2UU9I

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9I00
1BKNA 1J5EI 1PIEA 2R3VA 4DR6E 1N36I 4P52A 4JI3E 5LMNE 4UTGA 4DR4I 4R1FA 2UUCI 2V2ZA 1FNMA 4JYAI 4DR2E 4JI6I 4NXNE 2X36A 3PYDA 4LF4E 1HNZI 2J7KA 2UUBI 4DR1I 4B3SI 3LPSA 2UXCI 1PVGA 2E1RA 2NPFA 1N34E 4DPYA 4Z7CA 4I3HA 2UU9E 4AQYE 5L3JA 3QT7A 1NHHA 1XHKA 5LL6R 4X64E 4LF8E 1N0UA 1Z5AA 4JI2I 4LF5E 4DR5I 4JV5I 1Z0CA 2UUAE 1FI4A 1Z59A 4GKKE 1J5EE 5A2QC 4X62I 4WUBA 1N32E 5FLXC 1FJGE 2BM0A 1Z5CA 3ZKDA 4X66E 2UXBI 1XMQE 4DV5E 4B3RI 1ZM9A 4DR7I 2V2VA 5BR8I 4DR1E 1RR9A 3K17A 2WW4A 1IBKI 1ZM3A 4JI8I 1MU5A 4LF9I 1D6TA 2V8PA 3V5RA 1NZ0A 1ZM2A 1IBLI 3CWVA 1N33I 1Z0VA 4B3ME 3LNUA 1Z0TA 3ZZ0A 4DU8A 4LFAE 4LF6I 3Q1QA 4JI5I 1XNQI 4HYMA 2V2QA 4DV6I 1MX0A 2CZ9A 2ZBKB 4JI2E 4DV4E 4EMDA 4JV5E 4HY1A 3WU3A 5LMUE 4GKJE 3WU5A 1ELOA 4KQVA 1HR0I 3PYGA 3GONA 4NXME 4DR3I 5IWAE 4LF7E 3OTOI 4USMA 4DR7E 3M6AA 2OI2A 1HNXE 4DUZI 1IBKE 1I94E 4JI8E 1XMOI 4YHHI 1KKHA 4LF9E 3PYEA 1ZM4A 2X7IA 1NHJA 3WU4A 4DV0I 1H73A 3T1YI 3J81Q 4KHPI 1IBLE 4DV7E 4B3TI 4K0KE 4LFCE 3JAMQ 4HACB 4DU7A 1H7SA 3J7AM 4X65I 1DARA 2VQFI 1B63A 1UEKA 3J80Q 4DV6E 2F4VI 2AJ4A 1EA6A 1RREA 1Z0GA 2A2DA 4MYUA 4JI4E 3WU6A 4YY3I 1IBME 1HNWI 4JI1I 1KIJA 1H74A 3V2UC 4XTJA 3B8HA 1N36E 4DR4E 2UUCE 4DPWA 4DUZE 4JYAE 4JI6E 2VQEI 4YHHE 4DV1I 1Z0WA 1HNZE 1VISA 4JI7I 2BM1A 2UUBE 4UT4A 4B3SE 4DV0E 4DV2I 2UXCE 4KHPE 4JI0I 2E5LI 1XNRI 4B3TE 2HK3A 4LFBI 4DR6I 4JI3I 5LMNI 3K1JA 1FKAE 2Q2EB 1FWKA 5IT9Q 2F4VE 3B78A 1QZRA 1N0VC 4NXNI 4DR2I 4PRVA 4M1KA 5GMEA 4LF4I 4YY3E 1Z5BA 4FWHA 1B62A 4DR5E 4DUYI 1PKPA 2BV3A 1N34I 4USKA 4X62E 2HK2A 2UXDI 4P7AA 2UU9I 1MG7A 2UXBE 2DEJA 3QT6A 4AQYI 2ZITA 4B3RE 3J7AG 4OX9I 1H7UA 1A6FA 5BR8E 4X64I 1ZXMA 4LF8I 4ED4A 4FWDA 1XNRE 3H4LA 4HXZA 2UUAI 1KVKA 2HHHI 4PRXA 4GKKI 1Z0EA 4LFBE 1N33E 4DV3I 1N32I 1S16A 3T1HI 1FJGI 3F0NA 4X66I 4LF6E 1FWLA 4JI5E 3HULA 1XMQI 2HKJA 4DV5I 1XNQE 3PYFA 2EFGA 4Z7YA 4DUYE 5A2QQ 4DPXA 2A2CA 4WUDA 4FWGA 5FLXQ 3LTOA 3ZKBA 1HR0E 2UXDE 4DR3E 3J81C 4B3MI 2GS8A 3OTOE 3ZM7A 4OX9E 4LFAI 2HFUA 3JAMC 1NHIA 1XMOE 4DPTA 4MYTA 4DV4I 3J80C 2ZM6I 2HHHE 5LMUI 3ZZUA 4DXLA 1ZXNA 1S4EA 4GKJI 4FW9A 3D4JA 3T1YE 3QT8A 4ZVIA 4HACA 2HFSA 4DV3E 4NXMI 3T1HE 4JG4A 5IWAI 1KTVA 2HKEA 4LF7I 4X65E 2VF3A 2VQFE 2LJPA 3ZZTA 1HNXI 4DPUA 1H72C 1I94I 3B82A 4PU9A 1Z0BA 1EI1A 2V34A 1HNWE 4FN5A 4DV7I 4JI1E 2XEXA 4K0KI 4LFCI 1K47A 4URLA 1OJ4A 2VQEE 4DV1E 4RPFA 4WUCA 4JI7E 5IT9C 2ZM6E 5GMDA 4JI4I 4DV2E 1IBMI 4JI0E 2E5LE 3QT5A 4LF5I 2DEIA 1WUUA 1U2RA 2R42A
chains in the Genus database with same CATH superfamily
