2UU9I

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9I00
2R42A 1MX0A 2UUAE 1S16A 3B8HA 4LF7E 4JI8E 4JYAE 1PKPA 2V2ZA 2UXBI 3LPSA 1NHHA 4YY3E 5IWAI 4DPWA 4JI1I 4JI5E 4DV3I 3J81C 4DU7A 4DPYA 3ZKBA 4DV1E 1FJGI 3WU4A 1MU5A 1KKHA 1N33I 4LFAI 1H72C 2UUAI 4NXME 4B3ME 2J7KA 1EI1A 3QT6A 2UXDE 1FJGE 1N32E 2HK2A 3WU5A 1N32I 1HNZI 3J81Q 4LF7I 1ZM9A 2X7IA 4DR5I 2BM0A 1KVKA 1N33E 4JI8I 4ED4A 4FN5A 1Z0GA 2E5LE 1XMQE 4LF8I 4DXLA 4LF6I 5LMNE 4B3TE 1NHIA 1MG7A 4X66I 2UXCE 4X65I 2E5LI 1WUUA 4P52A 2V2VA 2ZM6I 1UEKA 4X66E 3J80C 4Z7YA 4LF9I 4LF8E 4JI7I 1RREA 1XNQE 1NHJA 4JI4I 4USKA 2HFUA 4JI0E 2BM1A 4OX9E 1Z5BA 1FNMA 4LF6E 4JV5E 3T1YI 2UXDI 1OJ4A 5LL6R 2UU9I 1ZM3A 1Z0WA 4K0KE 1XHKA 3K1JA 4KQVA 4JI4E 4UT4A 4DR2I 1N0UA 3HULA 1DARA 4DR6E 1U2RA 3QT8A 1N0VC 4WUCA 3J7AM 2NPFA 1KTVA 1S4EA 1RR9A 5BR8E 3OTOI 5FLXQ 4FW9A 4UTGA 1Z5AA 1ZM2A 2R3VA 3ZZUA 2F4VI 4YHHE 4HACA 1Z0CA 4PRXA 5IT9C 3PYGA 1H74A 3LNUA 4FWHA 2HHHI 5LMUI 4JYAI 4DV2E 4DR1I 3QT7A 4DR2E 1IBLE 2A2DA 4JI0I 4LFAE 4AQYE 4M1KA 4KHPI 3CWVA 1XNRE 4DV5E 4DUYI 1HR0I 1N34E 2V2QA 4OX9I 1N36E 1IBKI 4GKKI 3OTOE 5BR8I 2BV3A 4DV5I 2UU9E 2V8PA 1Z5CA 2HKEA 1I94I 5FLXC 2A2CA 4B3SI 4DR5E 4DPXA 4RPFA 1FKAE 4GKKE 5A2QC 4LFCI 1FWKA 3ZM7A 4DR3I 4B3RE 1A6FA 4X65E 4JG4A 2HFSA 3B78A 5LMUE 3T1YE 2DEIA 3WU6A 4PU9A 4FWGA 2DEJA 1BKNA 1PVGA 4P7AA 4YY3I 5IWAE 4B3MI 4LF5E 4DV0I 1XMQI 1PIEA 2ZM6E 1D6TA 3J7AG 4X62I 2UXCI 4JI2E 2VQFE 3V5RA 3WU3A 3GONA 4LF5I 5A2QQ 1XMOI 4LFBE 1ZXNA 2VQEI 1XMOE 4LFBI 4GKJE 1QZRA 2VQEE 4JI6I 3PYFA 1IBMI 3ZZ0A 3Q1QA 2UUCI 2ZBKB 4JI5I 4AQYI 1EA6A 3PYDA 4MYTA 1N36I 1IBKE 4R1FA 4YHHI 3ZZTA 1Z0VA 4X62E 1IBLI 4X64E 4NXNI 1J5EE 4WUDA 5GMDA 4JI7E 2LJPA 1XNRI 3LTOA 4HYMA 4DR4E 4B3SE 1H7UA 1FI4A 1K47A 4DUZE 2Q2EB 2V34A 1B63A 4XTJA 3D4JA 2CZ9A 2X36A 3T1HI 2HK3A 2ZITA 1Z0EA 4EMDA 4DV1I 3JAMC 2WW4A 2UUBE 1XNQI 1Z0BA 2GS8A 1FWLA 4JI1E 5GMEA 2UUCE 1H7SA 4DR4I 4DV6I 2F4VE 1J5EI 4NXNE 4LFCE 2OI2A 2XEXA 3B82A 4LF4E 1HNWI 3M6AA 3V2UC 4DV2I 4DUYE 1HR0E 4DV6E 1IBME 1N34I 3PYEA 1NZ0A 3QT5A 4DR3E 4B3RI 2VQFI 4USMA 4DV4I 4I3HA 4URLA 4K0KI 4DV7E 4DPTA 1HNZE 1I94E 2UXBE 1ELOA 4MYUA 5L3JA 5IT9Q 4DR7E 5LMNI 4B3TI 1ZXMA 4HACB 4FWDA 2E1RA 4DV0E 2HHHE 1VISA 4Z7CA 1Z59A 4WUBA 4DR7I 1B62A 1KIJA 1HNXE 2VF3A 1HNXI 1H73A 4LF4I 1HNWE 3JAMQ 3T1HE 4JI3E 4HY1A 4ZVIA 4DU8A 3ZKDA 4DUZI 2AJ4A 4LF9E 3F0NA 1ZM4A 2UUBI 4JV5I 4DR6I 2HKJA 4PRVA 2EFGA 4X64I 3H4LA 4DV7I 4JI2I 4GKJI 4DPUA 4DV4E 4JI6E 4NXMI 4JI3I 1Z0TA 4DR1E 3K17A 4HXZA 3J80Q 4DV3E 4KHPE
chains in the Genus database with same CATH superfamily
