3J7AG

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
224
Chain Sequence
KNWVPVTKLGRLVKEGKIVSIEEIYLHSLPIKEYQIIDYFFQPNECSHPLKDDVVKIMPVQKQTRAGQRTRFKAFVAIGDGNGHCGLGVKCAKEVATAIRGAIISAKLSLIPVRRGYWGNKIGDPHTVPMKVSGKCGSVRIRLVPAPRGTQIVGAPTTKKMLNFAGIKDCFSSSCGKTKTKGNFLRAIFNALSKTYGYLTPDLWKVTNFDKSPYEEWSDFLETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
total genus 46
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
G PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j7aG01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j7aG02
4OX9E 4DV7I 1XMOE 3QT6A 4JI6E 4DR2I 5IWAI 5FLXQ 2X36A 2UUBE 1ZXNA 4JI8I 3PYDA 1N0UA 4YY3E 4DV1E 3D4JA 2HFSA 2ZM6I 4EMDA 1Z0EA 1Z0GA 3GONA 4DUZI 4B3SI 1U2RA 4B3RI 2GS8A 2E5LI 1QZRA 5GMDA 3JAMC 4DR6E 4JI8E 4KQVA 1Z0VA 5LMUI 2VF3A 4DR3I 5A2QC 4B3SE 4DPXA 2BM1A 4DV5I 3V5RA 1HR0E 4FWHA 2XEXA 4DPYA 4LFCI 1XHKA 4DV0I 3PYFA 4X65I 1FI4A 2HKEA 4LF8I 4B3ME 2E1RA 1HNZE 1N33I 4LF7I 4MYUA 4JI0I 1NZ0A 2UXCI 4LFCE 3K1JA 1FWLA 4DV0E 4LF4I 4X65E 1I94E 1N33E 3WU3A 4JI1E 4KHPI 4JI0E 3J80C 1ZM9A 1BKNA 4JYAE 4HACA 4LF5I 3H4LA 4JI4I 4DR7E 3M6AA 2WW4A 1IBKI 2VQFI 1EA6A 1Z0TA 3HULA 2ZITA 4KHPE 4R1FA 3WU4A 4P52A 4DR5I 4LF6I 4LF9I 4HYMA 2OI2A 4P7AA 1NHHA 4FN5A 4DV6I 4Z7YA 1N32E 1A6FA 1IBKE 2VQFE 2UU9E 1N34E 4HXZA 2UUCI 1Z5BA 2DEJA 1RREA 4B3TI 1Z0WA 2V34A 4DV4E 4LFAE 5IT9Q 1KIJA 1MG7A 1H74A 2VQEE 5L3JA 3J7AM 2LJPA 3Q1QA 4JV5E 4DR4I 2NPFA 3LPSA 4GKKI 2UUCE 4WUBA 4DV7E 2HFUA 4DV3I 4DR2E 4WUCA 5IWAE 4B3TE 4JI5I 3LNUA 1KVKA 2F4VI 4AQYI 4X64I 4LFBI 2ZM6E 1HNWI 4DUZE 3JAMQ 4DR4E 1IBLI 4HY1A 1PVGA 4B3RE 3QT8A 2E5LE 1MU5A 5LL6R 1OJ4A 4JI5E 1S16A 5A2QQ 3QT5A 1IBMI 4RPFA 1ZM2A 4X64E 4LFBE 3OTOI 3WU6A 5LMUE 2UXDI 1VISA 3ZZ0A 4DR3E 1KTVA 4UT4A 4DV5E 4PRVA 1EI1A 1J5EI 3T1HI 5LMNI 1IBME 4DUYI 4M1KA 1K47A 4JG4A 2DEIA 2HHHI 2UXDE 4WUDA 4JI3I 4DXLA 5GMEA 1Z0CA 4NXNI 4LF8E 2X7IA 2BM0A 4LF7E 3T1HE 5LMNE 2UXCE 4URLA 3T1YI 1S4EA 4LF4E 4Z7CA 1H7UA 3ZM7A 2HHHE 4X66I 2V2ZA 4ZVIA 1XMQI 4DPWA 1B62A 2V2QA 3J80Q 2UXBI 4DU8A 4JI2I 4DR1I 1Z5AA 3LTOA 3K17A 2CZ9A 1N36I 3J81C 4LF5E 2A2DA 1XMQE 1XNQI 4JI4E 4GKJI 2HKJA 4ED4A 2AJ4A 1XNRI 4JI7I 3B82A 4USKA 2Q2EB 4OX9I 4K0KI 4FWDA 4FWGA 1XMOI 4DR5E 1NHIA 4JI6I 4LF6E 4LF9E 4YHHI 4YY3I 4DV1I 1MX0A 4DV6E 2V2VA 3F0NA 2HK2A 3ZKDA 4NXMI 5FLXC 1PIEA 1HNXI 1FJGI 4DPUA 4JI7E 4K0KE 4DPTA 1WUUA 4X62I 4DR6I 4YHHE 1B63A 2R3VA 4MYTA 1ELOA 1Z5CA 2A2CA 1RR9A 4NXME 2BV3A 1HNXE 1FJGE 2ZBKB 4GKKE 1KKHA 4I3HA 4DV3E 4X62E 1D6TA 1HR0I 2R42A 1FWKA 2F4VE 4AQYE 4DU7A 1HNWE 1H7SA 1IBLE 3ZKBA 1UEKA 4FW9A 4B3MI 1HNZI 3WU5A 3CWVA 5BR8I 3ZZTA 3OTOE 1Z0BA 1NHJA 1N0VC 2UUAI 1ZXMA 4UTGA 1I94I 1J5EE 3B78A 4JI1I 4XTJA 5BR8E 1H73A 4DUYE 4PRXA 4JYAI 3J7AG 1H72C 2EFGA 1Z59A 4JI3E 4DR7I 3QT7A 4NXNE 3B8HA 2UUAE 4HACB 3PYGA 1FNMA 4DV2I 1DARA 3T1YE 1FKAE 3PYEA 4X66E 1N32I 2UXBE 2V8PA 2UU9I 1N34I 3V2UC 4JI2E 4DR1E 3J81Q 4DV2E 2J7KA 2HK3A 1N36E 2UUBI 4DV4I 1XNQE 4LFAI 3ZZUA 1ZM4A 4PU9A 4GKJE 2VQEI 1ZM3A 4JV5I 1PKPA 1XNRE 5IT9C 4USMA
chains in the Genus database with same CATH superfamily
3P3EA 4OX9E 2N3GA 2BR2B 1WRJA 4U3DA 4DV7I 2HC5A 1XMOE 2YWQA 3QT6A 4JI6E 5AC4A 3HPSA 1EH7A 4WXCA 2WBSA 1F2IG 4DR2I 5A6AA 5IWAI 5FLXQ 2UUBE 1Y6ZA 1ZXNA 2X36A 2N8XA 4YY3E 1BBGA 4DV1E 1N0UA 3CDIA 4WXDA 3D4JA 3PYDA 4JI8I 2VF1A 2RPCA 2EPPA 2YRHA 1UILA 2HFSA 3BF2A 1SR9A 2MC6A 5DNXA 5ADZA 1PJSA 2ZM6I 4EMDA 2YRMA 1Z0EA 3ADLA 1Z0GA 3GONA 4FW3A 4DUZI 4B3SI 1X5WA 1YHCA 3AV0A 2L2MA 2EN8A 2ADRA 2FV4B 1U2RA 4B3RI 2GS8A 1Y5YA 1EH6A 2E5LI 3UHMA 1QZRA 5KL3A 5GMDA 3JAMC 4R03A 4DR6E 4JI8E 1X6HA 2DRPA 5AE1A 1PJTA 1MGTA 4MQYA 2L33A 4FW7A 5LLQA 3EPLA 4KQVA 3BBGA 5JEAB 2YTEA 1X49A 1TF6A 5KL7A 1Z0VA 1A1HA 4GEQB 4MDTA 2C39A 5LMUI 2EOIA 2VF3A 4WYQB 4DR3I 5A2QC 4B3SE 5C0XB 4F9CB 1BB8A 4DPXA 2Z5BA 4BC9A 2LUPB 2BM1A 4X8WA 2O1VA 4DV5I 2EMYA 3V5RA 4WX9A 4IZJB 1WHQA 4OO1C 2EPAA 2YTQA 1HR0E 1UN6B 4FWHA 5AE3A 2XEXA 4IFDA 1YH8A 4DPYA 4LFCI 1RC7A 1XHKA 2JPAA 3UK3C 5KL5A 4F9AB 2O3ZA 3PYFA 4DV0I 5AASA 3FIGA 2YT4A 5KL2A 4X65I 4MU1A 3H09A 4R2RA 4MU0A 3K85A 2EMIA 3KZZA 2F1DA 2B9DA 3LMLA 4LCGA 1FI4A 2HKEA 2EWLA 1HK7A 4LF8I 5K36A 4HEIA 4IZKB 4F2JC 4B3ME 1ZU1A 2E1RA 1HNZE 3BGHA 