1BKNA 1J5EI 1PIEA 2R3VA 4DR6E 1N36I 4P52A 4JI3E 5LMNE 4UTGA 4DR4I 4R1FA 2UUCI 2V2ZA 4NBQA 1FNMA 3PS1A 4JYAI 4DR2E 4JI6I 4NXNE 2X36A 3PYDA 4LF4E 1HNZI 2J7KA 2PO0B 2UUBI 4DR1I 4B3SI 3LPSA 2UXCI 1PVGA 2WNRA 2E1RA 5DNXA 2NPFA 1N34E 4DPYA 5FWKA 1E3PA 4Z7CA 5K36F 4I3HA 2UU9E 2C39B 4BA1B 4AQYE 5L3JA 4IZKA 2NN6B 3QT7A 4FW7A 4FW3A 1NHHA 2JEBA 1XHKA 5LL6R 4X64E 4IFDD 4LF8E 1N0UA 3U1KA 1Z5AA 2CGEA 4MU0A 4JI2I 4LF5E 2IOQA 4DR5I 4JV5I 1Z0CA 2UUAE 1FI4A 1Z59A 5C0XC 4GKKE 3P3CA 1J5EE 5A2QC 2C38B 5C0XD 4X62I 4WUBA 1N32E 5FLXC 3H1CA 2IERA 1FJGE 2BM0A 1Z5CA 3ZKDA 4X66E 2UXBI 3CDJA 1XMQE 4DV5E 4B3RI 1ZM9A 4J3DA 4DR7I 2V2VA 5BR8I 3K85A 4DR1E 1RR9A 3K17A 2WW4A 1IBKI 1ZM3A 4JI8I 2O1VA 1MU5A 3B4TA 3Q6NA 4LF9I 1D6TA 2BA1D 4N3OA 2V8PA 3V5RA 2JEAB 1NZ0A 1VI7A 4OO1B 1ZM2A 5JEAE 1IBLI 3CWVA 1N33I 1Z0VA 4B3ME 3LNUA 1Z0TA 2JE6B 3ZZ0A 4IZJB 2BA0D 4DU8A 4LFAE 3KRNA 4LF6I 3Q1QA 4JI5I 1XNQI 4HYMA 3GLLA 2V2QA 5C0XF 2AE8A 4DV6I 1MX0A 2CZ9A 1XXEA 2ZBKB 4JI2E 4DV4E 4EMDA 4JV5E 3P76A 4HY1A 1YHCA 4QNKA 5JEAC 3WU3A 5LMUE 2C37A 3M85D 4GKJE 3WU5A 2GQ0A 2WP8A 1ELOA 4KQVA 4FW6A 5JEAD 1HR0I 3PYGA 3GONA 4NXME 4DR3I 5IWAE 4IFDA 4LF7E 3OTOI 4USMA 4DR7E 3M6AA 2OI2A 1HNXE 5DRPA 4DUZI 1IBKE 1I94E 4JI8E 1XMOI 4YHHI 1KKHA 4LF9E 3PYEA 1ZM4A 2X7IA 5C0XA 4IFDE 1NHJA 3WU4A 3GCMA 4DV0I 4LCHA 1H73A 3T1YI 3J81Q 4KHPI 1IBLE 4BA2B 4DV7E 4B3TI 4K0KE 3P3EA 1Y60A 4LFCE 1UDNA 3JAMQ 4HACB 3M7ND 4DU7A 1H7SA 2BR2B 3J7AM 5C0XE 4X65I 5JEAF 1DARA 2VQFI 1B63A 1UEKA 3J80Q 4DV6E 4IFDC 2F4VI 2AJ4A 1EA6A 2Z5BA 1RREA 1Z0GA 5K36B 2A2DA 2PO1A 2PNMA 4MYUA 4JI4E 2BA1G 1OYRA 3WU6A 4YY3I 1RHYA 1IBME 3HJCA 1HNWI 5DRRA 3GMEA 2Z5CB 4JI1I 1KIJA 1H74A 3V2UC 2BA0G 3HKMA 1OYPA 4XTJA 3B8HA 1N36E 4DR4E 4IZJD 2UUCE 1USUA 4DPWA 2PNZB 4DUZE 2PO0A 4U3DA 4JYAE 4JI6E 2VQEI 4LOMA 4YHHE 4DV1I 1Z0WA 5JEAA 2O1WA 1VISA 1HNZE 4JI7I 1Y4UA 2BM1A 2PO2B 2UUBE 4UT4A 3M85G 4B3SE 4DV0E 4DV2I 2UXCE 5DNLA 4KHPE 4JI0I 2E5LI 1XNRI 4B3TE 2C39A 4BA1A 3L7ZB 2HK3A 1R6MA 4LCGA 4IFDF 4LFBI 2NN6A 4DR6I 4JI3I 5LMNI 3K1JA 1FKAE 2Q2EB 1FWKA 5IT9Q 2F4VE 3B78A 3DD6A 1QZRA 1N0VC 4NXNI 4DR2I 1UDQA 4LCFA 4PRVA 4M1KA 5GMEA 4LF4I 4YY3E 1Z5BA 2VESA 4MQYA 4FWHA 2NN6E 1B62A 4DR5E 2C38A 4DUYI 1PKPA 1P42A 2BV3A 2CVEA 1N34I 2GO4A 3M7NG 4USKA 4X62E 2WNRB 2HK2A 4IS9A 2UXDI 4P7AA 2UU9I 1MG7A 2UXBE 2DEJA 3QT6A 1R6LA 4AQYI 2ZITA 4B3RE 3J7AG 2NN6C 4OX9I 2IESA 1H7UA 1A6FA 5K36C 5BR8E 4X64I 1ZXMA 2JT2A 2NN6D 4ED4A 4LF8I 2JEAA 5K36D 4IZKB 4FWDA 1XNRE 2JEBB 3H4LA 2J65A 2O1UA 4HXZA 2UUAI 1KVKA 5DRQA 2HHHI 4AM3A 4GQUA 5EL9A 4PRXA 4U3BA 4GKKI 1Z0EA 2JE6A 4IZJA 4LFBE 3P06A 1N33E 2PNLA 4DV3I 1N32I 1S16A 3T1HI 4OO1E 1FJGI 3F0NA 4X66I 4LF6E 1FWLA 5DROA 4JI5E 3HULA 1XMQI 2HKJA 4DV5I 1XNQE 3PYFA 1HK7A 2EFGA 4Z7YA 4ISAA 5JEAB 4DUYE 4MU1A 5A2QQ 2IOPA 2A2CA 4DPXA 4WUDA 4FWGA 5FLXQ 4OO1C 1YH8A 3LTOA 3ZKBA 1HR0E 2UXDE 4DR3E 2NN6F 3J81C 1Y4SA 4B3MI 4FW5A 4OO1D 2GS8A 3OTOE 5ELWA 3ZM7A 4LPFA 4OX9E 4LFAI 2HFUA 1Y6ZA 3JAMC 4OKGA 1E3HA 1NHIA 1XMOE 4DPTA 4MYTA 4DV4I 3J80C 3PRYA 4BA2A 2ZM6I 2HHHE 5LMUI 