3M85G

Archaeoglobus fulgidus exosome y70a with rna bound to the active site
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
258
structure length
258
Chain Sequence
MPEDILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPAPDTPDRGVIIVNAELVPLASPTFEPGPPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 69
structure length 258
sequence length 258
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3m85G01
2PO0B 1UDQA 3U1KA 2C37A 4AIDA 4BA1A 4OO1F 2PO1B 1UDOA 2NN6F 4IFDF 5K36D 2C39B 2BR2A 2JE6A 4BA2A 2PNZB 4OO1C 4IFDC 5K36E 3KRNA 1OYRA 5JEAF 2BA0G 2WNRA 4OO1A 2BA0D 2NN6A 4OO1D 2BA1D 2NN6D 3GMEA 4IFDD 3DD6A 4OO1E 3CDIA 5C0XF 2NN6E 4IFDE 5JEAA 2JEBA 4NBQA 5JEAD 5K36C 2PO2B 1UDNA 2C37B 5JEAE 3HKMA 5K36B 2NN6C 3L7ZB 2PO0A 2WP8B 3CDJA 2BR2B 5C0XA 4BA2B 3GLLA 5C0XD 1R6LA 3M7NG 3B4TA 5JEAC 5C0XE 1OYPA 2PO1A 2WNRB 4OO1B 4AM3A 2C39A 3GCMA 3M85G 3M85D 4IFDB 2JEAB 5C0XC 5JEAB 2C38A 4BA1B 1E3PA 2JE6B 5C0XB 3M7ND 4AIMA 2PO2A 1UDSA 1R6MA 2PNZA 2NN6B 5K36A 1OYSA 3L7ZA 2WP8A 2JEBB 5K36F 2C38B 1E3HA 2BA1G 4IFDA 3H1CA 2JEAA
chains in the Genus database with same CATH superfamily
2VQFE 3QT7A 4B3ME 1FKAE 1HNZI 4B3RI 4NXMI 1WUUA 4KHPI 4DV6E 1HR0I 3H4LA 1Z0VA 4IZKB 4IFDF 2PNZB 3NZKA 4USMA 2IOPA 4FW4A 1XHKA 4DV5I 1IBKI 1PVGA 5EKWA 4DV3E 3Q6NA 3DD6A 3OTOE 4QNKA 3CDIA 3V5RA 4IFDE 2E5LI 1Z59A 1IBME 4DR5I 2F4VI 1FNMA 4LFBE 2A2CA 4JI4E 1KTVA 1ZM3A 4JYAI 3JAMC 4DUZE 2NN6C 1Y4SA 4FWHA 4HACB 2V2ZA 3U1YA 2O1TA 2IOQA 5JEAC 4DR7E 2PO1A 2UXCE 2LJPA 3Q6MA 2C39A 4DR4E 2UUAE 4IFDB 5LMNI 4U3DA 4X65I 3HJCA 5DRQA 4Z7YA 1N36E 2HK3A 4ED4A 4MU4A 4LF8E 1N32I 1HNXE 4FWGA 3J7AM 1Z0EA 1XXEA 2HFSA 2HKEA 3CWVA 4LF7E 4DUYI 4LCGA 4LF9I 4DV4E 3T1YE 1I94I 3T1HE 4QNJA 2IESA 3UHMA 1EA6A 1XMOE 2ZM6E 4N3OA 1D6TA 1FWKA 1H73A 4DR6E 1ZM2A 2VQEI 1R6MA 1PIEA 2PNZA 4KQVA 4LF5E 4JG4A 5K36A 3L7ZA 3M6AA 1Z0GA 1Z5BA 3PRYA 1N0VC 