2PO0B 2R42A 1MX0A 2UUAE 1S16A 3B8HA 4LF7E 4JI8E 3U1KA 4IZJD 4JYAE 4AIMA 1PKPA 4LCGA 3NZKA 4IFDE 4N3OA 2IOQA 4LCFA 2CGEA 2V2ZA 3K85A 5K36B 2UXBI 3L7ZB 4OO1E 3LPSA 1NHHA 4U3BA 4YY3E 5IWAI 2VESA 4DPWA 4IFDC 4JI1I 4OZEA 4JI5E 3Q6MA 3J81C 4DV3I 4DU7A 4OO1C 4DPYA 3ZKBA 2BA1D 4DV1E 2PO1B 2NN6B 1FJGI 3HKMA 3WU4A 1MU5A 1KKHA 1N33I 4LFAI 1H72C 2JT2A 2Z5CA 2UUAI 4NXME 4B3ME 2J7KA 5DROA 1EI1A 2WP8B 1OYSA 4BA1A 1E3PA 4IFDF 3QT6A 4IFDA 2UXDE 1FJGE 1N32E 2HK2A 3WU5A 4FW7A 1N32I 2Z5EA 1HNZI 4IZJA 3J81Q 4LF7I 1ZM9A 5K36F 2X7IA 4DR5I 2AE8A 2BM0A 1KVKA 1N33E 4BA2A 4JI8I 4ED4A 4FN5A 1Z0GA 2E5LE 1XMQE 5ELWA 4LF8I 4DXLA 4QNKA 3PRYA 4LF6I 5LMNE 4B3TE 1NHIA 4BA2B 1MG7A 4X66I 2GO4A 2UXCE 5K36C 4X65I 1UDNA 2E5LI 1VI7A 1WUUA 4P52A 2V2VA 5DNXA 4IS9A 2ZM6I 1UEKA 2BR2A 4MU0A 4IFDB 4X66E 2IESA 3J80C 4Z7YA 4LF9I 4LF8E 4JI7I 1RREA 5C0XF 2NN6F 5JEAE 1XNQE 2GO3A 5JEAF 1NHJA 2PNZB 4JI4I 4USKA 5EKWA 2HFUA 3DD6A 4QNJA 4JI0E 2BM1A 4OX9E 1Z5BA 1FNMA 4LF6E 2GQ0A 4JV5E 3T1YI 2UXDI 1HK7A 1OJ4A 5LL6R 2UU9I 1ZM3A 1Z0WA 5JEAC 2PNMA 4K0KE 1XHKA 5C0XA 2NN6E 3K1JA 3L7ZA 4KQVA 4JI4E 2Z5BB 2PO2B 4UT4A 4DR2I 1N0UA 3HULA 1DARA 4DR6E 1U2RA 1Y5YA 3QT8A 1N0VC 1OYPA 4WUCA 3J7AM 2NPFA 1KTVA 1S4EA 2IERA 1RR9A 5BR8E 3OTOI 4U3DA 5FLXQ 4FW9A 4UTGA 4OO1A 5DRPA 1Z5AA 2O1TA 1ZM2A 2R3VA 3ZZUA 2F4VI 4YHHE 4HACA 2CVEA 1Z0CA 1YHCA 2O1UA 4MDTA 4PRXA 5IT9C 2NN6A 1H74A 3LNUA 3PYGA 1OYRA 1P42A 4FWHA 2HHHI 3PS2A 5LMUI 4JYAI 4DV2E 2C39B 4DR1I 3QT7A 4DR2E 4LCHA 2O1WA 1IBLE 2A2DA 2Z5BA 4JI0I 2IOPA 4GQUA 4LFAE 4AQYE 4M1KA 4KHPI 2PNLA 3CWVA 1XNRE 5C0XB 4DV5E 4DUYI 1HR0I 5JEAB 4MU4A 1N34E 2JE6A 2V2QA 3Q6NA 4FW6A 4IZKA 4OX9I 1N36E 1IBKI 4GKKI 4IZJB 3OTOE 5BR8I 2BV3A 4DV5I 3P06A 2UU9E 2V8PA 2CG9A 1Z5CA 4BA1B 2HKEA 1I94I 1E3HA 5FLXC 3M7NG 2A2CA 1USUA 4B3SI 4DPXA 4RPFA 4DR5E 1FKAE 4GKKE 5A2QC 4LFCI 1FWKA 3ZM7A 4DR3I 2PO1A 4B3RE 1A6FA 4LOMA 4X65E 4JG4A 2HFSA 3B78A 3H1CA 2C37A 5LMUE 3T1YE 4IFDD 2DEIA 3WU6A 4PU9A 3PS3A 3M85G 4FWGA 5DRRA 2DEJA 1BKNA 1PVGA 4P7AA 4YY3I 5IWAE 4FW5A 4B3MI 4LF5E 4DV0I 2O1VA 1XMQI 1PIEA 2ZM6E 2NN6C 5K36A 1D6TA 3J7AG 4X62I 3P3GA 4MQYA 2UXCI 4JI2E 2VQFE 2F1DA 2BA1G 5FWKA 3V5RA 3WU3A 3GMEA 3GONA 2PO0A 3PS1A 4LF5I 5A2QQ 1XMOI 4LFBE 2WP8A 1ZXNA 2VQEI 1XMOE 4LFBI 4GKJE 1QZRA 2VQEE 4JI6I 1Y6ZA 2Z5CB 3PYFA 4OO1B 1IBMI 3ZZ0A 3Q1QA 5C0XE 2UUCI 2ZBKB 1R6LA 3M85D 4JI5I 5C0XD 4AQYI 2NN6D 1EA6A 3PYDA 3CDIA 4MYTA 5JEAD 1N36I 1IBKE 4R1FA 4MU1A 2JEBB 4YHHI 3ZZTA 1Z0VA 4X62E 1IBLI 4X64E 4NXNI 1J5EE 2BA0D 5EL9A 4WUDA 5GMDA 3CDJA 3GCMA 4JI7E 2LJPA 1XNRI 3LTOA 4HYMA 4DR4E 4B3SE 1H7UA 1FI4A 1Y4UA 1K47A 4DUZE 2Q2EB 2V34A 2BA0G 2JEBA 1B63A 4XTJA 3D4JA 2CZ9A 2C37B 2X36A 3T1HI 2HK3A 2ZITA 1Z0EA 4EMDA 4DV1I 3JAMC 2WW4A 2UUBE 1XNQI 1Z0BA 3B4TA 4OO1D 2GS8A 1Y60A 1FWLA 2C38A 1USVA 5GMEA 4JI1E 2UUCE 1H7SA 4DR4I 5K36D 4DV6I 2F4VE 2O3ZA 4FW3A 1J5EI 4NXNE 4LFCE 2OI2A 2XEXA 3B82A 1RHYA 4LF4E 1HNWI 4J3DA 3M6AA 4IZKB 3V2UC 4NBQA 2JE6B 4DUYE 4DV2I 4DV6E 1UDQA 1HR0E 1IBME 1N34I 3PYEA 2PO2A 1NZ0A 3QT5A 4DR3E 4B3RI 2JEAB 2VQFI 5DNLA 