3J7AG

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
224
Chain Sequence
KNWVPVTKLGRLVKEGKIVSIEEIYLHSLPIKEYQIIDYFFQPNECSHPLKDDVVKIMPVQKQTRAGQRTRFKAFVAIGDGNGHCGLGVKCAKEVATAIRGAIISAKLSLIPVRRGYWGNKIGDPHTVPMKVSGKCGSVRIRLVPAPRGTQIVGAPTTKKMLNFAGIKDCFSSSCGKTKTKGNFLRAIFNALSKTYGYLTPDLWKVTNFDKSPYEEWSDFLETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
total genus 46
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
G PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j7aG01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j7aG02
3OTOE 4LF9E 4GKKI 4JI0I 1ZM4A 4X64E 1N0UA 2V2QA 1KVKA 4USMA 4DV7I 4JI6E 4ED4A 1I94I 4PRVA 4LF8I 2UUBI 1XMOE 1UEKA 3Q1QA 1PVGA 4DV0I 2UUAI 4DXLA 4HY1A 4JI1I 4JYAE 4KHPI 3PYFA 1S16A 2BM1A 4GKKE 1HNXE 3OTOI 4FWHA 1N0VC 4HXZA 1IBMI 1J5EI 4PRXA 4X66E 3WU6A 2HKJA 3ZKBA 2E5LI 1XNQI 4LFBI 3T1YI 2UXCE 4YHHI 3LTOA 1IBKI 2UXDI 4WUDA 5GMDA 2A2DA 1HR0I 2E5LE 2VQEE 5GMEA 4DPWA 4HYMA 2V2ZA 4AQYI 2F4VE 1RR9A 1ZM3A 4DV3I 4DV5I 1XMOI 2UUBE 5L3JA 4DV2E 5LMUI 1I94E 1PKPA 4B3RI 1N33I 4HACA 3ZZUA 1HNZI 3QT7A 4DV1E 5BR8I 3LNUA 2DEJA 2VQFE 1XNRE 4RPFA 1MU5A 4K0KI 4JI3I 1IBLE 5FLXC 5LL6R 1ZXMA 4MYTA 4FW9A 1KTVA 3WU3A 4DV7E 4B3SE 1Z0BA 4X64I 4JI0E 2UXBE 4JI2I 4DR3E 2V34A 4JV5I 4LFAE 2XEXA 1Z0WA 4JI8E 4X62I 3ZM7A 2OI2A 4JV5E 1Z5AA 4WUBA 2UXBI 4UTGA 5IWAI 2X36A 1B63A 4DV6E 4OX9E 3LPSA 4YY3E 4DUYE 3JAMC 1S4EA 1HNWE 1XHKA 1FJGI 4DR6I 4EMDA 4GKJI 4HACB 4B3SI 3ZZ0A 4P52A 2ZBKB 1Z0TA 4FWGA 1IBLI 4DV3E 2VQFI 1XNRI 1A6FA 4USKA 4DR1I 4DV1I 4YY3I 2UU9E 4LF5I 2GS8A 1K47A 2WW4A 4NXNE 2AJ4A 1KKHA 4GKJE 1RREA 4DR6E 5LMNE 2VQEI 4DUZE 2UUCI 4JI5E 2E1RA 4URLA 5IWAE 1VISA 3K17A 4DR5I 4JI3E 4DR7E 4YHHE 3T1YE 3K1JA 4DR3I 4B3TE 4DR4I 4LF6I 4NXMI 4X65I 1Z0EA 4M1KA 1EA6A 1QZRA 4X66I 4DPTA 4JI4I 2ZM6I 1Z0GA 3T1HI 3B78A 2HHHI 4R1FA 2HKEA 3B8HA 4DV5E 3PYGA 4AQYE 2F4VI 4LF8E 3V2UC 1ZXNA 2HK3A 1MX0A 1HNZE 1NZ0A 4WUCA 2HFUA 4LF6E 3PYEA 5A2QQ 4JI1E 4NXME 4B3RE 4DV2I 4B3MI 1N33E 4DPXA 4DV0E 2UUAE 3QT6A 4DR2I 2V8PA 3J7AG 2HHHE 3T1HE 2UXCI 3HULA 2DEIA 3M6AA 2R3VA 2V2VA 5IT9C 2Q2EB 4LFBE 4JI4E 1B62A 3J80Q 4X65E 1OJ4A 3CWVA 3D4JA 2R42A 1HR0E 4LF4I 3F0NA 2J7KA 1ZM2A 1IBKE 1U2RA 4DR2E 1D6TA 1N34E 4LF4E 1NHIA 4KQVA 3J7AM 1HNXI 1PIEA 3ZKDA 2UUCE 4JI5I 1XMQE 4LFCI 4JYAI 4DPUA 3B82A 3JAMQ 5LMNI 1ELOA 3V5RA 3J81Q 1FI4A 4NXNI 3H4LA 2HK2A 4JI6I 2UU9I 4KHPE 3GONA 4LF9I 4B3TI 4DR4E 1BKNA 1N36I 1FWLA 1WUUA 1H7SA 4DU7A 4I3HA 2BM0A 4DUYI 4DR5E 3J80C 2ZM6E 1Z0VA 2CZ9A 1FNMA 4UT4A 4DUZI 4DV4I 1H72C 4DR7I 4FN5A 4JI8I 4DV6I 4JG4A 4JI2E 1N32E 2BV3A 4JI7E 4LF5E 5A2QC 2X7IA 4DR1E 2LJPA 4ZVIA 4DPYA 4K0KE 1H73A 4LF7I 3J81C 1MG7A 4DV4E 1N36E 4P7AA 3PYDA 1FWKA 1Z59A 1FKAE 3QT5A 2A2CA 5FLXQ 1Z0CA 1Z5CA 4MYUA 3QT8A 4DU8A 4LFCE 1XMQI 1NHHA 4OX9I 4JI7I 1KIJA 4Z7CA 5LMUE 1N32I 2ZITA 4LF7E 1FJGE 2UXDE 4X62E 5IT9Q 4FWDA 1NHJA 2HFSA 1HNWI 1EI1A 4XTJA 1H7UA 3WU5A 2NPFA 1H74A 1ZM9A 4Z7YA 1N34I 1J5EE 1Z5BA 4PU9A 3ZZTA 1DARA 3WU4A 1IBME 2EFGA 2VF3A 4LFAI 4B3ME 1XNQE 5BR8E
chains in the Genus database with same CATH superfamily
3U1YA 3OTOE 3F6HA 4LF9E 4GKKI 2BR2A 3MHSC 3HXLA 4X64E 1ZM4A 4R2QA 4JI0I 1N0UA 2V2QA 1KVKA 3HTXA 5DRQA 4USMA 4JI6E 2C39B 4DV7I 2Z5CB 1E3HA 2YRHA 4BA1B 2YU5A 4ED4A 1I94I 4PRVA 4LF8I 1X49A 1X48A 2EM3A 2J7JA 4R2RA 2UUBI 1PDAA 1XMOE 1UEKA 2ENHA 1PVGA 3Q1QA 3ZOQB 4DV0I 2UUAI 1VI7A 4FW7A 3JU0A 2O3ZA 1JK1A 1YUJA 4DXLA 3M7ND 3PS2A 4HY1A 5AE2A 2EMBA 1XXEA 4WX9A 3M7NG 1WHNA 1A1HA 2EQ1A 5A6KA 4JI1I 4JYAE 4KHPI 2JWOA 5KL2A 2EMFA 3PYFA 1X3CA 2Z5BB 3MHHC 3DD6A 2EJ4A 1S16A 4BA1A 2BM1A 2N3GA 4R8OA 2WZOA 4GKKE 2FV4B 1HNXE 3OTOI 4FWHA 2EPUA 2CVEA 1N0VC 2YTPA 2WCC3 4HXZA 2LO3A 4R03A 2V8QB 1IBMI 1IQOA 4OO1C 2I13A 2EOJA 2LV2A 2L92A 2DLQA 2C39A 1J5EI 3M85D 2EZ6A 1Y5YA 2EOZA 2DSYA 1Y6ZA 4PRXA 4GEQB 2EMAA 5ELWA 2B7TA 4M30A 2C37A 1GTKA 2ADRA 4X66E 3WU6A 2VF1A 2HKJA 3P06A 4IS9A 2EMKA 2BA1D 3ZKBA 2E5LI 3H1CA 1XNQI 1Y60A 5EKWA 3U1KA 4WSPA 4R2SA 3T1YI 4LFBI 3ADLA 2UXCE 2GO3A 4YHHI 2PO1A 3LTOA 2JYAA 2EE8A 1IBKI 4WXDA 2UXDI 2EN1A 2JPAA 2EMCA 3P1XA 1ZBTA 2ENCA 2M9AA 1YH8A 3EPJA 2WP8B 2C38B 4WUDA 2A2DA 5GMDA 2EOFA 5TSEA 1HR0I 2LRSA 2E5LE 1KYQA 1NCSA 2C37B 2AE8A 4FW6A 