3P3GA 2GO3A 3UHMA 3ZZUA 1ZXNA 4DXLA 1S4EA 4GKJI 4FW9A 3D4JA 3T1YE 3QT8A 4ZVIA 4HACA 2O1TA 2HFSA 4AIMA 2C37B 4DV3E 2BR2A 4NXMI 2WP8B 3T1HE 4JG4A 5IWAI 1KTVA 2O3ZA 2HKEA 4LF7I 5K36A 1UDOA 3Q6MA 4X65E 2VF3A 2VQFE 2LJPA 3ZZTA 1UDSA 4AIDA 4IFDB 4MU4A 3U1YA 1HNXI 4DPUA 1H72C 1I94I 2F1DA 4OO1F 2CG9A 3B82A 3CDIA 4PU9A 1Z0BA 3PS3A 5EKWA 1EI1A 2V34A 2Z5CA 1HNWE 5K36E 4FW4A 4MU3A 4FN5A 1OYSA 3PS2A 5C0XB 1Y5YA 4DV7I 4JI1E 2XEXA 4K0KI 2PNZA 4LFCI 1USVA 1K47A 4MDTA 4URLA 1OJ4A 2PO2A 2VQEE 4DV1E 4RPFA 4WUCA 4JI7E 4OZEA 5IT9C 2ZM6E 5GMDA 2Z5EA 4JI4I 4DV2E 3NZKA 2Z5BB 3L7ZA 1IBMI 4QNJA 4OO1A 4JI0E 2E5LE 3QT5A 4LF5I 2PO1B 2DEIA 1WUUA 1U2RA 2R42A
chains in the Genus database with same CATH topology
1BKNA 1J5EI 1PIEA 2R3VA 4DR6E 1N36I 4P52A 4JI3E 5LMNE 4UTGA 4DR4I 4R1FA 2UUCI 2V2ZA 1FNMA 4JYAI 4DR2E 4JI6I 4NXNE 2X36A 3PYDA 4LF4E 1HNZI 2J7KA 2UUBI 4DR1I 4B3SI 3LPSA 2UXCI 1PVGA 2E1RA 2NPFA 1N34E 4DPYA 5FWKA 4Z7CA 4I3HA 2UU9E 4AQYE 5L3JA 4IZKA 3QT7A 1NHHA 1XHKA 5LL6R 4X64E 4LF8E 1N0UA 1Z5AA 2CGEA 4JI2I 4LF5E 2IOQA 4DR5I 4JV5I 1Z0CA 2UUAE 1FI4A 1Z59A 4GKKE 1J5EE 5A2QC 4X62I 4WUBA 1N32E 5FLXC 1FJGE 2BM0A 1Z5CA 3ZKDA 4X66E 2UXBI 1XMQE 4DV5E 4B3RI 1ZM9A 4DR7I 2V2VA 5BR8I 3K85A 4DR1E 1RR9A 3K17A 2WW4A 1IBKI 1ZM3A 4JI8I 2O1VA 1MU5A 3Q6NA 4LF9I 1D6TA 4N3OA 2V8PA 3V5RA 1NZ0A 1ZM2A 1IBLI 3CWVA 1N33I 1Z0VA 4B3ME 3LNUA 1Z0TA 3ZZ0A 4IZJB 4DU8A 4LFAE 4LF6I 3Q1QA 4JI5I 1XNQI 4HYMA 2V2QA 4DV6I 1MX0A 2CZ9A 2ZBKB 4JI2E 4DV4E 4EMDA 4JV5E 4HY1A 3WU3A 5LMUE 4GKJE 3WU5A 2GQ0A 1ELOA 4KQVA 1HR0I 3PYGA 3GONA 4NXME 4DR3I 5IWAE 4LF7E 3OTOI 4USMA 4DR7E 3M6AA 2OI2A 1HNXE 4DUZI 1IBKE 1I94E 4JI8E 1XMOI 4YHHI 1KKHA 4LF9E 3PYEA 1ZM4A 2X7IA 1NHJA 3WU4A 4DV0I 1H73A 3T1YI 3J81Q 4KHPI 1IBLE 4DV7E 4B3TI 4K0KE 4LFCE 3JAMQ 4HACB 4DU7A 1H7SA 3J7AM 4X65I 1DARA 2VQFI 1B63A 1UEKA 3J80Q 4DV6E 2F4VI 2AJ4A 1EA6A 2Z5BA 1RREA 1Z0GA 2A2DA 2PNMA 4MYUA 4JI4E 3WU6A 4YY3I 1IBME 3HJCA 1HNWI 2Z5CB 4JI1I 1KIJA 1H74A 3V2UC 4XTJA 3B8HA 1N36E 4DR4E 4IZJD 2UUCE 1USUA 4DPWA 4DUZE 4JYAE 4JI6E 2VQEI 4YHHE 4DV1I 1Z0WA 2O1WA 1VISA 1HNZE 4JI7I 1Y4UA 2BM1A 2UUBE 4UT4A 4B3SE 4DV0E 4DV2I 2UXCE 4KHPE 4JI0I 2E5LI 1XNRI 4B3TE 2HK3A 4LFBI 4DR6I 4JI3I 5LMNI 3K1JA 1FKAE 2Q2EB 1FWKA 5IT9Q 2F4VE 3B78A 1QZRA 1N0VC 4NXNI 4DR2I 4PRVA 4M1KA 5GMEA 4LF4I 4YY3E 1Z5BA 4FWHA 1B62A 4DR5E 4DUYI 1PKPA 2BV3A 1N34I 4USKA 4X62E 2HK2A 2UXDI 4P7AA 2UU9I 1MG7A 2UXBE 2DEJA 3QT6A 4AQYI 2ZITA 4B3RE 3J7AG 4OX9I 1H7UA 1A6FA 5BR8E 4X64I 1ZXMA 4LF8I 4ED4A 4IZKB 4FWDA 1XNRE 3H4LA 2O1UA 4HXZA 2UUAI 1KVKA 2HHHI 4PRXA 4GKKI 1Z0EA 4IZJA 4LFBE 3P06A 1N33E 2PNLA 4DV3I 1N32I 1S16A 3T1HI 1FJGI 3F0NA 4X66I 4LF6E 1FWLA 4JI5E 3HULA 1XMQI 2HKJA 4DV5I 1XNQE 3PYFA 1HK7A 2EFGA 4Z7YA 4DUYE 5A2QQ 2IOPA 2A2CA 4DPXA 4WUDA 4FWGA 5FLXQ 3LTOA 3ZKBA 1HR0E 2UXDE 