2UU9I

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
molecule tags Ribosome
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9I00
5IWAE 4DXLA 4NXNE 4DR4E 4PRXA 4B3TE 1HNWE 1K47A 4YY3E 1N34I 2J7KA 3V5RA 1NHHA 2DEJA 4JI3I 4KHPI 4X64I 4WUCA 3ZZTA 1FJGE 4HACA 2VQFE 1Z0BA 3PYGA 2E5LE 2OI2A 1H74A 3K17A 2UUAI 4I3HA 4LF6E 1N32E 2BM0A 1N32I 4K0KE 3B8HA 2WW4A 4DPXA 1B63A 4RPFA 1N33E 3T1HI 2VQFI 5GMEA 3JAMC 2HK3A 3GONA 3WU4A 2AJ4A 2V34A 2LJPA 2UUBE 4DR6E 4X62I 3K1JA 2V2QA 4B3TI 1IBME 1HNWI 3OTOI 5L3JA 4DV5E 1RR9A 2A2CA 1ZM9A 1Z0WA 1ZM3A 2HK2A 1HNXE 2UXDE 4X62E 2UUBI 3J81C 4USKA 1XNQE 3ZKDA 1XMOI 1FNMA 4NXME 1WUUA 4FWDA 4LF9I 3QT7A 4GKKI 4DV2I 1PKPA 1Z0CA 1N33I 1Z5BA 4JI4E 3B78A 3WU6A 4JV5E 4DU8A 4DR7I 4OX9I 2ZM6I 2HKEA 4JG4A 5BR8I 1ELOA 2DEIA 1KKHA 4B3MI 3J7AG 2UUCI 4LF8I 2V2ZA 1UEKA 3CWVA 4DPYA 3LTOA 1MX0A 2HHHE 1B62A 3T1YE 1HR0E 3ZM7A 4KHPE 4DV3E 4LF7I 5FLXC 4JV5I 2ZITA 2UU9I 4JI2I 4X66E 3LNUA 3B82A 4HXZA 4WUBA 2HHHI 4LFCI 5GMDA 4DV6E 4URLA 4LF8E 4YHHI 4DV0E 2Q2EB 2F4VI 2BM1A 4B3ME 4FW9A 1KIJA 4JI8I 4X65E 2XEXA 4DV5I 3J7AM 1QZRA 3ZZ0A 4DR1I 1IBKI 4DPTA 1XNRE 1DARA 2V8PA 4X66I 4M1KA 4B3SE 3PYDA 4DU7A 4LF7E 5FLXQ 2R3VA 1PIEA 1H7UA 1NZ0A 3OTOE 4HYMA 4YHHE 1Z59A 5A2QC 1VISA 4WUDA 4PU9A 4FWHA 1Z0VA 2UXCE 4DV6I 1H73A 4JI5E 2E1RA 2E5LI 4DR3E 3QT8A 1IBLI 2NPFA 5A2QQ 1S16A 4LF9E 4GKKE 4LFBE 3ZKBA 1EA6A 1XMQI 4JI5I 4HACB 1XNQI 4LF6I 4LF5I 2UUCE 4JYAE 3ZZUA 2CZ9A 5BR8E 4XTJA 3WU3A 1N36E 1FJGI 4DV7I 3H4LA 3D4JA 5LL6R 1FI4A 4DV4I 4DV2E 4MYTA 2GS8A 1S4EA 1EI1A 1ZXMA 4LF4E 1XMOE 4DR4I 4DV1E 2UXDI 1HNXI 3Q1QA 3J80C 2VF3A 4UT4A 1J5EI 1N36I 4JI7I 3LPSA 1XMQE 3QT5A 1H7SA 3JAMQ 1HNZE 1MU5A 2X7IA 1IBLE 1I94E 1ZM2A 4JI1E 4LFAI 1KTVA 1Z5AA 1MG7A 2X36A 4LFBI 1OJ4A 1RREA 4FWGA 4GKJE 3T1HE 4PRVA 4JI2E 4R1FA 3J80Q 1D6TA 4JI6I 4X64E 4Z7CA 3F0NA 1HNZI 1A6FA 3T1YI 1Z5CA 4JI7E 4JI0I 4UTGA 2UUAE 2ZBKB 4AQYE 1Z0GA 4HY1A 4DR2E 5LMNE 4B3SI 4DV1I 5IT9C 2EFGA 3QT6A 4DUZI 2VQEE 1IBKE 4DR1E 4DUZE 1N34E 4NXNI 4X65I 4NXMI 4JI8E 2UXBI 3PYFA 4B3RI 4DR5I 1PVGA 1ZXNA 2V2VA 4LF5E 4JYAI 4ED4A 4EMDA 4DR2I 2UXBE 4KQVA 1N0UA 1Z0EA 1BKNA 4LFCE 2F4VE 3M6AA 1N0VC 1H72C 2VQEI 1FWLA 4DUYI 4DR6I 4DR3I 1XHKA 1Z0TA 4JI6E 1NHIA 2UU9E 1HR0I 3WU5A 3J81Q 5IT9Q 5LMNI 4AQYI 4DV3I 2UXCI 2BV3A 4LFAE 1U2RA 1ZM4A 4DPWA 4DPUA 4FN5A 4DUYE 4JI1I 1I94I 4JI0E 4P52A 5LMUI 4K0KI 2HKJA 5LMUE 4MYUA 2ZM6E 4DR7E 4ZVIA 3HULA 1FKAE 2HFUA 1FWKA 1KVKA 4B3RE 4GKJI 4OX9E 1XNRI 3V2UC 2A2DA 4LF4I 4USMA 4JI4I 4JI3E 2HFSA 3PYEA 4Z7YA 4DV4E 1NHJA 4YY3I 2R42A 1J5EE 4DV7E 4P7AA 1IBMI 5IWAI 4DV0I 4DR5E
chains in the Genus database with same CATH superfamily