4NXMI 2LE2A 2NN6E 5AC4A 2L3CA 3JTZA 2VQEE 2CPNA 2RSMA 2YWQA 4HTGA 5GMEA 2YTQA 5F3WA 4DPWA 2J65A 1SR9A 3F6GA 4HYMA 2V2ZA 2LUPB 2DRPA 2F4VE 3GLLA 4AQYI 1BB8A 2EOYA 1RR9A 1HK7A 1OYSA 1ZM3A 4DV3I 3P76A 4DV5I 2YTIA 1XMOI 4IFDC 1A1JA 2UUBE 5L3JA 5AASA 2LCEA 2RS7A 4DV2E 5LMUI 1I94E 1PKPA 2GQ0A 4B3RI 1N33I 5KL3A 4LOMA 2EM6A 1UHZA 1UDOA 2Z5BA 4HACA 3ZZUA 1HNZI 4O5GA 2EOIA 3QT7A 3EPKA 4DV1E 5K36F 2H36X 3DF6A 3LLHA 2EQ0A 2JR1A 1T4NA 3LNUA 2DEJA 4NBQA 5BR8I 2VQFE 1XNRE 2L3JA 4RPFA 1MU5A 2V85A 3Q6MA 4K0KI 1T38A 4JI3I 1IBLE 4ISAA 5FLXC 5LL6R 1ZXMA 2LTRA 4DKKA 4MYTA 4QNJA 2LJHA 4FW9A 1KTVA 2B9DA 3P3CA 3WU3A 4DV7E 1IMUA 1BBGA 4LU9A 2EOHA 2JE6A 2JXPA 4B3SE 4JI0E 1Z0BA 2YTDA 4J8ZA 4X64I 2EOOA 2RPCA 3EPHA 2UXBE 4JI2I 2EM7A 4DR3E 2V34A 4JV5I 3BBGA 2EM0A 4LFAE 5C0XC 2EM5A 1JK2A 1MGTA 5KL6A 5DNXA 2XEXA 4JI8E 3QG5C 1Z0WA 3GCMA 2ENAA 2JEBA 3C4BA 2EM4A 2EOXA 4X62I 4IFDE 3ZM7A 2EPPA 1WHQA 4ZYEA 4MDTA 2YRMA 1YPNA 2OI2A 4JV5E 1Z5AA 1WJPA 2LT7A 1IQSA 2KOUA 5K36D 2EPLX 4O24A 4WUBA 2L2MA 4BHCA 1B69A 4UTGA 4IZJB 2UXBI 5EL9A 3DJWA 5IWAI 2EMYA 2X36A 2IESA 1B63A 2C38A 3H09A 4DV6E 4OX9E 4IFDD 2EMHA 1X6EA 3LPSA 1L4SA 4YY3E 4DUYE 3THNA 3VK6A 3JAMC 1S4EA 4IZKB 1HNWE 1LLMC 1XHKA 2EM9A 1FJGI 2L33A 4DR6I 1UDSA 2PO0B 1SFEA 4EMDA 2Q8UA 3K6QA 4RH8A 2JY9A 5A69A 2EMZA 4M9VC 2DIXA 2WBTA 2EM2A 1O0WA 4GKJI 3P3GA 4HACB 4B3SI 2CGEA 4IZJD 2EMXA 3PS1A 4L5NC 4BS9A 1ZU1A 4M0VA 2RQLA 4U3BA 3ZZ0A 5K36B 1ZR9A 4P52A 4OO1D 4WXCA 2ZBKB 2FTXB 1Z0TA 2VE7C 2GHFA 4FWGA 5IV8B 5DROA 2WBSA 2EN3A 1YUIA 1IBLI 1EH7A 4R2DA 4DV3E 3PRYA 4BCAA 3IWBA 2VQFI 1XNRI 5JEAB 4FW5A 5DRRA 2YSPA 2EL4A 1A6FA 4USKA 4TUGA 4DR1I 4FW3A 4DV1I 4YY3I 4MLVA 2UU9E 4LF5I 2GS8A 3MSWA 1K47A 3GMEA 2A25A 5T6JA 4X9JA 2WW4A 3RMPA 2M4IA 4NXNE 2NUGA 4GKJE 1KKHA 2AJ4A 4KWYA 1A1KA 1RREA 1TN9A 5JEAF 2DMIA 2PRTA 2JEBB 2L6MA 4OKGA 4DR6E 5LMNE 2IHR1 2JOBA 2NN6D 2K4VA 2GO4A 1OYPA 2N3HA 3NZKA 2VQEI 5C0XE 2EOMA 4DUZE 1MEYC 4JI5E 2UUCI 4DMIA 5KL4A 2E1RA 2O1UA 5IWAE 4URLA 1VISA 2EPZA 4O43A 2NUEA 3K17A 5DNYA 2DGCA 4GQUA 4DR5I 2EL6A 2LVHA 1X47A 2YTOA 1GZ6A 1YYKA 2EM8A 5K36A 4JI3E 4ZYHA 4DR7E 4YHHE 1UDQA 4F6NA 3Q6NA 2O1TA 3T1YE 3K1JA 4DR3I 4B3TE 5IXMB 4DR4I 2YTNA 1PJQA 1ZBQA 2ODRD 4L8NA 1X6FA 4OO1A 1Z0EA 4X65I 4M1KA 4LF6I 2YZTA 2EPMX 3UK3C 1EA6A 1QZRA 4DPTA 4X66I 4JI4I 2ZM6I 3BF2A 5CFFE 4F6MA 2NA2A 5AE3A 1Z0GA 2EORA 3B78A 1A1FA 4R1FA 3T1HI 5JEAD 2HHHI 3PS3A 2VRDA 2BA0D 2ELZA 2YTFA 2NN6A 3UHMA 4BA2A 4DV5E 3HPZA 2HKEA 3B8HA 3ADJA 3PYGA 1PJTA 1X5WA 2Z5CA 4MU1A 4AQYE 4AIDA 2F4VI 4LF8E 3V2UC 2GPIA 2RS6A 2JEAB 2LTSA 3HQ1A 2X7IA 2KONA 2MDGA 2YTEA 2BR2B 1ZXNA 2O1WA 2JP9A 5DNLA 5C0XD 2HK3A 1MX0A 2LBSB 2JVAA 1HNZE 1NZ0A 2NN6C 4WUCA 1BBOA 2RTXA 4LF6E 4NXME 4JI1E 1J26A 2HFUA 3PYEA 5A2QQ 4B3RE 1N33E 4DV2I 4B3MI 2GLIA 2NN6B 2YRKA 4DPXA 4DV0E 2UUAE 3VYXA 3QT6A 4QNKA 4DR2I 4WFTA 4BBYA 3L7ZB 2PO1B 2EOSA 2V8PA 3J7AG 1QU6A 2BA0G 2LJUA 2HHHE 3T1HE 2WNRA 4MQYA 2YTJA 2JE6B 2UXCI 2EQ3A 2DEIA 3HULA 3M6AA 2R3VA 4R2CA 2V2VA 5IT9C 2Q2EB 4IJDA 4LFBE 1WXRA 2CTDA 4JI4E 4F9CB 1B62A 1AAYA 3J80Q 2CSHA 3KZZA 4X65E 3HKMA 5AE1A 1OJ4A 3CWVA 2DB2A 3J7Yp 3D4JA 1HR0E 2R42A 4LPFA 4LF4I 1TF6A 3F0NA 2EPOA 5LLQA 2J7KA 1DGCA 2EL5A 1USVA 4FK5C 2I9IA 1ZM2A 1IBKE 4OO1E 4IFDF 1U2RA 4DR2E 1D6TA 3C6MA 1A1IA 1N34E 3KRNA 2F8BA 3P3EA 4LF4E 2HC5A 1NHIA 3KZYA 2HGHA 4KQVA 3BIDA 2LUQA 3J7AM 2YU8A 1HNXI 1PIEA 2L2NA 3M99B 2PO2A 2V83A 4RHBB 4WYQB 3ZKDA 2UUCE 4JI5I 3FIGA 3ADGA 1UILA 2PO0A 5A6JA 2BB8A 3C6KA 5KL7A 1XMQE 4LFCI 4JYAI 1YZ9A 2PNMA 5K36C 2EMWA 2KHXA 4DPUA 3B82A 4F9AB 2EPKX 4O4KA 3K85A 3JAMQ 5LMNI 2JEAA 5A6BA 1ELOA 1RHYA 3V5RA 2M1SA 5C0XA 3AV0A 3J81Q 1FI4A 4NXNI 2EMLA 2HJJA 1WRJA 4HEIA 1USUA 2YPNA 3H4LA 1TF3A 1ZAAC 2HK2A 3HJCA 1UN6B 4BA2B 2O1VA 4JI6I 2V86A 2YT4A 2PNZA 2UU9I 2EPNA 1R6LA 4KHPE 4FW4A 3GONA 4LF9I 3L7ZA 4F54A 4DR4E 1BKNA 4AIMA 1N36I 4B3TI 3CDIA 2DMYA 3IWDA 1FWLA 1WUUA 3CDJA 1Y4SA 1DQ3A 4P78A 1H7SA 3L00A 4DU7A 4OZEA 1RMDA 2WNRB 1YFHA 4I3HA 2JT2A 2BM0A 4R2AA 2EN6A 1EH6A 4J3DA 2JOXA 4DUYI 4DR5E 3J80C 2ZM6E 2EOEA 2E72A 1Z0VA 2MC5A 2EP3A 2CZ9A 2EWLA 1FNMA 4UT4A 2MC6A 1UDNA 3EQ1A 4Q35B 5C0XB 4N4RB 4KZSA 4DUZI 2R1FA 4DV4I 4OO1F 1H72C 1G2FC 5A6BD 4BMJA 2CG9A 