2UU9I

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9I00
1XNQI 3ZZTA 2HFSA 4X65I 1N0VC 1XHKA 4JI0I 2UXCE 4WUBA 1B63A 3JAMQ 1ZM3A 1N33E 3T1HE 1N36E 4JI6E 4KQVA 4DV0E 3PYEA 4DV3I 3V2UC 1XMQE 4JG4A 4JYAE 4K0KI 1HR0I 2E5LE 4MYUA 1N34I 1PVGA 4B3RI 4FWGA 1KVKA 1H7UA 1MX0A 4JI3I 4LFCI 4JI4I 4DUZE 1Z0CA 4DV4I 1FI4A 1S4EA 4HACB 4LF7E 4NXME 1FNMA 3ZZUA 1IBME 3ZZ0A 1OJ4A 3ZKBA 2F4VE 4DUYE 4HY1A 2VQEE 1BKNA 3K17A 2UUBI 4GKJI 2V2ZA 5FLXQ 1J5EI 4I3HA 4YY3E 4UTGA 4AQYE 1XNRI 1Z0WA 2V2VA 5LMNI 4LF5I 4USMA 4DV1I 4DR1E 5LL6R 3B82A 2HHHI 4DR4E 3B8HA 3T1YI 4Z7YA 2ZM6I 1ZM4A 1HNXI 2X36A 5LMUE 1U2RA 1NZ0A 1FJGI 4JI5E 1N0UA 4X62I 4DR3I 4XTJA 4OX9E 4DR7I 2HK2A 2UU9I 5IWAE 4DPYA 2V8PA 4B3MI 1ZXNA 4YHHE 1KIJA 1EI1A 4JI8I 3WU3A 1KTVA 3ZM7A 5L3JA 4JI1E 2UU9E 1WUUA 1N32E 1D6TA 1ELOA 4JI2E 4DXLA 2BM0A 3OTOE 4DU8A 1N33I 4X66E 3T1HI 1N36I 4JI6I 4DV0I 4B3TE 2J7KA 1XMQI 3LNUA 4JYAI 1RR9A 2R3VA 1IBKE 2E5LI 1H72C 1Z5CA 3HULA 4FWHA 2UUAE 3GONA 1H74A 3J81Q 4DUZI 2Q2EB 5A2QQ 4LF7I 4P52A 4NXMI 2EFGA 2UUCE 2X7IA 3J80Q 2NPFA 1IBMI 2UXDE 3K1JA 1H7SA 3Q1QA 4DR6E 1ZM9A 2F4VI 4DUYI 2ZBKB 1HNZE 5GMDA 2VQEI 1Z5AA 2HFUA 4LFAE 4RPFA 4DV2E 4DPTA 1QZRA 4ED4A 4YY3I 4LF9E 1FKAE 3LPSA 4AQYI 4DV5E 1IBLI 3WU5A 4GKKE 4DR1I 4LF6E 2CZ9A 2AJ4A 4DR4I 3QT7A 1DARA 1IBLE 4HYMA 4X64E 4LF8E 4MYTA 3JAMC 5LMUI 4JI5I 4DPXA 1NHJA 1XMOE 1HNWE 3H4LA 2R42A 2HKJA 4P7AA 4OX9I 4LF4E 5IWAI 4HACA 1ZM2A 1Z59A 4FW9A 4DU7A 2HKEA 4YHHI 5A2QC 4KHPE 5BR8E 4DR5E 4JI1I 4JV5E 2VF3A 1FWKA 3J80C 1N32I 1MG7A 2UXBE 4HXZA 4JI2I 3J7AG 2WW4A 3OTOI 4NXNE 4X66I 2V2QA 2XEXA 2BV3A 4FWDA 4DV7E 4B3TI 1K47A 4LFBE 2ZITA 4WUCA 3B78A 5IT9Q 4USKA 1UEKA 3J7AM 1IBKI 4DR2E 2LJPA 1MU5A 2VQFE 5FLXC 4DV6E 1I94E 2UUAI 1Z0TA 3LTOA 1FWLA 4WUDA 4JI7E 4B3SE 2UUCI 2A2CA 2UXDI 4DPWA 3PYGA 4DR6I 4UT4A 1A6FA 1XNQE 1H73A 3V5RA 1HNZI 4X65E 4FN5A 4JI0E 4LFAI 4DV2I 1NHHA 2E1RA 4LF9I 1S16A 3CWVA 4DV5I 4DV3E 3ZKDA 1Z0EA 4GKKI 1VISA 3M6AA 4K0KE 4LF6I 1HR0E 5GMEA 1EA6A 1NHIA 1N34E 4B3RE 4X64I 4LF8I 4ZVIA 4JI3E 4EMDA 4LFCE 4JI4E 1XMOI 1HNWI 5IT9C 1ZXMA 4DV4E 3WU4A 4URLA 4LF4I 1Z5BA 1B62A 4R1FA 4PRVA 4KHPI 5BR8I 2V34A 4DR5I 4JV5I 2UXBI 3J81C 2UUBE 1Z0GA 1Z0BA 4M1KA 4GKJE 3WU6A 4Z7CA 1J5EE 4NXNI 1PIEA 2GS8A 3QT6A 4PRXA 1XNRE 4DV7I 2A2DA 5LMNE 4LF5E 3PYDA 3QT5A 4DV1E 4LFBI 3D4JA 2OI2A 2HHHE 1Z0VA 3T1YE 3PYFA 4DR2I 2ZM6E 1HNXE 3F0NA 2VQFI 1FJGE 4DV6I 1I94I 2DEIA 4X62E 4DR3E 1RREA 4DR7E 4PU9A 1PKPA 4JI7I 4B3SI 4B3ME 4DPUA 2DEJA 2BM1A 4JI8E 2UXCI 2HK3A 1KKHA 3QT8A
chains in the Genus database with same CATH superfamily