4OO1C 2PO1A 2Z5EA 5IWAE 4DXLA 4NXNE 4DR4E 4PRXA 4B3TE 1HNWE 2AE8A 1K47A 4YY3E 1N34I 2J7KA 3V5RA 3PS2A 1NHHA 2BR2A 3GLLA 2DEJA 4JI3I 3P3CA 4KHPI 4X64I 1Y60A 4WUCA 5C0XB 3ZZTA 3GMEA 1FJGE 4HACA 2VQFE 1Z0BA 3PYGA 2CGEA 2E5LE 2OI2A 1H74A 3K17A 2UUAI 4I3HA 4LF6E 1N32E 2NN6F 5JEAA 1HK7A 2JE6B 5K36E 2BM0A 1N32I 4K0KE 3B8HA 2WW4A 2PNZB 4DPXA 2Z5CA 2JE6A 1B63A 4RPFA 1R6LA 1N33E 4NBQA 3T1HI 1USUA 2VQFI 5GMEA 3JAMC 4IFDC 2HK3A 2CG9A 3GONA 2NN6A 3WU4A 2AJ4A 2V34A 4BA2B 2J65A 2LJPA 2UUBE 5JEAC 4X62I 4DR6E 3K1JA 2V2QA 4B3TI 1IBME 1HNWI 3OTOI 2C37B 5L3JA 4DV5E 1RR9A 3Q6MA 4IZJB 2A2CA 1ZM9A 1Z0WA 1ZM3A 2HK2A 1HNXE 2UXDE 4X62E 2UUBI 3J81C 2NN6D 4USKA 1XNQE 3ZKDA 1XMOI 4LOMA 2WNRA 1FNMA 3UHMA 4MU4A 4NXME 3M7ND 1WUUA 4AM3A 4FWDA 4LCGA 3QT7A 4LF9I 4GKKI 1VI7A 4DV2I 4QNJA 1PKPA 1Z0CA 1N33I 1Z5BA 4JI4E 1OYPA 3B78A 3WU6A 4JV5E 2NN6E 4DU8A 1Y4SA 4DR7I 4OX9I 2ZM6I 2HKEA 1RHYA 4JG4A 3P76A 3P3EA 1ELOA 5BR8I 2DEIA 1KKHA 4B3MI 5DNXA 3J7AG 2UUCI 4IZKA 4LF8I 2V2ZA 1UEKA 3CWVA 3U1YA 4DPYA 2IERA 1MX0A 2NN6C 3LTOA 2HHHE 5K36A 2PO0A 1XXEA 4OKGA 1B62A 1YH8A 3T1YE 3H1CA 4IZKB 1HR0E 4J3DA 3ZM7A 4KHPE 4MDTA 4DV3E 5K36B 4LF7I 5FLXC 4JV5I 2ZITA 2UU9I 4JI2I 1UDOA 4GQUA 4X66E 3LNUA 2PO2B 3B82A 4HXZA 4WUBA 2HHHI 4LFCI 5GMDA 4DV6E 4URLA 4LCFA 4LF8E 4YHHI 4DV0E 2Q2EB 2BA1D 2PO2A 4FW5A 2F4VI 4MU3A 2BM1A 4B3ME 4FW9A 3M85G 1KIJA 4JI8I 4X65E 2XEXA 4DV5I 3J7AM 1QZRA 3ZZ0A 1E3HA 2IOQA 4DR1I 1IBKI 5DROA 2O3ZA 4DPTA 4OO1A 1XNRE 5K36F 5EL9A 1DARA 2V8PA 4X66I 3DD6A 4M1KA 4B3SE 3PYDA 4MQYA 4DU7A 4AIDA 2C39B 4LF7E 2BA0G 2IESA 3CDJA 5FLXQ 2R3VA 1PIEA 1UDSA 1P42A 1H7UA 1NZ0A 3OTOE 5C0XD 5JEAE 2C38A 2JEAA 4MU0A 4HYMA 4YHHE 1Z59A 5A2QC 4MU1A 1VISA 4WUDA 4OO1D 4PU9A 4FWHA 1Z0VA 2PNLA 2UXCE 1R6MA 4DV6I 5DRQA 5JEAD 1H73A 4JI5E 3PS3A 2E1RA 2Z5BB 2E5LI 1YHCA 5DNLA 3QT8A 3P06A 4DR3E 1UDNA 2Z5BA 3PRYA 1IBLI 3U1KA 5FWKA 2NPFA 5A2QQ 1S16A 4LF9E 4BA1B 4GKKE 4LFBE 3NZKA 3ZKBA 1EA6A 1XMQI 4JI5I 4HACB 4FW7A 1XNQI 4LF6I 4LF5I 2UUCE 4JYAE 3ZZUA 1Y6ZA 2CZ9A 4BA1A 5DRRA 5BR8E 4XTJA 3WU3A 1N36E 4LPFA 1FJGI 2BR2B 4DV7I 3H4LA 5JEAB 3CDIA 3D4JA 5LL6R 5C0XA 1FI4A 4DV4I 4DV2E 4MYTA 2GS8A 2PNZA 1S4EA 1EI1A 5DRPA 1ZXMA 4LF4E 5JEAF 1XMOE 4DR4I 4AIMA 4DV1E 2UXDI 1HNXI 2NN6B 3Q1QA 2GQ0A 3J80C 2VF3A 4UT4A 2O1TA 2GO4A 1J5EI 1N36I 3LPSA 4JI7I 1XMQE 2Z5CB 3QT5A 1H7SA 3JAMQ 2C37A 3HJCA 3PS1A 4OZEA 1HNZE 1MU5A 2X7IA 3GCMA 4IZJA 1IBLE 2IOPA 1I94E 1ZM2A 1USVA 4JI1E 3L7ZB 4LFAI 1KTVA 1Z5AA 5K36D 2O1UA 5K36C 1MG7A 2X36A 4BA2A 4LFBI 4IS9A 1OJ4A 1RREA 4FWGA 4GKJE 2WP8A 3T1HE 4PRVA 4JI2E 4R1FA 3L7ZA 3J80Q 1D6TA 4JI6I 4X64E 4Z7CA 3F0NA 2GO3A 1HNZI 2WP8B 1Y5YA 3P3GA 4FW4A 1A6FA 3T1YI 1Z5CA 4JI7E 4JI0I 4UTGA 1OYRA 2UUAE 2BA0D 2ZBKB 2WNRB 4AQYE 1Z0GA 4HY1A 4DR2E 5LMNE 4B3SI 4FW6A 2PNMA 4DV1I 4FW3A 5IT9C 3K85A 4IFDA 5C0XE 2EFGA 3QT6A 4DUZI 2VQEE 1IBKE 4U3DA 4DR1E 4IFDB 4DUZE 1N34E 1E3PA 4NXNI 4ISAA 3M85D 4X65I 4NXMI 4JI8E 2UXBI 3PYFA 4N3OA 4U3BA 4B3RI 2JEBA 4DR5I 1PVGA 1ZXNA 2V2VA 