3M85G

Archaeoglobus fulgidus exosome y70a with rna bound to the active site
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
258
structure length
258
Chain Sequence
b'MPEDILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPAPDTPDRGVIIVNAELVPLASPTFEPGPPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
total genus 69
structure length 258
sequence length 258
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3m85G01
1UDSA 2C37A 5C0XA 4OO1D 4OO1B 4IFDE 3CDJA 3L7ZB 3DD6A 1E3HA 1R6LA 2C39A 5JEAE 2JEAB 2NN6D 2NN6B 2PNZA 4AM3A 3KRNA 2WNRB 5JEAA 5C0XE 3U1KA 4BA1B 4BA2B 5K36E 2BR2B 4OO1A 1UDQA 3L7ZA 2C38A 4IFDC 5K36A 4IFDF 2JEAA 2NN6A 4AIDA 3GLLA 4IFDD 3H1CA 2PO2B 4BA1A 2WP8B 4NBQA 4OO1E 2BR2A 1OYRA 3HKMA 4AIMA 3GCMA 5C0XF 3M7ND 1OYPA 2NN6E 2BA0D 2JE6B 3CDIA 2PO0B 2WP8A 5JEAC 3M85D 4IFDB 2C39B 2WNRA 5JEAF 2JEBB 3M85G 4BA2A 3GMEA 1UDNA 2PNZB 5C0XC 1UDOA 5JEAD 5JEAB 5K36C 2PO1B 1R6MA 1OYSA 2BA1D 5K36F 2JE6A 1E3PA 2NN6C 3M7NG 2PO0A 2BA1G 2C37B 5C0XD 5C0XB 2NN6F 2C38B 5K36D 5K36B 3B4TA 4IFDA 2BA0G 2JEBA 2PO2A 4OO1C 2PO1A 4OO1F
chains in the Genus database with same CATH superfamily
2O1WA 4B3SI 4USMA 4LFBE 4OO1D 3PYFA 1Z0BA 4QNJA 3JAMQ 1HR0I 2V8PA 1XNQE 1N33E 5JEAE 4B3RI 2CG9A 4UT4A 4WUCA 2WNRB 1B62A 4DV5E 4BA1B 4LFBI 2BR2B 2IESA 4FW9A 4X64E 1Y6ZA 1FWLA 1ZM9A 1NHHA 3K1JA 4YHHE 1XNQI 1MU5A 1N33I 4IFDC 1ZM4A 4U3DA 4YY3E 1VI7A 4N3OA 4IFDF 2JEAA 2NN6A 4DUZE 4R1FA 4HXZA 5EKWA 3LNUA 1DARA 2HK3A 4IZJA 2PO2B 2O1VA 3QT5A 4X64I 1YH8A 3HKMA 4LF7E 4YHHI 4AIMA 4LF6E 4DPWA 3J80C 3F0NA 4DV0E 4YY3I 1Y4UA 2WW4A 2HKEA 3K17A 3D4JA 1XHKA 4MU1A 3K85A 3UHMA 4IZKB 4LF4I 4LF7I 4JG4A 4LF6I 4DV0I 1N32E 2BV3A 2JEBB 4LCHA 4FWHA 4LCGA 2IOPA 3P06A 5ELWA 2PNZB 3P3GA 5GMEA 1N34E 4JI6E 1FKAE 3LPSA 2AE8A 1H74A 1HK7A 4DR3E 2NN6C 4HYMA 1XMQE 2PO0A 2BA1G 2C37B 5C0XB 4IS9A 2NN6F 2VQFE 5K36B 3B4TA 1N32I 5LMUE 