2PO0B 1XNQI 3ZZTA 2HFSA 4X65I 1N0VC 1XHKA 2CG9A 4JI0I 2UXCE 4WUBA 4ISAA 1B63A 5JEAB 2IERA 3JAMQ 1ZM3A 1N33E 3T1HE 1N36E 4JI6E 2IOQA 4BA2A 4KQVA 4DV0E 3HJCA 3PYEA 2JE6A 4DV3I 5ELWA 3V2UC 1XMQE 4FW6A 4JG4A 4JYAE 4K0KI 1HR0I 1P42A 2E5LE 4MYUA 1N34I 1PVGA 4B3RI 4FWGA 1KVKA 1H7UA 1MX0A 4JI3I 5FWKA 4LFCI 4OKGA 4JI4I 2Z5BA 2PNMA 4DUZE 1Z0CA 4DV4I 4HACB 1FI4A 1S4EA 4LF7E 4NXME 5C0XC 2GO4A 1FNMA 3ZZUA 1IBME 3ZZ0A 4MQYA 4OO1E 1OJ4A 3ZKBA 2F4VE 4DUYE 4HY1A 2O1VA 1HK7A 2VQEE 4IFDE 1USUA 1BKNA 2NN6B 3K17A 2PNZA 1UDSA 2UUBI 3Q6NA 4GKJI 2V2ZA 5FLXQ 1J5EI 4I3HA 4YY3E 4UTGA 5K36B 4AQYE 1XNRI 1Z0WA 2V2VA 3HKMA 2JEBA 4QNKA 2C37B 1OYSA 2WP8B 4IZJB 5LMNI 4LF5I 4USMA 4DV1I 4DR1E 5LL6R 3B82A 5DNXA 2C39B 2HHHI 4DR4E 3B8HA 3T1YI 2J65A 4Z7YA 2ZM6I 1ZM4A 1HNXI 2X36A 5LMUE 1U2RA 1NZ0A 3U1YA 1FJGI 4JI5E 2CVEA 4U3DA 1N0UA 4X62I 4DR3I 4XTJA 4OX9E 4DR7I 4AIMA 2HK2A 2O1UA 2UU9I 1Y5YA 5IWAE 2JEAA 2NN6F 4DPYA 3P3CA 2V8PA 4B3MI 4OO1D 1ZXNA 4OO1A 4YHHE 1KIJA 4QNJA 4GQUA 1EI1A 4JI8I 4BA1A 4OO1C 3WU3A 1KTVA 3ZM7A 2VESA 5L3JA 4JI1E 2UU9E 5C0XE 5K36F 1WUUA 1N32E 1D6TA 1ELOA 4FW4A 4JI2E 4LCGA 4DXLA 2BM0A 3B4TA 3OTOE 4DU8A 1N33I 4X66E 2BA0D 3T1HI 1R6LA 1N36I 2PO2A 4JI6I 2C38A 3L7ZA 1YH8A 4DV0I 5EKWA 3NZKA 4MU3A 4B3TE 2J7KA 1XMQI 3LNUA 4JYAI 2Z5EA 1RR9A 2R3VA 2O1TA 4IZKA 1IBKE 1H72C 2E5LI 3P76A 4FW7A 1Z5CA 3HULA 4FWHA 2UUAE 2PO1A 3DD6A 3GONA 2WNRA 1OYRA 1H74A 2Z5CA 3J81Q 4DUZI 4LOMA 2Q2EB 5A2QQ 2F1DA 4LF7I 4P52A 4NXMI 2EFGA 2UUCE 3KRNA 1RHYA 2X7IA 4FW3A 3J80Q 2NPFA 1IBMI 2UXDE 2BR2B 3K1JA 1H7SA 3K85A 5C0XD 3Q1QA 5C0XA 4DR6E 1ZM9A 2F4VI 4DUYI 2ZBKB 4MU0A 1HNZE 5GMDA 1UDNA 1Z5AA 2VQEI 2BA0G 2HFUA 2PO0A 4LFAE 4LPFA 4RPFA 4DV2E 1USVA 4DPTA 1R6MA 5JEAD 2AE8A 4U3BA 1QZRA 5JEAA 4ED4A 4YY3I 4LF9E 1FKAE 1Y60A 3LPSA 3GCMA 2GO3A 2JT2A 4LCHA 5JEAC 4AQYI 4DV5E 1XXEA 1IBLI 3WU5A 4GKKE 4DR1I 4LF6E 2CZ9A 2AJ4A 4MDTA 4DR4I 3QT7A 2JEAB 1DARA 1IBLE 4HYMA 4X64E 4LF8E 4MYTA 3JAMC 5LMUI 4JI5I 4DPXA 1NHJA 1XMOE 1HNWE 3H4LA 2R42A 2HKJA 4P7AA 4OX9I 4IFDB 4LF4E 1Y4UA 5IWAI 4HACA 1ZM2A 2BA1G 1Z59A 4FW9A 4DU7A 3M85G 2HKEA 4YHHI 4J3DA 5A2QC 3H1CA 4KHPE 4MU1A 5BR8E 2PO2B 4DR5E 4MU4A 4JI1I 4JV5E 2VF3A 1FWKA 3J80C 1N32I 1MG7A 1Y4SA 2UXBE 4HXZA 2NN6D 4JI2I 3J7AG 2WW4A 2NN6A 3OTOI 4NXNE 4BA2B 4X66I 2NN6C 2V2QA 1OYPA 3GMEA 2JE6B 2XEXA 5K36D 2BV3A 4FWDA 4DV7E 4OO1F 4B3TI 5K36A 1K47A 2WNRB 3PS3A 4IZJD 4LFBE 5K36C 2C37A 4IZJA 2ZITA 4IFDF 4WUCA 3B78A 5JEAE 5IT9Q 4USKA 1UEKA 3J7AM 1IBKI 4DR2E 2LJPA 2C39A 1MU5A 2VQFE 5EL9A 5FLXC 4DV6E 1I94E 2Z5BB 2UUAI 5C0XB 1E3PA 1Z0TA 4NBQA 3LTOA 1FWLA 4WUDA 4JI7E 4B3SE 1YHCA 2UUCI 3M7NG 1VI7A 2A2CA 4OZEA 3CDIA 5DNLA 2UXDI 4DPWA 3UHMA 3PYGA 4DR6I 4UT4A 1A6FA 1XNQE 1H73A 2PNZB 1UDOA 3V5RA 1HNZI 4X65E 4FN5A 4JI0E 3PS2A 4LFAI 4DV2I 1NHHA 2E1RA 3Q6MA 2BA1D 2IOPA 3PRYA 3M85D 4AIDA 2JEBB 4LF9I 1S16A 3CWVA 4DV5I 3ZKDA 4DV3E 1Z0EA 3PS1A 5C0XF 4GKKI 1VISA 1UDQA 2NN6E 2O1WA 3M6AA 4K0KE 4FW5A 4LF6I 1HR0E 5GMEA 1EA6A 1NHIA 1N34E 2GQ0A 4X64I 4B3RE 4LF8I 4ZVIA 5K36E 4JI3E 4EMDA 4LFCE 1E3HA 2CGEA 