3B4TA 4IZKA 3BGHA 4MU4A 4AM3A 4DR7I 4MU3A 3M85G 3KWRA 4FN5A 3ADIA 4JI8I 3C4TA 3OMLA 2ELYA 2MDRA 1P47A 4TUIA 4DV6I 4JI2E 1N32E 4JG4A 2BV3A 2IOPA 5JEAE 1RQ0A 3ECRA 4OOGC 2B7VA 2N8XA 4JI7E 1QNTA 4N3OA 4LF5E 4IS1C 4LTYA 4P7DA 5A2QC 1EH8A 2YTGA 2EPXA 4DR1E 1T39A 1A1LA 2LJPA 2EMIA 4R2EA 4LCHA 4U3DA 4ZVIA 4DPYA 4K0KE 1H73A 1F2IG 4LF7I 2LMZA 3J81C 1UBDC 1MG7A 4DV4E 5JEAA 2G7HA 1N36E 4P7AA 1DI2A 3PYDA 2PNZB 2R76A 1FWKA 2Z5EA 4Q28A 2V87A 2DLKA 4NZVA 2B3TB 2ODRC 5A6AA 1P42A 2BA1G 1Z59A 1X6HA 4I8OA 1FKAE 2IERA 5FWKA 1KJKA 1N3GA 3QT5A 4ZYDA 4F9BB 1A1GA 4WSGA 2A2CA 5DRPA 2EOQA 2EN2A 1Z1BA 5FLXQ 5ADZA 2NUFA 1Z0CA 1Z5CA 2WP8A 1STUA 3THOB 5AC5A 4M2ZA 4MYUA 3HPSA 2VESA 3LMLA 3QT8A 1GQEA 4LFCE 4ZYGA 1PJSA 1NHHA 1OYRA 2PO2B 4DU8A 1XMQI 2EMGA 5K36E 2WBUA 5JEAC 1T4OA 4OX9I 1T4LB 1G2DC 4IFDA 4JI7I 1YYWA 2EPCA 2EPAA 1KIJA 2EN8A 2FGGA 4WPYA 4F2JC 2NABA 4Z7CA 4X8WA 5LMUE 2K7IA 2F1DA 4LCGA 1N32I 4NHRA 2L8TA 2EN7A 4MLQA 2ZITA 3IWCA 4LF7E 1YYOA 2E1MA 1EKZA 1FJGE 2UXDE 4X62E 2D9HA 5IT9Q 2EN4A 2IOQA 2V89A 4FWDA 2RSIA 1NHJA 3EPLA 2HFSA 1E3PA 1HNWI 2MKNA 1EI1A 2CT1A 1R6MA 4MU0A 2EPRA 4XTJA 4IFDB 2L2KB 3VYYA 1H7UA 3WU5A 1Y4UA 4IZJA 2NPFA 4BHBA 1H74A 2NN6F 1ZM9A 4Z7YA 4R2PA 4OO1B 2MKDA 1AH5A 5C0XF 5KL5A 1YHCA 2M7QA 2V88A 1N34I 2BBGA 1J5EE 1Z5BA 4PU9A 3ZZTA 4GZNC 3TQMA 1DARA 1RC7A 2PNLA 3VHTB 3WU4A 2YSOA 3AUZA 1IBME 2EFGA 4BC7A 2VF3A 1NEIA 4BC9A 1YSAC 4LFAI 4B3ME 4LCFA 1XNQE 5BR8E
chains in the Genus database with same CATH topology
3OTOE 3F6HA 4LF9E 4GKKI 3HXLA 4X64E 1ZM4A 4JI0I 1N0UA 2V2QA 1KVKA 3HTXA 4USMA 4DV7I 4JI6E 2Z5CB 4ED4A 1I94I 4PRVA 4LF8I 1X49A 1X48A 2UUBI 1XMOE 1UEKA 3Q1QA 1PVGA 3ZOQB 4DV0I 2UUAI 3JU0A 4DXLA 4HY1A 5AE2A 1WHNA 4JI1I 4JYAE 4KHPI 2JWOA 3PYFA 2Z5BB 1S16A 2BM1A 2N3GA 4R8OA 2WZOA 4GKKE 2FV4B 1HNXE 3OTOI 4FWHA 1N0VC 4HXZA 4R03A 2V8QB 1IBMI 2L92A 1J5EI 2EZ6A 2DSYA 1Y6ZA 4PRXA 4GEQB 2B7TA 4M30A 4X66E 3WU6A 2VF1A 2HKJA 3P06A 3ZKBA 2E5LI 1XNQI 4LFBI 3T1YI 4WSPA 3ADLA 2UXCE 4YHHI 3LTOA 1IBKI 2UXDI 3P1XA 1ZBTA 4WUDA 5GMDA 2A2DA 1HR0I 2LRSA 2E5LE 2LE2A 2L3CA 3JTZA 2VQEE 2CPNA 2RSMA 5GMEA 5F3WA 4DPWA 1SR9A 3F6GA 4HYMA 2V2ZA 2LUPB 2F4VE 4AQYI 1RR9A 1HK7A 1ZM3A 4DV3I 4DV5I 1XMOI 2UUBE 5L3JA 5AASA 2RS7A 4DV2E 5LMUI 1I94E 1PKPA 2GQ0A 4B3RI 1N33I 1UHZA 2Z5BA 4HACA 3ZZUA 1HNZI 3QT7A 4DV1E 2H36X 3DF6A 3LLHA 2JR1A 5BR8I 1T4NA 3LNUA 2DEJA 2VQFE 1XNRE 2L3JA 4RPFA 1MU5A 2V85A 3Q6MA 4K0KI 4JI3I 1IBLE 5FLXC 5LL6R 1ZXMA 2LTRA 4DKKA 4MYTA 2LJHA 4FW9A 1KTVA 2B9DA 3WU3A 4DV7E 4LU9A 4B3SE 4JI0E 1Z0BA 4X64I 4J8ZA 2UXBE 4JI2I 4DR3E 2V34A 4JV5I 4LFAE 2XEXA 4JI8E 1Z0WA 3C4BA 4X62I 3ZM7A 1WHQA 2OI2A 4JV5E 1Z5AA 2KOUA 4WUBA 2UXBI 2L2MA 4UTGA 4IZJB 3DJWA 5IWAI 2X36A 1B63A 3H09A 4DV6E 4OX9E 3LPSA 4YY3E 4DUYE 3VK6A 3JAMC 1S4EA 4IZKB 1HNWE 1XHKA 1FJGI 2L33A 4DR6I 4EMDA 3K6QA 2JY9A 2DIXA 1O0WA 4GKJI 4HACB 4B3SI 2CGEA 4IZJD 4L5NC 4BS9A 4M0VA 3ZZ0A 4P52A 2ZBKB 2FTXB 1Z0TA 2VE7C 4FWGA 1IBLI 4DV3E 3PRYA 4BCAA 3IWBA 2VQFI 1XNRI 1A6FA 4USKA 4TUGA 4DR1I 4DV1I 4YY3I 2UU9E 4LF5I 2GS8A 3MSWA 1K47A 5T6JA 2WW4A 3RMPA 2M4IA 4NXNE 2NUGA 4GKJE 1KKHA 2AJ4A 1RREA 2L6MA 4DR6E 5LMNE 2IHR1 2JOBA 2K4VA 2N3HA 2VQEI 4DUZE 4JI5E 2UUCI 4DMIA 2E1RA 2O1UA 5IWAE 4URLA 1VISA 3K17A 2NUEA 5DNYA 4DR5I 1X47A 1GZ6A 1YYKA 4JI3E 4DR7E 4YHHE 3Q6NA 2O1TA 3T1YE 3K1JA 4DR3I 4B3TE 4DR4I 4LF6I 1ZBQA 2ODRD 4L8NA 4X65I 4NXMI 1Z0EA 4M1KA 2YZTA 1EA6A 1QZRA 4X66I 4DPTA 4JI4I 2ZM6I 5CFFE 2NA2A 5AE3A 1Z0GA 3T1HI 3B78A 2HHHI 4R1FA 4DV5E 3HPZA 2HKEA 3B8HA 3ADJA 3PYGA 2Z5CA 4AQYE 2F4VI 4LF8E 3V2UC 2RS6A 2LTSA 3HQ1A 2KONA 2O1WA 1ZXNA 2HK3A 1MX0A 2LBSB 2JVAA 1HNZE 1NZ0A 4WUCA 2RTXA 4LF6E 4NXME 4JI1E 1J26A 2HFUA 3PYEA 5A2QQ 4B3RE 1N33E 4DV2I 4B3MI 4DPXA 4DV0E 2UUAE 3VYXA 3QT6A 4DR2I 4WFTA 4BBYA 2V8PA 3J7AG 1QU6A 2HHHE 3T1HE 2UXCI 3HULA 2DEIA 3M6AA 2R3VA 2V2VA 5IT9C 2Q2EB 4LFBE 1WXRA 4JI4E 4F9CB 1B62A 3J80Q 4X65E 5AE1A 1OJ4A 3CWVA 2DB2A 3J7Yp 3D4JA 1HR0E 2R42A 4LF4I 3F0NA 2J7KA 1USVA 1ZM2A 1IBKE 1U2RA 4DR2E 1D6TA 1N34E 2F8BA 4LF4E 1NHIA 4KQVA 2LUQA 3J7AM 1HNXI 1PIEA 2L2NA 2V83A 3ZKDA 4WYQB 2UUCE 4JI5I 3FIGA 3ADGA 1UILA 1XMQE 4LFCI 4JYAI 1YZ9A 2PNMA 2KHXA 4DPUA 3B82A 4F9AB 3JAMQ 5LMNI 3K85A 1ELOA 3V5RA 