5K36D

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
221
Chain Sequence
SVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 68
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36D00
2NN6B 3KRNA 5JEAB 1R6LA 3HKMA 4AM3A 2C37B 2PO1B 2NN6A 3M7ND 2PO2A 4IFDB 1UDNA 5C0XA 2C39A 5C0XF 4AIDA 2BA0D 3L7ZB 2C39B 4OO1D 5C0XD 3GMEA 2JEAB 2BA1G 2JEBA 2BR2B 2C38B 1E3HA 4OO1E 5JEAA 4BA1B 5JEAF 2NN6D 2C37A 5K36C 2PO1A 4AIMA 4IFDA 4IFDF 3H1CA 3L7ZA 4IFDD 2PO0B 3CDIA 2BA1D 2WP8B 2NN6E 1E3PA 2PNZB 2JEAA 1UDSA 4BA2B 2BR2A 2C38A 4IFDE 3B4TA 2WNRB 4BA1A 5K36F 5C0XE 5K36B 1UDOA 4OO1B 3U1KA 5JEAD 2JE6B 1OYSA 1OYRA 4OO1C 1UDQA 5C0XC 2PO0A 2WP8A 2PNZA 3GLLA 1R6MA 4BA2A 5JEAE 3M85G 3DD6A 2NN6C 2WNRA 5K36A 3GCMA 3CDJA 5JEAC 4OO1A 4OO1F 5K36D 2PO2B 2JE6A 3M7NG 5C0XB 4IFDC 1OYPA 2BA0G 5K36E 2JEBB 3M85D 4NBQA 2NN6F
chains in the Genus database with same CATH superfamily
4JI5E 1MX0A 1IBLE 4X66I 1RHYA 3H4LA 2UXBE 5IWAI 4KHPE 1RREA 2R42A 2OI2A 5C0XA 3K85A 5C0XF 3Q6NA 4MDTA 4OO1D 2JEAB 4FW9A 1Z0GA 5DNXA 4DV4I 2J65A 1ZM2A 5IT9C 4OKGA 1Z59A 4DXLA 4OO1E 4FWDA 4HYMA 5JEAA 4IZJD 5GMDA 4BA1B 4FN5A 5JEAF 1S16A 2NPFA 4DV4E 1IBKI 2C37A 5K36C 4HACB 4LCHA 4IFDA 2Z5BB 4LOMA 1PKPA 4IFDF 3H1CA 4FW3A 3L7ZA 4USKA 4X65I 4DU8A 2PO0B 3CDIA 2BA1D 2WP8B 3T1HE 2CGEA 1E3PA 1XHKA 2F4VE 2IESA 4LF5I 4MYUA 1XNQI 4FW4A 4I3HA 2BR2A 4LF9E 1K47A 4X65E 4DV3E 2CVEA 3B4TA 5K36F 2V2QA 5BR8I 1Y4UA 4MYTA 1XNQE 4GKJI 4JI8I 3PRYA 4FWHA 4IZKA 1ZXMA 1FWLA 3B8HA 1OYRA 4DR5I 1Y60A 3ZKDA 4Z7YA 2V8PA 4X64I 3ZZTA 3GLLA 4B3ME 1R6MA 1KTVA 2ZITA 4DPTA 1Y6ZA 4QNJA 4LF8E 4LFBI 5FLXC 2O3ZA 4X64E 3M85G 5LMUI 2NN6C 1YH8A 3GCMA 4NXMI 1USUA 4DV7I 1QZRA 4B3SI 4DR7I 2XEXA 4B3TI 5C0XB 5LMUE 4UT4A 4DPWA 4LF4I 2VESA 2BA0G 5EKWA 1MG7A 4JI7E 1J5EE 4JI2E 3HULA 4DV7E 4DV2E 4JI6I 4DR7E 4B3TE 1FNMA 4P7AA 1XMOI 2NN6A 3WU4A 4LCFA 2NN6F 4JI0E 3J80Q 1XMQI 4LF7I 1DARA 5JEAB 1R6LA 2C37B 2AE8A 1EA6A 1HNXI 4OX9I 3M7ND 1H7SA 4IFDB 1UDNA 2UU9I 3K17A 3L7ZB 2C39B 1PIEA 4ISAA 4MU3A 4DU7A 2Z5CA 5C0XD 4ED4A 4JI5I 2HKJA 1Z0BA 2IERA 2GS8A 4DPYA 3LNUA 4IS9A 2UXBI 2BR2B 3ZZ0A 4KHPI 4DV5E 2GQ0A 2ZBKB 4LCGA 1N32E 2PNLA 3HJCA 4WUBA 4P52A 