3M85G

Archaeoglobus fulgidus exosome y70a with rna bound to the active site
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
258
structure length
258
Chain Sequence
MPEDILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPAPDTPDRGVIIVNAELVPLASPTFEPGPPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
total genus 69
structure length 258
sequence length 258
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3m85G01
2BA0D 5K36F 5K36A 2PNZB 4BA1B 5C0XB 5K36E 4OO1B 3GCMA 4IFDD 2NN6B 2JEAA 3M85G 2BA0G 1UDQA 2C37B 4AM3A 4AIMA 5JEAE 2C39A 4OO1C 3CDJA 1UDOA 3L7ZA 2NN6C 1E3HA 2PO1B 1UDSA 2PO0B 4IFDF 3GMEA 4BA2A 3B4TA 5K36B 2PO2A 5JEAF 4OO1D 4NBQA 2C38A 2NN6D 2WNRA 5JEAA 4IFDE 2C38B 2WNRB 2JEAB 5C0XC 1R6LA 2JEBA 1OYPA 2C39B 2JE6A 4OO1F 3KRNA 4AIDA 2JEBB 3L7ZB 4IFDA 5K36D 5C0XD 3HKMA 3M7ND 4BA2B 4IFDB 4OO1E 2WP8A 2NN6E 2PO2B 1OYSA 5JEAB 5K36C 3U1KA 2PNZA 3GLLA 3M7NG 2BA1G 5C0XF 4BA1A 1E3PA 5C0XA 5JEAC 2NN6F 1OYRA 4OO1A 1R6MA 2JE6B 2NN6A 5C0XE 3DD6A 2BA1D 3H1CA 1UDNA 2C37A 2BR2A 3CDIA 5JEAD 2BR2B 2WP8B 2PO1A 2PO0A 4IFDC 3M85D
chains in the Genus database with same CATH superfamily
2BA0D 5FLXQ 1Z59A 4LF6E 3OTOI 3WU6A 5C0XB 4DPWA 5K36E 4OO1B 4B3RE 1XHKA 2JEAA 3M85G 1HK7A 1Z0TA 3UHMA 4IZJB 3J7AM 1OJ4A 4DU8A 1IBKE 2C37B 1FNMA 4X65E 4IZKB 4HYMA 1Y4UA 1H72C 2UXBI 4DUZE 2PO1B 1QZRA 4JI8E 4LFBI 2Z5CA 3V5RA 4BA2A 5LMNE 5K36B 2HFSA 4DPXA 4JI4E 1N32E 2V34A 4NBQA 4DR1I 2IOQA 2X7IA 3P3EA 4DR6E 1HR0I 3M6AA 4HY1A 4URLA 2J7KA 4JI2E 4DV5I 1Z0BA 4LFCI 1R6LA 3QT6A 3ZKBA 4Z7YA 1KTVA 1OYPA 4LPFA 2C39B 4JI6I 3KRNA 4AIDA 4DV2I 1Y6ZA 5IT9Q 4X64E 4GKKE 1HNZI 4UT4A 4JV5I 4DV7I 1XMQI 5DRPA 2UU9E 2NN6E 1XMQE 2PO2B 5LMUE 1NHJA 1ZXMA 4MU1A 4NXNI 4JYAI 4JG4A 4DR3E 4OX9E 2VQFE 1VI7A 1NZ0A 1USVA 1PIEA 4BA1A 1E3PA 4DPTA 3ZZUA 4B3ME 5JEAC 1USUA 1S16A 2NN6F 4U3BA 2CGEA 4DV6I 4DR2E 4USKA 4JI0E 2DEJA 2VF3A 