3J7AG

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
224
Chain Sequence
KNWVPVTKLGRLVKEGKIVSIEEIYLHSLPIKEYQIIDYFFQPNECSHPLKDDVVKIMPVQKQTRAGQRTRFKAFVAIGDGNGHCGLGVKCAKEVATAIRGAIISAKLSLIPVRRGYWGNKIGDPHTVPMKVSGKCGSVRIRLVPAPRGTQIVGAPTTKKMLNFAGIKDCFSSSCGKTKTKGNFLRAIFNALSKTYGYLTPDLWKVTNFDKSPYEEWSDFLETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
total genus 46
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
G PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j7aG01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j7aG02
2GS8A 1XMOE 2UXCI 1ZM9A 2ZM6I 5IT9Q 1N36E 4JI1I 4DR2I 1FNMA 1N0UA 1Z5CA 4HYMA 1J5EE 2UU9I 4DV4E 1KKHA 4Z7CA 4GKKI 4LFCI 1OJ4A 1KTVA 2A2CA 1ELOA 4JI0E 4LF7E 4JV5I 3J7AG 1XMOI 4HXZA 5LMNI 4PRVA 4NXNE 5LMUI 4LF8E 2BM1A 4FWDA 4JI4E 3WU3A 1HNZE 4JI1E 3ZZ0A 1Z0TA 4B3RI 3PYGA 4R1FA 4LFCE 1XMQE 4DR5I 1ZXMA 4DR4E 3PYFA 1FKAE 4JI0I 4LF7I 1IBKI 4HY1A 3CWVA 4AQYE 1PVGA 4X64E 4DV5I 1H73A 2LJPA 3B78A 4LFBE 4LF4E 4DU7A 1HNWI 2V2VA 5A2QQ 4X62I 4DR6I 1Z0BA 1ZM4A 3OTOE 2VQEI 1I94I 4JG4A 5IT9C 2OI2A 4JI3E 4LF6E 2UXBI 2UUAE 1IBKE 3J80C 1XHKA 2VF3A 2E5LE 4DV1I 2UUBI 4X64I 4DV5E 4YY3E 4B3ME 1HNWE 1FI4A 1NHIA 2VQEE 1RREA 4DPYA 3T1YI 1D6TA 2HHHE 4JI3I 4USMA 2X36A 1IBMI 3T1HE 4B3TI 2UUAI 1KVKA 1EA6A 4PU9A 2XEXA 1QZRA 2X7IA 2UUBE 4JI7I 5IWAI 2UUCI 4YY3I 4DPUA 3V2UC 3B82A 1U2RA 2BM0A 2V2ZA 4KQVA 2DEIA 5FLXQ 4X65E 4DR1E 5FLXC 5A2QC 1HR0I 4DV0E 1K47A 4UT4A 1H72C 4DV6I 5IWAE 3B8HA 2UUCE 3J81C 1HNXE 1XNRE 1H7SA 4M1KA 4YHHI 4ED4A 5LMNE 5LMUE 1NHHA 4LF8I 1ZM3A 4DR1I 4JI4I 4JI6E 2VQFE 1HR0E 4DV0I 4EMDA 1EI1A 4B3RE 4LF5E 4DV6E 1S16A 4B3SI 4OX9E 3GONA 3WU6A 1N0VC 3J81Q 4DUYI 3LPSA 4DUZI 3J80Q 2ZBKB 1MX0A 2NPFA 3QT6A 2VQFI 1NZ0A 4JI2I 1B62A 1S4EA 2V34A 3ZM7A 4X62E 3OTOI 3LTOA 4DV3E 4B3SE 4OX9I 4URLA 1NHJA 1N34E 4DUZE 4K0KE 4LF6I 2HKEA 4PRXA 3V5RA 3D4JA 4JI8E 1Z0VA 1FWLA 1Z0CA 1ZM2A 4JI2E 4P7AA 4X66E 5L3JA 4DR7E 4DV3I 2A2DA 2EFGA 3T1YE 4Z7YA 2Q2EB 1IBME 4B3TE 5GMEA 1ZXNA 3PYDA 3M6AA 4MYUA 2HFUA 1N32I 4WUDA 4JI7E 4JI5I 2J7KA 2HFSA 4DR3E 2V2QA 4MYTA 1B63A 4X66I 1FWKA 4USKA 3QT8A 4WUCA 5GMDA 4UTGA 1XNQI 1UEKA 3F0NA 4WUBA 4X65I 1RR9A 3Q1QA 4GKJE 3K1JA 1N33E 1N32E 4LF9I 4JI5E 2UXCE 4FWGA 4DV7I 1VISA 1FJGE 1HNXI 1XNRI 4DPWA 2ZM6E 4KHPE 3WU4A 1N36I 4YHHE 1XNQE 4HACA 4DR2E 1Z5AA 3ZKBA 4DU8A 4LFAE 2DEJA 4JI6I 1J5EI 2UU9E 5BR8E 2F4VI 4GKJI 4HACB 4P52A 3QT5A 4JV5E 4LF5I 5LL6R 4DXLA 4JYAI 4DV7E 1FJGI 3H4LA 4NXNI 4DUYE 4KHPI 1HNZI 2HK2A 1DARA 4LFAI 3JAMC 3HULA 5BR8I 2F4VE 1Z0WA 1XMQI 4DR5E 1H7UA 2R42A 4DR4I 1PKPA 2AJ4A 4RPFA 4JYAE 4DPTA 3ZZTA 3J7AM 4AQYI 1N34I 1MU5A 4FW9A 4K0KI 2UXDI 4LFBI 4LF4I 2V8PA 4JI8I 2CZ9A 1Z59A 4DR6E 1I94E 4NXME 1Z5BA 3JAMQ 1PIEA 1KIJA 2R3VA 1IBLE 1Z0EA 4FWHA 4DR7I 2UXBE 1Z0GA 1MG7A 4FN5A 2E5LI 4DV2I 4DV1E 3LNUA 3ZKDA 2UXDE 2HKJA 3ZZUA 4I3HA 4B3MI 2E1RA 2HK3A 3WU5A 4NXMI 4DR3I 2HHHI 3PYEA 1BKNA 1IBLI 3T1HI 1WUUA 4XTJA 3K17A 2BV3A 4DV2E 2WW4A 2ZITA 4DPXA 4DV4I 1H74A 4GKKE 3QT7A 1N33I 1A6FA 4ZVIA 4LF9E
chains in the Genus database with same CATH superfamily
2GS8A 2L8TA 1XMOE 2UXCI 2N3GA 2LVHA 2EMCA 2B9DA 5C0XD 4BC7A 1ZM9A 2ZM6I 4WSPA 1J26A 2M1SA 2B3TB 5IT9Q 5A6AA 2I13A 2YTDA 4BHBA 1N36E 2JYAA 2NABA 5AE2A 4JI1I 3BF2A 2L6MA 2CT1A 1YHCA 4DR2I 1FNMA 3F6HA 4OO1F 2EM3A 1PDAA 3P3EA 1N0UA 1Z5CA 5DNLA 1X3CA 4HYMA 2NA2A 5AC4A 1J5EE 4MQYA 2UU9I 4DV4E 1KKHA 2C38B 4Z7CA 4GKKI 1PJTA 3P06A 2EN2A 4LFCI 2EMYA 1OJ4A 1WXRA 2WBSA 1KTVA 5K36F 2L2NA 4L8NA 2A2CA 1ELOA 4JI0E 1N3GA 4LF7E 2EM4A 4JV5I 3J7AG 3ADJA 2EQ1A 2EPCA 5ADZA 4R2PA 1Y4UA 1XMOI 4HXZA 5AC5A 2NN6F 5LMNI 4NXNE 4LCFA 4PRVA 5LMUI 1NEIA 4LF8E 2BM1A 1AAYA 2EM6A 4FWDA 4JI4E 2B7TA 3WU3A 4IFDD 3IWDA 4WSGA 2Z5CA 1HNZE 5LLQA 2EMFA 4JI1E 2PO0A 3ZZ0A 4BHCA 3VYYA 3HQ1A 5C0XC 2EPNA 4ZYDA 5DRQA 3M85G 4N4RB 3JTZA 4IFDB 1Y5YA 1Z0TA 4B3RI 2WP8A 1A1JA 2EOMA 2C37A 2CTDA 2L2MA 2IOQA 4F9AB 4OO1B 3PYGA 2O1TA 5JEAF 3M99B 4R1FA 4OKGA 4LFCE 1XMQE 4DR5I 4BCAA 2NN6E 4DR4E 1ZXMA 4J3DA 3PYFA 1FKAE 2LMZA 3IWCA 4JI0I 4LF7I 4OOGC 3F6GA 1UDNA 3CDIA 1IBKI 4HY1A 3CWVA 2YTNA 4AQYE 2NN6A 1PVGA 4GQUA 1WHQA 2JOXA 1UN6B 2PNMA 2BBGA 2RPCA 1HK7A 4MLQA 4X64E 2DLKA 1PJQA 4F9BB 4IJDA 3FIGA 