4USMA 1R6MA 4DV4I 2JEAA 4I3HA 4URLA 5DRQA 1XXEA 1Y4SA 4K0KI 4DV7E 4DPTA 1HNZE 1I94E 4OO1F 2UXBE 1ELOA 4ISAA 2WNRB 4MYUA 5L3JA 1UDSA 4DR7E 5IT9Q 5LMNI 4B3TI 3UHMA 5K36E 1ZXMA 4HACB 4FWDA 2E1RA 3HJCA 4DV0E 4FW4A 2HHHE 1VISA 4Z7CA 1Z59A 4WUBA 4DR7I 1B62A 1KIJA 1HNXE 2BR2B 2VF3A 1HNXI 4OKGA 1H73A 2WNRA 4LF4I 1HNWE 1UDOA 3JAMQ 5C0XC 4LPFA 3U1YA 3T1HE 3GLLA 4JI3E 4HY1A 4ZVIA 4DU8A 5JEAA 3ZKDA 4DUZI 2AJ4A 4LF9E 3F0NA 4AM3A 1ZM4A 4AIDA 4MU3A 3P3CA 2UUBI 4JV5I 4DR6I 2HKJA 4PRVA 2EFGA 4X64I 3H4LA 4DV7I 2C39A 4JI2I 4GKJI 4DPUA 4DV4E 4JI6E 4NXMI 2J65A 3P3EA 3P76A 4JI3I 1Z0TA 4DR1E 3KRNA 1YH8A 3K17A 2PNZA 3M7ND 4HXZA 3J80Q 4DV3E 4KHPE 2C38B
chains in the Genus database with same CATH topology
2R42A 1MX0A 2UUAE 1S16A 3B8HA 4LF7E 4JI8E 4IZJD 4JYAE 1PKPA 4N3OA 2IOQA 2CGEA 2V2ZA 3K85A 2UXBI 3LPSA 1NHHA 4YY3E 5IWAI 4DPWA 4JI1I 4JI5E 4DV3I 3Q6MA 3J81C 4DU7A 4DPYA 3ZKBA 4DV1E 1FJGI 3WU4A 1MU5A 1KKHA 1N33I 4LFAI 1H72C 2Z5CA 2UUAI 4NXME 4B3ME 2J7KA 1EI1A 3QT6A 2UXDE 1FJGE 1N32E 2HK2A 3WU5A 1N32I 2Z5EA 1HNZI 4IZJA 3J81Q 4LF7I 1ZM9A 2X7IA 4DR5I 2BM0A 1KVKA 1N33E 4JI8I 4ED4A 4FN5A 1Z0GA 2E5LE 1XMQE 4LF8I 4DXLA 4LF6I 3PRYA 5LMNE 4B3TE 1NHIA 1MG7A 4X66I 2UXCE 4X65I 2E5LI 1WUUA 4P52A 2V2VA 2ZM6I 1UEKA 4X66E 3J80C 4Z7YA 4LF9I 4LF8E 4JI7I 1RREA 1XNQE 1NHJA 4JI4I 4USKA 2HFUA 4JI0E 2BM1A 4OX9E 1Z5BA 1FNMA 4LF6E 2GQ0A 4JV5E 3T1YI 2UXDI 1HK7A 1OJ4A 5LL6R 2UU9I 1ZM3A 1Z0WA 2PNMA 4K0KE 1XHKA 3K1JA 4KQVA 4JI4E 2Z5BB 4UT4A 4DR2I 1N0UA 3HULA 1DARA 4DR6E 1U2RA 3QT8A 1N0VC 4WUCA 3J7AM 2NPFA 1KTVA 1S4EA 1RR9A 5BR8E 3OTOI 5FLXQ 4FW9A 4UTGA 1Z5AA 2O1TA 1ZM2A 2R3VA 3ZZUA 2F4VI 4YHHE 4HACA 1Z0CA 2O1UA 4PRXA 5IT9C 3PYGA 1H74A 3LNUA 4FWHA 2HHHI 5LMUI 4JYAI 4DV2E 4DR1I 3QT7A 4DR2E 2O1WA 1IBLE 2A2DA 2Z5BA 4JI0I 2IOPA 4LFAE 4AQYE 4M1KA 4KHPI 2PNLA 3CWVA 1XNRE 4DV5E 4DUYI 1HR0I 1N34E 2V2QA 3Q6NA 4IZKA 4OX9I 1N36E 1IBKI 4GKKI 4IZJB 3OTOE 5BR8I 2BV3A 4DV5I 3P06A 2UU9E 2V8PA 2CG9A 1Z5CA 2HKEA 1I94I 5FLXC 2A2CA 1USUA 4B3SI 4DR5E 4DPXA 4RPFA 1FKAE 4GKKE 5A2QC 4LFCI 1FWKA 3ZM7A 4DR3I 4B3RE 1A6FA 4X65E 4JG4A 2HFSA 3B78A 5LMUE 3T1YE 2DEIA 3WU6A 4PU9A 4FWGA 2DEJA 1BKNA 1PVGA 4P7AA 4YY3I 5IWAE 4B3MI 4LF5E 4DV0I 2O1VA 1XMQI 1PIEA 2ZM6E 1D6TA 3J7AG 4X62I 2UXCI 4JI2E 2VQFE 5FWKA 3V5RA 3WU3A 3GONA 4LF5I 5A2QQ 1XMOI 4LFBE 1ZXNA 2VQEI 1XMOE 4LFBI 4GKJE 1QZRA 2VQEE 4JI6I 1Y6ZA 2Z5CB 3PYFA 1IBMI 3ZZ0A 3Q1QA 2UUCI 2ZBKB 4JI5I 4AQYI 1EA6A 3PYDA 4MYTA 1N36I 1IBKE 4R1FA 4YHHI 3ZZTA 1Z0VA 4X62E 1IBLI 4X64E 4NXNI 1J5EE 4WUDA 5GMDA 4JI7E 2LJPA 1XNRI 3LTOA 4HYMA 4DR4E 4B3SE 1H7UA 1FI4A 1Y4UA 1K47A 4DUZE 2Q2EB 2V34A 1B63A 4XTJA 3D4JA 2CZ9A 2X36A 3T1HI 2HK3A 2ZITA 1Z0EA 4EMDA 4DV1I 3JAMC 2WW4A 2UUBE 1XNQI 1Z0BA 2GS8A 1FWLA 1USVA 5GMEA 4JI1E 2UUCE 1H7SA 4DR4I 4DV6I 2F4VE 1J5EI 4NXNE 4LFCE 2OI2A 