1YH8A 1XNRI 1RR9A 1Z0CA 4FW3A 4YY3I 4X64I 5K36F 1NZ0A 4DPYA 3H1CA 4OX9I 1Z0WA 4URLA 3B8HA 1S4EA 2J7KA 5EL9A 1NHHA 3J81Q 4DV1E 2UU9I 3U1KA 2DEJA 1U2RA 3PS1A 4BA1A 1USVA 4JI1E 1XNQE 4OO1F 4DR1E 4MU3A 4K0KE 2PO1B 2NN6F 4DPWA 2C39B 2JE6A 4P52A 4JI0I 5K36E 3Q1QA 5IT9C 1YHCA 3WU6A 5JEAF 4AQYE 4IFDD 4OO1E 1MU5A 4JI8E 2NN6E 1KIJA 3V2UC 4DV0I 5DRPA 1ELOA 1Z0TA 2DEIA 4ISAA 4LF4E 5JEAE 4DU8A 3HKMA 5K36B 4GKJI 2BM0A 3L7ZB 4B3TI 2AE8A 4JI3E 2PO0A 3GLLA 4JI5E 3PS3A 4MDTA 2R42A 3M7NG 3K85A 4LFCE 4X66E 1OJ4A 3ZZ0A 4OO1B 1XMQI 4YHHI 3ZKBA 5FLXQ 4P7AA 4DR2E 2UXDE 4FW5A 4JI6E 4XTJA 1ZXMA 2Z5BB 2CGEA 5C0XC 4DXLA 4JI7I 1IBLE 5JEAB 4WUCA 4BA1B 2JE6B 2BM1A 2NPFA 2V2VA 4FN5A 5A2QQ 2PO2A 1RHYA 4MYUA 4DR1I 1H7UA 4DR3I 4PRVA 4B3SE 4LFAE 2HFUA 5LMUI 5IWAE 1ZM4A 4UTGA 1UEKA 1NHJA 2WP8A 3ZKDA 2F1DA 2UUCI 1N33I 3J80Q 1B63A 4NXNI 3J7AG 4AQYI 3B78A 2V8PA 2E1RA 2UXBE 1FJGE 1MG7A 3PYFA 1N0UA 1J5EE 1USUA 2HHHI 1ZM9A 4GKKE 2VQFI 1NHIA 3PYEA 4X62E 4B3MI 2C38B 2BA1G 2X7IA 5L3JA 2ZBKB 2JEAA 1ZXNA 2PO0B 4DV6I 4DU7A 4EMDA 2O1UA 1HNWE 1BKNA 1UDQA 1Z5CA 1A6FA 3LTOA 1HNZE 3WU4A 4B3RE 1KKHA 4JI3I 1UDOA 4NXME 5K36D 4KHPE 4Z7CA 4FW6A 4IFDC 3KRNA 5GMEA 3LNUA 2CZ9A 2XEXA 4DV3I 3OTOI 4OO1A 2NN6A 4LF6E 4OO1D 4DV5E 1IBKE 2NN6D 3GMEA 3WU5A 1IBMI 5FWKA 4LOMA 2Z5BA 4LCFA 4LFBI 4OZEA 5C0XF 1QZRA 1VISA 3PYDA 1MX0A 5JEAA 4JI4I 4NBQA 1KVKA 5JEAD 4DUZI 2PO2B 1UDNA 2BV3A 2C37B 5ELWA 4DR5E 4FW7A 3HULA 4IZJA 4UT4A 2WP8B 4BA2B 2BR2B 1VI7A 4DR7I 2PNLA 4DV2E 4USKA 2UUBE 2UXCI 4DR4I 1H7SA 1P42A 2AJ4A 2UUAI 4LCHA 5C0XE 2VESA 1OYPA 4MU0A 2WNRB 3J81C 1N36I 4JV5E 3P3CA 5DRRA 4LF8I 2IERA 1HNXI 1H72C 2OI2A 2JEAB 1H74A 5LMNE 4LF7I 4DV7E 4X65E 2GS8A 2O1VA 4DV4I 3T1YI 3T1HI 4HYMA 2C38A 3WU3A 1XMOI 1N32E 1E3PA 2O3ZA 3QT5A 2ZM6I 4DR6I 1K47A 2GO4A 4FWDA 2WW4A 3D4JA 5C0XB 4LF9E 3M7ND 4DPUA 1I94E 4LF5I 4J3DA 4AIMA 1UDSA 2HKJA 2V34A 2NN6B 2V2QA 4MU1A 