2M1SA 3AV0A 3J81Q 1FI4A 4NXNI 1USUA 3H4LA 3HJCA 2HK2A 2O1VA 4JI6I 2V86A 2YT4A 2UU9I 4KHPE 3GONA 4LF9I 4F54A 4DR4E 1BKNA 1N36I 4B3TI 2DMYA 3IWDA 1FWLA 1WUUA 1Y4SA 1DQ3A 4P78A 1H7SA 4DU7A 4I3HA 2BM0A 4DUYI 2JOXA 4DR5E 3J80C 2ZM6E 1Z0VA 2MC5A 2CZ9A 2EWLA 1FNMA 4UT4A 2MC6A 4KZSA 4DUZI 4DV4I 1H72C 2CG9A 4IZKA 4BMJA 4DR7I 3KWRA 4FN5A 3ADIA 4JI8I 3C4TA 3OMLA 2MDRA 4TUIA 4DV6I 4JI2E 1N32E 4JG4A 2BV3A 2IOPA 1RQ0A 4OOGC 2B7VA 4JI7E 4N3OA 4LF5E 4LTYA 4P7DA 5A2QC 4DR1E 2X7IA 2LJPA 4ZVIA 4DPYA 4K0KE 1H73A 4LF7I 2LMZA 3J81C 1MG7A 4DV4E 2G7HA 1N36E 4P7AA 1DI2A 3PYDA 1FWKA 2Z5EA 4Q28A 2V87A 2B3TB 2ODRC 1Z59A 4I8OA 1FKAE 5FWKA 3QT5A 4F9BB 2A2CA 5FLXQ 5ADZA 2NUFA 1Z0CA 1Z5CA 1STUA 4M2ZA 4MYUA 3HPSA 3LMLA 3QT8A 1GQEA 4LFCE 4DU8A 1XMQI 1NHHA 1T4OA 4OX9I 1T4LB 4JI7I 1YYWA 1KIJA 4WPYA 2FGGA 4Z7CA 4X8WA 5LMUE 1N32I 2L8TA 2ZITA 3IWCA 4LF7E 1YYOA 2E1MA 1EKZA 1FJGE 2UXDE 4X62E 5IT9Q 2IOQA 4FWDA 2V89A 1NHJA 2HFSA 1HNWI 1EI1A 4XTJA 2L2KB 3VYYA 1H7UA 3WU5A 1Y4UA 4IZJA 2NPFA 1H74A 1ZM9A 4Z7YA 2M7QA 2V88A 1N34I 1J5EE 1Z5BA 4PU9A 3ZZTA 1DARA 1RC7A 2PNLA 3WU4A 3AUZA 1IBME 2EFGA 4BC7A 2VF3A 4BC9A 4LFAI 4B3ME 1XNQE 5BR8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO E;  4LF9 E;  4GKK I;  4JI0 I;  1ZM4 A;  4X64 E;  1N0U A;  2V2Q A;  1KVK A;  4USM A;  4DV7 I;  4JI6 E;  4ED4 A;  1I94 I;  4PRV A;  4LF8 I;  2UUB I;  1XMO E;  1UEK A;  3Q1Q A;  1PVG A;  4DV0 I;  2UUA I;  4DXL A;  4HY1 A;  4JI1 I;  4JYA E;  4KHP I;  3PYF A;  1S16 A;  2BM1 A;  4GKK E;  1HNX E;  3OTO I;  4FWH A;  1N0V C;  4HXZ A;  1IBM I;  1J5E I;  4PRX A;  4X66 E;  3WU6 A;  2HKJ A;  3ZKB A;  2E5L I;  1XNQ I;  4LFB I;  3T1Y I;  2UXC E;  4YHH I;  3LTO A;  1IBK I;  2UXD I;  4WUD A;  5GMD A;  2A2D A;  1HR0 I;  2E5L E;  2VQE E;  5GME A;  4DPW A;  4HYM A;  2V2Z A;  4AQY I;  2F4V E;  1RR9 A;  1ZM3 A;  4DV3 I;  4DV5 I;  1XMO I;  2UUB E;  5L3J A;  4DV2 E;  5LMU I;  1I94 E;  1PKP A;  4B3R I;  1N33 I;  4HAC A;  3ZZU A;  1HNZ I;  3QT7 A;  4DV1 E;  5BR8 I;  3LNU A;  2DEJ A;  2VQF E;  1XNR E;  4RPF A;  1MU5 A;  4K0K I;  4JI3 I;  1IBL E;  5FLX C;  5LL6 R;  1ZXM A;  4MYT A;  4FW9 A;  1KTV A;  3WU3 A;  4DV7 E;  4B3S E;  1Z0B A;  4X64 I;  4JI0 E;  2UXB E;  4JI2 I;  4DR3 E;  2V34 A;  4JV5 I;  4LFA E;  2XEX A;  1Z0W A;  4JI8 E;  4X62 I;  3ZM7 A;  2OI2 A;  4JV5 E;  1Z5A A;  4WUB A;  2UXB I;  4UTG A;  5IWA I;  2X36 A;  1B63 A;  4DV6 E;  4OX9 E;  3LPS A;  4YY3 E;  4DUY E;  3JAM C;  1S4E A;  1HNW E;  1XHK A;  1FJG I;  4DR6 I;  4EMD A;  4GKJ I;  4HAC B;  4B3S I;  3ZZ0 A;  4P52 A;  2ZBK B;  1Z0T A;  4FWG A;  1IBL I;  4DV3 E;  2VQF I;  1XNR I;  1A6F A;  4USK A;  4DR1 I;  4DV1 I;  4YY3 I;  2UU9 E;  4LF5 I;  2GS8 A;  1K47 A;  2WW4 A;  4NXN E;  2AJ4 A;  1KKH A;  4GKJ E;  1RRE A;  4DR6 E;  5LMN E;  2VQE I;  4DUZ E;  2UUC I;  4JI5 E;  2E1R A;  4URL A;  5IWA E;  1VIS A;  3K17 A;  4DR5 I;  4JI3 E;  4DR7 E;  4YHH E;  3T1Y E;  3K1J A;  4DR3 I;  4B3T E;  4DR4 I;  4LF6 I;  4NXM I;  4X65 I;  1Z0E A;  4M1K A;  1EA6 A;  1QZR A;  4X66 I;  4DPT A;  4JI4 I;  2ZM6 I;  1Z0G A;  3T1H I;  3B78 A;  2HHH I;  4R1F A;  2HKE A;  3B8H A;  4DV5 E;  3PYG A;  4AQY E;  2F4V I;  4LF8 E;  3V2U C;  1ZXN A;  2HK3 A;  1MX0 A;  1HNZ E;  1NZ0 A;  4WUC A;  2HFU A;  4LF6 E;  3PYE A;  5A2Q Q;  4JI1 E;  4NXM E;  4B3R E;  4DV2 I;  4B3M I;  1N33 E;  4DPX A;  4DV0 E;  2UUA E;  3QT6 A;  4DR2 I;  2V8P A;  3J7A G;  2HHH E;  3T1H E;  2UXC I;  3HUL A;  2DEI A;  3M6A A;  2R3V A;  2V2V A;  5IT9 C;  2Q2E B;  4LFB E;  4JI4 E;  1B62 A;  3J80 Q;  4X65 E;  1OJ4 A;  3CWV A;  3D4J A;  2R42 A;  1HR0 E;  4LF4 I;  3F0N A;  2J7K A;  1ZM2 A;  1IBK E;  1U2R A;  4DR2 E;  1D6T A;  1N34 E;  4LF4 E;  1NHI A;  4KQV A;  3J7A M;  1HNX I;  1PIE A;  3ZKD A;  2UUC E;  4JI5 I;  1XMQ E;  4LFC I;  4JYA I;  4DPU A;  3B82 A;  3JAM Q;  5LMN I;  1ELO A;  3V5R A;  3J81 Q;  1FI4 A;  4NXN I;  3H4L A;  2HK2 A;  4JI6 I;  2UU9 I;  4KHP E;  3GON A;  4LF9 I;  4B3T I;  4DR4 E;  1BKN A;  1N36 I;  1FWL A;  1WUU A;  1H7S A;  4DU7 A;  4I3H A;  2BM0 A;  4DUY I;  4DR5 E;  3J80 C;  2ZM6 E;  1Z0V A;  2CZ9 A;  1FNM A;  4UT4 A;  4DUZ I;  4DV4 I;  1H72 C;  4DR7 I;  4FN5 A;  4JI8 I;  4DV6 I;  