3M85G

Archaeoglobus fulgidus exosome y70a with rna bound to the active site
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
258
structure length
258
Chain Sequence
MPEDILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPAPDTPDRGVIIVNAELVPLASPTFEPGPPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
molecule keywords Putative uncharacterized protein AF_0206
total genus 69
structure length 258
sequence length 258
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3m85G01
4IFDB 2JEBB 4BA1A 4AIMA 2BA1D 3KRNA 2BR2A 2PNZA 2JEAA 3HKMA 2NN6C 5C0XD 2C38A 5K36A 5K36D 3M85G 1UDSA 3CDJA 2WP8A 2BR2B 2C37A 5JEAC 4OO1D 1R6LA 5JEAA 5K36F 3GCMA 4IFDE 1UDQA 4OO1B 2C39A 4IFDC 1UDOA 3M7NG 5K36B 1UDNA 2WP8B 5JEAE 3M85D 2PO0A 1OYRA 2NN6F 2NN6A 5C0XA 4AIDA 1E3PA 4BA1B 5C0XF 3M7ND 3GLLA 5K36C 3L7ZA 4AM3A 4BA2A 4OO1E 2JE6A 2C37B 3DD6A 2BA1G 4IFDA 2JEBA 2PO2B 5JEAD 3GMEA 4OO1C 4IFDF 4BA2B 2C39B 3CDIA 2NN6D 5C0XC 2PO2A 4NBQA 2NN6B 1OYSA 2PO1B 2BA0D 2BA0G 2C38B 3B4TA 5C0XB 5C0XE 5JEAB 2WNRB 5K36E 3L7ZB 1E3HA 2PO1A 3U1KA 4OO1F 4OO1A 1R6MA 2JE6B 5JEAF 3H1CA 2WNRA 4IFDD 2PNZB 2JEAB 1OYPA 2PO0B 2NN6E
chains in the Genus database with same CATH superfamily
4IFDB 1XNRE 2UUBE 1ZXMA 4DV7E 4B3TE 2BR2A 3JAMQ 4LFBE 2PNZA 4LF7E 1Z59A 1Z0GA 2Z5CA 4LF6E 1ZM3A 5K36D 2AJ4A 3ZM7A 4DV1I 3M85G 3CDJA 2BM1A 4DR5I 2BR2B 2C37A 2GO3A 4OZEA 3PYGA 4JV5E 4OX9E 5K36F 3WU3A 5BR8I 4IFDE 5EL9A 4OO1B 3HJCA 4YY3E 4JI2E 4NXNE 1UDOA 1UDNA 2WP8B 5JEAE 1IBLE 4JI5I 4LPFA 5LMNI 5L3JA 4USMA 5FLXC 1N34I 1ZXNA 2PNLA 2NN6F 2NN6A 1NHJA 1I94E 2UUAE 2DEJA 1FWLA 5IWAE 4DXLA 2HFUA 4FWDA 2AE8A 1J5EE 1XNQE 5IT9Q 4JYAE 2NPFA 2HHHI 2O1VA 4DPYA 1HNZI 2DEIA 3V5RA 1Z5CA 4MU1A 2JEBA 3T1YE 4BA2B 4PRVA 4MYUA 2C39B 4WUDA 4LFCE 5C0XC 4X65I 3P3GA 2IERA 4NBQA 1BKNA 4DU8A 4JI0I 4YHHE 2PO1B 2XEXA 5LMUE 1Y6ZA 4DV5I 5ELWA 1VISA 5DRRA 4DR4I 3B4TA 2UXDE 5C0XB 