2UU9I

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9I00
4ED4A 3WU4A 4YY3I 4LF4E 1DARA 1IBKE 2UXBI 5IWAE 2BV3A 3K1JA 3ZM7A 1HR0E 1ZM2A 2UXDE 1ZXMA 4JI8I 5BR8I 2UUAI 1N36E 1NHJA 5BR8E 4DUZE 2OI2A 1HNWE 2UXCI 3T1YI 4GKKI 3JAMQ 3GONA 1HNWI 4NXNI 4JI0E 4B3SE 4WUCA 4JI3E 2DEIA 3ZKBA 4UT4A 3ZKDA 3HULA 3V5RA 1XMQI 2UXBE 1PKPA 4Z7CA 1ZM4A 1MG7A 1Z0BA 2HFSA 5GMEA 4WUBA 4USMA 2WW4A 4MYUA 1RR9A 4URLA 4LFBI 3ZZ0A 4DR5E 4USKA 1BKNA 1Z0CA 2E1RA 4YHHE 4LF7E 5LMNE 1Z5CA 1UEKA 1FI4A 3JAMC 2ZBKB 4JI4E 2A2CA 1XNRI 2CZ9A 4B3ME 4GKJE 2UUCI 4HACB 4JI8E 3J80C 2R42A 4LF9E 4JYAI 2UUBI 2HHHI 4JYAE 4M1KA 3LNUA 1QZRA 4K0KE 4ZVIA 1EA6A 4K0KI 3D4JA 2E5LI 4DV7I 4DR2I 4DPWA 1I94I 3QT7A 4LFAI 5FLXQ 1H74A 1HNXI 4DR6I 4LFAE 4FW9A 2NPFA 2F4VI 1N33E 4I3HA 4DPXA 4DPYA 4R1FA 4OX9E 4JI2I 4AQYE 4DR4I 1NHIA 4JI7E 1Z0EA 1Z0VA 1FWKA 5IT9Q 3LTOA 1S16A 2BM0A 1KTVA 4X62I 4DV1E 3B78A 4DR3E 4DV3E 1Z0WA 1MX0A 4DU8A 4JG4A 4AQYI 1XMQE 3J81Q 4LFCI 5A2QC 4DR1E 4PRXA 4PRVA 2VQFE 4B3TE 4B3SI 1PVGA 4JI1I 1XNQI 4DV4E 1B63A 3WU3A 2VQEI 4FWDA 4DXLA 4PU9A 4JI2E 1HNXE 4DR6E 3WU5A 4JI5I 4EMDA 1XHKA 4XTJA 1ELOA 4FWHA 4LFBE 2HKEA 4LF5E 2E5LE 1Z5AA 1J5EI 3B8HA 2ZITA 4P52A 4LF9I 4X65E 4X66I 4LFCE 4DV1I 5LL6R 1KVKA 4JV5E 4JV5I 1Z0TA 4OX9I 4GKKE 2DEJA 1D6TA 1NZ0A 1H72C 1IBKI 4DPUA 2F4VE 1H7SA 3CWVA 1N33I 2A2DA 3WU6A 4KQVA 1N34I 3QT6A 3OTOE 4DV5E 2BM1A 4DV4I 1HNZI 2EFGA 3ZZTA 4KHPI 4B3RI 1N32I 4X65I 4X66E 4DR5I 4LF4I 2V8PA 1N32E 4B3RE 4HYMA 4WUDA 1N0UA 2ZM6I 4DUYE 4UTGA 4B3TI 4Z7YA 1MU5A 2AJ4A 4DR7I 3T1HI 4B3MI 4YY3E 3T1HE 4KHPE 2UU9E 1H73A 4DU7A 2HK2A 1N0VC 2HHHE 5IWAI 3K17A 3F0NA 3PYFA 2VF3A 1U2RA 1ZXNA 3B82A 1OJ4A 4JI5E 3PYDA 4HXZA 1WUUA 3J7AM 2UUBE 2V2ZA 5LMNI 4MYTA 4FWGA 4X62E 1FJGE 1KKHA 1XNRE 4LF6E 1EI1A 1KIJA 3QT5A 1HR0I 1FNMA 3PYGA 4FN5A 1K47A 1IBLI 4LF7I 4HY1A 4DUYI 4JI7I 4X64E 1XNQE 4DV0E 2VQFI 4DR7E 2UUCE 5L3JA 4DR3I 1XMOI 2HK3A 1HNZE 1ZM3A 1J5EE 4NXMI 4DV6I 3Q1QA 2X36A 1PIEA 1I94E 2Q2EB 3J81C 1A6FA 1IBMI 2LJPA 2ZM6E 2HKJA 4RPFA 4GKJI 1FKAE 4JI0I 2R3VA 3OTOI 4DV5I 4LF5I 4DPTA 1RREA 2UXCE 3V2UC 4DV0I 4DV3I 3H4LA 3M6AA 4DV2I 2V34A 4DV6E 4NXME 1Z5BA 5FLXC 4DUZI 5LMUE 5LMUI 2GS8A 4NXNE 2UXDI 2X7IA 3PYEA 2VQEE 3J7AG 4DR4E 5IT9C 4YHHI 1ZM9A 2HFUA 3LPSA 4DV7E 2V2QA 4DR2E 1S4EA 4LF8I 1FWLA 1NHHA 3J80Q 4DR1I 3ZZUA 4JI6I 4JI4I 2V2VA 1FJGI 1N34E 4JI3I 1Z59A 2J7KA 1H7UA 5GMDA 1B62A 4DV2E 1N36I 1IBLE 4LF6I 4LF8E 2UU9I 1Z0GA 4P7AA 4X64I 2UUAE 4JI6E 1IBME 2XEXA 3T1YE 5A2QQ 4JI1E 4HACA 1XMOE 3QT8A 1VISA
chains in the Genus database with same CATH superfamily