2XEXA 3B82A 4LF4E 1HNWI 3M6AA 4IZKB 3V2UC 4DV2I 4DUYE 1HR0E 4DV6E 1IBME 1N34I 3PYEA 1NZ0A 3QT5A 4DR3E 4B3RI 2VQFI 4USMA 4DV4I 4I3HA 4URLA 1Y4SA 4K0KI 4DV7E 4DPTA 1HNZE 1I94E 2UXBE 1ELOA 4MYUA 5L3JA 5IT9Q 4DR7E 5LMNI 4B3TI 1ZXMA 4HACB 4FWDA 2E1RA 3HJCA 4DV0E 2HHHE 1VISA 4Z7CA 1Z59A 4WUBA 4DR7I 1B62A 1KIJA 1HNXE 2VF3A 1HNXI 1H73A 4LF4I 1HNWE 3JAMQ 3T1HE 4JI3E 4HY1A 4ZVIA 4DU8A 3ZKDA 4DUZI 2AJ4A 4LF9E 3F0NA 1ZM4A 2UUBI 4JV5I 4DR6I 2HKJA 4PRVA 2EFGA 4X64I 3H4LA 4DV7I 4JI2I 4GKJI 4DPUA 4DV4E 4JI6E 4NXMI 4JI3I 1Z0TA 4DR1E 3K17A 4HXZA 3J80Q 4DV3E 4KHPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R42 A;  1MX0 A;  2UUA E;  1S16 A;  3B8H A;  4LF7 E;  4JI8 E;  4JYA E;  1PKP A;  2V2Z A;  2UXB I;  3LPS A;  1NHH A;  4YY3 E;  5IWA I;  4DPW A;  4JI1 I;  4JI5 E;  4DV3 I;  3J81 C;  4DU7 A;  4DPY A;  3ZKB A;  4DV1 E;  1FJG I;  3WU4 A;  1MU5 A;  1KKH A;  1N33 I;  4LFA I;  1H72 C;  2UUA I;  4NXM E;  4B3M E;  2J7K A;  1EI1 A;  3QT6 A;  2UXD E;  1FJG E;  1N32 E;  2HK2 A;  3WU5 A;  1N32 I;  1HNZ I;  3J81 Q;  4LF7 I;  1ZM9 A;  2X7I A;  4DR5 I;  2BM0 A;  1KVK A;  1N33 E;  4JI8 I;  4ED4 A;  4FN5 A;  1Z0G A;  2E5L E;  1XMQ E;  4LF8 I;  4DXL A;  4LF6 I;  5LMN E;  4B3T E;  1NHI A;  1MG7 A;  4X66 I;  2UXC E;  4X65 I;  2E5L I;  1WUU A;  4P52 A;  2V2V A;  2ZM6 I;  1UEK A;  4X66 E;  3J80 C;  4Z7Y A;  4LF9 I;  4LF8 E;  4JI7 I;  1RRE A;  1XNQ E;  1NHJ A;  4JI4 I;  4USK A;  2HFU A;  4JI0 E;  2BM1 A;  4OX9 E;  1Z5B A;  1FNM A;  4LF6 E;  4JV5 E;  3T1Y I;  2UXD I;  1OJ4 A;  5LL6 R;  2UU9 I;  1ZM3 A;  1Z0W A;  4K0K E;  1XHK A;  3K1J A;  4KQV A;  4JI4 E;  4UT4 A;  4DR2 I;  1N0U A;  3HUL A;  1DAR A;  4DR6 E;  1U2R A;  3QT8 A;  1N0V C;  4WUC A;  3J7A M;  2NPF A;  1KTV A;  1S4E A;  1RR9 A;  5BR8 E;  3OTO I;  5FLX Q;  4FW9 A;  4UTG A;  1Z5A A;  1ZM2 A;  2R3V A;  3ZZU A;  2F4V I;  4YHH E;  4HAC A;  1Z0C A;  4PRX A;  5IT9 C;  3PYG A;  1H74 A;  3LNU A;  4FWH A;  2HHH I;  5LMU I;  4JYA I;  4DV2 E;  4DR1 I;  3QT7 A;  4DR2 E;  1IBL E;  2A2D A;  4JI0 I;  4LFA E;  4AQY E;  4M1K A;  4KHP I;  3CWV A;  1XNR E;  4DV5 E;  4DUY I;  1HR0 I;  1N34 E;  2V2Q A;  4OX9 I;  1N36 E;  1IBK I;  4GKK I;  3OTO E;  5BR8 I;  2BV3 A;  4DV5 I;  2UU9 E;  2V8P A;  1Z5C A;  2HKE A;  1I94 I;  5FLX C;  2A2C A;  4B3S I;  4DR5 E;  4DPX A;  4RPF A;  1FKA E;  4GKK E;  5A2Q C;  4LFC I;  1FWK A;  3ZM7 A;  4DR3 I;  4B3R E;  1A6F A;  4X65 E;  4JG4 A;  2HFS A;  3B78 A;  5LMU E;  3T1Y E;  2DEI A;  3WU6 A;  4PU9 A;  4FWG A;  2DEJ A;  1BKN A;  1PVG A;  4P7A A;  4YY3 I;  5IWA E;  4B3M I;  4LF5 E;  4DV0 I;  1XMQ I;  1PIE A;  2ZM6 E;  1D6T A;  3J7A G;  4X62 I;  2UXC I;  4JI2 E;  2VQF E;  3V5R A;  3WU3 A;  3GON A;  4LF5 I;  5A2Q Q;  1XMO I;  4LFB E;  1ZXN A;  2VQE I;  1XMO E;  4LFB I;  4GKJ E;  1QZR A;  