2VQEE 2GO3A 2VF3A 3JAMQ 2Z5CB 4LF6I 4PRXA 2J65A 1E3HA 4LPFA 1XNRE 4DV1I 4IZJB 3F0NA 4YY3E 4X64E 5K36C 4JI1I 1XNQI 5FLXC 4K0KI 1Z0BA 4JI2E 4OX9E 2C37A 3QT6A 1Z5AA 3K1JA 3B82A 4AIDA 3P3GA 4MQYA 3K17A 2UU9E 4BA2A 2BR2A 4DV2I 4OO1C 2UUBI 5DNLA 2ZITA 1S16A 1OYRA 1FI4A 4PU9A 1HK7A 4JI0E 2BA0G 2WNRA 1DARA 4I3HA 2BA0D 2CVEA 2EFGA 4JV5I 2CG9A 5LL6R 2BA1D 5BR8E 4JI8I 5A2QC 3PS2A 3ZZTA 3PYGA 1N34E 4MYTA 4DV7I 4GQUA 4DPTA 4ZVIA 1RREA 2GQ0A 4LF4I 2Q2EB 2JEBA 4RPFA 4IS9A 3J80C 1Y5YA 4DV0E 1HR0E 2X36A 4JI5I 2Z5EA 2A2DA 5C0XA 3CDJA 3GONA 2JT2A 4LFCI 5C0XD 1Y6ZA 1R6LA 3ZM7A 4X66I 4GKJE 4B3TE 3LPSA 3B4TA 2UXDI 4DR2I 4OKGA 4JI6I 5DROA 2HK2A 4IZKA 5GMDA 2R3VA 4AM3A 3GCMA 3M85G 3M85D 1IBLI 1XMQE 2Z5CA 4YHHE 3ZZUA 1FWLA 5DNXA 4WUBA 2E5LE 4M1KA 2F4VE 3QT8A 1B62A 2O1WA 4JI7E 5IT9Q 1PKPA 4IZJD 4JYAE 4WUDA 4JI2I 4U3BA 2PNMA 3P76A 4HXZA 1Y60A 4B3SI 4LFAI 4DPXA 5IWAI 4FW9A 4HY1A 3P3EA 1OYSA 4DR3E 4HACA 2UXBI 1FJGI 1Y4UA 1J5EI 5LMUE 1EI1A 4GKKI 4R1FA 4X62I 2JEBB 2UUCE 5BR8I 1N33E 4NXNE 3P06A 1N34I 4IFDA 1HNWI 2HHHE 4DUYE
chains in the Genus database with same CATH topology
2PO0B 1UDQA 3U1KA 2C37A 4AIDA 4BA1A 4OO1F 2PO1B 1UDOA 2NN6F 4IFDF 5K36D 2C39B 2BR2A 2JE6A 4BA2A 2PNZB 4OO1C 4IFDC 5K36E 3KRNA 1OYRA 5JEAF 2BA0G 2WNRA 4OO1A 2BA0D 2NN6A 4OO1D 2BA1D 2NN6D 3GMEA 4IFDD 3DD6A 4OO1E 3CDIA 5C0XF 2NN6E 4IFDE 5JEAA 2JEBA 4NBQA 5JEAD 5K36C 2PO2B 1UDNA 2C37B 5JEAE 3HKMA 5K36B 2NN6C 3L7ZB 2PO0A 2WP8B 3CDJA 2BR2B 5C0XA 4BA2B 3GLLA 5C0XD 1R6LA 3M7NG 3B4TA 5JEAC 5C0XE 1OYPA 2PO1A 2WNRB 4OO1B 4AM3A 2C39A 3GCMA 3M85G 3M85D 4IFDB 2JEAB 5C0XC 5JEAB 2C38A 4BA1B 1E3PA 2JE6B 5C0XB 3M7ND 4AIMA 2PO2A 1UDSA 1R6MA 2PNZA 2NN6B 5K36A 1OYSA 3L7ZA 2WP8A 2JEBB 5K36F 2C38B 1E3HA 2BA1G 4IFDA 3H1CA 2JEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PO0 B;  1UDQ A;  3U1K A;  2C37 A;  4AID A;  4BA1 A;  4OO1 F;  2PO1 B;  1UDO