3F0NA

Mus musculus mevalonate pyrophosphate decarboxylase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
401
structure length
387
Chain Sequence
RENLYFDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNGREEDVGQPRLQACLREIRRLARKDTLPLSLSYKVHVASVNNFPTAAGLASSAAGYACLAYTLAQVYGVEGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWHWPQLRILILVVSADKQTGSTVGMQTSVETSTLLKFRAESVVPERMKEMTRCIQEQDFQGFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHHGQTKVAYTFDAGPNAVIFTLEDTVAEFVAAVRHSFPPAANKFLKGLQVAPVLLSDELKAALVVEPSPGGVQYIIATQVGPGPQVLDDTHDHLLGQDGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEVALONATE PYROPHOSPHATE DECARBOXYLASE
publication title Structure of Mus Musculus Mevalonate Pyrophosphate Decarboxylase
rcsb
source organism Mus musculus
molecule tags Lyase
total genus 127
structure length 387
sequence length 401
chains with identical sequence B
ec nomenclature ec 4.1.1.33: Diphosphomevalonate decarboxylase.
pdb deposition date 2008-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF18376 MDD_C Mevalonate 5-diphosphate decarboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3f0nA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3f0nA01
3GONA 2ZBKB 4DV4E 1N32I 1MG7A 4AQYE 3WU4A 4GKKE 2OI2A 4JI2E 4DUZE 4B3ME 2V2ZA 3J80C 3PYEA 1PVGA 5LMUI 4JI8E 1N34E 2A2CA 4DUYI 4X62I 2UXCE 3QT8A 4B3RE 1HR0I 1XNRI 2F4VE 1IBME 2BM1A 1EA6A 3HULA 1N0UA 4DV5I 4JI0E 1H72C 4MYUA 4KHPI 1RR9A 3WU5A 1HNXE 4JI6E 4DV2I 2UXDI 4YHHI 4JI4I 3OTOI 1PKPA 4LF5E 2AJ4A 4X66I 3LTOA 4GKJI 1XNQI 4X65E 3PYDA 2UUCI 1J5EI 3J81C 1NHHA 2WW4A 4YY3E 3QT7A 2X36A 5BR8E 4JI1E 4DV1I 3B78A 1NHIA 3CWVA 2UUAE 4FW9A 1XMOE 4HACB 2HK3A 2ZM6E 2X7IA 1KVKA 3PYGA 4DR7E 1H7SA 2VQFI 1FNMA 4B3TE 4LFBI 4DPYA 1IBKE 4Z7YA 2E5LE 1ZM4A 1DARA 1EI1A 1N32E 1KKHA 2GS8A 1MX0A 1Z5BA 3F0NA 3K1JA 1OJ4A 4PU9A 1N33E 3ZZUA 4LFCI 1XMQI 1Z0CA 4DUYE 2UU9I 4DR1I 4X62E 4DU7A 5A2QQ 3WU6A 1HR0E 4DV0I 1XNRE 3WU3A 4NXMI 5FLXQ 1HNZI 1Z0WA 2VF3A 2VQEI 4LF8I 4DV5E 4DR6I 4KHPE 1FWKA 4KQVA 2UXDE 4YHHE 4JI4E 3OTOE 4DR2I 4OX9E 3H4LA 1IBLI 1VISA 4X64I 4URLA 4K0KI 2E1RA 2HKEA 4X66E 1A6FA 1B62A 1ZM2A 4ED4A 2Q2EB 4GKJE 4B3SI 1XNQE 2R3VA 3K17A 4LF7I 2UUCE 1RREA 1ELOA 1XHKA 1J5EE 1ZM9A 4DV1E 4I3HA 1UEKA 4DV3I 1BKNA 5IT9C 4PRXA 4JYAI 4LFAI 3ZZ0A 2VQFE 4JI7I 4JI3I 4LFBE 1Z59A 4DV6I 3M6AA 3JAMC 3T1HI 4MYTA 4DR4E 2EFGA 4UTGA 4XTJA 4JI5E 5LMNE 4LFCE 4DUZI 1Z0BA 3QT5A 4DPUA 2DEJA 2V2QA 1XMQE 1HNWI 2UU9E 4P7AA 4DR1E 4JG4A 1Z5CA 1Z0VA 1HNZE 2R42A 4LF8E 4JI0I 4DR6E 3T1YI 2HFUA 3J80Q 1U2RA 1FJGI 4WUDA 4WUBA 4DV7I 4DR2E 4DR5I 4NXNI 4EMDA 1IBLE 4HYMA 2NPFA 4X64E 4K0KE 5LMUE 3ZKBA 1KTVA 1FKAE 3QT6A 1S16A 4B3SE 3B8HA 2A2DA 3ZKDA 1H73A 1ZXMA 2UXBI 4LF7E 2XEXA 2V2VA 4R1FA 3LPSA 4M1KA 3J7AG 4LF6I 4DU8A 1KIJA 4FWDA 4UT4A 2HHHI 4DV2E 4DV3E 3J7AM 3ZM7A 4JYAE 5IWAI 4LFAE 4JI7E 4JI3E 1D6TA 3J81Q 3ZZTA 4LF4I 4JV5I 4DR3I 4DV6E 4LF9I 1FWLA 3T1HE 2BV3A 4FWHA 4Z7CA 1N33I 1HNWE 1NZ0A 1N0VC 1N36I 1PIEA 2J7KA 3LNUA 2HK2A 1ZM3A 4USKA 2CZ9A 1ZXNA 1I94I 1FI4A 3T1YE 4HACA 3D4JA 5A2QC 4HXZA 3V5RA 2UUBI 1FJGE 4DV4I 1WUUA 1K47A 4DV7E 4AQYI 5FLXC 4DR5E 4OX9I 4NXNE 4GKKI 4ZVIA 4JI2I 4DPTA 4B3MI 1N34I 4JI8I 3B82A 2UXCI 4B3RI 4DV0E 4NXME 1H7UA 2F4VI 2UXBE 1IBMI 5LL6R 2VQEE 4LF6E 1B63A 4DPXA 3PYFA 2HFSA 2HHHE 4USMA 1HNXI 4JI6I 5GMEA 1H74A 4FN5A 1MU5A 5IWAE 2BM0A 3V2UC 1Z5AA 4LF5I 4LF4E 4JV5E 4RPFA 4DR3E 4HY1A 4LF9E 1Z0TA 4X65I 5L3JA 4DR4I 1Z0EA 3Q1QA 5IT9Q 4JI5I 2V8PA 5LMNI 4YY3I 4P52A 2DEIA 5BR8I 1QZRA 4JI1I 4DXLA 1N36E 2UUAI 3JAMQ 1XMOI 2ZM6I 4DPWA 1NHJA 2ZITA 2HKJA 4DR7I 1S4EA 2LJPA 4WUCA 4FWGA 5GMDA 4PRVA 2V34A 4B3TI 1Z0GA 1I94E 1IBKI 2E5LI 2UUBE
chains in the Genus database with same CATH superfamily
3VTIA 1Q5VA 2RSQA 2J9DE 3A13A 4GRSA 2CPYA 1KFDA 1HIYA 5D0RA 3U02A 3MUTP 5ETVA 2NSBA 1U0SA 1JKHA 1TKTA 1EHWA 3DLGA 1FXLA 3TJ9A 3L09A 3KJFB 2MJNA 1Y4SA 3CF5Q 2JEAB 3OTOI 3TZXA 4LF2A 4KO0B 2GA7A 2UUBJ 3CNQP 2AJ4A 1JLGB 1X9SA 1ZTTA 5DDPC 4GKKJ 1Y11A 3G8TA 1FKPB 4NBQA 2HVIA 2FC8A 4AUKA 4LT6A 4Y00A 1N34J 2EWHA 3BF4A 2A0FB 3PS1A 1T9YA 3I0SB 2XI3A 4MK7A 2RDDA 4C7QA 3CC4S 1SB6A 4HLBA 2CZ4A 3ONQA 3RBDA 1D9DA 1U1KA 3OTEA 3CPWR 5FIIA 3BBCA 2PO2B 1R6YA 4N5SA 3KK3A 4DR7E 3OFEA 4JI6J 1SIZA 2EXUA 4NA2A 1EZZB 5DROA 2VPWB 2YH1A 3GFXA 3LP1B 3IGVA 4R0JA 2JT2A 1F6TA 2UU9I 4DU7A 3JYTA 4WU3A 2VJVA 4FVCA 3KUEA 2YY3A 1U1QA 1ZBTA 2WB4A 5D4OA 2J9DA 2J76E 1RWOB 4PG6A 2WONB 2FJEB 3DDNA 4QJVA 1Q1KA 1F1BB 4MIWA 3SI8A 3AD7C 2XSJA 4KJIA 4IO1A 2PO4A 3ZFVA 3FCWA 3M8PA 1QAIA 1ZM2A 1IWGA 2R2UA 1XNQE 1TL5A 4RL1A 1C4AA 2Q6CA 4I6YA 5IV4A 1S6QA 3OJUA 4BA1B 3CJ0A 4K5RA 4CO1A 3LP0B 1VQOS 4C9DA 2HNDA 1BKNA 4YHHJ 2FDNA 2LXUA 2HHTA 1RI7A 4PG4A 2MGZA 3JAMC 3MWBA 2AEMA 2AF6A 4OMFG 5BYQA 5IM0A 5BR8F 2FTRA 2RQKA 4DR1E 1XMOF 2EFQA 2B7BB 5C42A 1HBOB 1Z0VA 3BB5A 2C3UA 2D3O1 4DS5A 4UZBA 1HQUB 1NAQA 2FJWA 2W4PA 3HT0A 3RYLA 2GHPA 2X3DA 5A0YA 2V4JA 2UV8G 1W2BR 1D1UA 4HYMA 1RTJA 2K3IA 2QL7B 2V6AA 4CLLA 3DDKA 1ZAWA 4I7FA 1KVJA 1WEZA 4B02A 5DDRC 1XNRF 4RW7B 1KBRA 1X5SA 3AT1B 4B08A 1U1RA 3IC1A 3OHBA 3FVYA 5LSLA 2H3EB 3TUJC 5IT0A 5D4PA 4WFXA 3NCRA 2K1RB 4K59A 5EGYA 5KTQA 2ZJQQ 2V9WA 3GIRA 1JLFA 1HW8A 3NGTA 1QAYA 3BN4A 4CO5A 3TEGA 1CQMA 3T1HE 3KK2A 3L95X 5D3GB 1S10A 4I6AA 4OHYA 2HLTA 2HGNA 5ETTA 1FK9B 2OPSB 3B4DA 3CCZA 3M32A 1VJWA 1ZA1B 2ZKUA 1ZXNA 1JIHA 1OY9A 1HFEL 3D4JA 4OFZA 1YRTA 4FF1A 5SUHA 5J2QB 5FLXC 2NUUG 3CW2C 3GYNA 1D8ZA 3OFGA 5K5MA 3PIOQ 1TMMA 1N5VA 3KUGA 4XK8C 2G2YA 4F36A 5D78A 2CJQA 3THPA 1S0OA 4DV0E 3L7OA 4CH1A 1WC4A 4FS2A 3MI7X 3JTPA 3EYZA 2C2KB 2WVBA 2DRDA 4OHZA 5KFTA 4ES1A 2ATLA 2PO1B 3DOLB 4RX6A 1U25A 2F9JA 3K5PA 3CDEA 1GQEA 3DRRB 1SXLA 4IKAA 4LF4E 4TQSA 4DR5J 2QMXA 4DR3E 1TU0B 1SH0A 4F7VA 3DC2A 2KVIA 3MECA 2W01A 4WU2A 4LSNB 2IY5B 4FVMA 5B0GA 3R5GA 1RACB 2PMWA 4P52A 1S9GB 3HVTB 3A1YG 3IBWA 1CC7A 1VBZA 1RHMB 2WSCC 4DR7I 1LWCA 1TKDA 4K50A 1JXVA 1OYDA 4DL4A 2FB0A 2LEBA 1NKCA 2NN6B 4AQYE 2DTJA 3MM5A 3D0IE 3BEGB 1FJ7A 4B9SA 4ELUA 1UFKA 2LU2A 4P71A 4A4JA 5C0XA 1XR6A 3G8SA 3KOAA 5CD4A 3TRGA 4TYAA 2BM1A 2LEPA 4DCPB 3TO8A 1BQNA 2BQ3A 2RNEA 4MKVA 3QGGA 2BX6A 3WHIA 4ZDNA 4FKXA 3GMGA 5KFKA 4QYZJ 3DGPA 3I31A 4IFDE 4YR3A 1R0CB 4CI0B 3I4HX 2Z5BB 1PKPA 3PKYA 4UZCA 4CT9A 3ETOA 3LTOA 3NY0A 2EBGA 1XNQI 1KNZA 3A8JA 5LSRA 4B3MJ 3QYYA 1WORA 5KT3A 4NLUA 3KJVA 3QT7A 3QSIA 1T03B 3MM8B 5KFZA 4JI0J 2HK3A 2ZM6E 4YQWA 3PYGA 2DNHA 3CJQA 1DTTB 4F3QA 4FW6A 2DVIA 3AODA 3AD9C 1IBCB 2L48A 2BJ3A 4AD6A 4NZ7A 2MXYA 2RQ4A 1HNIB 3R97A 1N33F 3T19A 5I3QA 2ROGA 5J2NB 1LKZA 5CCLA 1N36F 1RT4B 2RU9A 5CXTA 4DR1I 4WTYA 3RW7A 2YKAA 4N7TA 4HL9A 3FEXB 2X1BA 2XC9A 4AFFA 2NR0A 3PJ9A 2V8DA 1CVJA 3CCQS 3R2DJ 2OJ3A 4OYXA 2C38B 1B3TA 1D09B 1SI9A 1IBKJ 4KR0B 4OJ3A 3VQSA 1YLXA 2MTLA 3PDNA 4NEZA 4F4WA 4O23A 2C2OB 2R3VA 4IZKB 1RE1B 3TX8A 