1QZRA 4HACB 5JEAB 4B3RE 4DR5E 1YH8A 2PO1A 3U1KA 4OX9I 4DV3E 1R6MA 4LF9I 4DUZI 2CVEA 2JE6B 1XMOI 4NXNI 4IFDD 3D4JA 2PNZB 5DNXA 1OYPA 4DR6E 4IZJB 2PO0B 2E5LE 1IBLI 1HNXI 2Q2EB 4DUYI 3ZKBA 1Z0CA 4DPUA 4B3ME 4GKJE 2BA1D 4FW3A 1XNRI 4M1KA 2GQ0A 1USUA 3QT5A 2JEAA 3J81C 4MYTA 4MU0A 1YHCA 1IBMI 1Y4SA 2WP8A 1N32I 2F4VE 4RPFA 5JEAC 4DPTA 4DV6I 2HHHE 4ED4A 1R6LA 4X64E 4JV5I 3GCMA 4X66I 4P7AA 4KQVA 1UDQA 2UUCE 5FLXQ 3T1YI 1IBKE 1KTVA 3LTOA 1MG7A 2GS8A 1OJ4A 4MU3A 1USVA 2WW4A 4JI5E 2VQEI 1RREA 4KHPI 1D6TA 4JG4A 4B3SI 1N34E 1HK7A 2BM0A 1H74A 3P06A 5C0XF 4BA1B 3GLLA 4MU4A 2VQFI 1Z5BA 1B63A 4DV4I 4IZJD 3Q1QA 5K36C 4LFBI 3L7ZA 4BA2A 4AM3A 4OO1E 1XMQE 3ZZ0A 2R42A 2ZBKB 4AQYE 4LOMA 4DV1E 4DUZE 3DD6A 2BA1G 1N0UA 2CZ9A 1FJGI 1HNZE 1Z0EA 3P3CA 4IFDA 2PO2B 1ZM2A 5JEAD 1KIJA 4IFDF 4U3BA 2X36A 5FWKA 5BR8E 2V34A 2NN6D 4N3OA 1S16A 2PO2A 2LJPA 4HYMA 4JI1I 3Q6NA 4DR3E 4I3HA 1UEKA 1KKHA 1Z5AA 3P76A 4IZKB 4LF8I 3NZKA 2F1DA 4DV0I 1HNWI 2WNRB 1N32E 4DV7I 4GKKI 1E3HA 5IWAI 2O1WA 3Q6MA 1FKAE 4LF7I 1J5EI 4UTGA 4OO1A 1XNQI 4IZKA 3PYFA 3JAMC 2WNRA 2UUCI 1U2RA 1ELOA 4GQUA 2JEAB 2Z5EA 1XMOE 4DR2I 4JI4I 3UHMA 3PYDA 1PIEA 3J81Q 3J7AG 2IOQA 3ZZUA 2R3VA 2UXBI 4AIMA 2V8PA 3H4LA 4LFAE 1XHKA 3PYEA 1HR0E 1NHIA 2VQFE 1XXEA 1EI1A 2NN6C 1FNMA 5C0XD 3K1JA 2C38A 4LF5E 3J80C 4LCGA 4UT4A 4P52A 4DU7A 2UU9I 4OO1D 4DV5E 4DR7I 2ZM6E 2VESA 1ZM9A 3LPSA 4USKA 4AQYI 1A6FA 2F4VI 4OKGA 5GMEA 4B3RI 2C39A 2JT2A 1FI4A 2V2ZA 4JI6I 1PKPA 4DV3I 5K36B 3M85D 2OI2A 4LF9E 1Y4UA 2UXCE 2Z5BB 2J65A 3WU5A 4K0KI 3M6AA 4FW5A 4LF4E 2HK3A 1HNXE 4DUYE 4NXMI 2VQEE 4DR3I 4JI1E 4AIDA 5C0XA 4JI3E 4KHPE 3QT8A 4IS9A 2PNMA 4LCFA 4URLA 1N33E 3M7ND 4DV2E 4B3MI 4GKJI 3T1HE 3V2UC 4X62E 2JE6A 2Z5CB 2C37B 4FW9A 5LMNE 3B8HA 1Z0BA 4PU9A 3K85A 5DRQA 4DR4E 2UXDI 5GMDA 2IESA 3GMEA 2HKJA 5IT9C 1PVGA 3J7AM 4B3TI 1Y60A 3GONA 3QT7A 4FW4A 3CDIA 3B82A 4JI7E 4HY1A 1H7SA 2O1TA 2NN6B 