5K36D

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
221
Chain Sequence
SVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 68
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36D00
5K36C 2WNRA 5JEAA 4IFDD 3DD6A 2C38A 4AIMA 2JEAB 4OO1D 2PO0B 2C37A 2BA0G 1UDQA 4AIDA 5C0XE 2NN6B 5C0XB 3H1CA 2PO2B 2BA0D 3B4TA 2JEBA 3CDIA 4IFDB 1UDOA 2WP8A 4OO1B 1R6LA 2PNZA 4BA2A 2C39B 5K36A 4BA1A 2BA1G 2JE6B 5JEAF 5K36F 4AM3A 1UDSA 5JEAE 2BA1D 2WNRB 1UDNA 3HKMA 2JEAA 2C37B 2PO0A 2NN6C 5C0XC 5JEAD 3L7ZA 5K36D 2NN6A 2PO1B 4IFDC 2JEBB 4OO1C 3GLLA 2BR2B 4OO1A 5K36E 3M7NG 5JEAB 4BA2B 5K36B 4BA1B 2C38B 2JE6A 3M7ND 3M85G 1OYPA 4NBQA 3GMEA 5C0XA 1OYRA 3M85D 2PO2A 1OYSA 2NN6F 5C0XF 3U1KA 3GCMA 4IFDA 2NN6E 1R6MA 2WP8B 3L7ZB 4IFDF 3CDJA 4OO1F 2PNZB 4IFDE 1E3PA 2PO1A 2C39A 1E3HA 4OO1E 2BR2A 2NN6D 5C0XD 3KRNA 5JEAC
chains in the Genus database with same CATH superfamily
4WUCA 4LCGA 2WNRA 4JI8I 4DR6I 2C38A 4Z7YA 1FI4A 4MU3A 2F1DA 2PO0B 4DR7E 4X64I 1Z59A 4LF5I 5ELWA 5GMEA 4DV7E 4B3TI 4DR5I 2PO2B 2R3VA 4X65I 1MU5A 3QT5A 2F4VI 5BR8I 1D6TA 4OX9I 4AQYI 2VQEI 4JI0E 4QNJA 4OZEA 3B82A 2A2DA 2HK2A 2Z5EA 2PNZA 4JI1E 4BA2A 2AE8A 4BA1A 1N36E 5JEAF 5K36F 4AM3A 4JYAI 1UDSA 3WU4A 5JEAE 2WNRB 4P7AA 4LOMA 1S16A 3HKMA 4DR3I 1HNZE 4LF4I 2JEAA 5EKWA 2CVEA 1XNQE 4LFCI 3UHMA 4GKKI 4DR1E 1VISA 4ED4A 4ZVIA 2NN6A 4IZJA 4LFBE 1H73A 4JI3I 2VQFE 4OO1C 4LCHA 3P3EA 1NHHA 2E1RA 1N34E 3M7NG 4BA2B 4DUYE 4BA1B 4DV1I 1H74A 1Z0TA 4X66I 2JE6A 1VI7A 1J5EE 3M7ND 4IZJD 3M85G 4DV2I 4HACA 2HHHE 1ZM2A 3ZM7A 1QZRA 3PS2A 3M85D 2V2ZA 4DV5I 5C0XF 1IBKI 3P06A 1Y5YA 2WP8B 4NXNI 3ZKDA 4YHHE 1Y6ZA 4IFDF 4IZJB 4FWHA 4JI2I 1HNXE 3OTOE 3LTOA 2CG9A 4IFDE 2V8PA 2EFGA 2BR2A 5FLXC 1I94I 1B62A 1Y4UA 2Z5BB 4MQYA 4P52A 5JEAA 4JG4A 3DD6A 4FW4A 5FWKA 4DV3E 2Q2EB 2NPFA 4DR7I 4OO1D 2CGEA 3JAMQ 1PVGA 4HACB 4DR4E 1UDQA 4AIDA 1RHYA 4DV7I 3Q6MA 3HJCA 4URLA 3QT6A 3WU5A 2PNMA 4LF9E 2BM1A 1UDOA 4JI0I 4OO1B 3J80C 5IWAE 1EI1A 2UUBE 1Y60A 2V2QA 4DPYA 4X62E 4JI1I 3B78A 1N36I 4OKGA 2XEXA 4WUDA 4USKA 4DV0E 1HNZI 1XXEA 2ZBKB 3B8HA 3Q1QA 1XNQI 2NN6C 4PRXA 4DR1I 2O3ZA 1IBME 1U2RA 4LFBI 5LMUE 2VQFI 2O1UA 4KHPE 2J7KA 4YY3E 1A6FA 