2PNZ A;  2L2N A;  2V87 A;  1YZ9 A;  3P3C A;  3HUL A;  3H09 A;  1FWK A;  4DPT A;  5A2Q C;  3T1Y I;  1HNW E;  4LF4 I;  4LFA I;  1RMD A;  1NHH A;  2EPK X;  1HR0 I;  4GEQ B;  3K1J A;  2NUE A;  1RR9 A;  4R2C A;  1PJQ A;  2L6M A;  1X5W A;  5T6J A;  3TQM A;  2EOY A;  1H74 A;  1DI2 A;  1IQO A;  1ZM4 A;  1SR9 A;  2IES A;  2KON A;  4O24 A;  5AAS A;  5F3W A;  4DR1 I;  5TSE A;  1WHN A;  1N36 I;  1RC7 A;  4IZK A;  5K36 C;  5K36 E;  1WUU A;  2LBS B;  2JY9 A;  1ZBQ A;  2EN6 A;  1XNR E;  2UXD I;  4P78 A;  2A2D A;  3THN A;  2FV4 B;  2NN6 F;  4RPF A;  1PIE A;  1KJK A;  2EM7 A;  4BA1 A;  2EOQ A;  4FN5 A;  2MDG A;  2YT4 A;  5LLQ A;  1Z0C A;  2UUA E;  1JK2 A;  4OO1 D;  2EOJ A;  1Z0V A;  2UU9 I;  4JI0 I;  2R3V A;  4MU3 A;  1A1F A;  3H4L A;  5CFF E;  4B3T I;  5C0X F;  2J7J A;  2HGH A;  4BCA A;  4KHP E;  1YUI A;  1N3G A;  4FWG A;  2EMH A;  4L5N C;  1HNX I;  1USV A;  4JG4 A;  3PRY A;  4WXC A;  2LTS A;  4N4R B;  1Y5Y A;  3K85 A;  2YSO A;  4WPY A;  2ZIT A;  1Y4S A;  2BA1 D;  2XEX A;  3VHT B;  1GZ6 A;  5JEA B;  4MQY A;  4USM A;  2JPA A;  3PS3 A;  4WYQ B;  1E3H A;  1I94 I;  3ZKD A;  3B4T A;  2GS8 A;  3P06 A;  3GON A;  2ADR A;  3L7Z A;  1RHY A;  2PO0 B;  2GQ0 A;  3DD6 A;  4LF4 E;  2BA0 D;  2L8T A;  2DLK A;  3T1Y E;  4LFA E;  4FK5 C;  3CDI A;  3J7A G;  4ED4 A;  3JAM Q;  4Q35 B;  2D9H A;  1HR0 E;  4MYT A;  3PS1 A;  3QT6 A;  2M4I A;  3WU3 A;  2VRD A;  2LCE A;  2EPZ A;  4DV3 I;  2IOP A;  2ENA A;  3LLH A;  2EL4 A;  3GME A;  1FJG I;  4DV7 I;  2LT7 A;  5BR8 I;  2GO3 A;  2EPR A;  4DR1 E;  4BA2 B;  1Y60 A;  4LF6 I;  4AID A;  2EOF A;  1FWL A;  2YU8 A;  1N36 E;  1XNQ I;  1QU6 A;  2ODR D;  2ELY A;  1HK7 A;  1KTV A;  4NBQ A;  3EPJ A;  2HFU A;  2UXD E;  1XMQ I;  2PRT A;  5L3J A;  3J80 Q;  2HJJ A;  5IXM B;  1WHQ A;  2LJU A;  3D4J A;  5LMU I;  1X6E A;  2IOQ A;  4DV4 I;  2EM9 A;  4MLQ A;  2EPP A;  2UU9 E;  4JI0 E;  4IFD B;  5KL6 A;  3V5R A;  2HHH I;  1PVG A;  4B3T E;  2VF3 A;  3LPS A;  2JE6 B;  4F6N A;  1J26 A;  4N3O A;  4HAC B;  4JI2 I;  4GZN C;  2E1M A;  1UDS A;  1HNX E;  4PU9 A;  5FLX Q;  2I13 A;  3HQ1 A;  2PO2 B;  3CWV A;  3ZZT A; 