5A2QC 1N0VC 1NHHA 1EA6A 5C0XE 4LCHA 5K36E 4YY3I 3OTOI 4GKKE 4OO1F 4LFCI 3QT6A 1DARA 2A2CA 1Z0TA 5JEAF 3H1CA 1IBME 2CG9A 1K47A 4PRXA 4YHHI 1MU5A 2VF3A 2UUBI 1RHYA 1NZ0A 2NN6E 4JI8I 3PS3A 1I94I 1Z0VA 4X64I 4DR2E 4QNJA 2UUAI 2JEBB 4JI4E 4FWHA 1FJGE 4BA1A 2A2DA 4WUBA 2UXBE 3KRNA 4NXME 4JYAI 4JI3I 3LNUA 5A2QQ 1IBKI 4LF6I 4DPWA 4DR1E 3HKMA 2HFSA 1Y5YA 4LFAI 3ZZTA 4FN5A 2J7KA 5K36A 1UDSA 1H73A 4DPXA 4MQYA 1WUUA 1S4EA 3PS1A 2ZITA 4HACA 5JEAA 2UU9E 4JI2I 4Z7CA 3U1YA 4DV0E 1HNWE 4XTJA 1N36E 4IFDC 4QNKA 3M7NG 1XMQI 4X65E 1P42A 3ZKDA 4JI0E 5LMUI 3F0NA 4U3DA 2PO0A 4IZJA 1OYRA 2UXCI 3B78A 4DV6E 5LL6R 1E3PA 2EFGA 5DROA 4R1FA 4ISAA 2O3ZA 5EKWA 1N33I 4WUCA 3T1HI 1Z0WA 3K17A 2IOPA 2X7IA 1FWKA 4FW7A 2V2VA 4EMDA 4LF8E 1VI7A 2ZM6I 4OO1C 3HULA 2V2QA 3P3EA 4JI8E 3CWVA 4DV4E 4FWGA 4JI6E 3WU6A 1H7UA 2BV3A 2HK2A 1OYSA 5DNLA 4JI7I 2BA0D 2O1UA 4DR1I 4HXZA 4K0KE 2BA0G 2C38B 1ZM4A 4LF4I 4X66E 2GO4A 3J80Q 2HKEA 1H72C 3L7ZB 1RR9A 3PS2A 1KVKA 4J3DA 4DV2I 4ZVIA 1HR0I 4X62I 3OTOE 4Z7YA 4DR6I 3WU4A 2E5LI 1MX0A 1N36I 2E1RA 4MDTA 4FW6A 4LF5I 2CGEA 3PRYA 4DR7E 2Z5BA 4B3SE 1B62A 5DRPA
chains in the Genus database with same CATH topology
4IFDB 2JEBB 4BA1A 4AIMA 2BA1D 3KRNA 2BR2A 2PNZA 2JEAA 3HKMA 2NN6C 5C0XD 2C38A 5K36A 5K36D 3M85G 1UDSA 3CDJA 2WP8A 2BR2B 2C37A 5JEAC 4OO1D 1R6LA 5JEAA 5K36F 3GCMA 4IFDE 1UDQA 4OO1B 2C39A 4IFDC 1UDOA 3M7NG 5K36B 1UDNA 2WP8B 5JEAE 3M85D 2PO0A 1OYRA 2NN6F 2NN6A 5C0XA 4AIDA 1E3PA 4BA1B 5C0XF 3M7ND 3GLLA 5K36C 3L7ZA 4AM3A 4BA2A 4OO1E 2JE6A 2C37B 3DD6A 2BA1G 4IFDA 2JEBA 2PO2B 5JEAD 3GMEA 4OO1C 4IFDF 4BA2B 2C39B 3CDIA 2NN6D 5C0XC 2PO2A 4NBQA 2NN6B 1OYSA 2PO1B 2BA0D 2BA0G 2C38B 3B4TA 5C0XB 5C0XE 5JEAB 2WNRB 5K36E 3L7ZB 1E3HA 2PO1A 3U1KA 4OO1F 4OO1A 1R6MA 2JE6B 5JEAF 3H1CA 2WNRA 4IFDD 2PNZB 2JEAB 1OYPA 2PO0B 2NN6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD B;  2JEB B;  4BA1 A;  4AIM A;  