5K36D

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
221
Chain Sequence
b'SVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 68
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36D00
4BA1B 5JEAB 2JEBB 4IFDA 3M7NG 2C37B 3CDIA 5K36F 1OYRA 5C0XF 1UDNA 1E3HA 2NN6C 4IFDD 2WP8B 2PNZA 2NN6B 3M85D 3B4TA 4BA2B 3M7ND 4IFDE 2PO0B 4OO1F 5C0XA 2BR2A 1OYSA 3M85G 2C39A 3H1CA 4AM3A 5JEAF 5K36D 2PO2A 5C0XD 1UDQA 4OO1A 2C38A 2PO1A 1OYPA 2JEAA 1UDSA 5C0XE 2BA1G 3L7ZA 3DD6A 4IFDC 3GLLA 4BA1A 5JEAA 5K36A 2JE6B 2WNRB 2JEBA 2NN6F 4OO1D 4IFDB 2BA0G 2C37A 2C39B 1R6MA 4OO1E 3GCMA 3GMEA 2BA1D 2PO2B 5JEAD 1UDOA 2WP8A 2C38B 3HKMA 2NN6A 5JEAE 5K36E 4BA2A 4AIDA 4NBQA 3U1KA 2PNZB 5C0XC 2BA0D 1E3PA 5K36B 2BR2B 5C0XB 1R6LA 4AIMA 2NN6D 4OO1C 2NN6E 3CDJA 4IFDF 4OO1B 2PO1B 2JEAB 5JEAC 5K36C 3L7ZB 2PO0A 2JE6A 3KRNA 2WNRA
chains in the Genus database with same CATH superfamily
4BA1B 4JI8E 3NZKA 2A2CA 3M7NG 4JI4E 4LF5I 1YHCA 3ZZTA 2UXCE 2E5LI 5DRRA 1XNQE 3PYDA 2X7IA 2O1WA 1Z0WA 4IFDD 1IBKI 1OJ4A 3F0NA 4DR5I 4YY3I 3B4TA 2O1VA 4BA2B 4LCGA 5LMNE 5DRQA 4B3MI 1Z5AA 4OO1F 4DR3E 4DR7I 4USKA 4DUZE 1KVKA 1N32E 4GKJI 2C39A 4RPFA 4JI2E 4DR2E 2DEJA 1J5EI 4U3BA 2VF3A 1IBME 4LOMA 4DV3E 3WU4A 1QZRA 4FW4A 5IT9Q 1N34E 2BA1G 3L7ZA 4FW7A 1U2RA 2X36A 3J80C 4DR4I 3GLLA 4BA1A 4B3TI 4DV2E 1DARA 2DEIA 1HR0E 4DPYA 2WW4A 2VQFI 4DR1I 2HFSA 5FWKA 1PVGA 1Z0GA 2ZITA 1XMOI 4OO1E 2AJ4A 4X62I 4PU9A 3CWVA 4B3RE 4LF8I 2C38B 4DV0I 5L3JA 2UU9E 4LF9E 4LFBI 1RHYA 1I94E 1FI4A 4BA2A 4NBQA 5C0XC 2PNZB 4JI2I 3QT8A 1IBLE 1USVA 4MU3A 1E3PA 2UUCE 5K36B 5C0XB 1FNMA 3QT7A 4LCHA 1R6LA 2ZBKB 4HXZA 1HNWI 4I3HA 4UT4A 4DU8A 1NHJA 1Z0CA 3JAMQ 4NXNE 2Z5BB 3P3EA 4JI7E 1ELOA 4DV1E 4YHHE 4JV5E 4LF4I 2GO3A 2JEAB 3P06A 1YH8A 4FW9A 5DRPA 5JEAC 1HNZE 2EFGA 4B3SI 4NXME 3WU6A 3KRNA 1VISA 4LF7I 2VESA 2UXBE 5JEAB 4KHPE 4WUBA 1N0VC 4JI3E 2C37B 4MYUA 3PS3A 1OYRA 1Y4SA 2HK2A 3ZKBA 3T1YE 4JI0I 5DNLA 1UDNA 3B82A 1D6TA 3J7AG 4X65E 2NN6C 4LFAI 1MU5A 3OTOE 1B63A 4DV4I 2PNZA 2NN6B 3M85D 2PO0B 4LF6E 5C0XA 2Q2EB 1Y60A 2VQEE 1VI7A 1RREA 4MQYA 3ZZUA 1HNXE 5IT9C 4GKKI 4K0KI 3H1CA 4IZJD 3T1HE 2E1RA 2OI2A 4DPUA 2UUAI 1N36I 2V8PA 