4JG4 A;  4JI2 E;  1N32 E;  2BV3 A;  4JI7 E;  4LF5 E;  5A2Q C;  2X7I A;  4DR1 E;  2LJP A;  4ZVI A;  4DPY A;  4K0K E;  1H73 A;  4LF7 I;  3J81 C;  1MG7 A;  4DV4 E;  1N36 E;  4P7A A;  3PYD A;  1FWK A;  1Z59 A;  1FKA E;  3QT5 A;  2A2C A;  5FLX Q;  1Z0C A;  1Z5C A;  4MYU A;  3QT8 A;  4DU8 A;  4LFC E;  1XMQ I;  1NHH A;  4OX9 I;  4JI7 I;  1KIJ A;  4Z7C A;  5LMU E;  1N32 I;  2ZIT A;  4LF7 E;  1FJG E;  2UXD E;  4X62 E;  5IT9 Q;  4FWD A;  1NHJ A;  2HFS A;  1HNW I;  1EI1 A;  4XTJ A;  1H7U A;  3WU5 A;  2NPF A;  1H74 A;  1ZM9 A;  4Z7Y A;  1N34 I;  1J5E E;  1Z5B A;  4PU9 A;  3ZZT A;  1DAR A;  3WU4 A;  1IBM E;  2EFG A;  2VF3 A;  4LFA I;  4B3M E;  1XNQ E;  5BR8 E; 
#chains in the Genus database with same CATH topology
 3U1Y A;  3OTO E;  3F6H A;  4LF9 E;  4GKK I;  2BR2 A;  3MHS C;  3HXL A;  4X64 E;  1ZM4 A;  4R2Q A;  4JI0 I;  1N0U A;  2V2Q A;  1KVK A;  3HTX A;  5DRQ A;  4USM A;  4JI6 E;  2C39 B;  4DV7 I;  2Z5C B;  1E3H A;  2YRH A;  4BA1 B;  2YU5 A;  4ED4 A;  1I94 I;  4PRV A;  4LF8 I;  1X49 A;  1X48 A;  2EM3 A;  2J7J A;  4R2R A;  2UUB I;  1PDA A;  1XMO E;  1UEK A;  2ENH A;  1PVG A;  3Q1Q A;  3ZOQ B;  4DV0 I;  2UUA I;  1VI7 A;  4FW7 A;  3JU0 A;  2O3Z A;  1JK1 A;  1YUJ A;  4DXL A;  3M7N D;  3PS2 A;  4HY1 A;  5AE2 A;  2EMB A;  1XXE A;  4WX9 A;  3M7N G;  1WHN A;  1A1H A;  2EQ1 A;  5A6K A;  4JI1 I;  4JYA E;  4KHP I;  2JWO A;  5KL2 A;  2EMF A;  3PYF A;  1X3C A;  2Z5B B;  3MHH C;  3DD6 A;  2EJ4 A;  1S16 A;  4BA1 A;  2BM1 A;  2N3G A;  4R8O A;  2WZO A;  4GKK E;  2FV4 B;  1HNX E;  3OTO I;  4FWH A;  2EPU A;  2CVE A;  1N0V C;  2YTP A;  2WCC 3;  4HXZ A;  2LO3 A;  4R03 A;  2V8Q B;  1IBM I;  1IQO A;  4OO1 C;  2I13 A;  2EOJ A;  2LV2 A;  2L92 A;  2DLQ A;  2C39 A;  1J5E I;  3M85 D;  2EZ6 A;  1Y5Y A;  2EOZ A;  2DSY A;  1Y6Z A;  4PRX A;  4GEQ B;  2EMA A;  5ELW A;  2B7T A;  4M30 A;  2C37 A;  1GTK A;  2ADR A;  4X66 E;  3WU6 A;  2VF1 A;  2HKJ A;  3P06 A;  4IS9 A;  2EMK A;  2BA1 D;  3ZKB A;  2E5L I;  3H1C A;  1XNQ I;  1Y60 A;  5EKW A;  3U1K A;  4WSP A;  4R2S A;  3T1Y I;  4LFB I;  3ADL A;  2UXC E;  2GO3 A;  4YHH I;  2PO1 A;  3LTO A;  2JYA A;  2EE8 A;  1IBK I;  4WXD A;  2UXD I;  2EN1 A;  2JPA A;  2EMC A;  3P1X A;  1ZBT A;  2ENC A;  2M9A A;  1YH8 A;  3EPJ A;  2WP8 B;  2C38 B;  4WUD A;  2A2D A;  5GMD A;  2EOF A;  5TSE A;  1HR0 I;  2LRS A;  2E5L E;  1KYQ A;  1NCS A;  2C37 B;  2AE8 A;  4FW6 A;  4NXM I;  2LE2 A;  2NN6 E;  5AC4 A;  2L3C A;  3JTZ A;  2VQE E;  2CPN A;  2RSM A;  2YWQ A;  4HTG A;  5GME A;  2YTQ A;  5F3W A;  4DPW A;  2J65 A;  1SR9 A;  3F6G A;  4HYM A;  2V2Z A;  2LUP B;  2DRP A;  2F4V E;  3GLL A;  4AQY I;  1BB8 A;  2EOY A;  1RR9 A;  1HK7 A;  1OYS A;  1ZM3 A;  4DV3 I;  3P76 A;  4DV5 I;  2YTI A;  1XMO I;  4IFD C;  1A1J A;  2UUB E;  5L3J A;  5AAS A;  2LCE A;  2RS7 A;  4DV2 E;  5LMU I;  1I94 E;  1PKP A;  2GQ0 A;  4B3R I;  1N33 I;  5KL3 A;  4LOM A;  2EM6 A;  1UHZ A;  1UDO A;  2Z5B A;  4HAC A;  3ZZU A;  1HNZ I;  4O5G A;  2EOI A;  3QT7 A;  3EPK A;  4DV1 E;  5K36 F;  2H36 X;  3DF6 A;  3LLH A;  2EQ0 A;  2JR1 A;  1T4N A;  3LNU A;  2DEJ A;  4NBQ A;  5BR8 I;  2VQF E;  1XNR E;  2L3J A;  4RPF A;  1MU5 A;  2V85 A;  3Q6M A;  4K0K I;  1T38 A;  4JI3 I;  1IBL E;  4ISA A;  5FLX C;  5LL6 R;  1ZXM A;  2LTR A;  4DKK A;  4MYT A;  4QNJ A;  2LJH A;  4FW9 A;  1KTV A;  2B9D A;  3P3C A;  3WU3 A;  4DV7 E;  1IMU A;  1BBG A;  4LU9 A;  2EOH A;  2JE6 A;  2JXP A;  4B3S E;  4JI0 E;  1Z0B A;  2YTD A;  4J8Z A;  4X64 I;  2EOO A;  2RPC A;  3EPH A;  2UXB E;  4JI2 I;  2EM7 A;  4DR3 E;  2V34 A;  4JV5 I;  3BBG A;  2EM0 A;  4LFA E;  5C0X C;  2EM5 A;  1JK2 A;  1MGT A;  5KL6 A;  5DNX A;  2XEX A;  4JI8 E;  3QG5 C;  1Z0W A;  3GCM A;  2ENA A;  2JEB A;  3C4B A;  2EM4 A;  2EOX A;  4X62 I;  4IFD E;  3ZM7 A;  2EPP A;  1WHQ A;  4ZYE A;  4MDT A;  2YRM A;  1YPN A;  2OI2 A;  4JV5 E;  1Z5A A;  1WJP A;  2LT7 A;  1IQS A;  2KOU A;  5K36 D;  2EPL X;  4O24 A;  4WUB A;  2L2M A;  4BHC A;  1B69 A;  4UTG A;  4IZJ B;  2UXB I;  5EL9 A;  3DJW A;  5IWA I;  2EMY A;  2X36 A;  2IES A;  1B63 A;  2C38 A;  3H09 A;  4DV6 E;  4OX9 E;  4IFD D;  2EMH A;  1X6E A;  3LPS A;  1L4S A;  4YY3 E;  4DUY E;  3THN A;  3VK6 A;  