4M95A 4UY85 3FZBA 3UDVA 2B5JA 2BE9B 3LWMA 1HR0J 2XMTA 3EZUA 1RAHB 1VC0A 3HSGA 1PSDA 3AD8C 5GAEU 6FD1A 3I5AA 3TUIC 4J9VA 2LDYA 5IT9C 1LK7A 2DH8A 1U48A 1UVMA 2ZBCA 4USWA 5K8NA 2IM1A 3T1HI 2G1HA 1F5CA 2MKJA 4JI5E 4G1QA 2NREA 5JEAE 4B3RJ 3NLCA 3W2WB 3OHAA 3QT5A 4AXJA 2AT1B 2UUCJ 5JVGQ 3AXMA 3R5DA 2ADCA 2X1GA 5CH7B 1NJXA 3PW2A 3T41A 1VR6A 4LF8E 1U1OA 1KP6A 4K8RA 2WP8B 2OIHA 1L3VA 1RAEB 4DFPA 3M6VA 3BO3A 2R9LA 2OPRA 1SKUB 3WBZA 4M94A 2DGSA 3UFCX 2XMUA 4EBEA 2MQMA 2OMLA 1RISA 1RU1A 4U6PA 5HO4A 4IG0A 3H2LA 2M88A 3KG4A 1XMQJ 2XEXA 3CJ4A 4F0KA 2KM8C 1VIOA 4DV5F 2W25A 4YDDB 4KY3A 3OR2B 2UXDF 1HNZJ 4DV2E 5KT5A 1PC5A 4JI4F 5KOXA 4IG3B 1S1TB 3ZM7A 4DX5A 2RF2A 4LFAF 2DGVA 2BKOA 2DRBA 3UVJA 5FDLB 2FIUA 4C4WA 4LF4I 1I1GA 1WI6A 4O4GA 2GJIA 4DR3I 3CCUS 3IG1A 2MHNA 3TQ1A 1SIWB 2BRLA 5F0WA 3N4WA 3PJXA 3TYTA 5I3PA 5ITHA 5FLXY 2G2OA 4OHXA 1TL4A 4N8OA 5D15A 2B4OA 2XNQA 2R8GA 2HVHA 1JLCA 2J7KA 1CBKA 2IM2A 1TELA 3GFZA 4KRWA 4U67Q 4HHHA 2HQDA 4OZ3A 2PO0B 1RTHB 5F3TA 4AQYI 1NEEA 2FGOA 3GIMA 3D28A 1S1WB 3EVMA 3BGFA 3K0JA 3ILLA 1WKLA 3KUHA 1ZS6A 4OJGA 3MEEA 3G2XA 3T6JA 4NCBA 5DLFA 1NB7A 1R6LA 2L41A 4QYZK 1EB0A 5IWAE 3OR1B 2WSEC 1QVGR 3CULA 4RPFA 4DL0C 5F3ZA 2CQBA 2PNZA 3MCOA 4HY1A 3ILJA 3U1KA 4LF9E 2CUYA 2M0GB 4OYWA 5DRKA 3ZXWA 1M5VC 2DR6A 4LRFA 4XPEA 1Q4RA 3NP5A 1UVNA 2KL8A 4K2JA 1V6HA 2VQEJ 2E5HA 1SC1B 4F67A 3JAMQ 5HJXA 1C0TB 2G0CA 2ZM6I 5ETSA 1W7WA 1RWMB 1TV6B 1SKWA 2L3MA 4PR6A 3AHPA 3NNAA 2MLXA 1WG4A 4ER8A 5KFQA 4K0KJ 2LQJA 5KFUA 3WU4A 4CNYA 3THVA 3Q8VA 4C11A 2VD3A 2AHOB 3RBXA 1JXLA 4B3RE 1UWBB 2R4FA 2QSFA 4I2QB 3POTA 3ELHA 4L6V3 4IYQA 2OEKA 3NGDA 4EFAC 3M8SA 4H54A 2GZOA 4N8NA 1RHUB 3IRXB 3HXMA 1B0VA 1U8WA 1T94A 1DTTA 1VDHA 3D3BJ 1PAUB 3UCUP 5FWKA 3UCGA 1V9OA 3QFHA 2MKYA 4LVNP 1HNIA 1HPZB 4AIMA 4NI2A 3M9NB 3PW7A 3MEGB 5F8HA 4NLGA 2JZ5A 1GXUA 1Q82T 3MCSA 4JP8A 2JJ4D 2W7PA 5HMXA 4PQAA 2KT5A 3BGOP 2PNMA 2X7IA 2LLZA 2BE7D 3NAHA 2YKNA 3ADAC 4JV5F 1X5PA 4KV8B 4AXIA 4XO0A 2Z30B 2UZAA 3HHDA 4BA2B 3ZZUA 2BANA 1TTHB 3A4TA 1K44A 4MJKA 1F0XA 2P9CA 4IFVB 2Y3YA 4KGVB 5FLXQ 1MMNA 3M8QB 4LF8I 2NN6F 1UFWA 1WHYA 5I4MA 3NEKA 4DV4F 1MROB 4OX9E 3VVTA 2LU1A 3LGNA 1TVRA 1OWXA 4URLA 1N32J 3IGNA 5EKWA 5IT9Y 2J0QD 3NGKA 3W2WA 4M5JA 1KQSR 1YITS 2PT0A 2H48B 2LMIA 1ZM9A 5AXLA 5KFMA 4BBYA 1HWLA 4A8YA 2BQRA 2P6TA 1PJ6A 3QPIA 4KKOB 4PG7A 1H2VZ 2AW0A 3IO1A 1R8AA 3NCQA 4MU3A 5C25A 2EG1A 4UTGA 5LMNF 2FHJA 3MF5A 2Q1LA 3E51A 4F0MA 1HI1A 3D67A 3QSYB 4AIDA 4OO1E 1HL6A 3D6HB 3JAMU 4JI1F 4CRJA 3SSRA 3KLGA 4LSLB 3MMBB 4DFKA 5E3AA 3MPDA 1U02A 3I87A 4K4UA 2Y1JA 3KMQA 3QO9A 2W7AA 4RO0A 4JI0I 1HWJA 3KLIA 3LP2B 2AWZA 2WBRA 2WVDA 3GQCA 2OEMA 4J9UE 1YG0A 4LFBJ 2VC0A 1LXNA 2A6MA 4K0KE 2ACYA 2RUSA 3FEZA 1FKAE 2BW2A 1FVSA 3M7VA 1S16A 3FBCA 2ZH6A 1JJ2R 1VGYA 3M4XA 2ZH3A 5J2PB 1FESA 5HP1A 4UUWA 4MTPA 1S76D 1K8AT 1NK7A 2YKPA 2JRSA 4K4WA 3OTOF 1B7FA 2MPUA 4IDKB 3OLAA 2A3JA 3CD0A 1HHQA 5IWAI 2I0XA 2GO9A 4P2SA 2ZWPA 4LF9I 1U6BA 4O0NA 3C6UA 4CO0A 3MFHA 1WNEA 4PWUA 1X7VA 2VHGA 2Z2YB 4IUFA 4KBIA 1B0PA 2CJYB 2D9OA 3ZTRA 2JX2A 1R6MA 4F2RA 3GJRB 4PUOA 4OO1A 2KN4A 2GAHC 4A8XA 2BJEA 5KFJA 1P1LA 1ZZNA 3PV8A 1WD6A 5B0EA 3RB4A 2OH2A 3HFVA 4DPTA 4USVA 4U3DA 2WRMA 1KWMA 2NXJA 2VB6A 4B3RI 2OPQA 5E2QA 1IR1A 2JL9A 5LL6R 3PXGa 2N3LA 4OI3A 3CWJA 2ZBRA 4ECZA 1R6VA 2G0IA 4Q43A 3OJSA 3P3EA 1WKKA 4ETZA 2MLZA 4IFYA 3MTJA 3V2UC 1YBTA 1U1MA 5AJ3F 2VDHA 4OYBA 1KONA 2FYXA 3PO5A 5C2CA 4RNNA 5IT9Q 3FBFA 5B0FA 2F8MA 1HBMA 4KGMA 2PDAA 1X0FA 2X1FA 4R8UA 2HLUA 2GMLA 3EE3A 3IM8A 2ZUGA 3G4SS 2V94A 1U2FA 3NRBA 4JB8B 1YTYA 4WFAQ 2CQPA 1CJKA 1FJCA 3CJ8A 3JTOA 5ETPA 2ERRA 5HBMB 4OLOA 4EO8A 5DRRA 3MM9A 1DRZA 4OYAA 3VAJA 3ZZOA 4Q5VA 3VZIA 4OI0A 3Q2SC 2PMZD 1Z2LA 3J80C 3CT9A 1OY8A 1X5TA 4ZA1A 2DNOA 4ECVA 5HI7A 5M2UA 3BSAA 1RAIB 1FRHA 4CTAA 1FTRA 1YZ6A 4JV0A 1Q79A 3C15A 1X9WA 3F44A 1PGZA 4RU2A 1UVLA 2EBEA 3IFEA 2YX1A 1WSRA 2V50A 3IS9B 1DQ8A 4FP9A 2FGCA 3FQKA 3SCLE 1HYSB 3PR4A 4B3OA 1VRUA 4RBTA 3VHQA 2R7XA 4X4SA 4URGA 2IA6A 1Q53A 4K5SA 1MWYA 1Q16B 1RCXB 5F8IA 4MU1A 1WTFA 3MR2A 1NHIA 3DMJA 1P1TA 3CWVA 3IXQA 2BZ2A 1DY3A 2YPYA 1RQ0A 1M1GA 2FY1A 2QGFB 5EWFA 1MROA 2KJWA 3KJNB 4LVOP 2E5LE 1I5OB 4RUBA 1EI1A 1CQNA 1FDDA 3CDIA 1BQMA 3CEDA 1ZA2B 5K14B 4PAAA 2AD9A 2GX8A 2ZKTA 1O0PA 3AJ2A 4EU0A 5B0CA 1S0VA 5BR8J 2N4CA 1M1KT 2VQEI 2MQQA 1XMOJ 2DCLA 5DZ6A 3B4TA 3MPVA 3PRVA 4TY8B 5A8KB 4LRBA 4Y2CA 1HK7A 5J1EB 2NQPA 5CQGA 4ZVGA 2YNFB 4NLVA 2JEGA 3GILA 5L1KA 1SBRA 4K0KI 5ELWA 3CB4A 4X66E 4PG8A 2YQ3A 3IMQJ 4DN9A 1IVZA 2W2MP 2M70A 5AE2A 1XNRJ 4FW5A 2BA0D 3VGVA 3K8VA 3K7RA 2CNOB 3SFUA 2ALZA 2OD6A 3LP2A 4PPDA 4J9RA 5MLCV 1KTQA 4N3OA 3Q8UA 2ROEA 2K7JA 5JXSA 4WYLA 1QSYA 1S1UB 3IBCB 5K36E 2EFGA 1R31A 2Z58B 1U6FA 5JMNA 3M85D 4LFCE 1BC6A 5KFRA 4G1IA 4O0IA 5JEAB 3TAQA 5J2PA 4JG4A 2CPZA 5DETA 1PILA 4A48A 4LRDA 3DI6A 2D1CA 3ZNUA 2B3TB 1DFDA 4WUBA 5IFMA 1WEXA 1RBAA 2J8AA 5HQMA 1EARA 3V6DA 3CCRS 3BGLA 1UZDA 2FC9A 3HK2A 2VFVA 4FWDA 1SKSA 1QY7A 3T5JA 1IQZA 3C14A 1KQKA 2DK2A 2GMJA 3ZTOA 3BBFA 1XNQF 2BV3A 3P3DA 4KE5A 5HK4A 3HKZD 1TL1B 3NWGA 4X4OA 1NZ0A 3DN9A 2PGCA 3ULHA 3EGNA 5I3UB 1IQTA 3KLHA 2EVZA 3FQLA 1YJRA 3LGHA 1HWKA 4QPXA 3K59A 1NB2A 3EM1A 2AEJA 4I64A 4HXZA 4U95A 1PYOB 2VPYB 1FJGE 1J5OA 1AT1B 2RVJA 2EFVA 4G3IA 3NGRA 2DY1A 2RKIB 2E1MC 4DR1F 2F7VA 2HHXA 5JEAD 2HHUA 1W2IA 2AGQA 4NLXA 2YTCA 2Q66A 4DWIA 4EBDA 1TKZB 4Z37A 3AOCA 2RQCA 5J2MA 3CC7S 3HX9A 1BE4A 3RGIA 1DLOA 4KGXB 4W98A 1MW7A 4IOAQ 2JE6A 3QLHA 3FFIA 2CQHA 2VFTA 2EKNA 2H1YA 4C0HA 5GMKa 4RUCA 1AYEA 1LEOA 3BO4A 3DYAA 4DXLA 3R7NB 4Y65A 4Q0BA 4FS1A 2EI5A 2HVZA 2GFFA 3VWSA 1VQKS 2IJFA 2FUG9 4FYDA 2HKJA 2GAGC 2QYGA 1S4EA 1MWQA 5GMDA 1FFGB 2J9CA 1Y00A 1Z0GA 2KFZA 5T7LA 3T9ZA 2E5LI 3T1HF 3GCWP 5KFDA 5T14A 1UJ4A 1M1HA 3FK4A 4JI2E 4M5HA 1KSPA 4OZJA 4IOBA 3LQVA 1T7PA 2DJWA 2CKWA 3UN2A 2F4VE 1YJNS 1Q7YT 4WP9A 2ASJA 2W2PP 4MAKA 1N36J 1S9EA 3KYLA 4NZ0A 4PYDA 4JI6F 1HNXE 3MMAB 5IXUA 5DZ7A 5L46A 4DV6J 3E01B 4RW9B 5A2QU 5EWEA 1NK0A 1GXTA 3GSDA 4X66I 3HP6A 4R25A 2HQ3A 1IWAA 3ET6B 2Y1RI 1JLEB 5K14A 5A6WA 3I96A 3R9LA 4ES2A 4EYIB 4ERDA 1RT7B 5GADU 1TAUA 2LXIA 4RW4B 3LOUA 1XWLA 5C2GA 2B7CB 1NBEB 2WW4A 2B8PA 2WVFA 3BKUA 5BXIA 3CD5A 3BSNA 1N5TA 2VG6B 3JQMA 2EC0A 3NNHA 3VAFA 4U8YA 4X4UA 2QJ3A 2M52A 2VG7B 3FEYB 4LF4F 4DQQA 4DR3F 2RE1A 5J1EA 1RWWB 2PIIA 1JLQB 4IR9A 4GMKA 5JUMA 2EKYA 4LFCI 1LWEB 2O1TA 1PBAA 4LF6J 2QIFA 2CJAA 2HW3A 1Z0WA 3DRPB 3PX6A 2CQ2A 3M30B 4AQYF 2HRUA 5A8WB 2GIFA 3P76A 2O67A 2Q43A 3WZ0A 5E41A 3M85G 3PACA 2VG5A 2KFNA 3CVKA 3P96A 4WYWA 1ICEB 1S1UA 2C22A 1JLBA 4ED4A 4GKJE 2MQNA 1HHSA 1NDLA 3P5TL 3MAQA 1OPIA 4F3OA 2C39B 5F8GA 4C8KA 1S99A 3V4MA 3H40A 3CCVS 1JJ4A 4DV5J 4IFDF 5AE1A 2UXDJ 1X4AA 1IKVB 4DZDA 3NGSA 1AZSB 2XSFA 4JI4J 1USUA 3NCPA 4WE1B 1F2HA 2IJRA 3CDBA 1FKOA 3GIIA 2W9CB 1NHVA 4LBHA 2AYMA 3DRYA 3HHNB 1VMBA 5EL9A 2DXEA 