5EL9A 3LTOA 3K1JA 1P42A 4AIMA 4JV5I 2O1TA 3JAMC 4IFDD 1N33E 4Z7CA 4FW6A 4DR3E 3PYDA 4K0KI 1VI7A 4JV5E 1ZM3A 2C38A 3T1YE 1IBME 5DRPA 2HK3A 1Z5BA 3WU6A 4IFDE 4URLA 2CG9A 2BM0A 4K0KE 1N36E 3T1HI 1Z5AA 3OTOE 2F4VI 4LFAE 5DRRA 3QT7A 1Z0EA 1XNRE 1HNWI 2JT2A 1FKAE 1UDQA 4OO1C 5LMNE 4LF9I 4PU9A 4NXNI 1FWKA 1BKNA 4DV3I 2ZM6E 2O1UA 3PS2A 2HKEA 4PRVA 4DR2E 4LFCE 1HNWE 1Z0WA 1Z0CA 4HXZA 4BA2A 2V2ZA 3J7AG 1ZM9A 4NXNE 1Z0TA 2DEJA 1YHCA 1H7UA 5L3JA 2WNRA 5K36A 3CDJA 5A2QC 4OO1A 4DV1E 3QT5A 5DROA 4OO1F 2E5LE 4DR1I 4B3MI 3NZKA 1USVA 4JG4A 2A2CA 1OYPA 1KVKA 1UEKA 2Z5CB 4LF8I 4DR1E 1EI1A 1D6TA 4NBQA 3UHMA 3CWVA 4YY3E 3WU5A 3F0NA 3P76A 3KRNA 3D4JA 1A6FA 1PVGA 4JI7I 1J5EI 4JI2I 1B63A 4DV2I 4AIDA 4JI0I 2GO3A 2X7IA 2BM1A 4EMDA 2BA1G 2UUAE 1B62A 2V34A 1WUUA 2JEBA 1S4EA 4DR4E 2C38B 1E3HA 3V2UC 2IOQA 1HR0I 3M6AA 1HNZE 1FI4A 2PO1A 4U3DA 5FWKA 2HFUA 4DUZE 1HR0E 1FJGE 4DV5I 3PYGA 1N32I 4YHHI 4PRXA 4BA2B 4DUYE 2PNMA 4JYAE 3WU3A 2WNRB 5C0XE 1NHHA 5K36B 3B78A 3P3EA 4YHHE 2VQEE 1UDOA 2CZ9A 3J7AM 3Q1QA 4GKKE 2R3VA 2VQFE 4OO1B 1N33I 4DR3I 5JEAD 4IZKB 1OYSA 4MU4A 4X62I 4DV0E 5C0XC 4MU1A 3T1YI 2PNZA 4RPFA 1IBMI 1RR9A 2HFSA 4UTGA 1H73A 2HK2A 5JEAE 1N0UA 4X62E 2UXDI 1N36I 4U3BA 3OTOI 4LFAI 2O1WA 2UXCE 1ZXNA 2F1DA 2UUCI 1XNRI 5LMNI 4JI4I 4LF6E 5JEAC 2UXDE 2ZM6I 5K36D 2DEIA 4JI1I 4FW7A 3ZM7A 1I94I 2E1RA 2JE6A 4LFCI 4X66E 4DR2I 2UUCE 3M7NG 4J3DA 4IFDC 2O1VA 5IWAE 3J81Q 3U1YA 4JI4E 1Z0VA 1N0VC 1XXEA 4FW5A 4JI1E 5K36E 1I94E 4XTJA 2JEBB 3ZZUA 2J7KA 1NHIA 3M85D 4DV1I 5LL6R 1NHJA 4B3RI 2NN6B 4ZVIA 2E5LI 3B82A 3HKMA 4AM3A 2A2DA 2PO1B 2PO2A 4B3RE 1OJ4A 2C39A 3JAMQ 2AJ4A 2BA0D 1IBKE 4AQYI 4YY3I 3GMEA 3LPSA 1VISA 3Q6MA 2V2VA 5IT9Q 4IZJA 4GQUA 1KKHA 2X36A 4AQYE 1Y5YA 4LF5E 1H72C 3J80C 4DPUA 4HY1A 2NN6D 4DR6I 4QNKA 2UUAI 1Z5CA 1H74A 1Y4SA 1ELOA 5DNLA 2Z5EA 5BR8E 4GKJE 3P06A 4DR4I 4R1FA 4JI8E 2NN6E 2PNZB 2JEAA 4JI3I 4DR6E 3P3GA 1UDSA 4LPFA 5GMEA 1U2RA 4DPXA 4DR5E 2UUBI 1HNZI 2LJPA 4JI3E 4WUDA 4DUZI 2EFGA 4BA1A 5A2QQ 2WW4A 1FJGI 4HACA 2UUBE 5DRQA 3V5RA 4LFBE 4USMA 3P3CA 1KIJA 2Z5BA 3U1KA 2JE6B 4FWGA 2HHHI 4DUYI 1HK7A 4NXME 2PO0A 2WP8A 4JYAI 1N34I 2BV3A 4B3SE 1ZM4A 3PS1A 2VQEI 4M1KA 4GKKI 1MU5A 4MU0A 2HHHE 4LF4E 2VQFI 4WUCA 2IOPA 2VF3A 5FLXQ 2GO4A 4JI6E 3DD6A 1N34E 4DV0I 4KQVA 4DV6I 1NZ0A 3PYFA 1XMOE 2Q2EB 2PO2B 1XMQE 4LF7E 3PYEA 3QT6A 5ELWA 3QT8A 4N3OA 1IBLI 4DV6E 3J81C 1HNXE 4OX9E 2UXCI 3ZKBA 3PS3A 3GONA 4OZEA 2UU9E 4LF6I 4MQYA 4IZJB