3TQMA 4AIMA 1N33I 2EN4A 2B7VA 4LF7I 4MYUA 4JI0I 1NZ0A 2MDGA 2UXCI 4LFCE 3K1JA 2PNZB 1FWLA 1UBDC 2YSPA 4DV0E 1DQ3A 3P3GA 2EL5A 2PNLA 3HQ1A 2H36X 3M85G 4LF4I 2BBGA 2EPNA 4N4RB 4X65E 2RS6A 2LTSA 2JOXA 3VK6A 3RMPA 2NN6B 3F6HA 1WHNA 2DLKA 4ZYDA 4NHRA 2YRKA 1I94E 2DGCA 1N33E 1UDOA 2C37A 3DD6A 3WU3A 2EPCA 2R76A 4JI1E 4FK5C 2GO3A 4KHPI 1YYKA 2EE8A 5A6JA 4JI0E 1YZ9A 3J80C 2EQ3A 3LLHA 1ZM9A 2WNRB 5AC5A 2YU8A 1BKNA 2EM8A 4JYAE 2EN2A 2R1FA 2LBSB 2B3TB 2ENCA 4HACA 2JR1A 4LF5I 4OO1B 2EM4A 3H4LA 4DR7E 3IWDA 4Q28A 2IESA 3M6AA 3NZKA 3PS3A 4JI4I 2CT1A 2EOEA 2EQ0A 1RMDA 2WW4A 4LU9A 1IBKI 5DRPA 2EJ4A 2VQFI 2MKDA 4L8NA 1EA6A 2PO1B 1Z0TA 5AE2A 1T39A 2LRSA 4RHBB 2ENAA 3KWRA 3HULA 4KHPE 2EN6A 2IHR1 3K6QA 4M0VA 2ZITA 2PO0B 5KL6A 4R1FA 4O43A 2C38B 1PDAA 5JEAC 3WU4A 1GTKA 4P52A 4DR5I 2GO4A 4LF6I 2LVHA 4LF9I 4HYMA 5DNYA 1YYOA 2OI2A 2PO1A 4P7AA 1XXEA 3VHTB 5K36D 1NHHA 4FN5A 2K7IA 2ODRC 2YTOA 1E3HA 4DV6I 1N32E 4Z7YA 1A6FA 1JK2A 1IBKE 1NEIA 2VQFE 2C38A 2UU9E 2EM7A 1N34E 3P1XA 4HXZA 2DB2A 1KYQA 2HJJA 1UHZA 4BS9A 3M7ND 4LCHA 2FGGA 4KZSA 2UUCI 1Z5BA 2DEJA 1RREA 2EOOA 1GZ6A 2DMYA 3MHSC 3C4BA 4R2DA 2LE2A 4B3TI 2ELZA 2CGEA 1Z0WA 4DV4E 2V34A 2Z5EA 4LFAE 2DSYA 4ZYHA 5IT9Q 1KIJA 1MG7A 1H74A 2G7HA 2VQEE 2EOQA 1A1IA 1USUA 2Q8UA 2BR2A 5L3JA 2JEBB 2EM2A 2EMXA 3J7AM 4O5GA 2V86A 2EM0A 4P7DA 2LJPA 2V88A 4ZYGA 2IOPA 3HJCA 4GQUA 3Q1QA 2VRDA 2ENHA 4JV5E 4O24A 4DR4I 2NPFA 2M4IA 2GHFA 2NUEA 1A1FA 3LPSA 4GKKI 2EM6A 2UUCE 4WUBA 4DV7E 4IJDA 5DNLA 5ELWA 2MC5A 2M7QA 2HFUA 1X3CA 2YSOA 4DR2E 2BA0D 1EKZA 4M2ZA 3HKMA 2EOMA 5IWAE 4B3TE 4WUCA 3OMLA 4JI5I 3VYXA 4IFDF 3LNUA 2NN6C 2JY9A 1KVKA 5KL4A 2A25A 2F4VI 2EMLA 4RH8A 4AQYI 2EM5A 2YZTA 2E72A 1SFEA 4X64I 4LFBI 3THNA 2ZM6E 2EPUA 3MHHC 2EOFA 4WFTA 4DUZE 2PO2B 4DR4E 4OZEA 3JAMQ 1HNWI 1IBLI 3Q6NA 2YTFA 4HY1A 1IMUA 4FW4A 2CVEA 2JOBA 2KOUA 1A1JA 4B3RE 1PVGA 3ADJA 2PNMA 1EH8A 3QT8A 5K36F 2EM9A 2E5LE 1J26A 3ZOQB 1MU5A 5JEAA 2EMWA 5LL6R 1OJ4A 2GQ0A 4JI5E 1YSAC 1S16A 2V87A 4R2AA 5A2QQ 3QT5A 1IBMI 4RPFA 5C0XA 3L00A 1YUJA 1ZM2A 4MU3A 5FWKA 3EPKA 3JU0A 3DJWA 4X64E 4LFBE 4U3BA 3OTOI 1A1LA 3WU6A 5LMUE 2LT7A 1VISA 3ZZ0A 2UXDI 2EM3A 2L3JA 4IZJA 4DR3E 4LCFA 1KTVA 4BA2B 2YU5A 4M9VC 5IV8B 4UT4A 2YTNA 2RS7A 1Y4UA 4DV5E 1A1KA 1UDQA 4PRVA 2EOJA 2YTJA 3BIDA 2I13A 2JE6B 4Q35B 1EI1A 2EMFA 4F6NA 1IQSA 1J5EI 3T1HI 3CDJA 2JP9A 5DRRA 1IBME 5LMNI 4N3OA 4DUYI 4M1KA 1PJQA 4BA2A 4IFDE 2CPNA 5T6JA 4BC7A 3ADIA 1K47A 3ECRA 2E1MA 1X47A 4JG4A 2CSHA 2DEIA 3Q6MA 4IZKA 2UXDE 2J65A 4IS9A 2HHHI 4BA1B 4WUDA 1QNTA 1OYPA 4JI3I 4DXLA 2M1SA 2YPNA 5GMEA 2EPMX 4J8ZA 2YTPA 3B4TA 1Z0CA 4NXNI 2PNZA 1X6FA 4LF8E 2Z5CB 4NBQA 3KRNA 2X7IA 2CG9A 2BM0A 1Z1BA 5K36E 2DLQA 1X48A 4LF7E 3T1HE 1IQOA 4BA1A 4OO1F 5LMNE 2UXCE 2DMIA 4URLA 3THOB 2NN6A 3T1YI 3P76A 1S4EA 3L7ZB 3M7NG 3U1KA 4LF4E 4OOGC 4Z7CA 1R6MA 1H7UA 4LPFA 2HHHE 3ZM7A 4X66I 2V2ZA 4ZVIA 2BA1D 4DPWA 3GCMA 1XMQI 4AM3A 4BBYA 1B62A 2V2QA 4WSPA 3J80Q 1R6LA 4IFDD 2UXBI 2WNRA 1ZR9A 5C0XD 4DU8A 2V83A 4JI2I 4DR1I 2EOHA 2LJHA 1Z5AA 4QNKA 4GZNC 3LTOA 4OO1A 3K17A 4I8OA 2FTXB 3U1YA 4IZJD 1YFHA 2LUQA 1AAYA 2AE8A 2EPLX 3C6KA 2PRTA 2CZ9A 2LV2A 1N36I 3J81C 1O0WA 4LF5E 2A2DA 2BA0G 1XMQE 2IOQA 1XNQI 4JI4E 2PO0A 1MEYC 5TSEA 2EOXA 4AIDA 4GKJI 2HKJA 3AUZA 2EZ6A 1B69A 4ED4A 2AJ4A 4WPYA 2YTDA 2O1WA 2EP3A 2EMAA 1XNRI 4IS1C 4JI7I 3B82A 2EN7A 4USKA 5A69A 1A1GA 2EMBA 2LTRA 5IXMB 2Q2EB 4OX9I 4K0KI 4FWDA 4FWGA 3MSWA 1XMOI 2K4VA 4DR5E 1NHIA 4JI6I 4LF6E 4LF9E 3C6MA 1WXRA 4YHHI 2VE7C 4YY3I 4DV1I 4DV6E 1MX0A 4J3DA 1OYSA 2V2VA 1RHYA 5EL9A 1OYRA 3F0NA 2YTGA 1VI7A 2HK2A 3ZKDA 4NXMI 1ZBTA 1G2DC 3ADGA 5FLXC 1PIEA 1HNXI 4WSGA 5A6BA 4DPUA 4JI7E 1FJGI 2EOZA 2KHXA 1DGCA 5K36C 3VYYA 4K0KE 3H1CA 4DPTA 3M99B 1WUUA 5JEAF 4BHBA 2V85A 3C4TA 3KZYA 4X62I 2JEBA 3IWBA 5F3WA 1RQ0A 4FW6A 2JVAA 2YTIA 4R2EA 4DKKA 1BBOA 4YHHE 1B63A 2R3VA 5C0XF 4DR6I 4P78A 4NZVA 1L4SA 4MYTA 4LOMA 3QG5C 4MLQA 2NUFA 2D9HA 1ELOA 5DRQA 2NUGA 1Z5CA 4NXME 1RR9A 2A2CA 4ISAA 1T4NA 2V89A 5DROA 4OO1D 2RTXA 3JTZA 2BV3A 3EPJA 4F54A 1HNXE 1FJGE 3PS2A 2ZBKB 4GKKE 2MDRA 1N3GA 2EPZA 1KKHA 1NCSA 1DI2A 4I3HA 4DV3E 2KONA 4X62E 2C39B 2L92A 1T4OA 2EMHA 5EKWA 2WBTA 4O4KA 2EMGA 4M30A 1D6TA 2PO2A 4HTGA 1HR0I 