2VQE E;  4JI6 I;  3PYF A;  1IBM I;  3ZZ0 A;  3Q1Q A;  2UUC I;  2ZBK B;  4JI5 I;  4AQY I;  1EA6 A;  3PYD A;  4MYT A;  1N36 I;  1IBK E;  4R1F A;  4YHH I;  3ZZT A;  1Z0V A;  4X62 E;  1IBL I;  4X64 E;  4NXN I;  1J5E E;  4WUD A;  5GMD A;  4JI7 E;  2LJP A;  1XNR I;  3LTO A;  4HYM A;  4DR4 E;  4B3S E;  1H7U A;  1FI4 A;  1K47 A;  4DUZ E;  2Q2E B;  2V34 A;  1B63 A;  4XTJ A;  3D4J A;  2CZ9 A;  2X36 A;  3T1H I;  2HK3 A;  2ZIT A;  1Z0E A;  4EMD A;  4DV1 I;  3JAM C;  2WW4 A;  2UUB E;  1XNQ I;  1Z0B A;  2GS8 A;  1FWL A;  4JI1 E;  5GME A;  2UUC E;  1H7S A;  4DR4 I;  4DV6 I;  2F4V E;  1J5E I;  4NXN E;  4LFC E;  2OI2 A;  2XEX A;  3B82 A;  4LF4 E;  1HNW I;  3M6A A;  3V2U C;  4DV2 I;  4DUY E;  1HR0 E;  4DV6 E;  1IBM E;  1N34 I;  3PYE A;  1NZ0 A;  3QT5 A;  4DR3 E;  4B3R I;  2VQF I;  4USM A;  4DV4 I;  4I3H A;  4URL A;  4K0K I;  4DV7 E;  4DPT A;  1HNZ E;  1I94 E;  2UXB E;  1ELO A;  4MYU A;  5L3J A;  5IT9 Q;  4DR7 E;  5LMN I;  4B3T I;  1ZXM A;  4HAC B;  4FWD A;  2E1R A;  4DV0 E;  2HHH E;  1VIS A;  4Z7C A;  1Z59 A;  4WUB A;  4DR7 I;  1B62 A;  1KIJ A;  1HNX E;  2VF3 A;  1HNX I;  1H73 A;  4LF4 I;  1HNW E;  3JAM Q;  3T1H E;  4JI3 E;  4HY1 A;  4ZVI A;  4DU8 A;  3ZKD A;  4DUZ I;  2AJ4 A;  4LF9 E;  3F0N A;  1ZM4 A;  2UUB I;  4JV5 I;  4DR6 I;  2HKJ A;  4PRV A;  2EFG A;  4X64 I;  3H4L A;  4DV7 I;  4JI2 I;  4GKJ I;  4DPU A;  4DV4 E;  4JI6 E;  4NXM I;  4JI3 I;  1Z0T A;  4DR1 E;  3K17 A;  4HXZ A;  3J80 Q;  4DV3 E;  4KHP E; 
#chains in the Genus database with same CATH topology
 2PO0 B;  2R42 A;  1MX0 A;  2UUA E;  1S16 A;  3B8H A;  4LF7 E;  4JI8 E;  3U1K A;  4IZJ D;  4JYA E;  4AIM A;  1PKP A;  4LCG A;  3NZK A;  4IFD E;  4N3O A;  2IOQ A;  4LCF A;  2CGE A;  2V2Z A;  3K85 A;  5K36 B;  2UXB I;  3L7Z B;  4OO1 E;  3LPS A;  1NHH A;  4U3B A;  4YY3 E;  5IWA I;  2VES A;  4DPW A;  4IFD C;  4JI1 I;  4OZE A;  4JI5 E;  3Q6M A;  3J81 C;  4DV3 I;  4DU7 A;  4OO1 C;  4DPY A;  3ZKB A;  2BA1 D;  4DV1 E;  2PO1 B;  2NN6 B;  1FJG I;  3HKM A;  3WU4 A;  1MU5 A;  1KKH A;  1N33 I;  4LFA I;  1H72 C;  2JT2 A;  2Z5C A;  2UUA I;  4NXM E;  4B3M E;  2J7K A;  5DRO A;  1EI1 A;  2WP8 B;  1OYS A;  4BA1 A;  1E3P A;  4IFD F;  3QT6 A;  4IFD A;  2UXD E;  1FJG E;  1N32 E;  2HK2 A;  3WU5 A;  4FW7 A;  1N32 I;  2Z5E A;  1HNZ I;  4IZJ A;  3J81 Q;  4LF7 I;  1ZM9 A;  5K36 F;  2X7I A;  4DR5 I;  2AE8 A;  2BM0 A;  1KVK A;  1N33 E;  4BA2 A;  4JI8 I;  4ED4 A;  4FN5 A;  1Z0G A;  2E5L E;  1XMQ E;  5ELW A;  4LF8 I;  4DXL A;  4QNK A;  3PRY A;  4LF6 I;  5LMN E;  4B3T E;  1NHI A;  4BA2 B;  1MG7 A;  4X66 I;  2GO4 A;  2UXC E;  5K36 C;  4X65 I;  1UDN A;  2E5L I;  1VI7 A;  1WUU A;  4P52 A;  2V2V A;  5DNX A;  4IS9 A;  2ZM6 I;  1UEK A;  2BR2 A;  4MU0 A;  4IFD B;  4X66 E;  2IES A;  3J80 C;  4Z7Y A;  4LF9 I;  4LF8 