1OYPA 4DV5E 2JEAA 2AE8A 4DV6E 3LNUA 2HK3A 4MU4A 4JI5E 3WU5A 4DUYI 4IFDC 3PYEA 5JEAA 2UUBE 2WNRB 4OO1D 2F1DA 4PRXA 3OTOI 4IFDB 1XNRI 1K47A 2C37A 3U1YA 1N33I 3J7AM 3LPSA 4HACB 2HKJA 5ELWA 2PO2B 2V2ZA 2UXDE 1UDOA 2HHHI 3HKMA 4JI8I 4DV7E 1ZM3A 4KQVA 2NN6A 5LMUE 4JI4I 5IWAE 2PNLA 2BA0D 4JI6E 2UXCI 3JAMC 1XNQI 2A2DA 1Z0BA 1USUA 2BR2B 3UHMA 3K17A 4AIMA 3QT5A 4MDTA 4XTJA 4GQUA 1A6FA 5DROA 1S16A 2O1TA 5LMNI 5GMDA 4DR3I 2PO1B 2NPFA 2O3ZA 4LFCE 4DUZI 2F4VE 1H72C 1N32I 5K36C 1EA6A 3Q1QA 4DR2I 1XMQE 4LCFA 2WNRA 1ZXMA 3HULA 2CVEA 1IBMI 1ZXNA 2JEBB 4DV3I 4IFDA 4DR6E 2O1UA 5A2QQ 4X64E 1KIJA 4FWGA 3CDIA 5BR8E 1N34I 1FJGE 5K36F 4HACA 5C0XF 4OX9E 4IZKB 4DV2I 2LJPA 1HR0I 2GQ0A 4DPWA 1H7SA 4AQYE 3J81Q 2BR2A 1Y5YA 1ZM9A 4X66E 1EI1A 1FWKA 4B3RI 3PS1A 4JYAE 4LF9I 2UU9I 2R42A 4AM3A 1I94I 4OZEA 2ZM6E 4JI1E 5JEAF 3K1JA 4MU0A 5GMEA 2JT2A 1IBLI 2UUCI 1FKAE 2IERA 2C38A 2PO1A 2IESA 4P52A 4LF5E 2CZ9A 5C0XE 2E5LE 3B78A 3ZZ0A 1PIEA 5K36A 2JE6B 4ED4A 4NXNI 2JEBA 1IBKE 1Z0EA 2NN6F 4JI7I 4DV1I 4DR5E 4YHHI 4YY3E 4JV5I 4PRVA 2R3VA 2BA0G 2C39B 1RR9A 1R6MA 3B8HA 4B3ME 1HNZI 3PYGA 1UEKA 3V2UC 4NXMI 1KTVA 2Z5BA 4DR7E 1Z0VA 3QT6A 3HJCA 1PKPA 2UXBI 4GKJE 4FWHA 4HYMA 4KHPI 5JEAE 1Z0TA 3U1KA 2IOPA 4IZJB 4QNKA 4JI3I 1J5EE 2Z5CB 3ZM7A 1Y4UA 3T1YI 4P7AA 3P3GA 2J7KA 5DNXA 4DXLA 4X65I 3P3CA 1H7UA 3V5RA 4DPXA 2IOQA 4Z7CA 4DR4E 4OO1C 4B3TE 4URLA 5FLXQ 2NN6E 2GO4A 4IFDF 3Q6NA 4LF6I 2VQFE 4DR1E 1XXEA 2VQEI 4OO1B 2XEXA 5A2QC 1Y6ZA 1XMOE 1HNXI 4J3DA 4U3DA 2V2QA 3T1HI 4X62E 2PO0A 4USMA 4LF8E 2JE6A 4M1KA 4DV0E 4LFBE 4DU7A 1B62A 4DV5I 4DV6I 1H73A 4JI5I 3J81C 1E3HA 1NZ0A 4UTGA 2UUBI 5EL9A 5LL6R 1HNWE 2GS8A 2WP8B 1MX0A 4FN5A 4JG4A 3K85A 4ZVIA 4IZJA 4MU1A 2HFUA 3M7ND 2Z5CA 4IFDE 1BKNA 2CGEA 4Z7YA 4LF4E 1OYSA 2UXDI 1WUUA 3M85G 4DV7I 2BM1A 4B3SE 2Z5EA 5LMUI 1Z5CA 1NHHA 2CG9A 5IWAI 3M6AA 4JI6I 3H4LA 4LF7E 5K36D 2PO2A 5C0XD 1UDQA 3PYFA 4ISAA 4OO1A 4WUCA 1UDSA 4FW5A 4IS9A 1ZM4A 1FWLA 3WU3A 3LTOA 4LPFA 4JI0E 3DD6A 3PRYA 4LFAE 5EKWA 3Q6MA 4HY1A 4EMDA 4MYTA 4DV4E 1HK7A 1N0UA 1MG7A 4LFCI 4OKGA 1H74A 2F4VI 2V2VA 1KKHA 3GCMA 3J80Q 3GMEA 2BA1D 1XMQI 1Z5BA 2BV3A 5JEAD 3D4JA 2WP8A 4WUDA 3GONA 3ZKDA 4K0KE 4GKKE 1Z59A 1ZM2A 5K36E 4DR6I 4AIDA 2HKEA 4X64I 2UUAE 4FW3A 5BR8I 1FJGI 1P42A 4FWDA 5FLXC 1N36E 4OX9I 4DPTA 4N3OA 2J65A 2PNMA 3PS2A 2NN6D 2V34A 4DUYE 3CDJA 4AQYI 4QNJA 2BM0A 1S4EA 3P76A 4IZKA 4X66I 1XNRE 1XHKA 1N33E 4JYAI 4FW6A 3L7ZB 1NHIA 4R1FA 4JI1I 2ZM6I 2HHHE