5JEAF 4JI4E 1XMOI 1HNWI 5IT9C 1ZXMA 3P06A 4DV4E 3WU4A 3GLLA 4URLA 4LF4I 1Z5BA 1B62A 4OO1B 4R1FA 4BA1B 4PRVA 4KHPI 5BR8I 2BR2A 2V34A 4DR5I 4JV5I 5DRRA 2UXBI 3J81C 2UUBE 1Z0GA 1Z0BA 4M1KA 4GKJE 3M7ND 3WU6A 2C38B 3P3GA 4NXNI 3L7ZB 4Z7CA 1J5EE 1PIEA 2GS8A 3QT6A 4PRXA 1XNRE 4N3OA 4DV7I 2A2DA 5LMNE 4LF5E 3PYDA 4IS9A 3QT5A 4DV1E 4LFBI 3D4JA 2OI2A 4IZKB 2HHHE 1Z0VA 3T1YE 3PYFA 5DRQA 2O3ZA 2PO1B 4DR2I 2ZM6E 5DRPA 3F0NA 1HNXE 2VQFI 4LCFA 1FJGE 4DV6I 1I94I 2Z5CB 2DEIA 4X62E 2WP8A 4DR3E 4AM3A 3U1KA 1RREA 4DR7E 4PU9A 1PKPA 4IFDD 2IESA 4IFDA 5DROA 4B3SI 4JI7I 4B3ME 4DPUA 2DEJA 4IFDC 2BM1A 4JI8E 2UXCI 2HK3A 2PNLA 1KKHA 3P3EA 3QT8A 1Y6ZA 3CDJA
chains in the Genus database with same CATH topology
1XNQI 3ZZTA 2HFSA 4X65I 1N0VC 1XHKA 2CG9A 4JI0I 2UXCE 4WUBA 1B63A 3JAMQ 1ZM3A 1N33E 3T1HE 1N36E 4JI6E 2IOQA 4KQVA 4DV0E 3HJCA 3PYEA 4DV3I 3V2UC 1XMQE 4JG4A 4JYAE 4K0KI 1HR0I 2E5LE 4MYUA 1N34I 1PVGA 4B3RI 4FWGA 1KVKA 1H7UA 1MX0A 4JI3I 5FWKA 4LFCI 4JI4I 2Z5BA 2PNMA 4DUZE 1Z0CA 4DV4I 1FI4A 1S4EA 4HACB 4LF7E 4NXME 1FNMA 3ZZUA 1IBME 3ZZ0A 1OJ4A 3ZKBA 2F4VE 4DUYE 4HY1A 2O1VA 1HK7A 2VQEE 1USUA 1BKNA 3K17A 2UUBI 3Q6NA 4GKJI 2V2ZA 5FLXQ 1J5EI 4I3HA 4YY3E 4UTGA 4AQYE 1XNRI 1Z0WA 2V2VA 4IZJB 5LMNI 4LF5I 4USMA 4DV1I 4DR1E 5LL6R 3B82A 2HHHI 4DR4E 3B8HA 3T1YI 4Z7YA 2ZM6I 1ZM4A 1HNXI 2X36A 5LMUE 1U2RA 1NZ0A 1FJGI 4JI5E 1N0UA 4X62I 4DR3I 4XTJA 4OX9E 4DR7I 2HK2A 2O1UA 2UU9I 5IWAE 4DPYA 2V8PA 4B3MI 1ZXNA 4YHHE 1KIJA 1EI1A 4JI8I 3WU3A 1KTVA 3ZM7A 5L3JA 4JI1E 2UU9E 1WUUA 1N32E 1D6TA 1ELOA 4JI2E 4DXLA 2BM0A 3OTOE 4DU8A 1N33I 4X66E 3T1HI 1N36I 4JI6I 4DV0I 4B3TE 2J7KA 1XMQI 3LNUA 4JYAI 2Z5EA 1RR9A 2R3VA 2O1TA 4IZKA 1IBKE 1H72C 2E5LI 1Z5CA 3HULA 4FWHA 2UUAE 3GONA 1H74A 2Z5CA 3J81Q 4DUZI 2Q2EB 5A2QQ 4LF7I 4P52A 4NXMI 2EFGA 2UUCE 2X7IA 3J80Q 2NPFA 1IBMI 2UXDE 3K1JA 1H7SA 3K85A 3Q1QA 4DR6E 1ZM9A 2F4VI 4DUYI 2ZBKB 1HNZE 5GMDA 2VQEI 1Z5AA 2HFUA 4LFAE 4RPFA 4DV2E 1USVA 4DPTA 1QZRA 4ED4A 4YY3I 4LF9E 1FKAE 3LPSA 4AQYI 4DV5E 1IBLI 3WU5A 4GKKE 4DR1I 4LF6E 2CZ9A 2AJ4A 4DR4I 3QT7A 1DARA 1IBLE 4HYMA 4X64E 4LF8E 4MYTA 3JAMC 5LMUI 4JI5I 4DPXA 1NHJA 1XMOE 1HNWE 3H4LA 2R42A 2HKJA 4P7AA 4OX9I 4LF4E 1Y4UA 5IWAI 4HACA 1ZM2A 1Z59A 4FW9A 4DU7A 2HKEA 4YHHI 5A2QC 4KHPE 5BR8E 4DR5E 4JI1I 4JV5E 2VF3A 1FWKA 3J80C 1N32I 1MG7A 1Y4SA 2UXBE 4HXZA 4JI2I 3J7AG 2WW4A 3OTOI 4NXNE 4X66I 2V2QA 2XEXA 2BV3A 4FWDA 4DV7E 4B3TI 1K47A 4IZJD 4LFBE 4IZJA 2ZITA 4WUCA 3B78A 5IT9Q 4USKA 1UEKA 3J7AM 1IBKI 4DR2E 2LJPA 1MU5A 2VQFE 5FLXC 4DV6E 1I94E 2Z5BB 2UUAI 1Z0TA 3LTOA 1FWLA 4WUDA 4JI7E 4B3SE 2UUCI 2A2CA 2UXDI 4DPWA 3PYGA 4DR6I 4UT4A 1A6FA 1XNQE 1H73A 3V5RA 1HNZI 4X65E 4FN5A 4JI0E 4LFAI 4DV2I 1NHHA 2E1RA 3Q6MA 2IOPA 3PRYA 4LF9I 1S16A 3CWVA 4DV5I 4DV3E 3ZKDA 1Z0EA 4GKKI 1VISA 2O1WA 3M6AA 4K0KE 4LF6I 1HR0E 5GMEA 