4DR3E 3J81C 1Y4SA 4B3MI 2GS8A 3OTOE 3ZM7A 4OX9E 4LFAI 2HFUA 1Y6ZA 3JAMC 1NHIA 1XMOE 4DPTA 4MYTA 4DV4I 3J80C 3PRYA 2ZM6I 2HHHE 5LMUI 3ZZUA 4DXLA 1ZXNA 1S4EA 4GKJI 4FW9A 3D4JA 3T1YE 3QT8A 4ZVIA 4HACA 2O1TA 2HFSA 4DV3E 4NXMI 3T1HE 4JG4A 5IWAI 1KTVA 2HKEA 4LF7I 4X65E 3Q6MA 2VF3A 2VQFE 2LJPA 3ZZTA 1HNXI 4DPUA 1H72C 1I94I 2CG9A 3B82A 4PU9A 1Z0BA 1EI1A 2V34A 2Z5CA 1HNWE 4FN5A 4DV7I 4JI1E 2XEXA 4K0KI 4LFCI 1USVA 1K47A 4URLA 1OJ4A 2VQEE 4DV1E 4RPFA 4WUCA 4JI7E 5IT9C 2ZM6E 5GMDA 2Z5EA 4JI4I 4DV2E 2Z5BB 1IBMI 4JI0E 2E5LE 3QT5A 4LF5I 2DEIA 1WUUA 1U2RA 2R42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKN A;  1J5E I;  1PIE A;  2R3V A;  4DR6 E;  1N36 I;  4P52 A;  4JI3 E;  5LMN E;  4UTG A;  4DR4 I;  4R1F A;  2UUC I;  2V2Z A;  1FNM A;  4JYA I;  4DR2 E;  4JI6 I;  4NXN E;  2X36 A;  3PYD A;  4LF4 E;  1HNZ I;  2J7K A;  2UUB I;  4DR1 I;  4B3S I;  3LPS A;  2UXC I;  1PVG A;  2E1R A;  2NPF A;  1N34 E;  4DPY A;  4Z7C A;  4I3H A;  2UU9 E;  4AQY E;  5L3J A;  3QT7 A;  1NHH A;  1XHK A;  5LL6 R;  4X64 E;  4LF8 E;  1N0U A;  1Z5A A;  4JI2 I;  4LF5 E;  4DR5 I;  4JV5 I;  1Z0C A;  2UUA E;  1FI4 A;  1Z59 A;  4GKK E;  1J5E E;  5A2Q C;  4X62 I;  4WUB A;  1N32 E;  5FLX C;  1FJG E;  2BM0 A;  1Z5C A;  3ZKD A;  4X66 E;  2UXB I;  1XMQ E;  4DV5 E;  4B3R I;  1ZM9 A;  4DR7 I;  2V2V A;  5BR8 I;  4DR1 E;  1RR9 A;  3K17 A;  2WW4 A;  1IBK I;  1ZM3 A;  4JI8 I;  1MU5 A;  4LF9 I;  1D6T A;  2V8P A;  3V5R A;  1NZ0 A;  1ZM2 A;  1IBL I;  3CWV A;  1N33 I;  1Z0V A;  4B3M E;  3LNU A;  1Z0T A;  3ZZ0 A;  4DU8 A;  4LFA E;  4LF6 I;  3Q1Q A;  4JI5 I;  1XNQ I;  4HYM A;  2V2Q A;  4DV6 I;  1MX0 A;  2CZ9 A;  2ZBK B;  4JI2 E;  4DV4 E;  4EMD A;  4JV5 E;  4HY1 A;  3WU3 A;  5LMU E;  4GKJ E;  3WU5 A;  1ELO A;  4KQV A;  1HR0 I;  3PYG A;  3GON A;  4NXM E;  4DR3 I;  5IWA E;  4LF7 E;  3OTO I;  4USM A;  4DR7 E;  3M6A A;  2OI2 A;  1HNX E;  4DUZ I;  1IBK E;  1I94 E;  4JI8 E;  1XMO I;  4YHH I;  1KKH A;  4LF9 E;  3PYE A;  1ZM4 A;  2X7I A;  1NHJ A;  3WU4 A;  4DV0 I;  1H73 A;  3T1Y I;  3J81 Q;  4KHP I;  1IBL E;  4DV7 E;  4B3T I;  4K0K E;  4LFC E;  3JAM Q;  4HAC B;  4DU7 A;  1H7S A;  3J7A M;  4X65 I;  1DAR A;  2VQF I;  1B63 A;  1UEK A;  3J80 Q;  4DV6 E;  2F4V I;  2AJ4 A;  1EA6 A;  1RRE A;  1Z0G A;  2A2D A;  4MYU A;  4JI4 E;  3WU6 A;  4YY3 I;  1IBM E;  1HNW I;  4JI1 I;  1KIJ A;  1H74 A;  3V2U C;  4XTJ A;  3B8H A;  1N36 E;  4DR4 E;  2UUC E;  4DPW A;  4DUZ E;  4JYA E;  4JI6 E;  2VQE I;  4YHH E;  4DV1 I;  1Z0W A;  1HNZ E;  1VIS A;  4JI7 I;  2BM1 A;  2UUB E;  4UT4 A;  4B3S E;  4DV0 E;  4DV2 I;  2UXC E;  4KHP E;  4JI0 I;  2E5L I;  1XNR I;  4B3T E;  2HK3 A;  4LFB I;  4DR6 I;  4JI3 I;  5LMN I;  3K1J A;  1FKA E;  2Q2E B;  1FWK A;  5IT9 Q;  2F4V E;  3B78 A;  1QZR A;  1N0V C;  4NXN I;  4DR2 I;  4PRV A;  