2UU9I

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9I00
1IBLE 3T1HE 2X7IA 4DR1E 1N34I 4PRVA 4DR6E 4LFAE 1XMQI 2HHHE 3CWVA 1UEKA 3H4LA 4DUZI 1N32E 5IT9C 3LPSA 4DUYI 1QZRA 2XEXA 3OTOE 4DV7I 4JI2I 2ZBKB 1HNZI 4X62I 1ZXMA 4JI1E 2UXDE 4ED4A 1HNXE 2ZM6E 4JI7E 2HFUA 1XMOI 3PYFA 1Z0TA 2R3VA 1Z5CA 1DARA 2OI2A 1NHIA 4WUCA 1EI1A 1ZM2A 2V2QA 4DV0I 1FKAE 5LMUI 4NXNE 5LMNE 5GMDA 1H7UA 3B78A 4JI4E 1B62A 1Z0GA 4FN5A 4DPTA 1WUUA 2UXCE 2AJ4A 4UTGA 1N36I 4DR2I 1IBKI 4B3SE 3ZZTA 4HYMA 2ZITA 4YY3E 1ZXNA 3QT7A 4LF7I 4JYAI 2A2DA 4DV2E 1Z5BA 4LF4E 1XMQE 1Z5AA 4B3MI 4DUZE 4M1KA 1K47A 4LFBI 4DV1I 4NXMI 3LNUA 2V2ZA 4JI2E 4X62E 5FLXC 2F4VI 1Z0VA 4RPFA 4DV6I 4URLA 4DV5I 5IWAI 4JI0E 1MU5A 2BM0A 2J7KA 1IBME 1FJGE 5BR8E 1XMOE 4OX9I 5IT9Q 2GS8A 4DR3E 2VQEI 1HR0E 4JI8E 4KQVA 3J7AM 3QT6A 4DV0E 5A2QQ 4X65E 3J81Q 1N33E 4DV4I 3PYEA 1MG7A 4I3HA 3B8HA 3Q1QA 4JG4A 4LF8E 2V34A 1N36E 4DU8A 2UXBI 4DR2E 1KKHA 4K0KE 4LFCI 2BV3A 4JV5I 1VISA 1KIJA 4LF7E 1A6FA 1BKNA 4JYAE 4YHHI 4B3ME 3ZZ0A 5A2QC 1MX0A 3J81C 4KHPI 4HACA 4LFBE 4NXME 1ZM3A 4DR4E 4Z7CA 4DPYA 4JI5E 3T1YI 4MYTA 4B3RE 4DPUA 5IWAE 4FWHA 1PKPA 2V8PA 3WU6A 1RREA 1I94I 4P52A 4HACB 1PVGA 2UUCI 1Z0WA 4OX9E 1HNWI 1FWLA 1XHKA 1ZM9A 3B82A 2DEIA 3GONA 5FLXQ 2HKJA 3WU4A 2CZ9A 3V5RA 1KTVA 5LL6R 4DV4E 4USMA 5GMEA 4R1FA 4X66E 1J5EI 1KVKA 4HY1A 2UUBI 4HXZA 4X64I 2UUAI 2E5LI 4LF9I 2HK3A 1N34E 3ZM7A 3PYGA 4WUDA 2VF3A 3ZZUA 4FWDA 4JV5E 4DR1I 4DUYE 3J80Q 2A2CA 4DV7E 1B63A 3QT5A 4LFAI 4YHHE 1HNZE 4B3TI 4AQYI 3J7AG 4GKKI 1Z0EA 1XNQI 1FNMA 3JAMQ 4FW9A 1FI4A 3V2UC 4DR5I 1D6TA 3T1YE 1HNXI 1N0VC 4JI7I 4LF5I 4DPWA 3K1JA 4DV3I 3ZKBA 2EFGA 1EA6A 1H72C 3J80C 2UUCE 2VQFI 1OJ4A 4XTJA 3M6AA 4GKJI 5LMUE 2E1RA 3ZKDA 1Z0BA 4LF6I 4P7AA 3PYDA 3JAMC 5LMNI 1N0UA 4DR7I 1H7SA 1IBKE 1FWKA 4EMDA 2UUBE 2BM1A 2UUAE 1ELOA 4YY3I 1XNRI 4MYUA 3QT8A 4ZVIA 4DV1E 1Z0CA 2HK2A 4DV2I 4LF4I 3HULA 4B3TE 2F4VE 4Z7YA 4AQYE 2Q2EB 2WW4A 4DV6E 4GKKE 1ZM4A 1XNQE 4DV5E 4JI6I 4DPXA 3D4JA 2R42A 2X36A 1S16A 1H73A 4DR5E 4JI0I 1IBMI 1FJGI 4LF5E 5BR8I 3WU3A 4DV3E 2VQEE 2HFSA 3LTOA 2VQFE 2UU9I 4DR3I 4JI3I 4GKJE 1HR0I 4JI8I 4PU9A 4LF6E 4X65I 1N33I 1NHHA 4DR7E 2UXBE 1IBLI 2LJPA 3T1HI 4LFCE 4WUBA 4LF8I 1S4EA 3WU5A 4DR6I 4DU7A 2HHHI 1XNRE 1N32I 4K0KI 1Z59A 4KHPE 4FWGA 3OTOI 3F0NA 1U2RA 4JI1I 1NZ0A 2UXDI 3K17A 1RR9A 2DEJA 2NPFA 2HKEA 1PIEA 4JI6E 2ZM6I 1NHJA 4DXLA 4DR4I 4JI5I 1I94E 4USKA 4B3RI 1HNWE 2V2VA 4UT4A 4PRXA 2UU9E 4NXNI 4JI3E 5L3JA 1J5EE 4X64E 4JI4I 2E5LE 4LF9E 2UXCI 1H74A 4X66I 4B3SI
chains in the Genus database with same CATH superfamily
