3F0NA

Mus musculus mevalonate pyrophosphate decarboxylase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
401
structure length
387
Chain Sequence
RENLYFDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNGREEDVGQPRLQACLREIRRLARKDTLPLSLSYKVHVASVNNFPTAAGLASSAAGYACLAYTLAQVYGVEGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWHWPQLRILILVVSADKQTGSTVGMQTSVETSTLLKFRAESVVPERMKEMTRCIQEQDFQGFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHHGQTKVAYTFDAGPNAVIFTLEDTVAEFVAAVRHSFPPAANKFLKGLQVAPVLLSDELKAALVVEPSPGGVQYIIATQVGPGPQVLDDTHDHLLGQDGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Mus Musculus Mevalonate Pyrophosphate Decarboxylase
rcsb
source organism Mus musculus
molecule tags Lyase
molecule keywords MEVALONATE PYROPHOSPHATE DECARBOXYLASE
total genus 127
structure length 387
sequence length 401
chains with identical sequence B
ec nomenclature ec 4.1.1.33: Diphosphomevalonate decarboxylase.
pdb deposition date 2008-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF18376 MDD_C Mevalonate 5-diphosphate decarboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3f0nA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3f0nA01
2HHHE 4R1FA 4DR4E 4DPWA 4HXZA 4GKKE 2E1RA 4DV7I 4DR1I 2BV3A 4HYMA 1RREA 4B3RE 2X7IA 4WUCA 4DPXA 3QT6A 4X64I 4LF5E 1Z59A 4AQYE 2BM0A 1D6TA 4DR1E 3J7AG 4FWHA 1H7SA 4GKKI 3F0NA 2UU9E 1NHJA 1ELOA 3WU3A 1XMOI 1ZXMA 1FJGE 1B62A 2VF3A 1N36E 4HY1A 2UUCE 4JI0E 5LMNE 3OTOE 1I94E 4NXNI 5BR8I 1H72C 4JV5I 4JI4E 5LMUE 3LPSA 4JI0I 4OX9I 1HNZI 2V34A 4GKJE 4DPTA 2V2QA 2UXDI 1I94I 5LMNI 2HFUA 4LF7E 1N33I 3QT8A 4DV6E 4Z7CA 4B3ME 3JAMQ 4JG4A 5L3JA 4EMDA 3LTOA 4JI3E 4PRXA 2UUAE 1IBKE 1Z0WA 1Z0GA 2LJPA 1Z0BA 3JAMC 2V2VA 4XTJA 2UXDE 2UXCE 3ZM7A 4LF6E 4DV7E 2E5LE 4DV3I 1MG7A 3ZKBA 1PKPA 5BR8E 3V5RA 4JI1E 2VQFE 2GS8A 2UUBE 4DR7E 4JI1I 4P52A 1HNWI 4M1KA 1XMQI 4ZVIA 2VQEE 1N34E 4JI5I 2Q2EB 4UT4A 3QT5A 4WUBA 4DV5I 2HKJA 5GMEA 1N0UA 4DXLA 3WU5A 2HFSA 2F4VI 4DUYI 1J5EE 3PYEA 4DV1I 4JI2E 4DR5E 1EA6A 1IBMI 1FI4A 1XNQE 1PVGA 4LF4E 4JI6I 2EFGA 4URLA 1K47A 1XNQI 1RR9A 1A6FA 4B3TI 2X36A 4YHHI 2HKEA 3PYDA 1N32I 1IBLI 1N33E 4B3SI 3J7AM 2A2CA 4JI4I 3B78A 4B3MI 4LF4I 4DV6I 2A2DA 3ZKDA 4DPYA 4DV5E 4LFBE 2UXBE 3T1YI 1PIEA 1HNZE 1XMQE 4JYAE 1Z0EA 1N0VC 1J5EI 2NPFA 4JV5E 3HULA 4DV0I 4LF8E 4DV3E 1KTVA 4JI8I 3H4LA 4DR3E 1FJGI 4X62E 4USMA 2ZBKB 1XNRE 1U2RA 4X66E 4DV4I 2UUBI 2XEXA 4DR2I 3V2UC 2ZM6E 1H73A 4YY3I 3PYGA 2HK2A 4LF5I 5GMDA 2F4VE 4USKA 2CZ9A 2R42A 1B63A 1MX0A 4LFAI 4DPUA 1UEKA 2V8PA 4DV4E 4LF6I 4JI5E 4LF7I 2UXCI 4DV0E 4X62I 4DUZE 1MU5A 4KQVA 4JYAI 1HR0I 3Q1QA 3M6AA 1ZM3A 5FLXC 1DARA 1IBKI 5LMUI 4FW9A 2HHHI 4LF8I 1HNXE 3D4JA 3OTOI 4JI7E 4LFCE 1IBLE 1KKHA 4YHHE 3LNUA 4HACA 4I3HA 1HR0E 4HACB 1HNWE 3K1JA 1EI1A 4B3SE 1H74A 3T1YE 1WUUA 5A2QC 4NXME 4LFBI 1S4EA 1BKNA 4LFAE 4LFCI 1Z5CA 4ED4A 1XMOE 4FWGA 2UUAI 2J7KA 4FWDA 4RPFA 2UU9I 2V2ZA 2AJ4A 2UUCI 5A2QQ 1ZM2A 4B3RI 1XHKA 4WUDA 5IWAI 4X64E 1XNRI 4DU7A 2BM1A 1ZM4A 4DUYE 4DR2E 4KHPI 3J80C 5LL6R 5IT9Q 4P7AA 4AQYI 2ZITA 2VQFI 4X66I 4DR5I 4X65E 4DR6I 1NHIA 4JI3I 4JI7I 1Z5AA 3ZZTA 4YY3E 3J80Q 4DU8A 4Z7YA 5IT9C 4DR6E 2DEIA 4NXMI 2UXBI 1NHHA 1OJ4A 4MYTA 4LF9I 2DEJA 3GONA 3QT7A 2R3VA 4X65I 4DR3I 2WW4A 4K0KI 1Z0VA 4MYUA 2OI2A 4JI6E 2E5LI 5IWAE 3ZZ0A 3K17A 3B82A 4DV2I 1VISA 1IBME 1ZXNA 1FWKA 5FLXQ 4DUZI 3WU4A 1QZRA 4UTGA 1ZM9A 1NZ0A 1S16A 4PRVA 1N32E 3CWVA 3PYFA 4B3TE 3J81Q 1N34I 4DV1E 4JI2I 3T1HI 4LF9E 1Z5BA 1HNXI 1FNMA 2ZM6I 1Z0TA 3J81C 4PU9A 4DV2E 4DR7I 1KVKA 1FKAE 4DR4I 3WU6A 1Z0CA 3T1HE 4NXNE 2HK3A 4GKJI 4K0KE 1N36I 1KIJA 4JI8E 4FN5A 1FWLA 4OX9E 2VQEI 4KHPE 3B8HA 3ZZUA 1H7UA
chains in the Genus database with same CATH superfamily
1U49A 1N52B 2QYCA 4P6QA 1YLXA 1Q4RA 5F8HA 5KFMA 2PNZA 1GMUA 1S9GB 1WC4A 2QTWA 3HLUA 3I4PA 2E1RA 2MHNA 5CYQB 4P74A 1HARA 1EHWA 1FRLA 2XC9A 1RYRA 1MU2B 3K8VA 5C24B 2RD5C 2KM8B 1KRPA 4QYRA 1LKZA 1RWMB 1UVKA 1A9NB 2PO1A 5KT6A 4MU0A 4K59A 4LSZB 1HD0A 4OYOA 2DPJA 2PO1B 2AW0A 1N34F 4TY9A 1N33F 2OSRA 2YWKA 3OL6A 3NMAA 2DHGA 1E3PA 4X64I 2JC0A 4AL5A 3CJSA 3H7HB 4CLFA 3CXCR 1RADB 4LSLA 4JI6F 3RBEA 2B9XA 2GVZB 3HHKA 4HT7A 1S77D 1RHMB 4LSLB 2BM0A 2K7KA 1FKAE 2V8VA 2FQQB 2EKNA 2I9SA 4ZPCA 1LWCA 1UKUA 4UOGA 3TZXA 1D6TA 3RBXA 4FYYB 3QAEA 5JXSA 2Z57B 3RR8A 2IERA 3D3CJ 4IZKB 3M2UA 1H7SA 4DR1E 4DUZF 2HHWA 2KKHA 4M63A 5H9EK 4IZKA 4GKKI 2UU9E 3PDNA 5H1SV 2MZ1A 2IHR1 4CLLA 1KOOA 2EC2A 1S1WB 4O44A 1P1TA 2XSJA 1NHVA 3IWNC 3W60A 4NXMJ 5D3GA 3H5UA 2IMOA 4AXIA 8AT1B 3MFIA 1FJGE 4CQ1A 4Q7AA 1B62A 1RXOB 2GGPB 3GJQB 4EBDA 2ADCA 1I5OB 1RAFB 1YJ7A 2H5JB 3M7VA 3RUBL 2B5JA 3TP2A 4EU0A 2ZBIA 3CT9A 4HY1A 3MPUB 2PO4A 1U2FA 2VFTA 2B5JB 5FWKA 4CLYA 1NPRA 1P9YA 4PPDA 2MZJA 2E7VA 4HHUA 4BDPA 3GMEA 4JV5I 1CBKA 2JX2A 4DN9A 2ZM6F 4JI4E 4LIWA 5A76A 3LPSA 3I9V9 3W65A 3GTYX 2CWKA 3CCTA 2AYMA 1U09A 2VFSA 5HMZA 2V34A 4N7TA 2PMZD 3T41A 2H65B 3CCQS 5JEAE 2O3DA 3M4XA 1DLOA 4G1QA 1HWUA 3N6MA 3PIOQ 3SI8A 4DPTA 1XNRJ 5IM0B 2DKOB 2E5HA 4NLUA 4U7UK 1SV5B 3FEZA 4RUAA 3CJRA 2AZ1A 3VAJA 1GH8A 4LFAI 1U6FA 1VQ8S 2DO0A 2KXHA 1UWAA 3BSAA 1WHYA 2GV1A 4JOUA 2W9BA 5CXTA 1V5VA 2KZMA 2AU0A 3Q8SB 4C0BA 4LF7E 3JYTB 2HGMA 3QQCD 4M5IA 2IM1A 1WG1A 2I1RA 5A2QU 3JYTA 4E98A 2ZHAA 2HHTA 2HEKA 2DH7A 2V67A 2B9YA 1WC3A 3SQOP 3CO9A 4A8KA 1Q82T 2YKQA 1DQ8A 3D6MB 3KYLA 5DETA 3HI9A 3HT0A 2DGOA 4K5SA 4Y00A 4Z7CA 3HHNB 4K4ZA 3B4TA 5IXUA 4LOMA 4NYZA 3GFHA 3SCJE 3UN2A 2D69A 3DC2A 1RWWB 4Y28C 2BOPA 3LTOA 2HHHF 4IQXA 1MSWD 4PRXA 1RCXB 2UUAE 4JI3E 1LFWA 2GC8A 4KGKA 2BQ3A 1Z0WA 4EZ9A 3QSIA 3N6LA 4USIA 3UO0A 2BW7A 3MM6A 4EGLA 4IG3B 1Q81T 2DR5A 2LJPA 4OZ2A 4I68A 3PFOA 2POKA 2YBVA 4NASA 2NZCA 4UW2A 4ZCKA 3J7YI 3KJVB 3THVA 4LMZA 4B3MI 1IBLF 3I9ZA 2JLEA 4UUWA 1V6HA 2IC3A 2UZAA 2E66A 3BGRA 1D0EA 1IM4A 3ZM7A 4K4UA 3CULA 1K73T 1HNIB 4WFZA 5J2MA 1N5SA 4BWMA 5HLFB 2RSQA 1IR2A 1MMDA 1VQKS 3W9HA 3HXMA 5LXRA 5KFJA 4N3OA 3MM9A 1RBLA 2IRYA 4LSNB 4Y2CA 3U02A 3SXLA 3OUYB 3BKTA 4C97A 3MM9B 2YX7A 1VBXA 2E5LE 7FDRA 4DV3I 3G6YA 4K4YA 4QCLA 3GFZA 2RHSB 2XMJA 