2PO0B 4IFDE 4LF5E 4JYAI 4ED4A 4EMDA 4DR2I 2UXBE 4KQVA 1N0UA 1Z0EA 1BKNA 2JEBB 4OO1F 4QNKA 4LFCE 4OO1E 2F4VE 3M6AA 5ELWA 1N0VC 1H72C 5C0XF 4LCHA 2VQEI 1FWLA 4DUYI 4DR6I 4DR3I 1XHKA 1Z0TA 4JI6E 3KRNA 1NHIA 2UU9E 1HR0I 3B4TA 3WU5A 3J81Q 5IT9Q 5LMNI 4AQYI 3HKMA 4DV3I 2UXCI 2JT2A 2BV3A 4LFAE 1U2RA 1ZM4A 4DPWA 4DPUA 2O1WA 4FN5A 4JI1I 4DUYE 1I94I 4JI0E 4P52A 5LMUI 4K0KI 2BA1G 2HKJA 2VESA 5LMUE 4MYUA 1UDQA 5EKWA 2ZM6E 4DR7E 4OO1B 3Q6NA 2O1VA 2C38B 2JEAB 4ZVIA 3HULA 1FKAE 2HFUA 1FWKA 1KVKA 4B3RE 4GKJI 5C0XC 4IFDD 4OX9E 1XNRI 2C39A 3V2UC 2A2DA 2F1DA 4LF4I 1Y4UA 4USMA 4JI4I 4JI3E 2HFSA 3PYEA 2CVEA 4Z7YA 4IFDF 4IZJD 4DV4E 1NHJA 1OYSA 4YY3I 2R42A 1J5EE 2PO1B 4DV7E 3M7NG 4P7AA 1IBMI 5IWAI 4DV0I 4DR5E
chains in the Genus database with same CATH topology
2Z5EA 5IWAE 4DXLA 4NXNE 4DR4E 4PRXA 4B3TE 1HNWE 1K47A 4YY3E 1N34I 2J7KA 3V5RA 1NHHA 2DEJA 4JI3I 4KHPI 4X64I 4WUCA 3ZZTA 1FJGE 4HACA 2VQFE 1Z0BA 3PYGA 2CGEA 2E5LE 2OI2A 1H74A 3K17A 2UUAI 4I3HA 4LF6E 1N32E 1HK7A 2BM0A 1N32I 4K0KE 3B8HA 2WW4A 4DPXA 2Z5CA 1B63A 4RPFA 1N33E 3T1HI 1USUA 2VQFI 5GMEA 3JAMC 2HK3A 2CG9A 3GONA 3WU4A 2AJ4A 2V34A 2LJPA 2UUBE 4DR6E 4X62I 3K1JA 2V2QA 4B3TI 1IBME 1HNWI 3OTOI 5L3JA 4DV5E 1RR9A 3Q6MA 4IZJB 2A2CA 1ZM9A 1Z0WA 1ZM3A 2HK2A 1HNXE 2UXDE 4X62E 2UUBI 3J81C 4USKA 1XNQE 3ZKDA 1XMOI 1FNMA 4NXME 1WUUA 4FWDA 4LF9I 3QT7A 4GKKI 4DV2I 1PKPA 1Z0CA 1N33I 1Z5BA 4JI4E 3B78A 3WU6A 4JV5E 4DU8A 1Y4SA 4DR7I 4OX9I 2ZM6I 2HKEA 4JG4A 5BR8I 1ELOA 2DEIA 1KKHA 4B3MI 3J7AG 2UUCI 4IZKA 4LF8I 2V2ZA 1UEKA 3CWVA 4DPYA 3LTOA 1MX0A 2HHHE 1B62A 3T1YE 4IZKB 1HR0E 3ZM7A 4KHPE 4DV3E 4LF7I 5FLXC 4JV5I 2ZITA 2UU9I 4JI2I 4X66E 3LNUA 3B82A 4HXZA 4WUBA 2HHHI 4LFCI 5GMDA 4DV6E 4URLA 4LF8E 4YHHI 4DV0E 2Q2EB 2F4VI 2BM1A 4B3ME 4FW9A 1KIJA 4JI8I 4X65E 2XEXA 4DV5I 3J7AM 1QZRA 3ZZ0A 4DR1I 2IOQA 1IBKI 4DPTA 1XNRE 1DARA 2V8PA 4X66I 4M1KA 4B3SE 3PYDA 4DU7A 4LF7E 5FLXQ 2R3VA 1PIEA 1H7UA 1NZ0A 3OTOE 4HYMA 4YHHE 1Z59A 5A2QC 1VISA 4WUDA 4PU9A 4FWHA 1Z0VA 2PNLA 2UXCE 4DV6I 1H73A 4JI5E 2E1RA 2Z5BB 2E5LI 4DR3E 3QT8A 3P06A 3PRYA 2Z5BA 1IBLI 5FWKA 2NPFA 5A2QQ 1S16A 4LF9E 4GKKE 4LFBE 3ZKBA 1EA6A 1XMQI 4JI5I 4HACB 1XNQI 4LF6I 4LF5I 2UUCE 4JYAE 3ZZUA 1Y6ZA 2CZ9A 5BR8E 4XTJA 3WU3A 1N36E 1FJGI 4DV7I 3H4LA 3D4JA 5LL6R 1FI4A 4DV4I 4DV2E 4MYTA 2GS8A 1S4EA 1EI1A 1ZXMA 4LF4E 1XMOE 4DR4I 4DV1E 2UXDI 1HNXI 3Q1QA 2GQ0A 3J80C 2VF3A 4UT4A 2O1TA 1J5EI 1N36I 3LPSA 4JI7I 1XMQE 2Z5CB 3QT5A 1H7SA 3JAMQ 3HJCA 1HNZE 1MU5A 2X7IA 1IBLE 4IZJA 2IOPA 1I94E 1ZM2A 1USVA 4JI1E 4LFAI 1KTVA 1Z5AA 2O1UA 1MG7A 2X36A 4LFBI 1OJ4A 1RREA 4FWGA 4GKJE 3T1HE 4PRVA 4JI2E 4R1FA 3J80Q 1D6TA 4JI6I 4X64E 4Z7CA 3F0NA 1HNZI 1A6FA 3T1YI 1Z5CA 4JI7E 4JI0I 4UTGA 2UUAE 2ZBKB 4AQYE 1Z0GA 4HY1A 4DR2E 5LMNE 4B3SI 2PNMA 4DV1I 5IT9C 3K85A 2EFGA 3QT6A 4DUZI 2VQEE 1IBKE 4DR1E 4DUZE 