chains in the Genus database with same CATH topology
2NN6B 3KRNA 5JEAB 1R6LA 3HKMA 4AM3A 2C37B 2PO1B 2NN6A 3M7ND 2PO2A 4IFDB 1UDNA 5C0XA 2C39A 5C0XF 4AIDA 2BA0D 3L7ZB 2C39B 4OO1D 5C0XD 3GMEA 2JEAB 2BA1G 2JEBA 2BR2B 2C38B 1E3HA 4OO1E 5JEAA 4BA1B 5JEAF 2NN6D 2C37A 5K36C 2PO1A 4AIMA 4IFDA 4IFDF 3H1CA 3L7ZA 4IFDD 2PO0B 3CDIA 2BA1D 2WP8B 2NN6E 1E3PA 2PNZB 2JEAA 1UDSA 4BA2B 2BR2A 2C38A 4IFDE 3B4TA 2WNRB 4BA1A 5K36F 5C0XE 5K36B 1UDOA 4OO1B 3U1KA 5JEAD 2JE6B 1OYSA 1OYRA 4OO1C 1UDQA 5C0XC 2PO0A 2WP8A 2PNZA 3GLLA 1R6MA 4BA2A 5JEAE 3M85G 3DD6A 2NN6C 2WNRA 5K36A 3GCMA 3CDJA 5JEAC 4OO1A 4OO1F 5K36D 2PO2B 2JE6A 3M7NG 5C0XB 4IFDC 1OYPA 2BA0G 5K36E 2JEBB 3M85D 4NBQA 2NN6F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 B;  3KRN A;  5JEA B;  1R6L A;  3HKM A;  4AM3 A;  2C37 B;  2PO1 B;  2NN6 A;  3M7N D;  2PO2 A;  4IFD B;  1UDN A;  5C0X A;  2C39 A;  5C0X F;  4AID A;  2BA0 D;  3L7Z B;  2C39 B;  4OO1 D;  5C0X D;  3GME A;  2JEA B;  2BA1 G;  2JEB A;  2BR2 B;  2C38 B;  1E3H A;  4OO1 E;  5JEA A;  4BA1 B;  5JEA F;  2NN6 D;  2C37 A;  5K36 C;  2PO1 A;  4AIM A;  4IFD A;  4IFD F;  3H1C A;  3L7Z A;  4IFD D;  2PO0 B;  3CDI A;  2BA1 D;  2WP8 B;  2NN6 E;  1E3P A;  2PNZ B;  2JEA A;  1UDS A;  4BA2 B;  2BR2 A;  2C38 A;  4IFD E;  3B4T A;  2WNR B;  4BA1 A;  5K36 F;  5C0X E;  5K36 B;  1UDO A;  4OO1 B;  3U1K A;  5JEA D;  2JE6 B;  1OYS A;  1OYR A;  4OO1 C;  1UDQ A;  5C0X C;  2PO0 A;  2WP8 A;  2PNZ A;  3GLL A;  1R6M A;  4BA2 A;  5JEA E;  3M85 G;  3DD6 A;  2NN6 C;  2WNR A;  5K36 A;  3GCM A;  3CDJ A;  5JEA C;  4OO1 A;  4OO1 F;  5K36 D;  2PO2 B;  2JE6 A;  3M7N G;  5C0X B;  4IFD C;  1OYP A;  2BA0 G;  5K36 E;  2JEB B;  3M85 D;  4NBQ A;  2NN6 F; 
#chains in the Genus database with same CATH topology