3CJ2A 1U45A 5ETTA 4ZJOA 3PY8A 3SSSA 2UXCF 3NOCA 2DNKA 1HMVB 4DV0F 1Q5YA 5I3PA 5I4MA 4BS2A 1TQLA 4RUCA 5AJ3F 2BBEA 2ROEA 4DV1J 4QYZK 4JI1E 2LQJA 1ROFA 2VUGA 1KDNA 2GVDB 4J5OA 2V5HG 1RAJA 3ITHB 3BO4A 2C2RA 5HN0A 2PT0A 4F3MA 3VAHA 4DR7E 2X1GA 2UVWA 4QR0A 2DR7A 4P2SA 2FHJA 1CS4B 2JVOA 1FXLA 1YZ6A 2BW2A 4P52A 4RNOA 1YBUA 2X1BA 3MZIA 3QFWA 3KK2A 5HVHA 3DLBA 2XZTB 1NUEA 4H4KA 1HBOA 4MJKA 1UJ4A 4Z2XA 2J6SA 1PAEX 3P8BB 3QJJA 1FX4A 5IT4A 3EWGA 2HW3A 4KFBA 2VQEE 5ELWA 4CT8A 4R8UB 4UZBA 3QT5A 3MEDA 2ZM6J 4WUBA 3T3FA 4CLUA 1X5SA 3BR9A 1FF2A 3CJ8A 3M8ZA 2HQFA 3FQLA 3MEDB 4IH7A 2E29A 4N77A 3E01B 2C2MB 2WSFC 4QOTA 3J7Z5 1N34J 1RT6A 2E44A 5K8OA 2R8IA 1BC6A 4K2XA 1QTMA 3P6YC 3AA8A 3FNNA 2ZC4A 2BR2A 4DUYI 1HNZJ 2XS5A 3M2RA 2E7WA 1EP4B 2H9ZA 2NN6C 3CJKA 3GV5B 3M8PA 3U1NA 3LPEA 1YTYA 4DWIA 1FO1A 3R1LA 3EGZA 3KUEA 1C4CA 3WX8A 4Q44A 4LQ3A 1K1QA 2P9EA 4NLTA 3M9NB 3RAXA 3VGUA 2BA9A 3UD5A 1FA0A 1LWFA 3G87A 4P7TA 4IZJD 1AZSA 3SQGB 1HI0P 2C38A 3TYTA 1ZH5A 3BQ1A 1JQGA 3UDEA 4D3HA 1F0XA 2C2DA 4DZDA 2IVYA 4EO6A 4ZP9A 5KFQA 1WWHA 5CYQA 3TI0A 4WK1A 3I0RB 1QVGR 4Q5VA 2LQ8A 2VG7A 3M2VB 3MD3A 2N4CA 4RNNA 3M2VA 3D28A 4YHHI 4DX5A 1S0VA 2KRBA 1TKZA 3PYDA 3Q86A 2H4YB 1Q1KA 4R5PA 4IZJA 2KO1A 2CNLB 3ZTSA 3MOJB 3Q8YA 1TKZB 2HFNA 4NLSA 3AD9C 4ZPDA 4KPCA 4U9RA 2L08A 1SKSA 3NWRA 1KN6A 1SQEA 1BHNA 1GMVA 3DGPA 1VIXA 3ETOA 3DXBA 3B78A 3M30B 1V3ZA 3MMBA 4HDGA 4USJC 5JMNA 3DGPB 3M30A 4MDTA 2ZE2A 1TV6A 5ETSA 2KXFA 4OYPA 2QT7A 3EGNA 1VRUB 4A46A 3OLBA 2MJUA 3ZKDA 4KHRA 2D74B 5LXYA 1FDAA 4NCAA 3GV8B 2E5LF 3NNAA 4OZ3A 4CLKA 7FD1A 2H54B 1HI1A 2RVJA 4IR9A 4QQBA 3WDOA 1URRA 3S8SA 2M70A 2X51A 4IOCQ 1HR0F 3IRXB 4RBTA 4CH7A 1N54B 5F41A 4C8ZA 1UEVA 1MWZA 5THWA 4BCAA 3HULA 4NMXA 1TUVA 5K20B 1X4HA 2ZHOA 4OV1A 1GQEA 4L75A 1JLFB 4A8WA 2VKZG 4ZVTB 1VQ7S 4DV3E 4LF8E 3MMCB 1JLFA 3PKMA 1WC5A 1XNQJ 2QA2A 2QFIA 1FESA 2GGPA 5L9XA 5LSOA 2R7WA 4CLZA 4DR3E 2HIYA 2YWFA 3NCRA 1CJVB 4X65F 2KN4A 5D77A 5FDLA 1G6BA 3IO1A 3KHLA 3KLHA 3VAMA 2JEAB 1CJVA 2DGWA 4ZCLA 5T14A 1D9AA 2DGSA 3H2VE 1H98A 1TL7B 1WHXA 3HFZB 4PYDA 4LRBA 3GJSB 1WI8A 2FIUA 4X66J 3G96A 2V68A 1TL7A 5BYSA 2KXNB 2EW9A 2ZBKB 1RTHB 5ITHA 1U2RA 3SYZA 3D54A 2MMYA 2WB4A 1HNVB 3BV8A 3GYNA 3N79A 3LW5C 5DDPC 3NS6A 5KFLA 3TEGA 4ECTA 4MH8A 4V19X 4DV4I 4J91A 5ETLA 4L3NA 5A0YB 5ETRA 1V3SA 4BBYA 4NLXA 5IM0A 3R7NB 1SV5A 1H73A 5KFPA 3G82A 3W64A 2XLKA 2CQ3A 2W9BB 3HJFA 5HBMB 2HK2A 4ID5A 2PMWA 1R6LA 3HKWA 3DFEA 2L9WA 3D66A 1S48A 3OTEA 4GMKA 4ID5B 5HQLA 2UVRA 3CC7S 2F4VE 2UV8A 4USKA 5M2PA 1HNZF 1VQNS 3OTDA 2C3PA 1N48A 2BJ8A 1R0BG 3KLEA 5JEAC 1T05B 4DPUA 1SJ1A 3GMGA 1DJ0A 2YVSA 4KGVB 3GSIA 1BQMB 1U1RA 1VBYA 4BA2B 4PYAA 3H0PA 1WTFA 3GWCA 3UQSA 1L3UA 4DV4E 4ECZA 4JI5E 4U7UD 5LJ3Y 2HNYB 2CA9A 3GILA 1BQNB 1TKDA 2F65A 4DR6F 4Y2MA 5GAEI 4P7VA 4J9MA 5ETKA 4DV0E 2LFVA 4AL6A 1VQMS 2JE6B 2B9EA 3FRYA 1KVJA 1YJRA 2WVEA 4DV4J 1X4FA 2M88A 2RQMA 3MR7A 4HL9A 2B51A 4F3QA 3CIZA 4B3TF 2Q66A 4CP5A 5J2NA 4A47A 3M6AA 5E3CA 4LJMA 4JUZA 2G9OA 1GXLA 5FLXC 3QMQA 4EUVA 3M85D 5DNLA 4OJ1A 2XZWA 2J6UA 2MLZA 4LF8I 2NN6E 1W25A 2ILZA 3I6PA 2VOOA 1FXRA 1T11A 1M1HA 3UFCX 1YVFA 4TXSA 5IZHA 1L3TA 5DRQA 4RWXA 2ZH8A 2DIVA 2MQNA 2DHHA 2PNZB 3JQJA 2BZ2A 2CNOB 3DI6A 4X64F 4FP9A 4ED3A 2VOPA 4FW4A 3QGGA 1IBLE 3LGHA 2G2OA 2IYIA 4MU1A 1MU2A 5E33A 4LSNA 3QYYA 3MOZA 3J80U 3LNUA 4MU3A 4HACA 3EYZA 4I3HA 2HBYB 2DNGA 4ZPAA 1J5EF 2HZCA 3LP2B 2WSEC 3J80Y 1F60B 3C15A 2CQIA 5T7LB 1HR0J 4KO0A 2BMBA 2C39B 1EI1A 4LF4J 1EQMA 4J90A 4C8NA 5DNXA 3QZ8A 3BKUA 1RP5A 5GAGI 4NXME 4B3SJ 2A3JA 3NXZA 5BR8F 1BKNA 2Z2ZA 4LFCI 3SEOA 2XS7A 4FWGA 2YNGB 4O3PA 1GK8A 2WAQD 2DH8A 3OR2A 4K8RA 1HBOB 1RTIA 1TL1A 4KY3A 3DRPA 4Q2MA 4QIFA 4Y2AA 1N32J 4FWDA 5C0XD 1S1WA 3I5BA 1RAIB 2AJ4A 4O44B 5KG6A 3PX4A 2P9CA 2BANB 4R8UA 1M5PC 3QFHA 2V8DA 4F36A 4RU2A 2BANA 2FC9A 2PMHA 2RDDA 4A8OA 3GPAA 1RUSA 2XMTA 3NGTA 1D1UA 4MTPA 1QAJA 1RWXB 5IWAI 3N4WA 3HHDA 4WYWA 2RH3A 2J0SD 2G0JA 2VQEJ 4TKTA 4ECXA 4KRWA 2BM1A 3KRNA 1FKPB 1VHFA 4NA1A 1ZM4A 3CJKB 1Q86T 1TKXB 3GFXA 1FKPA 3K89A 4NEZA 1ITPA 4DUYE 2DY9A 1R27B 3OSNA 3OTOF 3LP1A 1VC6A 3PTWA 2MHEA 4FKYA 4U6PA 1IKYA 4CIOA 2DD8S 1F5BA 1WKLA 4WE1A 4JI0J 3NZKA 4YB7A 3J80C 1LWFB 2IPOB 1NDPA 2OPPA 2RKIA 4GVLA 2ZITA 2VQFI 4PZVA 5K36F 1SQGA 3DOKA 3M05A 4DUYJ 3SFGA 2F4VJ 4YHHF 1NHIA 1S99A 2PC6A 2VG5B 1IQZA 2HBQB 2AWZA 2BJ7A 3DOKB 1T9WA 2CDRB 3GJTB 2VG5A 4NBQA 4JI5J 2VA2A 1B3TA 1OYEA 3EMTA 3J80Q 2VONA 2CVEA 3EVOA 1UFWA 4ZVEA 5KFCA 3Q8QB 4WCEQ 4JI8J 1FXDA 3H5SA 4ZOSA 5IT9C 2R8HA 2F9JA 2WVBA 2P8IA 1K9MT 2V6AA 3OFGA 2HAIA 4H4KC 1MLAA 1TUWA 2DNZA 3VVTA 1BD6A 3CDUA 2UXBI 3IA0A 5B7WA 4K4VA 1UDOA 1U0SA 2XI3A 2FD2A 5HQ8A 2GIRA 1ZAXA 3H98A 3MMBB 2R8KA 1OJ4A 3BF4A 2GMJA 3HVWA 5F8MA 4R0EA 1HYSA 2K8GA 3GONA 1YJUA 2GO8A 1LWXA 4WFAQ 1X60A 2XS2A 3KUGA 2OTLS 5KG2A 2QO3A 2GZOA 4ZS6A 3G4SS 3MM6B 2V50A 3UWTA 2WOMB 4NRTA 1RA6A 4K0KI 2QYGA 3DMJA 1QD1A 5IQ6A 3L7OA 4Y3CA 4PG8A 1EX8A 2Q1LA 3IFEA 4MYUA 4PCQA 4ID8A 5HQMA 3HM9A 4KTQA 1TAUA 1FFSB 4X4QA 3WBZA 3CCLS 2J76E 3RRKA 2HWIA 3A8JA 4Q8FA 4AIMA 3BSCA 1C2PA 3OD2A 3ZZ0A 3HFVA 3IBFB 4C8KA 4F50A 4PG7A 1IR0A 4KYZA 4OX8A 5DDOC 5HLFA 1VISA 2JEIA 3IR5B 4DV2I 1IBME 2XHWA 3RBZA 4BHQA 1QUVA 4NZ7A 4DR6J 3KLHB 4BA1B 1HQUA 4KIAA 3OJUA 2DNOA 2Y3YA 2FZCB 2G0IA 2WW8A 3FEXB 1HQUB 3NP5A 3CPWR 4JI5F 4K0KJ 2Z30B 4FKXA 3TJAA 3CCRS 1RT3B 3H4BA 3M8RA 1QZRA 2EK6A 3BS9A 2UUCF 4OI3A 4X66F 1RT3A 1BXNA 2G2YA 1S16A 4PRVA 1HMVA 1T95A 1F9EB 1QJHA 3C6TA 5F3ZA 4X62J 1Q5VA 4WPAA 4MQYA 1RTDA 1WC6A 2H5IB 3PYFA 2DGVA 2G1HA 4WYLA 4GC6A 1B4SA 1YHQS 2N7YA 1J27A 1RTDB 3J81Q 2DRBA 4WU2A 4QWBA 1U2CA 3BREA 4NWBA 3CD6S 3ZFVA 4M94A 4OHWA 5LSLA 4LF9E 4DR7J 1ZPWX 1WF2A 1Z5BA 1Y9OA 2MKIA 1SJ3P 4ELUA 1YJWS 1HNXI 4LF9F 2VG6A 2AD9A 1OQ3A 2LA6A 2PEHA 3K5NA 1XBWA 3GYXB 3T9NA 3KLEB 5B0CA 3P3GA 3I55S 1YSJA 2ZFHA 2XCPA 5C0XE 1UDQA 4RUBA 3BN7A 2Z5BB 1DZ5A 4TQSA 3NS7B 3PNIA 4KGMA 4O4RA 5K8NA 1YGYA 2PNMA 4IDKA 4LF5F 1VK3A 2XYGB 3UR3C 3UNGC 1D09B 5L1KA 2OAUA 1OY6A 3W8PA 4DLGA 2KJVA 2JJ4D 2UUBJ 2JE6A 1TR0A 1RT4A 3WU6A 3M2RB 3THTA 4LF4E 1EJ7L 4NCGB 