1IBLE 2Z5EA 3T1HE 4OO1F 2X7IA 2WNRA 4DR1E 3Q6MA 1N34I 3PRYA 4QNKA 4PRVA 4DR6E 4OKGA 4LFAE 1XMQI 2HHHE 2GO3A 3CWVA 1UEKA 3H4LA 4DUZI 1N32E 5IT9C 2IOPA 3LPSA 4BA1A 4DUYI 4IS9A 1QZRA 2XEXA 2BR2B 3OTOE 4DV7I 4JI2I 2ZBKB 2BA0D 1HNZI 4X62I 1ZXMA 4JI1E 2UXDE 2C39A 4ED4A 1E3PA 1XXEA 2WNRB 4OO1B 5C0XF 1USVA 1HNXE 2ZM6E 4JI7E 4MU0A 2HFUA 4IZKA 1XMOI 3PYFA 1Z0TA 1E3HA 2R3VA 1Z5CA 1USUA 4BA1B 4U3DA 1DARA 2NN6E 4MQYA 1P42A 2C39B 2OI2A 4IFDF 1NHIA 4WUCA 1EI1A 1ZM2A 1YHCA 2V2QA 5C0XB 2CVEA 3HKMA 4DV0I 1FKAE 4OO1D 4IZKB 1UDOA 5LMUI 4NXNE 5LMNE 5GMDA 1H7UA 3B78A 4JI4E 1B62A 1Z0GA 2IERA 4FN5A 4DPTA 1WUUA 3PS3A 2UXCE 2AJ4A 1UDNA 4UTGA 1N36I 4DR2I 1IBKI 4IFDB 3L7ZA 2PNZB 4B3SE 3ZZTA 4HYMA 2ZITA 4YY3E 1ZXNA 3QT7A 4OZEA 3PS1A 5C0XD 1Y4UA 2Z5CA 4LF7I 2JEAA 4JYAI 2A2DA 4DV2E 1Z5BA 4LF4E 5K36A 1XMQE 1Z5AA 2JE6A 4B3MI 4DUZE 4M1KA 1K47A 4LFBI 2AE8A 4DV1I 4MU1A 5C0XC 4NXMI 2NN6C 3LNUA 2V2ZA 4JI2E 5JEAF 4X62E 5FLXC 2F4VI 4IZJA 4IFDD 1Z0VA 4RPFA 4DV6I 4URLA 4DV5I 5IWAI 4JI0E 1MU5A 2BM0A 2J7KA 1IBME 4N3OA 1FJGE 2BA1G 5BR8E 1OYPA 1XMOE 3DD6A 1OYSA 4OX9I 5IT9Q 2GS8A 3B4TA 4DR3E 1HK7A 5JEAB 2C38A 2VQEI 1HR0E 4JI8E 4KQVA 3J7AM 3QT6A 2O1UA 4MU4A 4LCHA 1Y4SA 4DV0E 5A2QQ 4X65E 3J81Q 1N33E 4DV4I 2O3ZA 3PYEA 1MG7A 4I3HA 3P3GA 3B8HA 4U3BA 3Q1QA 4JG4A 4LF8E 2V34A 1N36E 4DU8A 2UXBI 4DR2E 5JEAD 1KKHA 4GQUA 5EL9A 4OO1E 4K0KE 4LFCI 2BV3A 4JV5I 1VISA 1KIJA 4LF7E 1A6FA 1BKNA 4JYAE 4YHHI 5JEAC 4B3ME 2BA1D 3ZZ0A 1Y5YA 5A2QC 1MX0A 5DRRA 3J81C 4KHPI 4HACA 4LFBE 4NXME 4MU3A 5FWKA 1ZM3A 3GCMA 4DR4E 3GLLA 4DPYA 4Z7CA 4JI5E 5C0XE 2CGEA 3T1YI 4MYTA 4AM3A 4B3RE 1OYRA 4DPUA 4BA2A 5DNXA 5IWAE 4FWHA 1RHYA 1PKPA 4J3DA 2V8PA 3WU6A 1RREA 1I94I 4P52A 4HACB 1PVGA 2UUCI 5EKWA 1Z0WA 2F1DA 2NN6A 3M85G 4LCFA 4OX9E 1HNWI 1FWLA 1XHKA 1ZM9A 3B82A 2O1WA 2DEIA 3GONA 5FLXQ 2HKJA 3WU4A 2CZ9A 3V5RA 5DRPA 1KTVA 2IESA 5LL6R 4OO1C 4DV4E 2CG9A 4USMA 5GMEA 3M7NG 2PNMA 4R1FA 4X66E 1J5EI 1KVKA 4HY1A 2UUBI 3GMEA 2O1TA 4HXZA 4X64I 2UUAI 2JT2A 2E5LI 4LF9I 2WP8A 3CDIA 2HK3A 1N34E 3ZM7A 3PYGA 5K36F 4WUDA 2VF3A 4MDTA 3ZZUA 4FWDA 4JV5E 4DR1I 4DUYE 4ISAA 3J80Q 2A2CA 4FW6A 4DV7E 1B63A 3L7ZB 3QT5A 4LFAI 4YHHE 1HNZE 4B3TI 1R6MA 4LOMA 4AQYI 3J7AG 2WP8B 2J65A 4GKKI 1Z0EA 1XNQI 2Z5CB 2JEAB 4LPFA 1FNMA 5JEAE 5K36B 3JAMQ 2JE6B 4FW9A 5DROA 1FI4A 2IOQA 4IFDC 3V2UC 4DR5I 2JEBA 1D6TA 3T1YE 1HNXI 1N0VC 3UHMA 4JI7I 2Z5BA 4LF5I 4DPWA 4IZJB 3K1JA 4DV3I 3ZKBA 2EFGA 1EA6A 3M7ND 1H72C 3J80C 2UUCE 2VQFI 1OJ4A 4XTJA 3M6AA 4GKJI 5LMUE 2E1RA 5K36D 3ZKDA 2JEBB 1Z0BA 4LF6I 3PS2A 4P7AA 3PYDA 2Z5BB 3JAMC 5LMNI 1N0UA 3NZKA 4DR7I 2C38B 3U1KA 1H7SA 1IBKE 1FWKA 2PO2A 4IZJD 4EMDA 4FW3A 2UUBE 2BM1A 3P3EA 2UUAE 4NBQA 2BR2A 1ELOA 4YY3I 1XNRI 4MYUA 3QT8A 4ZVIA 4OO1A 4DV1E 1Z0CA 2HK2A 2PO2B 4DV2I 4LF4I 3HULA 4B3TE 2F4VE 4Z7YA 4AQYE 2Q2EB 2WW4A 4DV6E 4GKKE 1ZM4A 1XNQE 4DV5E 4JI6I 4DPXA 1R6LA 1UDQA 4FW5A 3D4JA 2R42A 2X36A 1S16A 1H73A 4DR5E 2NN6F 4LCGA 4JI0I 5C0XA 1IBMI 1FJGI 4IFDE 4LF5E 5BR8I 3WU3A 4DV3E 2O1VA 3P06A 2VQEE 2HFSA 2VESA 3Q6NA 3LTOA 4BA2B 2GO4A 2VQFE 