4M1K A;  5GME A;  4LF4 I;  4YY3 E;  1Z5B A;  4FWH A;  1B62 A;  4DR5 E;  4DUY I;  1PKP A;  2BV3 A;  1N34 I;  4USK A;  4X62 E;  2HK2 A;  2UXD I;  4P7A A;  2UU9 I;  1MG7 A;  2UXB E;  2DEJ A;  3QT6 A;  4AQY I;  2ZIT A;  4B3R E;  3J7A G;  4OX9 I;  1H7U A;  1A6F A;  5BR8 E;  4X64 I;  1ZXM A;  4LF8 I;  4ED4 A;  4FWD A;  1XNR E;  3H4L A;  4HXZ A;  2UUA I;  1KVK A;  2HHH I;  4PRX A;  4GKK I;  1Z0E A;  4LFB E;  1N33 E;  4DV3 I;  1N32 I;  1S16 A;  3T1H I;  1FJG I;  3F0N A;  4X66 I;  4LF6 E;  1FWL A;  4JI5 E;  3HUL A;  1XMQ I;  2HKJ A;  4DV5 I;  1XNQ E;  3PYF A;  2EFG A;  4Z7Y A;  4DUY E;  5A2Q Q;  4DPX A;  2A2C A;  4WUD A;  4FWG A;  5FLX Q;  3LTO A;  3ZKB A;  1HR0 E;  2UXD E;  4DR3 E;  3J81 C;  4B3M I;  2GS8 A;  3OTO E;  3ZM7 A;  4OX9 E;  4LFA I;  2HFU A;  3JAM C;  1NHI A;  1XMO E;  4DPT A;  4MYT A;  4DV4 I;  3J80 C;  2ZM6 I;  2HHH E;  5LMU I;  3ZZU A;  4DXL A;  1ZXN A;  1S4E A;  4GKJ I;  4FW9 A;  3D4J A;  3T1Y E;  3QT8 A;  4ZVI A;  4HAC A;  2HFS A;  4DV3 E;  4NXM I;  3T1H E;  4JG4 A;  5IWA I;  1KTV A;  2HKE A;  4LF7 I;  4X65 E;  2VF3 A;  2VQF E;  2LJP A;  3ZZT A;  1HNX I;  4DPU A;  1H72 C;  1I94 I;  3B82 A;  4PU9 A;  1Z0B A;  1EI1 A;  2V34 A;  1HNW E;  4FN5 A;  4DV7 I;  4JI1 E;  2XEX A;  4K0K I;  4LFC I;  1K47 A;  4URL A;  1OJ4 A;  2VQE E;  4DV1 E;  4RPF A;  4WUC A;  4JI7 E;  5IT9 C;  2ZM6 E;  5GMD A;  4JI4 I;  4DV2 E;  1IBM I;  4JI0 E;  2E5L E;  3QT5 A;  4LF5 I;  2DEI A;  1WUU A;  1U2R A;  2R42 A; 
#chains in the Genus database with same CATH topology
 1BKN A;  1J5E I;  1PIE A;  2R3V A;  4DR6 E;  1N36 I;  4P52 A;  4JI3 E;  5LMN E;  4UTG A;  4DR4 I;  4R1F A;  2UUC I;  2V2Z A;  4NBQ A;  1FNM A;  3PS1 A;  4JYA I;  4DR2 E;  4JI6 I;  4NXN E;  2X36 A;  3PYD A;  4LF4 E;  1HNZ I;  2J7K A;  2PO0 B;  2UUB I;  4DR1 I;  4B3S I;  3LPS A;  2UXC I;  1PVG A;  2WNR A;  2E1R A;  5DNX A;  2NPF A;  1N34 E;  4DPY A;  5FWK A;  1E3P A;  4Z7C A;  5K36 F;  4I3H A;  2UU9 E;  2C39 B;  4BA1 B;  4AQY E;  5L3J A;  4IZK A;  2NN6 B;  3QT7 A;  4FW7 A;  4FW3 A;  1NHH A;  2JEB A;  1XHK A;  5LL6 R;  4X64 E;  4IFD D;  4LF8 E;  1N0U A;  3U1K A;  1Z5A A;  2CGE A;  4MU0 A;  4JI2 I;  4LF5 E;  2IOQ A;  4DR5 I;  4JV5 I;  1Z0C A;  2UUA E;  1FI4 A;  1Z59 A;  5C0X C;  4GKK E;  3P3C A;  1J5E E;  5A2Q C;  2C38 B;  5C0X D;  4X62 I;  4WUB A;  1N32 E;  5FLX C;  3H1C A;  2IER A;  1FJG E;  2BM0 A;  1Z5C A;  3ZKD A;  4X66 E;  2UXB I;  3CDJ A;  1XMQ E;  4DV5 E;  4B3R I;  1ZM9 A;  4J3D A;  4DR7 I;  2V2V A;  5BR8 I;  3K85 A;  4DR1 E;  1RR9 A;  3K17 A;  2WW4 A;  1IBK I;  1ZM3 A;  4JI8 I;  2O1V A;  1MU5 A;  3B4T A;  3Q6N A;  4LF9 I;  1D6T A;  2BA1 D;  4N3O A;  2V8P A;  3V5R A;  2JEA B;  1NZ0 A;  1VI7 A;  4OO1 B;  1ZM2 A;  5JEA E;  1IBL I;  3CWV A;  1N33 I;  1Z0V A;  4B3M E;  3LNU