3P5BP 1UJ5A 1A7GE 3PS2A 5B0BA 2AEFA 2DR9A 4A46A 3R2CJ 2RT3A 2DD8S 2ZM6F 1E6YB 2DHGA 3G6ES 2DT9A 3V4IB 2CWKA 3RBEA 3N79A 3J80Q 2LQBA 2XY6A 1RBOB 1FJGI 4ZVEA 4J9PA 4DR2E 2YWGA 5F0UA 1R7IA 2WHOA 2ASDA 2DXDA 4F3MA 3DCAA 2QSWA 3NG8A 1WF0A 5E3CA 3CDUA 3F56A 3MEDA 4LF7E 2QA1A 1FRIA 2I1RA 3FBBA 2RHSB 3U1NA 2HBRB 4XDDA 2KG1A 3FDSA 4ZPTR 1T3OA 5I3UA 3X3UA 4XPCA 4C0BA 5T41A 1EP4B 1N5YB 2C37A 1CJVB 1IR0A 4TYBA 4LIRA 1LWFB 1FTCA 3D68A 4ED3A 3KLFA 4OX6A 4DV6E 2QG9B 1JB0C 2J8SA 2UUTA 1HBNA 4P7VA 1HNWE 4NE9C 4E0DA 3GFHA 2R7SA 4QR2A 2FLLA 4USKA 3I0RA 3T1YE 4TVAB 1HHTP 2JFKA 1FNOA 2B9YA 5JEAF 4NXNE 4JI2I 2DB1A 4MFBB 1BXNA 2EK1A 3H5XA 1RTZA 2RJZA 4HVZA 3B82A 5K8PA 4RW8A 3Q0AA 1GH8A 2F4VI 2IOPA 2YNHA 5A6PA 1DTQB 2BR0A 4LF8F 4LF6E 1F5BA 3MUMP 2CVIA 1Y5NB 1HNXI 7FD1A 3MMCA 4U9RA 4IQMA 3MM7A 1TFYA 3ZZPA 1MU5A 3O8WA 1Z5AA 1GFWB 3KK1B 3Q8SB 1V3RA 1VRTB 3CJKB 2VOPA 3MOZA 4HKQA 5AXKA 2CG8A 2G0JA 2HQFA 1FX4A 1JNZB 4NXMJ 4ELVA 2CJBA 2QEXS 1FO1A 1VHIA 3QIPA 2EEYA 1SPBP 2M3DA 4DPWA 2QMUB 2GJ2A 4A47A 2R7UA 1LV5A 1TUGB 5D4LA 4WIQA 1TL7A 1QUVA 1YJ9S 3HKWA 4GC6A 4JV5J 1MG7A 1SVDA 3VGSA 4OZEA 5LOQA 1PVGA 3AB2B 2XHWA 2COLA 3CJSA 2C2EA 4ZVFA 2ZC3A 4C3LA 3J80U 2C3PA 1EJ7L 1EA6A 3TJ8A 4JI0F 3M9OB 1IKWA 2XCAA 1IN0A 3SYZA 5BYSA 4P6QA 4RLEA 3BSCA 3R5CA 3VF0B 2KG0A 1A6LA 3E2EA 2SXLA 4H4OA 4DV4J 3LW5C 4ILMA 4GO7X 1TUVA 4GKJI 4DUZJ 1HI0P 2AYEA 3TANA 4JI8J 3DLHA 2W8KA 3OT9A 2UXCJ 1FCAA 2BE2B 3M2UB 3P6YC 3FKBA 2UUAE 4HACB 1RP5A 2X1AA 5IWAF 4DF8A 2AIRB 3H5UA 3AQPA 1PYSB 4ZCIA 4LF9F 2IMOA 4HEA9 4P74A 4ZVOB 4C8ZA 3CJRA 2J7WA 1NZAA 1HKAA 2CZVC 1OJ4A 3T5HA 2V4RA 1RTIB 2OFHX 1KLNA 2MKHA 3N6LA 2YNIA 2V2KA 4W4MA 1FRJA 1YHQS 4CQ1A 2Y8WA 1K1SA 4JI1J 2LCWA 2ILZA 2VF3A 2YKMA 1SL2A 3A8IA 1TK8A 4LBPA 1KQFB 1MNEA 3D0GE 3ITHB 4O3SA 4DR2I 4WFZA 1VISA 2AKWB 5CZXA 2J9EA 5KG7A 2J6SA 4PWDB 5GAHI 4FBUA 3FMBA 3U27A 4B3RF 1VQPS 1Q5YA 1JMTA 1R8BA 4LF7I 4YP3A 2AMCB 4Q8FA 2YWWA 5I42B 3W2VB 2GIQA 3EX7B 4XIUA 4Z2XA 4ECUA 4Y0FA 3EVOA 3MMJA 5A8RA 1REVB 1YKWA 3OTOJ 3DLEB 4DV6I 3M6AA 4JV2A 2Z57B 3F73A 2G1DA 2UVVA 2V63A 4YB7A 2KKHA 5KFBA 1FE0A 3SEOA 5K36B 1HNWI 2BUNA 4ZVRB 2F9DA 4ED0A 4QU7A 2YWKA 4L75A 2BJDA 2Z5CA 2N7YA 5KFVA 3T1YI 1EP4A 4J9NA 2Z2ZA 4ATNA 4BCAA 5AE3A 5G0RA 4NXNI 1VI7A 4RNOA 1QTMA 1R27B 4ED2A 1S1VB 4DF4A 3M2VB 1XK8A 2CQDA 2MKKA 4DR4J 4DI6A 1RADB 8AT1B 3B8HA 3PS3A 4MKYA 2UU9J 2NS1B 1FVQA 4LF6I 1O8BA 1KIJA 4J9MA 5CAAA 3MGJA 1AUSL 4QYRA 1RA6A 4JI7E 4JI3E 2RUGA 3ZZTA 3H8YA 1HW9A 4DOZA 1HARA 2C2NA 2PE8A 2R7QA 4KPCA 1LW2A 4I2PB 1RAGB 4ZHRA 1AA1B 2QT7A 1QJHA 5LMUJ 3KJQB 4FWHA 3OTCA 3QZ7A 3IWLA 2LA6A 2V5HG 2HHVA 2GVDB 2WB1D 1X4CA 2Z5EA 4U7CA 2QO3A 2GW8A 2ZZMA 1NSKL 3U1YA 2I5JA 2RDIA 1NH8A 3LNUA 4X4VA 1ULRA 2B6AB 4ZLNA 3IP0A 1WC1A 4F02A 1FRXA 4R5PA 3P3GA 2LP4A 4C8YA 2MSTA 2QA4S 3KHRA 2ZVIA 1NXIA 1KRPA 2JC0A 2V67A 4HTJA 3KHLA 3MEKA 1E6VB 3UO0A 4WFBQ 1SUQB 1Y5LB 2VKZG 2VQEF 4ID5A 4BWMA 1SC3B 2E44A 3M7NG 3JSMB 1RT1A 4ECYA 2E9TA 1OYRA 4DL5A 4WP3A 2A10A 3I56S 1ZOTA 1HWUA 3I4PA 4K0KF 4K4YA 3CMQA 2HMIA 1FKAF 2UP1A 3DXBA 3P06A 2AJ0A 5L3JA 2R7OA 4PQUA 2MJUA 3G8QA 5HANA 2V8PA 2QLBB 1RHQB 2ZH2A 4DG1B 3ENQA 4DCOB 2UUAI 1T8EA 1S7IA 2D3ZA 4F0HA 3EUNA 2F63A 3PX4A 2CRLA 3EMTA 1H6KX 2K2PA 4UOGA 1Q78A 2Z2MA 3P4UB 4OZ0A 2ADBA 4B17A 5BYRA 1RTDA 2FLPA 1UA1A 1SV5B 3PYEA 2YWFA 2DRAA 2G9OA 2IRXA 4ZIVA 1ZAVA 4J9SA 3MAHA 4USIA 4YB1P 1LNQA 2GV1A 2QLXA 2VBXA 3OQ2A 2W9BA 4N77A 1KDNA 4IZJB 3BO2A 1RWNB 4Y28C 2HEKA 2XYPB 1HWIA 2YKOA 4I1TA 3PYDA 2B56A 3MAAB 1P9YA 2HFVA 1YBAA 1R3NA 2HG4A 4LRCA 1R8CA 2Y0BB 3BPDA 2Q3PA 1TK0A 2JWNA 2OUGA 5C24B 2W4DA 3GG1A 2E1AA 1NPRA 3RUBL 2WNRB 4Z7YA 5HMYA 1FE4A 2KTQA 3F0NA 1UA0A 2MZTA 4PU9A 3T9NA 4FF2A 1NUEA 2AX0A 2ZE2A 3J7ZT 2BR2B 1G3OA 1N4LA 4PCQA 4PG5A 4NXMI 4KFBB 1OMSA 5IOLA 1VQ6S 1YGYA 3LANA 2ZJPQ 2G4BA 1FHTA 3W2VA 5KFCA 1WOOA 3DOKA 1RT5B 4DR7J 1FEEA 3KLEB 5B08A 2ZZNA 4O3RA 1IM4A 3DLEA 2DGUA 2Z56B 4M8LA 1A6FA 5EHHA 1Y0HA 7AT1B 1HNVB 1C1BB 3UR3C 1SC6A 2V68A 2RD5C 1UDQA 4ECQA 3FRZA 2RIJA 1KOOA 4IS9A 2VFSA 2KFYA 4ED5A 1IR2A 2OHDA 3SIPB 1LW0B 4JI7I 4JI3I 2ZD1B 1QAXA 2R2TA 3J7YU 1NZ8A 2CQ0A 4DQIA 3EXYA 1HMVA 2IM3A 1XNQJ 2RAQA 4DUZI 4FXWA 2YX7A 3IWNC 3H42A 5HLFA 6FDRA 4CM0A 3PKMA 1IKXA 2M7SA 5M2PA 3V81A 3L4BC 4ZJLA 3QGPA 3TZWA 1N48A 3EPGA 3OTBA 3AOBA 2E5LF 4ZPAA 3G6XA 4U3BA 4J91A 4NRTA 3MPUB 2WK4A 2VICA 3KDNA 1IBLE 3HZGA 3ETMA 3Q8PB 2CJKA 4QIVA 1TL3A 3AJ1A 4I2PA 3AXKA 5LJ5Y 2HFOA 1Q7LB 3W60A 2O01C 3VGTA 4B3SE 3CMES 3K57A 1XMBA 1HBUA 3H0PA 4DR1J 4KHRA 4RZRA 2ZDPA 1TKXA 4JV1A 4UT4A 1C4CA 2HWTA 4DV3E 3ILIA 3ILOA 4UY8T 1WOPA 3PW0A 3TAMA 1OIAA 8RUCA 1TR0A 4KB7A 4X66F 3HFKA 5U47A 5LT5A 4WK1A 3C6TB 3W64A 2VA3A 3GPAA 3H2VE 4RR5A 2BA9A 2HIYA 2WCXA 3NAIA 1SH2A 1C1CA 4J5OA 3U7JA 3H2UB 4YOEA 5B7WA 2O1PA 4G1PA 1CS4A 1BWEA 4L3NA 3O3LA 1B0TA 2HQCA 5CYQA 2NXUA 1S12A 4RBVA 3M9MB 5K36F 1K47A 4LUBA 3J81j 2KB2A 1SQFA 2E5IA 4LFCF 3KHGA 3NXZA 2FJAB 3B6BA 3T1HJ 1S48A 3V6JA 2MZSA 2KM8B 3NBPB 1IKYA 2VBWA 2XMJA 3SCKE 3PRYA 2N4DA 2DNRA 1USVA 1PO6A 3L7ZA 4QW8A 3P49B 3LF0A 2HZAA 4I6WA 1QD1A 1GMUA 3D7SB 1H74A 5K8OA 2HNZB 5DM6Q 4RKUC 4CYUB 3OXFA 3HHLB 1TK5A 1URRA 2XG8A 3G87A 1HQEB 1Z0TA 4AL6A 2VV5A 4QIWD 3O44A 4DR4I 1Z0EA 2WTFA 3WIUA 4C8MA 4F4XA 3CCSS 3CO9A 4DV0J 4ID8A 1GK8A 3M2RB 1QZRA 4TQRA 3DM2B 3Q6MA 4O44A 1RAOA 2GGPA 2WOMA 1RDRA 4CT8A 2H9ZA 4J9KA 1NJYA 5KFIA 4LF4J 1U49A 1OYEA 3C16B 3W5ZA 1VC6A 4DR3J 2XO6A 4E2FB 4GVLA 5LMUI 4CO2A 2A2CA 3NS5A 2FQQB 1KLMA 5KFXA 2OO4A 2QL9B 1N0UA 4HYKA 1EQMA 1VYAA 2DR5A 1RR9A 1FJGF 2CQGA 3MCNA 1CJTA 3HJFA 3GP9A 2BEFA 3DU6A 2QE5A 4AQYJ 3WC2A 3M1VB 3PFEA 4J9LA 1FF2A 2J6UA 2KHDA 1H7XA 1NCLA 2W7OA 3J81C 2BJ7A 2O1VA 4YY3E 3IN5A 2ZJRQ 2I38A 4Y6IA 4QZVB 3NS7B 1RT5A 2OKQA 1NU4A 1PG5B 2QN6B 2GVZA 1AFIA 4B3TE 3HHLD 1Z1ZA 3CD6S 1ZPVA 2HPUA 1U0HA 3D6TB 3SXLA 1N33E 3W62A 5KFPA 1Y5IB 1QE1B 1VS3A 4DUYE 2YQ0A 2YXLA 3SQGB 1RB0A 1RK8A 2KRBA 2EW9A 1NPPA 4C8NA 2FVSA 2ZM6J 5J1NA 3R5JB 2UVUA 2ZHOA 2FY8A 4JI2F 1IBLI 5D6GA 1R0AB 4E98A 1SJ1A 4A8WA 2F40A 4C98A 4ZLJA 4ELTA 2Q2EB 4AL5A 2F4VF 3QIDA 4B3SI 1DAXA 2MHEA 1KHWA 3G82B 4I3HA 1OQ3A 4DV3I 4WF9Q 3NS6A 3TJAA 1I94J 4GVBB 1W25A 3CSKA 4LIWA 2E1PA 5CYMA 5C0XE 3CCJS 1TUWA 2WVEA 1PAEX 2XCPA 1X4FA 1F9FA 2CPDA 1RU2A 1ACMB 4ZCKA 3B54A 1U8SA 2IYIA 3BGRB 3AA8A 4NWBA 4XTJA 4DQPA 5HVFA 4UQGA 2ZUAA 1Y10A 4P7AA 3CXCR 5DDQC 3PRBA 1R89A 2HGMA 5DG7A 1V3SA 5LXYA 1WWHA 1G1XA 1C0UB 3BH7B 2FPHX 4EZ9A 3BYPA 1JJHA 1AUDA 3MM6A 3ISND 3LGMA 1UKUA 3OL6A 2BJ8A 4WFNQ 3GV7B 2DGQA 5JJBA 4BC7A 3PNIA 4JI5J 1OS5A 4YUDA 1T05B 5JEAC 1FDBA 2B9EA 4QOTA 4LF8J 3HJVA 1P8GA 3OXGA 4BS2A 2IJNA 2U1AA 3QRQA 4HHJA 4LFAE 3K5MA 1KQGB 4USTA 2JEAA 3J7Z5 4GKJF 2DO4A 3M05A 4C8OA 5KG0A 2NXEA 1FWLA 4KO0A 2KXNB 4F04B 2CQ1A 1JLGA 1FKPA 2C28A 3GB0A 4PPZA 4TU7A 3VAKA 4F26A 2HHWA 3I0SA 4DV2J 5KG2A 4FNIA 3HT3A 1G4CA 