2UU9I 4DR3I 4JI3I 1UDSA 3U1YA 4GKJE 1HR0I 4JI8I 4IFDA 2PNZA 4PU9A 3CDJA 4LF6E 2C37A 2NN6B 4FW7A 4X65I 1N33I 1NHHA 4DR7E 4AIDA 2UXBE 3P3CA 1IBLI 2LJPA 3T1HI 4LFCE 1Y60A 2PO0A 1YH8A 4WUBA 4LF8I 1S4EA 5K36E 3WU5A 4DR6I 2GQ0A 4DU7A 1Y6ZA 2HHHI 1XNRE 1N32I 2C37B 4K0KI 1Z59A 4KHPE 4FWGA 2NN6D 3F0NA 3OTOI 3M85D 1U2RA 4JI1I 1NZ0A 2UXDI 3K17A 1RR9A 2DEJA 2PO0B 2NPFA 2HKEA 3KRNA 4AIMA 1PIEA 4JI6E 2ZM6I 1NHJA 3K85A 5JEAA 2PO1A 4DXLA 4DR4I 4FW4A 4JI5I 1I94E 4USKA 4B3RI 3HJCA 3H1CA 2BA0G 1HNWE 2V2VA 1VI7A 5DRQA 4QNJA 4UT4A 4PRXA 2UU9E 3P76A 2PNLA 2PO1B 4NXNI 4JI3E 5L3JA 5K36C 5DNLA 1J5EE 4X64E 4JI4I 2E5LE 4LF9E 2UXCI 1H74A 4X66I 4B3SI 5ELWA
chains in the Genus database with same CATH topology
1IBLE 2Z5EA 3T1HE 2X7IA 4DR1E 3Q6MA 1N34I 3PRYA 4PRVA 4DR6E 4LFAE 1XMQI 2HHHE 3CWVA 1UEKA 3H4LA 4DUZI 1N32E 5IT9C 2IOPA 3LPSA 4DUYI 1QZRA 2XEXA 3OTOE 4DV7I 4JI2I 2ZBKB 1HNZI 4X62I 1ZXMA 4JI1E 2UXDE 4ED4A 1USVA 1HNXE 2ZM6E 4JI7E 2HFUA 4IZKA 1XMOI 3PYFA 1Z0TA 2R3VA 1Z5CA 1USUA 1DARA 2OI2A 1NHIA 4WUCA 1EI1A 1ZM2A 2V2QA 4DV0I 1FKAE 4IZKB 5LMUI 4NXNE 5LMNE 5GMDA 1H7UA 3B78A 4JI4E 1B62A 1Z0GA 4FN5A 4DPTA 1WUUA 2UXCE 2AJ4A 4UTGA 1N36I 4DR2I 1IBKI 4B3SE 3ZZTA 4HYMA 2ZITA 4YY3E 1ZXNA 3QT7A 1Y4UA 2Z5CA 4LF7I 4JYAI 2A2DA 4DV2E 1Z5BA 4LF4E 1XMQE 1Z5AA 4B3MI 4DUZE 4M1KA 1K47A 4LFBI 4DV1I 4NXMI 3LNUA 2V2ZA 4JI2E 4X62E 5FLXC 2F4VI 4IZJA 1Z0VA 4RPFA 4DV6I 4URLA 4DV5I 5IWAI 4JI0E 1MU5A 2BM0A 2J7KA 1IBME 4N3OA 1FJGE 5BR8E 1XMOE 4OX9I 5IT9Q 2GS8A 4DR3E 1HK7A 2VQEI 1HR0E 4JI8E 4KQVA 3J7AM 3QT6A 2O1UA 1Y4SA 4DV0E 5A2QQ 4X65E 3J81Q 1N33E 4DV4I 3PYEA 1MG7A 4I3HA 3B8HA 3Q1QA 4JG4A 4LF8E 2V34A 1N36E 4DU8A 2UXBI 4DR2E 1KKHA 4K0KE 4LFCI 2BV3A 4JV5I 1VISA 1KIJA 4LF7E 1A6FA 1BKNA 4JYAE 4YHHI 4B3ME 3ZZ0A 5A2QC 1MX0A 3J81C 4KHPI 4HACA 4LFBE 4NXME 5FWKA 1ZM3A 4DR4E 4Z7CA 4DPYA 4JI5E 2CGEA 3T1YI 4MYTA 4B3RE 4DPUA 5IWAE 4FWHA 1PKPA 2V8PA 3WU6A 1RREA 1I94I 4P52A 4HACB 1PVGA 2UUCI 1Z0WA 4OX9E 1HNWI 1FWLA 1XHKA 1ZM9A 3B82A 2O1WA 2DEIA 3GONA 5FLXQ 2HKJA 3WU4A 2CZ9A 3V5RA 1KTVA 5LL6R 4DV4E 2CG9A 4USMA 5GMEA 2PNMA 4R1FA 4X66E 1J5EI 1KVKA 4HY1A 2UUBI 2O1TA 4HXZA 4X64I 2UUAI 2E5LI 4LF9I 2HK3A 1N34E 3ZM7A 3PYGA 4WUDA 2VF3A 3ZZUA 4FWDA 4JV5E 4DR1I 4DUYE 3J80Q 2A2CA 4DV7E 1B63A 3QT5A 4LFAI 4YHHE 1HNZE 4B3TI 4AQYI 3J7AG 4GKKI 1Z0EA 1XNQI 2Z5CB 1FNMA 3JAMQ 4FW9A 1FI4A 2IOQA 3V2UC 4DR5I 1D6TA 3T1YE 1HNXI 1N0VC 4JI7I 2Z5BA 4LF5I 4DPWA 4IZJB 3K1JA 4DV3I 3ZKBA 2EFGA 1EA6A 1H72C 3J80C 2UUCE 2VQFI 1OJ4A 4XTJA 3M6AA 4GKJI 5LMUE 2E1RA 3ZKDA 1Z0BA 4LF6I 4P7AA 3PYDA 2Z5BB 3JAMC 5LMNI 1N0UA 4DR7I 1H7SA 1IBKE 1FWKA 4IZJD 4EMDA 2UUBE 2BM1A 2UUAE 1ELOA 4YY3I 1XNRI 4MYUA 3QT8A 4ZVIA 4DV1E 1Z0CA 2HK2A 4DV2I 4LF4I 3HULA 4B3TE 2F4VE 4Z7YA 4AQYE 2Q2EB 2WW4A 4DV6E 4GKKE 1ZM4A 1XNQE 4DV5E 4JI6I 4DPXA 3D4JA 