4DXLA 1PIEA 3PYDA 4UT4A 4JV5E 1N34I 3F0NA 5K36E 2JT2A 2DEJA 4DUYI 2C38B 1NHJA 4WUBA 3QT7A 1Z5AA 1N33E 4MU1A 1J5EI 2HHHI 3PYEA 3J81Q 1XMQE 3GMEA 4GKJE 2O1TA 4LF7E 2A2CA 3V2UC 1NHIA 4UTGA 5LL6R 3U1KA 2UXCE 4DPUA 3K17A 1R6MA 4J3DA 4YHHI 1HNXI 4B3ME 2WW4A 3OTOI 2HFSA 2X7IA 2PNZB 1XNRE 2PO1A 1HNWE 1K47A 5IT9C 2C39A 1E3HA 4ISAA 3P3GA 2NN6D 1Z0CA 1N32E 1H7UA 4DU7A 5DRQA 4FWDA 5JEAC 5K36C 4MDTA 4DV3I 2JEAB 4I3HA 4DR4I 2IOPA 4DV6E 4MU4A 5C0XE 4NXME 1RR9A 1XMOE 2NN6B 3H1CA 3P3CA 3J7AM 4K0KE 2O1WA 2GO3A 2UXBE 3B4TA 4M1KA 3H4LA 4U3DA 4LF9I 2ZM6E 4LFAE 2HKEA 2JEBA 3CDIA 3T1YE 4PRVA 4Z7CA 1HR0E 4FW7A 5IWAI 1Z0EA 2UUBI 1R6LA 4X62I 1USUA 4IZKA 2C39B 5K36A 1OJ4A 2BA1G 1BKNA 2JE6B 2ZITA 4B3SE 2R42A 4JI7E 3U1YA 2AJ4A 2BA1D 4DV0I 1N0UA 2GO4A 2X36A 4B3RE 1USVA 2GQ0A 1IBLE 2GS8A 4DR2E 2E5LE 1FJGE 2PO0A 1H7SA 1UEKA 5C0XC 5JEAD 3L7ZA 5K36D 2UU9E 3PYGA 2UXDE 1IBMI 5LMUI 4IFDC 2JEBB 5DNXA 4KHPI 2BR2B 4LF6E 4DUZE 1P42A 4YY3I 2Z5CA 4JV5I 4DV4E 3T1HE 4IZKB 3M6AA 4JI6E 4USMA 1MG7A 5JEAB 5K36B 4JI5E 1N33I 3GONA 1XMQI 1OYPA 3K85A 4NBQA 4GKJI 1ZXMA 4MU0A 4JI4E 4LF7I 4FW3A 1PKPA 4FW5A 5C0XA 1OYRA 2UXCI 1NZ0A 4FW9A 1YHCA 4QNKA 3GCMA 4IFDA 3L7ZB 4LPFA 4B3MI 5FLXQ 3CDJA 2IOQA 4OO1F 5DNLA 1XNRI 2BM0A 1HNWI 2UUCE 1WUUA 4OO1E 1XHKA 1S4EA 2UUAE 5A2QQ 3P76A 4LF8E 1N32I 1ZM9A 2BV3A 2CZ9A 2Z5CB 5C0XD 5LMNE 5L3JA 1Z0GA 3PS3A 1ZM4A 3D4JA 2VF3A 4IS9A 4JI8E 4IFDD 4AIMA 4DR6E 1KKHA 2C37A 2BA0G 4DV6I 2HKJA 5DROA 4NXMI 1XMOI 4DPWA 4X64E 4LF5E 5C0XB 4K0KI 3J80Q 4B3TE 4XTJA 4DR5E 2BA0D 2UXBI 2J65A 4X65E 3JAMC 4U3BA 2ZM6I 4LFAI 3Q6NA 1Y4SA 1Z0BA 4FN5A 3T1YI 2F4VE 5BR8E 4IFDB 4OX9E 2WP8A 3LNUA 2VESA 2VQEE 4AQYE 1HR0I 1Z5CA 1ZM3A 1H72C 3QT8A 3LPSA 4LCFA 2DEIA 1FNMA 3K1JA 4B3SI 2PNLA 2IERA 4JI7I 4JYAE 3NZKA 1FWLA 4B3RI 1RREA 1UDNA 2Z5BA 1IBLI 4R1FA 4EMDA 4DR3E 4MYUA 1YH8A 4DR2I 1B63A 2E5LI 4LF4E 1FJGI 2C37B 4HY1A 5EL9A 4LFCE 2UU9I 4GKKE 4DU8A 4PU9A 2UXDI 1FKAE 3ZZTA 1ELOA 1KVKA 2PO1B 3WU6A 4JI3E 4KQVA 1FWKA 2V34A 4LF6I 3GLLA 4DUZI 1HK7A 4OO1A 2V2VA 4N3OA 2HFUA 2IESA 3PRYA 4DV4I 3T1HI 4JI6I 1Z5BA 4MYTA 3ZZ0A 3CWVA 3V5RA 4JI5I 1KIJA 4DV1E 4HYMA 5GMDA 3WU3A 3ZKBA 4X66E 4DV2E 4FW6A 4JI4I 3PS1A 3J7AG 4DPXA 2PO2A 1OYSA 5A2QC 1N0VC 2NN6F 4DV5E 4FWGA 3J81C 1IBKE 5IT9Q 2NN6E 4GQUA 4NXNE 1MX0A 3ZZUA 5DRRA 4JI2E 2LJPA 3HULA 4DPTA 5DRPA 1Z0VA 1Z0WA 1E3PA 2O1VA 1EA6A 2UUCI 4HXZA 1KTVA 1ZXNA 2HK3A 2UUAI 1DARA 4LF8I 3PYFA 2OI2A 5LMNI 1I94E 3KRNA 4RPFA