1N34E 4NXNI 4X65I 4NXMI 4JI8E 2UXBI 3PYFA 4N3OA 4B3RI 4DR5I 1PVGA 1ZXNA 2V2VA 4LF5E 4JYAI 4ED4A 4EMDA 4DR2I 2UXBE 4KQVA 1N0UA 1Z0EA 1BKNA 4LFCE 2F4VE 3M6AA 1N0VC 1H72C 2VQEI 1FWLA 4DUYI 4DR6I 4DR3I 1XHKA 1Z0TA 4JI6E 1NHIA 2UU9E 1HR0I 3WU5A 3J81Q 5IT9Q 5LMNI 4AQYI 4DV3I 2UXCI 2BV3A 4LFAE 1U2RA 1ZM4A 4DPWA 4DPUA 2O1WA 4FN5A 4JI1I 4DUYE 1I94I 4JI0E 4P52A 5LMUI 4K0KI 2HKJA 5LMUE 4MYUA 2ZM6E 4DR7E 3Q6NA 2O1VA 4ZVIA 3HULA 1FKAE 2HFUA 1FWKA 1KVKA 4B3RE 4GKJI 4OX9E 1XNRI 3V2UC 2A2DA 4LF4I 1Y4UA 4USMA 4JI4I 4JI3E 2HFSA 3PYEA 4Z7YA 4IZJD 4DV4E 1NHJA 4YY3I 2R42A 1J5EE 4DV7E 4P7AA 1IBMI 5IWAI 4DV0I 4DR5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA E;  4DXL A;  4NXN E;  4DR4 E;  4PRX A;  4B3T E;  1HNW E;  1K47 A;  4YY3 E;  1N34 I;  2J7K A;  3V5R A;  1NHH A;  2DEJ A;  4JI3 I;  4KHP I;  4X64 I;  4WUC A;  3ZZT A;  1FJG E;  4HAC A;  2VQF E;  1Z0B A;  3PYG A;  2E5L E;  2OI2 A;  1H74 A;  3K17 A;  2UUA I;  4I3H A;  4LF6 E;  1N32 E;  2BM0 A;  1N32 I;  4K0K E;  3B8H A;  2WW4 A;  4DPX A;  1B63 A;  4RPF A;  1N33 E;  3T1H I;  2VQF I;  5GME A;  3JAM C;  2HK3 A;  3GON A;  3WU4 A;  2AJ4 A;  2V34 A;  2LJP A;  2UUB E;  4DR6 E;  4X62 I;  3K1J A;  2V2Q A;  4B3T I;  1IBM E;  1HNW I;  3OTO I;  5L3J A;  4DV5 E;  1RR9 A;  2A2C A;  1ZM9 A;  1Z0W A;  1ZM3 A;  2HK2 A;  1HNX E;  2UXD E;  4X62 E;  2UUB I;  3J81 C;  4USK A;  1XNQ E;  3ZKD A;  1XMO I;  1FNM A;  4NXM E;  1WUU A;  4FWD A;  4LF9 I;  3QT7 A;  4GKK I;  4DV2 I;  1PKP A;  1Z0C A;  1N33 I;  1Z5B A;  4JI4 E;  3B78 A;  3WU6 A;  4JV5 E;  4DU8 A;  4DR7 I;  4OX9 I;  2ZM6 I;  2HKE A;  4JG4 A;  5BR8 I;  1ELO A;  2DEI A;  1KKH A;  4B3M I;  3J7A G;  2UUC I;  4LF8 I;  2V2Z A;  1UEK A;  3CWV A;  4DPY A;  3LTO A;  1MX0 A;  2HHH E;  1B62 A;  3T1Y E;  1HR0 E;  3ZM7 A;  4KHP E;  4DV3 E;  4LF7 I;  5FLX C;  4JV5 I;  2ZIT A;  2UU9 I;  4JI2 I;  4X66 E;  3LNU A;  3B82 A;  4HXZ A;  4WUB A;  2HHH I;  4LFC I;  5GMD A;  4DV6 E;  4URL A;  4LF8 E;  4YHH I;  4DV0 E;  2Q2E B;  2F4V I;  2BM1 A;  4B3M E;  4FW9 A;  1KIJ A;  4JI8 I;  4X65 E;  2XEX A;  4DV5 I;  3J7A M;  1QZR A;  3ZZ0 A;  4DR1 I;  1IBK I;  4DPT A;  1XNR E;  1DAR A;  2V8P A;  4X66 I;  4M1K A;  4B3S E;  3PYD A;  4DU7 A;  4LF7 E;  5FLX Q;  2R3V A;  1PIE A;  1H7U A;  1NZ0 A;  3OTO E;  4HYM A;  4YHH E;  1Z59 A;  5A2Q C;  1VIS A;  4WUD A;  4PU9 A;  4FWH A;  1Z0V A;  2UXC E;  4DV6 I;  1H73 A;  4JI5 E;  2E1R A;  2E5L I;  4DR3 E;  3QT8 A;  1IBL I;  2NPF A;  5A2Q Q;  1S16 A;  4LF9 E;  4GKK E;  4LFB E;  3ZKB A;  1EA6 A;  1XMQ I;  4JI5 I;  4HAC B;  1XNQ I;  4LF6 I;  4LF5 I;  2UUC E;  4JYA E;  3ZZU A;  2CZ9 A;  5BR8 E;  4XTJ A;  3WU3 A;  1N36 E;  1FJG I;  4DV7 I;  3H4L A;  3D4J A;  5LL6 R;  1FI4 A;  4DV4 I;  4DV2 E;  4MYT A;  2GS8 A;  1S4E A;  1EI1 A;  1ZXM A;  4LF4 E;  1XMO