A;  1Z0T A;  2JE6 B;  3ZZ0 A;  4IZJ B;  2BA0 D;  4DU8 A;  4LFA E;  3KRN A;  4LF6 I;  3Q1Q A;  4JI5 I;  1XNQ I;  4HYM A;  3GLL A;  2V2Q A;  5C0X F;  2AE8 A;  4DV6 I;  1MX0 A;  2CZ9 A;  1XXE A;  2ZBK B;  4JI2 E;  4DV4 E;  4EMD A;  4JV5 E;  3P76 A;  4HY1 A;  1YHC A;  4QNK A;  5JEA C;  3WU3 A;  5LMU E;  2C37 A;  3M85 D;  4GKJ E;  3WU5 A;  2GQ0 A;  2WP8 A;  1ELO A;  4KQV A;  4FW6 A;  5JEA D;  1HR0 I;  3PYG A;  3GON A;  4NXM E;  4DR3 I;  5IWA E;  4IFD A;  4LF7 E;  3OTO I;  4USM A;  4DR7 E;  3M6A A;  2OI2 A;  1HNX E;  5DRP A;  4DUZ I;  1IBK E;  1I94 E;  4JI8 E;  1XMO I;  4YHH I;  1KKH A;  4LF9 E;  3PYE A;  1ZM4 A;  2X7I A;  5C0X A;  4IFD E;  1NHJ A;  3WU4 A;  3GCM A;  4DV0 I;  4LCH A;  1H73 A;  3T1Y I;  3J81 Q;  4KHP I;  1IBL E;  4BA2 B;  4DV7 E;  4B3T I;  4K0K E;  3P3E A;  1Y60 A;  4LFC E;  1UDN A;  3JAM Q;  4HAC B;  3M7N D;  4DU7 A;  1H7S A;  2BR2 B;  3J7A M;  5C0X E;  4X65 I;  5JEA F;  1DAR A;  2VQF I;  1B63 A;  1UEK A;  3J80 Q;  4DV6 E;  4IFD C;  2F4V I;  2AJ4 A;  1EA6 A;  2Z5B A;  1RRE A;  1Z0G A;  5K36 B;  2A2D A;  2PO1 A;  2PNM A;  4MYU A;  4JI4 E;  2BA1 G;  1OYR A;  3WU6 A;  4YY3 I;  1RHY A;  1IBM E;  3HJC A;  1HNW I;  5DRR A;  3GME A;  2Z5C B;  4JI1 I;  1KIJ A;  1H74 A;  3V2U C;  2BA0 G;  3HKM A;  1OYP A;  4XTJ A;  3B8H A;  1N36 E;  4DR4 E;  4IZJ D;  2UUC E;  1USU A;  4DPW A;  2PNZ B;  4DUZ E;  2PO0 A;  4U3D A;  4JYA E;  4JI6 E;  2VQE I;  4LOM A;  4YHH E;  4DV1 I;  1Z0W A;  5JEA A;  2O1W A;  1VIS A;  1HNZ E;  4JI7 I;  1Y4U A;  2BM1 A;  2PO2 B;  2UUB E;  4UT4 A;  3M85 G;  4B3S E;  4DV0 E;  4DV2 I;  2UXC E;  5DNL A;  4KHP E;  4JI0 I;  2E5L I;  1XNR I;  4B3T E;  2C39 A;  4BA1 A;  3L7Z B;  2HK3 A;  1R6M A;  4LCG A;  4IFD F;  4LFB I;  2NN6 A;  4DR6 I;  4JI3 I;  5LMN I;  3K1J A;  1FKA E;  2Q2E B;  1FWK A;  5IT9 Q;  2F4V E;  3B78 A;  3DD6 A;  1QZR A;  1N0V C;  4NXN I;  4DR2 I;  1UDQ A;  4LCF A;  4PRV A;  4M1K A;  5GME A;  4LF4 I;  4YY3 E;  1Z5B A;  2VES A;  4MQY A;  4FWH A;  2NN6 E;  1B62 A;  4DR5 E;  2C38 A;  4DUY I;  1PKP A;  1P42 A;  2BV3 A;  2CVE A;  1N34 I;  2GO4 A;  3M7N G;  4USK A;  4X62 E;  2WNR B;  2HK2 A;  4IS9 A;  2UXD I;  4P7A A;  2UU9 I;  1MG7 A;  2UXB E;  2DEJ A;  3QT6 A;  1R6L A;  4AQY I;  2ZIT A;  4B3R E;  3J7A G;  2NN6 C;  4OX9 I;  2IES A;  1H7U A;  1A6F A;  5K36 C;  5BR8 E;  4X64 I;  1ZXM A;  2JT2 A;  2NN6 D;  4ED4 A;  4LF8 I;  2JEA A;  5K36 D;  4IZK B;  4FWD A;  1XNR E;  2JEB B;  3H4L A;  2J65 A;  2O1U A;  4HXZ A;  2UUA I;  1KVK A;  5DRQ A;  2HHH I;  4AM3 A;  4GQU A;  5EL9 A;  4PRX A;  4U3B A;  4GKK I;  1Z0E A;  2JE6 A;  4IZJ A;  4LFB E;  3P06 A;  1N33 E;  2PNL A;  4DV3 I;  1N32 I;  1S16 A;  3T1H I;  4OO1 E;  1FJG I;  3F0N A;  4X66 I;  4LF6 E;  1FWL A;  5DRO A;  4JI5 E;  3HUL A;  1XMQ I;  2HKJ A;  