2R42A 2X36A 1S16A 1H73A 4DR5E 4JI0I 1IBMI 1FJGI 4LF5E 5BR8I 3WU3A 4DV3E 2O1VA 3P06A 2VQEE 2HFSA 3Q6NA 3LTOA 2VQFE 2UU9I 4DR3I 4JI3I 4GKJE 1HR0I 4JI8I 4PU9A 4LF6E 4X65I 1N33I 1NHHA 4DR7E 2UXBE 1IBLI 2LJPA 3T1HI 4LFCE 4WUBA 4LF8I 1S4EA 3WU5A 4DR6I 2GQ0A 4DU7A 1Y6ZA 2HHHI 1XNRE 1N32I 4K0KI 1Z59A 4KHPE 4FWGA 3OTOI 3F0NA 1U2RA 4JI1I 1NZ0A 2UXDI 3K17A 1RR9A 2DEJA 2NPFA 2HKEA 1PIEA 4JI6E 2ZM6I 1NHJA 3K85A 4DXLA 4DR4I 4JI5I 1I94E 4USKA 4B3RI 3HJCA 1HNWE 2V2VA 4UT4A 4PRXA 2UU9E 2PNLA 4NXNI 4JI3E 5L3JA 1J5EE 4X64E 4JI4I 2E5LE 4LF9E 2UXCI 1H74A 4X66I 4B3SI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL E;  3T1H E;  2X7I A;  4DR1 E;  1N34 I;  4PRV A;  4DR6 E;  4LFA E;  1XMQ I;  2HHH E;  3CWV A;  1UEK A;  3H4L A;  4DUZ I;  1N32 E;  5IT9 C;  3LPS A;  4DUY I;  1QZR A;  2XEX A;  3OTO E;  4DV7 I;  4JI2 I;  2ZBK B;  1HNZ I;  4X62 I;  1ZXM A;  4JI1 E;  2UXD E;  4ED4 A;  1HNX E;  2ZM6 E;  4JI7 E;  2HFU A;  1XMO I;  3PYF A;  1Z0T A;  2R3V A;  1Z5C A;  1DAR A;  2OI2 A;  1NHI A;  4WUC A;  1EI1 A;  1ZM2 A;  2V2Q A;  4DV0 I;  1FKA E;  5LMU I;  4NXN E;  5LMN E;  5GMD A;  1H7U A;  3B78 A;  4JI4 E;  1B62 A;  1Z0G A;  4FN5 A;  4DPT A;  1WUU A;  2UXC E;  2AJ4 A;  4UTG A;  1N36 I;  4DR2 I;  1IBK I;  4B3S E;  3ZZT A;  4HYM A;  2ZIT A;  4YY3 E;  1ZXN A;  3QT7 A;  4LF7 I;  4JYA I;  2A2D A;  4DV2 E;  1Z5B A;  4LF4 E;  1XMQ E;  1Z5A A;  4B3M I;  4DUZ E;  4M1K A;  1K47 A;  4LFB I;  4DV1 I;  4NXM I;  3LNU A;  2V2Z A;  4JI2 E;  4X62 E;  5FLX C;  2F4V I;  1Z0V A;  4RPF A;  4DV6 I;  4URL A;  4DV5 I;  5IWA I;  4JI0 E;  1MU5 A;  2BM0 A;  2J7K A;  1IBM E;  1FJG E;  5BR8 E;  1XMO E;  4OX9 I;  5IT9 Q;  2GS8 A;  4DR3 E;  2VQE I;  1HR0 E;  4JI8 E;  4KQV A;  3J7A M;  3QT6 A;  4DV0 E;  5A2Q Q;  4X65 E;  3J81 Q;  1N33 E;  4DV4 I;  3PYE A;  1MG7 A;  4I3H A;  3B8H A;  3Q1Q A;  4JG4 A;  4LF8 E;  2V34 A;  1N36 E;  4DU8 A;  2UXB I;  4DR2 E;  1KKH A;  4K0K E;  4LFC I;  2BV3 A;  4JV5 I;  1VIS A;  1KIJ A;  4LF7 E;  1A6F A;  1BKN A;  4JYA E;  4YHH I;  4B3M E;  3ZZ0 A;  5A2Q C;  1MX0 A;  3J81 C;  4KHP I;  4HAC A;  4LFB E;  4NXM E;  1ZM3 A;  4DR4 E;  4Z7C A;  4DPY A;  4JI5 E;  3T1Y I;  4MYT A;  4B3R E;  4DPU A;  5IWA E;  4FWH A;  1PKP A;  2V8P A;  3WU6 A;  1RRE A;  1I94 I;  4P52 A;  4HAC B;  1PVG A;  2UUC I;  1Z0W A;  4OX9 E;  1HNW I;  1FWL A;  1XHK A;  1ZM9 A;  3B82 A;  2DEI A;  3GON A;  5FLX Q;  2HKJ A;  3WU4 A;  2CZ9 A;  3V5R A;  1KTV A;  5LL6 R;  4DV4 E;  4USM A;  5GME A;  4R1F A;  4X66 E;  1J5E I;  1KVK A;  4HY1 A;  2UUB I;  4HXZ A;  4X64 I;  2UUA I;  2E5L I;  4LF9 I;  2HK3 A;  1N34 E;  3ZM7 A;  3PYG A;  4WUD A;  2VF3 A;  3ZZU A;  4FWD A;  4JV5 E;  4DR1 I;  4DUY E;  3J80 Q;  2A2C A;  4DV7 E;  1B63 A;  3QT5 A;  4LFA I;  4YHH E;  1HNZ E;  4B3T I;  4AQY I;  3J7A G;  