4UOHA 4QU6A 2L9WA 4NCAA 4NEYA 2M9KA 2PO2A 4DMZA 1MSWD 1T02A 5DQIA 1YSJA 3LH2S 4N76A 4ECRA 3GCXP 1HQEA 4DFMA 2N82B 2KI2A 4PRFA 4WZMA 4RWXA 3LP1A 4WJBA 4FDFA 1MN7A 4KHMA 3W9IA 3KLVA 3GCMA 2PNLA 4WP8A 1S6PB 3VAGA 3G86A 5E0OA 4YS2A 4DSEA 4X4TA 1CC8A 3OV7A 4U96A 4DR2F 2F8EX 2CPHA 2HWIA 1N8RT 2JSXA 2WONA 1YRUA 1RLCL 1KC8T 4RWWA 1YZ7A 3C16A 3H90A 4LJMA 4N47A 3L3CA 1NH7A 5HJYA 4NLRA 4YY3I 2E7XA 1LK5A 1FJEB 3HD1A 3N6MA 4NLQA 1NHKL 2XZDB 3EGZA 1S1XB 1UW9A 5KT4A 3WIVA 4Q44A 4BHQA 1OQ6A 8ATCB 4BA1A 1KS2A 4Y2MA 5K20B 4B3TI 3AFGA 1U26A 1M5HA 1I94E 4DV6F 4QW9A 3LP0A 4Q7AA 5IWAJ 1RT6B 3H7HB 1WC6A 2AGOA 2R8KA 3FSIA 2NN6D 2HURA 3M1VA 3CCTA 1S77D 2P9GA 4LF9J 2LQ8A 1HNWF 4YR0A 3WDOA 3OXLA 5DGBA 4DUYI 4MIBA 1OSDA 4I0WA 4B9UA 2OMOA 2DHAA 3EPIA 3JAMY 2XMWA 2IVMA 3T1YF 4MYUA 4PWWA 2VFRA 2B51A 2YNGB 3J81Y 1HBOA 3R5BA 4NXNF 1HQUA 2B8QA 3SV3A 2ZVSA 3QJPA 3M6UA 3O2IA 3TVKA 1IJFB 4OX8A 2ZBQA 4K4VA 2KU7A 2JEBB 4X4RA 2DNNA 4LF6F 2CQCA 3AQOA 2HGLA 4RW7A 3R7BB 2VBZA 5GVQA 1YDLA 2HWHA 3SQGA 1WJ9A 3EZOA 3IR6B 2XY7A 1GMWD 4K4SA 5GAGI 1RYRA 3W65A 1Y7PA 1NHUA 2K1RA 1U1NA 1K0TA 4PZVA 2K3KA 1SQEA 4I56A 2IC3B 3DLKB 4OQJA 3A8EA 1Z5BA 1RT2B 5DO2A 3W63A 1B64A 1HD1A 1X4HA 1XEZA 1C2PA 4J9OA 2BYCA 2ZH9A 2NLWA 1YJ7A 3PO4A 3MFIA 4X62E 3WU6A 4DV0I 1XBWA 5D3GA 2W4CA 2J0SD 4RW6B 4B9TA 1UMJA 5CD4H 3DOMB 3K85A 1Q86T 1FK9A 2OPSA 1KD1T 3VALA 4NMXA 3HLUA 5BJRA 3L7UA 2CPJA 1YX2A 4DN0A 2ILYA 4ICLB 5J2QA 1NJWA 3U1MA 3PFOA 1O5JA 1A0OB 1FA0A 3J7YI 1J5EE 4DX8H 2RRNA 1Y3KA 4KSEB 1S6UA 1N6QB 4QWEA 2A1BA 2QV6A 2JNJA 4PRXA 4LFAI 4L76A 2PO1A 3EGWB 3DOLA 4OX9J 5ETMA 4J9QA 3LWLA 2VZ9A 2IBOA 3DRRA 4UF4A 3EDRB 5LMNE 4ANEA 4M63A 4CLFA 1JKHB 1TKTB 4URSA 2BJ9A 3DLGB 3MXHP 4LSNA 2DGXA 2UUAF 2Z0GA 2HFZA 1E3PA 3UI3A 3V6HA 2R42A 1S9GA 2DH7A 3HVTA 3KG0A 2Y8YA 1RHRB 4DR6E 2HFUA 3CIMA 4ZVHA 4OI6A 4DUTA 2ZZTA 2F65A 1UFLA 3EZ5A 4DSLA 1O6XA 5H9EJ 4X64E 5KG3A 2AX1A 4CDIA 2NN6A 2RB7A 3OVAA 3QATA 1T9XA 1V5VA 3T1AA 2AQ4A 4DZ6A 3J7AG 5DGAA 2AJFE 1U4BA 2N7CA 2XWYA 3R27A 1X0PA 1CSJA 1X4BA 2GC8A 4OHWA 3CIZA 2IDEA 1B7YB 1T0TV 2NZCA 2CQ4A 2U2FA 3WQPA 3FGVA 4JYAE 3BKTA 3J81Q 2VODA 1DHMA 1XR7A 2UUWA 2WW8A 2Z5BA 3DKDA 2C3OA 3HVWA 1B99A 1M5SA 1P6TA 4KH1B 1SJ4P 1QM9A 1RJJA 5CZVA 4RNFA 1PJ7A 4ETXA 1RA7A 1YI2S 3H5SA 3JSYA 1T03A 2HK2A 3RZAA 1EKSA 3GJTB 4EUVA 4C6AA 3TR5A 1GMWA 3MM8A 1I94I 2XSJB 2MQLA 2DO0A 5A2QC 3V5RA 3T3FA 2CJ9A 4NLYA 4YN3B 4DV7E 1X4GA 5AXMA 1X9MA 2B0GA 3MD1A 1WDTA 2DXFA 3UN5A 4B9VA 4F8RA 2P5VA 4NXMF 4NLWA 1S6QB 1VBYA 2K8GA 4PYAA 5J2NA 4MK9A 3UHMA 1FFWB 3TZZA 1RT4A 1B63A 2HNDB 5FJ4A 1REGX 2WSFC 2HFSA 1RAFB 3CJ3A 3BQ1A 4OYPA 4FN5A 5ETKA 2Q6BA 2MGZB 1RSCA 2Y0SD 3P45B 3NWRA 3SMZA 4WKYA 5CYJA 3HF5A 1VBXA 1GNKA 3I82A 3CJ2A 2C38A 4XDCA 5IM0B 4IRDA 4O3QA 2FJXA 3FSXA 3H59A 1NNDA 1L3TA 2XS7A 4I67A 1FD2A 1CG2A 1P42A 4JI5I 2W24A 2C3YA 2DEIA 2QYCA 5C42B 1DZ5A 4IZKA 3Q2TC 5D4NA 5A76A 4ANCA 1SC4B 3WC0A 1NHJA 4JI7F 4JI3F 5A0YB 4F4KA 3QGIA 3GYGA 3I55S 3R8YA 3G6VA 1RTJB 2H5EA 5DG9A 3ZO7A 3RJMB 4J37A 4TN2A 4I7FB 4ILRA 4DUZF 1M5KC 5L9NA 4JI8F 1NDCA 1QTNB 2QA4G 2UXCF 4LPFA 4X62I 2F5GA 3QT8A 1N52B 1IBME 3TP2A 5KFOA 1OYPA 1RWUA 4KAIA 2ATCB 1JLFB 4DV2I 5DS7A 2ZNYA 2M8DB 2HHQA 2KYZA 2QC3A 3QFWA 2PC6A 5C5JA 2WP8A 3QMQA 4ECWA 4LF5E 3KK2B 3SDEB 2J5AA 1BLUA 1RT2A 3GU0A 4X65E 5D0GA 2DNGA 1RBLA 1J5EI 1NHHA 3M32B 3R6GB 1XJWB 5MAOA 2VONA 3J81U 3SBMA 1LFPA 4DX7A 4HH0A 1F5AA 3EGVA 3OR2A 4B9MA 1FERA 4IG3A 5ETQA 1S1TA 4URQU 4WWSA 5ETNA 4DL3A 5FDLA 2V0NA 1TP7A 4F4YA 4YMEA 4ZJOA 3ENAA 4ILLA 2ZDOA 4NLSA 3V6KA 2MY8A 4K7QA 3UD5A 2CXEA 2H4WB 1UWAA 4DR6I 4J90A 4KHPE 4CWBA 5H1SV 4KQVA 4FNHA 1VJQA 2DYAA 4NLTA 2JLEA 4ZLLA 3GSIA 2E5LJ 4W90B 5H9EK 3MECB 4X64I 4X4NA 2YQ1A 2PO0A 1RTHA 2E7VA 1QVFR 5HL7Q 4JUZA 1S1WA 3AAWB 1UCNA 2MLYA 1VQYA 5KFYA 2MYFA 4UQTA 3MOJB 4ZMMA 4DV1E 1LWCB 1JWWA 4M5DB 2MKSA 3EXCX 3CO0P 4LOMA 1UVKA 4JYAI 3R7SB 3MM5B 2OLWA 3FMWA 4RNHA 5C0XB 4LR8A 2XMVA 2VOOA 4DR4F 2E5JA 3OR1A 4QQBA 4X66J 3W9HA 5HVHA 1GTHA 1ROFA 1APSA 1BQNB 2UU9F 2HBQB 2NXCA 2MQOA 4RU9A 4CLYA 2RU3A 3HMJG 3CTRA 5HQ8A 4U7UK 3UQSA 3DGPB 3RAMA 4CZCA 5HQLA 3NOCA 1C0TA 1WKJA 1U2RA 1TV6A 2XULA 2ZH7A 1AROP 2VPXB 4DL2A 4DV7I 4TY9A 4XTTA 4Y2KA 1M0SA 5LMUF 3BQ2A 1U47A 4A8QA 3ZKBA 2UV8A 3AA9A 3KJVB 4LFCJ 1H73A 5K36C 3LPSA 1D8YA 4ECTA 3D1QA 1YHCA 4OJHA 1UWBA 4I2QA 2CNLB 3J7AM 3BS9A 2BXJA 1UJ6A 4ZK7M 1D6TA 3IRXA 1SCJB 3H4DA 1VQ9S 2PFDA 2E9ZA 2XHCA 4KTQA 2DPIA 4LR7A 5A2QY 4PEOA 1HPZA 1OSCA 1KFSA 5JVHQ 3MEGA 2OAUA 2RS8A 3PVXA 5H9FJ 3G6YA 1KHVA 1FI4A 3BR9A 3DHXA 2RRAA 1ZETA 2PN6A 5C0XD 1NMEB 1WUUA 2D69A 1U1LA 4OX9I 4PABA 1J2VA 4ZVIA 4R0EA 2OSQA 3OUYB 4KV8A 2QLJB 2RMLA 2B5JB 2DITA 1K73T 4IFDB 4BA2A 3HI9A 2UXBE 1IBMI 3JXOA 1FDAA 4M5KA 4ITSA 1U45A 5L1LA 2IAJB 4X2BA 2HHHE 4IFVA 3S8SA 1KEKA 3M8RA 3ICLA 3M8QA 1IBLF 7FDRA 2VFUA 3JTNA 2BM0A 1FJGJ 1XC9A 1RWVB 3N5FA 4LF5I 4TNOA 4G1QB 2E66A 4B3SF 2BDPA 4X65I 2AU0A 5KFFA 1XN9A 4DV3F 4CO4A 4CCHA 4AE5A 3QRPA 4P9SA 3W3SA 4LBIA 3OFFA 3S1TA 2HRTA 4FWGA 2OPRB 2BOPA 5EDWA 4KKOA 1GX6A 1LFWA 3LUYA 3PY8A 2UVWA 2UUBE 1HA1A 2DNZA 5IS2A 3WX4A 4IG0B 3SDEA 4GKKE 4EYHB 5GAEI 4L72B 2IDLA 4NYOA 1Z4UA 2HZCA 2V2ZA 2B43A 1LXJA 2XWXA 1N34E 2XLKA 1HI8A 1X8DA 4N56A 3SZ2A 2NSCA 4DHVA 1UTAA 4HH1A 4QWDA 2WZ1A 4LSLA 4IH6A 2RF2B 3MMBA 1SJQA 2MZ1A 4KHPI 2FJVA 3UVJB 4JI6E 2OP5A 2F1FA 4ED8A 4O4GB 2IRYA 3IG1B 2MZQA 4ANDA 4JI2J 2HZVA 2HNYB 2M8HA 3EWGA 5B0DA 4IFDD 3BH6B 4OI1A 3IAS9 4WZQA 3CDWA 2LYVA 3RBZA 2F4VJ 5EN1A 3C19A 2X36A 1JLCB 3KFWX 4DV1I 2XYGB 1ZAXA 2R7RA 2W8LA 5DDOC 3S7RA 4J7CA 4DR7F 1HNXJ 1NO8A 1FNMA 3UR0A 2QFIA 1QDUB 3AY0A 2BACA 4OZ2A 4DPYA 4NCGB 3K5NA 4IDKA 2EFOA 1ZM4A 4UW2A 4DJBA 1VQMS 2GS8A 3D0HE 3LPYA 3D6MB 4ZPBA 1VCTA 3UNGC 3ZNJ1 2DBBA 5A2QQ 3OL7A 1T9TA 3WU3A 4QIGA 2DNLA 3MEEB 3MTKA 4M5DA 3CCMS 1YJTA 2GIRA 1FWKA 3O6QA 4YHHE 1NJIT 2O3ZA 2PNZB 2HBYB 4MU0A 1Y4UA 1U6ZA 1MMLA 2GQCA 1VQ5S 1B62A 2I9SA 1YQHA 1H2UX 2L9DA 3H1CA 3CC2S 2VU5A 1T3NA 1N54B 4YB5A 3A3OB 5EX0A 1SJFA 3TI0A 2BQUA 3ZC4A 3ZZ0A 3QJJA 3TWZA 2MEWA 4C11B 1VQ8S 5KFGA 2FZKB 3PIPQ 2XBPA 3SCIE 2H65B 4GKJJ 4YY3F 1QLNA 3POTB 4TU8A 1VC5A 4ECSA 5E3QA 5KT2A 1VQ4S 5H9FK 5F8LA 4B3TF 1QUPA 4KGZB 1YIJS 1D9AA 1RXOB 1XIQA 3DXSX 4OX7A 2ZH1A 1Y3JA 3VQTA 2MSSA 1N88A 3OL8A 2XO7A 2BKNA 5HMWA 3PM9A 1FRMA 4NI2B 3GZ7A 4OZLA 5HBMA 4ZPWR 4V19J 3ZZRA 4HT7A 4DUYF 4YB6A 3Q8YA 4ZP7A 2UXBI 1XTZA 4FYYB 4DPOA 1GXLA 3K89A 2CAJA 1MU2B 1F3FA 2F4FA 3GMEA 3LPEA 2YKNB 2HHHI 1JK9B 2AV5A 1B70B 3VAHA 4KYZA 4K4TA 1UETA 2CADA 4M5NA 3J80Y 3S01A 4OLPA 2GHVC 4DR2J 4KC5A 2BANB 2G2ZA 4QPTA 3OUYA 1S72S 4FPRA 4O3PA 5KG1A 3IS9A 1HYSA 1X4EA 4RUAA 3RR7A 4IFDA 3C3LA 4LF7J 1CULB 1N0VC 3W66A 3Q8QB 1WG5A 4MU4A 4OZ1A 2IAJA 5C0XF 4DSKA 1RUSA 4LSZB 4TXSA 3CDJA 5LSOA 3T5LA 1JNRB 1TVRB 2I8EA 2UUBI 4BC9A 2HVEA 2AE8A 2O5DA 3SSQA 3BKFA 4DR5E 4GKKI 1X31C 5KFLA 1SJRA 