1EA6A 1NHIA 1N34E 2GQ0A 4X64I 4B3RE 4LF8I 4ZVIA 4JI3E 4EMDA 4LFCE 2CGEA 4JI4E 1XMOI 1HNWI 5IT9C 1ZXMA 3P06A 4DV4E 3WU4A 4URLA 4LF4I 1Z5BA 1B62A 4R1FA 4PRVA 4KHPI 5BR8I 2V34A 4DR5I 4JV5I 2UXBI 3J81C 2UUBE 1Z0GA 1Z0BA 4M1KA 4GKJE 3WU6A 4Z7CA 1J5EE 4NXNI 1PIEA 2GS8A 3QT6A 4PRXA 1XNRE 4N3OA 4DV7I 2A2DA 5LMNE 4LF5E 3PYDA 3QT5A 4DV1E 4LFBI 3D4JA 2OI2A 4IZKB 2HHHE 1Z0VA 3T1YE 3PYFA 4DR2I 2ZM6E 1HNXE 3F0NA 2VQFI 1FJGE 4DV6I 1I94I 2Z5CB 2DEIA 4X62E 4DR3E 1RREA 4DR7E 4PU9A 1PKPA 4JI7I 4B3SI 4B3ME 4DPUA 2DEJA 2BM1A 4JI8E 2UXCI 2HK3A 2PNLA 1KKHA 3QT8A 1Y6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ I;  3ZZT A;  2HFS A;  4X65 I;  1N0V C;  1XHK A;  4JI0 I;  2UXC E;  4WUB A;  1B63 A;  3JAM Q;  1ZM3 A;  1N33 E;  3T1H E;  1N36 E;  4JI6 E;  4KQV A;  4DV0 E;  3PYE A;  4DV3 I;  3V2U C;  1XMQ E;  4JG4 A;  4JYA E;  4K0K I;  1HR0 I;  2E5L E;  4MYU A;  1N34 I;  1PVG A;  4B3R I;  4FWG A;  1KVK A;  1H7U A;  1MX0 A;  4JI3 I;  4LFC I;  4JI4 I;  4DUZ E;  1Z0C A;  4DV4 I;  1FI4 A;  1S4E A;  4HAC B;  4LF7 E;  4NXM E;  1FNM A;  3ZZU A;  1IBM E;  3ZZ0 A;  1OJ4 A;  3ZKB A;  2F4V E;  4DUY E;  4HY1 A;  2VQE E;  1BKN A;  3K17 A;  2UUB I;  4GKJ I;  2V2Z A;  5FLX Q;  1J5E I;  4I3H A;  4YY3 E;  4UTG A;  4AQY E;  1XNR I;  1Z0W A;  2V2V A;  5LMN I;  4LF5 I;  4USM A;  4DV1 I;  4DR1 E;  5LL6 R;  3B82 A;  2HHH I;  4DR4 E;  3B8H A;  3T1Y I;  4Z7Y A;  2ZM6 I;  1ZM4 A;  1HNX I;  2X36 A;  5LMU E;  1U2R A;  1NZ0 A;  1FJG I;  4JI5 E;  1N0U A;  4X62 I;  4DR3 I;  4XTJ A;  4OX9 E;  4DR7 I;  2HK2 A;  2UU9 I;  5IWA E;  4DPY A;  2V8P A;  4B3M I;  1ZXN A;  4YHH E;  1KIJ A;  1EI1 A;  4JI8 I;  3WU3 A;  1KTV A;  3ZM7 A;  5L3J A;  4JI1 E;  2UU9 E;  1WUU A;  1N32 E;  1D6T A;  1ELO A;  4JI2 E;  4DXL A;  2BM0 A;  3OTO E;  4DU8 A;  1N33 I;  4X66 E;  3T1H I;  1N36 I;  4JI6 I;  4DV0 I;  4B3T E;  2J7K A;  1XMQ I;  3LNU A;  4JYA I;  1RR9 A;  2R3V A;  1IBK E;  2E5L I;  1H72 C;  1Z5C A;  3HUL A;  4FWH A;  2UUA E;  3GON A;  1H74 A;  3J81 Q;  4DUZ I;  2Q2E B;  5A2Q Q;  4LF7 I;  4P52 A;  4NXM I;  2EFG A;  2UUC E;  2X7I A;  3J80 Q;  2NPF A;  1IBM I;  2UXD E;  3K1J A;  1H7S A;  3Q1Q A;  4DR6 E;  1ZM9 A;  2F4V I;  4DUY I;  2ZBK B;  1HNZ E;  5GMD A;  2VQE I;  1Z5A A;  2HFU A;  4LFA E;  4RPF A;  4DV2 E;  4DPT A;  1QZR A;  4ED4 A;  4YY3 I;  4LF9 E;  1FKA E;  3LPS A;  4AQY I;  4DV5 E;  1IBL I;  3WU5 A;  4GKK E;  4DR1 I;  4LF6 E;  2CZ9 A;  2AJ4 A;  4DR4 I;  3QT7 A;  1DAR A;  1IBL E;  4HYM A;  4X64 E;  4LF8 E;  4MYT A;  3JAM C;  5LMU I;  4JI5 I;  4DPX A;  1NHJ A;  1XMO E;  1HNW E;  3H4L A;  2R42 A;  2HKJ A;  4P7A A;  4OX9 I;  4LF4 E;  5IWA I;  4HAC A;  1ZM2 A;  1Z59 A;  4FW9 A;  4DU7 A;  2HKE A;  4YHH I;  5A2Q C;  4KHP E;  5BR8 E;  4DR5 E;  4JI1 I;  4JV5 E;  2VF3 A;  1FWK A;  3J80 C;  