chains in the Genus database with same CATH topology
5K36C 2WNRA 5JEAA 4IFDD 3DD6A 2C38A 4AIMA 2JEAB 4OO1D 2PO0B 2C37A 2BA0G 1UDQA 4AIDA 5C0XE 2NN6B 5C0XB 3H1CA 2PO2B 2BA0D 3B4TA 2JEBA 3CDIA 4IFDB 1UDOA 2WP8A 4OO1B 1R6LA 2PNZA 4BA2A 2C39B 5K36A 4BA1A 2BA1G 2JE6B 5JEAF 5K36F 4AM3A 1UDSA 5JEAE 2BA1D 2WNRB 1UDNA 3HKMA 2JEAA 2C37B 2PO0A 2NN6C 5C0XC 5JEAD 3L7ZA 5K36D 2NN6A 2PO1B 4IFDC 2JEBB 4OO1C 3GLLA 2BR2B 4OO1A 5K36E 3M7NG 5JEAB 4BA2B 5K36B 4BA1B 2C38B 2JE6A 3M7ND 3M85G 1OYPA 4NBQA 3GMEA 5C0XA 1OYRA 3M85D 2PO2A 1OYSA 2NN6F 5C0XF 3U1KA 3GCMA 4IFDA 2NN6E 1R6MA 2WP8B 3L7ZB 4IFDF 3CDJA 4OO1F 2PNZB 4IFDE 1E3PA 2PO1A 2C39A 1E3HA 4OO1E 2BR2A 2NN6D 5C0XD 3KRNA 5JEAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 C;  2WNR A;  5JEA A;  4IFD D;  3DD6 A;  2C38 A;  4AIM A;  2JEA B;  4OO1 D;  2PO0 B;  2C37 A;  2BA0 G;  1UDQ A;  4AID A;  5C0X E;  2NN6 B;  5C0X B;  3H1C A;  2PO2 B;  2BA0 D;  3B4T A;  2JEB A;  3CDI A;  4IFD B;  1UDO A;  2WP8 A;  4OO1 B;  1R6L A;  2PNZ A;  4BA2 A;  2C39 B;  5K36 A;  4BA1 A;  2BA1 G;  2JE6 B;  5JEA F;  5K36 F;  4AM3 A;  1UDS A;  5JEA E;  2BA1 D;  2WNR B;  1UDN A;  3HKM A;  2JEA A;  2C37 B;  2PO0 A;  2NN6 C;  5C0X C;  5JEA D;  3L7Z A;  5K36 D;  2NN6 A;  2PO1 B;  4IFD C;  2JEB B;  4OO1 C;  3GLL A;  2BR2 B;  4OO1 A;  5K36 E;  3M7N G;  5JEA B;  4BA2 B;  5K36 B;  4BA1 B;  2C38 B;  2JE6 A;  3M7N D;  3M85 G;  1OYP A;  4NBQ A;  3GME A;  5C0X A;  1OYR A;  3M85 D;  2PO2 A;  1OYS A;  2NN6 F;  5C0X F;  3U1K A;  3GCM A;  4IFD A;  2NN6 E;  1R6M A;  2WP8 B;  3L7Z B;  4IFD F;  3CDJ A;  4OO1 F;  2PNZ B;  4IFD E;  1E3P A;  2PO1 A;  2C39 A;  1E3H A;  4OO1 E;  2BR2 A;  2NN6 D;  5C0X D;  3KRN A;  5JEA C; 
#chains in the Genus database with same CATH topology