2R42A 1FWKA 2F4VE 2L2NA 2WBUA 4R2QA 1YUIA 2Z5BB 4MU4A 1KJKA 1GQEA 4AQYE 2O1UA 4DU7A 3P06A 2JWOA 2B7TA 2L2KB 2J7JA 1HNWE 1H7SA 4FW5A 1AH5A 2NABA 3GMEA 4IFDB 1IBLE 3ZKBA 3GLLA 2JYAA 2BA1G 2ELYA 1UEKA 1T38A 2EQ1A 4FW9A 2EMKA 4B3MI 2EPRA 1HNZI 2NA2A 4R8OA 3WU5A 5JEAE 3CWVA 4KWYA 2NN6F 1T4LB 3J7Yp 5BR8I 2LMZA 1Y60A 1UDNA 5K36B 5A6BD 3ZZTA 2EPOA 2LCEA 5C0XE 3EQ1A 3OTOE 1P42A 1YYWA 2EOSA 2JE6A 1Z0BA 1TN9A 4OKGA 4QNJA 1NHJA 4DV3I 1N0VC 2EL4A 1E3PA 1STUA 2GLIA 2MKNA 2UUAI 4R2SA 1ZXMA 4UTGA 2RSMA 2RSIA 3HXLA 1I94I 2L3CA 2LJUA 1J5EE 3B78A 4JI1I 4XTJA 4F6MA 3HTXA 2EORA 5BR8E 4DUYE 2HGHA 1H73A 2JXPA 4X9JA 2C37B 2N3HA 4PRXA 2Z5CA 4JYAI 3J7AG 4BCAA 3EPHA 1H72C 2EFGA 1Z59A 4JI3E 1G2FC 2BB8A 5JEAD 4DR7I 4R2CA 3QT7A 4NXNE 3B8HA 2I9IA 3PRYA 1YPNA 2UUAE 3L7ZA 1ZAAC 1Y4SA 2WCC3 2JEAB 4HACB 3PYGA 1FNMA 4LTYA 4TUGA 2EL6A 2ODRD 4DV2I 1P47A 2EMCA 2L8TA 4MLVA 1DARA 4BHCA 5A6KA 4TUIA 3T1YE 4L5NC 1LLMC 1FKAE 2NN6E 2RQLA 2EPKX 4X66E 3PYEA 2JEAA 1ZBQA 2EPXA 2GPIA 4ZYEA 2IERA 1N32I 3F6GA 3HPZA 1TF3A 2UXBE 2V8PA 2UU9I 1N34I 3V2UC 3IWCA 4JI2E 4DR1E 3J81Q 4DMIA 4DV2E 2WP8B 2L6MA 3M85D 1WJPA 2M9AA 2WZOA 4OO1E 3P3CA 2J7KA 2EMZA 1USVA 3PS1A 2HK3A 1N36E 2VESA 4IFDC 1QU6A 2UUBI 5C0XC 4DV4I 2V8QB 1XNQE 4LFAI 3ZZUA 1ZM4A 4PU9A 2EN1A 4F9BB 2WP8A 4GKJE 2VQEI 1X6EA 2F8BA 3DF6A 2CTDA 2EN3A 1JK1A 2EOYA 4BMJA 2DIXA 2LO3A 1ZM3A 1UDSA 2NN6D 4R2PA 4JV5I 1PKPA 5CFFE 1XNRE 5IT9C 2O1TA 2JT2A 4USMA
chains in the Genus database with same CATH topology
4OX9E 2N3GA 4DV7I 1XMOE 3QT6A 4JI6E 3HPSA 4DR2I 5IWAI 5FLXQ 2UUBE 1Y6ZA 1ZXNA 2X36A 4JI8I 4YY3E 4DV1E 1N0UA 3PYDA 3D4JA 2VF1A 1UILA 2HFSA 1SR9A 2MC6A 5ADZA 2ZM6I 4EMDA 1Z0EA 3ADLA 1Z0GA 3GONA 4DUZI 4B3SI 3AV0A 2L2MA 2FV4B 1U2RA 4B3RI 2GS8A 2E5LI 1QZRA 5GMDA 3JAMC 4R03A 4DR6E 4JI8E 5AE1A 2L33A 4KQVA 1X49A 1Z0VA 4GEQB 5LMUI 2VF3A 4WYQB 4DR3I 5A2QC 4B3SE 4F9CB 4DPXA 2Z5BA 4BC9A 2LUPB 2BM1A 4X8WA 2O1VA 4DV5I 3V5RA 4IZJB 1WHQA 1HR0E 4FWHA 5AE3A 2XEXA 4DPYA 4LFCI 1RC7A 1XHKA 4F9AB 4DV0I 3PYFA 5AASA 3FIGA 2YT4A 4X65I 3H09A 3K85A 2B9DA 3LMLA 1FI4A 2HKEA 2EWLA 1HK7A 4LF8I 4IZKB 4B3ME 2E1RA 1HNZE 1N33I 2B7VA 4LF7I 4MYUA 4JI0I 1NZ0A 2UXCI 4LFCE 3K1JA 1FWLA 4DV0E 1DQ3A 2PNLA 3HQ1A 2H36X 4LF4I 4X65E 2RS6A 2LTSA 2JOXA 3VK6A 3RMPA 3F6HA 1WHNA 1I94E 1N33E 3WU3A 4JI1E 4KHPI 1YYKA 4JI0E 1YZ9A 3J80C 3LLHA 1ZM9A 1BKNA 4JYAE 2LBSB 2B3TB 4HACA 2JR1A 4LF5I 3H4LA 4DR7E 3IWDA 4Q28A 4JI4I 3M6AA 2WW4A 4LU9A 1IBKI 2VQFI 1EA6A 4L8NA 1Z0TA 5AE2A 2LRSA 3KWRA 3HULA 4KHPE 2ZITA 2IHR1 3K6QA 4M0VA 4R1FA 3WU4A 4P52A 4DR5I 4LF6I 4LF9I 4HYMA 5DNYA 1YYOA 2OI2A 4P7AA 1NHHA 4FN5A 4DV6I 2ODRC 1N32E 4Z7YA 1A6FA 1IBKE 2VQFE 2UU9E 1N34E 3P1XA 4HXZA 2DB2A 1UHZA 4BS9A 2FGGA 4KZSA 2UUCI 1Z5BA 2DEJA 1RREA 1GZ6A 2DMYA 3C4BA 2LE2A 4B3TI 2CGEA 1Z0WA 4DV4E 2V34A 2Z5EA 4LFAE 2DSYA 5IT9Q 1KIJA 1MG7A 1H74A 2G7HA 2VQEE 1USUA 5L3JA 3J7AM 3HJCA 2V86A 4P7DA 2LJPA 3Q1QA 2V88A 2IOPA 4JV5E 4DR4I 2NPFA 2M4IA 2NUEA 3LPSA 4GKKI 2UUCE 4WUBA 4DV7E 2MC5A 2M7QA 2HFUA 4DR2E 4DV3I 1EKZA 4M2ZA 4WUCA 5IWAE 4B3TE 3OMLA 4JI5I 3VYXA 3LNUA 2JY9A 1KVKA 2F4VI 4AQYI 2YZTA 4X64I 4LFBI 2ZM6E 4WFTA 1HNWI 4DUZE 3JAMQ 4DR4E 1IBLI 3Q6NA 4HY1A 2PNMA 2JOBA 2KOUA 4B3RE 1PVGA 3QT8A 3ADJA 2E5LE 1J26A 3ZOQB 1MU5A 5LL6R 1OJ4A 2GQ0A 4JI5E 1S16A 2V87A 5A2QQ 3QT5A 1IBMI 4RPFA 1ZM2A 5FWKA 3JU0A 3DJWA 4X64E 4LFBE 3OTOI 3WU6A 5LMUE 2UXDI 1VISA 3ZZ0A 4IZJA 2L3JA 4DR3E 1KTVA 4UT4A 2RS7A 1Y4UA 4DV5E 4PRVA 1EI1A 1J5EI 3T1HI 1IBME 5LMNI 4N3OA 4DUYI 4M1KA 2CPNA 5T6JA 4BC7A 3ADIA 1K47A 2E1MA 1X47A 4JG4A 2DEIA 3Q6MA 4IZKA 2UXDE 2HHHI 4WUDA 4JI3I 4DXLA 2M1SA 5GMEA 4J8ZA 1Z0CA 4NXNI 4LF8E 2Z5CB 2X7IA 2CG9A 2BM0A 1X48A 4LF7E 3T1HE 5LMNE 2UXCE 4URLA 3T1YI 1S4EA 4LF4E 4OOGC 4Z7CA 1H7UA 2HHHE 3ZM7A 4X66I 2V2ZA 4ZVIA 1XMQI 4DPWA 4BBYA 1B62A 2V2QA 4WSPA 3J80Q 2UXBI 4DU8A 2V83A 4JI2I 4DR1I 1Z5AA 2LJHA 3LTOA 3K17A 4I8OA 2FTXB 4IZJD 2LUQA 2CZ9A 1N36I 3J81C 1O0WA 4LF5E 2A2DA 1XMQE 2IOQA 1XNQI 4JI4E 4GKJI 2HKJA 3AUZA 2EZ6A 4ED4A 2AJ4A 4WPYA 2O1WA 1XNRI 4JI7I 3B82A 4USKA 2LTRA 2Q2EB 4OX9I 4K0KI 4FWDA 4FWGA 3MSWA 1XMOI 2K4VA 4DR5E 1NHIA 4JI6I 4LF6E 4LF9E 1WXRA 4YHHI 2VE7C 4YY3I 4DV1I 4DV6E 1MX0A 2V2VA 3F0NA 2HK2A 3ZKDA 4NXMI 