#chains in the Genus database with same CATH homology
 3F0N A;  1WXR A;  1UEK A;  3JU0 A;  4JI7 I;  3K17 A;  4BC7 A;  3ADJ A;  1I94 E;  2Z5B B;  2LRS A;  5GMD A;  4DR5 I;  3ADG A;  4P7D A;  3PYF A;  1YYO A;  4JYA I;  2B9D A;  2JVA A;  4NXN I;  2DEI A;  3VYX A;  2UUB I;  4DV3 E;  1FJG E;  3VYY A;  4DU7 A;  1MX0 A;  2V2V A;  4DV7 E;  4BBY A;  3J7A M;  4X65 E;  5BR8 E;  3F6H A;  2DSY A;  1B62 A;  1KIJ A;  2X36 A;  1XNQ E;  1PKP A;  1ZM9 A;  3B82 A;  2Z5C B;  5AE2 A;  2Z5E A;  1XMQ E;  1IBM I;  2UXB I;  4DV2 I;  4FWH A;  2X7I A;  1RQ0 A;  4LTY A;  1IBK I;  5LMU E;  4LF9 I;  3HJC A;  1S4E A;  4DV4 E;  3M6A A;  4LFC I;  5A2Q Q;  1H73 A;  4P7A A;  2ZM6 I;  4JI1 I;  3ADL A;  2HHH E;  2RS7 A;  4JI2 E;  1FNM A;  2L2M A;  1UIL A;  4LF8 I;  2DEJ A;  3VK6 A;  3AUZ A;  3OML A;  2BM1 A;  4DR6 I;  5IWA I;  2LTR A;  1Z5A A;  2V83 A;  4X62 E;  4AQY I;  4JI7 E;  4IZK B;  1KVK A;  4WSP A;  4DR5 E;  3PYD A;  4DPY A;  4JYA E;  3Q1Q A;  4HYM A;  2JR1 A;  4DR3 I;  4LU9 A;  4KZS A;  1STU A;  4F9B B;  4NXN E;  1O0W A;  2UUB E;  4M2Z A;  1X49 A;  2L3C A;  4WUB A;  4PRV A;  1ZXM A;  1YYK A;  1USU A;  4DPW A;  4J8Z A;  1N33 I;  2EFG A;  1IBM E;  2L33 A;  1X47 A;  4DV2 E;  2UXB E;  1D6T A;  3HPZ A;  1IBK E;  4LF9 E;  3J81 Q;  4GKK I;  1S16 A;  2LJP A;  4F9C B;  4WUC A;  2M7Q A;  3PYG A;  4LFC E;  3ZM7 A;  4BS9 A;  2ZM6 E;  4JI1 E;  2O1T A;  3J81 C;  2UUC I;  4YHH I;  1DQ3 A;  4LF8 E;  2CGE A;  1H7U A;  4X66 I;  5IT9 C;  1HNZ I;  2V89 A;  4DR6 E;  2FTX B;  1H72 C;  5IWA E;  4R8O A;  1FKA E;  2Q2E B;  2V2Z A;  4AQY E;  2L92 A;  4X65 I;  2ODR C;  2N3H A;  2DMY A;  3C4T A;  3FIG A;  4M30 A;  3WU4 A;  4B3S I;  3PYE A;  1ZXN A;  3B8H A;  3RMP A;  2VQF I;  1T4O A;  2MDR A;  3WU5 A;  3JTZ A;  2V86 A;  4DR3 E;  4B3M I;  4KQV A;  3OTO I;  2CZ9 A;  5AE3 A;  4YY3 I;  1MG7 A;  1ELO A;  1N33 