 4JI5 E;  1MX0 A;  1IBL E;  4X66 I;  1RHY A;  3H4L A;  2UXB E;  5IWA I;  4KHP E;  1RRE A;  2R42 A;  2OI2 A;  5C0X A;  3K85 A;  5C0X F;  3Q6N A;  4MDT A;  4OO1 D;  2JEA B;  4FW9 A;  1Z0G A;  5DNX A;  4DV4 I;  2J65 A;  1ZM2 A;  5IT9 C;  4OKG A;  1Z59 A;  4DXL A;  4OO1 E;  4FWD A;  4HYM A;  5JEA A;  4IZJ D;  5GMD A;  4BA1 B;  4FN5 A;  5JEA F;  1S16 A;  2NPF A;  4DV4 E;  1IBK I;  2C37 A;  5K36 C;  4HAC B;  4LCH A;  4IFD A;  2Z5B B;  4LOM A;  1PKP A;  4IFD F;  3H1C A;  4FW3 A;  3L7Z A;  4USK A;  4X65 I;  4DU8 A;  2PO0 B;  3CDI A;  2BA1 D;  2WP8 B;  3T1H E;  2CGE A;  1E3P A;  1XHK A;  2F4V E;  2IES A;  4LF5 I;  4MYU A;  1XNQ I;  4FW4 A;  4I3H A;  2BR2 A;  4LF9 E;  1K47 A;  4X65 E;  4DV3 E;  2CVE A;  3B4T A;  5K36 F;  2V2Q A;  5BR8 I;  1Y4U A;  4MYT A;  1XNQ E;  4GKJ I;  4JI8 I;  3PRY A;  4FWH A;  4IZK A;  1ZXM A;  1FWL A;  3B8H A;  1OYR A;  4DR5 I;  1Y60 A;  3ZKD A;  4Z7Y A;  2V8P A;  4X64 I;  3ZZT A;  3GLL A;  4B3M E;  1R6M A;  1KTV A;  2ZIT A;  4DPT A;  1Y6Z A;  4QNJ A;  4LF8 E;  4LFB I;  5FLX C;  2O3Z A;  4X64 E;  3M85 G;  5LMU I;  2NN6 C;  1YH8 A;  3GCM A;  4NXM I;  1USU A;  4DV7 I;  1QZR A;  4B3S I;  4DR7 I;  2XEX A;  4B3T I;  5C0X B;  5LMU E;  4UT4 A;  4DPW A;  4LF4 I;  2VES A;  2BA0 G;  5EKW A;  1MG7 A;  4JI7 E;  1J5E E;  4JI2 E;  3HUL A;  4DV7 E;  4DV2 E;  4JI6 I;  4DR7 E;  4B3T E;  1FNM A;  4P7A A;  1XMO I;  2NN6 A;  3WU4 A;  4LCF A;  2NN6 F;  4JI0 E;  3J80 Q;  1XMQ I;  4LF7 I;  1DAR A;  5JEA B;  1R6L A;  2C37 B;  2AE8 A;  1EA6 A;  1HNX I;  4OX9 I;  3M7N D;  1H7S A;  4IFD B;  1UDN A;  2UU9 I;  3K17 A;  3L7Z B;  2C39 B;  1PIE A;  4ISA A;  4MU3 A;  4DU7 A;  2Z5C A;  5C0X D;  4ED4 A;  4JI5 I;  2HKJ A;  1Z0B A;  2IER A;  2GS8 A;  4DPY A;  3LNU A;  4IS9 A;  2UXB I;  2BR2 B;  3ZZ0 A;  4KHP I;  4DV5 E;  2GQ0 A;  2ZBK B;  4LCG A;  1N32 E;  2PNL A;  3HJC A;  4WUB A;  4P52 A;  5EL9 A;  3LTO A;  3K1J A;  1P42 A;  4AIM A;  4JV5 I;  2O1T A;  3JAM C;  4IFD D;  1N33 E;  4Z7C A;  4FW6 A;  4DR3 E;  3PYD A;  4K0K I;  1VI7 A;  4JV5 E;  1ZM3 A;  2C38 A;  3T1Y E;  1IBM E;  5DRP A;  2HK3 A;  1Z5B A;  3WU6 A;  4IFD E;  4URL A;  2CG9 A;  2BM0 A;  4K0K E;  1N36 E;  3T1H I;  1Z5A A;  3OTO E;  2F4V I;  4LFA E;  5DRR A;  3QT7 A;  1Z0E A;  1XNR E;  1HNW I;  2JT2 A;  1FKA