5K36D

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
221
Chain Sequence
SVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 68
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36D00
1E3PA 1UDNA 2NN6C 2PO1B 5JEAD 4IFDB 1UDOA 4BA1A 2NN6E 1R6MA 2PO0B 2BA0G 4AM3A 5C0XA 4OO1D 4OO1C 3L7ZA 5C0XE 5JEAC 3KRNA 4BA1B 2NN6D 1OYSA 2NN6A 5C0XF 2PO1A 4IFDC 3GMEA 3H1CA 3CDIA 4IFDE 2C39A 3M85D 2JEAB 1R6LA 5K36C 2JEBA 2C38B 5K36B 5C0XD 1UDQA 2NN6F 3M85G 4BA2A 3M7NG 4OO1E 2BA0D 5JEAA 2PO2A 2BR2A 2WP8B 5K36F 2PO2B 2PNZB 2JE6A 5JEAB 2C37B 3GLLA 4OO1A 3U1KA 4AIMA 2WNRB 5K36E 4AIDA 4IFDF 1UDSA 4NBQA 2WNRA 3DD6A 4OO1B 2C38A 2C37A 2JE6B 2PNZA 5C0XC 2JEAA 2C39B 1E3HA 3M7ND 3B4TA 4OO1F 1OYPA 2WP8A 2BA1D 2NN6B 2BR2B 5JEAF 3GCMA 3L7ZB 4BA2B 3CDJA 3HKMA 5K36D 5K36A 5C0XB 1OYRA 2JEBB 2PO0A 5JEAE 2BA1G 4IFDD 4IFDA
chains in the Genus database with same CATH superfamily
3U1YA 1E3PA 5IWAE 1ZXNA 4K0KE 4IS9A 5FLXQ 1D6TA 1MU5A 2UXBE 4IFDB 1UDOA 3B78A 5DROA 2BM0A 4QNKA 4X65E 1FKAE 2X7IA 1UEKA 3J81C 5LL6R 4OO1D 4DV6I 4DR4E 4OO1C 3WU4A 2ZM6E 4LFCE 3GONA 2HK3A 4DPWA 1NHIA 5IT9C 5C0XE 1XNQE 1PKPA 4NXNE 3QT6A 5DNLA 1FWKA 4DR6I 2NN6D 3ZZTA 4LFBE 4FW5A 1XMQE 5C0XF 4FW7A 4JI7E 4LCFA 2PO1A 3CWVA 4DR1I 3GMEA 2UUBE 3PYFA 4LPFA 2C39A 4UTGA 1IBKI 4DV0I 3WU5A 3M85D 1Z5AA 5DRRA 5K36C 1Z0GA 2HKEA 2HFSA 2AE8A 1HR0I 4FN5A 5BR8E 1IBME 3PRYA 4DU7A 3B8HA 3M85G 4DUYE 4PRVA 2IESA 5LMNI 1HNZI 1S4EA 1ZM4A 2Z5BB 4I3HA 1VISA 1XHKA 3T1YE 1J5EI 1FJGI 2A2CA 3ZZ0A 2PNZB 4B3MI 3GLLA 3F0NA 4FWDA 2DEIA 2WNRB 1S16A 4AIDA 2ZM6I 3P3CA 3QT7A 4DR1E 4NBQA 4DR4I 4P7AA 4OX9E 1Z0BA 4USMA 4YY3E 4B3SE 4DV2I 2JE6B 2PNZA 5C0XC 4DR6E 1Z0VA 2JEAA 2R3VA 1Z5BA 4X62E 4MDTA 1OYPA 4LF4E 4M1KA 2BA1D 4KHPI 4JI2I 4HACA 5JEAF 1KVKA 1IBKE 3LPSA 4XTJA 4LF5I 1YHCA 1PVGA 4X64E 4MYTA 3UHMA 2O1UA 1FWLA 2VQFE 3OTOE 1ZM2A 4DUZI 4MU4A 4JI6E 4DU8A 2E5LI 5C0XB 4DV4E 4Z7CA 1OYRA 4J3DA 2BM1A 4ED4A 3T1YI 3H4LA 3Q6MA 1I94I 1XXEA 2NN6C 2PO1B 4Z7YA 4DV1I 2ZITA 4BA1A 2R42A 4OKGA 4X65I 3Q6NA 4EMDA 5C0XA 1XMOI 4IZKA 1Z5CA 2Z5CB 2PNMA 4UT4A 1N32E 1HNWI 3J81Q 3L7ZA 4DV2E 3D4JA 4GQUA 1H74A 3KRNA 1OYSA 4IZJD 4YHHE 3JAMQ 2GO4A 2HHHE 