1XXEA 4DV5I 2O1VA 1H73A 2GO3A 2LJPA 4BS9A 4LF4E 4LF9E 4LFBE 3B78A 2V2VA 4FW4A 4LOMA 4DU7A 2M7QA 5A2QQ 1HNWI 1T4LB 2LE2A 4X62I 4DR6I 1Z0BA 1ZM4A 3OTOE 4AM3A 2VQEI 2YTEA 4FW5A 2EORA 2GO4A 4JG4A 1I94I 1DQ3A 3K6QA 1YH8A 2V83A 5IT9C 4IS1C 4TUGA 2OI2A 4P78A 1G2DC 1X47A 4JI3E 2LJHA 2RSIA 3L7ZB 4LF6E 2LCEA 4KZSA 2MC5A 2EP3A 1P42A 2UXBI 1T4NA 4NBQA 2UUAE 2V85A 1IBKE 3J80C 2GLIA 1XHKA 2EOOA 5KL7A 1L4SA 2VF3A 4M30A 1A1HA 3EQ1A 2EL5A 2DLQA 2E5LE 4I8OA 1OYRA 4DV1I 2FTXB 2UUBI 4HTGA 2NN6D 4X64I 2DB2A 4AIMA 2LUPB 5KL3A 4OO1E 4DMIA 4DV5E 4YY3E 2VRDA 2ELYA 4B3ME 4R2AA 3EPJA 1HNWE 1Y4SA 1FI4A 2IESA 2YU5A 1NHIA 2VQEE 4GZNC 1RREA 4DPYA 3T1YI 5K36A 2RS6A 1YYKA 1D6TA 2HHHE 2LT7A 4QNJA 4JI3I 4USMA 2X36A 2WNRB 1IBMI 3T1HE 4B3TI 2E1MA 1A1KA 2UUAI 2H36X 1X6EA 5EKWA 1KVKA 1RQ0A 1EA6A 4PU9A 3U1YA 2XEXA 2D9HA 1MEYC 4AIDA 1QZRA 4MDTA 4LTYA 3EPKA 5CFFE 2UUBE 2WP8B 2X7IA 5IWAI 4JI7I 5ELWA 2UUCI 4YY3I 2EOEA 4WXCA 2DMIA 2PO0B 3V2UC 4DPUA 4R03A 2F1DA 3THNA 4IZKB 2ODRD 3B82A 2YTPA 2EMZA 3AV0A 4F9CB 1U2RA 2BM0A 4Q35B 2V2ZA 5JEAC 4FK5C 4OZEA 4KQVA 2DEIA 3DJWA 4R2DA 5FLXQ 1GZ6A 1T4OA 2RSMA 4M0VA 2C38A 2WBTA 4WX9A 4X65E 4DR1E 5A6BD 2FV4B 5FLXC 3VYXA 2EPMX 4HEIA 1Z1BA 4IZJA 5A6JA 5A2QC 2YRMA 2O1WA 2EMLA 1HR0I 1NCSA 4WPYA 2V87A 2YRKA 4BBYA 4DV0E 1G2FC 2NUFA 1K47A 2CSHA 4UT4A 4MLVA 1H72C 2EM7A 2JEBB 4ZYGA 4F54A 5IWAE 4DV6I 3LLHA 4IZJB 3B8HA 2UUCE 2E72A 2YTGA 5K36E 3DF6A 2EMHA 2EN7A 3J81C 4LCHA 1HNXE 2KONA 1XNRE 4FW3A 2M9AA 1H7SA 3MHHC 4M1KA 2JEAA 2NUEA 4YHHI 1UDSA 1ZR9A 4ED4A 5LMNE 2WCC3 2JXPA 3BGHA 5LMUE 1NHHA 1WRJA 1ZM3A 4DR1I 4LF8I 1PJSA 2YSOA 4JI4I 1E3HA 4JI6E 1GTKA 3OMLA 2I9IA 4RHBB 3M7ND 2VQFE 1IQOA 2HJJA 1HR0E 2PO2A 2R76A 2JR1A 4DV0I 3ADIA 4EMDA 1EI1A 2JOBA 2GQ0A 2EPLX 4B3RE 4LF5E 4DV6E 1S16A 4B3SI 1YSAC 5JEAB 2B7VA 4OX9E 2EM0A 2DRPA 2RTXA 2PNLA 3GONA 3WU6A 1N0VC 3J81Q 4DUYI 3J7Yp 3LPSA 2WBUA 4DUZI 2JP9A 2ENAA 2PNZB 3J80Q 1A1GA 2PRTA 2JE6B 2ZBKB 3MSWA 3PS2A 1MX0A 1UILA 2C39B 4BA1B 2LTSA 2NPFA 1WHNA 3CDJA 1B69A 2KOUA 2EOZA 4Q28A 3HPZA 2EQ0A 3C4BA 1YYWA 1EH6A 3L7ZA 2EN8A 3QT6A 2MKDA 2EZ6A 2VQFI 4IFDA 1NZ0A 2EN6A 5A6KA 5IV8B 2BA1G 2NN6B 4JI2I 1B62A 2K7IA 1S4EA 2V34A 2JPAA 3ZM7A 4BMJA 2YRHA 4X62E 2DSYA 4OO1D 4NZVA 4DV3E 1BBOA 4B3SE 3LTOA 3OTOI 2EM2A 4OX9I 4URLA 2L3JA 4R2SA 2EMGA 1NHJA 2JY9A 4R2QA 1SFEA 2WZOA 2YPNA 3RMPA 1UDOA 4WYQB 4P7DA 1N34E 3EPLA 2BA1D 2PO2B 2EOIA 2CVEA 4DUZE 4K0KE 2C37B 4LF6I 2EPUA 4MU0A 2HKEA 2LTRA 4TUIA 3BBGA 1X6HA 4PRXA 3V5RA 5KL2A 2DGCA 3D4JA 2VE7C 4JI8E 1Z0VA 2O1UA 3DD6A 1FWLA 4KWYA 4N3OA 1Z0CA 2O3ZA 1ZM2A 5TSEA 1USVA 2EMIA 2EJ4A 2EOXA 2L3CA 4JI2E 4P7AA 2GHFA 2LO3A 3KWRA 1OYPA 4FW6A 4X66E 5L3JA 4DR7E 4DV3I 2VF1A 2A2DA 3T1YE 2EFGA 2Z5BA 2JEAB 1RC7A 2L2KB 2L33A 4MU3A 4Z7YA 3C4TA 1X5WA 4R2CA 3THOB 3GMEA 2MKNA 4RH8A 2M4IA 2Q2EB 5FWKA 1KYQA 1IBME 2N3HA 2PO1B 4B3TE 5GMEA 3JU0A 1ZXNA 1IQSA 3C6MA 5C0XE 2EN3A 2HGHA 3PYDA 3M6AA 3U1KA 2ADRA 2LRSA 4MYUA 2HFUA 1N32I 1JK2A 4WUDA 2YTJA 2EMAA 4IFDC 3MHSC 4J8ZA 4JI7E 4JI5I 1ZU1A 4U3DA 2PO1A 5KL4A 3ADLA 2J7KA 5C0XA 4DR3E 2HFSA 3NZKA 2V89A 3P3GA 2EMBA 2V2QA 4MYTA 5T6JA 1DGCA 4IFDF 2EOQA 1B63A 4X66I 1FWKA 1GQEA 4BA2A 4USKA 3QT8A 4WUCA 2WNRA 5GMDA 4UTGA 1X49A 1VI7A 4O4KA 2BR2A 1XNQI 2EOFA 2EM9A 4ZYEA 1UEKA 2EOSA 3F0NA 2EM8A 4WUBA 5K36B 2V86A 4X65I 2N8XA 1YYOA 3VK6A 1RR9A 2BA0D 2YTOA 3IWBA 3TQMA 4GKJE 4R8OA 3Q1QA 1P47A 1STUA 3K1JA 1N33E 4OO1C 1N32E 1A1IA 3VHTB 1ZBQA 4LF9I 5IXMB 1ZAAC 2PNZA 4JI5E 2YSPA 4R2RA 2UXCE 4FWGA 4DV7I 1VISA 1FJGE 2DMYA 4F6MA 3HKMA 4WFTA 1JK1A 2C39A 4BA1A 4DPWA 1HNXI 1XNRI 2ZM6E 4KHPE 1BBGA 2DIXA 1YUIA 3GLLA 4ZYHA 1YUJA 3WU4A 4LU9A 4YHHE 1N36I 4F6NA 1XNQE 2L92A 4HACA 3HXLA 4DR2E 4GEQB 1AH5A 4BC9A 1Z5AA 2ENHA 3HJCA 3ZKBA 3P3CA 4DU8A 4LFAE 5JEAE 3UHMA 3KRNA 2DEJA 2YU8A 3HPSA 1T39A 4JI6I 1J5EI 1X6FA 4OO1A 4O43A 2UU9E 5BR8E 2F4VI 2JVAA 4U3BA 4GKJI 3C6KA 5DNXA 2MDRA 4WXDA 2BR2B 1USUA 3B4TA 4HACB 4P52A 3QT5A 4JV5E 4LF5I 5LL6R 4DXLA 4JYAI 2IOPA 4DV7E 2EL6A 1FJGI 4QNKA 1WJPA 3H4LA 4NXNI 5AE3A 4DUYE 5EL9A 4M9VC 2EOHA 2KHXA 2Z5EA 5C0XB 1OYSA 4KHPI 4BA2B 1A1FA 1HNZI 2RQLA 2V8QB 2CG9A 2EL4A 4MU1A 2HK2A 2ELZA 1KJKA 2EN1A 4ISAA 2EPRA 1DARA 4LFAI 1IMUA 2JWOA 5DRPA 1F2IG 