 4WUC A;  4LCG A;  2WNR A;  4JI8 I;  4DR6 I;  2C38 A;  4Z7Y A;  1FI4 A;  4MU3 A;  2F1D A;  2PO0 B;  4DR7 E;  4X64 I;  1Z59 A;  4LF5 I;  5ELW A;  5GME A;  4DV7 E;  4B3T I;  4DR5 I;  2PO2 B;  2R3V A;  4X65 I;  1MU5 A;  3QT5 A;  2F4V I;  5BR8 I;  1D6T A;  4OX9 I;  4AQY I;  2VQE I;  4JI0 E;  4QNJ A;  4OZE A;  3B82 A;  2A2D A;  2HK2 A;  2Z5E A;  2PNZ A;  4JI1 E;  4BA2 A;  2AE8 A;  4BA1 A;  1N36 E;  5JEA F;  5K36 F;  4AM3 A;  4JYA I;  1UDS A;  3WU4 A;  5JEA E;  2WNR B;  4P7A A;  4LOM A;  1S16 A;  3HKM A;  4DR3 I;  1HNZ E;  4LF4 I;  2JEA A;  5EKW A;  2CVE A;  1XNQ E;  4LFC I;  3UHM A;  4GKK I;  4DR1 E;  1VIS A;  4ED4 A;  4ZVI A;  2NN6 A;  4IZJ A;  4LFB E;  1H73 A;  4JI3 I;  2VQF E;  4OO1 C;  4LCH A;  3P3E A;  1NHH A;  2E1R A;  1N34 E;  3M7N G;  4BA2 B;  4DUY E;  4BA1 B;  4DV1 I;  1H74 A;  1Z0T A;  4X66 I;  2JE6 A;  1VI7 A;  1J5E E;  3M7N D;  4IZJ D;  3M85 G;  4DV2 I;  4HAC A;  2HHH E;  1ZM2 A;  3ZM7 A;  1QZR A;  3PS2 A;  3M85 D;  2V2Z A;  4DV5 I;  5C0X F;  1IBK I;  3P06 A;  1Y5Y A;  2WP8 B;  4NXN I;  3ZKD A;  4YHH E;  1Y6Z A;  4IFD F;  4IZJ B;  4FWH A;  4JI2 I;  1HNX E;  3OTO E;  3LTO A;  2CG9 A;  4IFD E;  2V8P A;  2EFG A;  2BR2 A;  5FLX C;  1I94 I;  1B62 A;  1Y4U A;  2Z5B B;  4MQY A;  4P52 A;  5JEA A;  4JG4 A;  3DD6 A;  4FW4 A;  5FWK A;  4DV3 E;  2Q2E B;  2NPF A;  4DR7 I;  4OO1 D;  2CGE A;  3JAM Q;  1PVG A;  4HAC B;  4DR4 E;  1UDQ A;  4AID A;  1RHY A;  4DV7 I;  3Q6M A;  3HJC A;  4URL A;  3QT6 A;  3WU5 A;  2PNM A;  4LF9 E;  2BM1 A;  1UDO A;  4JI0 I;  4OO1 B;  3J80 C;  5IWA E;  1EI1 A;  2UUB E;  1Y60 A;  2V2Q A;  4DPY A;  4X62 E;  4JI1 I;  3B78 A;  1N36 I;  4OKG A;  2XEX A;  4WUD A;  4USK A;  4DV0 E;  1HNZ I;  1XXE A;  2ZBK B;  3B8H A;  3Q1Q A;  1XNQ I;  2NN6 C;  4PRX A;  4DR1 I;  2O3Z A;  1IBM E;  1U2R A;  4LFB I;  5LMU E;  2VQF I;  2O1U A;  4KHP E;  2J7K A;  4YY3 E;  1A6F A;  4DXL A;  1PIE A;  3PYD A;  4UT4 A;  4JV5 E;  1N34 I;  3F0N A;  5K36 E;  2JT2 A;  2DEJ A;  4DUY I;  2C38 B;  1NHJ A;  4WUB A;  3QT7 A;  1Z5A A;  1N33 E;  4MU1 A;  1J5E I;  2HHH I;  3PYE A;  3J81 Q;  1XMQ E;  3GME A;  4GKJ E;  2O1T A;  4LF7 E;  2A2C A;  3V2U C;  1NHI A;  4UTG A;  5LL6 R;  3U1K A;  2UXC E;  4DPU A;  3K17 A;  1R6M A;  4J3D A;  4YHH I;  1HNX I;  4B3M E;  2WW4 A;  