1Y60A 1N0VC 4UTGA 2J65A 1S4EA 4DV1E 1N34I 2CGEA 4OO1C 4LPFA 1N36I 2E1RA 4DR3I 2ZITA 4OO1F 2HFSA 1XMQI 3HJCA 2V2ZA 1NZ0A 1UDSA 4MYUA 1OJ4A 4DU7A 5LMUI 5DNXA 1IBMI 3J80Q 1PVGA 4LFCI 3L7ZB 3PS2A 2UUBE 1E3HA 4NXME 4DV1I 2GQ0A 2C39A 2NN6D 4MQYA 1Y4SA 2CZ9A 4IZJD 4KQVA 2F4VE 3T1HE 5C0XE 3U1KA 4JI3E 1FWKA 4NXNE 1U2RA 2UXBI 5K36E 1ZM2A 4B3ME 3WU3A 2UUBI 4NXMI 2R42A 2C38A 3PS1A 3ZKBA 1ZXMA 1Z0GA 4MDTA 4AIDA 2A2DA 2UU9E 2HKJA 3V2UC 2F4VI 5L3JA 3T1HI 1IBLE 4JI3I 3U1YA 4NXNI 2WP8B 4BA1A 2BR2A 4DV7E 1KIJA 3B8HA 5A2QQ 4X66E 4B3MI 5LMNE 1K47A 2UUAI 2UXCE 3P3CA 1QZRA 1Z59A 4DXLA 4MYTA 2UU9I 3PYDA 2JE6B 2BM0A 1IBLI 1Z5CA 2Z5EA 3T1YI 4DV2E 2F1DA 3V5RA 4DV7I 4X66I 5LMNI 4DV3E 4U3BA 2V2QA 2JT2A 3M85G 4BA2A 1Z0WA 3GONA 2UXCI 4M1KA 4LF5I 3GMEA 3HULA 3QT6A 4LF4E 1Z0VA 2ZM6E 5JEAD 2LJPA 3B78A 3ZKDA 4JI4E 2PO1B 3QT7A 4DU8A 3M7NG 4DV2I 2GS8A 3Q6MA 4WUBA 4IZKA 4DV3I 2Z5BB 2O3ZA 4LOMA 4DR7E 2JEBA 2O1TA 2ZM6I 1Z0EA 2Q2EB 4URLA 2UXDI 1PKPA 4HACB 4JI4I 4MU3A 4JV5I 1N0UA 2XEXA 4ISAA 1USUA 4DV4E 4PRVA 4FWDA 2C37A 5C0XA 1N36E 3M6AA 4OO1B 2GO4A 4DR7I 3J7AG 3Q1QA 3CDJA 2UUCE 3DD6A 3B82A 3ZM7A 1R6LA 1H7SA 5A2QC 1IBME 4QNKA 4MU0A 2GO3A 4LFCE 4DV4I 5IWAE 4AM3A 1USVA 5JEAA 4ED4A 4AQYE 1FI4A 1FJGE 4RPFA 2V34A 2UUCI 3WU6A 1MG7A 3L7ZA 4X65I 2HK2A 4LF9E 2UXBE 1UEKA 2O1UA 1ZM3A 4JI7E 1I94E 1HNZE 2V2VA 3PYGA 5DNLA 4P52A 1XMOI 5IWAI 3CWVA 3GLLA 4OKGA 2PNLA 3P3EA 1RR9A 4OZEA 4AQYI 1FJGI 2J7KA 4DR5E 4NBQA 4OO1E 4JI0E 1OYRA 1Z5BA 4P7AA 4OX9E 4LF9I 5C0XF 3M7ND 4JI7I 1I94I 4DPTA 1OYPA 1HNZI 4DR4E 4JI5E 4GKJE 2E5LE 2UUAE 4FN5A 2VF3A 4DR5I 3CDIA 1Z0CA 1P42A 4JI0I 2WP8A 2IERA 5JEAC 3H4LA 4IFDB 2C39B 2WNRA 4OX9I 5JEAF 3ZZ0A 3T1YE 4GQUA 1KVKA 1KTVA 4DR4I 1H72C 1UDOA 2VESA 1WUUA 4JI5I 1KKHA 3PYEA 5DRPA 4GKJI 4FW6A 3WU4A 2E5LI 4FW5A 4B3TE 4LF5E 2Z5CB 2BA1D 2JE6A 4FW3A 4HY1A 1PIEA 2AJ4A 5C0XD 2C38B 5K36D 2BA0G 4I3HA 3WU5A 2PO2A 