3JAMC 3HULA 1SR9A 2K4VA 1DI2A 2JEBA 3UK3C 2F4VE 2A25A 5BR8I 1Z0WA 4F2JC 4DR5E 1XMQI 1R6LA 1H7UA 2R42A 4DR4I 1PKPA 2AJ4A 2EPXA 2EM5A 2Z5CB 2FGGA 1Y60A 2BA0G 4JYAE 4RPFA 3QG5C 2EQ3A 2NN6C 4DPTA 2VESA 1E3PA 2HC5A 2J7JA 4LCGA 3ZZTA 3J7AM 2EOYA 1YFHA 2MC6A 2EN4A 5KL5A 3PS3A 4AQYI 2ODRC 5A69A 2IERA 1N34I 3L00A 1MU5A 3P76A 4FW9A 4K0KI 1Y6ZA 4FW7A 1O0WA 1TF3A 2UXDI 2CGEA 5DNYA 2EWLA 2YTIA 4IS9A 2YT4A 4LFBI 4LF4I 2V8PA 5C0XF 4JI8I 1R6MA 2CZ9A 1Z59A 2RS7A 3KZZA 4DR6E 2Z5BB 4MU4A 1I94E 3EPHA 2EMKA 4NXME 1Z5BA 3JAMQ 4IZKA 2EOJA 2EMWA 1KIJA 1PIEA 2J65A 2EPZA 2R3VA 1IBLE 4LPFA 1Z0EA 4O5GA 5AASA 1UDQA 4FWHA 5JEAD 4DR7I 2EPAA 2UXBE 2IHR1 1X48A 2V88A 1YZ9A 4O24A 2LJUA 1MG7A 1Z0GA 1QNTA 4IFDE 3H09A 4FN5A 4DKKA 2LV2A 1ZBTA 2LBSB 5DROA 2E5LI 4DV2I 4DV1E 3LMLA 1RMDA 3Q6NA 3LNUA 2R1FA 2ENCA 2F8BA 2NUGA 3ZKDA 2BB8A 2UXDE 1EH7A 1MGTA 2EE8A 2EMXA 5A6BA 4L5NC 2HKJA 4IZJD 3ZZUA 4I3HA 4B3MI 2E1RA 3KZYA 2HK3A 3WU5A 2EPPA 2Q8UA 3M85D 4M2ZA 3BIDA 5F3WA 5K36C 2MDGA 3PS1A 1EKZA 4NXMI 2YWQA 2JT2A 4DR3I 3AUZA 1EH8A 4X8WA 2HHHI 3ADGA 3PYEA 3GCMA 2JE6A 2YTQA 1TN9A 1BKNA 1RHYA 1UBDC 3PRYA 1IBLI 3T1HI 3ECRA 1LLMC 2CPNA 2YTFA 3K85A 1WUUA 1QU6A 2LUQA 5DRRA 2EPKX 4R2EA 2YZTA 1YPNA 3ZOQB 2G7HA 2AE8A 1UHZA 4XTJA 3K17A 2BV3A 5KL6A 4DV2E 4X9JA 2WW4A 1T38A 1BB8A 3M7NG 3Q6MA 1A1LA 2ZITA 4DPXA 4DV4I 1H74A 2EPOA 4NHRA 4GKKE 3QT7A 5K36D 1N33I 1A6FA 4ZVIA 5JEAA 5AE1A 2GPIA 3H1CA 3HTXA 3P1XA 1TF6A
chains in the Genus database with same CATH topology
2GS8A 2L8TA 1XMOE 2UXCI 2N3GA 2B9DA 4BC7A 1ZM9A 2ZM6I 4WSPA 1J26A 2M1SA 2B3TB 5IT9Q 1N36E 4JI1I 5AE2A 2L6MA 4DR2I 1FNMA 3F6HA 1N0UA 1Z5CA 4HYMA 2NA2A 1J5EE 2UU9I 4DV4E 1KKHA 4Z7CA 4GKKI 3P06A 4LFCI 1OJ4A 1WXRA 1KTVA 2L2NA 4L8NA 2A2CA 1ELOA 4JI0E 4LF7E 4JV5I 3J7AG 3ADJA 5ADZA 1XMOI 1Y4UA 4HXZA 5LMNI 4NXNE 4PRVA 5LMUI 4LF8E 2BM1A 4FWDA 4JI4E 2B7TA 3WU3A 3IWDA 2Z5CA 1HNZE 4JI1E 3ZZ0A 3VYYA 3HQ1A 3JTZA 1Z0TA 4B3RI 2L2MA 2IOQA 4F9AB 3PYGA 2O1TA 4R1FA 4LFCE 1XMQE 4DR5I 4BCAA 4DR4E 1ZXMA 3PYFA 1FKAE 2LMZA 3IWCA 4JI0I 4LF7I 4OOGC 3F6GA 1IBKI 4HY1A 3CWVA 4AQYE 1PVGA 1WHQA 2JOXA 2PNMA 1HK7A 4X64E 4F9BB 3FIGA 4DV5I 2O1VA 1H73A 2LJPA 3B78A 4BS9A 4LF4E 4LFBE 4DU7A 1HNWI 2V2VA 5A2QQ 2M7QA 1T4LB 2LE2A 4X62I 4DR6I 1Z0BA 1ZM4A 3OTOE 2VQEI 1I94I 4JG4A 1DQ3A 3K6QA 2V83A 5IT9C 4TUGA 2OI2A 4P78A 4JI3E 1X47A 2LJHA 4LF6E 4KZSA 2MC5A 2UXBI 1T4NA 2UUAE 2V85A 1IBKE 3J80C 1XHKA 2VF3A 4M30A 2E5LE 4I8OA 4DV1I 2FTXB 2UUBI 4X64I 2DB2A 2LUPB 4DMIA 4DV5E 4YY3E 4B3ME 1HNWE 1Y4SA 1FI4A 1NHIA 2VQEE 1RREA 4DPYA 3T1YI 2RS6A 1YYKA 1D6TA 2HHHE 4JI3I 4USMA 2X36A 1IBMI 3T1HE 4B3TI 2E1MA 2UUAI 2H36X 1KVKA 1RQ0A 1EA6A 4PU9A 2XEXA 1QZRA 4LTYA 2UUBE 5CFFE 2X7IA 5IWAI 4JI7I 2UUCI 4YY3I 4DPUA 3V2UC 4R03A 4IZKB 2ODRD 3B82A 3AV0A 4F9CB 1U2RA 2BM0A 2V2ZA 4KQVA 2DEIA 3DJWA 5FLXQ 1GZ6A 1T4OA 2RSMA 4M0VA 4X65E 4DR1E 4IZJA 2FV4B 5FLXC 3VYXA 5A2QC 2O1WA 1HR0I 4WPYA 2V87A 4BBYA 4DV0E 2NUFA 1K47A 4UT4A 1H72C 4F54A 5IWAE 4DV6I 3LLHA 4IZJB 3B8HA 2UUCE 3DF6A 3J81C 1HNXE 2KONA 1XNRE 1H7SA 4M1KA 2NUEA 4YHHI 4ED4A 5LMNE 5LMUE 1NHHA 4LF8I 1ZM3A 4DR1I 4JI4I 4JI6E 3OMLA 2VQFE 1HR0E 4DV0I 2JR1A 3ADIA 4EMDA 1EI1A 2JOBA 2GQ0A 4B3RE 4LF5E 4DV6E 1S16A 4B3SI 2B7VA 4OX9E 2RTXA 2PNLA 3GONA 3WU6A 1N0VC 3J81Q 4DUYI 3J7Yp 3LPSA 4DUZI 3J80Q 2ZBKB 3MSWA 1MX0A 1UILA 2LTSA 2NPFA 1WHNA 2KOUA 4Q28A 3HPZA 3C4BA 1YYWA 3QT6A 2EZ6A 2VQFI 1NZ0A 4JI2I 1B62A 1S4EA 2V34A 3ZM7A 4BMJA 4X62E 2DSYA 3OTOI 4DV3E 3LTOA 4B3SE 4OX9I 4URLA 2L3JA 1NHJA 2JY9A 2WZOA 3RMPA 4WYQB 4P7DA 1N34E 4DUZE 4K0KE 4LF6I 2HKEA 2LTRA 4TUIA 4PRXA 3V5RA 3D4JA 2VE7C 4JI8E 1Z0VA 2O1UA 1FWLA 4N3OA 1Z0CA 1ZM2A 1USVA 2L3CA 4JI2E 4P7AA 3KWRA 4X66E 5L3JA 4DR7E 4DV3I 2VF1A 2A2DA 3T1YE 2EFGA 2Z5BA 1RC7A 2L2KB 2L33A 4Z7YA 3C4TA 2M4IA 2Q2EB 5FWKA 1IBME 2N3HA 4B3TE 5GMEA 3JU0A 1ZXNA 3PYDA 3M6AA 2LRSA 4MYUA 2HFUA 1N32I 4WUDA 4J8ZA 4JI7E 4JI5I 3ADLA 2J7KA 4DR3E 2HFSA 2V89A 2V2QA 4MYTA 5T6JA 1B63A 4X66I 1FWKA 1GQEA 4USKA 3QT8A 4WUCA 5GMDA 4UTGA 1X49A 1XNQI 1UEKA 3F0NA 4WUBA 2V86A 4X65I 1YYOA 3VK6A 1RR9A 3Q1QA 3IWBA 4GKJE 4R8OA 1STUA 3K1JA 1N33E 1N32E 3P1XA 1ZBQA 4LF9I 4JI5E 2UXCE 4FWGA 4DV7I 1VISA 1FJGE 2DMYA 4WFTA 1HNXI 1XNRI 4DPWA 2ZM6E 