chains in the Genus database with same CATH topology
4BA1B 5JEAB 2JEBB 4IFDA 3M7NG 2C37B 3CDIA 5K36F 1OYRA 5C0XF 1UDNA 1E3HA 2NN6C 4IFDD 2WP8B 2PNZA 2NN6B 3M85D 3B4TA 4BA2B 3M7ND 4IFDE 2PO0B 4OO1F 5C0XA 2BR2A 1OYSA 3M85G 2C39A 3H1CA 4AM3A 5JEAF 5K36D 2PO2A 5C0XD 1UDQA 4OO1A 2C38A 2PO1A 1OYPA 2JEAA 1UDSA 5C0XE 2BA1G 3L7ZA 3DD6A 4IFDC 3GLLA 4BA1A 5JEAA 5K36A 2JE6B 2WNRB 2JEBA 2NN6F 4OO1D 4IFDB 2BA0G 2C37A 2C39B 1R6MA 4OO1E 3GCMA 3GMEA 2BA1D 2PO2B 5JEAD 1UDOA 2WP8A 2C38B 3HKMA 2NN6A 5JEAE 5K36E 4BA2A 4AIDA 4NBQA 3U1KA 2PNZB 5C0XC 2BA0D 1E3PA 5K36B 2BR2B 5C0XB 1R6LA 4AIMA 2NN6D 4OO1C 2NN6E 3CDJA 4IFDF 4OO1B 2PO1B 2JEAB 5JEAC 5K36C 3L7ZB 2PO0A 2JE6A 3KRNA 2WNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA1 B;  5JEA B;  2JEB B;  4IFD A;  3M7N G;  2C37 B;  3CDI A;  5K36 F;  1OYR A;  5C0X F;  1UDN A;  1E3H A;  2NN6 C;  4IFD D;  2WP8 B;  2PNZ A;  2NN6 B;  3M85 D;  3B4T A;  4BA2 B;  3M7N D;  4IFD E;  2PO0 B;  4OO1 F;  5C0X A;  2BR2 A;  1OYS A;  3M85 G;  2C39 A;  3H1C A;  4AM3 A;  5JEA F;  5K36 D;  2PO2 A;  5C0X D;  1UDQ A;  4OO1 A;  2C38 A;  2PO1 A;  1OYP A;  2JEA A;  1UDS A;  5C0X E;  2BA1 G;  3L7Z A;  3DD6 A;  4IFD C;  3GLL A;  4BA1 A;  5JEA A;  5K36 A;  2JE6 B;  2WNR B;  2JEB A;  2NN6 F;  4OO1 D;  4IFD B;  2BA0 G;  2C37 A;  2C39 B;  1R6M A;  4OO1 E;  3GCM A;  3GME A;  2BA1 D;  2PO2 B;  5JEA D;  1UDO A;  2WP8 A;  2C38 B;  3HKM A;  2NN6 A;  5JEA E;  5K36 E;  4BA2 A;  4AID A;  4NBQ A;  3U1K A;  2PNZ B;  5C0X C;  2BA0 D;  1E3P A;  5K36 B;  2BR2 B;  5C0X B;  1R6L A;  4AIM A;  2NN6 D;  4OO1 C;  2NN6 E;  3CDJ A;  4IFD F;  4OO1 B;  2PO1 B;  2JEA B;  5JEA C;  5K36 C;  3L7Z B;  2PO0 A;  2JE6 A;  3KRN A;  2WNR A; 
#chains in the Genus database with same CATH topology