4ED4A 3WU4A 4QNKA 4YY3I 4OZEA 1DARA 1IBKE 4LF4E 2NN6C 2UXBI 1VI7A 5IWAE 2BV3A 3K1JA 2PO0A 2C38A 3ZM7A 1HR0E 1ZM2A 2UXDE 1ZXMA 2WP8A 4JI8I 4AIMA 5BR8I 1HK7A 2UUAI 1N36E 3B4TA 1NHJA 2NN6B 5BR8E 4DUZE 2OI2A 1HNWE 2UXCI 3T1YI 2IOQA 4GKKI 2Z5CB 3JAMQ 3GONA 1HNWI 4NXNI 4JI0E 2C38B 4IFDF 1YH8A 4B3SE 5C0XC 4WUCA 4JI3E 2DEIA 3ZKBA 4UT4A 3ZKDA 3HULA 3V5RA 1XMQI 3NZKA 2UXBE 1PKPA 3KRNA 3L7ZB 4Z7CA 1ZM4A 1MG7A 1Z0BA 4IFDC 2HFSA 5GMEA 4WUBA 4USMA 2WW4A 4MYUA 1RR9A 4URLA 4LFBI 2NN6F 2WNRA 3ZZ0A 4DR5E 3H1CA 4OO1E 4USKA 2PNLA 1BKNA 1Z0CA 2E1RA 2BA0G 4YHHE 4LF7E 5LMNE 1Z5CA 1UEKA 1FI4A 3JAMC 2ZBKB 4JI4E 2A2CA 1XNRI 2CZ9A 4B3ME 4NBQA 4IZJB 2GO3A 2UUCI 4GKJE 5DNLA 1OYSA 4HACB 4JI8E 3J80C 2R42A 4LF9E 4JYAI 2UUBI 2HHHI 4JYAE 4M1KA 3LNUA 1QZRA 4K0KE 4ZVIA 1EA6A 2O1TA 4K0KI 3P3CA 2BA1G 3D4JA 1E3HA 2PO0B 2E5LI 5EKWA 4DV7I 4DR2I 4DPWA 1I94I 3QT7A 4LFAI 4MU0A 2GQ0A 3P06A 5FLXQ 1H74A 1HNXI 4DR6I 5K36F 4LFAE 2NN6A 1UDOA 3P3GA 4FW9A 2NPFA 2F4VI 2JEAA 1N33E 4I3HA 4LPFA 3PRYA 4DPXA 4DPYA 4R1FA 4OX9E 4JI2I 4AQYE 4OO1C 4DR4I 1NHIA 4JI7E 1Z0EA 3L7ZA 1Z0VA 1UDNA 1FWKA 5IT9Q 3LTOA 3M7ND 1S16A 2BM0A 1KTVA 4X62I 4DV1E 3B78A 4LCGA 4DV3E 1Z0WA 2BR2B 1MX0A 1R6LA 4IFDE 4LCFA 4DU8A 4J3DA 4JG4A 4AQYI 1E3PA 3M85G 4IS9A 1XMQE 5C0XF 3J81Q 4LFCI 5A2QC 3P76A 4DR1E 4PRXA 4FW5A 4PRVA 2VQFE 4B3TE 2BR2A 4B3SI 1PVGA 4JI1I 1XNQI 3P3EA 3M85D 4DV4E 1B63A 2PO1B 3WU3A 2VQEI 4FWDA 1USUA 4PU9A 4DXLA 1HNXE 4JI2E 4DR6E 3WU5A 4JI5I 4EMDA 1XHKA 4XTJA 3CDIA 4OO1D 4QNJA 1ELOA 4FWHA 1OYPA 4LFBE 2Z5BA 1P42A 2HKEA 1USVA 1UDQA 5K36B 4LF5E 4OKGA 1Y6ZA 2PO1A 2E5LE 1Z5AA 2CG9A 1J5EI 2JE6A 3B8HA 2ZITA 1XMOE 4P52A 4LF9I 4X65E 4X66I 4LFCE 4DV1I 2JEAB 5LL6R 1KVKA 4JV5E 4JV5I 1Z0TA 4OX9I 4GKKE 3GMEA 2DEJA 1D6TA 1NZ0A 1H72C 1IBKI 3HKMA 4DPUA 2BA1D 5K36E 2F4VE 1H7SA 3CWVA 2F1DA 1N33I 2A2DA 3WU6A 4KQVA 1R6MA 3DD6A 1N34I 3QT6A 5JEAD 3OTOE 4DV5E 4MDTA 2BM1A 4DV4I 5JEAC 1HNZI 5DROA 2EFGA 3ZZTA 2IOPA 4LCHA 4KHPI 4B3RI 1N32I 4BA1A 4X65I 4X66E 4DR5I 2VESA 4LF4I 2V8PA 4IFDA 5DRQA 1N32E 4B3RE 4HYMA 1Y5YA 2JT2A 1YHCA 4WUDA 1N0UA 2ZM6I 4DUYE 4UTGA 3U1YA 4BA2B 4B3TI 4Z7YA 3Q6MA 1MU5A 2AJ4A 5FWKA 2BA0D 4DR7I 3T1HI 4B3MI 4OO1A 4YY3E 3T1HE 4KHPE 4BA1B 4IFDD 2UU9E 1H73A 4IFDB 4U3DA 5C0XE 4DU7A 2HK2A 1N0VC 2HHHE 5IWAI 3K17A 2Z5BB 5JEAA 3F0NA 3PS2A 3PYFA 5K36A 3UHMA 2VF3A 3PS1A 1U2RA 1ZXNA 3B82A 1OJ4A 4FW7A 4JI5E 2JE6B 4MU4A 3PYDA 4HXZA 2IERA 1WUUA 3J7AM 2UUBE 4FW6A 1XXEA 4AM3A 2V2ZA 5LMNI 4MYTA 4FWGA 4IZKA 5JEAB 4X62E 3Q6NA 1FJGE 2PNMA 5DRPA 4U3BA 1KKHA 1XNRE 4LF6E 1EI1A 1KIJA 3QT5A 1HR0I 1FNMA 3PYGA 4FN5A 1K47A 1IBLI 4LF7I 4HY1A 4DUYI 4JI7I 5JEAE 4X64E 1XNQE 4AIDA 5C0XD 4DV0E 2JEBB 2VQFI 4DR7E 4FW3A 4MQYA 2UUCE 5L3JA 4DR3I 1XMOI 2HK3A 3M7NG 1HNZE 1ZM3A 1J5EE 5K36C 4DV6I 4NXMI 3Q1QA 2X36A 1PIEA 5ELWA 2Z5EA 1I94E 2Q2EB 3J81C 3GCMA 3U1KA 2NN6D 1A6FA 1IBMI 2LJPA 3CDJA 2ZM6E 2HKJA 4BA2A 4RPFA 5K36D 4GKJI 1FKAE 2JEBA 4JI0I 1Y4SA 5C0XB 2R3VA 3OTOI 4DV5I 4LF5I 4OO1B 2O1WA 4DPTA 1Y4UA 1RREA 2UXCE 3HJCA 3V2UC 3PS3A 4DV0I 4DV3I 3H4LA 5DNXA 