4DV5 I;  1XNQ E;  3PYF A;  1HK7 A;  2EFG A;  4Z7Y A;  4ISA A;  5JEA B;  4DUY E;  4MU1 A;  5A2Q Q;  2IOP A;  2A2C A;  4DPX A;  4WUD A;  4FWG A;  5FLX Q;  4OO1 C;  1YH8 A;  3LTO A;  3ZKB A;  1HR0 E;  2UXD E;  4DR3 E;  2NN6 F;  3J81 C;  1Y4S A;  4B3M I;  4FW5 A;  4OO1 D;  2GS8 A;  3OTO E;  5ELW A;  3ZM7 A;  4LPF A;  4OX9 E;  4LFA I;  2HFU A;  1Y6Z A;  3JAM C;  4OKG A;  1E3H A;  1NHI A;  1XMO E;  4DPT A;  4MYT A;  4DV4 I;  3J80 C;  3PRY A;  4BA2 A;  2ZM6 I;  2HHH E;  5LMU I;  3P3G A;  2GO3 A;  3UHM A;  3ZZU A;  1ZXN A;  4DXL A;  1S4E A;  4GKJ I;  4FW9 A;  3D4J A;  3T1Y E;  3QT8 A;  4ZVI A;  4HAC A;  2O1T A;  2HFS A;  4AIM A;  2C37 B;  4DV3 E;  2BR2 A;  4NXM I;  2WP8 B;  3T1H E;  4JG4 A;  5IWA I;  1KTV A;  2O3Z A;  2HKE A;  4LF7 I;  5K36 A;  1UDO A;  3Q6M A;  4X65 E;  2VF3 A;  2VQF E;  2LJP A;  3ZZT A;  1UDS A;  4AID A;  4IFD B;  4MU4 A;  3U1Y A;  1HNX I;  4DPU A;  1H72 C;  1I94 I;  2F1D A;  4OO1 F;  2CG9 A;  3B82 A;  3CDI A;  4PU9 A;  1Z0B A;  3PS3 A;  5EKW A;  1EI1 A;  2V34 A;  2Z5C A;  1HNW E;  5K36 E;  4FW4 A;  4MU3 A;  4FN5 A;  1OYS A;  3PS2 A;  5C0X B;  1Y5Y A;  4DV7 I;  4JI1 E;  2XEX A;  4K0K I;  2PNZ A;  4LFC I;  1USV A;  1K47 A;  4MDT A;  4URL A;  1OJ4 A;  2PO2 A;  2VQE E;  4DV1 E;  4RPF A;  4WUC A;  4JI7 E;  4OZE A;  5IT9 C;  2ZM6 E;  5GMD A;  2Z5E A;  4JI4 I;  4DV2 E;  3NZK A;  2Z5B B;  3L7Z A;  1IBM I;  4QNJ A;  4OO1 A;  4JI0 E;  2E5L E;  3QT5 A;  4LF5 I;  2PO1 B;  2DEI A;  1WUU A;  1U2R A;  2R42 A; 
#chains in the Genus database with same CATH homology
 1BKN A;  1J5E I;  1PIE A;  2R3V A;  4DR6 E;  1N36 I;  4P52 A;  4JI3 E;  5LMN E;  4UTG A;  4DR4 I;  4R1F A;  2UUC I;  2V2Z A;  1FNM A;  4JYA I;  4DR2 E;  4JI6 I;  4NXN E;  2X36 A;  3PYD A;  4LF4 E;  1HNZ I;  2J7K A;  2UUB I;  4DR1 I;  4B3S I;  3LPS A;  2UXC I;  1PVG A;  2E1R A;  2NPF A;  1N34 E;  4DPY A;  5FWK A;  4Z7C A;  4I3H A;  2UU9 E;  4AQY E;  5L3J A;  4IZK A;  3QT7 A;  1NHH A;  1XHK A;  5LL6 R;  4X64 E;  4LF8 E;  1N0U A;  1Z5A A;  2CGE A;  4JI2 I;  4LF5 E;  2IOQ A;  4DR5 I;  4JV5 I;  1Z0C A;  2UUA E;  1FI4 A;  1Z59 A;  4GKK E;  1J5E E;  5A2Q C;  4X62 I;  4WUB A;  1N32 E;  5FLX C;  1FJG E;  2BM0 A;  1Z5C A;  3ZKD A;  4X66 E;  2UXB I;  1XMQ E;  4DV5 E;  4B3R I;  1ZM9 A;  4DR7 I;  2V2V A;  5BR8 I;  3K85 A;  4DR1 E;  1RR9 A;  3K17 A;  2WW4 A;  1IBK I;  1ZM3 A;  4JI8 I;  2O1V A;  1MU5 A;  3Q6N A;  4LF9 I;  1D6T A;  4N3O A;  2V8P A;  3V5R A;  1NZ0 A;  1ZM2 A;  1IBL I;  3CWV A;  1N33 I;  1Z0V A;  4B3M E;  3LNU A;  1Z0T A;  3ZZ0 A;  4IZJ B;  4DU8 A;  4LFA E;  4LF6 I;  3Q1Q A;  4JI5 I;  1XNQ I;  4HYM A;  2V2Q A;  4DV6 I;  1MX0 A;  2CZ9 A;  2ZBK B;  4JI2 E;  4DV4 E;  4EMD A;  4JV5 E;  4HY1 A;  3WU3 A;  5LMU E;  4GKJ E;  3WU5 A;  2GQ0 A;  1ELO A;  4KQV A;  1HR0 I;  