4GKK I;  1Z0E A;  1XNQ I;  1FNM A;  3JAM Q;  4FW9 A;  1FI4 A;  3V2U C;  4DR5 I;  1D6T A;  3T1Y E;  1HNX I;  1N0V C;  4JI7 I;  4LF5 I;  4DPW A;  3K1J A;  4DV3 I;  3ZKB A;  2EFG A;  1EA6 A;  1H72 C;  3J80 C;  2UUC E;  2VQF I;  1OJ4 A;  4XTJ A;  3M6A A;  4GKJ I;  5LMU E;  2E1R A;  3ZKD A;  1Z0B A;  4LF6 I;  4P7A A;  3PYD A;  3JAM C;  5LMN I;  1N0U A;  4DR7 I;  1H7S A;  1IBK E;  1FWK A;  4EMD A;  2UUB E;  2BM1 A;  2UUA E;  1ELO A;  4YY3 I;  1XNR I;  4MYU A;  3QT8 A;  4ZVI A;  4DV1 E;  1Z0C A;  2HK2 A;  4DV2 I;  4LF4 I;  3HUL A;  4B3T E;  2F4V E;  4Z7Y A;  4AQY E;  2Q2E B;  2WW4 A;  4DV6 E;  4GKK E;  1ZM4 A;  1XNQ E;  4DV5 E;  4JI6 I;  4DPX A;  3D4J A;  2R42 A;  2X36 A;  1S16 A;  1H73 A;  4DR5 E;  4JI0 I;  1IBM I;  1FJG I;  4LF5 E;  5BR8 I;  3WU3 A;  4DV3 E;  2VQE E;  2HFS A;  3LTO A;  2VQF E;  2UU9 I;  4DR3 I;  4JI3 I;  4GKJ E;  1HR0 I;  4JI8 I;  4PU9 A;  4LF6 E;  4X65 I;  1N33 I;  1NHH A;  4DR7 E;  2UXB E;  1IBL I;  2LJP A;  3T1H I;  4LFC E;  4WUB A;  4LF8 I;  1S4E A;  3WU5 A;  4DR6 I;  4DU7 A;  2HHH I;  1XNR E;  1N32 I;  4K0K I;  1Z59 A;  4KHP E;  4FWG A;  3OTO I;  3F0N A;  1U2R A;  4JI1 I;  1NZ0 A;  2UXD I;  3K17 A;  1RR9 A;  2DEJ A;  2NPF A;  2HKE A;  1PIE A;  4JI6 E;  2ZM6 I;  1NHJ A;  4DXL A;  4DR4 I;  4JI5 I;  1I94 E;  4USK A;  4B3R I;  1HNW E;  2V2V A;  4UT4 A;  4PRX A;  2UU9 E;  4NXN I;  4JI3 E;  5L3J A;  1J5E E;  4X64 E;  4JI4 I;  2E5L E;  4LF9 E;  2UXC I;  1H74 A;  4X66 I;  4B3S I; 
#chains in the Genus database with same CATH topology
 1IBL E;  2Z5E A;  3T1H E;  4OO1 F;  2X7I A;  2WNR A;  4DR1 E;  3Q6M A;  1N34 I;  3PRY A;  4QNK A;  4PRV A;  4DR6 E;  4OKG A;  4LFA E;  1XMQ I;  2HHH E;  2GO3 A;  3CWV A;  1UEK A;  3H4L A;  4DUZ I;  1N32 E;  5IT9 C;  2IOP A;  3LPS A;  4BA1 A;  4DUY I;  4IS9 A;  1QZR A;  2XEX A;  2BR2 B;  3OTO E;  4DV7 I;  4JI2 I;  2ZBK B;  2BA0 D;  1HNZ I;  4X62 I;  1ZXM A;  4JI1 E;  2UXD E;  2C39 A;  4ED4 A;  1E3P A;  1XXE A;  2WNR B;  4OO1 B;  5C0X F;  1USV A;  1HNX E;  2ZM6 E;  4JI7 E;  4MU0 A;  2HFU A;  4IZK A;  1XMO I;  3PYF A;  1Z0T A;  1E3H A;  2R3V A;  1Z5C A;  1USU A;  4BA1 B;  4U3D A;  1DAR A;  2NN6 E;  4MQY A;  1P42 A;  2C39 B;  2OI2 A;  4IFD F;  1NHI A;  4WUC A;  1EI1 A;  1ZM2 A;  1YHC A;  2V2Q A;  5C0X B;  2CVE A;  3HKM A;  4DV0 I;  1FKA E;  4OO1 D;  4IZK B;  1UDO A;  5LMU I;  4NXN E;  5LMN E;  5GMD A;  1H7U A;  3B78 A;  4JI4 E;  1B62 A;  1Z0G A;  2IER A;  4FN5 A;  4DPT A;  1WUU A;  3PS3 A;  2UXC E;  2AJ4 A;  1UDN A;  4UTG A;  1N36 I;  4DR2 I;  1IBK I;  4IFD B;  3L7Z A;  2PNZ B;  4B3S E;  3ZZT A;  4HYM A;  2ZIT A;  4YY3 E;  1ZXN A;  3QT7 A;  4OZE A;  3PS1 A;  5C0X D;  1Y4U A;  2Z5C A;  4LF7 I;  2JEA A;  4JYA I;  2A2D A;  4DV2 E;  1Z5B A;  4LF4 E;  5K36 A;  1XMQ E;  1Z5A A;  2JE6 