1RHYA 3M6AA 3K85A 4DV2I 2C39A 2V34A 2WP8B 5EL9A 2J65A 4GQUA 4DV6E 4NXME 1Z5BA 5FLXC 2GO4A 4DUZI 5LMUE 2C37B 5LMUI 2GS8A 2Z5CA 4IZKB 4NXNE 2UXDI 4ISAA 2X7IA 3PYEA 2NN6E 2VQEE 3J7AG 4DR4E 4FW4A 2C39B 1OYRA 5IT9C 4OO1F 4YHHI 1ZM9A 2HFUA 2PNZA 3LPSA 2PO2A 4MU1A 4DV7E 2V2QA 4DR2E 1S4EA 4LF8I 1FWLA 1NHHA 2C37A 4LOMA 3J80Q 4DR1I 3ZZUA 4JI6I 4N3OA 4JI4I 2V2VA 1FJGI 1N34E 4JI3I 1Z59A 2J7KA 2WNRB 2O1UA 1H7UA 4IZJD 5GMDA 2CGEA 1B62A 2IESA 4DV2E 1N36I 1IBLE 4LF6I 2PNZB 2PO2B 4MU3A 4LF8E 2UU9I 1Z0GA 4P7AA 1Y60A 4X64I 2UUAE 4JI6E 5JEAF 1IBME 2XEXA 2O1VA 3T1YE 1UDSA 2CVEA 4IZJA 5A2QQ 5C0XA 2AE8A 4JI1E 4HACA 5DRRA 4DR3E 3GLLA 3QT8A 2O3ZA 1VISA
chains in the Genus database with same CATH topology
4ED4A 3WU4A 4YY3I 4LF4E 1DARA 1IBKE 2UXBI 5IWAE 2BV3A 3K1JA 3ZM7A 1HR0E 1ZM2A 2UXDE 1ZXMA 4JI8I 5BR8I 1HK7A 2UUAI 1N36E 1NHJA 5BR8E 4DUZE 2OI2A 1HNWE 2UXCI 3T1YI 2IOQA 4GKKI 2Z5CB 3JAMQ 3GONA 1HNWI 4NXNI 4JI0E 4B3SE 4WUCA 4JI3E 2DEIA 3ZKBA 4UT4A 3ZKDA 3HULA 3V5RA 1XMQI 2UXBE 1PKPA 4Z7CA 1ZM4A 1MG7A 1Z0BA 2HFSA 5GMEA 4WUBA 4USMA 2WW4A 4MYUA 1RR9A 4URLA 4LFBI 3ZZ0A 4DR5E 4USKA 2PNLA 1BKNA 1Z0CA 2E1RA 4YHHE 4LF7E 5LMNE 1Z5CA 1UEKA 1FI4A 3JAMC 2ZBKB 4JI4E 2A2CA 1XNRI 2CZ9A 4B3ME 4IZJB 2UUCI 4GKJE 4HACB 4JI8E 3J80C 2R42A 4LF9E 4JYAI 2UUBI 2HHHI 4JYAE 4M1KA 3LNUA 1QZRA 4K0KE 4ZVIA 1EA6A 2O1TA 4K0KI 3D4JA 2E5LI 4DV7I 4DR2I 4DPWA 1I94I 3QT7A 4LFAI 2GQ0A 3P06A 5FLXQ 1H74A 1HNXI 4DR6I 4LFAE 4FW9A 2NPFA 2F4VI 1N33E 4I3HA 3PRYA 4DPXA 4DPYA 4R1FA 4OX9E 4JI2I 4AQYE 4DR4I 1NHIA 4JI7E 1Z0EA 1Z0VA 1FWKA 5IT9Q 3LTOA 1S16A 2BM0A 1KTVA 4X62I 4DV1E 3B78A 4DR3E 4DV3E 1Z0WA 1MX0A 4DU8A 4JG4A 4AQYI 1XMQE 3J81Q 4LFCI 5A2QC 4DR1E 4PRXA 4PRVA 2VQFE 4B3TE 4B3SI 1PVGA 4JI1I 1XNQI 4DV4E 1B63A 3WU3A 2VQEI 4FWDA 1USUA 4PU9A 4DXLA 1HNXE 4JI2E 4DR6E 3WU5A 4JI5I 4EMDA 1XHKA 4XTJA 1ELOA 4FWHA 4LFBE 2Z5BA 2HKEA 1USVA 4LF5E 1Y6ZA 2E5LE 1Z5AA 1J5EI 2CG9A 3B8HA 2ZITA 4P52A 4LF9I 4X65E 4X66I 4LFCE 4DV1I 5LL6R 1KVKA 4JV5E 4JV5I 1Z0TA 4OX9I 4GKKE 2DEJA 1D6TA 1NZ0A 1H72C 1IBKI 4DPUA 2F4VE 1H7SA 3CWVA 1N33I 2A2DA 3WU6A 4KQVA 1N34I 3QT6A 3OTOE 4DV5E 2BM1A 4DV4I 1HNZI 2EFGA 3ZZTA 2IOPA 4KHPI 4B3RI 1N32I 4X65I 4X66E 4DR5I 4LF4I 2V8PA 1N32E 4B3RE 4HYMA 4WUDA 1N0UA 2ZM6I 4DUYE 4UTGA 4B3TI 4Z7YA 3Q6MA 1MU5A 2AJ4A 5FWKA 4DR7I 3T1HI 4B3MI 4YY3E 3T1HE 4KHPE 2UU9E 1H73A 4DU7A 2HK2A 1N0VC 2HHHE 5IWAI 3K17A 2Z5BB 3F0NA 3PYFA 2VF3A 1U2RA 1ZXNA 3B82A 1OJ4A 4JI5E 3PYDA 4HXZA 1WUUA 3J7AM 2UUBE 2V2ZA 5LMNI 4MYTA 4FWGA 4IZKA 4X62E 3Q6NA 1FJGE 2PNMA 1KKHA 1XNRE 4LF6E 1EI1A 1KIJA 3QT5A 1HR0I 1FNMA 3PYGA 4FN5A 1K47A 1IBLI 4LF7I 4HY1A 4DUYI 4JI7I 4X64E 1XNQE 4DV0E 2VQFI 4DR7E 2UUCE 5L3JA 4DR3I 1XMOI 2HK3A 1HNZE 1ZM3A 1J5EE 4DV6I 4NXMI 3Q1QA 2X36A 1PIEA 1I94E 2Z5EA 2Q2EB 3J81C 1A6FA 1IBMI 2LJPA 2ZM6E 2HKJA 