5D4PA 2IOQA 5BYRA 1SL2A 1EB0A 4ED5A 4LRCA 5BR8J 4NXMF 2XZDB 1N36I 1JLEA 3KK3A 1JLAA 1OY9A 4ECRA 1QSYA 4NXNJ 3E3XA 1LWEB 4OYZA 1HBMB 4JV5F 2DO4A 4HR2A 5H9FJ 1CPZA 5EX3A 2NXEA 4F4YA 4GC7A 5DQIA 4WFXA 3CCES 2O1UA 4AM3A 5CQGA 4WP8A 4FF2A 2E9ZA 4OLPA 3OVBA 3TZYA 3BSOA 2HHHE 4ETXA 2Z56B 3LAMA 3M9OB 5L1LA 3IR6B 1OYPA 1KHVA 4GKKE 1PC5A 4WIIA 3GZ7A 4FF1A 2B6AB 2UVUA 3I0RA 2K1RA 4DV7I 4F67A 4DR1I 1QAIA 5E5NA 3AB4B 4L74A 1JMTA 1PJ5A 2BV3A 4CO0A 1S0OA 1F2GA 4TYBA 1FVQA 2F1DA 4HYMA 3KTQA 5JEAA 2YPYA 3AH6A 1D8ZA 3LP2A 1JJCB 2CPHA 1UMJA 3O2IA 5C7PA 1SL1A 3CEDA 3TAMA 1TK0A 4WUCA 4DPXA 2YH0A 2GO3A 5JEAF 4QWAA 1WG4A 4LBIA 4EYIB 1FEEA 5G0RB 2W7OA 1NSQA 2HLUA 1PG5B 4ELVA 1TV6B 1OIAA 1Z59A 4B9LA 2X1AA 3V4MA 5FLXU 4R0JA 1HQEB 3LO3A 5IC6B 3MWBA 1YBAA 1X0FA 5EHHA 1ZZNA 5KFIA 3A13A 4LRDA 3MECB 5D4LA 3UI3A 4NA3A 4OO1A 2IDLA 1NDCA 1OYDA 1ZS6A 5H9EJ 3CCMS 1UVMA 2DR6A 1NHJA 1X4AA 3IRXA 4MKYA 3QRRA 3F44A 4DL2A 2X1FA 2DXFA 3ET6A 5C25A 4O23A 3S1TA 2JNJA 1ZXMA 3VHQA 5C25B 3KHRA 4HHJA 4LR8A 3H2LA 4DR1J 3AAWB 2X3GA 4OHYA 2YWHA 3MMCA 4OJ3A 4ELTA 3C19A 1H3DA 1IM6A 2HRUA 2PGCA 2JDJA 1SH0A 1SH2A 1I94J 1M0SA 2VF3A 2NUHA 3P5TL 4PG6A 4PPZA 1OO0B 2RJZA 4DX6A 3AT1B 5FDLB 2Q79A 2I5JB 3ULHA 3OTOE 3AD8C 1QY7A 4GRSA 1NM2A 3US5A 3FFIA 2J6TA 3E8OA 4E0DA 4WJBA 3K0JA 4FPIA 2A10A 3FFIB 2L9DA 4OL8A 4LFCF 5LMUE 4HTJA 2XY6A 1RTHA 1IKYB 2IM0A 4TN2A 4CO2A 4OX9I 1NKEA 2DGUA 5HJXA 3CDAA 1HNVA 3P3EA 4QW9A 5DLGA 5BJRA 2BACA 4G1QB 4CO5A 3B54A 4QBUA 1S59A 2J8AA 4J9UE 1B0PA 3EXYA 1KONA 2UXBE 2CJ9A 2BRKA 4GKJE 4LF2A 2ASYA 5HJYA 5EKWA 1S7IA 4OQJA 3MPVA 4O3OA 1E6VA 1HBNA 3O5TB 4KGXB 4ES1A 2XY5A 5HBMA 2UXDI 1E6VB 5LMNI 3RBDA 1R0AA 3QZ7A 4V19J 2UUBF 3J81Y 1WF0A 1M5SA 1R0AB 3KDNA 4J9PA 1XMOJ 2FY8A 1RZMA 4DV0J 3PJXA 2HHVA 4NCBA 3KHHA 3M6VA 1R8CA 4ZITA 1UPMB 3HK2A 1XJWB 4H4OB 1M5HA 3T1HJ 1RI7A 5AXLA 1RJJA 2QIFA 4B3ME 1FNOA 3ILOA 3OJSA 2R7UA 1JIHA 1RLDA 2NXCA 2R4FA 2YKOA 5KT2A 4EBEA 1TL5A 1S5ZA 2BKPA 3CUNA 2QLJB 1IBKE 2DTJA 2F7VA 3PRDA 1VRTA 1SIZA 2LA4A 4GO7X 4IG3A 1X5TA 4KKOA 5KFXA 4C98A 2L41A 4A8SA 1RHKB 2UUTA 3I96A 1OSCA 1RCOB 4H4MA 4UQTA 1YI2S 3M85G 1Z0BA 1Y0HA 5KT7A 2BQUA 1PYSB 4CTAA 4EBCA 1U1LA 1S9FA 3DYAB 4QU6A 2UUAI 1S6UA 3BGRB 1X4CA 4J9SA 4P2MA 3RU0A 2ZNZA 3DYAA 1CJKA 5F8NA 2XNQA 4N76A 3DNCA 3C16A 2Z4PA 2OD4A 3CD0A 1IJEB 3D67A 4HLBA 2LEAA 5AXKA 5D0GA 1WORA 3DI6B 3KLFB 4DV7J 5HROB 4ECSA 4F3OA 2JZ5A 1NK5A 1DFDA 1HHTP 4JI6J 4HH1A 1UJ5A 1H2UX 2E5IA 2CQ1A 3DLEB 3CCJS 1AB8A 2EVZA 2W1BA 2UXDF 1OPZA 3DLEA 4P2FA 2RQ4A 3IP0A 3JS9A 2R2SA 2I8EA 3I32A 1HIYA 1U1OA 2HLTA 4JBCA 3BDPA 1PKPA 3D1OA 1UDNA 5BR8E 2VJVA 2YQ1A 1UA0A 2MYFA 4ANEA 1H6KX 2QZ8A 4IFDC 3QAUA 2FLNA 1SKRA 5IC4B 1LNQA 5DRPA 5EN1A 4Q0BB 4P2XA 4W98A 5KG3A 1IBCB 2KHDA 5F8LA 3OHAA 4DOZA 1P9QC 2AYBA 3R2CJ 4M5DA 4AFFA 4G65A 4URQU 3EVWA 4P73A 3J7AN 3GCXP 1BWVA 2DRAA 3I0SA 5KG4A 3FGVA 3CE8A 1L3VA 4OX7A 3DGVA 3OR2B 4GVBA 1RTIB 1TL1B 1VJQA 2FC8A 2PSZA 3FRZA 3IXQA 2XO6A 2FLOA 4ECVA 2RS2A 1ZTTA 1CEZA 4ZVIA 3CC2S 2CYYA 4HKQA 4JI5I 3GIJA 1UVNA 1YX2A 4N47A 2EFPA 3VAFA 3SV3A 2HURA 4DL4A 3U1YA 2NQPA 3TA0A 2ZWOA 1NK8A 3MEGB 2AX1A 4RW9A 1HW9A 1HNXJ 2L9NA 2KU7A 1Y6ZA 1X4DA 2XMVA 2HKJA 2BR2B 4P10A 4I67A 4ILMA 5E7OB 3SSQA 4OV6A 2F4VI 1EP4A 4Y65A 4PXEA 1F6TA 3EGVA 3NOGA 3G86A 4NCGA 4ZVPB 3D1HA 4ANCA 4XIUA 1GTEA 2NSBA 1NH8A 4OX9J 2GQ0A 4DR5E 4OX6A 1H0HB 3TX8A 4XTTA 3UD4P 3K85A 1FT8A 2VFUA 3GP9A 4DUZJ 1WELA 1AZSB 1IBMI 3PFEA 2B4UA 1URNA 2KVQE 2DYAA 3NGSA 3W5XA 2J65A 2ZBRA 2Q6BA 3DLLQ 3AJ2A 1X5OA 3K8WA 3WZ0A 4DV3F 3OW2R 2C2EA 3AHPA 1XN9A 2IJRA 1NJXA 2KTQA 1UP1A 3N9UC 4ED7A 3PS1A 1QSSA 3PR4A 4URLA 5CA5A 1ICEB 5L38A 2B6AA 1RR9A 3D6TB 1YWXA 2DNPA 1R6MA 5HANA 1RAAB 1NMEB 5DRKA 4DF8A 2HQCA 4ENOA 4JI3F 4R5PB 2UUAJ 4IZJB 4I2QB 2HKEA 3N0VA 3NWGA 1VS3A 1CVJA 5JEAB 1QE1A 4MMOA 3SCKE 4O0IA 2LQ5A 3MR3A 2JEBB 1U47A 1N33E 4LFBJ 4NZ6A 4LFCJ 2HHXA 3EPIA 4LBHA 2JEBA 2EWHA 5G0RA 2BVZA 5HP1B 4J9KA 5M2UA 1KBRA 2P6TA 2CJAA 3Q8VA 3IR7B 1WTBA 2I2YA 3KKFA 3GR1A 4C8OA 4DSJA 1HYSB 2IESA 4DPYA 4DV5E 4NX9A 4LFBE 1IKWA 2YNFB 1YZ7A 1Z5AA 2XTJP 5DDQC 4MKAA 1GNKA 1PIEA 4E2FB 4FYXB 4ETZA 2IDEA 2O01C 2IJFA 2MLXA 2WOMA 2ILYA 2LDYA 3ILIA 1HL6A 4FDFA 2ERRA 2ZZNA 1WOOA 3DMJB 3K5PA 2ZD1B 3UPFA 4JYAE 5I42B 3A1YG 3KUHA 2AKWB 5L46A 2BA1D 4DUYF 1NCLA 1U1KA 1FNXH 4DFPA 5LM7E 4YP3A 3ISND 1NK9A 4DFMA 5DG8A 3MFHA 2M5YA 1NXIA 3HHLD 2HVHA 3R7BB 2M0GB 2MQ8A 2QL9B 2IMWP 1WKJA 2ZOFA 3ENQA 2D3UA 2OEKA 3IAM9 4RLEA 4AD6A 5KFTA 4OI1A 4XDDA 4DL7A 4LF8J 3H4LA 4JI8I 4DV1F 1OQ6A 4QWDA 1AFIA 2JEAA 3R97A 1IBMF 1VLYA 1H38A 4X4VA 2DBBA 4TU7A 1C0TB 1T3NA 1MN7A 4KH0B 2QLXA 3KWMA 2KG0A 4N5SA 3BEGB 1IBKJ 2JHEA 2XBPA 6AT1B 3HT3A 4USMA 1N36J 4KHPJ 4DSKA 1JJHA 2FVPA 1GX5A 2ZOMA 1RT5B 1C1CB 2W01A 3VGSA 4P9SA 4X66E 1REVB 3E51A 1YJNS 1RT5A 1P1LA 3IM8A 2LKZA 3BZQA 5A0YA 5U47A 2C3MA 2OHDA 5E3PA 2QC3A 4O3QA 3OL8A 2WRMA 2XEXA 3HSDA 1MMNA 2J9DA 4QJVA 3CMAS 2UUBI 4OO1B 4UZCA 1JKHB 1YJVA 4DR2I 3MMAA 3M7ND 4JI4F 2P5VA 3DU5A 3AOBA 2BKNA 4NL5A 1JX4A 1D9FA 3R2DJ 2ZM6E 2G0CA 3KXDA 1R8BA 3JXOA 3GQCA 3IM9A 1HHSA 4LF5I 3P96A 2RUSA 4JI0F 5DROA 4IFDF 2AEJA 2JOQA 5GMDA 4C2MA 2CPYA 2J0QD 2CZ9A 2R42A 2VG6B 4JB8B 1GEHA 4J9OA 3C8YA 3LPYA 4DN0A 5EX0A 4BA2A 1X31C 2HBRB 3GLJA 4B3MF 3PRBA 2IIHA 4UY85 1QLNA 4DQSA 1LEOA 2C42A 3HVRA 2YKPA 2V8PA 3VAKA 4DV6F 1HNWJ 1YQHA 2HNYA 3W63A 3KG0A 4CLTA 5KAKA 1GFWB 4F4ZA 1RT1B 2WSCC 1RWOB 3J81U 1NHKL 5DG7A 2VFVA 4IDKB 3A8IA 1S1XA 2HGLA 4PABA 3IWXA 3MD1A 3FBEA 3OXFA 4B9NA 1ULRA 1S1XB 4MIAA 4X62I 4DUZE 3CB4A 3S7RA 4JYAI 1RTJB 3DDNA 2D3O1 1VRTB 2WZ1A 4KKOB 1H2VZ 2KL8A 4CM2A 1N5QA 2KH9A 1T94A 3QNWB 4UF4A 3DHXA 4H4MB 2DR9A 3KG1A 1KSPA 1ZM3A 5B08A 2W4PA 3KK3B 1JLBB 1YRXA 4ZPTR 3DDIA 4CTAB 1LWEA 1KEKA 2ZH6A 4QU7A 4IFDE 2HVDA 4NMLA 3DLGA 2Y0SD 4DCOB 1WC0A 1R0CB 3CIMA 1CSJA 2DXDA 5JUMA 3OPKA 2CQ0A 3IGNA 5KFNA 2OGUA 4C3KA 2PO2A 2AQ4A 5ETNA 2MKHA 3D4JA 1WEXA 2ZZTA 4FXVA 3KLFA 4LFCE 3RAMA 3GCMA 3UNYA 3A8EA 3IBCB 4RJVA 1UW4A 2ZVIA 4NLYA 3ZTQA 4X2BA 3EUNA 2IA0A 3FSYA 2PDAA 4DR5F 1JLGB 4PQUA 1VQLS 4HI1A 2N7CA 2W9CB 4AQYF 4DL3A 