3JAM C;  1S4E A;  4IZK B;  1HNW E;  1LLM C;  1XHK A;  2EM9 A;  1FJG I;  2L33 A;  4DR6 I;  1UDS A;  2PO0 B;  1SFE A;  4EMD A;  2Q8U A;  3K6Q A;  4RH8 A;  2JY9 A;  5A69 A;  2EMZ A;  4M9V C;  2DIX A;  2WBT A;  2EM2 A;  1O0W A;  4GKJ I;  3P3G A;  4HAC B;  4B3S I;  2CGE A;  4IZJ D;  2EMX A;  3PS1 A;  4L5N C;  4BS9 A;  1ZU1 A;  4M0V A;  2RQL A;  4U3B A;  3ZZ0 A;  5K36 B;  1ZR9 A;  4P52 A;  4OO1 D;  4WXC A;  2ZBK B;  2FTX B;  1Z0T A;  2VE7 C;  2GHF A;  4FWG A;  5IV8 B;  5DRO A;  2WBS A;  2EN3 A;  1YUI A;  1IBL I;  1EH7 A;  4R2D A;  4DV3 E;  3PRY A;  4BCA A;  3IWB A;  2VQF I;  1XNR I;  5JEA B;  4FW5 A;  5DRR A;  2YSP A;  2EL4 A;  1A6F A;  4USK A;  4TUG A;  4DR1 I;  4FW3 A;  4DV1 I;  4YY3 I;  4MLV A;  2UU9 E;  4LF5 I;  2GS8 A;  3MSW A;  1K47 A;  3GME A;  2A25 A;  5T6J A;  4X9J A;  2WW4 A;  3RMP A;  2M4I A;  4NXN E;  2NUG A;  4GKJ E;  1KKH A;  2AJ4 A;  4KWY A;  1A1K A;  1RRE A;  1TN9 A;  5JEA F;  2DMI A;  2PRT A;  2JEB B;  2L6M A;  4OKG A;  4DR6 E;  5LMN E;  2IHR 1;  2JOB A;  2NN6 D;  2K4V A;  2GO4 A;  1OYP A;  2N3H A;  3NZK A;  2VQE I;  5C0X E;  2EOM A;  4DUZ E;  1MEY C;  4JI5 E;  2UUC I;  4DMI A;  5KL4 A;  2E1R A;  2O1U A;  5IWA E;  4URL A;  1VIS A;  2EPZ A;  4O43 A;  2NUE A;  3K17 A;  5DNY A;  2DGC A;  4GQU A;  4DR5 I;  2EL6 A;  2LVH A;  1X47 A;  2YTO A;  1GZ6 A;  1YYK A;  2EM8 A;  5K36 A;  4JI3 E;  4ZYH A;  4DR7 E;  4YHH E;  1UDQ A;  4F6N A;  3Q6N A;  2O1T A;  3T1Y E;  3K1J A;  4DR3 I;  4B3T E;  5IXM B;  4DR4 I;  2YTN A;  1PJQ A;  1ZBQ A;  2ODR D;  4L8N A;  1X6F A;  4OO1 A;  1Z0E A;  4X65 I;  4M1K A;  4LF6 I;  2YZT A;  2EPM X;  3UK3 C;  1EA6 A;  1QZR A;  4DPT A;  4X66 I;  4JI4 I;  2ZM6 I;  3BF2 A;  5CFF E;  4F6M A;  2NA2 A;  5AE3 A;  1Z0G A;  2EOR A;  3B78 A;  1A1F A;  4R1F A;  3T1H I;  5JEA D;  2HHH I;  3PS3 A;  2VRD A;  2BA0 D;  2ELZ A;  2YTF A;  2NN6 A;  3UHM A;  4BA2 A;  4DV5 E;  3HPZ A;  2HKE A;  3B8H A;  3ADJ A;  3PYG A;  1PJT A;  1X5W A;  2Z5C A;  4MU1 A;  4AQY E;  4AID A;  2F4V I;  4LF8 E;  3V2U C;  2GPI A;  2RS6 A;  2JEA B;  2LTS A;  3HQ1 A;  2X7I A;  2KON A;  2MDG A;  2YTE A;  2BR2 B;  1ZXN A;  2O1W A;  2JP9 A;  5DNL A;  5C0X D;  2HK3 A;  1MX0 A;  2LBS B;  2JVA A;  1HNZ E;  1NZ0 A;  2NN6 C;  4WUC A;  1BBO A;  2RTX A;  4LF6 E;  4NXM E;  4JI1 E;  1J26 A;  2HFU A;  3PYE A;  5A2Q Q;  4B3R E;  1N33 E;  4DV2 I;  4B3M I;  2GLI A;  2NN6 B;  2YRK A;  4DPX A;  4DV0 E;  2UUA E;  3VYX A;  3QT6 A;  4QNK A;  4DR2 I;  4WFT A;  4BBY A;  3L7Z B;  2PO1 B;  2EOS A;  2V8P A;  3J7A G;  1QU6 A;  2BA0 G;  2LJU A;  2HHH E;  3T1H E;  2WNR A;  4MQY A;  2YTJ A;  2JE6 B;  2UXC I;  2EQ3 A;  2DEI A;  3HUL A;  3M6A A;  2R3V A;  4R2C A;  2V2V A;  5IT9 C;  2Q2E B;  4IJD A;  4LFB E;  1WXR A;  2CTD A;  4JI4 E;  4F9C B;  1B62 A;  1AAY A;  3J80 Q;  2CSH A;  3KZZ A;  4X65 E;  3HKM A;  5AE1 A;  1OJ4 A;  3CWV A;  2DB2 A;  3J7Y p;  3D4J A;  1HR0 E;  2R42 A;  4LPF A;  4LF4 I;  1TF6 A;  3F0N A;  2EPO A;  5LLQ A;  2J7K A;  1DGC A;  2EL5 A;  1USV A;  4FK5 C;  2I9I A;  1ZM2 A;  1IBK E;  4OO1 E;  4IFD F;  1U2R A;  4DR2 E;  1D6T A;  3C6M A;  1A1I A;  1N34 E;  3KRN A;  2F8B A;  3P3E A;  4LF4 E;  2HC5 A;  1NHI A;  3KZY A;  2HGH A;  4KQV A;  3BID A;  2LUQ A;  3J7A M;  2YU8 A;  1HNX I;  1PIE A;  2L2N A;  3M99 B;  2PO2 A;  2V83 A;  4RHB B;  4WYQ B;  3ZKD A;  2UUC E;  4JI5 I;  3FIG A;  3ADG A;  1UIL A;  2PO0 A;  5A6J A;  2BB8 A;  3C6K A;  5KL7 A;  1XMQ E;  4LFC I;  4JYA I;  1YZ9 A;  2PNM A;  5K36 C;  2EMW A;  2KHX A;  4DPU A;  3B82 A;  4F9A B;  2EPK X;  4O4K A;  3K85 A;  3JAM Q;  5LMN I;  2JEA A;  5A6B A;  1ELO A;  1RHY A;  3V5R A;  2M1S A;  5C0X A;  3AV0 A;  3J81 Q;  1FI4 A;  4NXN I;  2EML A;  2HJJ A;  1WRJ A;  4HEI A;  1USU A;  2YPN A;  3H4L A;  1TF3 A;  1ZAA C;  2HK2 A;  3HJC A;  1UN6 B;  4BA2 B;  2O1V A;  4JI6 I;  2V86 A;  2YT4 A;  2PNZ A;  2UU9 I;  2EPN A;  1R6L A;  4KHP E;  4FW4 A;  3GON A;  4LF9 I;  3L7Z A;  4F54 A;  4DR4 E;  1BKN A;  4AIM A;  1N36 I;  4B3T I;  3CDI A;  2DMY A;  3IWD A;  1FWL A;  1WUU A;  3CDJ A;  1Y4S A;  1DQ3 A;  4P78 A;  1H7S A;  3L00 A;  4DU7 A;  4OZE A;  1RMD A;  2WNR B;  1YFH A;  4I3H A;  2JT2 A;  2BM0 A;  4R2A A;  