1ZBTA 3ADGA 5FLXC 1PIEA 1HNXI 1FJGI 4DPUA 4JI7E 2KHXA 3VYYA 4K0KE 4DPTA 1WUUA 2V85A 3C4TA 4X62I 3IWBA 5F3WA 1RQ0A 2JVAA 4DKKA 4DR6I 4YHHE 1B63A 2R3VA 4P78A 4MYTA 2NUFA 1ELOA 2NUGA 1Z5CA 4NXME 1RR9A 2A2CA 1T4NA 2V89A 2RTXA 3JTZA 2BV3A 4F54A 1HNXE 1FJGE 2ZBKB 4GKKE 2MDRA 1KKHA 1DI2A 4I3HA 4DV3E 2KONA 4X62E 2L92A 1T4OA 4M30A 1D6TA 1HR0I 2R42A 1FWKA 2F4VE 2L2NA 2Z5BB 1GQEA 4AQYE 2O1UA 4DU7A 3P06A 2JWOA 2B7TA 2L2KB 1HNWE 1H7SA 1IBLE 3ZKBA 1UEKA 4FW9A 4B3MI 1HNZI 2NA2A 4R8OA 3WU5A 3CWVA 1T4LB 3J7Yp 5BR8I 2LMZA 3ZZTA 3OTOE 1YYWA 1Z0BA 1NHJA 1N0VC 1STUA 2UUAI 1ZXMA 4UTGA 2RSMA 3HXLA 1I94I 2L3CA 1J5EE 3B78A 4JI1I 4XTJA 3HTXA 5BR8E 4DUYE 1H73A 2N3HA 4PRXA 2Z5CA 4JYAI 3J7AG 4BCAA 1H72C 2EFGA 1Z59A 4JI3E 4DR7I 3QT7A 4NXNE 3B8HA 3PRYA 2UUAE 1Y4SA 4HACB 3PYGA 1FNMA 4LTYA 4TUGA 2ODRD 4DV2I 2L8TA 1DARA 3T1YE 4TUIA 4L5NC 1FKAE 4X66E 3PYEA 1ZBQA 1N32I 3F6GA 3HPZA 2UXBE 2V8PA 2UU9I 1N34I 3V2UC 3IWCA 4JI2E 4DR1E 3J81Q 4DMIA 4DV2E 2L6MA 2WZOA 2J7KA 1USVA 2HK3A 1N36E 1QU6A 2UUBI 4DV4I 2V8QB 1XNQE 4LFAI 3ZZUA 1ZM4A 4PU9A 4F9BB 4GKJE 2VQEI 2F8BA 3DF6A 4BMJA 2DIXA 1ZM3A 4JV5I 1PKPA 5CFFE 1XNRE 5IT9C 2O1TA 4USMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 E;  4DV7 I;  1XMO E;  3QT6 A;  4JI6 E;  4DR2 I;  5IWA I;  5FLX Q;  2X36 A;  2UUB E;  1ZXN A;  4JI8 I;  3PYD A;  1N0U A;  4YY3 E;  4DV1 E;  3D4J A;  2HFS A;  2ZM6 I;  4EMD A;  1Z0E A;  1Z0G A;  3GON A;  4DUZ I;  4B3S I;  1U2R A;  4B3R I;  2GS8 A;  2E5L I;  1QZR A;  5GMD A;  3JAM C;  4DR6 E;  4JI8 E;  4KQV A;  1Z0V A;  5LMU I;  2VF3 A;  4DR3 I;  5A2Q C;  4B3S E;  4DPX A;  2BM1 A;  4DV5 I;  3V5R A;  1HR0 E;  4FWH A;  2XEX A;  4DPY A;  4LFC I;  1XHK A;  4DV0 I;  3PYF A;  4X65 I;  1FI4 A;  2HKE A;  4LF8 I;  4B3M E;  2E1R A;  1HNZ E;  1N33 I;  4LF7 I;  4MYU A;  4JI0 I;  1NZ0 A;  2UXC I;  4LFC E;  3K1J A;  1FWL A;  4DV0 E;  4LF4 I;  4X65 E;  1I94 E;  1N33 E;  3WU3 A;  4JI1 E;  4KHP I;  4JI0 E;  3J80 C;  1ZM9 A;  1BKN A;  4JYA E;  4HAC A;  4LF5 I;  3H4L A;  4JI4 I;  4DR7 E;  3M6A A;  2WW4 A;  1IBK I;  2VQF I;  1EA6 A;  1Z0T A;  3HUL A;  2ZIT A;  4KHP E;  4R1F A;  3WU4 A;  4P52 A;  4DR5 I;  4LF6 I;  4LF9 I;  4HYM A;  2OI2 A;  4P7A A;  1NHH A;  4FN5 A;  4DV6 I;  4Z7Y A;  1N32 E;  1A6F A;  1IBK E;  2VQF E;  2UU9 E;  1N34 E;  4HXZ A;  2UUC I;  1Z5B A;  2DEJ A;  1RRE A;  4B3T I;  1Z0W A;  2V34 A;  4DV4 E;  4LFA E;  5IT9 Q;  1KIJ A;  1MG7 A;  1H74 A;  2VQE E;  5L3J A;  3J7A M;  2LJP A;  3Q1Q A;  4JV5 E;  4DR4 I;  2NPF A;  3LPS A;  4GKK I;  2UUC E;  4WUB A;  4DV7 E;  2HFU A;  4DV3 I;  4DR2 E;  4WUC A;  5IWA E;  4B3T E;  4JI5 I;  3LNU A;  1KVK A;  2F4V I;  4AQY I;  4X64 I;  4LFB I;  2ZM6 E;  1HNW I;  4DUZ E;  3JAM Q;  4DR4 E;  1IBL I;  4HY1 A;  1PVG A;  4B3R E;  3QT8 A;  2E5L E;  1MU5 A;  5LL6 R;  1OJ4 A;  4JI5 E;  1S16 A;  5A2Q Q;  3QT5 A;  1IBM I;  4RPF A;  1ZM2 A;  4X64 E;  4LFB E;  3OTO I;  3WU6 A;  5LMU E;  2UXD I;  1VIS A;  3ZZ0 A;  4DR3 E;  1KTV A;  4UT4 A;  4DV5 E;  4PRV A;  1EI1 A;  1J5E I;  3T1H I;  5LMN I;  1IBM E;  4DUY I;  4M1K A;  1K47 A;  4JG4 A;  2DEI A;  2HHH I;  2UXD E;  4WUD A;  4JI3 I;  4DXL A;  5GME A;  1Z0C A;  4NXN I;  4LF8 E;  2X7I A;  2BM0 A;  4LF7 E;  3T1H E;  5LMN E;  2UXC E;  4URL A;  3T1Y I;  1S4E A;  4LF4 E;  4Z7C A;  1H7U A;  3ZM7 A;  2HHH E;  4X66 I;  2V2Z A;  4ZVI A;  1XMQ I;  4DPW A;  1B62 A;  2V2Q A;  3J80 Q;  2UXB I;  4DU8 A;  4JI2 I;  4DR1 I;  1Z5A A;  3LTO A;  3K17 A;  2CZ9 A;  1N36 I;  3J81 C;  4LF5 E;  2A2D A;  1XMQ E;  1XNQ I;  4JI4 E;  4GKJ I;  2HKJ A;  4ED4 A;  2AJ4 A;  1XNR I;  4JI7 I;  3B82 A;  4USK A;  2Q2E B;  4OX9 I;  4K0K I;  4FWD A;  4FWG A;  1XMO I;  4DR5 E;  1NHI A;  4JI6 I;  4LF6 E;  4LF9 E;  4YHH I;  4YY3 I;  4DV1 I;  1MX0 A;  4DV6 E;  2V2V A;  3F0N A;  2HK2 A;  3ZKD A;  4NXM I;  5FLX C;  1PIE A;  1HNX I;  1FJG I;  4DPU A;  4JI7 E;  4K0K E;  4DPT A;  1WUU A;  4X62 I;  4DR6 I;  4YHH E;  1B63 A;  2R3V A;  4MYT A;  1ELO A;  1Z5C A;  2A2C A;  1RR9 A;  4NXM E;  2BV3 A;  1HNX E;  1FJG E;  2ZBK B;  4GKK E;  1KKH A;  4I3H A;  4DV3 E;  4X62 E;  1D6T A;  1HR0 I;  2R42 A;  1FWK A;  2F4V E;  4AQY E;  4DU7 A;  1HNW E;  1H7S A;  1IBL E;  