4KHPE 2DIXA 3WU4A 1N36I 4LU9A 4YHHE 1XNQE 2L92A 4HACA 3HXLA 4DR2E 4GEQB 4BC9A 1Z5AA 3HJCA 3ZKBA 4DU8A 4LFAE 2DEJA 3HPSA 4JI6I 1J5EI 2UU9E 5BR8E 2F4VI 2JVAA 4GKJI 2MDRA 4HACB 1USUA 4P52A 3QT5A 4JV5E 4LF5I 5LL6R 4DXLA 4JYAI 2IOPA 4DV7E 1FJGI 3H4LA 4NXNI 5AE3A 4DUYE 2KHXA 2Z5EA 4KHPI 1HNZI 2V8QB 2CG9A 2HK2A 1DARA 4LFAI 2JWOA 3JAMC 3HULA 1SR9A 2K4VA 1DI2A 2F4VE 5BR8I 1Z0WA 1XMQI 4DR5E 1H7UA 2R42A 4DR4I 1PKPA 2AJ4A 2Z5CB 2FGGA 4RPFA 4JYAE 4DPTA 3ZZTA 3J7AM 4AQYI 2MC6A 2ODRC 1N34I 1MU5A 4FW9A 4K0KI 1Y6ZA 1O0WA 2UXDI 2CGEA 5DNYA 2EWLA 2YT4A 4LFBI 4LF4I 2V8PA 4JI8I 2CZ9A 1Z59A 2RS7A 2Z5BB 4DR6E 1I94E 4NXME 1Z5BA 3JAMQ 4IZKA 1KIJA 1PIEA 2R3VA 1IBLE 1Z0EA 5AASA 4FWHA 4DR7I 2UXBE 2IHR1 1X48A 2V88A 1YZ9A 1MG7A 1Z0GA 3H09A 4FN5A 4DKKA 1ZBTA 2LBSB 2E5LI 4DV2I 4DV1E 3LMLA 3Q6NA 3LNUA 3ZKDA 2F8BA 2NUGA 2UXDE 4IZJD 2HKJA 4L5NC 3ZZUA 4I3HA 4B3MI 2E1RA 2HK3A 3WU5A 4M2ZA 5F3WA 1EKZA 4NXMI 4DR3I 3AUZA 4X8WA 2HHHI 3ADGA 3PYEA 1BKNA 1IBLI 3PRYA 3T1HI 2CPNA 3K85A 1WUUA 1QU6A 2LUQA 2YZTA 2G7HA 3ZOQB 1UHZA 4XTJA 3K17A 2BV3A 4DV2E 2WW4A 3Q6MA 2ZITA 4DPXA 4DV4I 1H74A 4GKKE 3QT7A 1N33I 1A6FA 4ZVIA 5AE1A 3HTXA 4LF9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GS8 A;  1XMO E;  2UXC I;  1ZM9 A;  2ZM6 I;  5IT9 Q;  1N36 E;  4JI1 I;  4DR2 I;  1FNM A;  1N0U A;  1Z5C A;  4HYM A;  1J5E E;  2UU9 I;  4DV4 E;  1KKH A;  4Z7C A;  4GKK I;  4LFC I;  1OJ4 A;  1KTV A;  2A2C A;  1ELO A;  4JI0 E;  4LF7 E;  4JV5 I;  3J7A G;  1XMO I;  4HXZ A;  5LMN I;  4PRV A;  4NXN E;  5LMU I;  4LF8 E;  2BM1 A;  4FWD A;  4JI4 E;  3WU3 A;  1HNZ E;  4JI1 E;  3ZZ0 A;  1Z0T A;  4B3R I;  3PYG A;  4R1F A;  4LFC E;  1XMQ E;  4DR5 I;  1ZXM A;  4DR4 E;  3PYF A;  1FKA E;  4JI0 I;  4LF7 I;  1IBK I;  4HY1 A;  3CWV A;  4AQY E;  1PVG A;  4X64 E;  4DV5 I;  1H73 A;  2LJP A;  3B78 A;  4LFB E;  4LF4 E;  4DU7 A;  1HNW I;  2V2V A;  5A2Q Q;  4X62 I;  4DR6 I;  1Z0B A;  1ZM4 A;  3OTO E;  2VQE I;  1I94 I;  4JG4 A;  5IT9 C;  2OI2 A;  4JI3 E;  4LF6 E;  2UXB I;  2UUA E;  1IBK E;  3J80 C;  1XHK A;  2VF3 A;  2E5L E;  4DV1 I;  2UUB I;  4X64 I;  4DV5 E;  4YY3 E;  4B3M E;  1HNW E;  1FI4 A;  1NHI A;  2VQE E;  1RRE A;  4DPY A;  3T1Y I;  1D6T A;  2HHH E;  4JI3 I;  4USM A;  2X36 A;  1IBM I;  3T1H E;  4B3T I;  2UUA I;  1KVK A;  1EA6 A;  4PU9 A;  2XEX A;  1QZR A;  2X7I A;  2UUB E;  4JI7 I;  5IWA I;  2UUC I;  4YY3 I;  4DPU A;  3V2U C;  3B82 A;  1U2R A;  2BM0 A;  2V2Z A;  4KQV A;  2DEI A;  5FLX Q;  4X65 E;  4DR1 E;  5FLX C;  5A2Q C;  1HR0 I;  4DV0 E;  1K47 A;  4UT4 A;  1H72 C;  4DV6 I;  5IWA E;  3B8H A;  2UUC E;  3J81 C;  1HNX E;  1XNR E;  1H7S A;  4M1K A;  4YHH I;  4ED4 A;  5LMN E;  5LMU E;  1NHH A;  4LF8 I;  1ZM3 A;  4DR1 I;  4JI4 I;  4JI6 E;  2VQF E;  1HR0 E;  4DV0 I;  4EMD A;  1EI1 A;  4B3R E;  4LF5 E;  4DV6 E;  1S16 A;  4B3S I;  4OX9 E;  3GON A;  3WU6 A;  1N0V C;  3J81 Q;  4DUY I;  3LPS A;  4DUZ I;  3J80 Q;  2ZBK B;  1MX0 A;  2NPF A;  3QT6 A;  2VQF I;  1NZ0 A;  4JI2 I;  1B62 A;  1S4E A;  2V34 A;  3ZM7 A;  4X62 E;  3OTO I;  3LTO A;  4DV3 E;  4B3S E;  4OX9 I;  4URL A;  1NHJ A;  1N34 E;  4DUZ E;  4K0K E;  4LF6 I;  2HKE A;  4PRX A;  3V5R A;  3D4J A;  4JI8 E;  1Z0V A;  1FWL A;  1Z0C A;  1ZM2 A;  4JI2 E;  4P7A A;  4X66 E;  5L3J A;  4DR7 E;  4DV3 I;  2A2D A;  2EFG A;  3T1Y E;  4Z7Y A;  2Q2E B;  1IBM E;  4B3T E;  5GME A;  1ZXN A;  3PYD A;  3M6A A;  4MYU A;  2HFU A;  1N32 I;  4WUD A;  4JI7 E;  4JI5 I;  2J7K A;  2HFS A;  4DR3 E;  2V2Q A;  4MYT A;  1B63 A;  4X66 I;  1FWK A;  4USK A;  3QT8 A;  4WUC A;  5GMD A;  4UTG A;  1XNQ I;  1UEK A;  3F0N A;  4WUB A;  4X65 I;  1RR9 A;  3Q1Q A;  4GKJ E;  3K1J A;  1N33 E;  1N32 E;  4LF9 I;  4JI5 E;  2UXC E;  4FWG A;  4DV7 I;  1VIS A;  1FJG E;  1HNX I;  1XNR I;  4DPW A;  2ZM6 E;  4KHP E;  3WU4 A;  1N36 I;  4YHH E;  1XNQ E;  4HAC A;  4DR2 E;  1Z5A A;  3ZKB A;  4DU8 A;  4LFA E;  2DEJ A;  4JI6 I;  1J5E I;  2UU9 E;  5BR8 E;  2F4V I;  4GKJ I;  4HAC B;  4P52 A;  3QT5 A;  4JV5 E;  4LF5 I;  5LL6 R;  4DXL A;  4JYA I;  4DV7 E;  1FJG I;  3H4L A;  4NXN I;  4DUY E;  4KHP I;  1HNZ I;  2HK2 A;  1DAR A;  4LFA I;  3JAM C;  3HUL A;  5BR8 I;  2F4V E;  1Z0W A;  1XMQ I;  4DR5 E;  1H7U A;  