E;  4DR2 I;  2HKE A;  4DXL A;  4F54 A;  4K0K I;  2HKJ A;  3LNU A;  4LF5 I;  4DUZ I;  4GKK E;  2DB2 A;  4X62 I;  4FWD A;  3J7Y p;  4URL A;  2UUC E;  4YHH E;  2JOX A;  1NHJ A;  1Y6Z A;  4BMJ A;  3QT5 A;  2CPN A;  4X66 E;  1Z0W A;  1HNZ E;  1UHZ A;  1DAR A;  5GME A;  2A2C A;  3B78 A;  2V8Q B;  4M0V A;  2NUF A;  4JI3 I;  3ZOQ B;  4JI5 I;  4B3S E;  2N3G A;  2ZBK B;  2VQF E;  4DMI A;  5AE1 A;  4JI8 I;  4LF7 I;  3P1X A;  4B3M E;  1XHK A;  4Z7C A;  3OTO E;  2OI2 A;  1YYW A;  4TUG A;  4L8N A;  4UTG A;  1ZBT A;  1XMO I;  4YY3 E;  4DR7 I;  3F6G A;  4DR2 E;  1B63 A;  1Z5B A;  1Z0B A;  2L2K B;  4K0K E;  4LF5 E;  4DUZ E;  1KKH A;  2E5L E;  4IZJ A;  4X64 I;  1GQE A;  1Z5C A;  2MC6 A;  4Q28 A;  3QT7 A;  4LFB I;  3HPS A;  4DV5 I;  2VQE I;  4JV5 I;  2JWO A;  4B3R I;  4JI6 I;  1Z0T A;  4FW9 A;  4UT4 A;  1Y4U A;  2L3J A;  4P52 A;  2LUQ A;  4NXM I;  4GKJ I;  3QT8 A;  2EZ6 A;  4JI3 E;  3MSW A;  4EMD A;  4JI5 E;  1BKN A;  2NA2 A;  4DUY I;  4DR4 I;  3IWB A;  4JI8 E;  4LF7 E;  1ZM3 A;  1IBL I;  2CG9 A;  2B7V A;  5IT9 Q;  2HK3 A;  1N0U A;  3WU6 A;  1XMO E;  3LML A;  4DR7 E;  2WZO A;  4BC9 A;  2M1S A;  1VIS A;  2FGG A;  5LMN I;  4DV1 I;  2HK2 A;  1QZR A;  4DV6 I;  1N32 I;  3IWD A;  4IZJ D;  2PNL A;  4R1F A;  4X64 E;  2O1U A;  4I8O A;  1U2R A;  1MU5 A;  4MYU A;  2BM0 A;  4R03 A;  2AJ4 A;  4LFB E;  4DV5 E;  1T4N A;  1ZM2 A;  2VQE E;  4JV5 E;  4DPX A;  1Z0E A;  4B3R E;  2IHR 1;  2VF1 A;  2JOB A;  3HTX A;  4JI6 E;  2E1R A;  1N34 I;  1Z0G A;  3DF6 A;  2V8P A;  2V2Q A;  2WW4 A;  4NXM E;  4GKJ E;  2DIX A;  2PNM A;  5LL6 R;  4DV0 I;  5DNY A;  3JAM C;  1J5E I;  4DUY E;  2G7H A;  4DR4 E;  1NZ0 A;  3KWR A;  4DPU A;  4OX9 I;  2LMZ A;  2E5L I;  2F4V I;  2KHX A;  4DKK A;  1IBL E;  4WUD A;  2H36 X;  1OJ4 A;  3T1H I;  4USK A;  2KOU A;  2LUP B;  2V88 A;  2R42 A;  4XTJ A;  4JI4 I;  3LTO A;  2LJH A;  3J80 C;  2VE7 C;  4HY1 A;  2NPF A;  5LMN E;  2NUG A;  4DV1 E;  2UXC I;  1H7S A;  3IWC A;  1HNW I;  4DV6 E;  1N32 E;  