 4BA1 B;  4JI8 E;  3NZK A;  2A2C A;  3M7N G;  4JI4 E;  4LF5 I;  1YHC A;  3ZZT A;  2UXC E;  2E5L I;  5DRR A;  1XNQ E;  3PYD A;  2X7I A;  2O1W A;  1Z0W A;  4IFD D;  1IBK I;  1OJ4 A;  3F0N A;  4DR5 I;  4YY3 I;  3B4T A;  2O1V A;  4BA2 B;  4LCG A;  5LMN E;  5DRQ A;  4B3M I;  1Z5A A;  4OO1 F;  4DR3 E;  4DR7 I;  4USK A;  4DUZ E;  1KVK A;  1N32 E;  4GKJ I;  2C39 A;  4RPF A;  4JI2 E;  4DR2 E;  2DEJ A;  1J5E I;  4U3B A;  2VF3 A;  1IBM E;  4LOM A;  4DV3 E;  3WU4 A;  1QZR A;  4FW4 A;  5IT9 Q;  1N34 E;  2BA1 G;  3L7Z A;  4FW7 A;  1U2R A;  2X36 A;  3J80 C;  4DR4 I;  3GLL A;  4BA1 A;  4B3T I;  4DV2 E;  1DAR A;  2DEI A;  1HR0 E;  4DPY A;  2WW4 A;  2VQF I;  4DR1 I;  2HFS A;  5FWK A;  1PVG A;  1Z0G A;  2ZIT A;  1XMO I;  4OO1 E;  2AJ4 A;  4X62 I;  4PU9 A;  3CWV A;  4B3R E;  4LF8 I;  2C38 B;  4DV0 I;  5L3J A;  2UU9 E;  4LF9 E;  4LFB I;  1RHY A;  1I94 E;  1FI4 A;  4BA2 A;  4NBQ A;  5C0X C;  2PNZ B;  4JI2 I;  3QT8 A;  1IBL E;  1USV A;  4MU3 A;  1E3P A;  2UUC E;  5K36 B;  5C0X B;  1FNM A;  3QT7 A;  4LCH A;  1R6L A;  2ZBK B;  4HXZ A;  1HNW I;  4I3H A;  4UT4 A;  4DU8 A;  1NHJ A;  1Z0C A;  3JAM Q;  4NXN E;  2Z5B B;  3P3E A;  4JI7 E;  1ELO A;  4DV1 E;  4YHH E;  4JV5 E;  4LF4 I;  2GO3 A;  2JEA B;  3P06 A;  1YH8 A;  4FW9 A;  5DRP A;  5JEA C;  1HNZ E;  2EFG A;  4B3S I;  4NXM E;  3WU6 A;  3KRN A;  1VIS A;  4LF7 I;  2VES A;  2UXB E;  5JEA B;  4KHP E;  4WUB A;  1N0V C;  4JI3 E;  2C37 B;  4MYU A;  3PS3 A;  1OYR A;  1Y4S A;  2HK2 A;  3ZKB A;  3T1Y E;  4JI0 I;  5DNL A;  1UDN A;  3B82 A;  1D6T A;  3J7A G;  4X65 E;  2NN6 C;  4LFA I;  1MU5 A;  3OTO E;  1B63 A;  4DV4 I;  2PNZ A;  2NN6 B;  3M85 D;  2PO0 B;  4LF6 E;  5C0X A;  2Q2E B;  1Y60 A;  2VQE E;  1VI7 A;  1RRE A;  4MQY A;  3ZZU A;  1HNX E;  5IT9 C;  4GKK I;  4K0K I;  3H1C A;  4IZJ D;  3T1H E;  2E1R A;  2OI2 A;  4DPU A;  2UUA I;  1N36 I;  2V8P A;  1OYP A;  4DV5 E;  2JEA A;  2AE8 A;  4DV6 E;  3LNU A;  2HK3 A;  4MU4 A;  4JI5 E;  3WU5 A;  4DUY I;  4IFD C;  3PYE A;  5JEA A;  2UUB E;  2WNR B;  4OO1 D;  2F1D A;  4PRX A;  3OTO I;  4IFD B;  1XNR I;  1K47 A;  2C37 A;  3U1Y A;  1N33 I;  3J7A M;  3LPS A;  4HAC B;  2HKJ A;  5ELW A;  2PO2 B;  2V2Z A;  2UXD E;  1UDO A;  2HHH I;  3HKM A;  4JI8 I;  4DV7 E;  1ZM3 A;  4KQV A;  2NN6 A;  5LMU E;  