2NN6A 3PYDA 1N0VC 4LF8I 2BA1D 1UDNA 1ZM9A 3H1CA 2IOPA 2BR2A 4X62I 2CG9A 1N36E 1H7SA 3Q6MA 5JEAD 2BR2B 1Y5YA 2A2CA 1J5EE 1Y4SA 3H4LA 3LTOA 1H74A 4LOMA 1HNWI 4IFDC 3M85D 4LF4I 1DARA 2GS8A 4JI3I 1Z0WA 2R3VA 2PNZB 4PRXA 4U3DA 5DROA 4MYUA 1XNRI 2HK2A 2E5LI 4RPFA 1FJGI 3ZZTA 5IWAE 4LF5I 2UUBE 2ZITA 4MQYA 2XEXA 4YY3I 2O1WA 4IFDD 4LFAI 4LCGA 1IBMI 4I3HA 4B3TI 5GMDA 2OI2A 4AM3A 4AIMA 4DR5I 2X36A 4DR7I 4OO1C 5IT9C 4DV4I 3L7ZA 4FW9A 4FW4A 1E3HA 4DV4E 4EMDA 2V8PA 4IFDF 3GMEA 3B4TA 2V2VA 3OTOE 3GONA 4OO1D 1H73A 4MDTA 1Z5BA 3PS1A 4IZJD 1S4EA 2Z5BA 1XXEA 4UTGA 2JEAB 3K17A 3JAMC 1N34I 2LJPA 4DPUA 1XNQI 2UXBE 2JE6A 4OO1F 3T1YI 4FWHA 4LFBE 1ELOA 4DU7A 3PS3A 4QNJA 2O1TA 3J7AG 2Z5CB 3HKMA 5K36D 1IBLI 4BA2B 3WU5A 2J65A 4LCFA 2WP8A 4DR1E 2IESA 2V2QA 5LL6R 1A6FA 1OYSA 3QT8A 3PYFA 5DRRA 1HR0E 4B3SI 4DV0I 1U2RA 3PYEA 3ZZ0A 3P3GA 4FWDA 2HHHI 4DV5E 2O3ZA 4OZEA 4LFCE 1Z5CA 3M7NG 4JI1I 4X66I 1ZXNA 1ZM2A 1MX0A 1VISA 4DV1I 3Q1QA 3V2UC 2CZ9A 4JI6E 4FW7A 1Y60A 4DV2E 5EL9A 1HNXI 4IS9A 1N33I 1EI1A 1HNZE 4JV5E 2UXDI 4QNKA 4DV7E 3CDIA 4K0KI 2BM1A 2HK3A 4NXNE 2PO0A 2CVEA 4LF7I 4JYAE 4USMA 2HKEA 4HACA 2ZM6I 3JAMQ 4BA1B 1FKAE 1Z0EA 4Z7CA 4DV6E 2F1DA 2NN6B 1ZM3A 2UUCI 1UDQA 4LF8E 5GMEA 4DV3I 4X62E 5JEAE 4DR4I 5DRQA 4J3DA 4KHPI 3CDJA 1RREA 1FI4A 4FW3A 1B63A 1HNWE 4LF4E 5A2QC 5EKWA 2GO3A 4JI7I 4JI3E 3P76A 3B8HA 1XNRE 2PNLA 4HXZA 3U1YA 2E5LE 5JEAF 3K1JA 1FJGE 4LF5E 5JEAA 2WNRA 4IFDE 2HFUA 3P3CA 4YY3E 1P42A 3HULA 4LFAE 2WNRB 1IBME 2JT2A 4B3TE 2VQEI 4AQYI 4ISAA 5C0XC 2A2DA 4M1KA 3T1HI 1H7UA 4DR5E 4MU4A 4JI5I 4LF9I 5DNXA 4GQUA 4DR7E 3J81C 4YHHI 3LNUA 1XMOI 3L7ZB 1KKHA 4GKJI 1K47A 2NPFA 5BR8I 4IFDA 4WUDA 2UUAI 5C0XD 3NZKA 4ZVIA 3M7ND 1PVGA 4IFDB 4OO1E 3PRYA 4MYTA 4XTJA 1BKNA 1B62A 2Z5BB 3PYGA 5K36C 4DUYI 1Z0CA 1N34E 2BA1G 3D4JA 5C0XF 4LF6I 1XNQE 2F4VI 5C0XA 1RHYA 2AE8A 2F4VE 4DXLA 5ELWA 3T1YE 1OYRA 4OO1A 2IERA 2JE6B 3K85A 