2R42 A;  4DR4 I;  1PKP A;  2AJ4 A;  4RPF A;  4JYA E;  4DPT A;  3ZZT A;  3J7A M;  4AQY I;  1N34 I;  1MU5 A;  4FW9 A;  4K0K I;  2UXD I;  4LFB I;  4LF4 I;  2V8P A;  4JI8 I;  2CZ9 A;  1Z59 A;  4DR6 E;  1I94 E;  4NXM E;  1Z5B A;  3JAM Q;  1PIE A;  1KIJ A;  2R3V A;  1IBL E;  1Z0E A;  4FWH A;  4DR7 I;  2UXB E;  1Z0G A;  1MG7 A;  4FN5 A;  2E5L I;  4DV2 I;  4DV1 E;  3LNU A;  3ZKD A;  2UXD E;  2HKJ A;  3ZZU A;  4I3H A;  4B3M I;  2E1R A;  2HK3 A;  3WU5 A;  4NXM I;  4DR3 I;  2HHH I;  3PYE A;  1BKN A;  1IBL I;  3T1H I;  1WUU A;  4XTJ A;  3K17 A;  2BV3 A;  4DV2 E;  2WW4 A;  2ZIT A;  4DPX A;  4DV4 I;  1H74 A;  4GKK E;  3QT7 A;  1N33 I;  1A6F A;  4ZVI A;  4LF9 E; 
#chains in the Genus database with same CATH topology
 2GS8 A;  2L8T A;  1XMO E;  2UXC I;  2N3G A;  2LVH A;  2EMC A;  2B9D A;  5C0X D;  4BC7 A;  1ZM9 A;  2ZM6 I;  4WSP A;  1J26 A;  2M1S A;  2B3T B;  5IT9 Q;  5A6A A;  2I13 A;  2YTD A;  4BHB A;  1N36 E;  2JYA A;  2NAB A;  5AE2 A;  4JI1 I;  3BF2 A;  2L6M A;  2CT1 A;  1YHC A;  4DR2 I;  1FNM A;  3F6H A;  4OO1 F;  2EM3 A;  1PDA A;  3P3E A;  1N0U A;  1Z5C A;  5DNL A;  1X3C A;  4HYM A;  2NA2 A;  5AC4 A;  1J5E E;  4MQY A;  2UU9 I;  4DV4 E;  1KKH A;  2C38 B;  4Z7C A;  4GKK I;  1PJT A;  3P06 A;  2EN2 A;  4LFC I;  2EMY A;  1OJ4 A;  1WXR A;  2WBS A;  1KTV A;  5K36 F;  2L2N A;  4L8N A;  2A2C A;  1ELO A;  4JI0 E;  1N3G A;  4LF7 E;  2EM4 A;  4JV5 I;  3J7A G;  3ADJ A;  2EQ1 A;  2EPC A;  5ADZ A;  4R2P A;  1Y4U A;  1XMO I;  4HXZ A;  5AC5 A;  2NN6 F;  5LMN I;  4NXN E;  4LCF A;  4PRV A;  5LMU I;  1NEI A;  4LF8 E;  2BM1 A;  1AAY A;  2EM6 A;  4FWD A;  4JI4 E;  2B7T A;  3WU3 A;  4IFD D;  3IWD A;  4WSG A;  2Z5C A;  1HNZ E;  5LLQ A;  2EMF A;  4JI1 E;  2PO0 A;  3ZZ0 A;  4BHC A;  3VYY A;  3HQ1 A;  5C0X C;  2EPN A;  4ZYD A;  5DRQ A;  3M85 G;  4N4R B;  3JTZ A;  4IFD B;  1Y5Y A;  1Z0T A;  4B3R I;  2WP8 A;  1A1J A;  2EOM A;  2C37 A;  2CTD A;  2L2M A;  2IOQ A;  4F9A B;  4OO1 B;  3PYG A;  2O1T A;  5JEA F;  3M99 B;  4R1F A;  4OKG A;  4LFC E;  1XMQ E;  4DR5 I;  4BCA A;  2NN6 E;  4DR4 E;  1ZXM A;  4J3D A;  3PYF A;  1FKA E;  2LMZ A;  3IWC A;  4JI0 I;  4LF7 I;  4OOG C;  3F6G A;  1UDN A;  3CDI A;  1IBK I;  4HY1 A;  3CWV A;  2YTN A;  4AQY E;  2NN6 A;  1PVG A;  4GQU A;  1WHQ A;  2JOX A;  1UN6 B;  2PNM A;  2BBG A;  2RPC A;  1HK7 A;  4MLQ A;  4X64 E;  2DLK A;  1PJQ A;  4F9B B;  4IJD A;  3FIG A;  1XXE A;  4DV5 I;  2O1V A;  1H73 A;  2GO3 A;  2LJP A;  4BS9 A;  4LF4 E;  4LF9 E;  4LFB E;  3B78 A;  2V2V A;  4FW4 A;  4LOM A;  4DU7 A;  2M7Q A;  5A2Q Q;  1HNW I;  1T4L B;  2LE2 A;  4X62 I;  4DR6 I;  1Z0B A;  1ZM4 A;  3OTO E;  4AM3 A;  2VQE I;  2YTE A;  4FW5 A;  2EOR A;  2GO4 A;  4JG4 A;  1I94 I;  1DQ3 A;  3K6Q A;  1YH8 A;  2V83 A;  5IT9 C;  4IS1 C;  4TUG A;  2OI2 A;  4P78 A;  1G2D C;  1X47 A;  4JI3 E;  2LJH A;  2RSI A;  3L7Z B;  4LF6 E;  2LCE A;  4KZS A;  2MC5 A;  2EP3 A;  1P42 A;  2UXB I;  1T4N A;  4NBQ A;  2UUA E;  2V85 A;  1IBK E;  3J80 C;  2GLI A;  1XHK A;  2EOO A;  5KL7 A;  1L4S A;  2VF3 A;  4M30 A;  1A1H A;  3EQ1 A;  2EL5 A;  2DLQ A;  2E5L E;  4I8O A;  1OYR A;  4DV1 I;  2FTX B;  2UUB I;  4HTG A;  2NN6 D;  4X64 I;  2DB2 A;  4AIM A;  2LUP B;  5KL3 A;  4OO1 E;  4DMI A;  4DV5 E;  4YY3 E;  2VRD A;  2ELY A;  4B3M E;  4R2A A;  3EPJ A;  1HNW E;  1Y4S A;  1FI4 A;  2IES A;  2YU5 A;  1NHI A;  2VQE E;  4GZN C;  1RRE A;  4DPY A;  3T1Y I;  5K36 A;  2RS6 A;  1YYK A;  1D6T A;  2HHH E;  2LT7 A;  4QNJ A;  4JI3 I;  4USM A;  2X36 A;  2WNR B;  1IBM I;  3T1H E;  4B3T I;  2E1M A;  1A1K A;  2UUA I;  2H36 X;  1X6E A;  5EKW A;  1KVK A;  1RQ0 A;  1EA6 A;  4PU9 A;  3U1Y A;  2XEX A;  2D9H A;  1MEY C;  4AID A;  1QZR A;  4MDT A;  4LTY A;  3EPK A;  5CFF E;  2UUB E;  2WP8 B;  2X7I A;  5IWA I;  4JI7 I;  5ELW A;  2UUC I;  4YY3 I;  2EOE A;  4WXC A;  2DMI A;  2PO0 B;  3V2U C;  4DPU A;  4R03 A;  2F1D A;  3THN A;  4IZK B;  2ODR D;  3B82 A;  2YTP A;  2EMZ A;  3AV0 A;  4F9C B;  1U2R A;  2BM0 A;  4Q35 B;  2V2Z A;  5JEA C;  4FK5 C;  4OZE A;  4KQV A;  2DEI A;  3DJW A;  4R2D A;  5FLX Q;  1GZ6 A;  1T4O A;  2RSM A;  4M0V A;  2C38 A;  2WBT A;  4WX9 A;  4X65 E;  4DR1 E;  5A6B D;  2FV4 B;  5FLX