3ZKB A;  1UEK A;  4FW9 A;  4B3M I;  1HNZ I;  3WU5 A;  3CWV A;  5BR8 I;  3ZZT A;  3OTO E;  1Z0B A;  1NHJ A;  1N0V C;  2UUA I;  1ZXM A;  4UTG A;  1I94 I;  1J5E E;  3B78 A;  4JI1 I;  4XTJ A;  5BR8 E;  1H73 A;  4DUY E;  4PRX A;  4JYA I;  3J7A G;  1H72 C;  2EFG A;  1Z59 A;  4JI3 E;  4DR7 I;  3QT7 A;  4NXN E;  3B8H A;  2UUA E;  4HAC B;  3PYG A;  1FNM A;  4DV2 I;  1DAR A;  3T1Y E;  1FKA E;  3PYE A;  4X66 E;  1N32 I;  2UXB E;  2V8P A;  2UU9 I;  1N34 I;  3V2U C;  4JI2 E;  4DR1 E;  3J81 Q;  4DV2 E;  2J7K A;  2HK3 A;  1N36 E;  2UUB I;  4DV4 I;  1XNQ E;  4LFA I;  3ZZU A;  1ZM4 A;  4PU9 A;  4GKJ E;  2VQE I;  1ZM3 A;  4JV5 I;  1PKP A;  1XNR E;  5IT9 C;  4USM A; 
#chains in the Genus database with same CATH topology
 3P3E A;  4OX9 E;  2N3G A;  2BR2 B;  1WRJ A;  4U3D A;  4DV7 I;  2HC5 A;  1XMO E;  2YWQ A;  3QT6 A;  4JI6 E;  5AC4 A;  3HPS A;  1EH7 A;  4WXC A;  2WBS A;  1F2I G;  4DR2 I;  5A6A A;  5IWA I;  5FLX Q;  2UUB E;  1Y6Z A;  1ZXN A;  2X36 A;  2N8X A;  4YY3 E;  1BBG A;  4DV1 E;  1N0U A;  3CDI A;  4WXD A;  3D4J A;  3PYD A;  4JI8 I;  2VF1 A;  2RPC A;  2EPP A;  2YRH A;  1UIL A;  2HFS A;  3BF2 A;  1SR9 A;  2MC6 A;  5DNX A;  5ADZ A;  1PJS A;  2ZM6 I;  4EMD A;  2YRM A;  1Z0E A;  3ADL A;  1Z0G A;  3GON A;  4FW3 A;  4DUZ I;  4B3S I;  1X5W A;  1YHC A;  3AV0 A;  2L2M A;  2EN8 A;  2ADR A;  2FV4 B;  1U2R A;  4B3R I;  2GS8 A;  1Y5Y A;  1EH6 A;  2E5L I;  3UHM A;  1QZR A;  5KL3 A;  5GMD A;  3JAM C;  4R03 A;  4DR6 E;  4JI8 E;  1X6H A;  2DRP A;  5AE1 A;  1PJT A;  1MGT A;  4MQY A;  2L33 A;  4FW7 A;  5LLQ A;  3EPL A;  4KQV A;  3BBG A;  5JEA B;  2YTE A;  1X49 A;  1TF6 A;  5KL7 A;  1Z0V A;  1A1H A;  4GEQ B;  4MDT A;  2C39 A;  5LMU I;  2EOI A;  2VF3 A;  4WYQ B;  4DR3 I;  5A2Q C;  4B3S E;  5C0X B;  4F9C B;  1BB8 A;  4DPX A;  2Z5B A;  4BC9 A;  2LUP B;  2BM1 A;  4X8W A;  2O1V A;  4DV5 I;  2EMY A;  3V5R A;  4WX9 A;  4IZJ B;  1WHQ A;  4OO1 C;  2EPA A;  2YTQ A;  1HR0 E;  1UN6 B;  4FWH A;  5AE3 A;  2XEX A;  4IFD A;  1YH8 A;  4DPY A;  4LFC I;  1RC7 A;  1XHK A;  2JPA A;  3UK3 C;  5KL5 A;  4F9A B;  2O3Z A;  3PYF A;  4DV0 I;  5AAS A;  3FIG A;  2YT4 A;  5KL2 A;  4X65 I;  4MU1 A;  3H09 A;  4R2R A;  4MU0 A;  3K85 A;  2EMI A;  3KZZ A;  2F1D A;  2B9D A;  3LML A;  4LCG A;  1FI4 A;  2HKE A;  2EWL A;  1HK7 A;  4LF8 I;  5K36 A;  4HEI A;  4IZK B;  4F2J C;  4B3M E;  1ZU1 A;  2E1R A;  1HNZ E;  3BGH A;  3TQM A;  4AIM A;  1N33 I;  2EN4 A;  2B7V A;  4LF7 I;  4MYU A;  4JI0 I;  1NZ0 A;  2MDG A;  2UXC I;  4LFC E;  3K1J A;  2PNZ B;  1FWL A;  1UBD C;  2YSP A;  4DV0 E;  1DQ3 A;  3P3G A;  2EL5 A;  2PNL A;  3HQ1 A;  2H36 X;  3M85 G;  4LF4 I;  2BBG A;  2EPN A;  4N4R B;  4X65 E;  2RS6 A;  2LTS A;  2JOX A;  3VK6 A;  3RMP A;  2NN6 B;  3F6H A;  1WHN A;  2DLK A;  4ZYD A;  4NHR A;  2YRK A;  1I94 E;  2DGC A;  1N33 E;  1UDO A;  2C37 A;  3DD6 A;  3WU3 A;  2EPC A;  2R76 A;  4JI1 E;  4FK5 C;  2GO3 A;  4KHP I;  1YYK A;  2EE8 A;  5A6J A;  4JI0 E;  1YZ9 A;  3J80 C;  2EQ3 A;  3LLH A;  1ZM9 A;  2WNR B;  5AC5 A;  2YU8 A;  1BKN A;  2EM8 A;  4JYA E;  2EN2 A;  2R1F A;  2LBS B;  2B3T B;  2ENC A;  4HAC A;  2JR1 A;  4LF5 I;  4OO1 B;  2EM4 A;  3H4L A;  4DR7 E;  3IWD A;  4Q28 A;  2IES A;  3M6A A;  3NZK A;  3PS3 A;  4JI4 I;  2CT1 A;  2EOE A;  2EQ0 A;  1RMD A;  2WW4 A;  4LU9 A;  1IBK I;  5DRP A;  2EJ4 A;  2VQF I;  2MKD A;  4L8N A;  1EA6 A;  2PO1 B;  1Z0T A;  5AE2 A;  1T39 A;  2LRS A;  4RHB B;  2ENA A;  3KWR A;  3HUL A;  4KHP E;  2EN6 A;  2IHR 1;  3K6Q A;  4M0V A;  2ZIT A;  2PO0 B;  5KL6 A;  4R1F A;  4O43 A;  2C38 B;  1PDA A;  5JEA C;  3WU4 A;  1GTK A;  4P52 A;  4DR5 I;  2GO4 A;  4LF6 I;  2LVH A;  4LF9 I;  4HYM A;  5DNY A;  1YYO A;  2OI2 A;  2PO1 A;  4P7A A;  1XXE A;  3VHT B;  5K36 D;  1NHH A;  4FN5 A;  2K7I A;  2ODR C;  2YTO A;  1E3H A;  4DV6 I;  1N32 E;  4Z7Y A;  1A6F A;  1JK2 A;  1IBK E;  1NEI A;  2VQF E;  2C38 A;  2UU9 E;  2EM7 A;  1N34 E;  3P1X A;  4HXZ A;  2DB2 A;  1KYQ A;  2HJJ A;  1UHZ A;  4BS9 A;  3M7N D;  4LCH A;  2FGG A;  4KZS A;  2UUC I;  1Z5B A;  2DEJ A;  1RRE A;  2EOO A;  1GZ6 A;  2DMY A;  3MHS C;  3C4B A;  4R2D A;  2LE2 A;  4B3T I;  2ELZ A;  2CGE A;  1Z0W A;  4DV4 E;  2V34 A;  