2BA1 D;  3KRN A;  2BR2 A;  2PNZ A;  2JEA A;  3HKM A;  2NN6 C;  5C0X D;  2C38 A;  5K36 A;  5K36 D;  3M85 G;  1UDS A;  3CDJ A;  2WP8 A;  2BR2 B;  2C37 A;  5JEA C;  4OO1 D;  1R6L A;  5JEA A;  5K36 F;  3GCM A;  4IFD E;  1UDQ A;  4OO1 B;  2C39 A;  4IFD C;  1UDO A;  3M7N G;  5K36 B;  1UDN A;  2WP8 B;  5JEA E;  3M85 D;  2PO0 A;  1OYR A;  2NN6 F;  2NN6 A;  5C0X A;  4AID A;  1E3P A;  4BA1 B;  5C0X F;  3M7N D;  3GLL A;  5K36 C;  3L7Z A;  4AM3 A;  4BA2 A;  4OO1 E;  2JE6 A;  2C37 B;  3DD6 A;  2BA1 G;  4IFD A;  2JEB A;  2PO2 B;  5JEA D;  3GME A;  4OO1 C;  4IFD F;  4BA2 B;  2C39 B;  3CDI A;  2NN6 D;  5C0X C;  2PO2 A;  4NBQ A;  2NN6 B;  1OYS A;  2PO1 B;  2BA0 D;  2BA0 G;  2C38 B;  3B4T A;  5C0X B;  5C0X E;  5JEA B;  2WNR B;  5K36 E;  3L7Z B;  1E3H A;  2PO1 A;  3U1K A;  4OO1 F;  4OO1 A;  1R6M A;  2JE6 B;  5JEA F;  3H1C A;  2WNR A;  4IFD D;  2PNZ B;  2JEA B;  1OYP A;  2PO0 B;  2NN6 E; 
#chains in the Genus database with same CATH topology
 4IFD B;  1XNR E;  2UUB E;  1ZXM A;  4DV7 E;  4B3T E;  2BR2 A;  3JAM Q;  4LFB E;  2PNZ A;  4LF7 E;  1Z59 A;  1Z0G A;  2Z5C A;  4LF6 E;  1ZM3 A;  5K36 D;  2AJ4 A;  3ZM7 A;  4DV1 I;  3M85 G;  3CDJ A;  2BM1 A;  4DR5 I;  2BR2 B;  2C37 A;  2GO3 A;  4OZE A;  3PYG A;  4JV5 E;  4OX9 E;  5K36 F;  3WU3 A;  5BR8 I;  4IFD E;  5EL9 A;  4OO1 B;  3HJC A;  4YY3 E;  4JI2 E;  4NXN E;  1UDO A;  1UDN A;  2WP8 B;  5JEA E;  1IBL E;  4JI5 I;  4LPF A;  5LMN I;  5L3J A;  4USM A;  5FLX C;  1N34 I;  1ZXN A;  2PNL A;  2NN6 F;  2NN6 A;  1NHJ A;  1I94 E;  2UUA E;  2DEJ A;  1FWL A;  5IWA E;  4DXL A;  2HFU A;  4FWD A;  2AE8 A;  1J5E E;  1XNQ E;  5IT9 Q;  4JYA E;  2NPF A;  2HHH I;  2O1V A;  4DPY A;  1HNZ I;  2DEI A;  3V5R A;  1Z5C A;  4MU1 A;  2JEB A;  3T1Y E;  4BA2 B;  4PRV A;  4MYU A;  2C39 B;  4WUD A;  4LFC E;  5C0X C;  4X65 I;  3P3G A;  2IER A;  4NBQ A;  1BKN A;  4DU8 A;  4JI0 I;  4YHH E;  2PO1 