E;  1UDQ A;  4OO1 C;  5LMN E;  4LF9 I;  4PU9 A;  4NXN I;  1FWK A;  1BKN A;  4DV3 I;  2ZM6 E;  2O1U A;  3PS2 A;  2HKE A;  4PRV A;  4DR2 E;  4LFC E;  1HNW E;  1Z0W A;  1Z0C A;  4HXZ A;  4BA2 A;  2V2Z A;  3J7A G;  1ZM9 A;  4NXN E;  1Z0T A;  2DEJ A;  1YHC A;  1H7U A;  5L3J A;  2WNR A;  5K36 A;  3CDJ A;  5A2Q C;  4OO1 A;  4DV1 E;  3QT5 A;  5DRO A;  4OO1 F;  2E5L E;  4DR1 I;  4B3M I;  3NZK A;  1USV A;  4JG4 A;  2A2C A;  1OYP A;  1KVK A;  1UEK A;  2Z5C B;  4LF8 I;  4DR1 E;  1EI1 A;  1D6T A;  4NBQ A;  3UHM A;  3CWV A;  4YY3 E;  3WU5 A;  3F0N A;  3P76 A;  3KRN A;  3D4J A;  1A6F A;  1PVG A;  4JI7 I;  1J5E I;  4JI2 I;  1B63 A;  4DV2 I;  4AID A;  4JI0 I;  2GO3 A;  2X7I A;  2BM1 A;  4EMD A;  2BA1 G;  2UUA E;  1B62 A;  2V34 A;  1WUU A;  2JEB A;  1S4E A;  4DR4 E;  2C38 B;  1E3H A;  3V2U C;  2IOQ A;  1HR0 I;  3M6A A;  1HNZ E;  1FI4 A;  2PO1 A;  4U3D A;  5FWK A;  2HFU A;  4DUZ E;  1HR0 E;  1FJG E;  4DV5 I;  3PYG A;  1N32 I;  4YHH I;  4PRX A;  4BA2 B;  4DUY E;  2PNM A;  4JYA E;  3WU3 A;  2WNR B;  5C0X E;  1NHH A;  5K36 B;  3B78 A;  3P3E A;  4YHH E;  2VQE E;  1UDO A;  2CZ9 A;  3J7A M;  3Q1Q A;  4GKK E;  2R3V A;  2VQF E;  4OO1 B;  1N33 I;  4DR3 I;  5JEA D;  4IZK B;  1OYS A;  4MU4 A;  4X62 I;  4DV0 E;  5C0X C;  4MU1 A;  3T1Y I;  2PNZ A;  4RPF A;  1IBM I;  1RR9 A;  2HFS A;  4UTG A;  1H73 A;  2HK2 A;  5JEA E;  1N0U A;  4X62 E;  2UXD I;  1N36 I;  4U3B A;  3OTO I;  4LFA I;  2O1W A;  2UXC E;  1ZXN A;  2F1D A;  2UUC I;  1XNR I;  5LMN I;  4JI4 I;  4LF6 E;  5JEA C;  2UXD E;  2ZM6 I;  5K36 D;  2DEI A;  4JI1 I;  4FW7 A;  3ZM7 A;  1I94 I;  2E1R A;  2JE6 A;  4LFC I;  4X66 E;  4DR2 I;  2UUC E;  3M7N G;  4J3D A;  4IFD C;  2O1V A;  5IWA E;  3J81 Q;  3U1Y A;  4JI4 E;  1Z0V A;  1N0V C;  1XXE A;  4FW5 A;  4JI1 E;  5K36 E;  1I94 E;  4XTJ A;  2JEB B;  3ZZU A;  2J7K A;  1NHI A;  3M85 D;  4DV1 I;  5LL6 R;  1NHJ A;  4B3R I;  2NN6 B;  4ZVI A;  2E5L I;  3B82 A;  3HKM A;  4AM3 A;  2A2D A;  2PO1 B;  2PO2 A;  4B3R E;  1OJ4 A;  2C39 A;  3JAM Q;  2AJ4 A;  2BA0 D;  1IBK E;  4AQY I;  4YY3 I;  3GME A;  3LPS A;  1VIS A;  3Q6M A;  2V2V A;  5IT9 Q;  4IZJ A;  4GQU A;  1KKH A;  2X36 