E;  4JI7 I;  1RRE A;  5C0X F;  2NN6 F;  5JEA E;  1XNQ E;  2GO3 A;  5JEA F;  1NHJ A;  2PNZ B;  4JI4 I;  4USK A;  5EKW A;  2HFU A;  3DD6 A;  4QNJ A;  4JI0 E;  2BM1 A;  4OX9 E;  1Z5B A;  1FNM A;  4LF6 E;  2GQ0 A;  4JV5 E;  3T1Y I;  2UXD I;  1HK7 A;  1OJ4 A;  5LL6 R;  2UU9 I;  1ZM3 A;  1Z0W A;  5JEA C;  2PNM A;  4K0K E;  1XHK A;  5C0X A;  2NN6 E;  3K1J A;  3L7Z A;  4KQV A;  4JI4 E;  2Z5B B;  2PO2 B;  4UT4 A;  4DR2 I;  1N0U A;  3HUL A;  1DAR A;  4DR6 E;  1U2R A;  1Y5Y A;  3QT8 A;  1N0V C;  1OYP A;  4WUC A;  3J7A M;  2NPF A;  1KTV A;  1S4E A;  2IER A;  1RR9 A;  5BR8 E;  3OTO I;  4U3D A;  5FLX Q;  4FW9 A;  4UTG A;  4OO1 A;  5DRP A;  1Z5A A;  2O1T A;  1ZM2 A;  2R3V A;  3ZZU A;  2F4V I;  4YHH E;  4HAC A;  2CVE A;  1Z0C A;  1YHC A;  2O1U A;  4MDT A;  4PRX A;  5IT9 C;  2NN6 A;  1H74 A;  3LNU A;  3PYG A;  1OYR A;  1P42 A;  4FWH A;  2HHH I;  3PS2 A;  5LMU I;  4JYA I;  4DV2 E;  2C39 B;  4DR1 I;  3QT7 A;  4DR2 E;  4LCH A;  2O1W A;  1IBL E;  2A2D A;  2Z5B A;  4JI0 I;  2IOP A;  4GQU A;  4LFA E;  4AQY E;  4M1K A;  4KHP I;  2PNL A;  3CWV A;  1XNR E;  5C0X B;  4DV5 E;  4DUY I;  1HR0 I;  5JEA B;  4MU4 A;  1N34 E;  2JE6 A;  2V2Q A;  3Q6N A;  4FW6 A;  4IZK A;  4OX9 I;  1N36 E;  1IBK I;  4GKK I;  4IZJ B;  3OTO E;  5BR8 I;  2BV3 A;  4DV5 I;  3P06 A;  2UU9 E;  2V8P A;  2CG9 A;  1Z5C A;  4BA1 B;  2HKE A;  1I94 I;  1E3H A;  5FLX C;  3M7N G;  2A2C A;  1USU A;  4B3S I;  4DPX A;  4RPF A;  4DR5 E;  1FKA E;  4GKK E;  5A2Q C;  4LFC I;  1FWK A;  3ZM7 A;  4DR3 I;  2PO1 A;  4B3R E;  1A6F A;  4LOM A;  4X65 E;  4JG4 A;  2HFS A;  3B78 A;  3H1C A;  2C37 A;  5LMU E;  3T1Y E;  4IFD D;  2DEI A;  3WU6 A;  4PU9 A;  3PS3 A;  3M85 G;  4FWG A;  5DRR A;  2DEJ A;  1BKN A;  1PVG A;  4P7A A;  4YY3 I;  5IWA E;  4FW5 A;  4B3M I;  4LF5 E;  4DV0 I;  2O1V A;  1XMQ I;  1PIE A;  2ZM6 E;  2NN6 C;  5K36 A;  1D6T A;  3J7A G;  4X62 I;  3P3G A;  4MQY A;  2UXC I;  4JI2 E;  2VQF E;  2F1D A;  2BA1 G;  5FWK A;  3V5R A;  3WU3 A;  3GME A;  3GON A;  2PO0 A;  3PS1 A;  4LF5 I;  5A2Q Q;  1XMO I;  4LFB E;  2WP8 A;  1ZXN A;  2VQE I;  1XMO E;  4LFB I;  4GKJ E;  1QZR A;  2VQE E;  4JI6 I;  1Y6Z A;  2Z5C B;  3PYF A;  4OO1 B;  1IBM I;  3ZZ0 A;  3Q1Q A;  5C0X E;  2UUC I;  2ZBK B;  1R6L A;  3M85 D;  4JI5 I;  5C0X D;  4AQY I;  2NN6 D;  1EA6 A;  3PYD A;  3CDI A;  4MYT A;  5JEA D;  1N36 I;  1IBK E;  4R1F A;  4MU1 A;  2JEB B;  4YHH I;  3ZZT A;  1Z0V A;  4X62 E;  1IBL I;  4X64 E;  4NXN I;  1J5E E;  2BA0 D;  5EL9 A;  4WUD A;  5GMD A;  3CDJ A;  3GCM A;  4JI7 E;  2LJP A;  1XNR I;  3LTO A;  4HYM A;  4DR4 E;  4B3S E;  1H7U A;  1FI4 A;  1Y4U A;  1K47 A;  4DUZ E;  2Q2E B;  2V34 A;  2BA0 G;  2JEB A;  1B63 A;  4XTJ A;  3D4J A;  2CZ9 A;  2C37 B;  2X36 A;  3T1H I;  2HK3 A;  2ZIT A;  1Z0E A;  4EMD A;  4DV1 I;  