4RPFA 4GKJI 1FKAE 4JI0I 1Y4SA 2R3VA 3OTOI 4DV5I 4LF5I 2O1WA 4DPTA 1Y4UA 1RREA 2UXCE 3HJCA 3V2UC 4DV0I 4DV3I 3H4LA 3M6AA 3K85A 4DV2I 2V34A 4DV6E 4NXME 1Z5BA 5FLXC 4DUZI 5LMUE 5LMUI 2GS8A 2Z5CA 4IZKB 4NXNE 2UXDI 2X7IA 3PYEA 2VQEE 3J7AG 4DR4E 5IT9C 4YHHI 1ZM9A 2HFUA 3LPSA 4DV7E 2V2QA 4DR2E 1S4EA 4LF8I 1FWLA 1NHHA 3J80Q 4DR1I 3ZZUA 4JI6I 4N3OA 4JI4I 2V2VA 1FJGI 1N34E 4JI3I 1Z59A 2J7KA 2O1UA 1H7UA 4IZJD 5GMDA 2CGEA 1B62A 4DV2E 1N36I 1IBLE 4LF6I 4LF8E 2UU9I 1Z0GA 4P7AA 4X64I 2UUAE 4JI6E 1IBME 2XEXA 2O1VA 3T1YE 4IZJA 5A2QQ 4JI1E 4HACA 1XMOE 3QT8A 1VISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ED4 A;  3WU4 A;  4YY3 I;  4LF4 E;  1DAR A;  1IBK E;  2UXB I;  5IWA E;  2BV3 A;  3K1J A;  3ZM7 A;  1HR0 E;  1ZM2 A;  2UXD E;  1ZXM A;  4JI8 I;  5BR8 I;  2UUA I;  1N36 E;  1NHJ A;  5BR8 E;  4DUZ E;  2OI2 A;  1HNW E;  2UXC I;  3T1Y I;  4GKK I;  3JAM Q;  3GON A;  1HNW I;  4NXN I;  4JI0 E;  4B3S E;  4WUC A;  4JI3 E;  2DEI A;  3ZKB A;  4UT4 A;  3ZKD A;  3HUL A;  3V5R A;  1XMQ I;  2UXB E;  1PKP A;  4Z7C A;  1ZM4 A;  1MG7 A;  1Z0B A;  2HFS A;  5GME A;  4WUB A;  4USM A;  2WW4 A;  4MYU A;  1RR9 A;  4URL A;  4LFB I;  3ZZ0 A;  4DR5 E;  4USK A;  1BKN A;  1Z0C A;  2E1R A;  4YHH E;  4LF7 E;  5LMN E;  1Z5C A;  1UEK A;  1FI4 A;  3JAM C;  2ZBK B;  4JI4 E;  2A2C A;  1XNR I;  2CZ9 A;  4B3M E;  4GKJ E;  2UUC I;  4HAC B;  4JI8 E;  3J80 C;  2R42 A;  4LF9 E;  4JYA I;  2UUB I;  2HHH I;  4JYA E;  4M1K A;  3LNU A;  1QZR A;  4K0K E;  4ZVI A;  1EA6 A;  4K0K I;  3D4J A;  2E5L I;  4DV7 I;  4DR2 I;  4DPW A;  1I94 I;  3QT7 A;  4LFA I;  5FLX Q;  1H74 A;  1HNX I;  4DR6 I;  4LFA E;  4FW9 A;  2NPF A;  2F4V I;  1N33 E;  4I3H A;  4DPX A;  4DPY A;  4R1F A;  4OX9 E;  4JI2 I;  4AQY E;  4DR4 I;  1NHI A;  4JI7 E;  1Z0E A;  1Z0V A;  1FWK A;  5IT9 Q;  3LTO A;  1S16 A;  2BM0 A;  1KTV A;  4X62 I;  4DV1 E;  3B78 A;  4DR3 E;  4DV3 E;  1Z0W A;  1MX0 A;  4DU8 A;  4JG4 A;  4AQY I;  1XMQ E;  3J81 Q;  4LFC I;  5A2Q C;  4DR1 E;  4PRX A;  4PRV A;  2VQF E;  4B3T E;  4B3S I;  1PVG A;  4JI1 I;  1XNQ I;  4DV4 E;  1B63 A;  3WU3 A;  2VQE I;  4FWD A;  4DXL A;  4PU9 A;  4JI2 E;  1HNX E;  4DR6 E;  3WU5 A;  4JI5 I;  4EMD A;  1XHK A;  4XTJ A;  1ELO A;  4FWH A;  4LFB E;  2HKE A;  4LF5 E;  2E5L E;  1Z5A A;  1J5E I;  3B8H A;  2ZIT A;  4P52 A;  4LF9 I;  4X65 E;  4X66 I;  4LFC E;  4DV1 I;  5LL6 R;  1KVK A;  4JV5 E;  4JV5 I;  1Z0T A;  4OX9 I;  4GKK E;  2DEJ A;  1D6T A;  1NZ0 A;  1H72 C;  1IBK I;  4DPU A;  2F4V E;  1H7S A;  3CWV A;  1N33 I;  2A2D A;  3WU6 A;  4KQV A;  1N34 I;  3QT6 A;  3OTO E;  4DV5 E;  2BM1 A;  4DV4 I;  1HNZ I;  2EFG A;  3ZZT A;  4KHP I;  4B3R I;  1N32 I;  4X65 I;  4X66 E;  4DR5 I;  4LF4 I;  2V8P A;  1N32 E;  4B3R E;  4HYM A;  4WUD A;  1N0U A;  2ZM6 I;  4DUY E;  4UTG A;  4B3T