E;  4DR4 I;  4DV1 E;  2UXD I;  1HNX I;  3Q1Q A;  3J80 C;  2VF3 A;  4UT4 A;  1J5E I;  1N36 I;  4JI7 I;  3LPS A;  1XMQ E;  3QT5 A;  1H7S A;  3JAM Q;  1HNZ E;  1MU5 A;  2X7I A;  1IBL E;  1I94 E;  1ZM2 A;  4JI1 E;  4LFA I;  1KTV A;  1Z5A A;  1MG7 A;  2X36 A;  4LFB I;  1OJ4 A;  1RRE A;  4FWG A;  4GKJ E;  3T1H E;  4PRV A;  4JI2 E;  4R1F A;  3J80 Q;  1D6T A;  4JI6 I;  4X64 E;  4Z7C A;  3F0N A;  1HNZ I;  1A6F A;  3T1Y I;  1Z5C A;  4JI7 E;  4JI0 I;  4UTG A;  2UUA E;  2ZBK B;  4AQY E;  1Z0G A;  4HY1 A;  4DR2 E;  5LMN E;  4B3S I;  4DV1 I;  5IT9 C;  2EFG A;  3QT6 A;  4DUZ I;  2VQE E;  1IBK E;  4DR1 E;  4DUZ E;  1N34 E;  4NXN I;  4X65 I;  4NXM I;  4JI8 E;  2UXB I;  3PYF A;  4B3R I;  4DR5 I;  1PVG A;  1ZXN A;  2V2V A;  4LF5 E;  4JYA I;  4ED4 A;  4EMD A;  4DR2 I;  2UXB E;  4KQV A;  1N0U A;  1Z0E A;  1BKN A;  4LFC E;  2F4V E;  3M6A A;  1N0V C;  1H72 C;  2VQE I;  1FWL A;  4DUY I;  4DR6 I;  4DR3 I;  1XHK A;  1Z0T A;  4JI6 E;  1NHI A;  2UU9 E;  1HR0 I;  3WU5 A;  3J81 Q;  5IT9 Q;  5LMN I;  4AQY I;  4DV3 I;  2UXC I;  2BV3 A;  4LFA E;  1U2R A;  1ZM4 A;  4DPW A;  4DPU A;  4FN5 A;  4DUY E;  4JI1 I;  1I94 I;  4JI0 E;  4P52 A;  5LMU I;  4K0K I;  2HKJ A;  5LMU E;  4MYU A;  2ZM6 E;  4DR7 E;  4ZVI A;  3HUL A;  1FKA E;  2HFU A;  1FWK A;  1KVK A;  4B3R E;  4GKJ I;  4OX9 E;  1XNR I;  3V2U C;  2A2D A;  4LF4 I;  4USM A;  4JI4 I;  4JI3 E;  2HFS A;  3PYE A;  4Z7Y A;  4DV4 E;  1NHJ A;  4YY3 I;  2R42 A;  1J5E E;  4DV7 E;  4P7A A;  1IBM I;  5IWA I;  4DV0 I;  4DR5 E; 
#chains in the Genus database with same CATH topology
 4OO1 C;  2PO1 A;  2Z5E A;  5IWA E;  4DXL A;  4NXN E;  4DR4 E;  4PRX A;  4B3T E;  1HNW E;  2AE8 A;  1K47 A;  4YY3 E;  1N34 I;  2J7K A;  3V5R A;  3PS2 A;  1NHH A;  2BR2 A;  3GLL A;  2DEJ A;  4JI3 I;  3P3C A;  4KHP I;  4X64 I;  1Y60 A;  4WUC A;  5C0X B;  3ZZT A;  3GME A;  1FJG E;  4HAC A;  2VQF E;  1Z0B A;  3PYG A;  2CGE A;  2E5L E;  2OI2 A;  1H74 A;  3K17 A;  2UUA I;  4I3H A;  4LF6 E;  1N32 E;  2NN6 F;  5JEA A;  1HK7 A;  2JE6 B;  5K36 E;  2BM0 A;  1N32 I;  4K0K E;  3B8H A;  2WW4 A;  2PNZ B;  4DPX A;  2Z5C A;  2JE6 A;  1B63 A;  4RPF A;  1R6L A;  1N33 E;  4NBQ A;  3T1H I;  1USU A;  2VQF I;  5GME A;  3JAM C;  4IFD C;  2HK3 A;  2CG9 A;  3GON A;  2NN6 A;  3WU4 A;  2AJ4 A;  2V34 A;  4BA2 B;  2J65 A;  2LJP A;  2UUB E;  5JEA C;  4X62 I;  4DR6 E;  3K1J A;  2V2Q A;  4B3T I;  1IBM E;  1HNW I;  3OTO I;  2C37 B;  5L3J A;  4DV5 E;  1RR9 A;  3Q6M A;  4IZJ B;  2A2C A;  1ZM9 A;  1Z0W A;  1ZM3 A;  2HK2 A;  1HNX E;  2UXD E;  4X62 E;  2UUB I;  3J81 C;  2NN6 D;  4USK A;  1XNQ E;  3ZKD A;  1XMO I;  4LOM A;  2WNR A;  1FNM A;  3UHM A;  4MU4 A;  4NXM E;  3M7N D;  1WUU A;  4AM3 A;  4FWD A;  4LCG A;  3QT7 A;  4LF9 I;  4GKK I;  1VI7 A;  4DV2 I;  4QNJ A;  1PKP A;  1Z0C A;  1N33 