2Z5E A;  4LFA E;  2DSY A;  4ZYH A;  5IT9 Q;  1KIJ A;  1MG7 A;  1H74 A;  2G7H A;  2VQE E;  2EOQ A;  1A1I A;  1USU A;  2Q8U A;  2BR2 A;  5L3J A;  2JEB B;  2EM2 A;  2EMX A;  3J7A M;  4O5G A;  2V86 A;  2EM0 A;  4P7D A;  2LJP A;  2V88 A;  4ZYG A;  2IOP A;  3HJC A;  4GQU A;  3Q1Q A;  2VRD A;  2ENH A;  4JV5 E;  4O24 A;  4DR4 I;  2NPF A;  2M4I A;  2GHF A;  2NUE A;  1A1F A;  3LPS A;  4GKK I;  2EM6 A;  2UUC E;  4WUB A;  4DV7 E;  4IJD A;  5DNL A;  5ELW A;  2MC5 A;  2M7Q A;  2HFU A;  1X3C A;  2YSO A;  4DR2 E;  2BA0 D;  1EKZ A;  4M2Z A;  3HKM A;  2EOM A;  5IWA E;  4B3T E;  4WUC A;  3OML A;  4JI5 I;  3VYX A;  4IFD F;  3LNU A;  2NN6 C;  2JY9 A;  1KVK A;  5KL4 A;  2A25 A;  2F4V I;  2EML A;  4RH8 A;  4AQY I;  2EM5 A;  2YZT A;  2E72 A;  1SFE A;  4X64 I;  4LFB I;  3THN A;  2ZM6 E;  2EPU A;  3MHH C;  2EOF A;  4WFT A;  4DUZ E;  2PO2 B;  4DR4 E;  4OZE A;  3JAM Q;  1HNW I;  1IBL I;  3Q6N A;  2YTF A;  4HY1 A;  1IMU A;  4FW4 A;  2CVE A;  2JOB A;  2KOU A;  1A1J A;  4B3R E;  1PVG A;  3ADJ A;  2PNM A;  1EH8 A;  3QT8 A;  5K36 F;  2EM9 A;  2E5L E;  1J26 A;  3ZOQ B;  1MU5 A;  5JEA A;  2EMW A;  5LL6 R;  1OJ4 A;  2GQ0 A;  4JI5 E;  1YSA C;  1S16 A;  2V87 A;  4R2A A;  5A2Q Q;  3QT5 A;  1IBM I;  4RPF A;  5C0X A;  3L00 A;  1YUJ A;  1ZM2 A;  4MU3 A;  5FWK A;  3EPK A;  3JU0 A;  3DJW A;  4X64 E;  4LFB E;  4U3B A;  3OTO I;  1A1L A;  3WU6 A;  5LMU E;  2LT7 A;  1VIS A;  3ZZ0 A;  2UXD I;  2EM3 A;  2L3J A;  4IZJ A;  4DR3 E;  4LCF A;  1KTV A;  4BA2 B;  2YU5 A;  4M9V C;  5IV8 B;  4UT4 A;  2YTN A;  2RS7 A;  1Y4U A;  4DV5 E;  1A1K A;  1UDQ A;  4PRV A;  2EOJ A;  2YTJ A;  3BID A;  2I13 A;  2JE6 B;  4Q35 B;  1EI1 A;  2EMF A;  4F6N A;  1IQS A;  1J5E I;  3T1H I;  3CDJ A;  2JP9 A;  5DRR A;  1IBM E;  5LMN I;  4N3O A;  4DUY I;  4M1K A;  1PJQ A;  4BA2 A;  4IFD E;  2CPN A;  5T6J A;  4BC7 A;  3ADI A;  1K47 A;  3ECR A;  2E1M A;  1X47 A;  4JG4 A;  2CSH A;  2DEI A;  3Q6M A;  4IZK A;  2UXD E;  2J65 A;  4IS9 A;  2HHH I;  4BA1 B;  4WUD A;  1QNT A;  1OYP A;  4JI3 I;  4DXL A;  2M1S A;  2YPN A;  5GME A;  2EPM X;  4J8Z A;  2YTP A;  3B4T A;  1Z0C A;  4NXN I;  2PNZ A;  1X6F A;  4LF8 E;  2Z5C B;  4NBQ A;  3KRN A;  2X7I A;  2CG9 A;  2BM0 A;  1Z1B A;  5K36 E;  2DLQ A;  1X48 A;  4LF7 E;  3T1H E;  1IQO A;  4BA1 A;  4OO1 F;  5LMN E;  2UXC E;  2DMI A;  4URL A;  3THO B;  2NN6 A;  3T1Y I;  3P76 A;  1S4E A;  3L7Z B;  3M7N G;  3U1K A;  4LF4 E;  4OOG C;  4Z7C A;  1R6M A;  1H7U A;  4LPF A;  2HHH E;  3ZM7 A;  4X66 I;  2V2Z A;  4ZVI A;  2BA1 D;  4DPW A;  3GCM A;  1XMQ I;  4AM3 A;  4BBY A;  1B62 A;  2V2Q A;  4WSP A;  3J80 Q;  1R6L A;  4IFD D;  2UXB I;  2WNR A;  1ZR9 A;  5C0X D;  4DU8 A;  2V83 A;  4JI2 I;  4DR1 I;  2EOH A;  2LJH A;  1Z5A A;  4QNK A;  4GZN C;  3LTO A;  4OO1 A;  3K17 A;  4I8O A;  2FTX B;  3U1Y A;  4IZJ D;  1YFH A;  2LUQ A;  1AAY A;  2AE8 A;  2EPL X;  3C6K A;  2PRT A;  2CZ9 A;  2LV2 A;  1N36 I;  3J81 C;  1O0W A;  4LF5 E;  2A2D A;  2BA0 G;  1XMQ E;  2IOQ A;  1XNQ I;  4JI4 E;  2PO0 A;  1MEY C;  5TSE A;  2EOX A;  4AID A;  4GKJ I;  2HKJ A;  3AUZ A;  2EZ6 A;  1B69 A;  4ED4 A;  2AJ4 A;  4WPY A;  2YTD A;  2O1W A;  2EP3 A;  2EMA A;  1XNR I;  4IS1 C;  4JI7 I;  3B82 A;  2EN7 A;  4USK A;  5A69 A;  1A1G A;  2EMB A;  2LTR A;  5IXM B;  2Q2E B;  4OX9 I;  4K0K I;  4FWD A;  4FWG A;  3MSW A;  1XMO I;  2K4V A;  4DR5 E;  1NHI A;  4JI6 I;  4LF6 E;  4LF9 E;  3C6M A;  1WXR A;  4YHH I;  2VE7 C;  4YY3 I;  4DV1 I;  4DV6 E;  1MX0 A;  4J3D A;  1OYS A;  2V2V A;  1RHY A;  5EL9 A;  1OYR A;  3F0N A;  2YTG A;  1VI7 A;  2HK2 A;  3ZKD A;  4NXM I;  1ZBT A;  1G2D C;  3ADG A;  5FLX C;  1PIE A;  1HNX I;  4WSG A;  5A6B A;  4DPU A;  4JI7 E;  1FJG I;  2EOZ A;  2KHX A;  1DGC A;  5K36 C;  3VYY A;  4K0K E;  3H1C A;  4DPT A;  3M99 B;  1WUU A;  5JEA F;  4BHB A;  2V85 A;  3C4T A;  3KZY A;  4X62 I;  2JEB A;  3IWB A;  5F3W A;  1RQ0 A;  4FW6 A;  2JVA A;  2YTI A;  4R2E A;  4DKK A;  1BBO A;  4YHH E;  1B63 A;  2R3V A;  5C0X F;  4DR6 I;  4P78 A;  4NZV A;  1L4S A;  4MYT A;  4LOM A;  3QG5 C;  4MLQ A;  2NUF A;  2D9H A;  1ELO A;  5DRQ A;  2NUG A;  1Z5C A;  4NXM E;  1RR9 A;  2A2C A;  4ISA A;  1T4N A;  2V89 A;  5DRO A;  4OO1 D;  