3OTO I;  2HFS A;  2X7I A;  2PNZ B;  1XNR E;  2PO1 A;  1HNW E;  1K47 A;  5IT9 C;  2C39 A;  1E3H A;  4ISA A;  3P3G A;  2NN6 D;  1Z0C A;  1N32 E;  1H7U A;  4DU7 A;  5DRQ A;  4FWD A;  5JEA C;  5K36 C;  4MDT A;  4DV3 I;  2JEA B;  4I3H A;  4DR4 I;  2IOP A;  4DV6 E;  4MU4 A;  5C0X E;  4NXM E;  1RR9 A;  1XMO E;  2NN6 B;  3H1C A;  3P3C A;  3J7A M;  4K0K E;  2O1W A;  2GO3 A;  2UXB E;  3B4T A;  4M1K A;  3H4L A;  4U3D A;  4LF9 I;  2ZM6 E;  4LFA E;  2HKE A;  2JEB A;  3CDI A;  3T1Y E;  4PRV A;  4Z7C A;  1HR0 E;  4FW7 A;  5IWA I;  1Z0E A;  2UUB I;  1R6L A;  4X62 I;  1USU A;  4IZK A;  2C39 B;  5K36 A;  1OJ4 A;  2BA1 G;  1BKN A;  2JE6 B;  2ZIT A;  4B3S E;  2R42 A;  4JI7 E;  3U1Y A;  2AJ4 A;  2BA1 D;  4DV0 I;  1N0U A;  2GO4 A;  2X36 A;  4B3R E;  1USV A;  2GQ0 A;  1IBL E;  2GS8 A;  4DR2 E;  2E5L E;  1FJG E;  2PO0 A;  1H7S A;  1UEK A;  5C0X C;  5JEA D;  3L7Z A;  5K36 D;  2UU9 E;  3PYG A;  2UXD E;  1IBM I;  5LMU I;  4IFD C;  2JEB B;  5DNX A;  4KHP I;  2BR2 B;  4LF6 E;  4DUZ E;  1P42 A;  4YY3 I;  2Z5C A;  4JV5 I;  4DV4 E;  3T1H E;  4IZK B;  3M6A A;  4JI6 E;  4USM A;  1MG7 A;  5JEA B;  5K36 B;  4JI5 E;  1N33 I;  3GON A;  1XMQ I;  1OYP A;  3K85 A;  4NBQ A;  4GKJ I;  1ZXM A;  4MU0 A;  4JI4 E;  4LF7 I;  4FW3 A;  1PKP A;  4FW5 A;  5C0X A;  1OYR A;  2UXC I;  1NZ0 A;  4FW9 A;  1YHC A;  4QNK A;  3GCM A;  4IFD A;  3L7Z B;  4LPF A;  4B3M I;  5FLX Q;  3CDJ A;  2IOQ A;  4OO1 F;  5DNL A;  1XNR I;  2BM0 A;  1HNW I;  2UUC E;  1WUU A;  4OO1 E;  1XHK A;  1S4E A;  2UUA E;  5A2Q Q;  3P76 A;  4LF8 E;  1N32 I;  1ZM9 A;  2BV3 A;  2CZ9 A;  2Z5C B;  5C0X D;  5LMN E;  5L3J A;  1Z0G A;  3PS3 A;  1ZM4 A;  3D4J A;  2VF3 A;  4IS9 A;  4JI8 E;  4IFD D;  4AIM A;  4DR6 E;  1KKH A;  2C37 A;  2BA0 G;  4DV6 I;  2HKJ A;  5DRO A;  4NXM I;  1XMO I;  4DPW A;  4X64 E;  4LF5 E;  5C0X B;  4K0K I;  3J80 Q;  4B3T E;  4XTJ A;  4DR5 E;  2BA0 D;  2UXB I;  2J65 A;  4X65 E;  3JAM C;  4U3B A;  2ZM6 I;  4LFA I;  3Q6N A;  1Y4S A;  1Z0B A;  4FN5 A;  3T1Y I;  2F4V E;  5BR8 E;  4IFD B;  4OX9 E;  2WP8 A;  3LNU A;  2VES A;  2VQE E;  4AQY E;  1HR0 I;  1Z5C A;  1ZM3 A;  1H72 C;  3QT8 A;  3LPS A;  4LCF A;  2DEI