4DR7I 3H1CA 3CDIA 4LFBI 1ZM3A 2EFGA 4DPXA 2C38B 3PYGA 1XNQI 5K36B 1N34I 2JT2A 3LNUA 3B82A 2UU9E 2O1WA 1I94E 4RPFA 4K0KI 2CG9A 4LCHA 4BA2A 4JI1E 4GKJI 4OO1E 3QT8A 2ZBKB 3QT5A 4JI8I 1NHJA 2BR2A 3Q1QA 1P42A 1YH8A 4JYAI 5LMUI 4LF9E 3ZKBA 5K36F 5JEAB 2C37B 5LMNE 1J5EE 1RR9A 4PU9A 1HNZE 4NXME 1FJGE 5K36E 5A2QQ 3DD6A 1USUA 1EI1A 4MQYA 2C37A 4DXLA 1MX0A 1H72C 3WU6A 2C39B 4OO1F 2UXDI 2WP8A 3P3GA 2WW4A 4USKA 4LF4I 5L3JA 2J65A 3HULA 5GMEA 5EL9A 4BA2B 2UXCI 3CDJA 4HXZA 2F4VI 2AJ4A 2V2VA 4X64I 3ZKDA 5DNXA 3PYEA 4U3BA 2JEBB 2PO0A 4X66I 4JI2E 4B3ME 3T1HE 3J7AM 4IFDA 1KIJA 1ZM9A 4DR2E 5IWAI 1HR0E 1IBMI 2NN6E 1N33I 1OJ4A 4JV5E 1MG7A 4B3SI 1R6MA 2PO0B 4OX9I 4AM3A 1Z0WA 4IZKB 2PNLA 2IERA 4JI5E 2F1DA 2GQ0A 2V8PA 1N0UA 2VESA 1N36E 4BA1B 2V2QA 1EA6A 4DUZE 4OZEA 4IFDC 1N0VC 4PRXA 4MYUA 2GS8A 3NZKA 1XMQI 2VF3A 1R6LA 1Z0CA 4B3TE 4JI5I 1DARA 5C0XD 4DV1E 2NN6F 4JI3E 4QNJA 4DUYI 3J80C 4LFAI 4X62I 3T1HI 2BA0D 2UUCI 2CGEA 3P06A 5JEAA 1IBLI 4MU3A 1A6FA 4HACB 1ZXMA 3J7AG 4DV5I 4U3DA 1B62A 2CVEA 4DPYA 4B3RE 4MU1A 4JI0E 4DR3I 1USVA 4JI4I 1RHYA 2HKJA 1Y5YA 2PO2B 4ZVIA 1FNMA 2JE6A 3WU3A 4OO1A 3PS1A 2HHHI 4WUCA 3K85A 4DPTA 2OI2A 4GKKE 1FI4A 2X36A 1H73A 1H7SA 1B63A 2O1TA 2WNRA 4IZJB 4OO1B 2C38A 4LOMA 3V2UC 2DEJA 4YY3I 1WUUA 2BV3A 2HK2A 1E3HA 5GMDA 4DR3E 3B4TA 4JI4E 3PS2A 4LCGA 3M7ND 4ISAA 5FWKA 4LFAE 2UXDE 1N34E 2NN6B 1PIEA 2GO3A 2Z5BA 4B3TI 3GCMA 2E5LE 3L7ZB 2NPFA 2VQFI 4URLA 2Z5CA 2UXCE 4JI7I 2LJPA 5FLXC 5BR8I 5JEAE 1HK7A 2A2DA 2O3ZA 4DV0E 4IFDD 4B3RI 4JI6I 4DV3E 1HNXI 4KQVA 4LFCI 4DV5E 1U2RA 1UDNA 2F4VE 2XEXA 5JEAD 4JG4A 1KTVA 2E1RA 4DPUA 1Y6ZA 1N33E 2IOPA 3LTOA 2BA0G 2Q2EB 5IT9Q 3HJCA 4GKKI 5DRQA 4DV3I 1HNXE 4LF5E 4WUDA 3ZZUA 1RREA 4FWGA 4LF8I 2VQEE 4LF7I 1H7UA 5JEAC 1HNWE 4JV5I 4FW3A 1N32I 2NN6A 1Y60A 3P76A 2UUBI 4R1FA 4YHHI 4IFDE 4LF7E 2JEAB 5A2QC 4FWHA 2JEBA 4IZJA 4KHPE 1NHHA 1UDQA 1Z59A 2IOQA 4DR5E 4FW4A 4HYMA 4DR2I 3M6AA 4JI3I 3M7NG 2UUAE 5ELWA 1QZRA 4DV7E 2CZ9A 1ELOA 1XMOE 4N3OA 4JI8E 2PO2A 3J80Q 1IBLE 1K47A 4FW6A 4AQYI 3ZM7A 4LF6I 3K1JA 2WP8B 1Z0EA 2V2ZA 1BKNA 2O1VA 1N36I 4WUBA 1VI7A 2HFUA 3JAMC 4LF8E 3PS3A 2VQEI 2UUCE 1NZ0A 4X66E 3U1KA 4AIMA 5LMUE 4LF9I 4IFDF 4LF6E 1UDSA 4DV6E 4P52A 2J7KA 3V5RA 1Y4UA 4HY1A 1XNRE 3K17A 1Y4SA 4JI1I 4FW9A 3P3EA 4MU0A 5DRPA 1KKHA 1Z0TA 4DR5I 2BR2B 4NXNI 2V34A 1XNRI 4DV4I 4DV7I 4DR7E 4JYAE 2UXBI 5EKWA 3OTOI 2UUAI 3HKMA 4AQYE 5K36D 3PYDA 5K36A 2UU9I 4NXMI 2BA1G 2Z5EA 4GKJE 4JI0I