2RTX A;  3JTZ A;  2BV3 A;  3EPJ A;  4F54 A;  1HNX E;  1FJG E;  3PS2 A;  2ZBK B;  4GKK E;  2MDR A;  1N3G A;  2EPZ A;  1KKH A;  1NCS A;  1DI2 A;  4I3H A;  4DV3 E;  2KON A;  4X62 E;  2C39 B;  2L92 A;  1T4O A;  2EMH A;  5EKW A;  2WBT A;  4O4K A;  2EMG A;  4M30 A;  1D6T A;  2PO2 A;  4HTG A;  1HR0 I;  2R42 A;  1FWK A;  2F4V E;  2L2N A;  2WBU A;  4R2Q A;  1YUI A;  2Z5B B;  4MU4 A;  1KJK A;  1GQE A;  4AQY E;  2O1U A;  4DU7 A;  3P06 A;  2JWO A;  2B7T A;  2L2K B;  2J7J A;  1HNW E;  1H7S A;  4FW5 A;  1AH5 A;  2NAB A;  3GME A;  4IFD B;  1IBL E;  3ZKB A;  3GLL A;  2JYA A;  2BA1 G;  2ELY A;  1UEK A;  1T38 A;  2EQ1 A;  4FW9 A;  2EMK A;  4B3M I;  2EPR A;  1HNZ I;  2NA2 A;  4R8O A;  3WU5 A;  5JEA E;  3CWV A;  4KWY A;  2NN6 F;  1T4L B;  3J7Y p;  5BR8 I;  2LMZ A;  1Y60 A;  1UDN A;  5K36 B;  5A6B D;  3ZZT A;  2EPO A;  2LCE A;  5C0X E;  3EQ1 A;  3OTO E;  1P42 A;  1YYW A;  2EOS A;  2JE6 A;  1Z0B A;  1TN9 A;  4OKG A;  4QNJ A;  1NHJ A;  4DV3 I;  1N0V C;  2EL4 A;  1E3P A;  1STU A;  2GLI A;  2MKN A;  2UUA I;  4R2S A;  1ZXM A;  4UTG A;  2RSM A;  2RSI A;  3HXL A;  1I94 I;  2L3C A;  2LJU A;  1J5E E;  3B78 A;  4JI1 I;  4XTJ A;  4F6M A;  3HTX A;  2EOR A;  5BR8 E;  4DUY E;  2HGH A;  1H73 A;  2JXP A;  4X9J A;  2C37 B;  2N3H A;  4PRX A;  2Z5C A;  4JYA I;  3J7A G;  4BCA A;  3EPH A;  1H72 C;  2EFG A;  1Z59 A;  4JI3 E;  1G2F C;  2BB8 A;  5JEA D;  4DR7 I;  4R2C A;  3QT7 A;  4NXN E;  3B8H A;  2I9I A;  3PRY A;  1YPN A;  2UUA E;  3L7Z A;  1ZAA C;  1Y4S A;  2WCC 3;  2JEA B;  4HAC B;  3PYG A;  1FNM A;  4LTY A;  4TUG A;  2EL6 A;  2ODR D;  4DV2 I;  1P47 A;  2EMC A;  2L8T A;  4MLV A;  1DAR A;  4BHC A;  5A6K A;  4TUI A;  3T1Y E;  4L5N C;  1LLM C;  1FKA E;  2NN6 E;  2RQL A;  2EPK X;  4X66 E;  3PYE A;  2JEA A;  1ZBQ A;  2EPX A;  2GPI A;  4ZYE A;  2IER A;  1N32 I;  3F6G A;  3HPZ A;  1TF3 A;  2UXB E;  2V8P A;  2UU9 I;  1N34 I;  3V2U C;  3IWC A;  4JI2 E;  4DR1 E;  3J81 Q;  4DMI A;  4DV2 E;  2WP8 B;  2L6M A;  3M85 D;  1WJP A;  2M9A A;  2WZO A;  4OO1 E;  3P3C A;  2J7K A;  2EMZ A;  1USV A;  3PS1 A;  2HK3 A;  1N36 E;  2VES A;  4IFD C;  1QU6 A;  2UUB I;  5C0X C;  4DV4 I;  2V8Q B;  1XNQ E;  4LFA I;  3ZZU A;  1ZM4 A;  4PU9 A;  2EN1 A;  4F9B B;  2WP8 A;  4GKJ E;  2VQE I;  1X6E A;  2F8B A;  3DF6 A;  2CTD A;  2EN3 A;  1JK1 A;  2EOY A;  4BMJ A;  2DIX A;  2LO3 A;  1ZM3 A;  1UDS A;  2NN6 D;  4R2P A;  4JV5 I;  1PKP A;  5CFF E;  1XNR E;  5IT9 C;  2O1T A;  2JT2 A;  4USM A; 
#chains in the Genus database with same CATH homology
 4OX9 E;  2N3G A;  4DV7 I;  1XMO E;  3QT6 A;  4JI6 E;  3HPS A;  4DR2 I;  5IWA I;  5FLX Q;  2UUB E;  1Y6Z A;  1ZXN A;  2X36 A;  4JI8 I;  4YY3 E;  4DV1 E;  1N0U A;  3PYD A;  3D4J A;  2VF1 A;  1UIL A;  2HFS A;  1SR9 A;  2MC6 A;  5ADZ A;  2ZM6 I;  4EMD A;  1Z0E A;  3ADL A;  1Z0G A;  3GON A;  4DUZ I;  4B3S I;  3AV0 A;  2L2M A;  2FV4 B;  1U2R A;  4B3R I;  2GS8 A;  2E5L I;  1QZR A;  5GMD A;  3JAM C;  4R03 A;  4DR6 E;  4JI8 E;  5AE1 A;  2L33 A;  4KQV A;  1X49 A;  1Z0V A;  4GEQ B;  5LMU I;  2VF3 A;  4WYQ B;  4DR3 I;  5A2Q C;  4B3S E;  4F9C B;  4DPX A;  2Z5B A;  4BC9 A;  2LUP B;  2BM1 A;  4X8W A;  2O1V A;  4DV5 I;  3V5R A;  4IZJ B;  1WHQ A;  1HR0 E;  4FWH A;  5AE3 A;  2XEX A;  4DPY A;  4LFC I;  1RC7 A;  1XHK A;  4F9A B;  4DV0 I;  3PYF A;  5AAS A;  3FIG A;  2YT4 A;  4X65 I;  3H09 A;  3K85 A;  2B9D A;  3LML A;  1FI4 A;  2HKE A;  2EWL A;  1HK7 A;  4LF8 I;  4IZK B;  4B3M E;  2E1R A;  1HNZ E;  1N33 I;  2B7V A;  4LF7 I;  4MYU A;  4JI0 I;  1NZ0 A;  2UXC I;  4LFC E;  3K1J A;  1FWL A;  4DV0 E;  1DQ3 A;  2PNL A;  3HQ1 A;  2H36 X;  4LF4 I;  4X65 E;  2RS6 A;  2LTS A;  2JOX A;  3VK6 A;  3RMP A;  3F6H A;  1WHN A;  1I94 E;  1N33 E;  3WU3 A;  4JI1 E;  4KHP I;  1YYK A;  4JI0 E;  1YZ9 A;  3J80 C;  3LLH A;  1ZM9 A;  1BKN A;  4JYA E;  2LBS B;  2B3T B;  4HAC A;  2JR1 A;  4LF5 I;  3H4L A;  4DR7 E;  3IWD A;  4Q28 A;  4JI4 I;  3M6A A;  2WW4 A;  4LU9 A;  1IBK I;  2VQF I;  1EA6 A;  4L8N A;  1Z0T A;  5AE2 A;  2LRS A;  3KWR A;  3HUL A;  4KHP E;  2ZIT A;  2IHR 1;  3K6Q A;  4M0V A;  4R1F A;  3WU4 A;  4P52 A;  4DR5 I;  4LF6 I;  4LF9 I;  4HYM A;  5DNY A;  1YYO A;  2OI2 A;  4P7A