4JI4 I;  5IWA E;  2PNL A;  2BA0 D;  4JI6 E;  2UXC I;  3JAM C;  1XNQ I;  2A2D A;  1Z0B A;  1USU A;  2BR2 B;  3UHM A;  3K17 A;  4AIM A;  3QT5 A;  4MDT A;  4XTJ A;  4GQU A;  1A6F A;  5DRO A;  1S16 A;  2O1T A;  5LMN I;  5GMD A;  4DR3 I;  2PO1 B;  2NPF A;  2O3Z A;  4LFC E;  4DUZ I;  2F4V E;  1H72 C;  1N32 I;  5K36 C;  1EA6 A;  3Q1Q A;  4DR2 I;  1XMQ E;  4LCF A;  2WNR A;  1ZXM A;  3HUL A;  2CVE A;  1IBM I;  1ZXN A;  2JEB B;  4DV3 I;  4IFD A;  4DR6 E;  2O1U A;  5A2Q Q;  4X64 E;  1KIJ A;  4FWG A;  3CDI A;  5BR8 E;  1N34 I;  1FJG E;  5K36 F;  4HAC A;  5C0X F;  4OX9 E;  4IZK B;  4DV2 I;  2LJP A;  1HR0 I;  2GQ0 A;  4DPW A;  1H7S A;  4AQY E;  3J81 Q;  2BR2 A;  1Y5Y A;  1ZM9 A;  4X66 E;  1EI1 A;  1FWK A;  4B3R I;  3PS1 A;  4JYA E;  4LF9 I;  2UU9 I;  2R42 A;  4AM3 A;  1I94 I;  4OZE A;  2ZM6 E;  4JI1 E;  5JEA F;  3K1J A;  4MU0 A;  5GME A;  2JT2 A;  1IBL I;  2UUC I;  1FKA E;  2IER A;  2C38 A;  2PO1 A;  2IES A;  4P52 A;  4LF5 E;  2CZ9 A;  5C0X E;  2E5L E;  3B78 A;  3ZZ0 A;  1PIE A;  5K36 A;  2JE6 B;  4ED4 A;  4NXN I;  2JEB A;  1IBK E;  1Z0E A;  2NN6 F;  4JI7 I;  4DV1 I;  4DR5 E;  4YHH I;  4YY3 E;  4JV5 I;  4PRV A;  2R3V A;  2BA0 G;  2C39 B;  1RR9 A;  1R6M A;  3B8H A;  4B3M E;  1HNZ I;  3PYG A;  1UEK A;  3V2U C;  4NXM I;  1KTV A;  2Z5B A;  4DR7 E;  1Z0V A;  3QT6 A;  3HJC A;  1PKP A;  2UXB I;  4GKJ E;  4FWH A;  4HYM A;  4KHP I;  5JEA E;  1Z0T A;  3U1K A;  2IOP A;  4IZJ B;  4QNK A;  4JI3 I;  1J5E E;  2Z5C B;  3ZM7 A;  1Y4U A;  3T1Y I;  4P7A A;  3P3G A;  2J7K A;  5DNX A;  4DXL A;  4X65 I;  3P3C A;  1H7U A;  3V5R A;  4DPX A;  2IOQ A;  4Z7C A;  4DR4 E;  4OO1 C;  4B3T E;  4URL A;  5FLX Q;  2NN6 E;  2GO4 A;  4IFD F;  3Q6N A;  4LF6 I;  2VQF E;  4DR1 E;  1XXE A;  2VQE I;  4OO1 B;  2XEX A;  5A2Q C;  1Y6Z A;  1XMO E;  1HNX I;  4J3D A;  4U3D A;  2V2Q A;  3T1H I;  4X62 E;  2PO0 A;  4USM A;  4LF8 E;  2JE6 A;  4M1K A;  4DV0 E;  4LFB E;  4DU7 A;  1B62 A;  4DV5 I;  4DV6 I;  1H73 A;  4JI5 I;  3J81 C;  1E3H A;  1NZ0 A;  4UTG A;  2UUB I;  5EL9 A;  5LL6 R;  1HNW E;  2GS8 A;  2WP8 B;  1MX0 A;  4FN5 A;  4JG4 A;  3K85 A;  4ZVI A;  4IZJ A;  4MU1 A;  2HFU A;  3M7N D;  2Z5C