2M8DB 1XMQF 2PA3A 3OR1A 1S76D 3BDEA 2F40A 2F63A 3HVAA 4HT5A 2X3DA 5T7LA 3TAMB 4LVOP 2KT3A 2XM3A 1Y4ZB 5CYMB 7AT1B 1JXEA 2C39A 2FVCA 5I3QA 2OELA 4PUOA 4MK7A 3W8GA 3ISZA 1K0VA 4QNJA 4Q0BA 4TNOA 2FZGB 2W4CA 1U1PA 4LFBI 1KLMA 1UEUA 2BRLA 4ZVSB 1S4EA 1Y5IB 2BJEA 2RAQA 4LFAE 1KLMB 1HWLA 1S6PA 3BBCA 3MECA 4I64A 2EFQA 3PEHA 4OYAA 4ED4A 1S6PB 3K5OA 5CABA 3UCZP 2J7KA 4ZDNA 3W62A 4NOHA 4TQRA 4LF7F 2LU1A 4IH5A 2DB1A 2UU9I 2XSFA 1TL3A 2MDAA 4X62F 3TQ1A 4FBUA 2CZ4A 2AEMA 2LCWA 5CD4A 2V4QA 4J9RA 2E1PA 2KYXA 2ZVSA 1N5YB 1FJCA 2OMOA 3NGKA 3OSPA 1NSAA 2EK1A 3KG4A 2WHOA 4DSEA 3R3TA 2RDJA 2JWNA 3KNGA 4KB7A 4JI7J 4I56A 4FYWB 4YB5A 3DU6A 4OHVA 2A6OA 4DR2J 2K3IA 2OPSB 1VDHA 3VAIA 1WG5A 4C4WA 4X64E 5A2QY 4NZ0A 1TKXA 2D9PA 1R8PA 1PYTA 2F9DA 3KLIB 3LP1B 2MSSA 3AJ1A 2BJ1A 4GKKF 4NLRA 1MMLA 3GLLA 4WE1B 3JAMU 4KHPI 2NSCA 4FS2A 3D7SB 2RKIB 4DQRA 1U8SA 1ZETA 2CRLA 5D0RA 2VPXB 5B0BA 1TFWA 3DRXA 1OYSA 5IT9Q 1B0VA 1RABB 1RWKB 4AQYI 2K2PA 3HHLB 3G9CA 2KZZA 1FD8A 1N32F 3P76A 3PRYA 4X65E 4DR5I 1NO8A 4KAIA 4JI3I 4CZCA 5HAOA 2GJFA 1AXQA 2J8SA 3LGNA 2JEJA 4G1IA 4CYUB 3VAGA 4KHMA 2QFJA 3K57A 3M32A 1HLWA 4M5MA 3HJCA 2Q43A 4DR6E 4HDHA 3M32B 1PGZA 2V9WA 3W5YA 5E0OA 1NHHA 1E6YA 3M8QA 4LRFA 1QE1B 4FYVB 5MAOA 1TP7A 3CDEA 3MM8B 1IBKF 2UUAF 4B3RE 1TMMA 2ZBPA 3JSMA 1VJWA 1T9UA 3BH7B 3FBBA 3MM8A 1MN9A 4LBPA 5KFFA 3VF0B 5HP1A 2ADBA 2YKMA 4MYTA 1KWMA 2YKMB 3FDSA 4NLWA 3PG9A 2NLWA 3DRSB 4CO3A 2R3VA 3GIRA 4X65I 1IKWB 2YNFA 4A8XA 5C42B 4WFBQ 2M7SA 5IS2A 1XERA 4DF4A 2R7XA 4DR3I 1UETA 4L72B 4LT6A 2O66A 4XDCA 2WW4A 1IBLJ 3QWUA 4YDXA 4KH1B 3MR2A 3K59A 2AE8A 4LCFA 1LW0B 1F9HA 3OT9A 4GKKJ 3G2XA 3M6WA 2CQ2A 2UXBJ 1Z0VA 5K36E 2DNLA 1WSVA 4V1Ak 3OVAA 1RKIA 2VC1A 1TU0B 5D8HB 2OI2A 1CJKB 2Y0BB 4DV2J 1FHTA 5KFZA 5KFHA 4GKJF 1U4BA 5GADU 1HD1A 3C16B 1NKCA 3MM7A 3P45B 3D2WA 3NNCA 2QSWA 1SC1B 3JSBA 2WVCA 2GAGC 1NLKL 1XR6A 1ZAVA 3FC9A 4DSLA 3TARA 1GMWA 5KFGA 4L76A 4O4GA 1H2TZ 4IRKA 3SMZA 3CWJA 2R7RA 4DUZI 2YTCA 2E9TA 4ZLPA 1APSA 2NXJA 3K7RA 4WTOB 3BO2A 2OLWA 4DR1F 3G8QA 3RW6A 2H1YA 3WU4A 4IG0A 1FERA 1ZM9A 3C6TB 1NZ0A 1Q53A 2QMWA 3PHEA 4IG0B 1RYSA 5C0XC 2A18A 1N32E 3HHLC 3MTKA 3CWVA 2C2KB 3ISNC 4U95A 5IOLA 1JKHA 2LMIA 2MTLA 2IVMA 2EG2A 1GTHA 1KQSR 1YHCA 5JVHQ 1ZZFA 1REGX 4H54A 4DV5F 4M5DB 4DV1E 3F56A 4JI2I 2QA1A 5KG0A 1G2EA 3I0SB 1T9YA 4EO8A 3MCNA 4FNIA 1S57A 4R25A 3ENAA 4GVBB 4K50A 4WKYA 1UW9A 2H4WB 2P2CB 3DDKA 2CPEA 4I4BA 4ZPBA 3CDIA 2ZM6I 2UU9J 1HKAA 3DOLA 1OWXA 1KQKA 4PU9A 1P8GA 3GIMA 4M5JA 1IKXB 2J5AA 4DR7I 1LQ9A 5IQQA 1C1BA 1KVKA 1RT1A 1I51B 3IMQJ 4LVNP 2ZH5A 2VASA 2XMMA 2XMAA 4JI2J 4ECWA 1HNWF 1S72S 2GA7A 2LQ9A 3BN4A 4W90B 3GU0A 3QLHB 3CDJA 1XMOF 1VRQC 1ZPVA 4NLOA 2XCAA 1Z0CA 3QLHA 4M5KA 3T1HE 3GFYA 2RRBA 3GR0A 4XPCA 1IJFB 2FYXA 3EDRB 2MKJA 3NRBA 4ED2A 1JLAB 4GKJI 2NPIA 4ZVGA 3L7UA 2U2FA 1TKTB 1OMSA 1KIJA 1HBMA 1JLBA 3JQKA 1KFSA 1YG0A 3BQ0A 4RKUC 4RO0A 4O3NA 3MMJA 4U8VA 4YR0A 4TU9A 1M90T 4OX9E 3DLGB 3HMJG 2VQEI 2QN6B 1UFLA 4DV3J 4WKRA 3RB4A 4MU4A 3W1YC 5IWAJ 1SXLA 4PG4A 4USVA 3EZUA 1F5AA 5E3AA 5FLXY 1OY8A 3CNQP 2QJ3A 4ECQA 1U6BA 1X4EA 1H7UA 3JQMA 4CCHA 1P42A 4GQUA 4HXZA 2K1RB 3KK1A 2QRRA 1YBTA 2J0WA 2QL5B 2UUWA 3ILLA 4M8LA 1T8EA 4F2RA 4IKAA 4IH6A 4X4PA 4DV5I 5KFKA 1JLGA 1HBUB 4IOBA 4OHZA 2YX4A 2HAFA 4I2QA 2BDPA 4PQUB 1RBAA 2W4DA 3GV7B 2RU3A 4DQQA 3LH2S 4IYQA 1SIWB 1U6ZA 4DQIA 1ACMB 1HNXF 2CQBA 3BR8A 4OYXA 3H40A 4ZVRB 2HHSA 3QT6A 4ANDA 3EM1A 2QX0A 3GB0A 3RRGA 4LF5E 3P3CA 1WDDA 4A8MP 2KJWA 4PUOB 3V6DA 3L95X 3UN3A 5C2GA 3SDEA 2AV5A 4WZMA 2CUYA 1HQEA 2JRSA 3D9BA 1RAHB 2PE8A 2IRUA 3B6BA 3MXHP 4DV2F 1G4CA 2FVRA 2ATCB 1MNEA 2F8EX 2V8HA 2CPZA 5I3UB 1F3FA 3L9ZA 1CULA 2XG8A 3J7AG 2RF2A 3BH6B 3TUIC 4FWHA 4A48A 1CULB 3TAQA 1ZTWA 2BA1G 3F0NA 1PBAA 3QATA 3ET6B 1S79A 2ZD1A 2XWXA 3WU3A 5I42A 1TL3B 2HPUA 3D68A 2Z5CB 3AQOA 1PKUA 2RT3A 1UWBB 2F3JA 5DQGA 2HVIA 5KFWA 2IM2A 3W2VB 3QGIA 3QJLA 4LIRA 2OFGX 4OI4A 3U7JA 4RW8A 2MQPA 2R7VA 3MR5A 4QIGA 1SI9A 2XWYA 1SKWA 2CPDA 1T9TA 2M8HA 2I5JA 2DT9A 1IXKA 2OPSA 2VODA 4JI3J 4OKGA 1M1GA 2UUCE 4X84A 2IM3A 3POTA 4NXNI 1I94E 2A0FB 3B4DA 4ZVUB 1C0TA 4BWJA 4ZLJA 4I6YA 3Q8PB 4L73A 3POTB 2R7OA 3RB3A 5BR8I 1H72C 3HD1A 1N5VA 1GXTA 1RBOB 2KRRA 3EJMA 1FTRA 1VC0A 4ZP8A 4ED8A 1EZZB 1R31A 2HS0A 1HNZI 1JLQA 4I2PB 3SCLE 2FJWA 3ZXWA 2CGEA 2ZJQQ 1NZ8A 2IJNA 3UHMA 3H42A 2B9WA 4I6WA 1HBNB 1S7HA 5EDWA 2ZDPA 1DRZA 1QSLA 1EQ0A 2E9RX 4CYUA 2HG4A 3PW7A 1I94I 3AFGA 2YWEA 4OZ5A 5F0WA 3K2YA 3NGUA 2NR0A 2HFUA 4RW7B 5C0XF 5ADZA 5JEAD 3R5JB 4URGA 1N33I 1MROB 3QT8A 5G4DA 5AJ3J 1SUQA 3M8QB 3CD7A 4CH1A 1VI7A 1M1KT 2B7CB 4H4OA 2IOPA 2AGPA 2Y1IA 2UP1A 1ZA1B 4DV6E 1VQ5S 4AL7A 2C2NA 4RNHA 4I0WA 2BJ3A 3UVJA 3OL9A 4JG4A 4ZPWR 1WF1A 3C3LA 4YUDA 4EMDA 1SBRA 2BKOA 5L3JA 2D7SA 1KS2A 4M5NA 2ZHBA 3DRSA 3CJ0A 4XAKA 2OO4A 4WU3A 3CCSS 1UFKA 5B0GA 1RTJA 2C3UA 1CJTB 4KSEB 5C42A 4OZ1A 1Y4SA 1VK8A 2K3KA 1Z0GA 3G6ES 1N6QB 1CJTA 4KR0B 4RR5A 4KBIA 3VWSA 5L39A 3OV7A 5LOQA 9RUBA 3JAMC 3V4IA 2ABYA 1LXJA 4B3OB 2IY5B 2H5EA 2V2VA 4F4AA 2KT5A 4B9TA 4RU9A 2ALZA 4ERDA 1M5KC 2QGFB 4X62E 4I69A 5DZ7A 2QV6A 2WVFA 2UXCE 2UXDE 1KR4A 2GQQA 3MGJA 3K5MA 3PW4A 3V6JA 5HROA 2QA4G 3RJMB 4LF6E 3RW7A 1HK7A 1S10A 4MK8A 1KQGB 3LF0A 4OZNA 4OI0A 4J9LA 2FGCA 3ELHA 2RS8A 4BC9A 1AYEA 1FDDA 4CLSA 2VC0A 3J81j 3MAHA 4ZJQA 1NDKA 1ZAWA 1VCTA 1WD6A 3LOUA 1Q79A 4IFYA 4OI6A 4YB1P 3C14A 2FJEB 4WIQA 1XK8A 5CCMA 2R2TA 2O1WA 3DN9A 4J9NA 2RNEA 3M8YA 3FK4A 5RUBA 4K0KF 1XNQF 2MLYA 2AEFA 3V5RA 2HWTA 3JTPA 5HMYA 1O6XA 3EICA 4Y34A 2VQFE 4JYAJ 2B43A 4NE9C 2LU2A 3QO9B 1DTTB 4HYKA 4K4XA 2Y8YA 3QO9A 2YKAA 1DTTA 3OBIA 4LF7J 2VFRA 3H5YA 4DV5J 1AFJA 4PRFA 1HNWI 1SC3B 5A6PA 3J7ZT 4M1KA 1YJTA 3DM2A 2XGQA 2R2RA 1Y5YA 2UV8G 3BQ2A 1N34E 3H2UB 1NAQA 3DOLB 4KE5A 2Q2EB 4UT4A 2N4DA 4ISAA 3M1VB 3M7NG 1XMBA 3MEGA 4RW9B 1MWYA 3VZIA 4B9SA 2CAJA 3VTIA 5J1EA 3M1VA 3T1YF 3T6JA 5J2QB 3LUYA 2HNZB 1SJFA 1U1NA 3BKFA 4IO1A 5GMEA 4NLPA 2BABA 5JJBA 2HNZA 4FNHA 2DNMA 2VPZB 3WU5A 2MY8A 2JEGA 2OEJA 1SC6A 5KTQA 3HZEA 4M5LA 1J5EE 1JLCB 3PYEA 4ZVHA 2VPYB 4DBQA 5DG9A 4DV1I 4JI2E 1YRUA 2HGNA 2HWHA 