1N34I 2IFXA 2GQ2A 4WFYA 4DV0F 4D3HA 3GV5B 1H7UA 1HNWJ 2O1UA 3NKYA 2B4PA 3OD2A 1F3VA 3JQJA 3PYFA 4JOUA 3US5A 1S4FA 3MZIA 2VQFJ 4JI6I 2R7WA 1BY9A 2CPXA 2BA1D 3T1YJ 5DM7Q 2BMBA 5C25B 4PXBA 4TY8A 5A8KA 3NMAA 4NXNJ 2YNFA 2DISA 2E1CA 3ZZZA 4ED7A 3KLGB 4OYMA 3KHHA 2J7UA 3PCOB 2IESA 2BA0G 3D1OA 1Y5YA 3QO9B 1UPMB 3DFEA 3KLIB 3W1YC 3OTDA 1I6JA 2V34A 1S7HA 4C3KA 4Q45A 4ZVSB 5ETOA 3JSBA 3GONA 4FF4A 3HHLC 1VQSA 2D3OR 1OO0B 2HNYA 4B3ME 2RH3A 3Q83A 4NASA 2IBKA 1YK9A 5HP1B 2CYYA 2WVCA 2XNRA 3VV2B 4WXOA 5KFNA 1NKEA 3HULA 1H3DA 4RUHA 2OPPB 5JEAA 4JI0E 4NYZA 3DLLQ 2R7VA 2BVZA 4YHHI 3DHWC 3W5YA 2CNKB 4NCGA 4TLQA 3C6UB 4LCHA 5L9XA 3D1HA 1VOMA 2QL5B 4OYZA 2CQ3A 3KXDA 2HRYA 2QRRA 2YBVA 4K2XA 3UDLA 4N41A 2KH9A 3C2PA 1NSPA 3AOAA 1H98A 1N56A 2Q79A 4AM3A 4PUOB 4OO1B 3ZTPA 2DY9A 2B9XA 1WOSA 2FHJD 1IBKE 3RW6A 1DARA 3RG6A 2F1DA 3K1JA 3SCJE 1RT3B 2OPQB 4QWAA 3WX8A 2RS2A 2ZFHA 1KR4A 3NZKA 4DDFA 3MR6A 2JLFA 1HR0E 4FXDA 3HM9A 4A8MP 1U7LA 3C8YA 3K2YA 1TL1A 5K8MA 1K0VA 1WF2A 2UUAJ 1EKRA 1I94F 4IFYB 4DSFA 1UZHA 2BW7A 4NPOA 3Q6NA 3MCMA 3BDPA 3UNYA 2PI5A 2FVCA 2FVRA 2W2QP 2D7SA 5D77A 1BMQB 3ISNC 1N5QA 1UVJA 1HBMB 2L08A 4YR2A 1FRLA 2DHHA 5IZHA 2HAIA 2GQQA 2RKIA 4H4MB 1XXEA 2UUCE 4R8UB 1ELOA 2DGTA 1FX2A 1PKUA 1CJKB 2XB2D 1TKZA 2ZHAA 1Q95G 3C46A 4G65A 4DSIA 4QBUA 2CPEA 3MM9B 1S9FA 2VQFE 1EAYC 2AJ2A 4XAKA 3HDSA 4GO5X 3W7BA 4B9LA 4F4AA 1F60B 5SZTA 1CPZA 1F9EB 1WC3A 4ZCLA 4JI5F 1S5ZA 3ENWA 5KFEA 3HSJA 2V2QA 1XMQE 4CTAB 4EI2A 4MMOA 2KRRA 3IBFB 4OO1D 2MY7A 1BHNA 2YKQA 1MU2A 2J65A 3C15B 4NMLA 1GT8A 1HNZE 5DJBA 1VQ7S 3KNGA 2C2DA 4DLGA 3QNWB 5KG5A 3HO1A 5HN0A 5DLGA 4M5LA 1D0EA 2OSRA 4DR5I 2RILA 1WACA 2XYHB 1VRUB 4B3OB 4ECXA 3GWCA 4EZ6A 4OV1A 3RRKA 3TW0A 3TUPA 4X62F 1LWXA 3GTYX 1ZXMA 1RHYA 4DQRA 3DMJB 1CULA 3A12A 2ZOMA 2MQ8A 3SQOP 4DV2F 1JXEA 3D54A 2HAFA 3TZYA 3MMAA 4U7UD 2EC2A 1BQMB 3E01A 2ZH8A 4RW9A 3GLLA 4ZP8A 5F8MA 2KVQE 4LF1A 1J5EF 2YWEA 4FYWB 5KAKA 3ET6A 1JLEA 3W61A 1RT7A 3HVRA 4RW4A 4YDXA 2RRBA 5KG4A 2BA1G 4C97A 1S59A 2FHMA 3VAIA 5KG6A 2HS3A 2ROPA 2VG6A 4Q2LA 3D2WA 2BJ1A 4CLTA 1M5OC 3UD3P 4JI7J 1UP1A 4JI3J 4P75A 2ALYB 2VG7A 2ZOFA 2R8HA 4LR9A 1P27B 3G9CA 1NPKA 1EETB 4B3MI 1JLQA 1V5IB 3PHEA 2NN6C 2M4MA 2XGQA 3DDIA 1LWEA 3OL9A 2VQEE 3DGVA 4DPXA 4DR6F 4HDGA 4YFUA 4USMA 4IR1A 1ZPWX 5D0HA 3DRPA 3EDQB 3M8WA 4X64F 2DH9A 1Z2ZA 2H51B 3M30A 2LFVA 2PEHA 5A8WA 4OJ1A 2XY5A 1G7CB 4ZP6A 4H4KA 1O51A 1RGVA 5ADZA 3THTA 3DI6B 1YJVA 2IMWP 2C39A 3PX0A 2OPPA 3X1LB 4JYAF 1NK9A 4GQUA 3SSSA 3GLJA 3N5BA 1GMVA 1HQ2A 4OI4A 1IBKI 1LQ9A 2ZBKB 1IKVA 1AZSA 3V6DB 4WE1A 4KT0C 2AJ1A 1SJ3P 3D9BA 2KJVA 3PW5A 2W9CA 2BRKA 1HR0I 2A18A 4OYIA 3FSYA 4CLUA 1DJ0A 3C14B 3DRXA 5E3RA 1E6YA 1NDPA 1R8PA 3WU5A 3V4IA 3HJCA 4USUA 3KKFA 4KIAA 4DV7F 1YRXA 2VBYA 4HI1A 4MKAA 2LKZA 2DCUB 3LO3A 1OY6A 1L3KA 2JEFA 4ES3A 5FLXU 4Y3CA 3OVSA 1VQNS 3FC9A 4CLWA 2DGOA 1RT3A 3I9ZA 2ZBIA 3BR8A 2DNMA 3CGIA 2UUCI 2E5GA 2OFGX 3KLHB 4P72A 1FWPA 1Q8IA 4V1Ak 1S49A 2WAQD 4FW9A 3QGHA 4EBCA 1VK8A 4C8LA 2VQFI 5THWA 1J5OB 1N5YA 4HDHA 1CJVA 1K9MT 1N32E 4C3MA 2DIUA 2V9KA 3CDAA 4A8SA 4BDPA 5EWGA 1MX0A 1LWFA 5DNXA 4GC7A 1TZ0A 1S0NA 1BGXT 3HFZB 1XMQI 4PXCA 4H4MA 5J2MB 5KFHA 3T5KA 2VESA 1HNZI 1DLOB 4IRKA 1A9NB 1T9VA 4JBCA 4TU9A 2JE6B 3QLHB 2HBZB 3FFIB 2Y1IA 3W8GA 2KZMA 4OX9F 5F8JA 4P73A 2LVWA 2IPOB 3OBIA 3NMRA 1IBMF 3K17A 3DYAB 2VC1A 4MFBA 1AW0A 2FZCB 3Q22A 3I5CA 4Q0BB 1RREA 3VCDA 4A8KA 1FNXH 1XHKA 2XLJA 2CGEA 1S79A 4QNJA 4CLSA 3D3CJ 1UEKA 1DTQA 3KNAA 4IRCA 9RUBA 2IRUA 2HS4A 5T7LB 5KT6A 4QIEA 3HHKA 3BZQA 3MD3A 4LF5F 3NGUA 1YH8A 4LFBE 1Z59A 3W5XA 5G4DA 4X65F 2EG2A 2XMAA 2L9NA 4FYVB 2IHR1 2OEJA 4OO1F 3KK1A 3QJLA 1FD8A 2C2MB 1VRTA 3CJKA 5K36D 1S9EB 3IR7B 2I6WA 3R6LB 3BJYA 4UOFA 3Q86A 1Z5CA 2KXHA 2FHOB 3TUZC 3PHTA 2IA0A 4QNKA 5HVGA 1S6OA 3Q23A 1Y4ZB 3RAQA 1UL3A 4WUDA 3I5BA 4IH7A 4EMDA 2NPFA 5DRPA 2HYIB 5L1IA 1SL0A 1KTVA 4ED6A 4F4ZA 3RAXA 4WCEQ 1D3WA 1E3HA 4AL7A 4KHPF 2GMHA 3N28A 4C48A 2MDAA 1AB8A 4I68A 2E29A 3FCVA 3IM9A 1NK5A 1AFJA 3PG9A 1IBLJ 3GE9A 5IV3A 1MWZA 1SQGA 5K9FA 1BQXA 5LL6d 1EETA 2W1BA 4Z7CA 2EPIA 4B3SJ 1GTEA 4OZ5A 4DV1F 5AXNA 2K7KA 3P8BB 2QLWA 1SL1A 3CUNA 2BE2A 3M2UA 4QR0A 4WK3A 1PIEA 5GAHU 4DV3J 2ZNZA 1UDNA 2P9EA 4ZPCA 2CZ9A 1DBDA 5GADI 5IT9U 4HACA 2VG5B 1VBKA 2ASYA 4CM2A 1JLBB 5L8RC 4ZS6A 5KFWA 1KOHA 4ZCMA 2DPJA 3LAKA 2CJXB 3GJSB 5HATA 5J1PA 2MKCA 4DFJA 2P8IA 4YEAA 1RTIA 2FD2A 3BSOA 2LECA 3DRSB 1W26A 1RLDA 2P2CB 1CJUB 2JFDA 2GO8A 3BN7A 2YH0A 4MT1A 3IRWP 1Q81T 3OSNA 4IOCQ 3O1LA 2JH3A 4K4ZA 3KTQA 1FKOB 2V4QA 3R1LA 3ITHA 2C42A 2YVSA 2C3MA 4BWJA 4PWDA 2H4YB 4M5IA 3GV8B 3M6WA 3N01A 3U1LA 2QFJA 2HVDA 2P6SA 1VFJA 2LJPA 4WUCA 5I42A 4ZPVR 4Y34A 3TA1A 3DD6A 2PSZA 4CIOA 2R2RA 3HVAA 3BREA 4NLOA 3OFHA 3VR1A 1N32I 1FT8A 1REVA 5F9LA 5CHCB 3MEDB 2QTWA 1HD0A 3MURP 1H0HB 1IM6A 1GAOA 3SV4A 2OD4A 4WKRA 2O3DA 3RB3A 5K36A 2HHPA 3OPKA 3QRRA 2C37B 5DNLA 3FCHA 3KLFB 2LA4A 4MK8A 4DCJB 3NNCA 1H38A 2ZEJA 3BYRA 3L9ZA 3GG0A 3RU0A 1EQ0A 1UAWA 5HMZA 4IZJD 1HBNB 9ATCB 3JSRA 2N3OA 1ZTWA 1S1VA 1JX4A 2YX4A 2UXBF 3OLBA 3M2VA 4NOHA 4ZKAA 2AYBA 3FJ2A 3DLJA 2CPIA 2CFXA 4EGLA 3AB4B 2OTJS 3ISZA 2XZTB 5BR8E 2HHHF 3B78A 2VH7A 3D66A 2DIVA 4P10A 4D3GA 1KVIA 3I0RB 1XMOE 4FW7A 3MPYA 3FNNA 1H7SA 4ZVQB 3TNVA 3IAM9 4CH0S 3HZEA 4LFBI 5CA5A 4O3OA 4L73A 1ZZFA 4MH8A 4ZIWA 1KKHA 4RW8B 3QBCA 3PR5B 2YNHB 2ASLA 4DEZA 1N5SA 1Z0CA 3HKMA 4IH5A 2H5JB 4YY3J 1XNRE 3H98A 2GVDA 3UW1A 3MMCB 3MDFA 4ZVUB 3PZPA 4OKGA 3MM7B 2J6TA 4BLGA 2V69A 2UUBF 1WSVA 3GFYA 1QSSA 4B3TJ 3DU5A 4GKKF 2B6AA 4L3KA 1R43A 3H4LA 2CVEA 1JLAB 2LDIA 1N34F 5DQGA 2VDIA 2E1RA 2JOQA 1NLKL 2B9WA 4NLDA 1N33J 3PW4A 1G2EA 2Z4PA 3QIPB 3QAEA 4DUYJ 1RAAB 4ZVPB 3UCZP 2E9RX 1E6VA 5LM7E 1SUQA 3UPFA 2W2OP 3PTWA 3K8WA 4U8VA 2Y9HA 2FZGB 3JSMA 1TL7B 1VHFA 5LXRA 1X5OA 1S57A 2DNPA 2FVPA 3MR5A 4MYTA 2DNKA 1WG1A 4NZ6A 2J0XA 2WBMA 3K5LA 1MN9A 2F3JA 3MUVP 5HROB 2G13A 4EEYA 1IKWB 4DG1A 3N9UC 4OIXA 3CMAS 2CNNB 1X4DA 2D41A 5F8NA 4H4OB 4UUXA 2GQ0A 4NLPA 2KT2A 2ZH5A 2MZJA 5C0XC 1TFWA 2LEAA 3A3NB 1D9FA 3ZZYA 4EO6A 4X4QA 1XR5A 3ZKDA 4Y2AA 4A8FA 5IC4B 4R1FA 1SV5A 2DR7A 4M1KA 5IQ6A 4YHHF 3BM7A 3RRHA 2XI2A 2D3UA 4O4RA 2IIHA 2KDOA 3EVWA 1TAQA 2JEJA 1AXQA 2OTLS 4Q2MA 2YNIB 4IZJA 1RABB 4P2XA 2VJUA 2FHKA 4QR1A 1WHXA 3MAAA 3DRSA 2YKMB 1CJUA 2HQIA 5L39A 1UEUA 2B4VA 1NKBA 1WTBA 2AYGA 4LFAJ 2J0WA 4F25A 2MMYA 2C2RA 5KFAA 3UE2A 5C24A 4HTIA 4DL7A 2ZOGA 4RJVA 2WNRA 5KOWA 3LALA 1PC4A 1IUJA 4F50A 2E7WA 1Y60A 2NYIA 2GCFA 2GHWA 2ABYA 5KFSA 4I4BA 4G6VB 3R1HA 2VASA 2FVQA 2BR2A 3BPSP 5A8RB 1RHJB 3IR5B 2HFNA 4KFBA 5M2RA 1URNA 4OI2A 1WHVA 5GMEA 3OW2R 5E5NA 3Q24A 1ZYQA 4I69A 3PRDA 2XMMA 2PD1A 3RB6A 3HSDA 2O1WA 3KLEA 5D0EA 1Y6ZA 2D9PA 2MQPA 1WDDA 2LQ5A 4FF3A 1WF1A 3IA0A 2OGUA 3Q1QA 4LQ3A 2VKRA 3VVUA 3BQ0A 2KHCA 3KG1A 4IFDC 1UVIA 5BR8I 1HNVA 2NXNA 1C1BA 2VIHA 3GR0A 3ENVA 2Z5CB 3UD4P 4WXWA 