C;  3VYX A;  2EPM X;  4HEI A;  1Z1B A;  4IZJ A;  5A6J A;  5A2Q C;  2YRM A;  2O1W A;  2EML A;  1HR0 I;  1NCS A;  4WPY A;  2V87 A;  2YRK A;  4BBY A;  4DV0 E;  1G2F C;  2NUF A;  1K47 A;  2CSH A;  4UT4 A;  4MLV A;  1H72 C;  2EM7 A;  2JEB B;  4ZYG A;  4F54 A;  5IWA E;  4DV6 I;  3LLH A;  4IZJ B;  3B8H A;  2UUC E;  2E72 A;  2YTG A;  5K36 E;  3DF6 A;  2EMH A;  2EN7 A;  3J81 C;  4LCH A;  1HNX E;  2KON A;  1XNR E;  4FW3 A;  2M9A A;  1H7S A;  3MHH C;  4M1K A;  2JEA A;  2NUE A;  4YHH I;  1UDS A;  1ZR9 A;  4ED4 A;  5LMN E;  2WCC 3;  2JXP A;  3BGH A;  5LMU E;  1NHH A;  1WRJ A;  1ZM3 A;  4DR1 I;  4LF8 I;  1PJS A;  2YSO A;  4JI4 I;  1E3H A;  4JI6 E;  1GTK A;  3OML A;  2I9I A;  4RHB B;  3M7N D;  2VQF E;  1IQO A;  2HJJ A;  1HR0 E;  2PO2 A;  2R76 A;  2JR1 A;  4DV0 I;  3ADI A;  4EMD A;  1EI1 A;  2JOB A;  2GQ0 A;  2EPL X;  4B3R E;  4LF5 E;  4DV6 E;  1S16 A;  4B3S I;  1YSA C;  5JEA B;  2B7V A;  4OX9 E;  2EM0 A;  2DRP A;  2RTX A;  2PNL A;  3GON A;  3WU6 A;  1N0V C;  3J81 Q;  4DUY I;  3J7Y p;  3LPS A;  2WBU A;  4DUZ I;  2JP9 A;  2ENA A;  2PNZ B;  3J80 Q;  1A1G A;  2PRT A;  2JE6 B;  2ZBK B;  3MSW A;  3PS2 A;  1MX0 A;  1UIL A;  2C39 B;  4BA1 B;  2LTS A;  2NPF A;  1WHN A;  3CDJ A;  1B69 A;  2KOU A;  2EOZ A;  4Q28 A;  3HPZ A;  2EQ0 A;  3C4B A;  1YYW A;  1EH6 A;  3L7Z A;  2EN8 A;  3QT6 A;  2MKD A;  2EZ6 A;  2VQF I;  4IFD A;  1NZ0 A;  2EN6 A;  5A6K A;  5IV8 B;  2BA1 G;  2NN6 B;  4JI2 I;  1B62 A;  2K7I A;  1S4E A;  2V34 A;  2JPA A;  3ZM7 A;  4BMJ A;  2YRH A;  4X62 E;  2DSY A;  4OO1 D;  4NZV A;  4DV3 E;  1BBO A;  4B3S E;  3LTO A;  3OTO I;  2EM2 A;  4OX9 I;  4URL A;  2L3J A;  4R2S A;  2EMG A;  1NHJ A;  2JY9 A;  4R2Q A;  1SFE A;  2WZO A;  2YPN A;  3RMP A;  1UDO A;  4WYQ B;  4P7D A;  1N34 E;  3EPL A;  2BA1 D;  2PO2 B;  2EOI A;  2CVE A;  4DUZ E;  4K0K E;  2C37 B;  4LF6 I;  2EPU A;  4MU0 A;  2HKE A;  2LTR A;  4TUI A;  3BBG A;  1X6H A;  4PRX A;  3V5R A;  5KL2 A;  2DGC A;  3D4J A;  2VE7 C;  4JI8 E;  1Z0V A;  2O1U A;  3DD6 A;  1FWL A;  4KWY A;  4N3O A;  1Z0C A;  2O3Z A;  1ZM2 A;  5TSE A;  1USV A;  2EMI A;  2EJ4 A;  2EOX A;  2L3C A;  4JI2 E;  4P7A A;  2GHF A;  2LO3 A;  3KWR A;  1OYP A;  4FW6 A;  4X66 E;  5L3J A;  4DR7 E;  4DV3 I;  2VF1 A;  2A2D A;  3T1Y E;  2EFG A;  2Z5B A;  2JEA B;  1RC7 A;  2L2K B;  2L33 A;  4MU3 A;  4Z7Y A;  3C4T A;  1X5W A;  4R2C A;  3THO B;  3GME A;  2MKN A;  4RH8 A;  2M4I A;  2Q2E B;  5FWK A;  1KYQ A;  1IBM E;  2N3H A;  2PO1 B;  4B3T E;  5GME A;  3JU0 A;  1ZXN A;  1IQS A;  3C6M A;  5C0X E;  2EN3 A;  2HGH A;  3PYD A;  3M6A A;  3U1K A;  2ADR A;  2LRS A;  4MYU A;  2HFU A;  1N32 I;  1JK2 A;  4WUD A;  2YTJ A;  2EMA A;  4IFD C;  3MHS C;  4J8Z A;  4JI7 E;  4JI5 I;  1ZU1 A;  4U3D A;  2PO1 A;  5KL4 A;  3ADL A;  2J7K A;  5C0X A;  4DR3 E;  2HFS A;  3NZK A;  2V89 A;  3P3G A;  2EMB A;  2V2Q A;  4MYT A;  5T6J A;  1DGC A;  4IFD F;  2EOQ A;  1B63 A;  4X66 I;  1FWK A;  1GQE A;  4BA2 A;  4USK A;  3QT8 A;  4WUC A;  2WNR A;  5GMD A;  4UTG A;  1X49 A;  1VI7 A;  4O4K A;  2BR2 A;  1XNQ I;  2EOF A;  2EM9 A;  4ZYE A;  1UEK A;  2EOS A;  3F0N A;  2EM8 A;  4WUB A;  5K36 B;  2V86 A;  4X65 I;  2N8X A;  1YYO A;  3VK6 A;  1RR9 A;  2BA0 D;  2YTO A;  3IWB A;  3TQM A;  4GKJ E;  4R8O A;  3Q1Q A;  1P47 A;  1STU A;  3K1J A;  1N33 E;  4OO1 C;  1N32 E;  1A1I A;  3VHT B;  1ZBQ A;  4LF9 I;  5IXM B;  1ZAA C;  2PNZ A;  4JI5 E;  2YSP A;  4R2R A;  2UXC E;  4FWG A;  4DV7 I;  1VIS A;  1FJG E;  2DMY A;  4F6M A;  3HKM A;  4WFT A;  1JK1 A;  2C39 A;  4BA1 A;  4DPW A;  1HNX I;  1XNR I;  2ZM6 E;  4KHP E;  1BBG A;  2DIX A;  1YUI A;  3GLL A;  4ZYH A;  1YUJ A;  3WU4 A;  4LU9 A;  4YHH E;  1N36 I;  4F6N A;  1XNQ E;  2L92 A;  4HAC A;  3HXL A;  4DR2 E;  4GEQ B;  1AH5 A;  4BC9 A;  1Z5A A;  2ENH A;  3HJC A;  3ZKB A;  3P3C A;  4DU8 A;  4LFA E;  5JEA E;  3UHM A;  3KRN A;  2DEJ A;  2YU8 A;  3HPS A;  1T39 A;  4JI6 I;  1J5E I;  1X6F A;  4OO1 A;  4O43 A;  2UU9 E;  5BR8 E;  2F4V I;  2JVA A;  4U3B A;  4GKJ I;  3C6K A;  5DNX A;  2MDR A;  4WXD A;  2BR2 B;  1USU A;  3B4T A;  4HAC B;  4P52 A;  3QT5 A;  4JV5 E;  4LF5 I;  5LL6 R;  4DXL A;  4JYA I;  2IOP A;  4DV7 E;  2EL6 A;  1FJG I;  4QNK