2CPJA 1VOMA 5D0EA 3CCZA 2I6WA 4ZHRB 2ZJRQ 1S1TB 3DXSX 3H20A 1TKTA 2QSFA 1KTQA 3W66A 4U67Q 3J7YU 3E2EA 3KJNB 3HO1A 2W9AA 1EA6A 3PS3A 1NJZA 9ATCB 1FI4A 4LR9A 4B3RF 3X1LB 2VIHA 2GO4A 4IS9A 2WK4A 1MW7A 2FGOA 3HHLA 4HI2A 2KG1A 4QWEA 2W2MP 3JSYA 1FEHA 4KQZA 2LDIA 1WKKA 3G8TA 5KFYA 1FD2A 1RHJB 4DV4F 4JI6I 2YKNB 4C3LA 5IWAF 4OYIA 1UJ6A 1PAUB 5A8KB 2YKNA 3K5LA 1K47A 2R9LA 2HNDA 1FRKA 3PW2A 1XNQI 3AODA 2AHOB 5A8KA 1Q8BA 1VLOA 4I7FB 4IQMA 4PWUA 2HNDB 3PIPQ 2W7PA 1A6FA 2EKYA 2RMLA 5DGAA 4I7FA 5L8RC 2KFNA 2DRDA 2X36A 3PS2A 3H90A 4IRDA 2NN6D 3BGUA 5EL9A 4ZP7A 3CCVS 2CQHA 1IBLI 1RDRA 1NBEB 2H48B 4JI1J 4B3SI 3J7AM 2VZ9A 3RZAA 2CPFA 1NRKA 3TQEA 4F4WA 1OSDA 5F8IA 2QLWA 2VB6A 3PO5A 2BQRA 4NA2A 3OTCA 1SC4B 3CGIA 3CDWA 4AXJA 5AXNA 2VQEF 3PVXA 1IQTA 2IAJA 4DV6I 4LF4I 4W92B 2IAJB 2XGPA 1L3KA 2W25A 4TVAB 1FJEB 2RU9A 1TK5A 5I3UA 1U26A 3MAQA 1CLFA 2Y1LB 3PEJA 2RF2B 4F25A 4Y2IA 3N5FA 2ZC3A 3Q6MA 3HZGA 4QZVB 4ZLNA 4HH0A 1XMQE 1JK9B 2AGOA 2Z8QA 3O8WA 2M2BA 3MUTP 3RYLA 3HVTB 1X4GA 1Q95G 1J5EI 4OX9F 2QE5A 1KC8T 4YEAA 1UWBA 4DV0I 4YHHJ 2DHAA 3DRRB 3W2VA 4USHA 3CO0P 5BYQA 3DRRA 1KTVA 2Z5EA 1HFEL 2V4RA 1Q7LB 2BE9B 4RW8B 2GHPA 4CNZA 1L5UA 1RT2B 2OUGA 5KOXA 3W5ZA 1I6JA 3SBMA 1JXLA 5K36D 3L7ZA 3IG1A 4M5GA 2ZKUA 2PFDA 3MEEB 1B70B 3VQSA 1F2HA 2K06A 3TOQA 3L7ZB 3IG1B 1SJQA 3TX0A 3G8SA 1RA7A 4O4GB 2W8KA 4QW8A 2VL1A 3FZ2A 5KFSA 2V94A 4UOCA 3KMQA 2Y1RI 1C1CA 3OXGA 5EWFA 1WHVA 3VV2B 3QPIA 1REVA 3M8SA 1XNRE 3PW0A 5GAHI 5E41A 2DHSA 1Y5NB 2DNHA 2LXIA 3NEKA 5LL6d 2QLFB 1Y10A 3DOMB 1JLQB 2HHUA 1S1VB 3MEKA 5DJBA 3NCQA 3MMAB 1RTZA 2AYEA 4DFKA 1RT7A 1JNRB 1S1VA 5EGYA 2A1BA 5K14A 2VH7A 1V5IB 2NXNA 3V2UC 2YQ3A 2HHHJ 1PYOB 2B56A 4IR1A 1PILA 3PYGA 2EEYA 3MTJA 2ASJA 1AUDA 1JJ2R 5EWEA 4M5HA 1KD1T 2DNQA 3DKDA 1HWJA 4WK3A 2GW8A 3DRYA 3THPA 4Q8EA 3OFHA 1B63A 2PI5A 1Q8KA 4CLWA 3R6GB 2BE7D 2P9GA 3I87A 1YIJS 4TY8A 1UAWA 1UEKA 2HS3A 3EE3A 1FDNA 3Q89A 3LALA 4FF4A 1KVIA 4YY3J 4LF1A 4LF6I 3UVJB 4JV2A 1W2IA 2E1MC 2XHCA 3N01A 3P3DA 4FW7A 2UXCI 1LW2A 2HVEA 3OVSA 2XMUA 2OH2A 2FHKA 4MFBB 1Q7YT 1LW2B 4ALZA 1N5TA 1KQFB 4KQVA 3R5CA 4MFBA 1HR0I 1ZA2B 5HI7A 4RL1A 2AJFE 1N6QA 4MK9A 5KFEA 4ZIWA 5CH7B 1S9EA 1V9OA 4JV5J 2Q6CA 3ADAC 4J9VA 1FJGJ 2DK2A 4YFUA 2OIHA 2FLLA 3ZTRA 1R43A 2ACMA 3Q8UA 3NNHA 4IOAQ 4IFDB 1DHMA 1QAXA 1S6QB 1DY3A 1VHIA 1RAGB 2Y8WA 2R7QA 3TA1A 4RBUA 2ZDOA 4OHXA 1RU1A 1S6QA 4FXWA 5CZVA 1FX2A 2VESA 3OTOJ 2OPRA 1VQPS 3FSXA 1KKHA 1VQYA 4YHHE 2NYHA 2CPXA 2VDIA 2W9CA 4HVZA 1NB2A 3IRWP 1KFDA 2I0XA 3OR1B 1SQFA 1S4FA 3C14B 4MKBA 3UR0A 5HL7Q 4X4SA 3EPGA 2O3ZA 3QGPA 5CYMA 2JEFA 1WACA 3DCAA 3RB0A 5F8GA 3VQTA 2CVIA 4E8UA 3JSMB 2AYGA 4FBTA 1RU2A 3G71S 3K1JA 3P49B 4ZPVR 2P6SA 1VMBA 4B3SE 1Y7PA 5CHCB 3GIIA 3LAKA 2FLPA 5K36A 2L3MA 3T5JA 1WUUA 2HYIB 2PNLA 4DV6J 1I3OB 1R3NA 1TL4A 1XWLA 3HDSA 4DDFA 4S0MA 4EK2A 2PA8D 3MM5B 1F9FA 3Q23A 3PW5A 4J7CA 3RR7A 4ILLA 2ZEJA 5DO2A 3CW2C 1XMOE 3CC4S 2AJ1A 3NKYA 3LANA 4RPFA 2V2ZA 1LK5A 2ZBCA 1GAOA 4W4MA 5CZXA 4UY8T 2UUCI 2M9KA 1LK7A 4JV0A 1N5YA 4B3TJ 2HHQA 4FS1A 5A2QQ 4MT1A 1UTAA 2XLIA 4DL6A 1FDBA 2MB0B 3GSDA 1YK9A 1CJUB 2ZH7A 4JI1F 2BX6A 1USVA 4NPOA 3R5GA 1C4AA 4FF3A 1B64A 1CJUA 5GVQA 4KV8A 5J1NA 2V2KA 1FRMA 3TRGA 1CQNA 5ETPA 2IYGA 4CO4A 4OI2A 2XYPB 2B8QA 3KLIA 2ZBQA 4DU7A 1RACB 1NH7A 4UOFA 4DHVA 5L1JA 1N4LA 2DCUB 3UCGA 4DEZA 4ZHRA 3M6UA 3PJ9A 4NLQA 5F8JA 3ZZOA 3AB2B 4RNFA 4DR2E 1L3SA 1SPBP 3K58A 3GE9A 5LL6R 5D0HA 4P7AA 2J9EA 4I2PA 4X66I 2YX1A 2Y1JA 2MXYA 1BE4A 2XYHB 1D8YA 4DR6I 3CJ3A 4PEOA 2AMCB 3AA9A 3KHGA 4LUBA 3LA0A 3ZZTA 3T5LA 2MQLA 1J5OB 2CIMA 1FK9B 3R5DA 3TJ8A 4YY3E 5EUHA 4FW6A 2VICA 2MZTA 3BPSP 1B7YB 3V6KA 4Z7YA 2CQCA 2UUCJ 4RW7A 3U27A 3EZOA 4PWWA 2PIIA 3MCSA 1CC7A 1E6YB 1T0TV 1TELA 2O1PA 3HCXA 3EXCX 3DLHA 4NXMI 4LQ9A 2AT1B 2VU5A 3ONQA 2YPZA 4Y2KA 2SXLA 1R7IA 2Z2LA 1SKUB 5KFBA 2HS4A 1D9DA 2FVSA 4B9MA 3HHEA 1VQ6S 2WB1D 2YNHA 3TVZA 5LT5A 3SV4A 1LV5A 3U1KA 3W7BA 1FE4A 3CDBA 2DIUA 5J1PA 2DEJA 3MPDA 3OFEA 3W61A 2RRAA 4K4WA 4LCGA 4K7QA 1J2VA 2B4OA 1U24A 2GIFA 5D4OA 2LYVA 5KT4A 3RB6A 4LF9J 1H7WA 1G1XA 2CNKB 2HRTA 4JI4J 3UCUP 1OPIA 4OZLA 3KJQB 4OJHA 4ES3A 4OO1F 1IKVB 3UE2A 2MQMA 1LW0A 1T9XA 2N3LA 3L4BC 3TEHB 2Z2YB 1KLNA 1UVJA 1SJ4P 3O3LA 2J7UA 4X4RA 3HVTA 4IFDD 3WIUA 3ZZRA 1JWWA 3TWZA 4WFNQ 2BE2A 1DURA 3T5KA 2NUUG 5KG1A 3MM7B 4AT1B 3LP0B 2E5LI 3LWMA 3GCWP 2PI4A 5IT9Y 4WP3A 3TZZA 5KFDA 3DLJA 3T5HA 3LP0A 5IWAE 4X4TA 2EPIA 3CJQA 2C1EB 1X7VA 2VA3A 4CDIA 5ETOA 3ZNJ1 1K0TA 2GFFA 4LF4F 4LPFA 5KT5A 3JSRA 4Y6IA 4OYBA 2EFVA 3IGVA 4YS2A 3I5AA 3NAIA 1IBMJ 1T3OA 2M52A 1D3WA 3A12A 3VGTA 4IFYB 2DHXA 3AOCA 4RW6A 3WHIA 3VZHA 3IC1A 4UTGA 2HMIA 2HQDA 1BLUA 4O3SA 2HMIB 3OLAA 4ECYA 1IN0A 2HBZB 1I1GA 1FJGF 1XXEA 3R1HA 4B3TE 2GJIA 3LWLA 5K14B 2HHPA 2QMXA 2FTRA 2RQKA 2IRXA 2E1AA 3UDCA 4DUTA 4F7VA 4YR3A 2D3OR 1U0HB 4LF6J 2KFZA 5L1IA 5IT9U 5AT1B 2JVRA 2RUGA 2VV5A 3ZO7A 1C0UA 2KYZA 5E3QA 5F0UA 3S01A 2JFDA 1RWUA 5C0XB 1C0UB 4CO1A 2B7BB 1K8AT 1N32I 2YWWA 1NU4A 3IN5A 1Y60A 4ZVQB 4DX7A 3ZZPA 4ED0A 3FMBA 1Z0TA 2XQCA 1IKXA 3WQPA 1SB6A 2CFXA 4TY8B 3RTVA 1PO6A 3AXMA 3D6FB 1C1BB 5HVFA 1XMQJ 1PJ7A 3QWPA 1FRXA 5J1EB 2WVDA 2W2NP 1WHWA 2ZUGA 2FUG9 5HMWA 3PHTA 4XO0A 4QWCA 3NAHA 4JV1A 4DR4I 2WTFA 4IO9Q 2O1TA 2J9DE 5B0FA 4B02A 1HQ2A 3W9JA 4LFAF 2Z0GA 4YR2A 3F41A 1VIOA 3GIKA 2PEBA 3DD6A 4NXNE 4ATNA 4LRAA 2DY1A 2HSEB 1NSPA 1S9EB 1S1TA 2FB0A 1LFPA 1EETB 2ACYA 3MF5A 1AA1B 4OIXA 4PWDA 1TMJA 1VFJA 4FN5A 1HHQA 4A8QA 1FWLA 1CG2A 1DQAA 2CNNB 3I31A 1T9VA 3PACA 6FD1A 2QEXS 4KHPE 2B0GA 3ZZUA 2XB2D 1AUSL 2XI2A 2DXEA 2FVQA 1NZAA 4DMZA 5KT3A 1VQ4S 4ILRA 4C8LA 4R1FA 1FRHA 3KK1B 5B0DA 4DR4E 1TUGB 1ZOTA 1U7LA 2BEFA 1R8AA 4ITSA 4DPWA 5CAAA 2MQQA 2R7SA 2NYIA 1F1BB 2CKWA 2HVZA 1S9GA 2MPUA 4LREA 4DPOA 1XC9A 2FHMA 4WTYA 1HBUA 1Z2ZA 4QPTA 2ROPA 4U96A 3RGIA 3T19A 3Q6NA 3Q83A 5KG5A 5C24A 5KOWA 3PX0A 5LMUF 4QR2A 2W24A 5K8PA 1RREA 3MUVP 1RSCA 3T1YJ 2EXUA 3N5BA 2ZH1A 4WF9Q 1EIYB 2X7IA 4KC5A 2OMLA 1TVRB 3V6DB 4WXOA 1NHUA 3OXLA 3SDEB 5FD1A 4C9DA 3D3BJ 4D3GA 2GQ2A 3T1AA 1B99A 3MI7X 2GNKA 1Q0NA 3C6UB 1RLCL 1X4BA 2ZNYA 5CCLA 1M5VC 