4XTJA 2PNMA 4X62E 1NHJA 1EI1A 5DROA 2DEJA 4JI1E 4B3TI 2PO1A 4DV6E 2DEIA 4DUYE 2HHHE 2VQEE 3J81C 2UXDE 4Z7YA 1J5EE 4USKA 4JV5E 5IT9C 4ZVIA 4IFDE 2Z5BA 1NHIA 1ZXNA 4X62I 2HFUA 1VISA 1Y5YA 4JI1I 4DPXA 4HACA 4DV5I 1XNRE 1Z0TA 2JEAB 5FLXC 4DV6I 2NN6B 4DUYI 2HHHI 1FNMA 3ZZUA 2VQEI 4LFAE 2PNZA 3KRNA 1J5EI 4IZJB 1D6TA 4BA2B 2X36A 3P76A 4OO1A 5EL9A 1EA6A 4PU9A 1UDQA 4DUZI 3PRYA 4DR1E 5LL6R 4GKKE 1HNXE 1A6FA 3NZKA 1IBKE 4LF8E 5K36A 5BR8E 3OTOE 1XNRI 4FW4A 4LFAI 4WUDA 2CVEA 4X65E 4IFDD 3H1CA 4DR6E 4JI8E 3J7AM 4JI2E 1B63A 2NPFA 4DR2E 1XMOE 4GKKI 4DR1I 3GCMA 1Z5AA 2ZBKB 3JAMC 1HNXI 1IBKI 4LF8I 1BKNA 5BR8I 1RHYA 3OTOI 4DPYA 1S16A 2IOQA 2NN6E 3J81Q 2BA0D 1MX0A 2X7IA 1HNWE 4J3DA 4JI8I 4DR6I 2A2CA 2PO0B 2BM1A 4JI2I 5IT9Q 4JYAE 4DR2I 5DRRA 4EMDA 4FWGA 3M85D 4KHPE 4JI6I 1UDNA 2R3VA 1RREA 5FLXQ 5C0XC 3LTOA 4K0KE 3QT8A 5FWKA 5JEAB 2VQFI 5K36C 1XXEA 3ZZTA 1HNWI 1R6MA 1OYSA 5K36F 1H7UA 3Q6NA 4LCFA 1E3PA 4B3SE 4JYAI 5DRQA 4KHPI 4IFDA 4DPUA 4FW7A 4PRXA 2EFGA 4MU4A 4Z7CA 1H73A 1YHCA 5GMDA 1HR0E 4K0KI 2OI2A 3PS3A 1ELOA 4B3RE 2Z5CA
chains in the Genus database with same CATH topology
1UDSA 2C37A 5C0XA 4OO1D 4OO1B 4IFDE 3CDJA 3L7ZB 3DD6A 1E3HA 1R6LA 2C39A 5JEAE 2JEAB 2NN6D 2NN6B 2PNZA 4AM3A 3KRNA 2WNRB 5JEAA 5C0XE 3U1KA 4BA1B 4BA2B 5K36E 2BR2B 4OO1A 1UDQA 3L7ZA 2C38A 4IFDC 5K36A 4IFDF 2JEAA 2NN6A 4AIDA 3GLLA 4IFDD 3H1CA 2PO2B 4BA1A 2WP8B 4NBQA 4OO1E 2BR2A 1OYRA 3HKMA 4AIMA 3GCMA 5C0XF 3M7ND 1OYPA 2NN6E 2BA0D 2JE6B 3CDIA 2PO0B 2WP8A 5JEAC 3M85D 4IFDB 2C39B 2WNRA 5JEAF 2JEBB 3M85G 4BA2A 3GMEA 1UDNA 2PNZB 5C0XC 1UDOA 5JEAD 5JEAB 5K36C 2PO1B 1R6MA 1OYSA 2BA1D 5K36F 2JE6A 1E3PA 2NN6C 3M7NG 2PO0A 2BA1G 2C37B 5C0XD 5C0XB 2NN6F 2C38B 5K36D 5K36B 3B4TA 4IFDA 2BA0G 2JEBA 2PO2A 4OO1C 2PO1A 4OO1F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDS A;  2C37 A;  5C0X A;  4OO1 D;  4OO1 B;  4IFD E;  3CDJ A;  3L7Z B;  