1N32 I;  1MG7 A;  2UXB E;  4HXZ A;  4JI2 I;  3J7A G;  2WW4 A;  3OTO I;  4NXN E;  4X66 I;  2V2Q A;  2XEX A;  2BV3 A;  4FWD A;  4DV7 E;  4B3T I;  1K47 A;  4LFB E;  2ZIT A;  4WUC A;  3B78 A;  5IT9 Q;  4USK A;  1UEK A;  3J7A M;  1IBK I;  4DR2 E;  2LJP A;  1MU5 A;  2VQF E;  5FLX C;  4DV6 E;  1I94 E;  2UUA I;  1Z0T A;  3LTO A;  1FWL A;  4WUD A;  4JI7 E;  4B3S E;  2UUC I;  2A2C A;  2UXD I;  4DPW A;  3PYG A;  4DR6 I;  4UT4 A;  1A6F A;  1XNQ E;  1H73 A;  3V5R A;  1HNZ I;  4X65 E;  4FN5 A;  4JI0 E;  4LFA I;  4DV2 I;  1NHH A;  2E1R A;  4LF9 I;  1S16 A;  3CWV A;  4DV5 I;  4DV3 E;  3ZKD A;  1Z0E A;  4GKK I;  1VIS A;  3M6A A;  4K0K E;  4LF6 I;  1HR0 E;  5GME A;  1EA6 A;  1NHI A;  1N34 E;  4B3R E;  4X64 I;  4LF8 I;  4ZVI A;  4JI3 E;  4EMD A;  4LFC E;  4JI4 E;  1XMO I;  1HNW I;  5IT9 C;  1ZXM A;  4DV4 E;  3WU4 A;  4URL A;  4LF4 I;  1Z5B A;  1B62 A;  4R1F A;  4PRV A;  4KHP I;  5BR8 I;  2V34 A;  4DR5 I;  4JV5 I;  2UXB I;  3J81 C;  2UUB E;  1Z0G A;  1Z0B A;  4M1K A;  4GKJ E;  3WU6 A;  4Z7C A;  1J5E E;  4NXN I;  1PIE A;  2GS8 A;  3QT6 A;  4PRX A;  1XNR E;  4DV7 I;  2A2D A;  5LMN E;  4LF5 E;  3PYD A;  3QT5 A;  4DV1 E;  4LFB I;  3D4J A;  2OI2 A;  2HHH E;  1Z0V A;  3T1Y E;  3PYF A;  4DR2 I;  2ZM6 E;  1HNX E;  3F0N A;  2VQF I;  1FJG E;  4DV6 I;  1I94 I;  2DEI A;  4X62 E;  4DR3 E;  1RRE A;  4DR7 E;  4PU9 A;  1PKP A;  4JI7 I;  4B3S I;  4B3M E;  4DPU A;  2DEJ A;  2BM1 A;  4JI8 E;  2UXC I;  2HK3 A;  1KKH A;  3QT8 A; 
#chains in the Genus database with same CATH topology
 2PO0 B;  1XNQ I;  3ZZT A;  2HFS A;  4X65 I;  1N0V C;  1XHK A;  2CG9 A;  4JI0 I;  2UXC E;  4WUB A;  4ISA A;  1B63 A;  5JEA B;  2IER A;  3JAM Q;  1ZM3 A;  1N33 E;  3T1H E;  1N36 E;  4JI6 E;  2IOQ A;  4BA2 A;  4KQV A;  4DV0 E;  3HJC A;  3PYE A;  2JE6 A;  4DV3 I;  5ELW A;  3V2U C;  1XMQ E;  4FW6 A;  4JG4 A;  4JYA E;  4K0K I;  1HR0 I;  1P42 A;  2E5L E;  4MYU A;  1N34 I;  1PVG A;  4B3R I;  4FWG A;  1KVK A;  1H7U A;  1MX0 A;  4JI3 I;  5FWK A;  4LFC I;  4OKG A;  4JI4 I;  2Z5B A;  2PNM A;  4DUZ E;  1Z0C A;  4DV4 I;  4HAC B;  1FI4 A;  1S4E A;  4LF7 E;  4NXM E;  5C0X C;  2GO4 A;  1FNM A;  3ZZU A;  1IBM E;  3ZZ0 A;  4MQY A;  4OO1 E;  1OJ4 A;  3ZKB A;  2F4V E;  4DUY E;  4HY1 A;  2O1V A;  1HK7 A;  2VQE E;  4IFD E;  1USU A;  1BKN A;  2NN6 B;  3K17 A;  2PNZ A;  1UDS A;  2UUB I;  3Q6N A;  4GKJ I;  2V2Z A;  5FLX Q;  1J5E I;  4I3H A;  4YY3 E;  4UTG A;  5K36 B;  4AQY E;  1XNR I;  1Z0W A;  2V2V A;  3HKM A;  2JEB A;  4QNK A;  2C37 B;  1OYS A;  2WP8 B;  4IZJ B;  5LMN I;  4LF5 I;  4USM A;  4DV1 I;  4DR1 E;  5LL6 R;  3B82 A;  5DNX A;  2C39 B;  2HHH I;  4DR4 E;  3B8H A;  3T1Y I;  2J65 A;  4Z7Y A;  2ZM6 I;  1ZM4 A;  1HNX I;  2X36 A;  5LMU E;  1U2R A;  1NZ0 A;  3U1Y A;  1FJG I;  4JI5 E;  2CVE A;  4U3D