2QA4S 3UW1A 4AQYE 3TR5A 4I6AA 3MCOA 1EAYC 3C66A 1TK8A 2DH9A 3KNAA 3NCPA 1TTHB 1SL0A 1AT1B 1RHUB 2F5GA 4ZKAA 1RK8A 2NCKL 2CADA 2YQ0A 4FZVA 4DS4A 1DQ9A 1VBZA 1KOHA 1VC5A 3BYPA 5KFRA 2HZVA 2Z5CA 1ELOA 3PRVA 4TU8A 4LFAJ 2GMLA 1YRTA 3H4DA 3CJ5A 1NJYA 2WP8B 1X9MA 1XMOI 2EC0A 4QR1A 2NS1B 1N56A 1Q8IA 1TZ0A 5LMNJ 1X8DA 2DNNA 3MPWA 3SFUA 3C46A 2NN6F 4OO1C 1W2BR 2XMWA 5BXIA 1UA1A 2R2UA 5GADI 4ED6A 1RKJA 2B3TB 3NG8A 5GAHU 4Q43A 3G6VA 3MEEA 3D6HB 4JI0E 5LMNE 2OSQA 4N8OA 4DR2F 2E5GA 3AY0A 4USUA 2OKQA 3L3CA 2VQFJ 3S6EA 5HMXA 4YOEA 3P5BP 4J3DA 4CRJA 3CMES 1O0PA 4U7CA 4PXCA 2EBEA 4PG5A 3ZTOA 4F26A 2B4VA 2J0XA 2MGZA 4F02A 2EG1A 4JI0I 1Y3JA 3FKBA 4P71A 3H8YA 2MGZB 3EX7B 3M8WA 1PC4A 2H3EB 4ZLLA 2MZRA 4QPXA 4CWBA 2VBYA 5IFMA 4ZK7M 1RT7B 2V4JA 4C0OC 5C2CA 1U48A 1DLOB 2V2QA 4ZVFA 5HVGA 2ZH2A 2V4JB 3T9ZA 1S6OA 2RRNA 2LP4A 3TJ9A 4EEYA 2F4VF 1PJ6A 2CWXA 5D15A 4C7QA 2DVIA 5DLFA 3QJPA 2KDOA 3NLCA 4OFZA 1MROA 2E1CA 2C3YA 3FJ2A 1SUQB 4IUFA 3FQKA 4B3RJ 2BA0G 2LECA 8RUCA 2PD1A 3FUYA 4PXDA 1FE0A 5B0EA 4YY3F 2ZJPQ 2AJ2A 3HSZA 2C3OA 1YH8A 4RBVA 4BLGA 2CJYB 4RZRA 2YNHB 3KMSA 2AIRB 2FHOB 2VHGA 1W7WA 3JAMQ 4OLOA 3UDLA 3HFKA 4A4JA 3QSYB 1ZYQA 2UVVA 4EZ6A 3KLGA 2HRYA 2IBOA 1NDLA 2W8LA 1Q16B 3I82A 4YN3B 2CXEA 4C6AA 1YJ9S 3M6XA 3OFFA 1RB0A 1Q78A 1RAEB 4LF6F 4MIWA 4MIBA 2KVIA 3V4IB 3TANA 2BR0A 4B3OA 3QGHA 3I56S 3CD5A 3ENVA 4PQAA 1MWQA 1QDUB 3EVMA 1ZBTA 3PJWA 1SH3A 3PO4A 2PN6A 1WDTA 2W2QP 3AXKA 3FZBA 4C11B 2XNRA 3W3SA 4FYDA 4XTJA 4JI4I 4B9UA 4C11A 1LXNA 2W2OP 4NLDA 5GAEU 1UL3A 3FCWA 3IS9A 4MAKA 2CQ4A 3PR5B 1NPPA 4BC7A 2IC3B 2E5LJ 3BJYA 4EYHB 2MEWA 4DS5A 2XMKA 2HZAA 3CMQA 1HNIA 1IUJA 4IFVB 4DQPA 2DGTA 3N6NA 4JI2F 3AD7C 2PO0A 2OPRB 4DV7E 4IFVA 3R5BA 2OPQA 2YWGA 3MAAA 3TAPA 1J5EJ 1IR1A 4IFDA 2BUNA 3RG6A 3NGDA 2HFOA 1R89A 4DR3F 2JSXA 4FW5A 1MG7A 1SVDA 3ZC4A 3OL7A 4K4TA 3ZKBA 2MZQA 4DCJB 4ER8A 1N8RT 1VQ9S 1T02A 3QIPB 4LF8F 4HHHA 5E3RA 5D4NA 3SZ2A 2GX8A 1T7PA 3QIPA 4QYZJ 2CPIA 1RWPB 4C8MA 1VR6A 1RGVA 3U1MA 4X65J 4B3SF 3Q22A 2GS8A 2HFVA 3J7A1 2UUBE 3FBCA 4ZP6A 5LMNF 1XIQA 2CQPA 4ZN3A 4RUHA 2MKKA 2FY1A 1B7FA 3EGWB 4J9QA 3MM5A 2B4PA 2RB7A 4XK8C 4JI1I 2KI2A 4DR4J 3HSGA 1X5PA 5GMKa 3DM2B 2C28A 4A8FA 1E3HA 3W2WB 1U25A 2CJBA 1XMQI 3NY0A 1X9SA 2AX0A 4NLGA 5AXMA 5F9NA 2VQFF 1XTZA 2GJ2A 2Z2MA 5DM6Q 4KFBB 4JI7F 5J2QA 4FVMA 4RW4A 3CF5Q 1HWKA 1KHWA 1XR5A 1UPPA 2B8PA 2VD3A 3TVYA 2FJVA 3A3PB 4QIWD 1RHYA 1N0UA 3E01A 3HKZD 2I38A 4K2JA 4KV8B 1Z4UA 2HFSA 4DXLA 2C37A 2UXDJ 1JLCA 4L3KA 4RX6A 2XLJA 1CC8A 1JXVA 1LOUA 1RISA 3FBFA 4DR5J 4U3DA 1S1UB 4AQYJ 6FDRA 2ZH4A 4DV7F 3QRPA 2WNRA 1S1UA 1VGYA 1Y5LB 3F73A 3UN5A 1UZDA 4KJIA 2G1DA 3HF5A 4KT0C 1EETA 1NPKA 5KFVA 4ZIVA 2KFYA 1FFGB 3GG0A 1G3OA 3VVUA 5A6WA 3ZTPA 5IV3A 2VDHA 4WWSA 1S0MA 5DM7Q 1WI6A 1UDSA 4DL5A 4HTIA 4HEA9 4B3RI 1XNQE 4EI2A 1PVGA 3CCUS 3SQGA 2YXLA 2H51B 1N36E 2CJXB 3TVKA 3OHBA 2EFGA 1FK9A 1SJRA 2V8GA 4F0KA 2D1CA 1N36F 4ES2A 3FCVA 4JYAF 1HA1A 1WOSA 2L48A 4K4SA 4DSIA 2VG7B 4B3TI 4LR7A 4U8YA 2CG9A 3JB9k 1H7XA 1R6YA 4OZ0A 4F0MA 2BYCA 2LQBA 1NKBA 1YITS 5D6GA 1JJ4A 3AJDA 1WOPA 2YY3A 1S97A 4QIVA 2A2CA 1TVRA 4OO1E 5F9LA 1RWVB 3AQPA 4B08A 1Q8LA 4CT9A 1QVFR 1QUPA 2ZOGA 2YH1A 2DGQA 1A6LA 2GVZA 3C6UA 2PO2B 4F2SA 3HKMA 2A2DA 2ZE2B 2FZKB 4C0HA 2ZH9A 3H1CA 2DJWA 1VRUA 2HIQA 1LWCB 3L09A 1FCAA 3SCIE 2JH3A 2GAHC 4UQGA 2BJDA 3BO3A 3T1YI 4CM0A 2UXBF 3R7SB 2ALYB 4DX8H 4FW3A 3PX6A 2MSTA 1N0VC 3H25A 1FJ7A 1Z0EA 2NPFA 2WP8A 4YMEA 4DSFA 4JV5E 2CG4A 4EFAC 3FEYB 2BE2B 2V69A 2JT2A 1UVLA 1NJWA 1RT2A 2CQGA 3BPDA 1A7GE 2GO9A 3T1HF 5FJ4A 2K7JA 3UD3P 1NK6A 3TUZC 3KFWX 1FJGI 1UCNA 4WZQA 1N88A 1I94F 3Q8RB 5K36C 2W7AA 4NYOA 3CSKA 2M3DA 3OQ2A 5KFOA 2ATLA 3MPYA 1R6VA 2DITA 2F8HA 3FCHA 3FMWA 1GT8A 2LLZA 2V0NA 4RW6B 3R8YA 5DRRA 3DOMA 2MJNA 4GO5X 5DGBA 2DISA 4UUXA 3DLKA 2COLA 3NS5A 2CQDA 3ENWA 5HATA 4ZJLA 4X4UA 2M4MA 4CH0S 3DLKB 4Q2LA 1NEEA 8ATCB 4FXDA 2DCLA 1HNZE 3BBBA 3TNVA 5A8WB 2ZH3A 2APOA 3BSNA 2CJKA 2QG9B 3I5CA 2BXJA 2FJAB 2F1FA 2GCFA 2R7TA 5A8WA 2O5DA 4UOHA 5K9FA 3N28A 1U1QA 3GYGA 3D5MA 2D9OA 4ECUA 2LVWA 1FFWB 5CD4H 3G82B 4ED1A 4YY3I 3MCMA 4YDDB 4TLQA 1VBKA 1EKSA 1HPZA 1IVZA 3R9LA 1MX0A 2FHJD 1HPZB 2VBXA 3IAS9 2KT2A 5ETQA 2ZZMA 2DNYA 3BYRA 3D0IE 4MKVA 1QTNB 5LJ5Y 1NB7A 4C48A 4F4KA 3QRQA 2BJ9A 1BQMA 1SCJB 1WEZA 1Z1ZA 2MZSA 3ICLA 3JTNA 1V3RA 4LF5J 4F04B 2GQCA 3DHWC 3NBPA 1Y3KA 3OTBA 2VPWB 5J2PB 3P06A 4QNKA 2WCXA 3LGMA 5J2PA 5M2RA 2LXUA 4JI8E 2WONB 1MU5A 4NI2A 2RHQB 2FJXA 2BA0D 3Q1QA 2WONA 4WFYA 2ASLA 3W9IA 2DR8A 3ZZYA 3CCWA 2XULA 4DLEA 1WNEA 4DR4F 3KJVA 1FRIA 5J2NB 2JLGA 2QLBB 4TLRA 1KNZA 4DZ6A 4NEYA 4WXWA 1DARA 4Q45A 1GX6A 3U1LA 2Q3PA 1IBKI 2CDQA 3WIVA 2HHHI 4URSA 1RQ0A 4G3IA 1BQXA 4FW9A 4KHPF 2F8MA 2Z58B 3IBWA 1RAOA 3IS9B 1NJIT 5LMUI 2XY7A 1HNXE 2G13A 2J7WA 2OEMA 2AZ3A 1P27B 5J2MB 2R8GA 3OTOI 4JI7E 2DNRA 3CJTA 4O0NA 4F0HA 1Y11A 1F3VA 1WSRA 4ICLB 5LMUJ 2LEBA 5K36B 2OPQB 3A8KA 3MAAB 1TAQA 4PAAA 4CNYA 3D0HE 4ICLA 3FVYA 1CQMA 1FTCA 2AGQA 2OTJS 3GG1A 1U02A 3CTRA 5FIIA 3MUMP 4OO1D 4DI6A 2R8JA 1HR0E 4HACB 1FRJA 5KFAA 1NSKL 1FKAF 1HNWE 4WP9A 2ASDA 4DR3J 1JNZB 5ETVA 2XO7A 3EZ5A 2VJUA 1PCAA 3KJFB 5DS7A 4B17A 2MY7A 2VBZA 3C15B 3D1QA 3I4HX 1NK7A 1X9WA 1HWIA 1PBUA 2U1AA 4KO0B 3TW0A 1H74A 2JFKA 3L7PA 4FVCA 4JI8F 1M5OC 2HFZA 4B3MJ 1QAYA 3T1YE 5A2QC 4RWWA 2HQ3A 1Z2LA 4RNMA 1VQOS 4KPYA 5HO4A 5SZTA 5L9NA 3PKYA 1U8WA 2ZUAA 3BB5A 3KK2B 3M2UB 1Z5CA 4OJGA 3VCDA 4XPEA 4QIEA 3W2WA 5LSRA 1DAXA 1F5CA 2FPHX 2YNGA 4J37A 4F4XA 3DRPB 2RQCA 2CZVC 1ZM2A 2XSJB 4G1PA 5D3GB 1UVIA 2C2ZB 1PSDA 2ROGA 4CI0B 3MHYA 4RW4B 4ZCMA 1XHKA 4WUDA 2WBRA 1BY9A 3MURP 5B09A 1RT6B 1WEYA 5F3TA 3BGLA 4ZVOB 2PFFB 4F8RA 2MKYA 2JL9A 3CJ4A 1XNRI 2RDIA 3B4MA 3TUPA 1YDLA 3M8PB 4I1TA 2WNRB 1U1MA 2CG8A 1VQSA 2GHWA 3QBCA 1GXUA 5D78A 3BBFA 4ZMMA 2JLFA 3RAQA 3FSIA 4GKJJ 2MKCA 4M95A 2CJQA 3JTOA 4ZCIA 3Q0AA 3BGOP 3Q24A 4CLPA 3R6LB 1W26A 2OPPB 3ZZZA 3SIPB 3KLVA 3PZPA 1J5OA 3WC0A 2G4BA 1OYRA 4JI7I 4WBFA 1FWPA 1X0PA 3H59A 4TYAA 4C8YA 1AW0A 1FVSA 1AROP 2AJ0A 1Y00A 2W2PP 2AF6A 2HQGA 5ETMA 1DTQB 1XQIA 2BOAA 4N56A 3HP6A 2GMHA 4NXNF 