I;  4Z7Y A;  1MU5 A;  2AJ4 A;  4DR7 I;  3T1H I;  4B3M I;  4YY3 E;  3T1H E;  4KHP E;  2UU9 E;  1H73 A;  4DU7 A;  2HK2 A;  1N0V C;  2HHH E;  5IWA I;  3K17 A;  3F0N A;  3PYF A;  2VF3 A;  1U2R A;  1ZXN A;  3B82 A;  1OJ4 A;  4JI5 E;  3PYD A;  4HXZ A;  1WUU A;  3J7A M;  2UUB E;  2V2Z A;  5LMN I;  4MYT A;  4FWG A;  4X62 E;  1FJG E;  1KKH A;  1XNR E;  4LF6 E;  1EI1 A;  1KIJ A;  3QT5 A;  1HR0 I;  1FNM A;  3PYG A;  4FN5 A;  1K47 A;  1IBL I;  4LF7 I;  4HY1 A;  4DUY I;  4JI7 I;  4X64 E;  1XNQ E;  4DV0 E;  2VQF I;  4DR7 E;  2UUC E;  5L3J A;  4DR3 I;  1XMO I;  2HK3 A;  1HNZ E;  1ZM3 A;  1J5E E;  4NXM I;  4DV6 I;  3Q1Q A;  2X36 A;  1PIE A;  1I94 E;  2Q2E B;  3J81 C;  1A6F A;  1IBM I;  2LJP A;  2ZM6 E;  2HKJ A;  4RPF A;  4GKJ I;  1FKA E;  4JI0 I;  2R3V A;  3OTO I;  4DV5 I;  4LF5 I;  4DPT A;  1RRE A;  2UXC E;  3V2U C;  4DV0 I;  4DV3 I;  3H4L A;  3M6A A;  4DV2 I;  2V34 A;  4DV6 E;  4NXM E;  1Z5B A;  5FLX C;  4DUZ I;  5LMU E;  5LMU I;  2GS8 A;  4NXN E;  2UXD I;  2X7I A;  3PYE A;  2VQE E;  3J7A G;  4DR4 E;  5IT9 C;  4YHH I;  1ZM9 A;  2HFU A;  3LPS A;  4DV7 E;  2V2Q A;  4DR2 E;  1S4E A;  4LF8 I;  1FWL A;  1NHH A;  3J80 Q;  4DR1 I;  3ZZU A;  4JI6 I;  4JI4 I;  2V2V A;  1FJG I;  1N34 E;  4JI3 I;  1Z59 A;  2J7K A;  1H7U A;  5GMD A;  1B62 A;  4DV2 E;  1N36 I;  1IBL E;  4LF6 I;  4LF8 E;  2UU9 I;  1Z0G A;  4P7A A;  4X64 I;  2UUA E;  4JI6 E;  1IBM E;  2XEX A;  3T1Y E;  5A2Q Q;  4JI1 E;  4HAC A;  1XMO E;  3QT8 A;  1VIS A; 
#chains in the Genus database with same CATH topology
 4ED4 A;  3WU4 A;  4QNK A;  4YY3 I;  4OZE A;  1DAR A;  1IBK E;  4LF4 E;  2NN6 C;  2UXB I;  1VI7 A;  5IWA E;  2BV3 A;  3K1J A;  2PO0 A;  2C38 A;  3ZM7 A;  1HR0 E;  1ZM2 A;  2UXD E;  1ZXM A;  2WP8 A;  4JI8 I;  4AIM A;  5BR8 I;  1HK7 A;  2UUA I;  1N36 E;  3B4T A;  1NHJ A;  2NN6 B;  5BR8 E;  4DUZ E;  2OI2 A;  1HNW E;  2UXC I;  3T1Y I;  2IOQ A;  4GKK I;  2Z5C B;  3JAM Q;  3GON A;  1HNW I;  4NXN I;  4JI0 E;  2C38 B;  4IFD F;  1YH8 A;  4B3S E;  5C0X C;  4WUC A;  4JI3 E;  2DEI A;  3ZKB A;  4UT4 A;  3ZKD A;  3HUL A;  3V5R A;  1XMQ I;  3NZK A;  2UXB E;  1PKP A;  3KRN A;  3L7Z B;  4Z7C A;  1ZM4 A;  1MG7 A;  1Z0B A;  4IFD C;  2HFS A;  5GME A;  4WUB A;  4USM A;  2WW4 A;  4MYU A;  1RR9 A;  4URL A;  4LFB I;  2NN6 F;  2WNR A;  3ZZ0 A;  4DR5 E;  3H1C A;  4OO1 E;  4USK A;  2PNL A;  1BKN A;  1Z0C A;  2E1R A;  2BA0 G;  4YHH E;  4LF7 E;  5LMN E;  1Z5C A;  1UEK A;  1FI4 A;  3JAM C;  2ZBK B;  4JI4 E;  2A2C A;  1XNR I;  2CZ9 A;  4B3M E;  4NBQ A;  4IZJ B;  2GO3 A;  2UUC I;  4GKJ E;  5DNL A;  1OYS A;  4HAC B;  4JI8 E;  3J80 C;  2R42 A;  4LF9 E;  4JYA I;  2UUB I;  2HHH I;  4JYA E;  4M1K A;  3LNU A;  1QZR A;  4K0K E;  4ZVI A;  1EA6 A;  2O1T A;  4K0K I;  3P3C A;  2BA1 G;  3D4J A;  1E3H A;  2PO0 B;  2E5L