chains in the Genus database with same CATH topology
1E3PA 1UDNA 2NN6C 2PO1B 5JEAD 4IFDB 1UDOA 4BA1A 2NN6E 1R6MA 2PO0B 2BA0G 4AM3A 5C0XA 4OO1D 4OO1C 3L7ZA 5C0XE 5JEAC 3KRNA 4BA1B 2NN6D 1OYSA 2NN6A 5C0XF 2PO1A 4IFDC 3GMEA 3H1CA 3CDIA 4IFDE 2C39A 3M85D 2JEAB 1R6LA 5K36C 2JEBA 2C38B 5K36B 5C0XD 1UDQA 2NN6F 3M85G 4BA2A 3M7NG 4OO1E 2BA0D 5JEAA 2PO2A 2BR2A 2WP8B 5K36F 2PO2B 2PNZB 2JE6A 5JEAB 2C37B 3GLLA 4OO1A 3U1KA 4AIMA 2WNRB 5K36E 4AIDA 4IFDF 1UDSA 4NBQA 2WNRA 3DD6A 4OO1B 2C38A 2C37A 2JE6B 2PNZA 5C0XC 2JEAA 2C39B 1E3HA 3M7ND 3B4TA 4OO1F 1OYPA 2WP8A 2BA1D 2NN6B 2BR2B 5JEAF 3GCMA 3L7ZB 4BA2B 3CDJA 3HKMA 5K36D 5K36A 5C0XB 1OYRA 2JEBB 2PO0A 5JEAE 2BA1G 4IFDD 4IFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3P A;  1UDN A;  2NN6 C;  2PO1 B;  5JEA D;  4IFD B;  1UDO A;  4BA1 A;  2NN6 E;  1R6M A;  2PO0 B;  2BA0 G;  4AM3 A;  5C0X A;  4OO1 D;  4OO1 C;  3L7Z A;  5C0X E;  5JEA C;  3KRN A;  4BA1 B;  2NN6 D;  1OYS A;  2NN6 A;  5C0X F;  2PO1 A;  4IFD C;  3GME A;  3H1C A;  3CDI A;  4IFD E;  2C39 A;  3M85 D;  2JEA B;  1R6L A;  5K36 C;  2JEB A;  2C38 B;  5K36 B;  5C0X D;  1UDQ A;  2NN6 F;  3M85 G;  4BA2 A;  3M7N G;  4OO1 E;  2BA0 D;  5JEA A;  2PO2 A;  2BR2 A;  2WP8 B;  5K36 F;  2PO2 B;  2PNZ B;  2JE6 A;  5JEA B;  2C37 B;  3GLL A;  4OO1 A;  3U1K A;  4AIM A;  2WNR B;  5K36 E;  4AID A;  4IFD F;  1UDS A;  4NBQ A;  2WNR A;  3DD6 A;  4OO1 B;  2C38 A;  2C37 A;  2JE6 B;  2PNZ A;  5C0X C;  2JEA A;  2C39 B;  1E3H A;  3M7N D;  3B4T A;  4OO1 F;  1OYP A;  2WP8 A;  2BA1 D;  2NN6 B;  2BR2 B;  5JEA F;  3GCM A;  3L7Z B;  4BA2 B;  3CDJ A;  3HKM A;  5K36 D;  5K36 A;  5C0X B;  1OYR A;  2JEB B;  2PO0 A;  5JEA E;  2BA1 G;  4IFD D;  4IFD A; 
#chains in the Genus database with same CATH topology