A;  4AQY E;  1Y5Y A;  4LF5 E;  1H72 C;  3J80 C;  4DPU A;  4HY1 A;  2NN6 D;  4DR6 I;  4QNK A;  2UUA I;  1Z5C A;  1H74 A;  1Y4S A;  1ELO A;  5DNL A;  2Z5E A;  5BR8 E;  4GKJ E;  3P06 A;  4DR4 I;  4R1F A;  4JI8 E;  2NN6 E;  2PNZ B;  2JEA A;  4JI3 I;  4DR6 E;  3P3G A;  1UDS A;  4LPF A;  5GME A;  1U2R A;  4DPX A;  4DR5 E;  2UUB I;  1HNZ I;  2LJP A;  4JI3 E;  4WUD A;  4DUZ I;  2EFG A;  4BA1 A;  5A2Q Q;  2WW4 A;  1FJG I;  4HAC A;  2UUB E;  5DRQ A;  3V5R A;  4LFB E;  4USM A;  3P3C A;  1KIJ A;  2Z5B A;  3U1K A;  2JE6 B;  4FWG A;  2HHH I;  4DUY I;  1HK7 A;  4NXM E;  2PO0 A;  2WP8 A;  4JYA I;  1N34 I;  2BV3 A;  4B3S E;  1ZM4 A;  3PS1 A;  2VQE I;  4M1K A;  4GKK I;  1MU5 A;  4MU0 A;  2HHH E;  4LF4 E;  2VQF I;  4WUC A;  2IOP A;  2VF3 A;  5FLX Q;  2GO4 A;  4JI6 E;  3DD6 A;  1N34 E;  4DV0 I;  4KQV A;  4DV6 I;  1NZ0 A;  3PYF A;  1XMO E;  2Q2E B;  2PO2 B;  1XMQ E;  4LF7 E;  3PYE A;  3QT6 A;  5ELW A;  3QT8 A;  4N3O A;  1IBL I;  4DV6 E;  3J81 C;  1HNX E;  4OX9 E;  2UXC I;  3ZKB A;  3PS3 A;  3GON A;  4OZE A;  2UU9 E;  4LF6 I;  4MQY A;  4IZJ B; 
#chains in the Genus database with same CATH homology
 2NN6 B;  3KRN A;  5JEA B;  1R6L A;  3HKM A;  4AM3 A;  2C37 B;  2PO1 B;  2NN6 A;  3M7N D;  2PO2 A;  4IFD B;  1UDN A;  5C0X A;  2C39 A;  5C0X F;  4AID A;  2BA0 D;  3L7Z B;  2C39 B;  4OO1 D;  5C0X D;  3GME A;  2JEA B;  2BA1 G;  2JEB A;  2BR2 B;  2C38 B;  1E3H A;  4OO1 E;  5JEA A;  4BA1 B;  5JEA F;  2NN6 D;  2C37 A;  5K36 C;  2PO1 A;  4AIM A;  4IFD A;  4IFD F;  3H1C A;  3L7Z A;  4IFD D;  2PO0 B;  3CDI A;  2BA1 D;  2WP8 B;  2NN6 E;  1E3P A;  2PNZ B;  2JEA A;  1UDS A;  4BA2 B;  2BR2 A;  2C38 A;  4IFD E;  3B4T A;  2WNR B;  4BA1 A;  5K36 F;  5C0X E;  5K36 B;  1UDO A;  4OO1 B;  3U1K A;  5JEA D;  2JE6 B;  1OYS A;  1OYR A;  4OO1 C;  1UDQ A;  5C0X C;  2PO0 A;  2WP8 A;  2PNZ A;  3GLL A;  1R6M A;  4BA2 A;  5JEA E;  3M85 G;  3DD6 A;  2NN6 C;  2WNR A;  5K36 A;  3GCM A;  3CDJ A;  5JEA C;  4OO1 A;  4OO1 F;  5K36 D;  2PO2 B;  2JE6 A;  3M7N G;  5C0X B;  4IFD C;  1OYP A;  2BA0 G;  5K36 E;  2JEB B;  3M85 D;  4NBQ A;  2NN6 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...