4B3RI 2R42A 1N0UA 4IZJA 3DD6A 5DNLA 4ED4A 2E1RA 1D6TA 2C37A 5A2QQ 1IBLE 1IBKI 4IZKA 4X65I 4FWGA 2WP8B 1KVKA 4B3SE 2PO1A 4P7AA 4DV0E 4DUZI 4JI8I 2UXCI 2HHHE 4OKGA 2UXCE 5K36F 4JI1E 4X66E 5K36A 5LMNI 4DV1E 3WU4A 4JI4I 1N32I 3J81Q 4DR6I 3GCMA 1HNXE 1FWKA 3J80Q 1N33E 2BA0G 2Z5EA 4JI2I 1YH8A 2UXDE 3B78A 2V2ZA 4K0KE 3HJCA 2C39A 1UDOA 2NN6C 4FW5A 1UDSA 4LF7E 1I94I 2PO0B 4MU0A 4X64I 4GKKI 1I94E 2WW4A 1Z0VA 3PS2A 2ZM6E 3LPSA 4HACB 2PNMA 3B82A 2O1VA 3CWVA 2PO2A 2BV3A 2UU9I 1WUUA 5LMUI 2GQ0A 2C38A 2NN6D 1RR9A 2BM0A 2AJ4A 2DEIA 2C38B 3F0NA 3P06A 2UUCE 4DR3I 5FLXC 4DV3E 5FWKA 1PKPA 4OX9I 2VQFI 1FWLA 4DR4E 1MG7A 2JEBA 4KHPE 4PU9A 4B3MI 3QT5A 4PRVA 1YHCA 2HKJA 2JEBB 2VESA 4DR2I 4JI0I 3QT7A 4JI7E 2Q2EB 1N36I 4MU3A 4P52A 1EA6A 1KIJA 1J5EI 2O1UA 3WU3A 5JEAB 4FN5A 4R1FA 4NXMI 4WUBA 4DPYA 4NXME 2ZBKB 2GO4A 4FW6A 3U1KA 2VQEE 4AQYE 2PNZA 3T1HE 3GLLA 3ZM7A 4JI5E 4LF9E 1ZM4A 4WUCA 2EFGA 4YHHE 4LCHA 5IWAI 3J80C 2UUBI 1XMOE 1R6MA 4GKJE 5BR8E 3ZKDA 5C0XE 2UUAE 1UEKA 4KQVA 1MU5A 3Q6NA 1Z0GA 1NHHA 1NHIA 4N3OA 5L3JA 4DUYE 1Z5AA
chains in the Genus database with same CATH topology
2BA0D 5K36F 5K36A 2PNZB 4BA1B 5C0XB 5K36E 4OO1B 3GCMA 4IFDD 2NN6B 2JEAA 3M85G 2BA0G 1UDQA 2C37B 4AM3A 4AIMA 5JEAE 2C39A 4OO1C 3CDJA 1UDOA 3L7ZA 2NN6C 1E3HA 2PO1B 1UDSA 2PO0B 4IFDF 3GMEA 4BA2A 3B4TA 5K36B 2PO2A 5JEAF 4OO1D 4NBQA 2C38A 2NN6D 2WNRA 5JEAA 4IFDE 2C38B 2WNRB 2JEAB 5C0XC 1R6LA 2JEBA 1OYPA 2C39B 2JE6A 4OO1F 3KRNA 4AIDA 2JEBB 3L7ZB 4IFDA 5K36D 5C0XD 3HKMA 3M7ND 4BA2B 4IFDB 4OO1E 2WP8A 2NN6E 2PO2B 1OYSA 5JEAB 5K36C 3U1KA 2PNZA 3GLLA 3M7NG 2BA1G 5C0XF 4BA1A 1E3PA 5C0XA 5JEAC 2NN6F 1OYRA 4OO1A 1R6MA 2JE6B 2NN6A 5C0XE 3DD6A 2BA1D 3H1CA 1UDNA 2C37A 2BR2A 3CDIA 5JEAD 2BR2B 2WP8B 2PO1A 2PO0A 4IFDC 3M85D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 D;  5K36 F;  5K36 A;  2PNZ B;  4BA1 B;  5C0X B;  5K36 E;  4OO1 B;  