A;  4B3M I;  4DUZ E;  4M1K A;  1K47 A;  4LFB I;  2AE8 A;  4DV1 I;  4MU1 A;  5C0X C;  4NXM I;  2NN6 C;  3LNU A;  2V2Z A;  4JI2 E;  5JEA F;  4X62 E;  5FLX C;  2F4V I;  4IZJ A;  4IFD D;  1Z0V A;  4RPF A;  4DV6 I;  4URL A;  4DV5 I;  5IWA I;  4JI0 E;  1MU5 A;  2BM0 A;  2J7K A;  1IBM E;  4N3O A;  1FJG E;  2BA1 G;  5BR8 E;  1OYP A;  1XMO E;  3DD6 A;  1OYS A;  4OX9 I;  5IT9 Q;  2GS8 A;  3B4T A;  4DR3 E;  1HK7 A;  5JEA B;  2C38 A;  2VQE I;  1HR0 E;  4JI8 E;  4KQV A;  3J7A M;  3QT6 A;  2O1U A;  4MU4 A;  4LCH A;  1Y4S A;  4DV0 E;  5A2Q Q;  4X65 E;  3J81 Q;  1N33 E;  4DV4 I;  2O3Z A;  3PYE A;  1MG7 A;  4I3H A;  3P3G A;  3B8H A;  4U3B A;  3Q1Q A;  4JG4 A;  4LF8 E;  2V34 A;  1N36 E;  4DU8 A;  2UXB I;  4DR2 E;  5JEA D;  1KKH A;  4GQU A;  5EL9 A;  4OO1 E;  4K0K E;  4LFC I;  2BV3 A;  4JV5 I;  1VIS A;  1KIJ A;  4LF7 E;  1A6F A;  1BKN A;  4JYA E;  4YHH I;  5JEA C;  4B3M E;  2BA1 D;  3ZZ0 A;  1Y5Y A;  5A2Q C;  1MX0 A;  5DRR A;  3J81 C;  4KHP I;  4HAC A;  4LFB E;  4NXM E;  4MU3 A;  5FWK A;  1ZM3 A;  3GCM A;  4DR4 E;  3GLL A;  4DPY A;  4Z7C A;  4JI5 E;  5C0X E;  2CGE A;  3T1Y I;  4MYT A;  4AM3 A;  4B3R E;  1OYR A;  4DPU A;  4BA2 A;  5DNX A;  5IWA E;  4FWH A;  1RHY A;  1PKP A;  4J3D A;  2V8P A;  3WU6 A;  1RRE A;  1I94 I;  4P52 A;  4HAC B;  1PVG A;  2UUC I;  5EKW A;  1Z0W A;  2F1D A;  2NN6 A;  3M85 G;  4LCF A;  4OX9 E;  1HNW I;  1FWL A;  1XHK A;  1ZM9 A;  3B82 A;  2O1W A;  2DEI A;  3GON A;  5FLX Q;  2HKJ A;  3WU4 A;  2CZ9 A;  3V5R A;  5DRP A;  1KTV A;  2IES A;  5LL6 R;  4OO1 C;  4DV4 E;  2CG9 A;  4USM A;  5GME A;  3M7N G;  2PNM A;  4R1F A;  4X66 E;  1J5E I;  1KVK A;  4HY1 A;  2UUB I;  3GME A;  2O1T A;  4HXZ A;  4X64 I;  2UUA I;  2JT2 A;  2E5L I;  4LF9 I;  2WP8 A;  3CDI A;  2HK3 A;  1N34 E;  3ZM7 A;  3PYG A;  5K36 F;  4WUD A;  2VF3 A;  4MDT A;  3ZZU A;  4FWD A;  4JV5 E;  4DR1 I;  4DUY E;  4ISA A;  3J80 Q;  2A2C A;  4FW6 A;  4DV7 E;  1B63 A;  3L7Z B;  3QT5 A;  4LFA I;  4YHH E;  1HNZ E;  4B3T I;  1R6M A;  4LOM A;  4AQY I;  3J7A G;  2WP8 B;  2J65 A;  4GKK I;  1Z0E A;  1XNQ I;  2Z5C B;  2JEA B;  4LPF A;  1FNM A;  5JEA E;  5K36 B;  3JAM Q;  2JE6 B;  4FW9 A;  5DRO A;  1FI4 A;  2IOQ A;  4IFD C;  3V2U C;  4DR5 I;  2JEB A;  1D6T A;  3T1Y E;  1HNX I;  1N0V C;  3UHM A;  4JI7 I;  2Z5B A;  4LF5 I;  4DPW A;  4IZJ B;  3K1J A;  4DV3 I;  3ZKB A;  2EFG A;  1EA6 A;  3M7N D;  1H72 C;  3J80 C;  2UUC E;  2VQF I;  1OJ4 A;  4XTJ A;  3M6A A;  4GKJ I;  5LMU E;  2E1R A;  5K36 D;  3ZKD A;  2JEB B;  1Z0B A;  4LF6 I;  3PS2 A;  4P7A A;  3PYD A;  2Z5B B;  3JAM C;  5LMN I;  1N0U A;  3NZK A;  4DR7 I;  2C38 B;  3U1K A;  1H7S A;  1IBK E;  1FWK A;  2PO2 A;  4IZJ D;  4EMD A;  4FW3 A;  2UUB E;  2BM1 A;  3P3E A;  2UUA E;  4NBQ A;  2BR2 A;  1ELO A;  4YY3 I;  1XNR I;  4MYU A;  3QT8 