3DD6 A;  1E3H A;  1R6L A;  2C39 A;  5JEA E;  2JEA B;  2NN6 D;  2NN6 B;  2PNZ A;  4AM3 A;  3KRN A;  2WNR B;  5JEA A;  5C0X E;  3U1K A;  4BA1 B;  4BA2 B;  5K36 E;  2BR2 B;  4OO1 A;  1UDQ A;  3L7Z A;  2C38 A;  4IFD C;  5K36 A;  4IFD F;  2JEA A;  2NN6 A;  4AID A;  3GLL A;  4IFD D;  3H1C A;  2PO2 B;  4BA1 A;  2WP8 B;  4NBQ A;  4OO1 E;  2BR2 A;  1OYR A;  3HKM A;  4AIM A;  3GCM A;  5C0X F;  3M7N D;  1OYP A;  2NN6 E;  2BA0 D;  2JE6 B;  3CDI A;  2PO0 B;  2WP8 A;  5JEA C;  3M85 D;  4IFD B;  2C39 B;  2WNR A;  5JEA F;  2JEB B;  3M85 G;  4BA2 A;  3GME A;  1UDN A;  2PNZ B;  5C0X C;  1UDO A;  5JEA D;  5JEA B;  5K36 C;  2PO1 B;  1R6M A;  1OYS A;  2BA1 D;  5K36 F;  2JE6 A;  1E3P A;  2NN6 C;  3M7N G;  2PO0 A;  2BA1 G;  2C37 B;  5C0X D;  5C0X B;  2NN6 F;  2C38 B;  5K36 D;  5K36 B;  3B4T A;  4IFD A;  2BA0 G;  2JEB A;  2PO2 A;  4OO1 C;  2PO1 A;  4OO1 F; 
#chains in the Genus database with same CATH topology
 2O1W A;  4B3S I;  4USM A;  4LFB E;  4OO1 D;  3PYF A;  1Z0B A;  4QNJ A;  3JAM Q;  1HR0 I;  2V8P A;  1XNQ E;  1N33 E;  5JEA E;  4B3R I;  2CG9 A;  4UT4 A;  4WUC A;  2WNR B;  1B62 A;  4DV5 E;  4BA1 B;  4LFB I;  2BR2 B;  2IES A;  4FW9 A;  4X64 E;  1Y6Z A;  1FWL A;  1ZM9 A;  1NHH A;  3K1J A;  4YHH E;  1XNQ I;  1MU5 A;  1N33 I;  4IFD C;  1ZM4 A;  4U3D A;  4YY3 E;  1VI7 A;  4N3O A;  4IFD F;  2JEA A;  2NN6 A;  4DUZ E;  4R1F A;  4HXZ A;  5EKW A;  3LNU A;  1DAR A;  2HK3 A;  4IZJ A;  2PO2 B;  2O1V A;  3QT5 A;  4X64 I;  1YH8 A;  3HKM A;  4LF7 E;  4YHH I;  4AIM A;  4LF6 E;  4DPW A;  3J80 C;  3F0N A;  4DV0 E;  4YY3 I;  1Y4U A;  2WW4 A;  2HKE A;  3K17 A;  3D4J A;  1XHK A;  4MU1 A;  3K85 A;  3UHM A;  4IZK B;  4LF4 I;  4LF7 I;  4JG4 A;  4LF6 I;  4DV0 I;  1N32 E;  2BV3 A;  2JEB B;  4LCH A;  4FWH A;  4LCG A;  2IOP A;  3P06 A;  5ELW A;  2PNZ B;  3P3G A;  5GME A;  1N34 E;  4JI6 E;  1FKA E;  3LPS A;  2AE8 A;  