1N36E 1XMOI 2ZITA 1NRKA 4NA1A 4PRVA 2GO3A 3W9JA 5G0RB 2C1EB 5AT1B 3MR3A 4OV6A 4QIFA 1T9UA 1LW0A 4P7TA 2CA9A 3BBBA 3CJ5A 2ZD1A 4EK2A 3QZ8A 2W2NP 3PEHA 1X60A 1V3ZA 3S6EA 1GX5A 1IJEB 1XNRI 4ZPDA 1WELA 4W92B 1UDSA 1H72C 1UW4A 3O5TB 1HNXF 1Q8KA 2DHSA 3RR8A 2CPFA 1XQIA 1MLAA 4DR5F 1Y9OA 3GIKA 4DQSA 4QCLA 1YBUA 1LW2B 4ZHRB 3CCWA 2CG4A 2DHXA 4USJC 2POKA 1NK4A 5CCMA 3EICA 2I5JB 1R0BG 2V8GA 5L1JA 4DLEA 1JJCB 3G96A 3C66A 3TVYA 1LOUA 4FYXB 4R5PB 4ED1A 1VK3A 2R8JA 3AJDA 1JLAA 3FRYA 3Q89A 2RHQB 1NDKA 4ID5B 4DBQA 4A8OA 3C6TA 2PMHA 1RT1B 1YVFA 1RHKB 3M7ND 2IOQA 4DV5E 2APOA 3G71S 2W9AA 1VLOA 2UXDE 4Q8EA 2HMIB 4KPYA 5C7PA 4JI4E 4HT5A 2CQIA 3TAPA 1RZMA 4B3MF 4ISAA 4PQUB 2ZBPA 2HKEA 4L74A 6AT1B 5ETLA 4FW4A 2Z2LA 2BABA 2DNQA 4LCFA 2QLFB 2XMKA 2EFNA 2JC1A 4ZN1A 5HROA 4B9NA 5CABA 4PKDB 1NJZA 4X62J 2H54B 3IWXA 4FZVA 3CCLS 3NBPA 4DL6A 2FLNA 1DQAA 4ZJQA 4V19X 2KXFA 3TX0A 4MKBA 2XLIA 2ZHBA 2RDJA 4WTOB 3DLBA 1J27A 3EJMA 2HNZA 1RTDB 1BD6A 2LQ9A 5L38A 4ZVTB 4CYUA 3RRGA 3M6XA 3HHLA 2GJFA 3H25A 2VL1A 1NK6A 2Z8QA 2IYGA 2DEJA 4DPUA 4ALZA 1J5EJ 3W8PA 2MZRA 3M2RA 2ACMA 1PYTA 3DM2A 2HHSA 2IM0A 3M8YA 1IBKF 2W9BB 3HHEA 3OSPA 3K58A 3E8OA 4FBTA 1Q8BA 2NZ4A 3D5MA 2DGWA 1U09A 1WC0A 4NA3A 1U2CA 1I51B 4C2MA 5LMNJ 1HR0F 3A8KA 4UOCA 2H5IB 4LF7F 1RCOB 2V2VA 4QWBA 3SFGA 3I6PA 3LA0A 2C2ZB 1PCAA 4LMZA 1G6BA 3HD2A 2VA2A 3RTVA 2YPZA 1NK8A 2FJDB 2A6OA 2BBEA 2HSEB 4CLPA 2IVFB 2F8HA 5B0AA 4DR6J 2HS0A 3JB9k 4FPIA 5B09A 4MQYA 2GO4A 5IT4A 4FXVA 1F2GA 4HR2A 1FFSB 3M8ZA 3GIJA 2ZE2B 4NRUA 4X64J 2UUCF 2JHEA 4AYBD 1N33I 2FJBB 4M5MA 2AJQA 5IQQA 3I9V9 1UEVA 1N36I 4TKTA 2YWHA 3DOKB 2EFPA 1QSLA 1JQGA 2K06A 1YJUA 1L3SA 2VQFF 3RB0A 1ZM3A 5E33A 2OELA 2M2BA 4JYAJ 4LQ9A 4CH7A 3F41A 3UDCA 3Q8RB 2IVYA 3L7PA 3N0VA 2AP6A 1S97A 4M5GA 1NM2A 1XMQF 5ETRA 2AGPA 3MPWA 2M5YA 3E3XA 1VLYA 4NXME 3CD7A 2X51A 3FUYA 4ZOSA 1HNZF 3PEJA 1QE1A 5HSPA 2MB0B 4P2FA 5E3PA 4HHUA 1DQ9A 1H2TZ 1BUXA 4LCGA 2JVRA 3FZ2A 1HMVB 4DV7J 4JV5E 1L3UA 4HI2A 4RNMA 3CCES 5HLFB 1R0AA 5F41A 1IKXB 3V81B 3TARA 2XS5A 4CNZA 4LREA 3G82A 1RWKB 3R5AA 3J7A1 2NN6E 4GVBA 2NPIA 3KRNA 1EX8A 3KWMA 1CLFA 1TL3B 4USHA 1DURA 4DV4E 2VPZB 2IERA 2OI2A 4E8UA 5AJ3J 4DUZE 1HBUB 2CWXA 1PJ5A 1R8HA 4JI8E 3BGRA 1TKXB 2UXCE 3QWPA 2JEIA 4EWTA 2HQGA 3TAMB 4DV5I 5KT7A 3B4MA 3UWTA 2UXDI 2XS2A 3CE8A 1M5PC 3T6BA 4ZP9A 1TMJA 4JI4I 2I2YA 4DS4A 3OVBA 1FRKA 1C0UA 1GEHA 4Y2IA 3TQEA 2O66A 1VQLS 3BGUA 3I32A 2NYHA 3TA0A 4MDTA 4CLKA 2QX0A 5FD1A 4PXDA 1C1CB 2AZ1A 2LXFA 4H4KC 1IBMJ 3N6NA 4JI1E 1T05A 1CS4B 1TQLA 4CP5A 5CYQB 3CJTA 1KVKA 2JVOA 2PFFB 3PJWA 2KZZA 5DG8A 2AZ3A 4KH0B 2GNKA 1FXDA 1PBUA 4MIAA 1WI8A 3BDEA 3VZHA 4NX9A 2MKIA 4LF5J 3NOGA 3KMSA 5DRQA 2XQCA 2ZC4A 3VGUA 1NSAA 1IKYB 3H5YA 2HIQA 4X65J 3FBEA 3R3TA 1QAJA 1RAJA 5RUBA 3L7ZB 3K5OA 4K4XA 1OYSA 3DNCA 4ENOA 2KYXA 4OO1C 3KK3B 1VIXA 1F9HA 1ZH5A 3ZTSA 3OTOE 4KGKA 3MR7A 4OL8A 4X84A 3UN3A 5IC6B 3AH6A 3HCXA 3GR1A 1RWPB 3BV8A 4C0OC 1OPZA 3GYXB 1RWXB 3J7AN 1P9QC 2QZ8A 4O44B 3TOQA 2XTJP 3JYTB 2GGPB 2WOMB 2QMWA 4AT1B 3D6FB 1Q0NA 3TVZA 4ZN3A 3KDOA 1S6PA 1NSQA 5LJ3Y 1K1QA 1RKJA 4KHPJ 1MMDA 5DQHA 4LRAA 1FEHA 1UDOA 4WPAA 4OHVA 1ITPA 1UPPA 3M8PB 4DR4E 4J3DA 2NUHA 2PA3A 5EX3A 2DKOB 1FDNA 4OYOA 1KLMB 1T95A 2UU9E 3HSZA 1FXRA 4NL5A 4QWCA 4RBUA 4DV1J 1CEZA 2PEBA 3H4BA 3NL0A 1CJTB 3A3PB 4ZITA 1KN6A 1S1XA 3LAMA 1WEYA 1SH3A 1N32F 1RYSA 3QWUA 2CG9A 4OZNA 3TA2A 4WIIA 4DSJA 4X4PA 4FW3A 5LMUE 2KO1A 1RT6A 1T11A 2R8IA 1U24A 5GAGU 3QT6A 2CDRB 2Y1LB 1HLWA 2A2DA 3JQKA 1WC5A 2VUGA 3ZTQA 2JDJA 1L5UA 4DU8A 3H20A 3GJQB 2GVZB 1YJWS 1EIYB 2YNGA 1U0HB 2DNYA 2V4JB 1Q8LA 4ZLPA 4JV5I 1YWXA 2BKPA 2RQMA 4WBFA 5E7OB 2R2SA 4NYPA 1IXKA 2JEBA 4CLZA 2FLOA 2JLGA 4O3NA 3UDEA 5F9NA 3QAUA 5EUHA 2QA2A 2EK6A 4P2MA 2ZH4A 4S0MA 5HAOA 4LFBF 5D8HB 3P3CA 2ZWOA 2BOAA 3HPOA 2V8HA 4DV4I 1RKIA 4IO9Q 2D74B 1S0MA 2UVRA 2DR8A 1WHWA 4F2SA 2IC3A 4JI8I 3DLKA 3MHYA 2UXCI 4PXEA 1M90T 1XERA 2B4UA 3JS9A 2CIMA 5CYMB 2XM3A 1SKRA 4RW6A 3TEHB 2X3GA 3DOMA 2NCKL 1VRQC 2CDQA 4TLRA 4DX6A 4CO3A 1B4SA 3QQCD 2R7TA 2XGPA 3VAMA 2V8VA 2KT3A 5LMNI 2XZWA 4ICLA 2PI4A 2UXBJ 4IQXA 4JI1I 4KQZA 1BWVA 1H7WA 1T9WA 3MM6B 2HHHJ 1U1PA 1N6QA 2PA8D 1I3OB 4FKYA 1Z0BA
chains in the Genus database with same CATH topology
3GONA 2ZBKB 4DV4E 1N32I 1MG7A 4AQYE 3WU4A 4GKKE 2OI2A 4JI2E 4DUZE 4B3ME 2V2ZA 3J80C 3PYEA 1PVGA 5LMUI 4JI8E 1N34E 2A2CA 4DUYI 4X62I 2UXCE 3QT8A 4B3RE 1HR0I 1XNRI 2F4VE 1IBME 2BM1A 1EA6A 3HULA 1N0UA 4DV5I 4JI0E 1H72C 4MYUA 4KHPI 1RR9A 3WU5A 1Y4SA 1HNXE 4JI6E 4DV2I 2UXDI 3HJCA 4YHHI 4JI4I 3OTOI 5FWKA 2Z5BB 1PKPA 4LF5E 4IZJB 2AJ4A 4X66I 4IZJD 3LTOA 4GKJI 1XNQI 4X65E 3PYDA 2UUCI 1J5EI 3J81C 1NHHA 2WW4A 2O1VA 4YY3E 3QT7A 2X36A 5BR8E 4JI1E 4DV1I 3B78A 1NHIA 3CWVA 2UUAE 2PNMA 1XMOE 4FW9A 4HACB 2HK3A 2ZM6E 2X7IA 1KVKA 3PYGA 4DR7E 1H7SA 2VQFI 1FNMA 4B3TE 4LFBI 4DPYA 1IBKE 4Z7YA 2E5LE 1ZM4A 1DARA 1EI1A 1N32E 1KKHA 2GS8A 1MX0A 1Z5BA 3F0NA 3K1JA 1OJ4A 4PU9A 1N33E 3ZZUA 4LFCI 2O1TA 1XMQI 1Z0CA 4DUYE 2UU9I 4DR1I 4X62E 4DU7A 5A2QQ 3WU6A 1HR0E 4DV0I 1XNRE 3WU3A 4NXMI 5FLXQ 1HNZI 1Z0WA 2VF3A 2VQEI 3K85A 4LF8I 2IOQA 4DV5E 4DR6I 4KHPE 1FWKA 4KQVA 2UXDE 3Q6NA 4YHHE 4JI4E 1HK7A 3OTOE 4DR2I 4OX9E 3H4LA 1Y4UA 1IBLI 1VISA 4X64I 4URLA 4K0KI 2E1RA 2HKEA 4X66E 1A6FA 1B62A 1ZM2A 4ED4A 2Q2EB 4GKJE 4B3SI 1XNQE 2R3VA 4IZKB 3K17A 4LF7I 2UUCE 1RREA 1ELOA 1XHKA 1J5EE 1ZM9A 2CGEA 4DV1E 4I3HA 1UEKA 4DV3I 1BKNA 5IT9C 4PRXA 4JYAI 4LFAI 3ZZ0A 2VQFE 4JI7I 4JI3I 1USUA 4N3OA 4LFBE 1Z59A 4DV6I 3M6AA 3JAMC 3T1HI 4MYTA 4DR4E 2EFGA 4UTGA 4XTJA 4JI5E 5LMNE 4LFCE 4DUZI 3QT5A 4DPUA 2DEJA 2V2QA 1XMQE 1HNWI 2UU9E 4P7AA 4DR1E 4JG4A 1Z5CA 1Z0VA 1HNZE 2R42A 4LF8E 2Z5CA 4JI0I 4DR6E 3T1YI 2HFUA 3J80Q 1U2RA 1FJGI 2CG9A 4WUDA 2GQ0A 4WUBA 4DV7I 4DR2E 4DR5I 4NXNI 4EMDA 1IBLE 4HYMA 2NPFA 4X64E 4K0KE 5LMUE 3ZKBA 1KTVA 1FKAE 3QT6A 1S16A 4B3SE 3B8HA 2A2DA 3ZKDA 1H73A 1ZXMA 2UXBI 4LF7E 2XEXA 2V2VA 4R1FA 3LPSA 2E5LI 4M1KA 3J7AG 4LF6I 4DU8A 1KIJA 4FWDA 4UT4A 2HHHI 4DV2E 4DV3E 3J7AM 3ZM7A 4JYAE 5IWAI 4LFAE 4JI7E 4JI3E 1D6TA 3J81Q 3ZZTA 4LF4I 4JV5I 4DR3I 4DV6E 4LF9I 1FWLA 3T1HE 2BV3A 2Z5BA 4FWHA 4IZJA 4Z7CA 1N33I 1HNWE 1NZ0A 1N0VC 1N36I 2Z5EA 1PIEA 2J7KA 3LNUA 2HK2A 1ZM3A 4USKA 2CZ9A 1ZXNA 1I94I 1FI4A 3T1YE 4HACA 3D4JA 5A2QC 4HXZA 3V5RA 2UUBI 1FJGE 4DV4I 1WUUA 1K47A 4DV7E 4AQYI 5FLXC 4DR5E 4OX9I 4NXNE 4GKKI 4ZVIA 4JI2I 4DPTA 4B3MI 1N34I 4JI8I 3B82A 2UXCI 4B3RI 4DV0E 4NXME 1H7UA 2F4VI 3PRYA 2IOPA 2UXBE 1IBMI 2PNLA 1USVA 2O1UA 5LL6R 2VQEE 4LF6E 1B63A 4DPXA 3PYFA 2HFSA 2HHHE 4USMA 1HNXI 4JI6I 5GMEA 1H74A 4FN5A 1MU5A 5IWAE 2BM0A 3V2UC 1Z5AA 4LF5I 2O1WA 4LF4E 4JV5E 4RPFA 1Y6ZA 4DR3E 3P06A 4HY1A 4LF9E 1Z0TA 4X65I 5L3JA 4DR4I 1Z0EA 3Q1QA 5IT9Q 4JI5I 2V8PA 5LMNI 4YY3I 4P52A 2DEIA 5BR8I 4IZKA 1QZRA 4JI1I 3Q6MA 4DXLA 2Z5CB 1N36E 2UUAI 3JAMQ 1XMOI 2ZM6I 4DPWA 1NHJA 2ZITA 2HKJA 