3PYG A;  3GON A;  4NXM E;  4DR3 I;  5IWA E;  4LF7 E;  3OTO I;  4USM A;  4DR7 E;  3M6A A;  2OI2 A;  1HNX E;  4DUZ I;  1IBK E;  1I94 E;  4JI8 E;  1XMO I;  4YHH I;  1KKH A;  4LF9 E;  3PYE A;  1ZM4 A;  2X7I A;  1NHJ A;  3WU4 A;  4DV0 I;  1H73 A;  3T1Y I;  3J81 Q;  4KHP I;  1IBL E;  4DV7 E;  4B3T I;  4K0K E;  4LFC E;  3JAM Q;  4HAC B;  4DU7 A;  1H7S A;  3J7A M;  4X65 I;  1DAR A;  2VQF I;  1B63 A;  1UEK A;  3J80 Q;  4DV6 E;  2F4V I;  2AJ4 A;  1EA6 A;  2Z5B A;  1RRE A;  1Z0G A;  2A2D A;  2PNM A;  4MYU A;  4JI4 E;  3WU6 A;  4YY3 I;  1IBM E;  3HJC A;  1HNW I;  2Z5C B;  4JI1 I;  1KIJ A;  1H74 A;  3V2U C;  4XTJ A;  3B8H A;  1N36 E;  4DR4 E;  4IZJ D;  2UUC E;  1USU A;  4DPW A;  4DUZ E;  4JYA E;  4JI6 E;  2VQE I;  4YHH E;  4DV1 I;  1Z0W A;  2O1W A;  1VIS A;  1HNZ E;  4JI7 I;  1Y4U A;  2BM1 A;  2UUB E;  4UT4 A;  4B3S E;  4DV0 E;  4DV2 I;  2UXC E;  4KHP E;  4JI0 I;  2E5L I;  1XNR I;  4B3T E;  2HK3 A;  4LFB I;  4DR6 I;  4JI3 I;  5LMN I;  3K1J A;  1FKA E;  2Q2E B;  1FWK A;  5IT9 Q;  2F4V E;  3B78 A;  1QZR A;  1N0V C;  4NXN I;  4DR2 I;  4PRV A;  4M1K A;  5GME A;  4LF4 I;  4YY3 E;  1Z5B A;  4FWH A;  1B62 A;  4DR5 E;  4DUY I;  1PKP A;  2BV3 A;  1N34 I;  4USK A;  4X62 E;  2HK2 A;  2UXD I;  4P7A A;  2UU9 I;  1MG7 A;  2UXB E;  2DEJ A;  3QT6 A;  4AQY I;  2ZIT A;  4B3R E;  3J7A G;  4OX9 I;  1H7U A;  1A6F A;  5BR8 E;  4X64 I;  1ZXM A;  4LF8 I;  4ED4 A;  4IZK B;  4FWD A;  1XNR E;  3H4L A;  2O1U A;  4HXZ A;  2UUA I;  1KVK A;  2HHH I;  4PRX A;  4GKK I;  1Z0E A;  4IZJ A;  4LFB E;  3P06 A;  1N33 E;  2PNL A;  4DV3 I;  1N32 I;  1S16 A;  3T1H I;  1FJG I;  3F0N A;  4X66 I;  4LF6 E;  1FWL A;  4JI5 E;  3HUL A;  1XMQ I;  2HKJ A;  4DV5 I;  1XNQ E;  3PYF A;  1HK7 A;  2EFG A;  4Z7Y A;  4DUY E;  5A2Q Q;  2IOP A;  2A2C A;  4DPX A;  4WUD A;  4FWG A;  5FLX Q;  3LTO A;  3ZKB A;  1HR0 E;  2UXD E;  4DR3 E;  3J81 C;  1Y4S A;  4B3M I;  2GS8 A;  3OTO E;  3ZM7 A;  4OX9 E;  4LFA I;  2HFU A;  1Y6Z A;  3JAM C;  1NHI A;  1XMO E;  4DPT A;  4MYT A;  4DV4 I;  3J80 C;  3PRY A;  2ZM6 I;  2HHH E;  5LMU I;  3ZZU A;  4DXL A;  1ZXN A;  1S4E A;  4GKJ I;  4FW9 A;  3D4J A;  3T1Y E;  3QT8 A;  4ZVI A;  4HAC A;  2O1T A;  2HFS A;  4DV3 E;  4NXM I;  3T1H E;  4JG4 A;  5IWA I;  1KTV A;  2HKE A;  4LF7 I;  4X65 E;  3Q6M A;  2VF3 A;  2VQF E;  2LJP A;  3ZZT A;  1HNX I;  4DPU A;  1H72 C;  1I94 I;  2CG9 A;  3B82 A;  4PU9 A;  1Z0B A;  1EI1 A;  2V34 A;  2Z5C A;  1HNW E;  4FN5 A;  4DV7 I;  4JI1 E;  2XEX A;  4K0K I;  4LFC I;  1USV A;  1K47 A;  4URL A;  1OJ4 A;  2VQE E;  4DV1 E;  4RPF A;  4WUC A;  4JI7 E;  5IT9 C;  2ZM6 E;  5GMD A;  2Z5E A;  4JI4 I;  4DV2 E;  2Z5B B;  1IBM I;  4JI0 E;  2E5L E;  3QT5 A;  4LF5 I;  2DEI A;  1WUU A;  1U2R A;  2R42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...