A;  1N0U A;  4X62 I;  4DR3 I;  4XTJ A;  4OX9 E;  4DR7 I;  4AIM A;  2HK2 A;  2O1U A;  2UU9 I;  1Y5Y A;  5IWA E;  2JEA A;  2NN6 F;  4DPY A;  3P3C A;  2V8P A;  4B3M I;  4OO1 D;  1ZXN A;  4OO1 A;  4YHH E;  1KIJ A;  4QNJ A;  4GQU A;  1EI1 A;  4JI8 I;  4BA1 A;  4OO1 C;  3WU3 A;  1KTV A;  3ZM7 A;  2VES A;  5L3J A;  4JI1 E;  2UU9 E;  5C0X E;  5K36 F;  1WUU A;  1N32 E;  1D6T A;  1ELO A;  4FW4 A;  4JI2 E;  4LCG A;  4DXL A;  2BM0 A;  3B4T A;  3OTO E;  4DU8 A;  1N33 I;  4X66 E;  2BA0 D;  3T1H I;  1R6L A;  1N36 I;  2PO2 A;  4JI6 I;  2C38 A;  3L7Z A;  1YH8 A;  4DV0 I;  5EKW A;  3NZK A;  4MU3 A;  4B3T E;  2J7K A;  1XMQ I;  3LNU A;  4JYA I;  2Z5E A;  1RR9 A;  2R3V A;  2O1T A;  4IZK A;  1IBK E;  1H72 C;  2E5L I;  3P76 A;  4FW7 A;  1Z5C A;  3HUL A;  4FWH A;  2UUA E;  2PO1 A;  3DD6 A;  3GON A;  2WNR A;  1OYR A;  1H74 A;  2Z5C A;  3J81 Q;  4DUZ I;  4LOM A;  2Q2E B;  5A2Q Q;  2F1D A;  4LF7 I;  4P52 A;  4NXM I;  2EFG A;  2UUC E;  3KRN A;  1RHY A;  2X7I A;  4FW3 A;  3J80 Q;  2NPF A;  1IBM I;  2UXD E;  2BR2 B;  3K1J A;  1H7S A;  3K85 A;  5C0X D;  3Q1Q A;  5C0X A;  4DR6 E;  1ZM9 A;  2F4V I;  4DUY I;  2ZBK B;  4MU0 A;  1HNZ E;  5GMD A;  1UDN A;  1Z5A A;  2VQE I;  2BA0 G;  2HFU A;  2PO0 A;  4LFA E;  4LPF A;  4RPF A;  4DV2 E;  1USV A;  4DPT A;  1R6M A;  5JEA D;  2AE8 A;  4U3B A;  1QZR A;  5JEA A;  4ED4 A;  4YY3 I;  4LF9 E;  1FKA E;  1Y60 A;  3LPS A;  3GCM A;  2GO3 A;  2JT2 A;  4LCH A;  5JEA C;  4AQY I;  4DV5 E;  1XXE A;  1IBL I;  3WU5 A;  4GKK E;  4DR1 I;  4LF6 E;  2CZ9 A;  2AJ4 A;  4MDT A;  4DR4 I;  3QT7 A;  2JEA B;  1DAR A;  1IBL E;  4HYM A;  4X64 E;  4LF8 E;  4MYT A;  3JAM C;  5LMU I;  4JI5 I;  4DPX A;  1NHJ A;  1XMO E;  1HNW E;  3H4L A;  2R42 A;  2HKJ A;  4P7A A;  4OX9 I;  4IFD B;  4LF4 E;  1Y4U A;  5IWA I;  4HAC A;  1ZM2 A;  2BA1 G;  1Z59 A;  4FW9 A;  4DU7 A;  3M85 G;  2HKE A;  4YHH I;  4J3D A;  5A2Q C;  3H1C A;  4KHP E;  4MU1 A;  5BR8 E;  2PO2 B;  4DR5 E;  4MU4 A;  4JI1 I;  4JV5 E;  2VF3 A;  1FWK A;  3J80 C;  1N32 I;  1MG7 A;  1Y4S A;  2UXB E;  4HXZ A;  2NN6 D;  4JI2 I;  3J7A G;  2WW4 A;  2NN6 A;  3OTO I;  4NXN E;  4BA2 B;  4X66 I;  2NN6 C;  2V2Q A;  1OYP A;  3GME A;  2JE6 B;  2XEX A;  5K36 D;  2BV3 A;  4FWD A;  4DV7 E;  4OO1 F;  4B3T I;  5K36 A;  1K47 A;  2WNR B;  3PS3 A;  4IZJ D;  4LFB E;  5K36 C;  2C37 A;  4IZJ A;  2ZIT A;  4IFD F;  4WUC A;  3B78 A;  5JEA E;  5IT9 Q;  4USK A;  1UEK A;  3J7A M;  1IBK I;  4DR2 E;  2LJP A;  2C39 A;  1MU5 A;  2VQF E;  5EL9 A;  5FLX C;  4DV6 E;  1I94 E;  2Z5B B;  2UUA I;  5C0X B;  1E3P A;  1Z0T A;  4NBQ A;  3LTO A;  1FWL A;  4WUD A;  4JI7 E;  4B3S E;  1YHC A;  2UUC I;  3M7N G;  1VI7 A;  2A2C A;  4OZE A;  3CDI A;  5DNL A;  2UXD I;  4DPW A;  3UHM A;  3PYG A;  4DR6 I;  4UT4 A;  1A6F A;  1XNQ E;  1H73 A;  