A;  4IFD E;  1BKN A;  2CGE A;  4Z7Y A;  4LF4 E;  1OYS A;  2UXD I;  1WUU A;  3M85 G;  4DV7 I;  2BM1 A;  4B3S E;  2Z5E A;  5LMU I;  1Z5C A;  1NHH A;  2CG9 A;  5IWA I;  3M6A A;  4JI6 I;  3H4L A;  4LF7 E;  5K36 D;  2PO2 A;  5C0X D;  1UDQ A;  3PYF A;  4ISA A;  4OO1 A;  4WUC A;  1UDS A;  4FW5 A;  4IS9 A;  1ZM4 A;  1FWL A;  3WU3 A;  3LTO A;  4LPF A;  4JI0 E;  3DD6 A;  3PRY A;  4LFA E;  5EKW A;  3Q6M A;  4HY1 A;  4EMD A;  4MYT A;  4DV4 E;  1HK7 A;  1N0U A;  1MG7 A;  4LFC I;  4OKG A;  1H74 A;  2F4V I;  2V2V A;  1KKH A;  3GCM A;  3J80 Q;  3GME A;  2BA1 D;  1XMQ I;  1Z5B A;  2BV3 A;  5JEA D;  3D4J A;  2WP8 A;  4WUD A;  3GON A;  3ZKD A;  4K0K E;  4GKK E;  1Z59 A;  1ZM2 A;  5K36 E;  4DR6 I;  4AID A;  2HKE A;  4X64 I;  2UUA E;  4FW3 A;  5BR8 I;  1FJG I;  1P42 A;  4FWD A;  5FLX C;  1N36 E;  4OX9 I;  4DPT A;  4N3O A;  2J65 A;  2PNM A;  3PS2 A;  2NN6 D;  2V34 A;  4DUY E;  3CDJ A;  4AQY I;  4QNJ A;  2BM0 A;  1S4E A;  3P76 A;  4IZK A;  4X66 I;  1XNR E;  1XHK A;  1N33 E;  4JYA I;  4FW6 A;  3L7Z B;  1NHI A;  4R1F A;  4JI1 I;  2ZM6 I;  2HHH E; 
#chains in the Genus database with same CATH homology
 4BA1 B;  5JEA B;  2JEB B;  4IFD A;  3M7N G;  2C37 B;  3CDI A;  5K36 F;  1OYR A;  5C0X F;  1UDN A;  1E3H A;  2NN6 C;  4IFD D;  2WP8 B;  2PNZ A;  2NN6 B;  3M85 D;  3B4T A;  4BA2 B;  3M7N D;  4IFD E;  2PO0 B;  4OO1 F;  5C0X A;  2BR2 A;  1OYS A;  3M85 G;  2C39 A;  3H1C A;  4AM3 A;  5JEA F;  5K36 D;  2PO2 A;  5C0X D;  1UDQ A;  4OO1 A;  2C38 A;  2PO1 A;  1OYP A;  2JEA A;  1UDS A;  5C0X E;  2BA1 G;  3L7Z A;  3DD6 A;  4IFD C;  3GLL A;  4BA1 A;  5JEA A;  5K36 A;  2JE6 B;  2WNR B;  2JEB A;  2NN6 F;  4OO1 D;  4IFD B;  2BA0 G;  2C37 A;  2C39 B;  1R6M A;  4OO1 E;  3GCM A;  3GME A;  2BA1 D;  2PO2 B;  5JEA D;  1UDO A;  2WP8 A;  2C38 B;  3HKM A;  2NN6 A;  5JEA E;  5K36 E;  4BA2 A;  4AID A;  4NBQ A;  3U1K A;  2PNZ B;  5C0X C;  2BA0 D;  1E3P A;  5K36 B;  2BR2 B;  5C0X B;  1R6L A;  4AIM A;  2NN6 D;  4OO1 C;  2NN6 E;  3CDJ A;  4IFD F;  4OO1 B;  2PO1 B;  2JEA B;  5JEA C;  5K36 C;  3L7Z B;  2PO0 A;  2JE6 A;  3KRN A;  2WNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...