3TUJC 1DTQA 1XR7A 4DU8A 2O1VA 2C2OB 2DEIA 2QL7B 3MDFA 2N3OA 2EBGA 2GIQA 3LQVA 2LEPA 5CYJA 2ZWPA 2N82B 1O8BA 4USWA 3A3NB 5DDRC 2KB2A 3KDOA 1O51A 5B0AA 3WC2A 2QMUB 5AE2A 3PCOB 4LFBF 3UDVA 2RIJA 5T41A 5KFUA 5AE3A 3TO8A 4LF9I 2NXUA 3EDQB 4YB6A 2V9KA 3KLGB 1HW8A 4DR7F 4DL0C 3HPOA 3QT7A 1P6TA 5HSPA 2Y9HA 1IKVA 5AE1A 4OZEA 1QM9A 4NYPA 1RHQB 2UU9F 4X64J 3HX9A 2LXFA 2IA6A 1RWNB 1A0OB 1IWAA 1RHRB 2E5JA 4OYMA 2DPIA 2EFNA 2MQOA 3T6BA 4X4OA 4AIDA 3CVKA 1BUXA 1NNDA 3JAMY 1FKOB 4OZJA 1EKRA 5K5MA 3M9MB 5JVGQ 1XNRF 4K5RA 1G7CB 3ETMA 3WX4A 1GMWD 1FKOA 2G2ZA 3O44A 5SUHA 4DCPB 4N41A 2AJQA 3ILJA 3HD2A 5HK4A 4JP8A 2IVFB 5K8MA 1B0TA 3NGRA 4JI6E 3IWLA 2OD6A 3NL0A 1HI8A 1O5JA 2KHCA 3K17A 4NLVA 4EWTA 5IT0A 4L6V3 3PV8A 3HJVA 3B82A 1S0NA 4X4NA 4DG1B 2NN6B 4NRUA 2JC1A 2FJDB 2FDNA 2NZ4A 1ZXNA 1OS5A 2RE1A 4DG1A 2PO0B 2NN6A 1FWKA 3D0GE 3NMRA 3OUYA 4BA1A 1EARA 5FLXQ 4DFJA 2GHVC 1KP6A 3P4UB 4Y0FA 4A8YA 1NK4A 1RE1B 1WJ9A 2V63A 3Q2SC 3A3OB 3R5AA 3X3UA 2A6MA 2FJBB 4O3RA 3TZWA 2C38B 3V81A 1S12A 1BMQB 1K1SA 2AP6A 2UXCJ 3VGVA 2GVDA 2J9CA 3VALA 3ITHA 3V81B 1U0HA 3O1LA 4G6VB 1UZHA 5GAGU 2IBKA 2IFXA 2O67A 5A8RB 4PXBA 3V6HA 4IRCA 4P72A 4KGZB 1BGXT 2YNIA 3BM7A 1N34I 5A8RA 1CS4A 3ZNUA 3T1HI 5C0XA 3H5XA 2KM8C 2YNIB 5E2QA 5MLCV 1R8HA 1WC1A 3A4TA 1N33J 5EWGA 3TA2A 1FNMA 1K44A 5DQHA 1YKWA 4N8NA 5KG7A 4LCHA 2VKRA 3RRHA 1T03A 2OJ3A 1T05A 3MR6A 3PM9A 4OMFG 2D3ZA 4AYBD 3G6XA 1T03B 1NK0A 3J81C 4DV2E 1DBDA 1VYAA 1XEZA 2MKSA 2RILA 2Z5BA 2OP5A 3NBPB 1BQNA 2HQIA 1S49A 2VBWA 4ZN1A 5C5JA 3Q2TC 2C37B 4P75A 3O6QA 4AUKA 2OFHX 1JB0C 3HSJA 3VR1A 4B9VA 4NI2B 3QIDA 2EI5A 1USUA 5DZ6A 4USTA 1RT4B 2F4FA 3R27A 4Z37A 2HK3A 4PR6A 4C3MA 4AE5A 4DJBA 4K0KE 4PWDB 4U3BA 2C22A 1BWEA 3PXGa 4PKDB 1TFYA 2DGXA 2WBMA 4OYWA 1JLEB 3BGFA 3AOAA 4LF7I 5H9FK 2EFOA 2ZKTA 5IV4A 2NREA 3B8HA 4FPRA 3SSRA 4YQWA 3C2PA 3KOAA 1IWGA 2D41A 2E7XA 1Y4UA 4ZA1A 3GJRB
chains in the Genus database with same CATH topology
2HHHE 4R1FA 4DR4E 4DPWA 4HXZA 4GKKE 2E1RA 4DV7I 4DR1I 3Q6NA 2BV3A 4HYMA 1RREA 4B3RE 2X7IA 4WUCA 4DPXA 3QT6A 4X64I 4LF5E 1Z59A 4AQYE 2BM0A 1D6TA 4IZKB 4DR1E 3J7AG 4FWHA 1H7SA 4IZKA 4GKKI 3F0NA 2UU9E 1NHJA 2Z5CA 1ELOA 3WU3A 2Z5CB 1XMOI 1ZXMA 1FJGE 1B62A 2VF3A 1N36E 4HY1A 2UUCE 4JI0E 5LMNE 3OTOE 1I94E 4NXNI 5FWKA 5BR8I 1H72C 4JV5I 4JI4E 5LMUE 3LPSA 4JI0I 4OX9I 1HNZI 2V34A 2CGEA 4GKJE 4DPTA 2V2QA 2UXDI 1I94I 5LMNI 2HFUA 4LF7E 1N33I 3QT8A 2IOPA 4DV6E 4Z7CA 4B3ME 3JAMQ 4JG4A 5L3JA 4EMDA 3LTOA 4JI3E 4PRXA 2UUAE 1IBKE 1Z0WA 1Y4SA 1Z0GA 2LJPA 1Z0BA 3JAMC 2V2VA 4XTJA 2UXDE 2UXCE 3ZM7A 4LF6E 1HK7A 4DV7E 4N3OA 2E5LE 4DV3I 1MG7A 2O1WA 3ZKBA 1PKPA 5BR8E 3V5RA 4JI1E 2VQFE 2GS8A 2UUBE 4DR7E 4JI1I 4P52A 1HNWI 2O1TA 4M1KA 1XMQI 4ZVIA 2VQEE 1N34E 4JI5I 2Q2EB 4UT4A 3QT5A 4WUBA 4DV5I 1Y6ZA 2HKJA 5GMEA 1N0UA 4DXLA 3WU5A 2HFSA 2F4VI 4DUYI 1J5EE 3PYEA 4DV1I 4JI2E 2GQ0A 4DR5E 3K85A 1EA6A 1IBMI 1FI4A 4IZJD 1XNQE 1PVGA 4LF4E 4JI6I 2EFGA 4URLA 1K47A 1XNQI 1RR9A 1A6FA 4B3TI 4IZJB 2X36A 4YHHI 2CG9A 2HKEA 3PYDA 4IZJA 1N32I 1IBLI 1N33E 4B3SI 3J7AM 2A2CA 4JI4I 3B78A 4B3MI 4LF4I 4DV6I 2A2DA 3ZKDA 4DPYA 4DV5E 4LFBE 2UXBE 3T1YI 1HNZE 1PIEA 3Q6MA 1XMQE 4JYAE 1Z0EA 1N0VC 1J5EI 2NPFA 4JV5E 3HULA 4DV0I 4LF8E 4DV3E 1KTVA 2Z5EA 4JI8I 3H4LA 4DR3E 1FJGI 4X62E 4USMA 2ZBKB 1XNRE 1U2RA 4X66E 4DV4I 2UUBI 2XEXA 4DR2I 3V2UC 2ZM6E 1H73A 4YY3I 3PYGA 2HK2A 4LF5I 5GMDA 2F4VE 4USKA 2CZ9A 2R42A 1B63A 1MX0A 4LFAI 4DPUA 1UEKA 2V8PA 4DV4E 4LF6I 4JI5E 4LF7I 3P06A 2UXCI 4DV0E 4X62I 4DUZE 1MU5A 4KQVA 4JYAI 1HR0I 3Q1QA 3M6AA 1ZM3A 5FLXC 1DARA 1IBKI 5LMUI 2HHHI 4FW9A 4LF8I 1HNXE 3D4JA 3OTOI 4JI7E 4LFCE 1IBLE 1KKHA 4YHHE 3LNUA 4HACA 4I3HA 1HR0E 4HACB 1HNWE 3K1JA 1EI1A 4B3SE 1H74A 3T1YE 1WUUA 2PNLA 5A2QC 4NXME 4LFBI 1S4EA 1BKNA 4LFAE 4LFCI 1Z5CA 4ED4A 1XMOE 4FWGA 2UUAI 2J7KA 4FWDA 4RPFA 2UU9I 2V2ZA 2AJ4A 2UUCI 5A2QQ 1ZM2A 4B3RI 1XHKA 4WUDA 1USVA 5IWAI 4X64E 1XNRI 4DU7A 2BM1A 1ZM4A 4DUYE 4DR2E 4KHPI 3J80C 5LL6R 5IT9Q 4P7AA 4AQYI 2ZITA 2VQFI 4X66I 3PRYA 4DR5I 4X65E 4DR6I 1NHIA 4JI3I 4JI7I 1Z5AA 3ZZTA 4YY3E 3J80Q 4DU8A 4Z7YA 2O1VA 3HJCA 5IT9C 2DEIA 4DR6E 4NXMI 2UXBI 1NHHA 1OJ4A 4MYTA 4LF9I 2DEJA 3GONA 3QT7A 2R3VA 4X65I 4DR3I 2WW4A 4K0KI 1Z0VA 4MYUA 2OI2A 4JI6E 2E5LI 5IWAE 3ZZ0A 3K17A 3B82A 4DV2I 1VISA 1IBME 1ZXNA 1FWKA 5FLXQ 4DUZI 3WU4A 1QZRA 4UTGA 1ZM9A 1NZ0A 1S16A 4PRVA 1N32E 3CWVA 3PYFA 4B3TE 3J81Q 1N34I 4DV1E 4JI2I 3T1HI 4LF9E 1Z5BA 1HNXI 1FNMA 2ZM6I 1Z0TA 3J81C 4PU9A 4DV2E 2Z5BB 4DR7I 1KVKA 2Z5BA 1FKAE 2PNMA 4DR4I 3WU6A 1USUA 1Z0CA 2IOQA 3T1HE 4NXNE 2HK3A 4GKJI 4K0KE 1N36I 1KIJA 4JI8E 4FN5A 1FWLA 4OX9E 2VQEI 4KHPE 3B8HA 3ZZUA 2O1UA 1Y4UA 1H7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH E;  4R1F A;  4DR4 E;  4DPW A;  4HXZ A;  4GKK E;  2E1R A;  4DV7 I;  4DR1 I;  2BV3 A;  4HYM A;  1RRE A;  4B3R E;  2X7I A;  4WUC A;  4DPX A;  3QT6 A;  4X64 I;  4LF5 E;  1Z59 A;  4AQY E;  2BM0 A;  1D6T A;  4DR1 E;  3J7A G;  4FWH A;  1H7S A;  4GKK I;  3F0N A;  2UU9 E;  1NHJ A;  1ELO A;  3WU3 A;  1XMO I;  1ZXM A;  1FJG E;  1B62 A;  2VF3 A;  1N36 E;  4HY1 A;  2UUC E;  4JI0 E;  5LMN E;  3OTO E;  1I94 E;  4NXN I;  5BR8 I;  1H72 C;  4JV5 I;  4JI4 E;  5LMU E;  3LPS A;  4JI0 I;  4OX9 I;  1HNZ I;  2V34 A;  4GKJ E;  4DPT A;  2V2Q A;  2UXD I;  1I94 I;  5LMN I;  2HFU A;  4LF7 E;  1N33 I;  3QT8 A;  4DV6 E;  4Z7C A;  4B3M E;  3JAM Q;  4JG4 A;  5L3J A;  4EMD A;  3LTO A;  4JI3 E;  4PRX A;  2UUA E;  1IBK E;  1Z0W A;  1Z0G A;  2LJP A;  1Z0B A;  3JAM C;  2V2V A;  4XTJ A;  2UXD E;  2UXC E;  3ZM7 A;  4LF6 E;  4DV7 E;  2E5L E;  4DV3 I;  1MG7 A;  3ZKB A;  1PKP A;  5BR8 E;  3V5R A;  4JI1 E;  2VQF E;  2GS8 A;  2UUB E;  4DR7 E;  4JI1 I;  4P52 A;  1HNW I;  4M1K A;  1XMQ I;  4ZVI A;  2VQE E;  1N34 E;  4JI5 I;  2Q2E B;  4UT4 A;  3QT5 A;  4WUB A;  4DV5 I;  2HKJ A;  5GME A;  1N0U A;  4DXL A;  3WU5 A;  2HFS A;  2F4V I;  4DUY I;  1J5E E;  3PYE A;  4DV1 I;  4JI2 E;  4DR5 E;  1EA6 A;  1IBM I;  1FI4 A;  1XNQ E;  1PVG A;  4LF4 E;  4JI6 I;  2EFG A;  4URL A;  1K47 A;  1XNQ I;  1RR9 A;  1A6F A;  4B3T I;  2X36 A;  