2PNZ B;  1UDO A;  3V5R A;  1HNZ I;  4X65 E;  4FN5 A;  4JI0 E;  3PS2 A;  4LFA I;  4DV2 I;  1NHH A;  2E1R A;  3Q6M A;  2BA1 D;  2IOP A;  3PRY A;  3M85 D;  4AID A;  2JEB B;  4LF9 I;  1S16 A;  3CWV A;  4DV5 I;  3ZKD A;  4DV3 E;  1Z0E A;  3PS1 A;  5C0X F;  4GKK I;  1VIS A;  1UDQ A;  2NN6 E;  2O1W A;  3M6A A;  4K0K E;  4FW5 A;  4LF6 I;  1HR0 E;  5GME A;  1EA6 A;  1NHI A;  1N34 E;  2GQ0 A;  4X64 I;  4B3R E;  4LF8 I;  4ZVI A;  5K36 E;  4JI3 E;  4EMD A;  4LFC E;  1E3H A;  2CGE A;  5JEA F;  4JI4 E;  1XMO I;  1HNW I;  5IT9 C;  1ZXM A;  3P06 A;  4DV4 E;  3WU4 A;  3GLL A;  4URL A;  4LF4 I;  1Z5B A;  1B62 A;  4OO1 B;  4R1F A;  4BA1 B;  4PRV A;  4KHP I;  5BR8 I;  2BR2 A;  2V34 A;  4DR5 I;  4JV5 I;  5DRR A;  2UXB I;  3J81 C;  2UUB E;  1Z0G A;  1Z0B A;  4M1K A;  4GKJ E;  3M7N D;  3WU6 A;  2C38 B;  3P3G A;  4NXN I;  3L7Z B;  4Z7C A;  1J5E E;  1PIE A;  2GS8 A;  3QT6 A;  4PRX A;  1XNR E;  4N3O A;  4DV7 I;  2A2D A;  5LMN E;  4LF5 E;  3PYD A;  4IS9 A;  3QT5 A;  4DV1 E;  4LFB I;  3D4J A;  2OI2 A;  4IZK B;  2HHH E;  1Z0V A;  3T1Y E;  3PYF A;  5DRQ A;  2O3Z A;  2PO1 B;  4DR2 I;  2ZM6 E;  5DRP A;  3F0N A;  1HNX E;  2VQF I;  4LCF A;  1FJG E;  4DV6 I;  1I94 I;  2Z5C B;  2DEI A;  4X62 E;  2WP8 A;  4DR3 E;  4AM3 A;  3U1K A;  1RRE A;  4DR7 E;  4PU9 A;  1PKP A;  4IFD D;  2IES A;  4IFD A;  5DRO A;  4B3S I;  4JI7 I;  4B3M E;  4DPU A;  2DEJ A;  4IFD C;  2BM1 A;  4JI8 E;  2UXC I;  2HK3 A;  2PNL A;  1KKH A;  3P3E A;  3QT8 A;  1Y6Z A;  3CDJ A; 
#chains in the Genus database with same CATH homology
 1XNQ I;  3ZZT A;  2HFS A;  4X65 I;  1N0V C;  1XHK A;  2CG9 A;  4JI0 I;  2UXC E;  4WUB A;  1B63 A;  3JAM Q;  1ZM3 A;  1N33 E;  3T1H E;  1N36 E;  4JI6 E;  2IOQ A;  4KQV A;  4DV0 E;  3HJC A;  3PYE A;  4DV3 I;  3V2U C;  1XMQ E;  4JG4 A;  4JYA E;  4K0K I;  1HR0 I;  2E5L E;  4MYU A;  1N34 I;  1PVG A;  4B3R I;  4FWG A;  1KVK A;  1H7U A;  1MX0 A;  4JI3 I;  5FWK A;  4LFC I;  4JI4 I;  2Z5B A;  2PNM A;  4DUZ E;  1Z0C A;  4DV4 I;  1FI4 A;  1S4E A;  4HAC B;  4LF7 E;  4NXM E;  1FNM A;  3ZZU A;  1IBM E;  3ZZ0 A;  1OJ4 A;  3ZKB A;  2F4V E;  4DUY E;  4HY1 A;  2O1V A;  1HK7 A;  2VQE E;  1USU A;  1BKN A;  3K17 A;  2UUB I;  3Q6N A;  4GKJ I;  2V2Z A;  5FLX Q;  1J5E I;  4I3H A;  4YY3 E;  4UTG A;  4AQY E;  1XNR I;  1Z0W A;  2V2V A;  4IZJ B;  5LMN I;  4LF5 I;  4USM A;  4DV1 I;  4DR1 E;  5LL6 R;  3B82 A;  2HHH I;  4DR4 E;  3B8H A;  3T1Y I;  4Z7Y A;  2ZM6 I;  1ZM4 A;  1HNX I;  2X36 A;  5LMU E;  1U2R A;  1NZ0 A;  1FJG I;  4JI5 E;  1N0U A;  4X62 I;  4DR3 I;  4XTJ A;  4OX9 E;  4DR7 I;  2HK2 A;  2O1U A;  2UU9 I;  5IWA E;  4DPY A;  2V8P A;  4B3M I;  1ZXN A;  4YHH E;  1KIJ A;  1EI1 A;  4JI8 I;  3WU3 A;  1KTV A;  3ZM7 A;  5L3J A;  4JI1 E;  2UU9 E;  1WUU A;  1N32 E;  1D6T A;  1ELO A;  4JI2 E;  