1H74 A;  1HK7 A;  4DR3 E;  2NN6 C;  4HYM A;  1XMQ E;  2PO0 A;  2BA1 G;  2C37 B;  5C0X B;  4IS9 A;  2NN6 F;  2VQF E;  5K36 B;  3B4T A;  1N32 I;  5LMU E;  1Y60 A;  1N0V C;  4UTG A;  2J65 A;  1S4E A;  4DV1 E;  1N34 I;  2CGE A;  4OO1 C;  4LPF A;  1N36 I;  2E1R A;  4DR3 I;  2ZIT A;  4OO1 F;  2HFS A;  1XMQ I;  3HJC A;  2V2Z A;  1NZ0 A;  1UDS A;  4MYU A;  1OJ4 A;  4DU7 A;  5LMU I;  5DNX A;  1IBM I;  3J80 Q;  1PVG A;  4LFC I;  3L7Z B;  3PS2 A;  2UUB E;  1E3H A;  4NXM E;  4DV1 I;  2GQ0 A;  2C39 A;  2NN6 D;  4MQY A;  1Y4S A;  2CZ9 A;  4IZJ D;  4KQV A;  2F4V E;  3T1H E;  5C0X E;  3U1K A;  4JI3 E;  1FWK A;  4NXN E;  1U2R A;  2UXB I;  5K36 E;  1ZM2 A;  4B3M E;  3WU3 A;  2UUB I;  4NXM I;  2R42 A;  2C38 A;  3PS1 A;  3ZKB A;  1ZXM A;  1Z0G A;  4MDT A;  4AID A;  2A2D A;  2UU9 E;  2HKJ A;  3V2U C;  2F4V I;  5L3J A;  3T1H I;  1IBL E;  4JI3 I;  3U1Y A;  4NXN I;  2WP8 B;  4BA1 A;  2BR2 A;  4DV7 E;  1KIJ A;  3B8H A;  5A2Q Q;  4X66 E;  4B3M I;  5LMN E;  1K47 A;  2UUA I;  2UXC E;  3P3C A;  1QZR A;  1Z59 A;  4DXL A;  4MYT A;  2UU9 I;  3PYD A;  2JE6 B;  2BM0 A;  1IBL I;  1Z5C A;  2Z5E A;  3T1Y I;  4DV2 E;  2F1D A;  3V5R A;  4DV7 I;  4X66 I;  5LMN I;  4DV3 E;  4U3B A;  2V2Q A;  2JT2 A;  3M85 G;  4BA2 A;  1Z0W A;  3GON A;  2UXC I;  4M1K A;  4LF5 I;  3GME A;  3HUL A;  3QT6 A;  4LF4 E;  1Z0V A;  2ZM6 E;  5JEA D;  2LJP A;  3B78 A;  3ZKD A;  4JI4 E;  2PO1 B;  3QT7 A;  4DU8 A;  3M7N G;  4DV2 I;  2GS8 A;  3Q6M A;  4WUB A;  4IZK A;  4DV3 I;  2Z5B B;  2O3Z A;  4LOM A;  4DR7 E;  2JEB A;  2O1T A;  2ZM6 I;  1Z0E A;  2Q2E B;  4URL A;  2UXD I;  1PKP A;  4HAC B;  4JI4 I;  4MU3 A;  4JV5 I;  1N0U A;  2XEX A;  4ISA A;  1USU A;  4DV4 E;  4PRV A;  4FWD A;  2C37 A;  5C0X A;  1N36 E;  3M6A A;  4OO1 B;  2GO4 A;  4DR7 I;  3J7A G;  3Q1Q A;  3CDJ A;  2UUC E;  3DD6 A;  3B82 A;  3ZM7 A;  1R6L A;  1H7S A;  5A2Q C;  1IBM E;  4QNK