I;  5EKW A;  4DV7 I;  4DR2 I;  4DPW A;  1I94 I;  3QT7 A;  4LFA I;  4MU0 A;  2GQ0 A;  3P06 A;  5FLX Q;  1H74 A;  1HNX I;  4DR6 I;  5K36 F;  4LFA E;  2NN6 A;  1UDO A;  3P3G A;  4FW9 A;  2NPF A;  2F4V I;  2JEA A;  1N33 E;  4I3H A;  4LPF A;  3PRY A;  4DPX A;  4DPY A;  4R1F A;  4OX9 E;  4JI2 I;  4AQY E;  4OO1 C;  4DR4 I;  1NHI A;  4JI7 E;  1Z0E A;  3L7Z A;  1Z0V A;  1UDN A;  1FWK A;  5IT9 Q;  3LTO A;  3M7N D;  1S16 A;  2BM0 A;  1KTV A;  4X62 I;  4DV1 E;  3B78 A;  4LCG A;  4DV3 E;  1Z0W A;  2BR2 B;  1MX0 A;  1R6L A;  4IFD E;  4LCF A;  4DU8 A;  4J3D A;  4JG4 A;  4AQY I;  1E3P A;  3M85 G;  4IS9 A;  1XMQ E;  5C0X F;  3J81 Q;  4LFC I;  5A2Q C;  3P76 A;  4DR1 E;  4PRX A;  4FW5 A;  4PRV A;  2VQF E;  4B3T E;  2BR2 A;  4B3S I;  1PVG A;  4JI1 I;  1XNQ I;  3P3E A;  3M85 D;  4DV4 E;  1B63 A;  2PO1 B;  3WU3 A;  2VQE I;  4FWD A;  1USU A;  4PU9 A;  4DXL A;  1HNX E;  4JI2 E;  4DR6 E;  3WU5 A;  4JI5 I;  4EMD A;  1XHK A;  4XTJ A;  3CDI A;  4OO1 D;  4QNJ A;  1ELO A;  4FWH A;  1OYP A;  4LFB E;  2Z5B A;  1P42 A;  2HKE A;  1USV A;  1UDQ A;  5K36 B;  4LF5 E;  4OKG A;  1Y6Z A;  2PO1 A;  2E5L E;  1Z5A A;  2CG9 A;  1J5E I;  2JE6 A;  3B8H A;  2ZIT A;  1XMO E;  4P52 A;  4LF9 I;  4X65 E;  4X66 I;  4LFC E;  4DV1 I;  2JEA B;  5LL6 R;  1KVK A;  4JV5 E;  4JV5 I;  1Z0T A;  4OX9 I;  4GKK E;  3GME A;  2DEJ A;  1D6T A;  1NZ0 A;  1H72 C;  1IBK I;  3HKM A;  4DPU A;  2BA1 D;  5K36 E;  2F4V E;  1H7S A;  3CWV A;  2F1D A;  1N33 I;  2A2D A;  3WU6 A;  4KQV A;  1R6M A;  3DD6 A;  1N34 I;  3QT6 A;  5JEA D;  3OTO E;  4DV5 E;  4MDT A;  2BM1 A;  4DV4 I;  5JEA C;  1HNZ I;  5DRO A;  2EFG A;  3ZZT A;  2IOP A;  4LCH A;  4KHP I;  4B3R I;  1N32 I;  4BA1 A;  4X65 I;  4X66 E;  4DR5 I;  2VES A;  4LF4 I;  2V8P A;  4IFD A;  5DRQ A;  1N32 E;  4B3R E;  4HYM A;  1Y5Y A;  2JT2 A;  1YHC A;  4WUD A;  1N0U A;  2ZM6 I;  4DUY E;  4UTG A;  3U1Y A;  4BA2 B;  4B3T I;  4Z7Y A;  3Q6M A;  1MU5 A;  2AJ4 A;  5FWK A;  2BA0 D;  4DR7 I;  3T1H I;  4B3M I;  4OO1 A;  4YY3 E;  3T1H E;  4KHP E;  4BA1 B;  4IFD D;  2UU9 E;  1H73 A;  4IFD B;  4U3D A;  5C0X E;  4DU7 A;  2HK2 A;  1N0V C;  2HHH E;  5IWA I;  3K17 A;  2Z5B B;  5JEA A;  3F0N A;  3PS2 A;  3PYF A;  5K36 A;  3UHM A;  2VF3 A;  3PS1 A;  1U2R A;  1ZXN A;  3B82 A;  1OJ4 A;  4FW7 A;  4JI5 E;  2JE6 B;  4MU4 A;  3PYD A;  4HXZ A;  2IER A;  1WUU A;  3J7A M;  2UUB E;  4FW6 A;  1XXE A;  4AM3 A;  2V2Z A;  5LMN I;  4MYT A;  4FWG A;  4IZK A;  5JEA B;  4X62 E;  3Q6N A;  1FJG E;  2PNM A;  5DRP A;  4U3B A;  1KKH A;  1XNR E;  4LF6 E;  1EI1 A;  1KIJ A;  3QT5 A;  1HR0 I;  1FNM A;  3PYG A;  4FN5 A;  1K47 A;  1IBL I;  4LF7 I;  4HY1 A;  4DUY I;  4JI7 I;  5JEA E;  4X64 E;  1XNQ E;  4AID A;  5C0X D;  4DV0 E;  2JEB B;  2VQF I;  4DR7 E;  4FW3 A;  4MQY A;  2UUC E;  5L3J A;  