B;  2XEX A;  5LMU E;  1Y6Z A;  4DV5 I;  5ELW A;  1VIS A;  5DRR A;  4DR4 I;  3B4T A;  2UXD E;  5C0X B;  1QZR A;  4HAC B;  5JEA B;  4B3R E;  4DR5 E;  1YH8 A;  2PO1 A;  3U1K A;  4OX9 I;  4DV3 E;  1R6M A;  4LF9 I;  4DUZ I;  2CVE A;  2JE6 B;  1XMO I;  4NXN I;  4IFD D;  3D4J A;  2PNZ B;  5DNX A;  1OYP A;  4DR6 E;  4IZJ B;  2PO0 B;  2E5L E;  1IBL I;  1HNX I;  2Q2E B;  4DUY I;  3ZKB A;  1Z0C A;  4DPU A;  4B3M E;  4GKJ E;  2BA1 D;  4FW3 A;  1XNR I;  4M1K A;  2GQ0 A;  1USU A;  3QT5 A;  2JEA A;  3J81 C;  4MYT A;  4MU0 A;  1YHC A;  1IBM I;  1Y4S A;  2WP8 A;  1N32 I;  2F4V E;  4RPF A;  5JEA C;  4DPT A;  4DV6 I;  2HHH E;  4ED4 A;  1R6L A;  4X64 E;  4JV5 I;  3GCM A;  4X66 I;  4P7A A;  4KQV A;  1UDQ A;  2UUC E;  5FLX Q;  3T1Y I;  1IBK E;  1KTV A;  3LTO A;  1MG7 A;  2GS8 A;  1OJ4 A;  4MU3 A;  1USV A;  2WW4 A;  4JI5 E;  2VQE I;  1RRE A;  4KHP I;  1D6T A;  4JG4 A;  4B3S I;  1N34 E;  1HK7 A;  2BM0 A;  1H74 A;  3P06 A;  5C0X F;  4BA1 B;  3GLL A;  4MU4 A;  2VQF I;  1Z5B A;  1B63 A;  4DV4 I;  4IZJ D;  3Q1Q A;  5K36 C;  4LFB I;  3L7Z A;  4BA2 A;  4AM3 A;  4OO1 E;  1XMQ E;  3ZZ0 A;  2R42 A;  2ZBK B;  4AQY E;  4LOM A;  4DV1 E;  4DUZ E;  3DD6 A;  2BA1 G;  1N0U A;  2CZ9 A;  1FJG I;  1HNZ E;  1Z0E A;  3P3C A;  4IFD A;  2PO2 B;  1ZM2 A;  5JEA D;  1KIJ A;  4IFD F;  4U3B A;  2X36 A;  5FWK A;  5BR8 E;  2V34 A;  2NN6 D;  4N3O A;  1S16 A;  2PO2 A;  2LJP A;  4HYM A;  4JI1 I;  3Q6N A;  4DR3 E;  4I3H A;  1UEK A;  1KKH A;  1Z5A A;  3P76 A;  4IZK B;  4LF8 I;  3NZK A;  2F1D A;  4DV0 I;  1HNW I;  2WNR B;  1N32 E;  4DV7 I;  4GKK I;  1E3H A;  5IWA I;  2O1W A;  3Q6M A;  1FKA E;  4LF7 I;  1J5E I;  4UTG A;  4OO1 A;  1XNQ I;  4IZK A;  3PYF A;  3JAM C;  2WNR A;  2UUC I;  1U2R A;  1ELO A;  4GQU A;  2JEA B;  2Z5E A;  1XMO E;  4DR2 I;  4JI4 I;  3UHM A;  3PYD A;  1PIE A;  3J81 Q;  3J7A G;  2IOQ A;  3ZZU A;  2R3V A;  2UXB I;  4AIM