4HAC A;  5FWK A;  4DU8 A;  1EI1 A;  1FI4 A;  3V2U C;  2F8B A;  3K6Q A;  4M1K A;  4I3H A;  2V85 A;  5FLX C;  5ADZ A;  3DJW A;  2K4V A;  1N0V C;  4OOG C;  2J7K A;  2HFS A;  1Z59 A;  3ADI A;  2Z5B A;  1EA6 A;  2O1W A;  1XNR I;  2EWL A;  2RTX A;  3C4B A;  1N34 E;  1K47 A;  4X8W A;  2BV3 A;  3ZZ0 A;  3AV0 A;  2LE2 A;  2O1V A;  2UUA I;  1T4L B;  3ZZU A;  4DV0 E;  3Q6N A;  1J5E E;  2YZT A;  2B3T B;  4LF6 E;  2RS6 A;  1A6F A;  4KHP I;  4TUI A;  4IZJ B;  4OX9 E;  2V34 A;  2F4V E;  1RRE A;  2B7T A;  3HXL A;  2Z5C A;  2MC5 A;  3T1H E;  4ZVI A;  4F9A B;  4JI4 E;  2RSM A;  4Z7Y A;  1NHI A;  1EKZ A;  3Q6M A;  1X48 A;  4HXZ A;  4PRX A;  4WFT A;  3ZKB A;  2UXC E;  2L2N A;  2V87 A;  1YZ9 A;  4LF4 I;  3HUL A;  3H09 A;  1FWK A;  4DPT A;  5A2Q C;  3T1Y I;  1HNW E;  4LFA I;  1NHH A;  1HR0 I;  4GEQ B;  3K1J A;  2NUE A;  1RR9 A;  2L6M A;  5T6J A;  1H74 A;  1DI2 A;  1ZM4 A;  1SR9 A;  2KON A;  5F3W A;  5AAS A;  4DR1 I;  1WHN A;  1N36 I;  1RC7 A;  4IZK A;  1WUU A;  2LBS B;  2JY9 A;  1ZBQ A;  1XNR E;  2UXD I;  4P78 A;  2A2D A;  2FV4 B;  4RPF A;  1PIE A;  4FN5 A;  2YT4 A;  1Z0C A;  2UUA E;  1Z0V A;  2UU9 I;  4JI0 I;  2R3V A;  3H4L A;  5CFF E;  4B3T I;  4BCA A;  4KHP E;  4FWG A;  4L5N C;  1HNX I;  1USV A;  4JG4 A;  3PRY A;  2LTS A;  3K85 A;  4WPY A;  2ZIT A;  1Y4S A;  2XEX A;  1GZ6 A;  4USM A;  4WYQ B;  1I94 I;  3ZKD A;  2GS8 A;  3P06 A;  3GON A;  2GQ0 A;  4LF4 E;  2L8T A;  3T1Y E;  4LFA E;  3J7A G;  4ED4 A;  3JAM Q;  1HR0 E;  4MYT A;  3WU3 A;  3QT6 A;  2M4I A;  4DV3 I;  2IOP A;  3LLH A;  1FJG I;  4DV7 I;  5BR8 I;  4DR1 E;  4LF6 I;  1FWL A;  1N36 E;  1XNQ I;  1QU6 A;  2ODR D;  1KTV A;  1HK7 A;  2HFU A;  2UXD E;  1XMQ I;  5L3J A;  3J80 Q;  1WHQ A;  3D4J A;  5LMU I;  2IOQ A;  4DV4 I;  2UU9 E;  4JI0 E;  3V5R A;  2HHH I;  1PVG A;  4B3T E;  2VF3 A;  3LPS A;  4N3O A;  1J26 A;  4JI2 I;  4HAC B;  2E1M A;  5FLX Q;  1HNX E;  4PU9 A;  3HQ1 A;  3CWV A;  3ZZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...