A;  1WJP A;  3H4L A;  4NXN I;  5AE3 A;  4DUY E;  5EL9 A;  4M9V C;  2EOH A;  2KHX A;  2Z5E A;  5C0X B;  1OYS A;  4KHP I;  4BA2 B;  1A1F A;  1HNZ I;  2RQL A;  2V8Q B;  2CG9 A;  2EL4 A;  4MU1 A;  2HK2 A;  2ELZ A;  1KJK A;  2EN1 A;  4ISA A;  2EPR A;  1DAR A;  4LFA I;  1IMU A;  2JWO A;  5DRP A;  1F2I G;  3JAM C;  3HUL A;  1SR9 A;  2K4V A;  1DI2 A;  2JEB A;  3UK3 C;  2F4V E;  2A25 A;  5BR8 I;  1Z0W A;  4F2J C;  4DR5 E;  1XMQ I;  1R6L A;  1H7U A;  2R42 A;  4DR4 I;  1PKP A;  2AJ4 A;  2EPX A;  2EM5 A;  2Z5C B;  2FGG A;  1Y60 A;  2BA0 G;  4JYA E;  4RPF A;  3QG5 C;  2EQ3 A;  2NN6 C;  4DPT A;  2VES A;  1E3P A;  2HC5 A;  2J7J A;  4LCG A;  3ZZT A;  3J7A M;  2EOY A;  1YFH A;  2MC6 A;  2EN4 A;  5KL5 A;  3PS3 A;  4AQY I;  2ODR C;  5A69 A;  2IER A;  1N34 I;  3L00 A;  1MU5 A;  3P76 A;  4FW9 A;  4K0K I;  1Y6Z A;  4FW7 A;  1O0W A;  1TF3 A;  2UXD I;  2CGE A;  5DNY A;  2EWL A;  2YTI A;  4IS9 A;  2YT4 A;  4LFB I;  4LF4 I;  2V8P A;  5C0X F;  4JI8 I;  1R6M A;  2CZ9 A;  1Z59 A;  2RS7 A;  3KZZ A;  4DR6 E;  2Z5B B;  4MU4 A;  1I94 E;  3EPH A;  2EMK A;  4NXM E;  1Z5B A;  3JAM Q;  4IZK A;  2EOJ A;  2EMW A;  1KIJ A;  1PIE A;  2J65 A;  2EPZ A;  2R3V A;  1IBL E;  4LPF A;  1Z0E A;  4O5G A;  5AAS A;  1UDQ A;  4FWH A;  5JEA D;  4DR7 I;  2EPA A;  2UXB E;  2IHR 1;  1X48 A;  2V88 A;  1YZ9 A;  4O24 A;  2LJU A;  1MG7 A;  1Z0G A;  1QNT A;  4IFD E;  3H09 A;  4FN5 A;  4DKK A;  2LV2 A;  1ZBT A;  2LBS B;  5DRO A;  2E5L I;  4DV2 I;  4DV1 E;  3LML A;  1RMD A;  3Q6N A;  3LNU A;  2R1F A;  2ENC A;  2F8B A;  2NUG A;  3ZKD A;  2BB8 A;  2UXD E;  1EH7 A;  1MGT A;  2EE8 A;  2EMX A;  5A6B A;  4L5N C;  2HKJ A;  4IZJ D;  3ZZU A;  4I3H A;  4B3M I;  2E1R A;  3KZY A;  2HK3 A;  3WU5 A;  2EPP A;  2Q8U A;  3M85 D;  4M2Z A;  3BID A;  5F3W A;  5K36 C;  2MDG A;  3PS1 A;  1EKZ A;  4NXM I;  2YWQ A;  2JT2 A;  4DR3 I;  3AUZ A;  1EH8 A;  4X8W A;  2HHH I;  3ADG A;  3PYE A;  3GCM A;  2JE6 A;  2YTQ A;  1TN9 A;  1BKN A;  1RHY A;  1UBD C;  3PRY A;  1IBL I;  3T1H I;  3ECR A;  1LLM C;  2CPN A;  2YTF A;  3K85 A;  1WUU A;  1QU6 A;  2LUQ A;  5DRR A;  2EPK X;  4R2E A;  2YZT A;  1YPN A;  3ZOQ B;  2G7H A;  2AE8 A;  1UHZ A;  4XTJ A;  3K17 A;  2BV3 A;  5KL6 A;  4DV2 E;  4X9J A;  2WW4 A;  1T38 A;  1BB8 A;  3M7N G;  3Q6M A;  1A1L A;  2ZIT A;  4DPX A;  4DV4 I;  1H74 A;  2EPO A;  4NHR A;  4GKK E;  3QT7 A;  5K36 D;  1N33 I;  1A6F A;  4ZVI A;  5JEA A;  5AE1 A;  2GPI A;  3H1C A;  3HTX A;  3P1X A;  1TF6 A; 
#chains in the Genus database with same CATH homology
 2GS8 A;  2L8T A;  1XMO E;  2UXC I;  2N3G A;  2B9D A;  4BC7 A;  1ZM9 A;  2ZM6 I;  4WSP A;  1J26 A;  2M1S A;  2B3T B;  5IT9 Q;  1N36 E;  4JI1 I;  5AE2 A;  2L6M A;  4DR2 I;  1FNM A;  3F6H A;  1N0U A;  1Z5C A;  4HYM A;  2NA2 A;  1J5E E;  2UU9 I;  4DV4 E;  1KKH A;  4Z7C A;  4GKK I;  3P06 A;  4LFC I;  1OJ4 A;  1WXR A;  1KTV A;  2L2N A;  4L8N A;  2A2C A;  1ELO A;  4JI0 E;  4LF7 E;  4JV5 I;  3J7A G;  3ADJ A;  5ADZ A;  1XMO I;  1Y4U A;  4HXZ A;  5LMN I;  4NXN E;  4PRV A;  5LMU I;  4LF8 E;  2BM1 A;  4FWD A;  4JI4 E;  2B7T A;  3WU3 A;  3IWD A;  2Z5C A;  1HNZ E;  4JI1 E;  3ZZ0 A;  3VYY A;  3HQ1 A;  3JTZ A;  1Z0T A;  4B3R I;  2L2M A;  2IOQ A;  4F9A B;  3PYG A;  2O1T A;  4R1F A;  4LFC E;  1XMQ E;  4DR5 I;  4BCA A;  4DR4 E;  1ZXM A;  3PYF A;  1FKA E;  2LMZ A;  3IWC A;  4JI0 I;  4LF7 I;  4OOG C;  3F6G A;  1IBK I;  4HY1 A;  3CWV A;  4AQY E;  1PVG A;  1WHQ A;  2JOX A;  2PNM A;  1HK7 A;  4X64 E;  4F9B B;  3FIG A;  4DV5 I;  2O1V A;  1H73 A;  2LJP A;  3B78 A;  4BS9 A;  4LF4 E;  4LFB E;  4DU7 A;  1HNW I;  2V2V A;  5A2Q Q;  2M7Q A;  1T4L B;  2LE2 A;  4X62 I;  4DR6 I;  1Z0B A;  1ZM4 A;  3OTO E;  2VQE I;  1I94 I;  4JG4 A;  1DQ3 A;  3K6Q A;  2V83 A;  5IT9 C;  4TUG A;  2OI2 A;  4P78 A;  4JI3 E;  1X47 A;  2LJH A;  4LF6 E;  4KZS A;  2MC5 A;  2UXB I;  1T4N A;  2UUA E;  2V85 A;  1IBK E;  3J80 C;  1XHK A;  2VF3 A;  4M30 A;  2E5L E;  4I8O A;  4DV1 I;  2FTX B;  2UUB I;  4X64 I;  2DB2 A;  2LUP B;  4DMI A;  4DV5 E;  4YY3 E;  4B3M E;  1HNW E;  1Y4S A;  1FI4 A;  1NHI A;  2VQE E;  1RRE A;  4DPY A;  3T1Y I;  2RS6 A;  1YYK A;  1D6T A;  2HHH E;  4JI3 I;  4USM A;  2X36 A;  1IBM