A;  2NN6 F;  4IFD F;  5K36 D;  2C39 B;  2BR2 A;  2JE6 A;  4BA2 A;  2PNZ B;  4OO1 C;  4IFD C;  5K36 E;  3KRN A;  1OYR A;  5JEA F;  2BA0 G;  2WNR A;  4OO1 A;  2BA0 D;  2NN6 A;  4OO1 D;  2BA1 D;  2NN6 D;  3GME A;  4IFD D;  3DD6 A;  4OO1 E;  3CDI A;  5C0X F;  2NN6 E;  4IFD E;  5JEA A;  2JEB A;  4NBQ A;  5JEA D;  5K36 C;  2PO2 B;  1UDN A;  2C37 B;  5JEA E;  3HKM A;  5K36 B;  2NN6 C;  3L7Z B;  2PO0 A;  2WP8 B;  3CDJ A;  2BR2 B;  5C0X A;  4BA2 B;  3GLL A;  5C0X D;  1R6L A;  3M7N G;  3B4T A;  5JEA C;  5C0X E;  1OYP A;  2PO1 A;  2WNR B;  4OO1 B;  4AM3 A;  2C39 A;  3GCM A;  3M85 G;  3M85 D;  4IFD B;  2JEA B;  5C0X C;  5JEA B;  2C38 A;  4BA1 B;  1E3P A;  2JE6 B;  5C0X B;  3M7N D;  4AIM A;  2PO2 A;  1UDS A;  1R6M A;  2PNZ A;  2NN6 B;  5K36 A;  1OYS A;  3L7Z A;  2WP8 A;  2JEB B;  5K36 F;  2C38 B;  1E3H A;  2BA1 G;  4IFD A;  3H1C A;  2JEA A; 
#chains in the Genus database with same CATH topology
 2VQF E;  3QT7 A;  4B3M E;  1FKA E;  1HNZ I;  4B3R I;  4NXM I;  1WUU A;  4KHP I;  4DV6 E;  1HR0 I;  3H4L A;  1Z0V A;  4IZK B;  4IFD F;  2PNZ B;  3NZK A;  4USM A;  2IOP A;  4FW4 A;  1XHK A;  4DV5 I;  1IBK I;  1PVG A;  5EKW A;  4DV3 E;  3Q6N A;  3DD6 A;  3OTO E;  4QNK A;  3CDI A;  3V5R A;  4IFD E;  2E5L I;  1Z59 A;  1IBM E;  4DR5 I;  2F4V I;  1FNM A;  4LFB E;  2A2C A;  4JI4 E;  1KTV A;  1ZM3 A;  4JYA I;  3JAM C;  4DUZ E;  2NN6 C;  1Y4S A;  4FWH A;  4HAC B;  2V2Z A;  3U1Y A;  2O1T A;  2IOQ A;  5JEA C;  4DR7 E;  2PO1 A;  2UXC E;  2LJP A;  3Q6M A;  2C39 A;  4DR4 E;  2UUA E;  4IFD B;  5LMN I;  4U3D A;  4X65 I;  3HJC A;  5DRQ A;  4Z7Y A;  1N36 E;  2HK3 A;  4ED4 A;  4MU4 A;  4LF8 E;  1N32 I;  1HNX E;  4FWG A;  3J7A M;  1Z0E A;  1XXE A;  2HFS A;  2HKE A;  3CWV A;  4LF7 E;  4DUY I;  4LCG A;  4LF9 I;  4DV4 E;  3T1Y E;  1I94 I;  3T1H E;  4QNJ A;  2IES A;  3UHM A;  1EA6 A;  1XMO E;  2ZM6 E;  4N3O A;  1D6T