A;  4MU0 A;  2GO3 A;  4LFC E;  4DV4 I;  5IWA E;  4AM3 A;  1USV A;  5JEA A;  4ED4 A;  4AQY E;  1FI4 A;  1FJG E;  4RPF A;  2V34 A;  2UUC I;  3WU6 A;  1MG7 A;  3L7Z A;  4X65 I;  2HK2 A;  4LF9 E;  2UXB E;  1UEK A;  2O1U A;  1ZM3 A;  4JI7 E;  1I94 E;  1HNZ E;  2V2V A;  3PYG A;  5DNL A;  4P52 A;  1XMO I;  5IWA I;  3CWV A;  3GLL A;  4OKG A;  2PNL A;  3P3E A;  1RR9 A;  4OZE A;  4AQY I;  1FJG I;  2J7K A;  4DR5 E;  4NBQ A;  4OO1 E;  4JI0 E;  1OYR A;  1Z5B A;  4P7A A;  4OX9 E;  4LF9 I;  5C0X F;  3M7N D;  4JI7 I;  1I94 I;  4DPT A;  1OYP A;  1HNZ I;  4DR4 E;  4JI5 E;  4GKJ E;  2E5L E;  2UUA E;  4FN5 A;  2VF3 A;  4DR5 I;  3CDI A;  1Z0C A;  1P42 A;  4JI0 I;  2WP8 A;  2IER A;  5JEA C;  3H4L A;  4IFD B;  2C39 B;  2WNR A;  4OX9 I;  5JEA F;  3ZZ0 A;  3T1Y E;  4GQU A;  1KVK A;  1KTV A;  4DR4 I;  1H72 C;  1UDO A;  2VES A;  1WUU A;  4JI5 I;  1KKH A;  3PYE A;  5DRP A;  4GKJ I;  4FW6 A;  3WU4 A;  2E5L I;  4FW5 A;  4B3T E;  4LF5 E;  2Z5C B;  2BA1 D;  2JE6 A;  4FW3 A;  4HY1 A;  1PIE A;  2AJ4 A;  5C0X D;  2C38 B;  5K36 D;  2BA0 G;  4I3H A;  3WU5 A;  2PO2 A;  4XTJ A;  2PNM A;  4X62 E;  1NHJ A;  1EI1 A;  5DRO A;  2DEJ A;  4JI1 E;  4B3T I;  2PO1 A;  4DV6 E;  2DEI A;  4DUY E;  2HHH E;  2VQE E;  3J81 C;  2UXD E;  4Z7Y A;  1J5E E;  4USK A;  4JV5 E;  5IT9 C;  4ZVI A;  4IFD E;  2Z5B A;  1NHI A;  1ZXN A;  4X62 I;  2HFU A;  1VIS A;  1Y5Y A;  4JI1 I;  4DPX A;  4HAC A;  4DV5 I;  1XNR E;  1Z0T A;  2JEA B;  5FLX C;  4DV6 I;  2NN6 B;  4DUY I;  2HHH I;  1FNM A;  3ZZU A;  2VQE I;  4LFA E;  2PNZ A;  3KRN A;  1J5E I;  4IZJ B;  1D6T A;  4BA2 B;  2X36 A;  3P76 A;  4OO1 A;  5EL9 A;  1EA6 A;  4PU9 A;  1UDQ A;  4DUZ I;  3PRY A;  4DR1 E;  5LL6 R;  4GKK E;  1HNX E;  1A6F A;  3NZK A;  1IBK E;  4LF8 E;  5K36 A;  5BR8 E;  3OTO E;  1XNR I;  4FW4 A;  4LFA I;  4WUD A;  2CVE A;  4X65 E;  4IFD D;  3H1C A;  4DR6 E;  4JI8 E;  3J7A