4DR7I 1S4EA 2LJPA 4WUCA 4FWGA 5GMDA 4PRVA 2V34A 4B3TI 1Z0GA 1I94E 1IBKI 1Z0BA 2UUBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GON A;  2ZBK B;  4DV4 E;  1N32 I;  1MG7 A;  4AQY E;  3WU4 A;  4GKK E;  2OI2 A;  4JI2 E;  4DUZ E;  4B3M E;  2V2Z A;  3J80 C;  3PYE A;  1PVG A;  5LMU I;  4JI8 E;  1N34 E;  2A2C A;  4DUY I;  4X62 I;  2UXC E;  3QT8 A;  4B3R E;  1HR0 I;  1XNR I;  2F4V E;  1IBM E;  2BM1 A;  1EA6 A;  3HUL A;  1N0U A;  4DV5 I;  4JI0 E;  1H72 C;  4MYU A;  4KHP I;  1RR9 A;  3WU5 A;  1HNX E;  4JI6 E;  4DV2 I;  2UXD I;  4YHH I;  4JI4 I;  3OTO I;  1PKP A;  4LF5 E;  2AJ4 A;  4X66 I;  3LTO A;  4GKJ I;  1XNQ I;  4X65 E;  3PYD A;  2UUC I;  1J5E I;  3J81 C;  1NHH A;  2WW4 A;  4YY3 E;  3QT7 A;  2X36 A;  5BR8 E;  4JI1 E;  4DV1 I;  3B78 A;  1NHI A;  3CWV A;  2UUA E;  4FW9 A;  1XMO E;  4HAC B;  2HK3 A;  2ZM6 E;  2X7I A;  1KVK A;  3PYG A;  4DR7 E;  1H7S A;  2VQF I;  1FNM A;  4B3T E;  4LFB I;  4DPY A;  1IBK E;  4Z7Y A;  2E5L E;  1ZM4 A;  1DAR A;  1EI1 A;  1N32 E;  1KKH A;  2GS8 A;  1MX0 A;  1Z5B A;  3F0N A;  3K1J A;  1OJ4 A;  4PU9 A;  1N33 E;  3ZZU A;  4LFC I;  1XMQ I;  1Z0C A;  4DUY E;  2UU9 I;  4DR1 I;  4X62 E;  4DU7 A;  5A2Q Q;  3WU6 A;  1HR0 E;  4DV0 I;  1XNR E;  3WU3 A;  4NXM I;  5FLX Q;  1HNZ I;  1Z0W A;  2VF3 A;  2VQE I;  4LF8 I;  4DV5 E;  4DR6 I;  4KHP E;  1FWK A;  4KQV A;  2UXD E;  4YHH E;  4JI4 E;  3OTO E;  4DR2 I;  4OX9 E;  3H4L A;  1IBL I;  1VIS A;  4X64 I;  4URL A;  4K0K I;  2E1R A;  2HKE A;  4X66 E;  1A6F A;  1B62 A;  1ZM2 A;  4ED4 A;  2Q2E B;  4GKJ E;  4B3S I;  1XNQ E;  2R3V A;  3K17 A;  4LF7 I;  2UUC E;  1RRE A;  1ELO A;  1XHK A;  1J5E E;  1ZM9 A;  4DV1 E;  4I3H A;  1UEK A;  4DV3 I;  1BKN A;  5IT9 C;  4PRX A;  4JYA I;  4LFA I;  3ZZ0 A;  2VQF E;  4JI7 I;  4JI3 I;  4LFB E;  1Z59 A;  4DV6 I;  3M6A A;  3JAM C;  3T1H I;  4MYT A;  4DR4 E;  2EFG A;  4UTG A;  4XTJ A;  4JI5 E;  5LMN E;  4LFC E;  4DUZ I;  1Z0B A;  3QT5 A;  4DPU A;  2DEJ A;  2V2Q A;  1XMQ E;  1HNW I;  2UU9 E;  4P7A A;  4DR1 E;  4JG4 A;  1Z5C A;  1Z0V A;  1HNZ E;  2R42 A;  4LF8 E;  4JI0 I;  4DR6 E;  3T1Y I;  2HFU A;  3J80 Q;  1U2R A;  1FJG I;  4WUD A;  4WUB A;  4DV7 I;  4DR2 E;  4DR5 I;  4NXN I;  4EMD A;  1IBL E;  4HYM A;  2NPF A;  4X64 E;  4K0K E;  5LMU E;  3ZKB A;  1KTV A;  1FKA E;  3QT6 A;  1S16 A;  4B3S E;  3B8H A;  2A2D A;  3ZKD A;  1H73 A;  1ZXM A;  2UXB I;  4LF7 E;  2XEX A;  2V2V A;  4R1F A;  3LPS A;  4M1K A;  3J7A G;  4LF6 I;  4DU8 A;  1KIJ A;  4FWD A;  4UT4 A;  2HHH I;  4DV2 E;  4DV3 E;  3J7A M;  3ZM7 A;  4JYA E;  5IWA I;  4LFA E;  4JI7 E;  4JI3 E;  1D6T A;  3J81 Q;  3ZZT A;  4LF4 I;  4JV5 I;  4DR3 I;  4DV6 E;  4LF9 I;  1FWL A;  3T1H E;  2BV3 A;  4FWH A;  4Z7C A;  1N33 I;  1HNW E;  1NZ0 A;  1N0V C;  1N36 I;  1PIE A;  2J7K A;  3LNU A;  2HK2 A;  1ZM3 A;  4USK A;  2CZ9 A;  1ZXN A;  1I94 I;  1FI4 A;  3T1Y E;  4HAC A;  3D4J A;  5A2Q C;  4HXZ A;  3V5R A;  2UUB I;  1FJG E;  4DV4 I;  1WUU A;  1K47 A;  4DV7 E;  4AQY I;  5FLX C;  4DR5 E;  4OX9 I;  4NXN E;  4GKK I;  4ZVI A;  4JI2 I;  4DPT A;  4B3M I;  1N34 I;  4JI8 I;  3B82 A;  2UXC I;  4B3R I;  4DV0 E;  4NXM E;  1H7U A;  2F4V I;  2UXB E;  1IBM I;  5LL6 R;  2VQE E;  4LF6 E;  1B63 A;  4DPX A;  3PYF A;  2HFS A;  2HHH E;  4USM A;  1HNX I;  4JI6 I;  5GME A;  1H74 A;  4FN5 A;  1MU5 A;  5IWA E;  2BM0 A;  3V2U C;  1Z5A A;  4LF5 I;  4LF4 E;  4JV5 E;  4RPF A;  4DR3 E;  4HY1 A;  4LF9 E;  1Z0T A;  4X65 I;  5L3J A;  4DR4 I;  1Z0E A;  3Q1Q A;  5IT9 Q;  4JI5 I;  2V8P A;  5LMN I;  4YY3 I;  4P52 A;  2DEI A;  5BR8 I;  1QZR A;  4JI1 I;  4DXL A;  1N36 E;  2UUA I;  3JAM Q;  1XMO I;  2ZM6 I;  4DPW A;  1NHJ A;  2ZIT A;  2HKJ A;  4DR7 I;  1S4E A;  2LJP A;  4WUC A;  4FWG A;  5GMD A;  4PRV A;  2V34 A;  4B3T I;  1Z0G A;  1I94 E;  1IBK I;  2E5L I;  2UUB E; 
#chains in the Genus database with same CATH topology
 3VTI A;  1Q5V A;  2RSQ A;  2J9D E;  3A13 A;  4GRS A;  2CPY A;  1KFD A;  1HIY A;  5D0R A;  3U02 A;  3MUT P;  5ETV A;  2NSB A;  1U0S A;  1JKH A;  1TKT A;  1EHW A;  3DLG A;  1FXL A;  3TJ9 A;  3L09 A;  3KJF B;  2MJN A;  1Y4S A;  3CF5 Q;  2JEA B;  3OTO I;  3TZX A;  4LF2 A;  4KO0 B;  2GA7 A;  2UUB J;  3CNQ P;  2AJ4 A;  1JLG B;  1X9S A;  1ZTT A;  5DDP C;  4GKK J;  1Y11 A;  3G8T A;  1FKP B;  4NBQ A;  2HVI A;  2FC8 A;  4AUK A;  4LT6 A;  4Y00 A;  1N34 J;  2EWH A;  3BF4 A;  2A0F B;  3PS1 A;  1T9Y A;  3I0S B;  2XI3 A;  4MK7 A;  2RDD A;  4C7Q A;  3CC4 S;  1SB6 A;  4HLB A;  2CZ4 A;  3ONQ A;  3RBD A;  1D9D A;  1U1K A;  3OTE A;  3CPW R;  5FII A;  3BBC A;  2PO2 B;  1R6Y A;  4N5S A;  3KK3 A;  4DR7 E;  3OFE A;  4JI6 J;  1SIZ A;  2EXU A;  4NA2 A;  1EZZ B;  5DRO A;  2VPW B;  2YH1 A;  3GFX A;  3LP1 B;  3IGV A;  4R0J A;  2JT2 A;  1F6T A;  2UU9 I;  4DU7 A;  3JYT A;  4WU3 A;  2VJV A;  4FVC A;  3KUE A;  2YY3 A;  1U1Q A;  1ZBT A;  2WB4 A;  5D4O A;  2J9D A;  2J76 E;  1RWO B;  4PG6 A;  2WON B;  2FJE B;  3DDN A;  4QJV A;  1Q1K A;  1F1B B;  4MIW A;  3SI8 A;  3AD7 C;  2XSJ A;  4KJI A;  4IO1 A;  2PO4 A;  3ZFV A;  3FCW A;  3M8P A;  1QAI A;  1ZM2 A;  1IWG A;  2R2U A;  1XNQ E;  1TL5 A;  4RL1 A;  1C4A A;  2Q6C A;  4I6Y A;  5IV4 A;  1S6Q A;  3OJU A;  4BA1 B;  3CJ0 A;  4K5R A;  4CO1 A;  3LP0 B;  1VQO S;  4C9D A;  2HND A;  1BKN A;  4YHH J;  2FDN A;  2LXU A;  2HHT A;  1RI7 A;  4PG4 A;  2MGZ A;  3JAM C;  3MWB A;  2AEM A;  2AF6 A;  4OMF G;  5BYQ A;  5IM0 A;  5BR8 F;  2FTR A;  2RQK A;  4DR1 E;  1XMO F;  2EFQ A;  2B7B B;  5C42 A;  1HBO B;  1Z0V A;  3BB5 A;  2C3U A;  2D3O 1;  4DS5 A;  4UZB A;  1HQU B;  1NAQ A;  2FJW A;  2W4P A;  3HT0 A;  3RYL A;  2GHP A;  2X3D A;  5A0Y A;  2V4J A;  2UV8 G;  1W2B R;  1D1U A;  4HYM A;  1RTJ A;  2K3I A;  2QL7 B;  2V6A A;  4CLL A;  3DDK A;  1ZAW A;  4I7F A;  1KVJ A;  1WEZ A;  4B02 A;  5DDR C;  1XNR F;  4RW7 B;  1KBR A;  1X5S A;  3AT1 B;  4B08 A;  1U1R A;  3IC1 A;  3OHB A;  3FVY A;  5LSL A;  2H3E B;  3TUJ C;  5IT0 A;  5D4P A;  4WFX A;  3NCR A;  2K1R B;  4K59 A;  5EGY A;  5KTQ A;  2ZJQ Q;  2V9W A;  3GIR A;  1JLF A;  1HW8 A;  3NGT A;  1QAY A;  3BN4 A;  4CO5 A;  3TEG A;  1CQM A;  3T1H E;  3KK2 A;  3L95 X;  5D3G B;  1S10 A;  4I6A A;  4OHY A;  2HLT A;  2HGN A;  5ETT A;  1FK9 B;  2OPS B;  3B4D A;  3CCZ A;  3M32 A;  1VJW A;  1ZA1 B;  2ZKU A;  1ZXN A;  1JIH A;  1OY9 A;  1HFE L;  3D4J A;  4OFZ A;  1YRT A;  4FF1 A;  5SUH A;  5J2Q B;  5FLX C;  2NUU G;  3CW2 C;  3GYN A;  1D8Z A;  3OFG A;  5K5M A;  3PIO Q;  1TMM A;  1N5V A;  3KUG A;  4XK8 C;  2G2Y A;  4F36 A;  5D78 A;  2CJQ A;  3THP A;  1S0O A;  4DV0 E;  3L7O A;  4CH1 A;  1WC4 A;  4FS2 A;  3MI7 X;  3JTP A;  3EYZ A;  2C2K B;  2WVB A;  2DRD A;  4OHZ A;  5KFT A;  4ES1 A;  2ATL A;  2PO1 B;  3DOL B;  4RX6 A;  1U25 A;  2F9J A;  3K5P A;  3CDE A;  1GQE A;  3DRR B;  1SXL A;  4IKA A;  4LF4 E;  4TQS A;  4DR5 J;  