4DXL A;  2BM0 A;  3OTO E;  4DU8 A;  1N33 I;  4X66 E;  3T1H I;  1N36 I;  4JI6 I;  4DV0 I;  4B3T E;  2J7K A;  1XMQ I;  3LNU A;  4JYA I;  2Z5E A;  1RR9 A;  2R3V A;  2O1T A;  4IZK A;  1IBK E;  1H72 C;  2E5L I;  1Z5C A;  3HUL A;  4FWH A;  2UUA E;  3GON A;  1H74 A;  2Z5C A;  3J81 Q;  4DUZ I;  2Q2E B;  5A2Q Q;  4LF7 I;  4P52 A;  4NXM I;  2EFG A;  2UUC E;  2X7I A;  3J80 Q;  2NPF A;  1IBM I;  2UXD E;  3K1J A;  1H7S A;  3K85 A;  3Q1Q A;  4DR6 E;  1ZM9 A;  2F4V I;  4DUY I;  2ZBK B;  1HNZ E;  5GMD A;  2VQE I;  1Z5A A;  2HFU A;  4LFA E;  4RPF A;  4DV2 E;  1USV A;  4DPT A;  1QZR A;  4ED4 A;  4YY3 I;  4LF9 E;  1FKA E;  3LPS A;  4AQY I;  4DV5 E;  1IBL I;  3WU5 A;  4GKK E;  4DR1 I;  4LF6 E;  2CZ9 A;  2AJ4 A;  4DR4 I;  3QT7 A;  1DAR A;  1IBL E;  4HYM A;  4X64 E;  4LF8 E;  4MYT A;  3JAM C;  5LMU I;  4JI5 I;  4DPX A;  1NHJ A;  1XMO E;  1HNW E;  3H4L A;  2R42 A;  2HKJ A;  4P7A A;  4OX9 I;  4LF4 E;  1Y4U A;  5IWA I;  4HAC A;  1ZM2 A;  1Z59 A;  4FW9 A;  4DU7 A;  2HKE A;  4YHH I;  5A2Q C;  4KHP E;  5BR8 E;  4DR5 E;  4JI1 I;  4JV5 E;  2VF3 A;  1FWK A;  3J80 C;  1N32 I;  1MG7 A;  1Y4S A;  2UXB E;  4HXZ A;  4JI2 I;  3J7A G;  2WW4 A;  3OTO I;  4NXN E;  4X66 I;  2V2Q A;  2XEX A;  2BV3 A;  4FWD A;  4DV7 E;  4B3T I;  1K47 A;  4IZJ D;  4LFB E;  4IZJ A;  2ZIT A;  4WUC A;  3B78 A;  5IT9 Q;  4USK A;  1UEK A;  3J7A M;  1IBK I;  4DR2 E;  2LJP A;  1MU5 A;  2VQF E;  5FLX C;  4DV6 E;  1I94 E;  2Z5B B;  2UUA I;  1Z0T A;  3LTO A;  1FWL A;  4WUD A;  4JI7 E;  4B3S E;  2UUC I;  2A2C A;  2UXD I;  4DPW A;  3PYG A;  4DR6 I;  4UT4 A;  1A6F A;  1XNQ E;  1H73 A;  3V5R A;  1HNZ I;  4X65 E;  4FN5 A;  4JI0 E;  4LFA I;  4DV2 I;  1NHH A;  2E1R A;  3Q6M A;  2IOP A;  3PRY A;  4LF9 I;  1S16 A;  3CWV A;  4DV5 I;  4DV3 E;  3ZKD A;  1Z0E A;  4GKK I;  1VIS A;  2O1W A;  3M6A A;  4K0K E;  4LF6 I;  1HR0 E;  5GME A;  1EA6 A;  1NHI A;  1N34 E;  2GQ0 A;  4X64 I;  4B3R E;  4LF8 I;  4ZVI A;  4JI3 E;  4EMD A;  4LFC E;  2CGE A;  4JI4 E;  1XMO I;  1HNW I;  5IT9 C;  1ZXM A;  3P06 A;  4DV4 E;  3WU4 A;  4URL A;  4LF4 I;  1Z5B A;  1B62 A;  4R1F A;  4PRV A;  4KHP I;  5BR8 I;  2V34 A;  4DR5 I;  4JV5 I;  2UXB I;  3J81 C;  2UUB E;  1Z0G A;  1Z0B A;  4M1K A;  4GKJ E;  3WU6 A;  4Z7C A;  1J5E E;  4NXN I;  1PIE A;  2GS8 A;  3QT6 A;  4PRX A;  1XNR E;  4N3O A;  4DV7 I;  2A2D A;  5LMN E;  4LF5 E;  3PYD A;  3QT5 A;  4DV1 E;  4LFB I;  3D4J A;  2OI2 A;  4IZK B;  2HHH E;  1Z0V A;  3T1Y E;  3PYF A;  4DR2 I;  2ZM6 E;  1HNX E;  3F0N A;  2VQF I;  1FJG E;  4DV6 I;  1I94 I;  2Z5C B;  2DEI A;  4X62 E;  4DR3 E;  1RRE A;  4DR7 E;  4PU9 A;  1PKP A;  4JI7 I;  4B3S I;  4B3M E;  4DPU A;  2DEJ A;  2BM1 A;  4JI8 E;  2UXC I;  2HK3 A;  2PNL A;  1KKH A;  3QT8 A;  1Y6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...