A;  1FWK A;  1H73 A;  4DR6 E;  1ZM2 A;  2VQE I;  1R6M A;  1PIE A;  2PNZ A;  4KQV A;  4LF5 E;  4JG4 A;  5K36 A;  3L7Z A;  3M6A A;  1Z0G A;  1Z5B A;  3PRY A;  1N0V C;  1YH8 A;  1XNR I;  1RR9 A;  1Z0C A;  4FW3 A;  4YY3 I;  4X64 I;  5K36 F;  1NZ0 A;  4DPY A;  3H1C A;  4OX9 I;  1Z0W A;  4URL A;  3B8H A;  1S4E A;  2J7K A;  5EL9 A;  1NHH A;  3J81 Q;  4DV1 E;  2UU9 I;  3U1K A;  2DEJ A;  1U2R A;  3PS1 A;  4BA1 A;  1USV A;  4JI1 E;  1XNQ E;  4OO1 F;  4DR1 E;  4MU3 A;  4K0K E;  2PO1 B;  2NN6 F;  4DPW A;  2C39 B;  2JE6 A;  4P52 A;  4JI0 I;  5K36 E;  3Q1Q A;  5IT9 C;  1YHC A;  3WU6 A;  5JEA F;  4AQY E;  4IFD D;  4OO1 E;  1MU5 A;  4JI8 E;  2NN6 E;  1KIJ A;  3V2U C;  4DV0 I;  5DRP A;  1ELO A;  1Z0T A;  2DEI A;  4ISA A;  4LF4 E;  5JEA E;  4DU8 A;  3HKM A;  5K36 B;  4GKJ I;  2BM0 A;  3L7Z B;  4B3T I;  2AE8 A;  4JI3 E;  2PO0 A;  3GLL A;  4JI5 E;  3PS3 A;  4MDT A;  2R42 A;  3M7N G;  3K85 A;  4LFC E;  4X66 E;  1OJ4 A;  3ZZ0 A;  4OO1 B;  1XMQ I;  4YHH I;  3ZKB A;  5FLX Q;  4P7A A;  4DR2 E;  2UXD E;  4FW5 A;  4JI6 E;  4XTJ A;  1ZXM A;  2Z5B B;  2CGE A;  5C0X C;  4DXL A;  4JI7 I;  1IBL E;  5JEA B;  4WUC A;  4BA1 B;  2JE6 B;  2BM1 A;  2NPF A;  2V2V A;  4FN5 A;  5A2Q Q;  2PO2 A;  1RHY A;  4MYU A;  4DR1 I;  1H7U A;  4DR3 I;  4PRV A;  4B3S E;  4LFA E;  2HFU A;  5LMU I;  5IWA E;  1ZM4 A;  4UTG A;  1UEK A;  1NHJ A;  2WP8 A;  3ZKD A;  2F1D A;  2UUC I;  1N33 I;  3J80 Q;  1B63 A;  4NXN I;  3J7A G;  4AQY I;  3B78 A;  2V8P A;  2E1R A;  2UXB E;  1FJG E;  1MG7 A;  3PYF A;  1N0U A;  1J5E E;  1USU A;  2HHH I;  1ZM9 A;  4GKK E;  2VQF I;  1NHI A;  3PYE A;  4X62 E;  4B3M I;  2C38 B;  2BA1 G;  2X7I A;  5L3J A;  2ZBK B;  2JEA A;  1ZXN A;  2PO0 B;  4DV6 I;  4DU7 A;  4EMD A;  2O1U A;  1HNW E;  1BKN A;  1UDQ A;  1Z5C A;  1A6F A;  3LTO A;  1HNZ E;  3WU4 A;  4B3R E;  1KKH A;  4JI3 I;  1UDO A;  4NXM E;  5K36 D;  4KHP