3GCM A;  4IFD D;  2NN6 B;  2JEA A;  3M85 G;  2BA0 G;  1UDQ A;  2C37 B;  4AM3 A;  4AIM A;  5JEA E;  2C39 A;  4OO1 C;  3CDJ A;  1UDO A;  3L7Z A;  2NN6 C;  1E3H A;  2PO1 B;  1UDS A;  2PO0 B;  4IFD F;  3GME A;  4BA2 A;  3B4T A;  5K36 B;  2PO2 A;  5JEA F;  4OO1 D;  4NBQ A;  2C38 A;  2NN6 D;  2WNR A;  5JEA A;  4IFD E;  2C38 B;  2WNR B;  2JEA B;  5C0X C;  1R6L A;  2JEB A;  1OYP A;  2C39 B;  2JE6 A;  4OO1 F;  3KRN A;  4AID A;  2JEB B;  3L7Z B;  4IFD A;  5K36 D;  5C0X D;  3HKM A;  3M7N D;  4BA2 B;  4IFD B;  4OO1 E;  2WP8 A;  2NN6 E;  2PO2 B;  1OYS A;  5JEA B;  5K36 C;  3U1K A;  2PNZ A;  3GLL A;  3M7N G;  2BA1 G;  5C0X F;  4BA1 A;  1E3P A;  5C0X A;  5JEA C;  2NN6 F;  1OYR A;  4OO1 A;  1R6M A;  2JE6 B;  2NN6 A;  5C0X E;  3DD6 A;  2BA1 D;  3H1C A;  1UDN A;  2C37 A;  2BR2 A;  3CDI A;  5JEA D;  2BR2 B;  2WP8 B;  2PO1 A;  2PO0 A;  4IFD C;  3M85 D; 
#chains in the Genus database with same CATH topology
 2BA0 D;  5FLX Q;  1Z59 A;  4LF6 E;  3OTO I;  3WU6 A;  5C0X B;  4DPW A;  5K36 E;  4OO1 B;  4B3R E;  1XHK A;  2JEA A;  3M85 G;  1HK7 A;  1Z0T A;  3UHM A;  4IZJ B;  3J7A M;  1OJ4 A;  4DU8 A;  1IBK E;  2C37 B;  1FNM A;  4X65 E;  4IZK B;  4HYM A;  1Y4U A;  1H72 C;  2UXB I;  4DUZ E;  2PO1 B;  1QZR A;  4JI8 E;  4LFB I;  2Z5C A;  3V5R A;  4BA2 A;  5LMN E;  5K36 B;  2HFS A;  4DPX A;  4JI4 E;  1N32 E;  2V34 A;  4NBQ A;  4DR1 I;  2IOQ A;  2X7I A;  3P3E A;  4DR6 E;  1HR0 I;  3M6A A;  4HY1 A;  4URL A;  2J7K A;  4JI2 E;  4DV5 I;  1Z0B A;  4LFC I;  1R6L A;  3QT6 A;  3ZKB A;  4Z7Y A;  1KTV A;  1OYP A;  4LPF A;  2C39 B;  4JI6 I;  3KRN A;  4AID A;  4DV2 I;  1Y6Z A;  5IT9 Q;  4X64 E;  4GKK E;  1HNZ I;  4UT4 A;  4JV5 I;  4DV7 I;  1XMQ I;  5DRP A;  2UU9 E;  2NN6 E;  1XMQ E;  2PO2 B;  5LMU E;  1NHJ A;  1ZXM A;  4MU1 A;  4NXN I;  4JYA I;  4JG4 A;  4DR3 E;  4OX9 E;  2VQF E;  1VI7 A;  1NZ0 A;  1USV A;  1PIE A;  