I;  3T1H E;  4B3T I;  2E1M A;  2UUA I;  2H36 X;  1KVK A;  1RQ0 A;  1EA6 A;  4PU9 A;  2XEX A;  1QZR A;  4LTY A;  2UUB E;  5CFF E;  2X7I A;  5IWA I;  4JI7 I;  2UUC I;  4YY3 I;  4DPU A;  3V2U C;  4R03 A;  4IZK B;  2ODR D;  3B82 A;  3AV0 A;  4F9C B;  1U2R A;  2BM0 A;  2V2Z A;  4KQV A;  2DEI A;  3DJW A;  5FLX Q;  1GZ6 A;  1T4O A;  2RSM A;  4M0V A;  4X65 E;  4DR1 E;  4IZJ A;  2FV4 B;  5FLX C;  3VYX A;  5A2Q C;  2O1W A;  1HR0 I;  4WPY A;  2V87 A;  4BBY A;  4DV0 E;  2NUF A;  1K47 A;  4UT4 A;  1H72 C;  4F54 A;  5IWA E;  4DV6 I;  3LLH A;  4IZJ B;  3B8H A;  2UUC E;  3DF6 A;  3J81 C;  1HNX E;  2KON A;  1XNR E;  1H7S A;  4M1K A;  2NUE A;  4YHH I;  4ED4 A;  5LMN E;  5LMU E;  1NHH A;  4LF8 I;  1ZM3 A;  4DR1 I;  4JI4 I;  4JI6 E;  3OML A;  2VQF E;  1HR0 E;  4DV0 I;  2JR1 A;  3ADI A;  4EMD A;  1EI1 A;  2JOB A;  2GQ0 A;  4B3R E;  4LF5 E;  4DV6 E;  1S16 A;  4B3S I;  2B7V A;  4OX9 E;  2RTX A;  2PNL A;  3GON A;  3WU6 A;  1N0V C;  3J81 Q;  4DUY I;  3J7Y p;  3LPS A;  4DUZ I;  3J80 Q;  2ZBK B;  3MSW A;  1MX0 A;  1UIL A;  2LTS A;  2NPF A;  1WHN A;  2KOU A;  4Q28 A;  3HPZ A;  3C4B A;  1YYW A;  3QT6 A;  2EZ6 A;  2VQF I;  1NZ0 A;  4JI2 I;  1B62 A;  1S4E A;  2V34 A;  3ZM7 A;  4BMJ A;  4X62 E;  2DSY A;  3OTO I;  4DV3 E;  3LTO A;  4B3S E;  4OX9 I;  4URL A;  2L3J A;  1NHJ A;  2JY9 A;  2WZO A;  3RMP A;  4WYQ B;  4P7D A;  1N34 E;  4DUZ E;  4K0K E;  4LF6 I;  2HKE A;  2LTR A;  4TUI A;  4PRX A;  3V5R A;  3D4J A;  2VE7 C;  4JI8 E;  1Z0V A;  2O1U A;  1FWL A;  4N3O A;  1Z0C A;  1ZM2 A;  1USV A;  2L3C A;  4JI2 E;  4P7A A;  3KWR A;  4X66 E;  5L3J A;  4DR7 E;  4DV3 I;  2VF1 A;  2A2D A;  3T1Y E;  2EFG A;  2Z5B A;  1RC7 A;  2L2K B;  2L33 A;  4Z7Y A;  3C4T A;  2M4I A;  2Q2E B;  5FWK A;  1IBM E;  2N3H A;  4B3T E;  5GME A;  3JU0 A;  1ZXN A;  3PYD A;  3M6A A;  2LRS A;  4MYU A;  2HFU A;  1N32 I;  4WUD A;  4J8Z A;  4JI7 E;  4JI5 I;  3ADL A;  2J7K A;  4DR3 E;  2HFS A;  2V89 A;  2V2Q A;  4MYT A;  5T6J A;  1B63 A;  4X66 I;  1FWK A;  1GQE A;  4USK A;  3QT8 A;  4WUC A;  5GMD A;  4UTG A;  1X49 A;  1XNQ I;  1UEK A;  3F0N A;  4WUB A;  2V86 A;  4X65 I;  1YYO A;  3VK6 A;  1RR9 A;  3Q1Q A;  3IWB A;  4GKJ E;  4R8O A;  1STU A;  3K1J A;  1N33 E;  1N32 E;  3P1X A;  1ZBQ A;  4LF9 I;  4JI5 E;  2UXC E;  4FWG A;  4DV7 I;  1VIS A;  1FJG E;  2DMY A;  4WFT A;  1HNX I;  1XNR I;  4DPW A;  2ZM6 E;  4KHP E;  2DIX A;  3WU4 A;  1N36 I;  4LU9 A;  4YHH E;  1XNQ E;  2L92 A;  4HAC A;  3HXL A;  4DR2 E;  4GEQ B;  4BC9 A;  1Z5A A;  3HJC A;  3ZKB A;  4DU8 A;  4LFA E;  2DEJ A;  3HPS A;  4JI6 I;  1J5E I;  2UU9 E;  5BR8 E;  2F4V I;  2JVA A;  4GKJ I;  2MDR A;  4HAC B;  1USU A;  4P52 A;  3QT5 A;  4JV5 E;  4LF5 I;  5LL6 R;  4DXL A;  4JYA I;  2IOP A;  4DV7 E;  1FJG I;  3H4L A;  4NXN I;  5AE3 A;  4DUY E;  2KHX A;  2Z5E A;  4KHP I;  1HNZ I;  2V8Q B;  2CG9 A;  2HK2 A;  1DAR A;  4LFA I;  2JWO A;  3JAM C;  3HUL A;  1SR9 A;  2K4V A;  1DI2 A;  2F4V E;  5BR8 I;  1Z0W A;  1XMQ I;  4DR5 E;  1H7U A;  2R42 A;  4DR4 I;  1PKP A;  2AJ4 A;  2Z5C B;  2FGG A;  4RPF A;  4JYA E;  4DPT A;  3ZZT A;  3J7A M;  4AQY I;  2MC6 A;  2ODR C;  1N34 I;  1MU5 A;  4FW9 A;  4K0K I;  1Y6Z A;  1O0W A;  2UXD I;  2CGE A;  5DNY A;  2EWL A;  2YT4 A;  4LFB I;  4LF4 I;  2V8P A;  4JI8 I;  2CZ9 A;  1Z59 A;  2RS7 A;  2Z5B B;  4DR6 E;  1I94 E;  4NXM E;  1Z5B A;  3JAM Q;  4IZK A;  1KIJ A;  1PIE A;  2R3V A;  1IBL E;  1Z0E A;  5AAS A;  4FWH A;  4DR7 I;  2UXB E;  2IHR 1;  1X48 A;  2V88 A;  1YZ9 A;  1MG7 A;  1Z0G A;  3H09 A;  4FN5 A;  4DKK A;  1ZBT A;  2LBS B;  2E5L I;  4DV2 I;  4DV1 E;  3LML A;  3Q6N A;  3LNU A;  3ZKD A;  2F8B A;  2NUG A;  2UXD E;  4IZJ D;  2HKJ A;  4L5N C;  3ZZU A;  4I3H A;  4B3M I;  2E1R A;  2HK3 A;  3WU5 A;  4M2Z A;  5F3W A;  1EKZ A;  4NXM I;  4DR3 I;  3AUZ A;  4X8W A;  2HHH I;  3ADG A;  3PYE A;  1BKN A;  1IBL I;  3PRY A;  3T1H I;  2CPN A;  3K85 A;  1WUU A;  1QU6 A;  2LUQ A;  2YZT A;  2G7H A;  3ZOQ B;  1UHZ A;  4XTJ A;  3K17 A;  2BV3 A;  4DV2 E;  2WW4 A;  3Q6M A;  2ZIT A;  4DPX A;  4DV4 I;  1H74 A;  4GKK E;  3QT7 A;  1N33 I;  1A6F A;  4ZVI A;  5AE1 A;  3HTX A;  4LF9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...