E;  4Z7C A;  4FW6 A;  4IFD C;  3KRN A;  5GME A;  3LNU A;  2CZ9 A;  2XEX A;  4DV3 I;  3OTO I;  4OO1 A;  2NN6 A;  4LF6 E;  4OO1 D;  4DV5 E;  1IBK E;  2NN6 D;  3GME A;  3WU5 A;  1IBM I;  5FWK A;  4LOM A;  2Z5B A;  4LCF A;  4LFB I;  4OZE A;  5C0X F;  1QZR A;  1VIS A;  3PYD A;  1MX0 A;  5JEA A;  4JI4 I;  4NBQ A;  1KVK A;  5JEA D;  4DUZ I;  2PO2 B;  1UDN A;  2BV3 A;  2C37 B;  5ELW A;  4DR5 E;  4FW7 A;  3HUL A;  4IZJ A;  4UT4 A;  2WP8 B;  4BA2 B;  2BR2 B;  1VI7 A;  4DR7 I;  2PNL A;  4DV2 E;  4USK A;  2UUB E;  2UXC I;  4DR4 I;  1H7S A;  1P42 A;  2AJ4 A;  2UUA I;  4LCH A;  5C0X E;  2VES A;  1OYP A;  4MU0 A;  2WNR B;  3J81 C;  1N36 I;  4JV5 E;  3P3C A;  5DRR A;  4LF8 I;  2IER A;  1HNX I;  1H72 C;  2OI2 A;  2JEA B;  1H74 A;  5LMN E;  4LF7 I;  4DV7 E;  4X65 E;  2GS8 A;  2O1V A;  4DV4 I;  3T1Y I;  3T1H I;  4HYM A;  2C38 A;  3WU3 A;  1XMO I;  1N32 E;  1E3P A;  2O3Z A;  3QT5 A;  2ZM6 I;  4DR6 I;  1K47 A;  2GO4 A;  4FWD A;  2WW4 A;  3D4J A;  5C0X B;  4LF9 E;  3M7N D;  4DPU A;  1I94 E;  4LF5 I;  4J3D A;  4AIM A;  1UDS A;  2HKJ A;  2V34 A;  2NN6 B;  2V2Q A;  4MU1 A;  2VQE E;  2GO3 A;  2VF3 A;  3JAM Q;  2Z5C B;  4LF6 I;  4PRX A;  2J65 A;  1E3H A;  4LPF A;  1XNR E;  4DV1 I;  4IZJ B;  3F0N A;  4YY3 E;  4X64 E;  5K36 C;  4JI1 I;  1XNQ I;  5FLX C;  4K0K I;  1Z0B A;  4JI2 E;  4OX9 E;  2C37 A;  3QT6 A;  1Z5A A;  3K1J A;  3B82 A;  4AID A;  3P3G A;  4MQY A;  3K17 A;  2UU9 E;  4BA2 A;  2BR2 A;  4DV2 I;  4OO1 C;  2UUB I;  5DNL A;  2ZIT A;  1S16 A;  1OYR A;  1FI4 A;  4PU9 A;  1HK7 A;  4JI0 E;  2BA0 G;  2WNR A;  1DAR A;  4I3H A;  2BA0 D;  2CVE A;  2EFG A;  4JV5 I;  2CG9 A;  5LL6 R;  2BA1 D;  5BR8 E;  4JI8 I;  5A2Q C;  3PS2 A;  3ZZT A;  3PYG A;  1N34 E;  4MYT A;  4DV7 I;  4GQU A;  4DPT A;  4ZVI A;  1RRE A;  2GQ0 A;  4LF4 I;  2Q2E B;  2JEB A;  4RPF A;  4IS9 A;  3J80 C;  1Y5Y A;  4DV0 E;  1HR0 E;  2X36 