4DR3 I;  1XMO I;  2HK3 A;  3M7N G;  1HNZ E;  1ZM3 A;  1J5E E;  5K36 C;  4DV6 I;  4NXM I;  3Q1Q A;  2X36 A;  1PIE A;  5ELW A;  2Z5E A;  1I94 E;  2Q2E B;  3J81 C;  3GCM A;  3U1K A;  2NN6 D;  1A6F A;  1IBM I;  2LJP A;  3CDJ A;  2ZM6 E;  2HKJ A;  4BA2 A;  4RPF A;  5K36 D;  4GKJ I;  1FKA E;  2JEB A;  4JI0 I;  1Y4S A;  5C0X B;  2R3V A;  3OTO I;  4DV5 I;  4LF5 I;  4OO1 B;  2O1W A;  4DPT A;  1Y4U A;  1RRE A;  2UXC E;  3HJC A;  3V2U C;  3PS3 A;  4DV0 I;  4DV3 I;  3H4L A;  5DNX A;  1RHY A;  3M6A A;  3K85 A;  4DV2 I;  2C39 A;  2V34 A;  2WP8 B;  5EL9 A;  2J65 A;  4GQU A;  4DV6 E;  4NXM E;  1Z5B A;  5FLX C;  2GO4 A;  4DUZ I;  5LMU E;  2C37 B;  5LMU I;  2GS8 A;  2Z5C A;  4IZK B;  4NXN E;  2UXD I;  4ISA A;  2X7I A;  3PYE A;  2NN6 E;  2VQE E;  3J7A G;  4DR4 E;  4FW4 A;  2C39 B;  1OYR A;  5IT9 C;  4OO1 F;  4YHH I;  1ZM9 A;  2HFU A;  2PNZ A;  3LPS A;  2PO2 A;  4MU1 A;  4DV7 E;  2V2Q A;  4DR2 E;  1S4E A;  4LF8 I;  1FWL A;  1NHH A;  2C37 A;  4LOM A;  3J80 Q;  4DR1 I;  3ZZU A;  4JI6 I;  4N3O A;  4JI4 I;  2V2V A;  1FJG I;  1N34 E;  4JI3 I;  1Z59 A;  2J7K A;  2WNR B;  2O1U A;  1H7U A;  4IZJ D;  5GMD A;  2CGE A;  1B62 A;  2IES A;  4DV2 E;  1N36 I;  1IBL E;  4LF6 I;  2PNZ B;  2PO2 B;  4MU3 A;  4LF8 E;  2UU9 I;  1Z0G A;  4P7A A;  1Y60 A;  4X64 I;  2UUA E;  4JI6 E;  5JEA F;  1IBM E;  2XEX A;  2O1V A;  3T1Y E;  1UDS A;  2CVE A;  4IZJ A;  5A2Q Q;  5C0X A;  2AE8 A;  4JI1 E;  4HAC A;  5DRR A;  4DR3 E;  3GLL A;  3QT8 A;  2O3Z A;  1VIS A; 
#chains in the Genus database with same CATH homology
 4ED4 A;  3WU4 A;  4YY3 I;  4LF4 E;  1DAR A;  1IBK E;  2UXB I;  5IWA E;  2BV3 A;  3K1J A;  3ZM7 A;  1HR0 E;  1ZM2 A;  2UXD E;  1ZXM A;  4JI8 I;  5BR8 I;  1HK7 A;  2UUA I;  1N36 E;  1NHJ A;  5BR8 E;  4DUZ E;  2OI2 A;  1HNW E;  2UXC I;  3T1Y I;  2IOQ A;  4GKK I;  2Z5C B;  3JAM Q;  3GON A;  1HNW I;  4NXN I;  4JI0 E;  4B3S E;  4WUC A;  4JI3 E;  2DEI A;  3ZKB A;  4UT4 A;  3ZKD A;  3HUL A;  3V5R A;  1XMQ I;  2UXB E;  1PKP A;  4Z7C A;  1ZM4 A;  1MG7 A;  1Z0B A;  2HFS A;  5GME A;  4WUB A;  4USM A;  2WW4 A;  4MYU A;  1RR9 A;  4URL A;  4LFB I;  3ZZ0 A;  4DR5 E;  4USK A;  2PNL A;  1BKN A;  1Z0C A;  2E1R A;  4YHH E;  4LF7 E;  5LMN E;  1Z5C A;  1UEK A;  1FI4 A;  3JAM C;  2ZBK B;  4JI4 E;  2A2C A;  1XNR I;  2CZ9 A;  4B3M E;  4IZJ B;  2UUC I;  4GKJ E;  4HAC B;  4JI8 E;  3J80 C;  2R42 A;  4LF9 E;  4JYA I;  2UUB I;  2HHH I;  4JYA E;  4M1K A;  3LNU A;  1QZR A;  4K0K E;  4ZVI A;  1EA6 A;  2O1T A;  4K0K I;  3D4J A;  2E5L I;  4DV7 I;  4DR2 I;  4DPW A;  1I94 I;  3QT7 A;  4LFA I;  2GQ0 A;  3P06 A;  5FLX Q;  1H74 A;  1HNX I;  4DR6 I;  4LFA E;  4FW9 A;  2NPF A;  2F4V I;  1N33 E;  4I3H A;  3PRY A;  4DPX A;  4DPY A;  4R1F A;  4OX9 E;  4JI2 I;  4AQY E;  4DR4 I;  1NHI A;  4JI7 E;  1Z0E A;  