A;  1NHH A;  4FN5 A;  4DV6 I;  2ODR C;  1N32 E;  4Z7Y A;  1A6F A;  1IBK E;  2VQF E;  2UU9 E;  1N34 E;  3P1X A;  4HXZ A;  2DB2 A;  1UHZ A;  4BS9 A;  2FGG A;  4KZS A;  2UUC I;  1Z5B A;  2DEJ A;  1RRE A;  1GZ6 A;  2DMY A;  3C4B A;  2LE2 A;  4B3T I;  2CGE A;  1Z0W A;  4DV4 E;  2V34 A;  2Z5E A;  4LFA E;  2DSY A;  5IT9 Q;  1KIJ A;  1MG7 A;  1H74 A;  2G7H A;  2VQE E;  1USU A;  5L3J A;  3J7A M;  3HJC A;  2V86 A;  4P7D A;  2LJP A;  3Q1Q A;  2V88 A;  2IOP A;  4JV5 E;  4DR4 I;  2NPF A;  2M4I A;  2NUE A;  3LPS A;  4GKK I;  2UUC E;  4WUB A;  4DV7 E;  2MC5 A;  2M7Q A;  2HFU A;  4DR2 E;  4DV3 I;  1EKZ A;  4M2Z A;  4WUC A;  5IWA E;  4B3T E;  3OML A;  4JI5 I;  3VYX A;  3LNU A;  2JY9 A;  1KVK A;  2F4V I;  4AQY I;  2YZT A;  4X64 I;  4LFB I;  2ZM6 E;  4WFT A;  1HNW I;  4DUZ E;  3JAM Q;  4DR4 E;  1IBL I;  3Q6N A;  4HY1 A;  2PNM A;  2JOB A;  2KOU A;  4B3R E;  1PVG A;  3QT8 A;  3ADJ A;  2E5L E;  1J26 A;  3ZOQ B;  1MU5 A;  5LL6 R;  1OJ4 A;  2GQ0 A;  4JI5 E;  1S16 A;  2V87 A;  5A2Q Q;  3QT5 A;  1IBM I;  4RPF A;  1ZM2 A;  5FWK A;  3JU0 A;  3DJW A;  4X64 E;  4LFB E;  3OTO I;  3WU6 A;  5LMU E;  2UXD I;  1VIS A;  3ZZ0 A;  4IZJ A;  2L3J A;  4DR3 E;  1KTV A;  4UT4 A;  2RS7 A;  1Y4U A;  4DV5 E;  4PRV A;  1EI1 A;  1J5E I;  3T1H I;  1IBM E;  5LMN I;  4N3O A;  4DUY I;  4M1K A;  2CPN A;  5T6J A;  4BC7 A;  3ADI A;  1K47 A;  2E1M A;  1X47 A;  4JG4 A;  2DEI A;  3Q6M A;  4IZK A;  2UXD E;  2HHH I;  4WUD A;  4JI3 I;  4DXL A;  2M1S A;  5GME A;  4J8Z A;  1Z0C A;  4NXN I;  4LF8 E;  2Z5C B;  2X7I A;  2CG9 A;  2BM0 A;  1X48 A;  4LF7 E;  3T1H E;  5LMN E;  2UXC E;  4URL A;  3T1Y I;  1S4E A;  4LF4 E;  4OOG C;  4Z7C A;  1H7U A;  2HHH E;  3ZM7 A;  4X66 I;  2V2Z A;  4ZVI A;  1XMQ I;  4DPW A;  4BBY A;  1B62 A;  2V2Q A;  4WSP A;  3J80 Q;  2UXB I;  4DU8 A;  2V83 A;  4JI2 I;  4DR1 I;  1Z5A A;  2LJH A;  3LTO A;  3K17 A;  4I8O A;  2FTX B;  4IZJ D;  2LUQ A;  2CZ9 A;  1N36 I;  3J81 C;  1O0W A;  4LF5 E;  2A2D A;  1XMQ E;  2IOQ A;  1XNQ I;  4JI4 E;  4GKJ I;  2HKJ A;  3AUZ A;  2EZ6 A;  4ED4 A;  2AJ4 A;  4WPY A;  2O1W A;  1XNR I;  4JI7 I;  3B82 A;  4USK A;  2LTR A;  2Q2E B;  4OX9 I;  4K0K I;  4FWD A;  4FWG A;  3MSW A;  1XMO I;  2K4V A;  4DR5 E;  1NHI A;  4JI6 I;  4LF6 E;  4LF9 E;  1WXR A;  4YHH I;  2VE7 C;  4YY3 I;  4DV1 I;  4DV6 E;  1MX0 A;  2V2V A;  3F0N A;  2HK2 A;  3ZKD A;  4NXM I;  1ZBT A;  3ADG A;  5FLX C;  1PIE A;  1HNX I;  1FJG I;  4DPU A;  4JI7 E;  2KHX A;  3VYY A;  4K0K E;  4DPT A;  1WUU A;  2V85 A;  3C4T A;  4X62 I;  3IWB A;  5F3W A;  1RQ0 A;  2JVA A;  4DKK A;  4DR6 I;  4YHH E;  1B63 A;  2R3V A;  4P78 A;  4MYT A;  2NUF A;  1ELO A;  2NUG A;  1Z5C A;  4NXM E;  1RR9 A;  2A2C A;  1T4N A;  2V89 A;  2RTX A;  3JTZ A;  2BV3 A;  4F54 A;  1HNX E;  1FJG E;  2ZBK B;  4GKK E;  2MDR A;  1KKH A;  1DI2 A;  4I3H A;  4DV3 E;  2KON A;  4X62 E;  2L92 A;  1T4O A;  4M30 A;  1D6T A;  1HR0 I;  2R42 A;  1FWK A;  2F4V E;  2L2N A;  2Z5B B;  1GQE A;  4AQY E;  2O1U A;  4DU7 A;  3P06 A;  2JWO A;  2B7T A;  2L2K B;  1HNW E;  1H7S A;  1IBL E;  3ZKB A;  1UEK A;  4FW9 A;  4B3M I;  1HNZ I;  2NA2 A;  4R8O A;  3WU5 A;  3CWV A;  1T4L B;  3J7Y p;  5BR8 I;  2LMZ A;  3ZZT A;  3OTO E;  1YYW A;  1Z0B A;  1NHJ A;  1N0V C;  1STU A;  2UUA I;  1ZXM A;  4UTG A;  2RSM A;  3HXL A;  1I94 I;  2L3C A;  1J5E E;  3B78 A;  4JI1 I;  4XTJ A;  3HTX A;  5BR8 E;  4DUY E;  1H73 A;  2N3H A;  4PRX A;  2Z5C A;  4JYA I;  3J7A G;  4BCA A;  1H72 C;  2EFG A;  1Z59 A;  4JI3 E;  4DR7 I;  3QT7 A;  4NXN E;  3B8H A;  3PRY A;  2UUA E;  1Y4S A;  4HAC B;  3PYG A;  1FNM A;  4LTY A;  4TUG A;  2ODR D;  4DV2 I;  2L8T A;  1DAR A;  3T1Y E;  4TUI A;  4L5N C;  1FKA E;  4X66 E;  3PYE A;  1ZBQ A;  1N32 I;  3F6G A;  3HPZ A;  2UXB E;  2V8P A;  2UU9 I;  1N34 I;  3V2U C;  3IWC A;  4JI2 E;  4DR1 E;  3J81 Q;  4DMI A;  4DV2 E;  2L6M A;  2WZO A;  2J7K A;  1USV A;  2HK3 A;  1N36 E;  1QU6 A;  2UUB I;  4DV4 I;  2V8Q B;  1XNQ E;  4LFA I;  3ZZU A;  1ZM4 A;  4PU9 A;  4F9B B;  4GKJ E;  2VQE I;  2F8B A;  3DF6 A;  4BMJ A;  2DIX A;  1ZM3 A;  4JV5 I;  1PKP A;  5CFF E;  1XNR E;  5IT9 C;  2O1T A;  4USM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...