I;  1Z5B A;  4JI4 E;  1OYP A;  3B78 A;  3WU6 A;  4JV5 E;  2NN6 E;  4DU8 A;  1Y4S A;  4DR7 I;  4OX9 I;  2ZM6 I;  2HKE A;  1RHY A;  4JG4 A;  3P76 A;  3P3E A;  1ELO A;  5BR8 I;  2DEI A;  1KKH A;  4B3M I;  5DNX A;  3J7A G;  2UUC I;  4IZK A;  4LF8 I;  2V2Z A;  1UEK A;  3CWV A;  3U1Y A;  4DPY A;  2IER A;  1MX0 A;  2NN6 C;  3LTO A;  2HHH E;  5K36 A;  2PO0 A;  1XXE A;  4OKG A;  1B62 A;  1YH8 A;  3T1Y E;  3H1C A;  4IZK B;  1HR0 E;  4J3D A;  3ZM7 A;  4KHP E;  4MDT A;  4DV3 E;  5K36 B;  4LF7 I;  5FLX C;  4JV5 I;  2ZIT A;  2UU9 I;  4JI2 I;  1UDO A;  4GQU A;  4X66 E;  3LNU A;  2PO2 B;  3B82 A;  4HXZ A;  4WUB A;  2HHH I;  4LFC I;  5GMD A;  4DV6 E;  4URL A;  4LCF A;  4LF8 E;  4YHH I;  4DV0 E;  2Q2E B;  2BA1 D;  2PO2 A;  4FW5 A;  2F4V I;  4MU3 A;  2BM1 A;  4B3M E;  4FW9 A;  3M85 G;  1KIJ A;  4JI8 I;  4X65 E;  2XEX A;  4DV5 I;  3J7A M;  1QZR A;  3ZZ0 A;  1E3H A;  2IOQ A;  4DR1 I;  1IBK I;  5DRO A;  2O3Z A;  4DPT A;  4OO1 A;  1XNR E;  5K36 F;  5EL9 A;  1DAR A;  2V8P A;  4X66 I;  3DD6 A;  4M1K A;  4B3S E;  3PYD A;  4MQY A;  4DU7 A;  4AID A;  2C39 B;  4LF7 E;  2BA0 G;  2IES A;  3CDJ A;  5FLX Q;  2R3V A;  1PIE A;  1UDS A;  1P42 A;  1H7U A;  1NZ0 A;  3OTO E;  5C0X D;  5JEA E;  2C38 A;  2JEA A;  4MU0 A;  4HYM A;  4YHH E;  1Z59 A;  5A2Q C;  4MU1 A;  1VIS A;  4WUD A;  4OO1 D;  4PU9 A;  4FWH A;  1Z0V A;  2PNL A;  2UXC E;  1R6M A;  4DV6 I;  5DRQ A;  5JEA D;  1H73 A;  4JI5 E;  3PS3 A;  2E1R A;  2Z5B B;  2E5L I;  1YHC A;  5DNL A;  3QT8 A;  3P06 A;  4DR3 E;  1UDN A;  2Z5B A;  3PRY A;  1IBL I;  3U1K A;  5FWK A;  2NPF A;  5A2Q Q;  1S16 A;  4LF9 E;  4BA1 B;  4GKK E;  4LFB E;  3NZK A;  3ZKB A;  1EA6 A;  1XMQ I;  4JI5 I;  4HAC B;  4FW7 A;  1XNQ I;  4LF6 I;  4LF5 I;  2UUC E;  4JYA E;  3ZZU A;  1Y6Z A;  2CZ9 A;  4BA1 A;  5DRR A;  5BR8 E;  4XTJ A;  3WU3 A;  1N36 E;  4LPF A;  1FJG I;  2BR2 B;  4DV7 I;  3H4L A;  5JEA B;  3CDI A;  3D4J A;  5LL6 R;  5C0X A;  1FI4 A;  4DV4 I;  4DV2 E;  4MYT A;  2GS8 A;  2PNZ A;  1S4E A;  1EI1 A;  5DRP A;  1ZXM A;  4LF4 E;  5JEA F;  1XMO E;  4DR4 I;  4AIM A;  4DV1 E;  2UXD I;  1HNX I;  2NN6 B;  3Q1Q A;  2GQ0 A;  3J80 C;  2VF3 A;  4UT4 A;  2O1T A;  2GO4 A;  1J5E I;  1N36 I;  3LPS A;  4JI7 I;  1XMQ E;  2Z5C B;  3QT5 A;  1H7S A;  3JAM Q;  2C37 A;  3HJC A;  3PS1 A;  4OZE A;  1HNZ E;  1MU5 A;  2X7I A;  3GCM A;  4IZJ A;  1IBL E;  2IOP A;  1I94 E;  1ZM2 A;  1USV A;  4JI1 E;  3L7Z B;  4LFA I;  1KTV A;  1Z5A A;  5K36 D;  2O1U A;  5K36 C;  1MG7 A;  2X36 A;  4BA2 A;  4LFB I;  4IS9 A;  1OJ4 A;  1RRE A;  4FWG A;  4GKJ E;  2WP8 A;  3T1H E;  4PRV A;  4JI2 E;  4R1F A;  3L7Z A;  3J80 Q;  1D6T A;  4JI6 I;  4X64 E;  4Z7C A;  3F0N A;  2GO3 A;  1HNZ I;  2WP8 B;  1Y5Y A;  3P3G A;  4FW4 A;  1A6F A;  3T1Y I;  1Z5C A;  4JI7 E;  4JI0 I;  4UTG A;  1OYR A;  