2QMX A;  4DR3 E;  1TU0 B;  1SH0 A;  4F7V A;  3DC2 A;  2KVI A;  3MEC A;  2W01 A;  4WU2 A;  4LSN B;  2IY5 B;  4FVM A;  5B0G A;  3R5G A;  1RAC B;  2PMW A;  4P52 A;  1S9G B;  3HVT B;  3A1Y G;  3IBW A;  1CC7 A;  1VBZ A;  1RHM B;  2WSC C;  4DR7 I;  1LWC A;  1TKD A;  4K50 A;  1JXV A;  1OYD A;  4DL4 A;  2FB0 A;  2LEB A;  1NKC A;  2NN6 B;  4AQY E;  2DTJ A;  3MM5 A;  3D0I E;  3BEG B;  1FJ7 A;  4B9S A;  4ELU A;  1UFK A;  2LU2 A;  4P71 A;  4A4J A;  5C0X A;  1XR6 A;  3G8S A;  3KOA A;  5CD4 A;  3TRG A;  4TYA A;  2BM1 A;  2LEP A;  4DCP B;  3TO8 A;  1BQN A;  2BQ3 A;  2RNE A;  4MKV A;  3QGG A;  2BX6 A;  3WHI A;  4ZDN A;  4FKX A;  3GMG A;  5KFK A;  4QYZ J;  3DGP A;  3I31 A;  4IFD E;  4YR3 A;  1R0C B;  4CI0 B;  3I4H X;  2Z5B B;  1PKP A;  3PKY A;  4UZC A;  4CT9 A;  3ETO A;  3LTO A;  3NY0 A;  2EBG A;  1XNQ I;  1KNZ A;  3A8J A;  5LSR A;  4B3M J;  3QYY A;  1WOR A;  5KT3 A;  4NLU A;  3KJV A;  3QT7 A;  3QSI A;  1T03 B;  3MM8 B;  5KFZ A;  4JI0 J;  2HK3 A;  2ZM6 E;  4YQW A;  3PYG A;  2DNH A;  3CJQ A;  1DTT B;  4F3Q A;  4FW6 A;  2DVI A;  3AOD A;  3AD9 C;  1IBC B;  2L48 A;  2BJ3 A;  4AD6 A;  4NZ7 A;  2MXY A;  2RQ4 A;  1HNI B;  3R97 A;  1N33 F;  3T19 A;  5I3Q A;  2ROG A;  5J2N B;  1LKZ A;  5CCL A;  1N36 F;  1RT4 B;  2RU9 A;  5CXT A;  4DR1 I;  4WTY A;  3RW7 A;  2YKA A;  4N7T A;  4HL9 A;  3FEX B;  2X1B A;  2XC9 A;  4AFF A;  2NR0 A;  3PJ9 A;  2V8D A;  1CVJ A;  3CCQ S;  3R2D J;  2OJ3 A;  4OYX A;  2C38 B;  1B3T A;  1D09 B;  1SI9 A;  1IBK J;  4KR0 B;  4OJ3 A;  3VQS A;  1YLX A;  2MTL A;  3PDN A;  4NEZ A;  4F4W A;  4O23 A;  2C2O B;  2R3V A;  4IZK B;  1RE1 B;  3TX8 A;  4M95 A;  4UY8 5;  3FZB A;  3UDV A;  2B5J A;  2BE9 B;  3LWM A;  1HR0 J;  2XMT A;  3EZU A;  1RAH B;  1VC0 A;  3HSG A;  1PSD A;  3AD8 C;  5GAE U;  6FD1 A;  3I5A A;  3TUI C;  4J9V A;  2LDY A;  5IT9 C;  1LK7 A;  2DH8 A;  1U48 A;  1UVM A;  2ZBC A;  4USW A;  5K8N A;  2IM1 A;  3T1H I;  2G1H A;  1F5C A;  2MKJ A;  4JI5 E;  4G1Q A;  2NRE A;  5JEA E;  4B3R J;  3NLC A;  3W2W B;  3OHA A;  3QT5 A;  4AXJ A;  2AT1 B;  2UUC J;  5JVG Q;  3AXM A;  3R5D A;  2ADC A;  2X1G A;  5CH7 B;  1NJX A;  3PW2 A;  3T41 A;  1VR6 A;  4LF8 E;  1U1O A;  1KP6 A;  4K8R A;  2WP8 B;  2OIH A;  1L3V A;  1RAE B;  4DFP A;  3M6V A;  3BO3 A;  2R9L A;  2OPR A;  1SKU B;  3WBZ A;  4M94 A;  2DGS A;  3UFC X;  2XMU A;  4EBE A;  2MQM A;  2OML A;  1RIS A;  1RU1 A;  4U6P A;  5HO4 A;  4IG0 A;  3H2L A;  2M88 A;  3KG4 A;  1XMQ J;  2XEX A;  3CJ4 A;  4F0K A;  2KM8 C;  1VIO A;  4DV5 F;  2W25 A;  4YDD B;  4KY3 A;  3OR2 B;  2UXD F;  1HNZ J;  4DV2 E;  5KT5 A;  1PC5 A;  4JI4 F;  5KOX A;  4IG3 B;  1S1T B;  3ZM7 A;  4DX5 A;  2RF2 A;  4LFA F;  2DGV A;  2BKO A;  2DRB A;  3UVJ A;  5FDL B;  2FIU A;  4C4W A;  4LF4 I;  1I1G A;  1WI6 A;  4O4G A;  2GJI A;  4DR3 I;  3CCU S;  3IG1 A;  2MHN A;  3TQ1 A;  1SIW B;  2BRL A;  5F0W A;  3N4W A;  3PJX A;  3TYT A;  5I3P A;  5ITH A;  5FLX Y;  2G2O A;  4OHX A;  1TL4 A;  4N8O A;  5D15 A;  2B4O A;  2XNQ A;  2R8G A;  2HVH A;  1JLC A;  2J7K A;  1CBK A;  2IM2 A;  1TEL A;  3GFZ A;  4KRW A;  4U67 Q;  4HHH A;  2HQD A;  4OZ3 A;  2PO0 B;  1RTH B;  5F3T A;  4AQY I;  1NEE A;  2FGO A;  3GIM A;  3D28 A;  1S1W B;  3EVM A;  3BGF A;  3K0J A;  3ILL A;  1WKL A;  3KUH A;  1ZS6 A;  4OJG A;  3MEE A;  3G2X A;  3T6J A;  4NCB A;  5DLF A;  1NB7 A;  1R6L A;  2L41 A;  4QYZ K;  1EB0 A;  5IWA E;  3OR1 B;  2WSE C;  1QVG R;  3CUL A;  4RPF A;  4DL0 C;  5F3Z A;  2CQB A;  2PNZ A;  3MCO A;  4HY1 A;  3ILJ A;  3U1K A;  4LF9 E;  2CUY A;  2M0G B;  4OYW A;  5DRK A;  3ZXW A;  1M5V C;  2DR6 A;  4LRF A;  4XPE A;  1Q4R A;  3NP5 A;  1UVN A;  2KL8 A;  4K2J A;  1V6H A;  2VQE J;  2E5H A;  1SC1 B;  4F67 A;  3JAM Q;  5HJX A;  1C0T B;  2G0C A;  2ZM6 I;  5ETS A;  1W7W A;  1RWM B;  1TV6 B;  1SKW A;  2L3M A;  4PR6 A;  3AHP A;  3NNA A;  2MLX A;  1WG4 A;  4ER8 A;  5KFQ A;  4K0K J;  2LQJ A;  5KFU A;  3WU4 A;  4CNY A;  3THV A;  3Q8V A;  4C11 A;  2VD3 A;  2AHO B;  3RBX A;  1JXL A;  4B3R E;  1UWB B;  2R4F A;  2QSF A;  4I2Q B;  3POT A;  3ELH A;  4L6V 3;  4IYQ A;  2OEK A;  3NGD A;  4EFA C;  3M8S A;  4H54 A;  2GZO A;  4N8N A;  1RHU B;  3IRX B;  3HXM A;  1B0V A;  1U8W A;  1T94 A;  1DTT A;  1VDH A;  3D3B J;  1PAU B;  3UCU P;  5FWK A;  3UCG A;  1V9O A;  3QFH A;  2MKY A;  4LVN P;  1HNI A;  1HPZ B;  4AIM A;  4NI2 A;  3M9N B;  3PW7 A;  3MEG B;  5F8H A;  4NLG A;  2JZ5 A;  1GXU A;  1Q82 T;  3MCS A;  4JP8 A;  2JJ4 D;  2W7P A;  5HMX A;  4PQA A;  2KT5 A;  3BGO P;  2PNM A;  2X7I A;  2LLZ A;  2BE7 D;  3NAH A;  2YKN A;  3ADA C;  4JV5 F;  1X5P A;  4KV8 B;  4AXI A;  4XO0 A;  2Z30 B;  2UZA A;  3HHD A;  4BA2 B;  3ZZU A;  2BAN A;  1TTH B;  3A4T A;  1K44 A;  4MJK A;  1F0X A;  2P9C A;  4IFV B;  2Y3Y A;  4KGV B;  5FLX Q;  1MMN A;  3M8Q B;  4LF8 I;  2NN6 F;  1UFW A;  1WHY A;  5I4M A;  3NEK A;  4DV4 F;  1MRO B;  4OX9 E;  3VVT A;  2LU1 A;  3LGN A;  1TVR A;  1OWX A;  4URL A;  1N32 J;  3IGN A;  5EKW A;  5IT9 Y;  2J0Q D;  3NGK A;  3W2W A;  4M5J A;  1KQS R;  1YIT S;  2PT0 A;  2H48 B;  2LMI A;  1ZM9 A;  5AXL A;  5KFM A;  4BBY A;  1HWL A;  4A8Y A;  2BQR A;  2P6T A;  1PJ6 A;  3QPI A;  4KKO B;  4PG7 A;  1H2V Z;  2AW0 A;  3IO1 A;  1R8A A;  3NCQ A;  4MU3 A;  5C25 A;  2EG1 A;  4UTG A;  5LMN F;  2FHJ A;  3MF5 A;  2Q1L A;  3E51 A;  4F0M A;  1HI1 A;  3D67 A;  3QSY B;  4AID A;  4OO1 E;  1HL6 A;  3D6H B;  3JAM U;  4JI1 F;  4CRJ A;  3SSR A;  3KLG A;  4LSL B;  3MMB B;  4DFK A;  5E3A A;  3MPD A;  1U02 A;  3I87 A;  4K4U A;  2Y1J A;  3KMQ A;  3QO9 A;  2W7A A;  4RO0 A;  4JI0 I;  1HWJ A;  3KLI A;  3LP2 B;  2AWZ A;  2WBR A;  2WVD A;  3GQC A;  2OEM A;  4J9U E;  1YG0 A;  4LFB J;  2VC0 A;  1LXN A;  2A6M A;  4K0K E;  2ACY A;  2RUS A;  3FEZ A;  1FKA E;  2BW2 A;  1FVS A;  3M7V A;  1S16 A;  3FBC A;  2ZH6 A;  1JJ2 R;  1VGY A;  3M4X A;  2ZH3 A;  5J2P B;  1FES A;  5HP1 A;  4UUW A;  4MTP A;  1S76 D;  1K8A T;  1NK7 A;  2YKP A;  2JRS A;  4K4W A;  3OTO F;  1B7F A;  2MPU A;  4IDK B;  3OLA A;  2A3J A;  3CD0 A;  1HHQ A;  5IWA I;  2I0X A;  2GO9 A;  4P2S A;  2ZWP A;  4LF9 I;  1U6B A;  4O0N A;  3C6U A;  4CO0 A;  3MFH A;  1WNE A;  4PWU A;  1X7V A;  2VHG A;  2Z2Y B;  4IUF A;  4KBI A;  1B0P A;  2CJY B;  2D9O A;  3ZTR A;  2JX2 A;  1R6M A;  4F2R A;  3GJR B;  4PUO A;  4OO1 A;  2KN4 A;  2GAH C;  4A8X A;  2BJE A;  5KFJ A;  1P1L A;  1ZZN A;  3PV8 A;  1WD6 A;  5B0E A;  3RB4 A;  2OH2 A;  3HFV A;  4DPT A;  4USV A;  4U3D A;  2WRM A;  1KWM A;  2NXJ A;  2VB6 A;  4B3R I;  2OPQ A;  5E2Q A;  1IR1 A;  2JL9 A;  5LL6 R;  3PXG a;  2N3L A;  4OI3 A;  3CWJ A;  2ZBR A;  4ECZ A;  1R6V A;  2G0I A;  4Q43 A;  3OJS A;  3P3E A;  1WKK A;  4ETZ A;  2MLZ A;  4IFY A;  3MTJ A;  3V2U C;  1YBT A;  1U1M A;  5AJ3 F;  2VDH A;  4OYB A;  1KON A;  2FYX A;  3PO5 A;  5C2C A;  4RNN A;  5IT9 Q;  3FBF A;  5B