 3U1Y A;  1E3P A;  5IWA E;  1ZXN A;  4K0K E;  4IS9 A;  5FLX Q;  1D6T A;  1MU5 A;  2UXB E;  4IFD B;  1UDO A;  3B78 A;  5DRO A;  2BM0 A;  4QNK A;  4X65 E;  1FKA E;  2X7I A;  1UEK A;  3J81 C;  5LL6 R;  4OO1 D;  4DV6 I;  4DR4 E;  4OO1 C;  3WU4 A;  2ZM6 E;  4LFC E;  3GON A;  2HK3 A;  4DPW A;  1NHI A;  5IT9 C;  5C0X E;  1XNQ E;  1PKP A;  4NXN E;  3QT6 A;  5DNL A;  1FWK A;  4DR6 I;  2NN6 D;  3ZZT A;  4LFB E;  4FW5 A;  1XMQ E;  5C0X F;  4FW7 A;  4JI7 E;  4LCF A;  2PO1 A;  3CWV A;  4DR1 I;  3GME A;  2UUB E;  3PYF A;  4LPF A;  2C39 A;  4UTG A;  1IBK I;  4DV0 I;  3WU5 A;  3M85 D;  1Z5A A;  5DRR A;  5K36 C;  1Z0G A;  2HKE A;  2HFS A;  2AE8 A;  1HR0 I;  4FN5 A;  5BR8 E;  1IBM E;  3PRY A;  4DU7 A;  3B8H A;  3M85 G;  4DUY E;  4PRV A;  2IES A;  5LMN I;  1HNZ I;  1S4E A;  1ZM4 A;  2Z5B B;  4I3H A;  1VIS A;  1XHK A;  3T1Y E;  1J5E I;  1FJG I;  2A2C A;  3ZZ0 A;  2PNZ B;  4B3M I;  3GLL A;  3F0N A;  4FWD A;  2DEI A;  2WNR B;  1S16 A;  4AID A;  2ZM6 I;  3P3C A;  3QT7 A;  4DR1 E;  4NBQ A;  4DR4 I;  4P7A A;  4OX9 E;  1Z0B A;  4USM A;  4YY3 E;  4B3S E;  4DV2 I;  2JE6 B;  2PNZ A;  5C0X C;  4DR6 E;  1Z0V A;  2JEA A;  2R3V A;  1Z5B A;  4X62 E;  4MDT A;  1OYP A;  4LF4 E;  4M1K A;  2BA1 D;  4KHP I;  4JI2 I;  4HAC A;  5JEA F;  1KVK A;  1IBK E;  3LPS A;  4XTJ A;  4LF5 I;  1YHC A;  1PVG A;  4X64 E;  4MYT A;  3UHM A;  2O1U A;  1FWL A;  2VQF E;  3OTO E;  1ZM2 A;  4DUZ I;  4MU4 A;  4JI6 E;  4DU8 A;  2E5L I;  5C0X B;  4DV4 E;  4Z7C A;  1OYR A;  4J3D A;  2BM1 A;  4ED4 A;  3T1Y I;  3H4L A;  3Q6M A;  1I94 I;  1XXE A;  2NN6 C;  2PO1 B;  4Z7Y A;  4DV1 I;  2ZIT A;  4BA1 A;  2R42 A;  4OKG A;  4X65 I;  3Q6N A;  4EMD A;  5C0X A;  1XMO I;  4IZK A;  1Z5C A;  2Z5C B;  2PNM A;  4UT4 A;  1N32 E;  1HNW I;  3J81 Q;  3L7Z A;  4DV2 E;  3D4J A;  4GQU A;  1H74 A;  3KRN A;  1OYS A;  4IZJ D;  4YHH E;  3JAM Q;  2GO4 A;  2HHH E;  4DR7 I;  3H1C A;  3CDI A;  4LFB I;  1ZM3 A;  2EFG A;  4DPX A;  2C38 B;  3PYG A;  1XNQ I;  5K36 B;  1N34 I;  2JT2 A;  3LNU A;  3B82 A;  2UU9 E;  2O1W A;  1I94 E;  4RPF A;  4K0K I;  2CG9 A;  4LCH A;  4BA2 A;  4JI1 E;  4GKJ I;  4OO1 E;  3QT8 A;  2ZBK B;  3QT5 A;  4JI8 I;  1NHJ A;  2BR2 A;  3Q1Q A;  1P42 A;  1YH8 A;  4JYA I;  5LMU I;  4LF9 E;  3ZKB A;  5K36 F;  5JEA B;  2C37 B;  