A;  4ZVI A;  4OO1 A;  4DV1 E;  1Z0C A;  2HK2 A;  2PO2 B;  4DV2 I;  4LF4 I;  3HUL A;  4B3T E;  2F4V E;  4Z7Y A;  4AQY E;  2Q2E B;  2WW4 A;  4DV6 E;  4GKK E;  1ZM4 A;  1XNQ E;  4DV5 E;  4JI6 I;  4DPX A;  1R6L A;  1UDQ A;  4FW5 A;  3D4J A;  2R42 A;  2X36 A;  1S16 A;  1H73 A;  4DR5 E;  2NN6 F;  4LCG A;  4JI0 I;  5C0X A;  1IBM I;  1FJG I;  4IFD E;  4LF5 E;  5BR8 I;  3WU3 A;  4DV3 E;  2O1V A;  3P06 A;  2VQE E;  2HFS A;  2VES A;  3Q6N A;  3LTO A;  4BA2 B;  2GO4 A;  2VQF E;  2UU9 I;  4DR3 I;  4JI3 I;  1UDS A;  3U1Y A;  4GKJ E;  1HR0 I;  4JI8 I;  4IFD A;  2PNZ A;  4PU9 A;  3CDJ A;  4LF6 E;  2C37 A;  2NN6 B;  4FW7 A;  4X65 I;  1N33 I;  1NHH A;  4DR7 E;  4AID A;  2UXB E;  3P3C A;  1IBL I;  2LJP A;  3T1H I;  4LFC E;  1Y60 A;  2PO0 A;  1YH8 A;  4WUB A;  4LF8 I;  1S4E A;  5K36 E;  3WU5 A;  4DR6 I;  2GQ0 A;  4DU7 A;  1Y6Z A;  2HHH I;  1XNR E;  1N32 I;  2C37 B;  4K0K I;  1Z59 A;  4KHP E;  4FWG A;  2NN6 D;  3F0N A;  3OTO I;  3M85 D;  1U2R A;  4JI1 I;  1NZ0 A;  2UXD I;  3K17 A;  1RR9 A;  2DEJ A;  2PO0 B;  2NPF A;  2HKE A;  3KRN A;  4AIM A;  1PIE A;  4JI6 E;  2ZM6 I;  1NHJ A;  3K85 A;  5JEA A;  2PO1 A;  4DXL A;  4DR4 I;  4FW4 A;  4JI5 I;  1I94 E;  4USK A;  4B3R I;  3HJC A;  3H1C A;  2BA0 G;  1HNW E;  2V2V A;  1VI7 A;  5DRQ A;  4QNJ A;  4UT4 A;  4PRX A;  2UU9 E;  3P76 A;  2PNL A;  2PO1 B;  4NXN I;  4JI3 E;  5L3J A;  5K36 C;  5DNL A;  1J5E E;  4X64 E;  4JI4 I;  2E5L E;  4LF9 E;  2UXC I;  1H74 A;  4X66 I;  4B3S I;  5ELW A; 
#chains in the Genus database with same CATH homology
 1IBL E;  2Z5E A;  3T1H E;  2X7I A;  4DR1 E;  3Q6M A;  1N34 I;  3PRY A;  4PRV A;  4DR6 E;  4LFA E;  1XMQ I;  2HHH E;  3CWV A;  1UEK A;  3H4L A;  4DUZ I;  1N32 E;  5IT9 C;  2IOP A;  3LPS A;  4DUY I;  1QZR A;  2XEX A;  3OTO E;  4DV7 I;  4JI2 I;  2ZBK B;  1HNZ I;  4X62 I;  1ZXM A;  4JI1 E;  2UXD E;  4ED4 A;  1USV A;  1HNX E;  2ZM6 E;  4JI7 E;  2HFU A;  4IZK A;  1XMO I;  3PYF A;  1Z0T A;  2R3V A;  1Z5C A;  1USU A;  1DAR A;  2OI2 A;  1NHI A;  4WUC A;  1EI1 A;  1ZM2 A;  2V2Q A;  4DV0 I;  1FKA E;  4IZK B;  5LMU I;  4NXN E;  5LMN E;  5GMD A;  1H7U A;  3B78 A;  4JI4 E;  1B62 A;  1Z0G A;  4FN5 A;  4DPT A;  1WUU A;  2UXC E;  2AJ4 A;  4UTG A;  1N36 I;  4DR2 I;  1IBK I;  4B3S E;  3ZZT A;  4HYM A;  2ZIT A;  4YY3 E;  1ZXN A;  3QT7 A;  1Y4U A;  2Z5C A;  4LF7 I;  4JYA I;  2A2D A;  4DV2 E;  1Z5B A;  4LF4 E;  1XMQ E;  1Z5A A;  4B3M I;  4DUZ E;  4M1K A;  1K47 A;  4LFB I;  4DV1 I;  4NXM I;  3LNU A;  2V2Z A;  4JI2 E;  4X62 E;  5FLX C;  2F4V I;  4IZJ A;  1Z0V A;  4RPF A;  4DV6 I;  4URL A;  4DV5 I;  5IWA I;  4JI0 E;  1MU5 A;  2BM0 A;  2J7K A;  1IBM E;  4N3O A;  1FJG E;  5BR8 E;  1XMO E;  4OX9 I;  5IT9 Q;  2GS8 A;  4DR3 E;  1HK7 A;  2VQE I;  1HR0 E;  4JI8 E;  4KQV A;  3J7A M;  3QT6 A;  