A;  4JI5 I;  2Z5E A;  2A2D A;  5C0X A;  3CDJ A;  3GON A;  2JT2 A;  4LFC I;  5C0X D;  1Y6Z A;  1R6L A;  3ZM7 A;  4X66 I;  4GKJ E;  4B3T E;  3LPS A;  3B4T A;  2UXD I;  4DR2 I;  4OKG A;  4JI6 I;  5DRO A;  2HK2 A;  4IZK A;  5GMD A;  2R3V A;  4AM3 A;  3GCM A;  3M85 G;  3M85 D;  1IBL I;  1XMQ E;  2Z5C A;  4YHH E;  3ZZU A;  1FWL A;  5DNX A;  4WUB A;  2E5L E;  4M1K A;  2F4V E;  3QT8 A;  1B62 A;  2O1W A;  4JI7 E;  5IT9 Q;  1PKP A;  4IZJ D;  4JYA E;  4WUD A;  4JI2 I;  4U3B A;  2PNM A;  3P76 A;  4HXZ A;  1Y60 A;  4B3S I;  4LFA I;  4DPX A;  5IWA I;  4FW9 A;  4HY1 A;  3P3E A;  1OYS A;  4DR3 E;  4HAC A;  2UXB I;  1FJG I;  1Y4U A;  1J5E I;  5LMU E;  1EI1 A;  4GKK I;  4R1F A;  4X62 I;  2JEB B;  2UUC E;  5BR8 I;  1N33 E;  4NXN E;  3P06 A;  1N34 I;  4IFD A;  1HNW I;  2HHH E;  4DUY E; 
#chains in the Genus database with same CATH homology
 2PO0 B;  1UDQ A;  3U1K A;  2C37 A;  4AID A;  4BA1 A;  4OO1 F;  2PO1 B;  1UDO A;  2NN6 F;  4IFD F;  5K36 D;  2C39 B;  2BR2 A;  2JE6 A;  4BA2 A;  2PNZ B;  4OO1 C;  4IFD C;  5K36 E;  3KRN A;  1OYR A;  5JEA F;  2BA0 G;  2WNR A;  4OO1 A;  2BA0 D;  2NN6 A;  4OO1 D;  2BA1 D;  2NN6 D;  3GME A;  4IFD D;  3DD6 A;  4OO1 E;  3CDI A;  5C0X F;  2NN6 E;  4IFD E;  5JEA A;  2JEB A;  4NBQ A;  5JEA D;  5K36 C;  2PO2 B;  1UDN A;  2C37 B;  5JEA E;  3HKM A;  5K36 B;  2NN6 C;  3L7Z B;  2PO0 A;  2WP8 B;  3CDJ A;  2BR2 B;  5C0X A;  4BA2 B;  3GLL A;  5C0X D;  1R6L A;  3M7N G;  3B4T A;  5JEA C;  5C0X E;  1OYP A;  2PO1 A;  2WNR B;  4OO1 B;  4AM3 A;  2C39 A;  3GCM A;  3M85 G;  3M85 D;  4IFD B;  2JEA B;  5C0X C;  5JEA B;  2C38 A;  4BA1 B;  1E3P A;  2JE6 B;  5C0X B;  3M7N D;  4AIM A;  2PO2 A;  1UDS A;  1R6M A;  2PNZ A;  2NN6 B;  5K36 A;  1OYS A;  3L7Z A;  2WP8 A;  2JEB B;  5K36 F;  2C38 B;  1E3H A;  2BA1 G;  4IFD A;  3H1C A;  2JEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...