5LMN E;  1J5E E;  1RR9 A;  4PU9 A;  1HNZ E;  4NXM E;  1FJG E;  5K36 E;  5A2Q Q;  3DD6 A;  1USU A;  1EI1 A;  4MQY A;  2C37 A;  4DXL A;  1MX0 A;  1H72 C;  3WU6 A;  2C39 B;  4OO1 F;  2UXD I;  2WP8 A;  3P3G A;  2WW4 A;  4USK A;  4LF4 I;  5L3J A;  2J65 A;  3HUL A;  5GME A;  5EL9 A;  4BA2 B;  2UXC I;  3CDJ A;  4HXZ A;  2F4V I;  2AJ4 A;  2V2V A;  4X64 I;  3ZKD A;  5DNX A;  3PYE A;  4U3B A;  2JEB B;  2PO0 A;  4X66 I;  4JI2 E;  4B3M E;  3T1H E;  3J7A M;  4IFD A;  1KIJ A;  1ZM9 A;  4DR2 E;  5IWA I;  1HR0 E;  1IBM I;  2NN6 E;  1N33 I;  1OJ4 A;  4JV5 E;  1MG7 A;  4B3S I;  1R6M A;  2PO0 B;  4OX9 I;  4AM3 A;  1Z0W A;  4IZK B;  2PNL A;  2IER A;  4JI5 E;  2F1D A;  2GQ0 A;  2V8P A;  1N0U A;  2VES A;  1N36 E;  4BA1 B;  2V2Q A;  1EA6 A;  4DUZ E;  4OZE A;  4IFD C;  1N0V C;  4PRX A;  4MYU A;  2GS8 A;  3NZK A;  1XMQ I;  2VF3 A;  1R6L A;  1Z0C A;  4B3T E;  4JI5 I;  1DAR A;  5C0X D;  4DV1 E;  2NN6 F;  4JI3 E;  4QNJ A;  4DUY I;  3J80 C;  4LFA I;  4X62 I;  3T1H I;  2BA0 D;  2UUC I;  2CGE A;  3P06 A;  5JEA A;  1IBL I;  4MU3 A;  1A6F A;  4HAC B;  1ZXM A;  3J7A G;  4DV5 I;  4U3D A;  1B62 A;  2CVE A;  4DPY A;  4B3R E;  4MU1 A;  4JI0 E;  4DR3 I;  1USV A;  4JI4 I;  1RHY A;  2HKJ A;  1Y5Y A;  2PO2 B;  4ZVI A;  1FNM A;  2JE6 A;  3WU3 A;  4OO1 A;  3PS1 A;  2HHH I;  4WUC A;  3K85 A;  4DPT A;  2OI2 A;  4GKK E;  1FI4 A;  2X36 A;  1H73 A;  1H7S A;  1B63 A;  2O1T A;  2WNR A;  4IZJ B;  4OO1 B;  2C38 A;  4LOM A;  3V2U C;  2DEJ A;  4YY3 I;  1WUU A;  2BV3 A;  2HK2 A;  1E3H A;  5GMD A;  4DR3 E;  3B4T A;  4JI4 E;  3PS2 A;  4LCG A;  3M7N D;  4ISA A;  5FWK A;  4LFA E;  2UXD E;  1N34 E;  2NN6 B;  1PIE A;  2GO3 A;  2Z5B A;  4B3T I;  3GCM A;  2E5L E;  3L7Z B;  2NPF A;  2VQF I;  4URL A;  2Z5C A;  2UXC E;  4JI7 I;  2LJP A;  5FLX C;  5BR8 I;  5JEA E;  1HK7 A;  2A2D A;  2O3Z A;  4DV0 E;  4IFD D;  4B3R I;  4JI6 I;  4DV3 E;  1HNX I;  4KQV A;  4LFC I;  4DV5 E;  1U2R A;  1UDN A;  2F4V E;  2XEX A;  5JEA D;  4JG4 A;  1KTV A;  2E1R A;  4DPU A;  1Y6Z A;  1N33 E;  2IOP A;  3LTO A;  2BA0 G;  2Q2E B;  5IT9 Q;  3HJC A;  4GKK I;  5DRQ A;  4DV3 I;  1HNX E;  4LF5 E;  4WUD A;  3ZZU A;  1RRE A;  4FWG