2O1U A;  1Y4S A;  4DV0 E;  5A2Q Q;  4X65 E;  3J81 Q;  1N33 E;  4DV4 I;  3PYE A;  1MG7 A;  4I3H A;  3B8H A;  3Q1Q A;  4JG4 A;  4LF8 E;  2V34 A;  1N36 E;  4DU8 A;  2UXB I;  4DR2 E;  1KKH A;  4K0K E;  4LFC I;  2BV3 A;  4JV5 I;  1VIS A;  1KIJ A;  4LF7 E;  1A6F A;  1BKN A;  4JYA E;  4YHH I;  4B3M E;  3ZZ0 A;  5A2Q C;  1MX0 A;  3J81 C;  4KHP I;  4HAC A;  4LFB E;  4NXM E;  5FWK A;  1ZM3 A;  4DR4 E;  4Z7C A;  4DPY A;  4JI5 E;  2CGE A;  3T1Y I;  4MYT A;  4B3R E;  4DPU A;  5IWA E;  4FWH A;  1PKP A;  2V8P A;  3WU6 A;  1RRE A;  1I94 I;  4P52 A;  4HAC B;  1PVG A;  2UUC I;  1Z0W A;  4OX9 E;  1HNW I;  1FWL A;  1XHK A;  1ZM9 A;  3B82 A;  2O1W A;  2DEI A;  3GON A;  5FLX Q;  2HKJ A;  3WU4 A;  2CZ9 A;  3V5R A;  1KTV A;  5LL6 R;  4DV4 E;  2CG9 A;  4USM A;  5GME A;  2PNM A;  4R1F A;  4X66 E;  1J5E I;  1KVK A;  4HY1 A;  2UUB I;  2O1T A;  4HXZ A;  4X64 I;  2UUA I;  2E5L I;  4LF9 I;  2HK3 A;  1N34 E;  3ZM7 A;  3PYG A;  4WUD A;  2VF3 A;  3ZZU A;  4FWD A;  4JV5 E;  4DR1 I;  4DUY E;  3J80 Q;  2A2C A;  4DV7 E;  1B63 A;  3QT5 A;  4LFA I;  4YHH E;  1HNZ E;  4B3T I;  4AQY I;  3J7A G;  4GKK I;  1Z0E A;  1XNQ I;  2Z5C B;  1FNM A;  3JAM Q;  4FW9 A;  1FI4 A;  2IOQ A;  3V2U C;  4DR5 I;  1D6T A;  3T1Y E;  1HNX I;  1N0V C;  4JI7 I;  2Z5B A;  4LF5 I;  4DPW A;  4IZJ B;  3K1J A;  4DV3 I;  3ZKB A;  2EFG A;  1EA6 A;  1H72 C;  3J80 C;  2UUC E;  2VQF I;  1OJ4 A;  4XTJ A;  3M6A A;  4GKJ I;  5LMU E;  2E1R A;  3ZKD A;  1Z0B A;  4LF6 I;  4P7A A;  3PYD A;  2Z5B B;  3JAM C;  5LMN I;  1N0U A;  4DR7 I;  1H7S A;  1IBK E;  1FWK A;  4IZJ D;  4EMD A;  2UUB E;  2BM1 A;  2UUA E;  1ELO A;  4YY3 I;  1XNR I;  4MYU A;  3QT8 A;  4ZVI A;  4DV1 E;  1Z0C A;  2HK2 A;  4DV2 I;  4LF4 I;  3HUL A;  4B3T E;  2F4V E;  4Z7Y A;  4AQY E;  2Q2E B;  2WW4 A;  4DV6 E;  4GKK E;  1ZM4 A;  1XNQ E;  4DV5 E;  4JI6 I;  4DPX A;  3D4J A;  2R42 A;  2X36 A;  1S16 A;  1H73 A;  4DR5 E;  4JI0 I;  1IBM I;  1FJG I;  4LF5 E;  5BR8 I;  3WU3 A;  4DV3 E;  2O1V A;  3P06 A;  2VQE E;  2HFS A;  3Q6N A;  3LTO A;  2VQF E;  2UU9 I;  4DR3 I;  4JI3 I;  4GKJ E;  1HR0 I;  4JI8 I;  4PU9 A;  4LF6 E;  4X65 I;  1N33 I;  1NHH A;  4DR7 E;  2UXB E;  1IBL I;  2LJP A;  3T1H I;  4LFC E;  4WUB A;  4LF8 I;  1S4E A;  3WU5 A;  4DR6 I;  2GQ0 A;  4DU7 A;  1Y6Z A;  2HHH I;  1XNR E;  1N32 I;  4K0K I;  1Z59 A;  4KHP E;  4FWG A;  3OTO I;  3F0N A;  1U2R A;  4JI1 I;  1NZ0 A;  2UXD I;  3K17 A;  1RR9 A;  2DEJ A;  2NPF A;  2HKE A;  1PIE A;  4JI6 E;  2ZM6 I;  1NHJ A;  3K85 A;  4DXL A;  4DR4 I;  4JI5 I;  1I94 E;  4USK A;  4B3R I;  3HJC A;  1HNW E;  2V2V A;  4UT4 A;  4PRX A;  2UU9 E;  2PNL A;  4NXN I;  4JI3 E;  5L3J A;  1J5E E;  4X64 E;  4JI4 I;  2E5L E;  4LF9 E;  2UXC I;  1H74 A;  4X66 I;  4B3S I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...