2UUA E;  2BA0 D;  2ZBK B;  2WNR B;  4AQY E;  1Z0G A;  4HY1 A;  4DR2 E;  5LMN E;  4B3S I;  4FW6 A;  2PNM A;  4DV1 I;  4FW3 A;  5IT9 C;  3K85 A;  4IFD A;  5C0X E;  2EFG A;  3QT6 A;  4DUZ I;  2VQE E;  1IBK E;  4U3D A;  4DR1 E;  4IFD B;  4DUZ E;  1N34 E;  1E3P A;  4NXN I;  4ISA A;  3M85 D;  4X65 I;  4NXM I;  4JI8 E;  2UXB I;  3PYF A;  4N3O A;  4U3B A;  4B3R I;  2JEB A;  4DR5 I;  1PVG A;  1ZXN A;  2V2V A;  2PO0 B;  4IFD E;  4LF5 E;  4JYA I;  4ED4 A;  4EMD A;  4DR2 I;  2UXB E;  4KQV A;  1N0U A;  1Z0E A;  1BKN A;  2JEB B;  4OO1 F;  4QNK A;  4LFC E;  4OO1 E;  2F4V E;  3M6A A;  5ELW A;  1N0V C;  1H72 C;  5C0X F;  4LCH A;  2VQE I;  1FWL A;  4DUY I;  4DR6 I;  4DR3 I;  1XHK A;  1Z0T A;  4JI6 E;  3KRN A;  1NHI A;  2UU9 E;  1HR0 I;  3B4T A;  3WU5 A;  3J81 Q;  5IT9 Q;  5LMN I;  4AQY I;  3HKM A;  4DV3 I;  2UXC I;  2JT2 A;  2BV3 A;  4LFA E;  1U2R A;  1ZM4 A;  4DPW A;  4DPU A;  2O1W A;  4FN5 A;  4JI1 I;  4DUY E;  1I94 I;  4JI0 E;  4P52 A;  5LMU I;  4K0K I;  2BA1 G;  2HKJ A;  2VES A;  5LMU E;  4MYU A;  1UDQ A;  5EKW A;  2ZM6 E;  4DR7 E;  4OO1 B;  3Q6N A;  2O1V A;  2C38 B;  2JEA B;  4ZVI A;  3HUL A;  1FKA E;  2HFU A;  1FWK A;  1KVK A;  4B3R E;  4GKJ I;  5C0X C;  4IFD D;  4OX9 E;  1XNR I;  2C39 A;  3V2U C;  2A2D A;  2F1D A;  4LF4 I;  1Y4U A;  4USM A;  4JI4 I;  4JI3 E;  2HFS A;  3PYE A;  2CVE A;  4Z7Y A;  4IFD F;  4IZJ D;  4DV4 E;  1NHJ A;  1OYS A;  4YY3 I;  2R42 A;  1J5E E;  2PO1 B;  4DV7 E;  3M7N G;  4P7A A;  1IBM I;  5IWA I;  4DV0 I;  4DR5 E; 
#chains in the Genus database with same CATH homology
 2Z5E A;  5IWA E;  4DXL A;  4NXN E;  4DR4 E;  4PRX A;  4B3T E;  1HNW E;  1K47 A;  4YY3 E;  1N34 I;  2J7K A;  3V5R A;  1NHH A;  2DEJ A;  4JI3 I;  4KHP I;  4X64 I;  4WUC A;  3ZZT A;  1FJG E;  4HAC A;  2VQF E;  1Z0B A;  3PYG A;  2CGE A;  2E5L E;  2OI2 A;  1H74 A;  3K17 A;  2UUA I;  4I3H A;  4LF6 E;  1N32 E;  1HK7 A;  2BM0 A;  1N32 I;  4K0K E;  3B8H A;  2WW4 A;  4DPX A;  2Z5C A;  1B63 A;  4RPF A;  1N33 E;  3T1H I;  1USU A;  2VQF I;  5GME A;  3JAM C;  2HK3 A;  2CG9 A;  3GON A;  3WU4 A;  2AJ4 A;  2V34 A;  2LJP A;  2UUB E;  4DR6 E;  4X62 I;  3K1J A;  2V2Q A;  4B3T I;  1IBM E;  1HNW I;  3OTO I;  5L3J A;  4DV5 E;  1RR9 A;  3Q6M A;  4IZJ B;  2A2C A;  1ZM9 A;  1Z0W A;  1ZM3 A;  2HK2 A;  1HNX E;  2UXD E;  4X62 E;  2UUB I;  3J81 C;  4USK A;  1XNQ E;  3ZKD A;  1XMO I;  1FNM A;  4NXM E;  1WUU A;  4FWD A;  4LF9 I;  3QT7 A;  4GKK I;  4DV2 I;  1PKP A;  1Z0C A;  1N33 I;  1Z5B A;  4JI4 E;  3B78 A;  3WU6 A;  4JV5 E;  4DU8 A;  1Y4S A;  4DR7 I;  4OX9 I;  2ZM6 I;  2HKE A;  4JG4 A;  5BR8 I;  1ELO A;  2DEI A;  1KKH A;  4B3M I;  3J7A G;  2UUC I;  4IZK A;  4LF8 I;  2V2Z A;  1UEK A;  3CWV A;  4DPY A;  3LTO A;  1MX0 A;  2HHH E;  1B62 A;  3T1Y E;  4IZK B;  1HR0 E;  3ZM7 A;  4KHP E;  