3JAM C;  2WW4 A;  2UUB E;  1XNQ I;  1Z0B A;  3B4T A;  4OO1 D;  2GS8 A;  1Y60 A;  1FWL A;  2C38 A;  1USV A;  5GME A;  4JI1 E;  2UUC E;  1H7S A;  4DR4 I;  5K36 D;  4DV6 I;  2F4V E;  2O3Z A;  4FW3 A;  1J5E I;  4NXN E;  4LFC E;  2OI2 A;  2XEX A;  3B82 A;  1RHY A;  4LF4 E;  1HNW I;  4J3D A;  3M6A A;  4IZK B;  3V2U C;  4NBQ A;  2JE6 B;  4DUY E;  4DV2 I;  4DV6 E;  1UDQ A;  1HR0 E;  1IBM E;  1N34 I;  3PYE A;  2PO2 A;  1NZ0 A;  3QT5 A;  4DR3 E;  4B3R I;  2JEA B;  2VQF I;  5DNL A;  4USM A;  1R6M A;  4DV4 I;  2JEA A;  4I3H A;  4URL A;  5DRQ A;  1XXE A;  1Y4S A;  4K0K I;  4DV7 E;  4DPT A;  1HNZ E;  1I94 E;  4OO1 F;  2UXB E;  1ELO A;  4ISA A;  2WNR B;  4MYU A;  5L3J A;  1UDS A;  4DR7 E;  5IT9 Q;  5LMN I;  4B3T I;  3UHM A;  5K36 E;  1ZXM A;  4HAC B;  4FWD A;  2E1R A;  3HJC A;  4DV0 E;  4FW4 A;  2HHH E;  1VIS A;  4Z7C A;  1Z59 A;  4WUB A;  4DR7 I;  1B62 A;  1KIJ A;  1HNX E;  2BR2 B;  2VF3 A;  1HNX I;  4OKG A;  1H73 A;  2WNR A;  4LF4 I;  1HNW E;  1UDO A;  3JAM Q;  5C0X C;  4LPF A;  3U1Y A;  3T1H E;  3GLL A;  4JI3 E;  4HY1 A;  4ZVI A;  4DU8 A;  5JEA A;  3ZKD A;  4DUZ I;  2AJ4 A;  4LF9 E;  3F0N A;  4AM3 A;  1ZM4 A;  4AID A;  4MU3 A;  3P3C A;  2UUB I;  4JV5 I;  4DR6 I;  2HKJ A;  4PRV A;  2EFG A;  4X64 I;  3H4L A;  4DV7 I;  2C39 A;  4JI2 I;  4GKJ I;  4DPU A;  4DV4 E;  4JI6 E;  4NXM I;  2J65 A;  3P3E A;  3P76 A;  4JI3 I;  1Z0T A;  4DR1 E;  3KRN A;  1YH8 A;  3K17 A;  2PNZ A;  3M7N D;  4HXZ A;  3J80 Q;  4DV3 E;  4KHP E;  2C38 B; 
#chains in the Genus database with same CATH homology
 2R42 A;  1MX0 A;  2UUA E;  1S16 A;  3B8H A;  4LF7 E;  4JI8 E;  4IZJ D;  4JYA E;  1PKP A;  4N3O A;  2IOQ A;  2CGE A;  2V2Z A;  3K85 A;  2UXB I;  3LPS A;  1NHH A;  4YY3 E;  5IWA I;  4DPW A;  4JI1 I;  4JI5 E;  4DV3 I;  3Q6M A;  3J81 C;  4DU7 A;  4DPY A;  3ZKB A;  4DV1 E;  1FJG I;  3WU4 A;  1MU5 A;  1KKH A;  1N33 I;  4LFA I;  1H72 C;  2Z5C A;  2UUA I;  4NXM E;  4B3M E;  2J7K A;  1EI1 A;  3QT6 A;  2UXD E;  1FJG E;  1N32 E;  2HK2 A;  3WU5 A;  1N32 I;  2Z5E A;  1HNZ I;  4IZJ A;  3J81 Q;  4LF7 I;  1ZM9 A;  2X7I A;  4DR5 I;  2BM0 A;  1KVK A;  1N33 E;  4JI8 I;  4ED4 A;  4FN5 A;  1Z0G A;  2E5L E;  1XMQ E;  4LF8 I;  4DXL A;  4LF6 I;  3PRY A;  5LMN E;  4B3T E;  1NHI A;  1MG7 A;  4X66 I;  2UXC E;  4X65 I;  2E5L I;  1WUU A;  4P52 A;  2V2V A;  2ZM6 I;  1UEK A;  4X66 E;  3J80 C;  4Z7Y A;  4LF9 I;  4LF8 E;  4JI7 I;  1RRE A;  1XNQ E;  1NHJ A;  4JI4 I;  4USK A;  2HFU A;  4JI0 E;  2BM1 A;  4OX9 E;  1Z5B A;  1FNM A;  4LF6 E;  2GQ0 A;  4JV5 E;  3T1Y I;  2UXD I;  1HK7 A;  1OJ4 A;  5LL6 R;  2UU9 I;  1ZM3 A;  1Z0W A;  2PNM A;  4K0K E;  1XHK A;  3K1J A;  4KQV A;  4JI4 E;  2Z5B B;  4UT4 A;  4DR2 I;  1N0U A;  3HUL A;  1DAR A;  4DR6 E;  1U2R A;  3QT8 A;  1N0V C;  4WUC A;  3J7A M;  2NPF A;  