A;  2V8P A;  3H4L A;  4LFA E;  1XHK A;  3PYE A;  1HR0 E;  1NHI A;  2VQF E;  1XXE A;  1EI1 A;  2NN6 C;  1FNM A;  5C0X D;  3K1J A;  2C38 A;  4LF5 E;  3J80 C;  4LCG A;  4UT4 A;  4P52 A;  4DU7 A;  2UU9 I;  4OO1 D;  4DV5 E;  4DR7 I;  2ZM6 E;  2VES A;  1ZM9 A;  3LPS A;  4USK A;  4AQY I;  1A6F A;  2F4V I;  4OKG A;  5GME A;  4B3R I;  2C39 A;  2JT2 A;  1FI4 A;  2V2Z A;  4JI6 I;  1PKP A;  4DV3 I;  5K36 B;  3M85 D;  2OI2 A;  4LF9 E;  1Y4U A;  2UXC E;  2Z5B B;  2J65 A;  3WU5 A;  4K0K I;  3M6A A;  4FW5 A;  4LF4 E;  2HK3 A;  1HNX E;  4DUY E;  4NXM I;  2VQE E;  4DR3 I;  4JI1 E;  4AID A;  5C0X A;  4JI3 E;  4KHP E;  3QT8 A;  4IS9 A;  2PNM A;  4LCF A;  4URL A;  1N33 E;  3M7N D;  4DV2 E;  4B3M I;  4GKJ I;  3T1H E;  3V2U C;  4X62 E;  2JE6 A;  2Z5C B;  2C37 B;  4FW9 A;  5LMN E;  3B8H A;  1Z0B A;  4PU9 A;  3K85 A;  5DRQ A;  4DR4 E;  2UXD I;  5GMD A;  2IES A;  3GME A;  2HKJ A;  5IT9 C;  1PVG A;  3J7A M;  4B3T I;  1Y60 A;  3GON A;  3QT7 A;  4FW4 A;  3CDI A;  3B82 A;  4JI7 E;  4HY1 A;  1H7S A;  2O1T A;  2NN6 B;  5A2Q C;  1N0V C;  1NHH A;  1EA6 A;  5C0X E;  4LCH A;  5K36 E;  4YY3 I;  3OTO I;  4GKK E;  4OO1 F;  4LFC I;  3QT6 A;  1DAR A;  2A2C A;  1Z0T A;  5JEA F;  3H1C A;  1IBM E;  2CG9 A;  1K47 A;  4PRX A;  4YHH I;  1MU5 A;  2VF3 A;  2UUB I;  1RHY A;  1NZ0 A;  2NN6 E;  4JI8 I;  3PS3 A;  1I94 I;  1Z0V A;  4X64 I;  4DR2 E;  4QNJ A;  2UUA I;  2JEB B;  4JI4 E;  4FWH A;  1FJG E;  4BA1 A;  2A2D A;  4WUB A;  2UXB E;  3KRN A;  4NXM E;  4JYA I;  4JI3 I;  3LNU A;  5A2Q Q;  1IBK I;  4LF6 I;  4DPW A;  4DR1 E;  3HKM A;  2HFS A;  1Y5Y A;  4LFA I;  3ZZT A;  4FN5 A;  2J7K A;  5K36 A;  1UDS A;  1H73 A;  4DPX A;  4MQY A;  1WUU A;  1S4E A;  3PS1 A;  2ZIT A;  4HAC A;  5JEA A;  2UU9 E;  4JI2 I;  4Z7C A;  3U1Y A;  4DV0 E;  1HNW E;  4XTJ A;  1N36 E;  4IFD C;  4QNK A;  3M7N G;  1XMQ I;  4X65 E;  1P42 A;  3ZKD A;  4JI0 E;  5LMU