A;  1FNM A;  3K1J A;  4B3S I;  2PNL A;  2IER A;  4JI7 I;  4JYA E;  3NZK A;  1FWL A;  4B3R I;  1RRE A;  1UDN A;  2Z5B A;  1IBL I;  4R1F A;  4EMD A;  4DR3 E;  4MYU A;  1YH8 A;  4DR2 I;  1B63 A;  2E5L I;  4LF4 E;  1FJG I;  2C37 B;  4HY1 A;  5EL9 A;  4LFC E;  2UU9 I;  4GKK E;  4DU8 A;  4PU9 A;  2UXD I;  1FKA E;  3ZZT A;  1ELO A;  1KVK A;  2PO1 B;  3WU6 A;  4JI3 E;  4KQV A;  1FWK A;  2V34 A;  4LF6 I;  3GLL A;  4DUZ I;  1HK7 A;  4OO1 A;  2V2V A;  4N3O A;  2HFU A;  2IES A;  3PRY A;  4DV4 I;  3T1H I;  4JI6 I;  1Z5B A;  4MYT A;  3ZZ0 A;  3CWV A;  3V5R A;  4JI5 I;  1KIJ A;  4DV1 E;  4HYM A;  5GMD A;  3WU3 A;  3ZKB A;  4X66 E;  4DV2 E;  4FW6 A;  4JI4 I;  3PS1 A;  3J7A G;  4DPX A;  2PO2 A;  1OYS A;  5A2Q C;  1N0V C;  2NN6 F;  4DV5 E;  4FWG A;  3J81 C;  1IBK E;  5IT9 Q;  2NN6 E;  4GQU A;  4NXN E;  1MX0 A;  3ZZU A;  5DRR A;  4JI2 E;  2LJP A;  3HUL A;  4DPT A;  5DRP A;  1Z0V A;  1Z0W A;  1E3P A;  2O1V A;  1EA6 A;  2UUC I;  4HXZ A;  1KTV A;  1ZXN A;  2HK3 A;  2UUA I;  1DAR A;  4LF8 I;  3PYF A;  2OI2 A;  5LMN I;  1I94 E;  3KRN A;  4RPF A; 
#chains in the Genus database with same CATH homology
 5K36 C;  2WNR A;  5JEA A;  4IFD D;  3DD6 A;  2C38 A;  4AIM A;  2JEA B;  4OO1 D;  2PO0 B;  2C37 A;  2BA0 G;  1UDQ A;  4AID A;  5C0X E;  2NN6 B;  5C0X B;  3H1C A;  2PO2 B;  2BA0 D;  3B4T A;  2JEB A;  3CDI A;  4IFD B;  1UDO A;  2WP8 A;  4OO1 B;  1R6L A;  2PNZ A;  4BA2 A;  2C39 B;  5K36 A;  4BA1 A;  2BA1 G;  2JE6 B;  5JEA F;  5K36 F;  4AM3 A;  1UDS A;  5JEA E;  2BA1 D;  2WNR B;  1UDN A;  3HKM A;  2JEA A;  2C37 B;  2PO0 A;  2NN6 C;  5C0X C;  5JEA D;  3L7Z A;  5K36 D;  2NN6 A;  2PO1 B;  4IFD C;  2JEB B;  4OO1 C;  3GLL A;  2BR2 B;  4OO1 A;  5K36 E;  3M7N G;  5JEA B;  4BA2 B;  5K36 B;  4BA1 B;  2C38 B;  2JE6 A;  3M7N D;  3M85 G;  1OYP A;  4NBQ A;  3GME A;  5C0X A;  1OYR A;  3M85 D;  2PO2 A;  1OYS A;  2NN6 F;  5C0X F;  3U1K A;  3GCM A;  4IFD A;  2NN6 E;  1R6M A;  2WP8 B;  3L7Z B;  4IFD F;  3CDJ A;  4OO1 F;  2PNZ B;  4IFD E;  1E3P A;  2PO1 A;  2C39 A;  1E3H A;  4OO1 E;  2BR2 A;  2NN6 D;  5C0X D;  3KRN A;  5JEA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...