A;  4LF8 I;  2VQE E;  4LF7 I;  1H7U A;  5JEA C;  1HNW E;  4JV5 I;  4FW3 A;  1N32 I;  2NN6 A;  1Y60 A;  3P76 A;  2UUB I;  4R1F A;  4YHH I;  4IFD E;  4LF7 E;  2JEA B;  5A2Q C;  4FWH A;  2JEB A;  4IZJ A;  4KHP E;  1NHH A;  1UDQ A;  1Z59 A;  2IOQ A;  4DR5 E;  4FW4 A;  4HYM A;  4DR2 I;  3M6A A;  4JI3 I;  3M7N G;  2UUA E;  5ELW A;  1QZR A;  4DV7 E;  2CZ9 A;  1ELO A;  1XMO E;  4N3O A;  4JI8 E;  2PO2 A;  3J80 Q;  1IBL E;  1K47 A;  4FW6 A;  4AQY I;  3ZM7 A;  4LF6 I;  3K1J A;  2WP8 B;  1Z0E A;  2V2Z A;  1BKN A;  2O1V A;  1N36 I;  4WUB A;  1VI7 A;  2HFU A;  3JAM C;  4LF8 E;  3PS3 A;  2VQE I;  2UUC E;  1NZ0 A;  4X66 E;  3U1K A;  4AIM A;  5LMU E;  4LF9 I;  4IFD F;  4LF6 E;  1UDS A;  4DV6 E;  4P52 A;  2J7K A;  3V5R A;  1Y4U A;  4HY1 A;  1XNR E;  3K17 A;  1Y4S A;  4JI1 I;  4FW9 A;  3P3E A;  4MU0 A;  5DRP A;  1KKH A;  1Z0T A;  4DR5 I;  2BR2 B;  4NXN I;  2V34 A;  1XNR I;  4DV4 I;  4DV7 I;  4DR7 E;  4JYA E;  2UXB I;  5EKW A;  3OTO I;  2UUA I;  3HKM A;  4AQY E;  5K36 D;  3PYD A;  5K36 A;  2UU9 I;  4NXM I;  2BA1 G;  2Z5E A;  4GKJ E;  4JI0 I; 
#chains in the Genus database with same CATH homology
 1E3P A;  1UDN A;  2NN6 C;  2PO1 B;  5JEA D;  4IFD B;  1UDO A;  4BA1 A;  2NN6 E;  1R6M A;  2PO0 B;  2BA0 G;  4AM3 A;  5C0X A;  4OO1 D;  4OO1 C;  3L7Z A;  5C0X E;  5JEA C;  3KRN A;  4BA1 B;  2NN6 D;  1OYS A;  2NN6 A;  5C0X F;  2PO1 A;  4IFD C;  3GME A;  3H1C A;  3CDI A;  4IFD E;  2C39 A;  3M85 D;  2JEA B;  1R6L A;  5K36 C;  2JEB A;  2C38 B;  5K36 B;  5C0X D;  1UDQ A;  2NN6 F;  3M85 G;  4BA2 A;  3M7N G;  4OO1 E;  2BA0 D;  5JEA A;  2PO2 A;  2BR2 A;  2WP8 B;  5K36 F;  2PO2 B;  2PNZ B;  2JE6 A;  5JEA B;  2C37 B;  3GLL A;  4OO1 A;  3U1K A;  4AIM A;  2WNR B;  5K36 E;  4AID A;  4IFD F;  1UDS A;  4NBQ A;  2WNR A;  3DD6 A;  4OO1 B;  2C38 A;  2C37 A;  2JE6 B;  2PNZ A;  5C0X C;  2JEA A;  2C39 B;  1E3H A;  3M7N D;  3B4T A;  4OO1 F;  1OYP A;  2WP8 A;  2BA1 D;  2NN6 B;  2BR2 B;  5JEA F;  3GCM A;  3L7Z B;  4BA2 B;  3CDJ A;  3HKM A;  5K36 D;  5K36 A;  5C0X B;  1OYR A;  2JEB B;  2PO0 A;  5JEA E;  2BA1 G;  4IFD D;  4IFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...