1Z0V A;  1FWK A;  5IT9 Q;  3LTO A;  1S16 A;  2BM0 A;  1KTV A;  4X62 I;  4DV1 E;  3B78 A;  4DR3 E;  4DV3 E;  1Z0W A;  1MX0 A;  4DU8 A;  4JG4 A;  4AQY I;  1XMQ E;  3J81 Q;  4LFC I;  5A2Q C;  4DR1 E;  4PRX A;  4PRV A;  2VQF E;  4B3T E;  4B3S I;  1PVG A;  4JI1 I;  1XNQ I;  4DV4 E;  1B63 A;  3WU3 A;  2VQE I;  4FWD A;  1USU A;  4PU9 A;  4DXL A;  1HNX E;  4JI2 E;  4DR6 E;  3WU5 A;  4JI5 I;  4EMD A;  1XHK A;  4XTJ A;  1ELO A;  4FWH A;  4LFB E;  2Z5B A;  2HKE A;  1USV A;  4LF5 E;  1Y6Z A;  2E5L E;  1Z5A A;  1J5E I;  2CG9 A;  3B8H A;  2ZIT A;  4P52 A;  4LF9 I;  4X65 E;  4X66 I;  4LFC E;  4DV1 I;  5LL6 R;  1KVK A;  4JV5 E;  4JV5 I;  1Z0T A;  4OX9 I;  4GKK E;  2DEJ A;  1D6T A;  1NZ0 A;  1H72 C;  1IBK I;  4DPU A;  2F4V E;  1H7S A;  3CWV A;  1N33 I;  2A2D A;  3WU6 A;  4KQV A;  1N34 I;  3QT6 A;  3OTO E;  4DV5 E;  2BM1 A;  4DV4 I;  1HNZ I;  2EFG A;  3ZZT A;  2IOP A;  4KHP I;  4B3R I;  1N32 I;  4X65 I;  4X66 E;  4DR5 I;  4LF4 I;  2V8P A;  1N32 E;  4B3R E;  4HYM A;  4WUD A;  1N0U A;  2ZM6 I;  4DUY E;  4UTG A;  4B3T I;  4Z7Y A;  3Q6M A;  1MU5 A;  2AJ4 A;  5FWK A;  4DR7 I;  3T1H I;  4B3M I;  4YY3 E;  3T1H E;  4KHP E;  2UU9 E;  1H73 A;  4DU7 A;  2HK2 A;  1N0V C;  2HHH E;  5IWA I;  3K17 A;  2Z5B B;  3F0N A;  3PYF A;  2VF3 A;  1U2R A;  1ZXN A;  3B82 A;  1OJ4 A;  4JI5 E;  3PYD A;  4HXZ A;  1WUU A;  3J7A M;  2UUB E;  2V2Z A;  5LMN I;  4MYT A;  4FWG A;  4IZK A;  4X62 E;  3Q6N A;  1FJG E;  2PNM A;  1KKH A;  1XNR E;  4LF6 E;  1EI1 A;  1KIJ A;  3QT5 A;  1HR0 I;  1FNM A;  3PYG A;  4FN5 A;  1K47 A;  1IBL I;  4LF7 I;  4HY1 A;  4DUY I;  4JI7 I;  4X64 E;  1XNQ E;  4DV0 E;  2VQF I;  4DR7 E;  2UUC E;  5L3J A;  4DR3 I;  1XMO I;  2HK3 A;  1HNZ E;  1ZM3 A;  1J5E E;  4DV6 I;  4NXM I;  3Q1Q A;  2X36 A;  1PIE A;  1I94 E;  2Z5E A;  2Q2E B;  3J81 C;  1A6F A;  1IBM I;  2LJP A;  2ZM6 E;  2HKJ A;  4RPF A;  4GKJ I;  1FKA E;  4JI0 I;  1Y4S A;  2R3V A;  3OTO I;  4DV5 I;  4LF5 I;  2O1W A;  4DPT A;  1Y4U A;  1RRE A;  2UXC E;  3HJC A;  3V2U C;  4DV0 I;  4DV3 I;  3H4L A;  3M6A A;  3K85 A;  4DV2 I;  2V34 A;  4DV6 E;  4NXM E;  1Z5B A;  5FLX C;  4DUZ I;  5LMU E;  5LMU I;  2GS8 A;  2Z5C A;  4IZK B;  4NXN E;  2UXD I;  2X7I A;  3PYE A;  2VQE E;  3J7A G;  4DR4 E;  5IT9 C;  4YHH I;  1ZM9 A;  2HFU A;  3LPS A;  4DV7 E;  2V2Q A;  4DR2 E;  1S4E A;  4LF8 I;  1FWL A;  1NHH A;  3J80 Q;  4DR1 I;  3ZZU A;  4JI6 I;  4N3O A;  4JI4 I;  2V2V A;  1FJG I;  1N34 E;  4JI3 I;  1Z59 A;  2J7K A;  2O1U A;  1H7U A;  4IZJ D;  5GMD A;  2CGE A;  1B62 A;  4DV2 E;  1N36 I;  1IBL E;  4LF6 I;  4LF8 E;  2UU9 I;  1Z0G A;  4P7A A;  4X64 I;  2UUA E;  4JI6 E;  1IBM E;  2XEX A;  2O1V A;  3T1Y E;  4IZJ A;  5A2Q Q;  4JI1 E;  4HAC A;  1XMO E;  3QT8 A;  1VIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...