4BA1 A;  1E3P A;  4DPT A;  3ZZU A;  4B3M E;  5JEA C;  1USU A;  1S16 A;  2NN6 F;  4U3B A;  2CGE A;  4DV6 I;  4DR2 E;  4USK A;  4JI0 E;  2DEJ A;  2VF3 A;  2NN6 A;  3PYD A;  1N0V C;  4LF8 I;  2BA1 D;  1UDN A;  1ZM9 A;  3H1C A;  2IOP A;  2BR2 A;  4X62 I;  2CG9 A;  1N36 E;  1H7S A;  3Q6M A;  5JEA D;  2BR2 B;  1Y5Y A;  2A2C A;  1J5E E;  1Y4S A;  3H4L A;  3LTO A;  1H74 A;  4LOM A;  1HNW I;  4IFD C;  3M85 D;  4LF4 I;  1DAR A;  2GS8 A;  4JI3 I;  1Z0W A;  2R3V A;  2PNZ B;  4PRX A;  4U3D A;  5DRO A;  4MYU A;  1XNR I;  2HK2 A;  2E5L I;  4RPF A;  1FJG I;  3ZZT A;  5IWA E;  4LF5 I;  2UUB E;  2ZIT A;  4MQY A;  2XEX A;  4YY3 I;  2O1W A;  4IFD D;  4LFA I;  4LCG A;  1IBM I;  4I3H A;  4B3T I;  5GMD A;  2OI2 A;  4AM3 A;  4AIM A;  4DR5 I;  2X36 A;  4DR7 I;  4OO1 C;  5IT9 C;  4DV4 I;  3L7Z A;  4FW9 A;  4FW4 A;  1E3H A;  4DV4 E;  4EMD A;  2V8P A;  4IFD F;  3GME A;  3B4T A;  2V2V A;  3OTO E;  3GON A;  4OO1 D;  1H73 A;  4MDT A;  1Z5B A;  3PS1 A;  4IZJ D;  1S4E A;  2Z5B A;  1XXE A;  4UTG A;  2JEA B;  3K17 A;  3JAM C;  1N34 I;  2LJP A;  4DPU A;  1XNQ I;  2UXB E;  2JE6 A;  4OO1 F;  3T1Y I;  4FWH A;  4LFB E;  1ELO A;  4DU7 A;  3PS3 A;  4QNJ A;  2O1T A;  3J7A G;  2Z5C B;  3HKM A;  5K36 D;  1IBL I;  4BA2 B;  3WU5 A;  2J65 A;  4LCF A;  2WP8 A;  4DR1 E;  2IES A;  2V2Q A;  5LL6 R;  1A6F A;  1OYS A;  3QT8 A;  3PYF A;  5DRR A;  1HR0 E;  4B3S I;  4DV0 I;  1U2R A;  3PYE A;  3ZZ0 A;  3P3G A;  4FWD A;  2HHH I;  4DV5 E;  2O3Z A;  4OZE A;  4LFC E;  1Z5C A;  3M7N G;  4JI1 I;  4X66 I;  1ZXN A;  1ZM2 A;  1MX0 A;  1VIS A;  4DV1 I;  3Q1Q A;  3V2U C;  2CZ9 A;  4JI6 E;  4FW7 A;  1Y60 A;  4DV2 E;  5EL9 A;  1HNX I;  4IS9 A;  1N33 I;  1EI1 A;  1HNZ E;  4JV5 E;  2UXD I;  4QNK A;  4DV7 E;  3CDI A;  4K0K I;  2BM1 A;  2HK3 A;  4NXN E;  2PO0 A;  2CVE A;  4LF7 I;  4JYA E;  4USM A;  2HKE A;  4HAC A;  2ZM6 I;  3JAM Q;  4BA1 B;  1FKA