I;  3F0N A;  4U3D A;  2PO0 A;  4IZJ A;  1OYR A;  2UXC I;  3B78 A;  4DV6 E;  5LL6 R;  1E3P A;  2EFG A;  5DRO A;  4R1F A;  4ISA A;  2O3Z A;  5EKW A;  1N33 I;  4WUC A;  3T1H I;  1Z0W A;  3K17 A;  2IOP A;  2X7I A;  1FWK A;  4FW7 A;  2V2V A;  4EMD A;  4LF8 E;  1VI7 A;  2ZM6 I;  4OO1 C;  3HUL A;  2V2Q A;  3P3E A;  4JI8 E;  3CWV A;  4DV4 E;  4FWG A;  4JI6 E;  3WU6 A;  1H7U A;  2BV3 A;  2HK2 A;  1OYS A;  5DNL A;  4JI7 I;  2BA0 D;  2O1U A;  4DR1 I;  4HXZ A;  4K0K E;  2BA0 G;  2C38 B;  1ZM4 A;  4LF4 I;  4X66 E;  2GO4 A;  3J80 Q;  2HKE A;  1H72 C;  3L7Z B;  1RR9 A;  3PS2 A;  1KVK A;  4J3D A;  4DV2 I;  4ZVI A;  1HR0 I;  4X62 I;  3OTO E;  4Z7Y A;  4DR6 I;  3WU4 A;  2E5L I;  1MX0 A;  1N36 I;  2E1R A;  4MDT A;  4FW6 A;  4LF5 I;  2CGE A;  3PRY A;  4DR7 E;  2Z5B A;  4B3S E;  1B62 A;  5DRP A; 
#chains in the Genus database with same CATH homology
 4IFD B;  2JEB B;  4BA1 A;  4AIM A;  2BA1 D;  3KRN A;  2BR2 A;  2PNZ A;  2JEA A;  3HKM A;  2NN6 C;  5C0X D;  2C38 A;  5K36 A;  5K36 D;  3M85 G;  1UDS A;  3CDJ A;  2WP8 A;  2BR2 B;  2C37 A;  5JEA C;  4OO1 D;  1R6L A;  5JEA A;  5K36 F;  3GCM A;  4IFD E;  1UDQ A;  4OO1 B;  2C39 A;  4IFD C;  1UDO A;  3M7N G;  5K36 B;  1UDN A;  2WP8 B;  5JEA E;  3M85 D;  2PO0 A;  1OYR A;  2NN6 F;  2NN6 A;  5C0X A;  4AID A;  1E3P A;  4BA1 B;  5C0X F;  3M7N D;  3GLL A;  5K36 C;  3L7Z A;  4AM3 A;  4BA2 A;  4OO1 E;  2JE6 A;  2C37 B;  3DD6 A;  2BA1 G;  4IFD A;  2JEB A;  2PO2 B;  5JEA D;  3GME A;  4OO1 C;  4IFD F;  4BA2 B;  2C39 B;  3CDI A;  2NN6 D;  5C0X C;  2PO2 A;  4NBQ A;  2NN6 B;  1OYS A;  2PO1 B;  2BA0 D;  2BA0 G;  2C38 B;  3B4T A;  5C0X B;  5C0X E;  5JEA B;  2WNR B;  5K36 E;  3L7Z B;  1E3H A;  2PO1 A;  3U1K A;  4OO1 F;  4OO1 A;  1R6M A;  2JE6 B;  5JEA F;  3H1C A;  2WNR A;  4IFD D;  2PNZ B;  2JEA B;  1OYP A;  2PO0 B;  2NN6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...