1KTV A;  1S4E A;  1RR9 A;  5BR8 E;  3OTO I;  5FLX Q;  4FW9 A;  4UTG A;  1Z5A A;  2O1T A;  1ZM2 A;  2R3V A;  3ZZU A;  2F4V I;  4YHH E;  4HAC A;  1Z0C A;  2O1U A;  4PRX A;  5IT9 C;  3PYG A;  1H74 A;  3LNU A;  4FWH A;  2HHH I;  5LMU I;  4JYA I;  4DV2 E;  4DR1 I;  3QT7 A;  4DR2 E;  2O1W A;  1IBL E;  2A2D A;  2Z5B A;  4JI0 I;  2IOP A;  4LFA E;  4AQY E;  4M1K A;  4KHP I;  2PNL A;  3CWV A;  1XNR E;  4DV5 E;  4DUY I;  1HR0 I;  1N34 E;  2V2Q A;  3Q6N A;  4IZK A;  4OX9 I;  1N36 E;  1IBK I;  4GKK I;  4IZJ B;  3OTO E;  5BR8 I;  2BV3 A;  4DV5 I;  3P06 A;  2UU9 E;  2V8P A;  2CG9 A;  1Z5C A;  2HKE A;  1I94 I;  5FLX C;  2A2C A;  1USU A;  4B3S I;  4DR5 E;  4DPX A;  4RPF A;  1FKA E;  4GKK E;  5A2Q C;  4LFC I;  1FWK A;  3ZM7 A;  4DR3 I;  4B3R E;  1A6F A;  4X65 E;  4JG4 A;  2HFS A;  3B78 A;  5LMU E;  3T1Y E;  2DEI A;  3WU6 A;  4PU9 A;  4FWG A;  2DEJ A;  1BKN A;  1PVG A;  4P7A A;  4YY3 I;  5IWA E;  4B3M I;  4LF5 E;  4DV0 I;  2O1V A;  1XMQ I;  1PIE A;  2ZM6 E;  1D6T A;  3J7A G;  4X62 I;  2UXC I;  4JI2 E;  2VQF E;  5FWK A;  3V5R A;  3WU3 A;  3GON A;  4LF5 I;  5A2Q Q;  1XMO I;  4LFB E;  1ZXN A;  2VQE I;  1XMO E;  4LFB I;  4GKJ E;  1QZR A;  2VQE E;  4JI6 I;  1Y6Z A;  2Z5C B;  3PYF A;  1IBM I;  3ZZ0 A;  3Q1Q A;  2UUC I;  2ZBK B;  4JI5 I;  4AQY I;  1EA6 A;  3PYD A;  4MYT A;  1N36 I;  1IBK E;  4R1F A;  4YHH I;  3ZZT A;  1Z0V A;  4X62 E;  1IBL I;  4X64 E;  4NXN I;  1J5E E;  4WUD A;  5GMD A;  4JI7 E;  2LJP A;  1XNR I;  3LTO A;  4HYM A;  4DR4 E;  4B3S E;  1H7U A;  1FI4 A;  1Y4U A;  1K47 A;  4DUZ E;  2Q2E B;  2V34 A;  1B63 A;  4XTJ A;  3D4J A;  2CZ9 A;  2X36 A;  3T1H I;  2HK3 A;  2ZIT A;  1Z0E A;  4EMD A;  4DV1 I;  3JAM C;  2WW4 A;  2UUB E;  1XNQ I;  1Z0B A;  2GS8 A;  1FWL A;  1USV A;  5GME A;  4JI1 E;  2UUC E;  1H7S A;  4DR4 I;  4DV6 I;  2F4V E;  1J5E I;  4NXN E;  4LFC E;  2OI2 A;  2XEX A;  3B82 A;  4LF4 E;  1HNW I;  3M6A A;  4IZK B;  3V2U C;  4DV2 I;  4DUY E;  1HR0 E;  4DV6 E;  1IBM E;  1N34 I;  3PYE A;  1NZ0 A;  3QT5 A;  4DR3 E;  4B3R I;  2VQF I;  4USM A;  4DV4 I;  4I3H A;  4URL A;  1Y4S A;  4K0K I;  4DV7 E;  4DPT A;  1HNZ E;  1I94 E;  2UXB E;  1ELO A;  4MYU A;  5L3J A;  5IT9 Q;  4DR7 E;  5LMN I;  4B3T I;  1ZXM A;  4HAC B;  4FWD A;  2E1R A;  3HJC A;  4DV0 E;  2HHH E;  1VIS A;  4Z7C A;  1Z59 A;  4WUB A;  4DR7 I;  1B62 A;  1KIJ A;  1HNX E;  2VF3 A;  1HNX I;  1H73 A;  4LF4 I;  1HNW E;  3JAM Q;  3T1H E;  4JI3 E;  4HY1 A;  4ZVI A;  4DU8 A;  3ZKD A;  4DUZ I;  2AJ4 A;  4LF9 E;  3F0N A;  1ZM4 A;  2UUB I;  4JV5 I;  4DR6 I;  2HKJ A;  4PRV A;  2EFG A;  4X64 I;  3H4L A;  4DV7 I;  4JI2 I;  4GKJ I;  4DPU A;  4DV4 E;  4JI6 E;  4NXM I;  4JI3 I;  1Z0T A;  4DR1 E;  3K17 A;  4HXZ A;  3J80 Q;  4DV3 E;  4KHP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...