E;  1Z0E A;  4Z7C A;  4DV6 E;  2F1D A;  2NN6 B;  1ZM3 A;  2UUC I;  1UDQ A;  4LF8 E;  5GME A;  4DV3 I;  4X62 E;  5JEA E;  4DR4 I;  5DRQ A;  4J3D A;  4KHP I;  3CDJ A;  1RRE A;  1FI4 A;  4FW3 A;  1B63 A;  1HNW E;  4LF4 E;  5A2Q C;  5EKW A;  2GO3 A;  4JI7 I;  4JI3 E;  3P76 A;  3B8H A;  1XNR E;  2PNL A;  4HXZ A;  3U1Y A;  2E5L E;  5JEA F;  3K1J A;  1FJG E;  4LF5 E;  5JEA A;  2WNR A;  4IFD E;  2HFU A;  3P3C A;  4YY3 E;  1P42 A;  3HUL A;  4LFA E;  2WNR B;  1IBM E;  2JT2 A;  4B3T E;  2VQE I;  4AQY I;  4ISA A;  5C0X C;  2A2D A;  4M1K A;  3T1H I;  1H7U A;  4DR5 E;  4MU4 A;  4JI5 I;  4LF9 I;  5DNX A;  4GQU A;  4DR7 E;  3J81 C;  4YHH I;  3LNU A;  1XMO I;  3L7Z B;  1KKH A;  4GKJ I;  1K47 A;  2NPF A;  5BR8 I;  4IFD A;  4WUD A;  2UUA I;  5C0X D;  3NZK A;  4ZVI A;  3M7N D;  1PVG A;  4IFD B;  4OO1 E;  3PRY A;  4MYT A;  4XTJ A;  1BKN A;  1B62 A;  2Z5B B;  3PYG A;  5K36 C;  4DUY I;  1Z0C A;  1N34 E;  2BA1 G;  3D4J A;  5C0X F;  4LF6 I;  1XNQ E;  2F4V I;  5C0X A;  1RHY A;  2AE8 A;  2F4V E;  4DXL A;  5ELW A;  3T1Y E;  1OYR A;  4OO1 A;  2IER A;  2JE6 B;  3K85 A;  4B3R I;  2R42 A;  1N0U A;  4IZJ A;  3DD6 A;  5DNL A;  4ED4 A;  2E1R A;  1D6T A;  2C37 A;  5A2Q Q;  1IBL E;  1IBK I;  4IZK A;  4X65 I;  4FWG A;  2WP8 B;  1KVK A;  4B3S E;  2PO1 A;  4P7A A;  4DV0 E;  4DUZ I;  4JI8 I;  2UXC I;  2HHH E;  4OKG A;  2UXC E;  5K36 F;  4JI1 E;  4X66 E;  5K36 A;  5LMN I;  4DV1 E;  3WU4 A;  4JI4 I;  1N32 I;  3J81 Q;  4DR6 I;  3GCM A;  1HNX E;  1FWK A;  3J80 Q;  1N33 E;  2BA0 G;  2Z5E A;  4JI2 I;  1YH8 A;  2UXD E;  3B78 A;  2V2Z A;  4K0K E;  3HJC A;  2C39 A;  1UDO A;  2NN6 C;  4FW5 A;  1UDS A;  4LF7 E;  1I94 I;  2PO0 B;  4MU0 A;  4X64 I;  4GKK I;  1I94 E;  2WW4 A;  1Z0V A;  3PS2 A;  2ZM6 E;  3LPS A;  4HAC B;  2PNM A;  3B82 A;  2O1V A;  3CWV A;  2PO2 A;  2BV3 A;  2UU9 I;  1WUU A;  5LMU I;  2GQ0 A;  2C38 A;  2NN6 