2EN6 A;  1EH6 A;  4J3D A;  2JOX A;  4DUY I;  4DR5 E;  3J80 C;  2ZM6 E;  2EOE A;  2E72 A;  1Z0V A;  2MC5 A;  2EP3 A;  2CZ9 A;  2EWL A;  1FNM A;  4UT4 A;  2MC6 A;  1UDN A;  3EQ1 A;  4Q35 B;  5C0X B;  4N4R B;  4KZS A;  4DUZ I;  2R1F A;  4DV4 I;  4OO1 F;  1H72 C;  1G2F C;  5A6B D;  4BMJ A;  2CG9 A;  3B4T A;  4IZK A;  3BGH A;  4MU4 A;  4AM3 A;  4DR7 I;  4MU3 A;  3M85 G;  3KWR A;  4FN5 A;  3ADI A;  4JI8 I;  3C4T A;  3OML A;  2ELY A;  2MDR A;  1P47 A;  4TUI A;  4DV6 I;  4JI2 E;  1N32 E;  4JG4 A;  2BV3 A;  2IOP A;  5JEA E;  1RQ0 A;  3ECR A;  4OOG C;  2B7V A;  2N8X A;  4JI7 E;  1QNT A;  4N3O A;  4LF5 E;  4IS1 C;  4LTY A;  4P7D A;  5A2Q C;  1EH8 A;  2YTG A;  2EPX A;  4DR1 E;  1T39 A;  1A1L A;  2LJP A;  2EMI A;  4R2E A;  4LCH A;  4U3D A;  4ZVI A;  4DPY A;  4K0K E;  1H73 A;  1F2I G;  4LF7 I;  2LMZ A;  3J81 C;  1UBD C;  1MG7 A;  4DV4 E;  5JEA A;  2G7H A;  1N36 E;  4P7A A;  1DI2 A;  3PYD A;  2PNZ B;  2R76 A;  1FWK A;  2Z5E A;  4Q28 A;  2V87 A;  2DLK A;  4NZV A;  2B3T B;  2ODR C;  5A6A A;  1P42 A;  2BA1 G;  1Z59 A;  1X6H A;  4I8O A;  1FKA E;  2IER A;  5FWK A;  1KJK A;  1N3G A;  3QT5 A;  4ZYD A;  4F9B B;  1A1G A;  4WSG A;  2A2C A;  5DRP A;  2EOQ A;  2EN2 A;  1Z1B A;  5FLX Q;  5ADZ A;  2NUF A;  1Z0C A;  1Z5C A;  2WP8 A;  1STU A;  3THO B;  5AC5 A;  4M2Z A;  4MYU A;  3HPS A;  2VES A;  3LML A;  3QT8 A;  1GQE A;  4LFC E;  4ZYG A;  1PJS A;  1NHH A;  1OYR A;  2PO2 B;  4DU8 A;  1XMQ I;  2EMG A;  5K36 E;  2WBU A;  5JEA C;  1T4O A;  4OX9 I;  1T4L B;  1G2D C;  4IFD A;  4JI7 I;  1YYW A;  2EPC A;  2EPA A;  1KIJ A;  2EN8 A;  2FGG A;  4WPY A;  4F2J C;  2NAB A;  4Z7C A;  4X8W A;  5LMU E;  2K7I A;  2F1D A;  4LCG A;  1N32 I;  4NHR A;  2L8T A;  2EN7 A;  4MLQ A;  2ZIT A;  3IWC A;  4LF7 E;  1YYO A;  2E1M A;  1EKZ A;  1FJG E;  2UXD E;  4X62 E;  2D9H A;  5IT9 Q;  2EN4 A;  2IOQ A;  2V89 A;  4FWD A;  2RSI A;  1NHJ A;  3EPL A;  2HFS A;  1E3P A;  1HNW I;  2MKN A;  1EI1 A;  2CT1 A;  1R6M A;  4MU0 A;  2EPR A;  4XTJ A;  4IFD B;  2L2K B;  3VYY A;  1H7U A;  3WU5 A;  1Y4U A;  4IZJ A;  2NPF A;  4BHB A;  1H74 A;  2NN6 F;  1ZM9 A;  4Z7Y A;  4R2P A;  4OO1 B;  2MKD A;  1AH5 A;  5C0X F;  5KL5 A;  1YHC A;  2M7Q A;  2V88 A;  1N34 I;  2BBG A;  1J5E E;  1Z5B A;  4PU9 A;  3ZZT A;  4GZN C;  3TQM A;  1DAR A;  1RC7 A;  2PNL A;  3VHT B;  3WU4 A;  2YSO A;  3AUZ A;  1IBM E;  2EFG A;  4BC7 A;  2VF3 A;  1NEI A;  4BC9 A;  1YSA C;  4LFA I;  4B3M E;  4LCF A;  1XNQ E;  5BR8 E; 
#chains in the Genus database with same CATH homology
 3OTO E;  3F6H A;  4LF9 E;  4GKK I;  3HXL A;  4X64 E;  1ZM4 A;  4JI0 I;  1N0U A;  2V2Q A;  1KVK A;  3HTX A;  4USM A;  4DV7 I;  4JI6 E;  2Z5C B;  4ED4 A;  1I94 I;  4PRV A;  4LF8 I;  1X49 A;  1X48 A;  2UUB I;  1XMO E;  1UEK A;  3Q1Q A;  1PVG A;  3ZOQ B;  4DV0 I;  2UUA I;  3JU0 A;  4DXL A;  4HY1 A;  5AE2 A;  1WHN A;  4JI1 I;  4JYA E;  4KHP I;  2JWO A;  3PYF A;  2Z5B B;  1S16 A;  2BM1 A;  2N3G A;  4R8O A;  2WZO A;  4GKK E;  2FV4 B;  1HNX E;  3OTO I;  4FWH A;  1N0V C;  4HXZ A;  4R03 A;  2V8Q B;  1IBM I;  2L92 A;  1J5E I;  2EZ6 A;  2DSY A;  1Y6Z A;  4PRX A;  4GEQ B;  2B7T A;  4M30 A;  4X66 E;  3WU6 A;  2VF1 A;  2HKJ A;  3P06 A;  3ZKB A;  2E5L I;  1XNQ I;  4LFB I;  3T1Y I;  4WSP A;  3ADL A;  2UXC E;  4YHH I;  3LTO A;  1IBK I;  2UXD I;  3P1X A;  1ZBT A;  4WUD A;  5GMD A;  2A2D A;  1HR0 I;  2LRS A;  2E5L E;  2LE2 A;  2L3C A;  3JTZ A;  2VQE E;  2CPN A;  2RSM A;  5GME A;  5F3W A;  4DPW A;  1SR9 A;  3F6G A;  4HYM A;  2V2Z A;  2LUP B;  2F4V E;  4AQY I;  1RR9 A;  1HK7 A;  1ZM3 A;  4DV3 I;  4DV5 I;  1XMO I;  2UUB E;  5L3J A;  5AAS A;  2RS7 A;  4DV2 E;  5LMU I;  1I94 E;  1PKP A;  2GQ0 A;  4B3R I;  1N33 I;  1UHZ A;  2Z5B A;  4HAC A;  3ZZU A;  1HNZ I;  3QT7 A;  4DV1 E;  2H36 X;  3DF6 A;  3LLH A;  2JR1 A;  5BR8 I;  1T4N A;  3LNU A;  2DEJ A;  2VQF E;  1XNR E;  2L3J A;  4RPF A;  1MU5 A;  2V85 A;  3Q6M A;  4K0K I;  4JI3 I;  1IBL E;  5FLX C;  5LL6 R;  1ZXM A;  2LTR A;  4DKK A;  4MYT A;  2LJH A;  4FW9 A;  1KTV A;  2B9D A;  3WU3 A;  4DV7 E;  4LU9 A;  4B3S E;  4JI0 E;  1Z0B A;  4X64 I;  4J8Z A;  2UXB E;  4JI2 I;  4DR3 E;  2V34 A;  4JV5 I;  4LFA E;  2XEX A;  4JI8 