M;  4JI2 E;  1B63 A;  2NPF A;  4DR2 E;  1XMO E;  4GKK I;  4DR1 I;  3GCM A;  1Z5A A;  2ZBK B;  3JAM C;  1HNX I;  1IBK I;  4LF8 I;  1BKN A;  5BR8 I;  1RHY A;  3OTO I;  4DPY A;  1S16 A;  2IOQ A;  2NN6 E;  3J81 Q;  2BA0 D;  1MX0 A;  2X7I A;  1HNW E;  4J3D A;  4JI8 I;  4DR6 I;  2A2C A;  2PO0 B;  2BM1 A;  4JI2 I;  5IT9 Q;  4JYA E;  4DR2 I;  5DRR A;  4EMD A;  4FWG A;  3M85 D;  4KHP E;  4JI6 I;  1UDN A;  2R3V A;  1RRE A;  5FLX Q;  5C0X C;  3LTO A;  4K0K E;  3QT8 A;  5FWK A;  5JEA B;  2VQF I;  5K36 C;  1XXE A;  3ZZT A;  1HNW I;  1R6M A;  1OYS A;  5K36 F;  1H7U A;  3Q6N A;  4LCF A;  1E3P A;  4B3S E;  4JYA I;  5DRQ A;  4KHP I;  4IFD A;  4DPU A;  4FW7 A;  4PRX A;  2EFG A;  4MU4 A;  4Z7C A;  1H73 A;  1YHC A;  5GMD A;  1HR0 E;  4K0K I;  2OI2 A;  3PS3 A;  1ELO A;  4B3R E;  2Z5C A; 
#chains in the Genus database with same CATH homology
 1UDS A;  2C37 A;  5C0X A;  4OO1 D;  4OO1 B;  4IFD E;  3CDJ A;  3L7Z B;  3DD6 A;  1E3H A;  1R6L A;  2C39 A;  5JEA E;  2JEA B;  2NN6 D;  2NN6 B;  2PNZ A;  4AM3 A;  3KRN A;  2WNR B;  5JEA A;  5C0X E;  3U1K A;  4BA1 B;  4BA2 B;  5K36 E;  2BR2 B;  4OO1 A;  1UDQ A;  3L7Z A;  2C38 A;  4IFD C;  5K36 A;  4IFD F;  2JEA A;  2NN6 A;  4AID A;  3GLL A;  4IFD D;  3H1C A;  2PO2 B;  4BA1 A;  2WP8 B;  4NBQ A;  4OO1 E;  2BR2 A;  1OYR A;  3HKM A;  4AIM A;  3GCM A;  5C0X F;  3M7N D;  1OYP A;  2NN6 E;  2BA0 D;  2JE6 B;  3CDI A;  2PO0 B;  2WP8 A;  5JEA C;  3M85 D;  4IFD B;  2C39 B;  2WNR A;  5JEA F;  2JEB B;  3M85 G;  4BA2 A;  3GME A;  1UDN A;  2PNZ B;  5C0X C;  1UDO A;  5JEA D;  5JEA B;  5K36 C;  2PO1 B;  1R6M A;  1OYS A;  2BA1 D;  5K36 F;  2JE6 A;  1E3P A;  2NN6 C;  3M7N G;  2PO0 A;  2BA1 G;  2C37 B;  5C0X D;  5C0X B;  2NN6 F;  2C38 B;  5K36 D;  5K36 B;  3B4T A;  4IFD A;  2BA0 G;  2JEB A;  2PO2 A;  4OO1 C;  2PO1 A;  4OO1 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...