D;  1RR9 A;  2BM0 A;  2AJ4 A;  2DEI A;  2C38 B;  3F0N A;  3P06 A;  2UUC E;  4DR3 I;  5FLX C;  4DV3 E;  5FWK A;  1PKP A;  4OX9 I;  2VQF I;  1FWL A;  4DR4 E;  1MG7 A;  2JEB A;  4KHP E;  4PU9 A;  4B3M I;  3QT5 A;  4PRV A;  1YHC A;  2HKJ A;  2JEB B;  2VES A;  4DR2 I;  4JI0 I;  3QT7 A;  4JI7 E;  2Q2E B;  1N36 I;  4MU3 A;  4P52 A;  1EA6 A;  1KIJ A;  1J5E I;  2O1U A;  3WU3 A;  5JEA B;  4FN5 A;  4R1F A;  4NXM I;  4WUB A;  4DPY A;  4NXM E;  2ZBK B;  2GO4 A;  4FW6 A;  3U1K A;  2VQE E;  4AQY E;  2PNZ A;  3T1H E;  3GLL A;  3ZM7 A;  4JI5 E;  4LF9 E;  1ZM4 A;  4WUC A;  2EFG A;  4YHH E;  4LCH A;  5IWA I;  3J80 C;  2UUB I;  1XMO E;  1R6M A;  4GKJ E;  5BR8 E;  3ZKD A;  5C0X E;  2UUA E;  1UEK A;  4KQV A;  1MU5 A;  3Q6N A;  1Z0G A;  1NHH A;  1NHI A;  4N3O A;  5L3J A;  4DUY E;  1Z5A A; 
#chains in the Genus database with same CATH homology
 2BA0 D;  5K36 F;  5K36 A;  2PNZ B;  4BA1 B;  5C0X B;  5K36 E;  4OO1 B;  3GCM A;  4IFD D;  2NN6 B;  2JEA A;  3M85 G;  2BA0 G;  1UDQ A;  2C37 B;  4AM3 A;  4AIM A;  5JEA E;  2C39 A;  4OO1 C;  3CDJ A;  1UDO A;  3L7Z A;  2NN6 C;  1E3H A;  2PO1 B;  1UDS A;  2PO0 B;  4IFD F;  3GME A;  4BA2 A;  3B4T A;  5K36 B;  2PO2 A;  5JEA F;  4OO1 D;  4NBQ A;  2C38 A;  2NN6 D;  2WNR A;  5JEA A;  4IFD E;  2C38 B;  2WNR B;  2JEA B;  5C0X C;  1R6L A;  2JEB A;  1OYP A;  2C39 B;  2JE6 A;  4OO1 F;  3KRN A;  4AID A;  2JEB B;  3L7Z B;  4IFD A;  5K36 D;  5C0X D;  3HKM A;  3M7N D;  4BA2 B;  4IFD B;  4OO1 E;  2WP8 A;  2NN6 E;  2PO2 B;  1OYS A;  5JEA B;  5K36 C;  3U1K A;  2PNZ A;  3GLL A;  3M7N G;  2BA1 G;  5C0X F;  4BA1 A;  1E3P A;  5C0X A;  5JEA C;  2NN6 F;  1OYR A;  4OO1 A;  1R6M A;  2JE6 B;  2NN6 A;  5C0X E;  3DD6 A;  2BA1 D;  3H1C A;  1UDN A;  2C37 A;  2BR2 A;  3CDI A;  5JEA D;  2BR2 B;  2WP8 B;  2PO1 A;  2PO0 A;  4IFD C;  3M85 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...