E;  1Z0W A;  3C4B A;  4X62 I;  3ZM7 A;  1WHQ A;  2OI2 A;  4JV5 E;  1Z5A A;  2KOU A;  4WUB A;  2UXB I;  2L2M A;  4UTG A;  4IZJ B;  3DJW A;  5IWA I;  2X36 A;  1B63 A;  3H09 A;  4DV6 E;  4OX9 E;  3LPS A;  4YY3 E;  4DUY E;  3VK6 A;  3JAM C;  1S4E A;  4IZK B;  1HNW E;  1XHK A;  1FJG I;  2L33 A;  4DR6 I;  4EMD A;  3K6Q A;  2JY9 A;  2DIX A;  1O0W A;  4GKJ I;  4HAC B;  4B3S I;  2CGE A;  4IZJ D;  4L5N C;  4BS9 A;  4M0V A;  3ZZ0 A;  4P52 A;  2ZBK B;  2FTX B;  1Z0T A;  2VE7 C;  4FWG A;  1IBL I;  4DV3 E;  3PRY A;  4BCA A;  3IWB A;  2VQF I;  1XNR I;  1A6F A;  4USK A;  4TUG A;  4DR1 I;  4DV1 I;  4YY3 I;  2UU9 E;  4LF5 I;  2GS8 A;  3MSW A;  1K47 A;  5T6J A;  2WW4 A;  3RMP A;  2M4I A;  4NXN E;  2NUG A;  4GKJ E;  1KKH A;  2AJ4 A;  1RRE A;  2L6M A;  4DR6 E;  5LMN E;  2IHR 1;  2JOB A;  2K4V A;  2N3H A;  2VQE I;  4DUZ E;  4JI5 E;  2UUC I;  4DMI A;  2E1R A;  2O1U A;  5IWA E;  4URL A;  1VIS A;  3K17 A;  2NUE A;  5DNY A;  4DR5 I;  1X47 A;  1GZ6 A;  1YYK A;  4JI3 E;  4DR7 E;  4YHH E;  3Q6N A;  2O1T A;  3T1Y E;  3K1J A;  4DR3 I;  4B3T E;  4DR4 I;  4LF6 I;  1ZBQ A;  2ODR D;  4L8N A;  4X65 I;  4NXM I;  1Z0E A;  4M1K A;  2YZT A;  1EA6 A;  1QZR A;  4X66 I;  4DPT A;  4JI4 I;  2ZM6 I;  5CFF E;  2NA2 A;  5AE3 A;  1Z0G A;  3T1H I;  3B78 A;  2HHH I;  4R1F A;  4DV5 E;  3HPZ A;  2HKE A;  3B8H A;  3ADJ A;  3PYG A;  2Z5C A;  4AQY E;  2F4V I;  4LF8 E;  3V2U C;  2RS6 A;  2LTS A;  3HQ1 A;  2KON A;  2O1W A;  1ZXN A;  2HK3 A;  1MX0 A;  2LBS B;  2JVA A;  1HNZ E;  1NZ0 A;  4WUC A;  2RTX A;  4LF6 E;  4NXM E;  4JI1 E;  1J26 A;  2HFU A;  3PYE A;  5A2Q Q;  4B3R E;  1N33 E;  4DV2 I;  4B3M I;  4DPX A;  4DV0 E;  2UUA E;  3VYX A;  3QT6 A;  4DR2 I;  4WFT A;  4BBY A;  2V8P A;  3J7A G;  1QU6 A;  2HHH E;  3T1H E;  2UXC I;  3HUL A;  2DEI A;  3M6A A;  2R3V A;  2V2V A;  5IT9 C;  2Q2E B;  4LFB E;  1WXR A;  4JI4 E;  4F9C B;  1B62 A;  3J80 Q;  4X65 E;  5AE1 A;  1OJ4 A;  3CWV A;  2DB2 A;  3J7Y p;  3D4J A;  1HR0 E;  2R42 A;  4LF4 I;  3F0N A;  2J7K A;  1USV A;  1ZM2 A;  1IBK E;  1U2R A;  4DR2 E;  1D6T A;  1N34 E;  2F8B A;  4LF4 E;  1NHI A;  4KQV A;  2LUQ A;  3J7A M;  1HNX I;  1PIE A;  2L2N A;  2V83 A;  3ZKD A;  4WYQ B;  2UUC E;  4JI5 I;  3FIG A;  3ADG A;  1UIL A;  1XMQ E;  4LFC I;  4JYA I;  1YZ9 A;  2PNM A;  2KHX A;  4DPU A;  3B82 A;  4F9A B;  3JAM Q;  5LMN I;  3K85 A;  1ELO A;  3V5R A;  2M1S A;  3AV0 A;  3J81 Q;  1FI4 A;  4NXN I;  1USU A;  3H4L A;  3HJC A;  2HK2 A;  2O1V A;  4JI6 I;  2V86 A;  2YT4 A;  2UU9 I;  4KHP E;  3GON A;  4LF9 I;  4F54 A;  4DR4 E;  1BKN A;  1N36 I;  4B3T I;  2DMY A;  3IWD A;  1FWL A;  1WUU A;  1Y4S A;  1DQ3 A;  4P78 A;  1H7S A;  4DU7 A;  4I3H A;  2BM0 A;  4DUY I;  2JOX A;  4DR5 E;  3J80 C;  2ZM6 E;  1Z0V A;  2MC5 A;  2CZ9 A;  2EWL A;  1FNM A;  4UT4 A;  2MC6 A;  4KZS A;  4DUZ I;  4DV4 I;  1H72 C;  2CG9 A;  4IZK A;  4BMJ A;  4DR7 I;  3KWR A;  4FN5 A;  3ADI A;  4JI8 I;  3C4T A;  3OML A;  2MDR A;  4TUI A;  4DV6 I;  4JI2 E;  1N32 E;  4JG4 A;  2BV3 A;  2IOP A;  1RQ0 A;  4OOG C;  2B7V A;  4JI7 E;  4N3O A;  4LF5 E;  4LTY A;  4P7D A;  5A2Q C;  4DR1 E;  2X7I A;  2LJP A;  4ZVI A;  4DPY A;  4K0K E;  1H73 A;  4LF7 I;  2LMZ A;  3J81 C;  1MG7 A;  4DV4 E;  2G7H A;  1N36 E;  4P7A A;  1DI2 A;  3PYD A;  1FWK A;  2Z5E A;  4Q28 A;  2V87 A;  2B3T B;  2ODR C;  1Z59 A;  4I8O A;  1FKA E;  5FWK A;  3QT5 A;  4F9B B;  2A2C A;  5FLX Q;  5ADZ A;  2NUF A;  1Z0C A;  1Z5C A;  1STU A;  4M2Z A;  4MYU A;  3HPS A;  3LML A;  3QT8 A;  1GQE A;  4LFC E;  4DU8 A;  1XMQ I;  1NHH A;  1T4O A;  4OX9 I;  1T4L B;  4JI7 I;  1YYW A;  1KIJ A;  4WPY A;  2FGG A;  4Z7C A;  4X8W A;  5LMU E;  1N32 I;  2L8T A;  2ZIT A;  3IWC A;  4LF7 E;  1YYO A;  2E1M A;  1EKZ A;  1FJG E;  2UXD E;  4X62 E;  5IT9 Q;  2IOQ A;  4FWD A;  2V89 A;  1NHJ A;  2HFS A;  1HNW I;  1EI1 A;  4XTJ A;  2L2K B;  3VYY A;  1H7U A;  3WU5 A;  1Y4U A;  4IZJ A;  2NPF A;  1H74 A;  1ZM9 A;  4Z7Y A;  2M7Q A;  2V88 A;  1N34 I;  1J5E E;  1Z5B A;  4PU9 A;  3ZZT A;  1DAR A;  1RC7 A;  2PNL A;  3WU4 A;  3AUZ A;  1IBM E;  2EFG A;  4BC7 A;  2VF3 A;  4BC9 A;  4LFA I;  4B3M E;  1XNQ E;  5BR8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...