4DV3 E;  4LF7 I;  5FLX C;  4JV5 I;  2ZIT A;  2UU9 I;  4JI2 I;  4X66 E;  3LNU A;  3B82 A;  4HXZ A;  4WUB A;  2HHH I;  4LFC I;  5GMD A;  4DV6 E;  4URL A;  4LF8 E;  4YHH I;  4DV0 E;  2Q2E B;  2F4V I;  2BM1 A;  4B3M E;  4FW9 A;  1KIJ A;  4JI8 I;  4X65 E;  2XEX A;  4DV5 I;  3J7A M;  1QZR A;  3ZZ0 A;  4DR1 I;  2IOQ A;  1IBK I;  4DPT A;  1XNR E;  1DAR A;  2V8P A;  4X66 I;  4M1K A;  4B3S E;  3PYD A;  4DU7 A;  4LF7 E;  5FLX Q;  2R3V A;  1PIE A;  1H7U A;  1NZ0 A;  3OTO E;  4HYM A;  4YHH E;  1Z59 A;  5A2Q C;  1VIS A;  4WUD A;  4PU9 A;  4FWH A;  1Z0V A;  2PNL A;  2UXC E;  4DV6 I;  1H73 A;  4JI5 E;  2E1R A;  2Z5B B;  2E5L I;  4DR3 E;  3QT8 A;  3P06 A;  3PRY A;  2Z5B A;  1IBL I;  5FWK A;  2NPF A;  5A2Q Q;  1S16 A;  4LF9 E;  4GKK E;  4LFB E;  3ZKB A;  1EA6 A;  1XMQ I;  4JI5 I;  4HAC B;  1XNQ I;  4LF6 I;  4LF5 I;  2UUC E;  4JYA E;  3ZZU A;  1Y6Z A;  2CZ9 A;  5BR8 E;  4XTJ A;  3WU3 A;  1N36 E;  1FJG I;  4DV7 I;  3H4L A;  3D4J A;  5LL6 R;  1FI4 A;  4DV4 I;  4DV2 E;  4MYT A;  2GS8 A;  1S4E A;  1EI1 A;  1ZXM A;  4LF4 E;  1XMO E;  4DR4 I;  4DV1 E;  2UXD I;  1HNX I;  3Q1Q A;  2GQ0 A;  3J80 C;  2VF3 A;  4UT4 A;  2O1T A;  1J5E I;  1N36 I;  3LPS A;  4JI7 I;  1XMQ E;  2Z5C B;  3QT5 A;  1H7S A;  3JAM Q;  3HJC A;  1HNZ E;  1MU5 A;  2X7I A;  1IBL E;  4IZJ A;  2IOP A;  1I94 E;  1ZM2 A;  1USV A;  4JI1 E;  4LFA I;  1KTV A;  1Z5A A;  2O1U A;  1MG7 A;  2X36 A;  4LFB I;  1OJ4 A;  1RRE A;  4FWG A;  4GKJ E;  3T1H E;  4PRV A;  4JI2 E;  4R1F A;  3J80 Q;  1D6T A;  4JI6 I;  4X64 E;  4Z7C A;  3F0N A;  1HNZ I;  1A6F A;  3T1Y I;  1Z5C A;  4JI7 E;  4JI0 I;  4UTG A;  2UUA E;  2ZBK B;  4AQY E;  1Z0G A;  4HY1 A;  4DR2 E;  5LMN E;  4B3S I;  2PNM A;  4DV1 I;  5IT9 C;  3K85 A;  2EFG A;  3QT6 A;  4DUZ I;  2VQE E;  1IBK E;  4DR1 E;  4DUZ E;  1N34 E;  4NXN I;  4X65 I;  4NXM I;  4JI8 E;  2UXB I;  3PYF A;  4N3O A;  4B3R I;  4DR5 I;  1PVG A;  1ZXN A;  2V2V A;  4LF5 E;  4JYA I;  4ED4 A;  4EMD A;  4DR2 I;  2UXB E;  4KQV A;  1N0U A;  1Z0E A;  1BKN A;  4LFC E;  2F4V E;  3M6A A;  1N0V C;  1H72 C;  2VQE I;  1FWL A;  4DUY I;  4DR6 I;  4DR3 I;  1XHK A;  1Z0T A;  4JI6 E;  1NHI A;  2UU9 E;  1HR0 I;  3WU5 A;  3J81 Q;  5IT9 Q;  5LMN I;  4AQY I;  4DV3 I;  2UXC I;  2BV3 A;  4LFA E;  1U2R A;  1ZM4 A;  4DPW A;  4DPU A;  2O1W A;  4FN5 A;  4JI1 I;  4DUY E;  1I94 I;  4JI0 E;  4P52 A;  5LMU I;  4K0K I;  2HKJ A;  5LMU E;  4MYU A;  2ZM6 E;  4DR7 E;  3Q6N A;  2O1V A;  4ZVI A;  3HUL A;  1FKA E;  2HFU A;  1FWK A;  1KVK A;  4B3R E;  4GKJ I;  4OX9 E;  1XNR I;  3V2U C;  2A2D A;  4LF4 I;  1Y4U A;  4USM A;  4JI4 I;  4JI3 E;  2HFS A;  3PYE A;  4Z7Y A;  4IZJ D;  4DV4 E;  1NHJ A;  4YY3 I;  2R42 A;  1J5E E;  4DV7 E;  4P7A A;  1IBM I;  5IWA I;  4DV0 I;  4DR5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...