4YHH I;  2HKE A;  3PYD A;  1N32 I;  1IBL I;  1N33 E;  4B3S I;  3J7A M;  2A2C A;  4JI4 I;  3B78 A;  4B3M I;  4LF4 I;  4DV6 I;  2A2D A;  3ZKD A;  4DPY A;  4DV5 E;  4LFB E;  2UXB E;  3T1Y I;  1PIE A;  1HNZ E;  1XMQ E;  4JYA E;  1Z0E A;  1N0V C;  1J5E I;  2NPF A;  4JV5 E;  3HUL A;  4DV0 I;  4LF8 E;  4DV3 E;  1KTV A;  4JI8 I;  3H4L A;  4DR3 E;  1FJG I;  4X62 E;  4USM A;  2ZBK B;  1XNR E;  1U2R A;  4X66 E;  4DV4 I;  2UUB I;  2XEX A;  4DR2 I;  3V2U C;  2ZM6 E;  1H73 A;  4YY3 I;  3PYG A;  2HK2 A;  4LF5 I;  5GMD A;  2F4V E;  4USK A;  2CZ9 A;  2R42 A;  1B63 A;  1MX0 A;  4LFA I;  4DPU A;  1UEK A;  2V8P A;  4DV4 E;  4LF6 I;  4JI5 E;  4LF7 I;  2UXC I;  4DV0 E;  4X62 I;  4DUZ E;  1MU5 A;  4KQV A;  4JYA I;  1HR0 I;  3Q1Q A;  3M6A A;  1ZM3 A;  5FLX C;  1DAR A;  1IBK I;  5LMU I;  4FW9 A;  2HHH I;  4LF8 I;  1HNX E;  3D4J A;  3OTO I;  4JI7 E;  4LFC E;  1IBL E;  1KKH A;  4YHH E;  3LNU A;  4HAC A;  4I3H A;  1HR0 E;  4HAC B;  1HNW E;  3K1J A;  1EI1 A;  4B3S E;  1H74 A;  3T1Y E;  1WUU A;  5A2Q C;  4NXM E;  4LFB I;  1S4E A;  1BKN A;  4LFA E;  4LFC I;  1Z5C A;  4ED4 A;  1XMO E;  4FWG A;  2UUA I;  2J7K A;  4FWD A;  4RPF A;  2UU9 I;  2V2Z A;  2AJ4 A;  2UUC I;  5A2Q Q;  1ZM2 A;  4B3R I;  1XHK A;  4WUD A;  5IWA I;  4X64 E;  1XNR I;  4DU7 A;  2BM1 A;  1ZM4 A;  4DUY E;  4DR2 E;  4KHP I;  3J80 C;  5LL6 R;  5IT9 Q;  4P7A A;  4AQY I;  2ZIT A;  2VQF I;  4X66 I;  4DR5 I;  4X65 E;  4DR6 I;  1NHI A;  4JI3 I;  4JI7 I;  1Z5A A;  3ZZT A;  4YY3 E;  3J80 Q;  4DU8 A;  4Z7Y A;  5IT9 C;  4DR6 E;  2DEI A;  4NXM I;  2UXB I;  1NHH A;  1OJ4 A;  4MYT A;  4LF9 I;  2DEJ A;  3GON A;  3QT7 A;  2R3V A;  4X65 I;  4DR3 I;  2WW4 A;  4K0K I;  1Z0V A;  4MYU A;  2OI2 A;  4JI6 E;  2E5L I;  5IWA E;  3ZZ0 A;  3K17 A;  3B82 A;  4DV2 I;  1VIS A;  1IBM E;  1ZXN A;  1FWK A;  5FLX Q;  4DUZ I;  3WU4 A;  1QZR A;  4UTG A;  1ZM9 A;  1NZ0 A;  1S16 A;  4PRV A;  1N32 E;  3CWV A;  3PYF A;  4B3T E;  3J81 Q;  1N34 I;  4DV1 E;  4JI2 I;  3T1H I;  4LF9 E;  1Z5B A;  1HNX I;  1FNM A;  2ZM6 I;  1Z0T A;  3J81 C;  4PU9 A;  4DV2 E;  4DR7 I;  1KVK A;  1FKA E;  4DR4 I;  3WU6 A;  1Z0C A;  3T1H E;  4NXN E;  2HK3 A;  4GKJ I;  4K0K E;  1N36 I;  1KIJ A;  4JI8 E;  4FN5 A;  1FWL A;  4OX9 E;  2VQE I;  4KHP E;  3B8H A;  3ZZU A;  1H7U A; 
#chains in the Genus database with same CATH topology
 1U49 A;  1N52 B;  2QYC A;  4P6Q A;  1YLX A;  1Q4R A;  5F8H A;  5KFM A;  2PNZ A;  1GMU A;  1S9G B;  1WC4 A;  2QTW A;  3HLU A;  3I4P A;  2E1R A;  2MHN A;  5CYQ B;  4P74 A;  1HAR A;  1EHW A;  1FRL A;  2XC9 A;  1RYR A;  1MU2 B;  3K8V A;  5C24 B;  2RD5 C;  2KM8 B;  1KRP A;  4QYR A;  1LKZ A;  1RWM B;  1UVK A;  1A9N B;  2PO1 A;  5KT6 A;  4MU0 A;  4K59 A;  4LSZ B;  1HD0 A;  4OYO A;  2DPJ A;  2PO1 B;  2AW0 A;  1N34 F;  4TY9 A;  1N33 F;  2OSR A;  2YWK A;  3OL6 A;  3NMA A;  2DHG A;  1E3P A;  4X64 I;  2JC0 A;  4AL5 A;  3CJS A;  3H7H B;  4CLF A;  3CXC R;  1RAD B;  4LSL A;  4JI6 F;  3RBE A;  2B9X A;  2GVZ B;  3HHK A;  4HT7 A;  1S77 D;  1RHM B;  4LSL B;  2BM0 A;  2K7K A;  1FKA E;  2V8V A;  2FQQ B;  2EKN A;  2I9S A;  4ZPC A;  1LWC A;  1UKU A;  4UOG A;  3TZX A;  1D6T A;  3RBX A;  4FYY B;  3QAE A;  5JXS A;  2Z57 B;  3RR8 A;  2IER A;  3D3C J;  4IZK B;  3M2U A;  1H7S A;  4DR1 E;  4DUZ F;  2HHW A;  2KKH A;  4M63 A;  5H9E K;  4IZK A;  4GKK I;  2UU9 E;  3PDN A;  5H1S V;  2MZ1 A;  2IHR 1;  4CLL A;  1KOO A;  2EC2 A;  1S1W B;  4O44 A;  1P1T A;  2XSJ A;  1NHV A;  3IWN C;  3W60 A;  4NXM J;  5D3G A;  3H5U A;  2IMO A;  4AXI A;  8AT1 B;  3MFI A;  1FJG E;  4CQ1 A;  4Q7A A;  1B62 A;  1RXO B;  2GGP B;  3GJQ B;  4EBD A;  2ADC A;  1I5O B;  1RAF B;  1YJ7 A;  2H5J B;  3M7V A;  3RUB L;  2B5J A;  3TP2 A;  4EU0 A;  2ZBI A;  3CT9 A;  4HY1 A;  3MPU B;  2PO4 A;  1U2F A;  2VFT A;  2B5J B;  5FWK A;  4CLY A;  1NPR A;  1P9Y A;  4PPD A;  2MZJ A;  2E7V A;  4HHU A;  4BDP A;  3GME A;  4JV5 I;  1CBK A;  2JX2 A;  4DN9 A;  2ZM6 F;  4JI4 E;  4LIW A;  5A76 A;  3LPS A;  3I9V 9;  3W65 A;  3GTY X;  2CWK A;  3CCT A;  2AYM A;  1U09 A;  2VFS A;  5HMZ A;  2V34 A;  4N7T A;  2PMZ D;  3T41 A;  2H65 B;  3CCQ S;  5JEA E;  2O3D A;  3M4X A;  1DLO A;  4G1Q A;  1HWU A;  3N6M A;  3PIO Q;  3SI8 A;  4DPT A;  1XNR J;  5IM0 B;  2DKO B;  2E5H A;  4NLU A;  4U7U K;  1SV5 B;  3FEZ A;  4RUA A;  3CJR A;  2AZ1 A;  3VAJ A;  1GH8 A;  4LFA I;  1U6F A;  1VQ8 S;  2DO0 A;  2KXH A;  1UWA A;  3BSA A;  1WHY A;  2GV1 A;  4JOU A;  2W9B A;  5CXT A;  1V5V A;  2KZM A;  2AU0 A;  3Q8S B;  4C0B A;  4LF7 E;  3JYT B;  2HGM A;  3QQC D;  4M5I A;  2IM1 A;  1WG1 A;  2I1R A;  5A2Q U;  3JYT A;  4E98 A;  2ZHA A;  2HHT A;  2HEK A;  2DH7 A;  2V67 A;  2B9Y A;  1WC3 A;  3SQO P;  3CO9 A;  4A8K A;  1Q82 T;  2YKQ A;  1DQ8 A;  3D6M B;  3KYL A;  5DET A;  3HI9 A;  3HT0 A;  2DGO A;  4K5S A;  4Y00 A;  4Z7C A;  3HHN B;  4K4Z A;  3B4T A;  5IXU A;  4LOM A;  4NYZ A;  3GFH A;  3SCJ E;  3UN2 A;  2D69 A;  3DC2 A;  1RWW B;  4Y28 C;  2BOP A;  3LTO A;  2HHH F;  4IQX A;  1MSW D;  4PRX A;  1RCX B;  2UUA E;  4JI3 E;  1LFW A;  2GC8 A;  4KGK A;  2BQ3 A;  1Z0W A;  4EZ9 A;  3QSI A;  3N6L A;  4USI A;  3UO0 A;  2BW7 A;  3MM6 A;  4EGL A;  4IG3 B;  1Q81 T;  2DR5 A;  2LJP A;  4OZ2 A;  4I68 A;  3PFO A;  2POK A;  2YBV A;  4NAS A;  2NZC A;  4UW2 A;  4ZCK A;  3J7Y I;  3KJV B;  3THV A;  4LMZ A;  4B3M I;  1IBL F;  3I9Z A;  2JLE A;  4UUW A;  1V6H A;  2IC3 A;  2UZA A;  2E66 A;  3BGR A;  1D0E A;  1IM4 A;  3ZM7 A;  4K4U A;  3CUL A;  1K73 T;  1HNI B;  4WFZ A;  5J2M A;  1N5S A;  4BWM A;  5HLF B;  2RSQ A;  1IR2 A;  1MMD A;  1VQK S;  3W9H A;  3HXM A;  5LXR A;  5KFJ A;  4N3O A;  3MM9 A;  1RBL A;  2IRY A;  4LSN B;  4Y2C A;  3U02 A;  3SXL A;  3OUY B;  3BKT A;  4C97 A;  3MM9 B;  2YX7 A;  1VBX A;  2E5L E;  7FDR A;  4DV3 I;  3G6Y A;  4K4Y A;  4QCL A;  3GFZ A;  2RHS B;  2XMJ A;  3CJ2 A;  1U45 A;  5ETT A;  4ZJO A;  3PY8 A;  3SSS A;  2UXC F;  3NOC A;  2DNK A;  1HMV B;  4DV0 F;  1Q5Y A;  5I3P A;  5I4M A;  4BS2 A;  1TQL A;  4RUC A;  5AJ3 F;  2BBE A;  2ROE A;  4DV1 J;  4QYZ K;  4JI1 E;  2LQJ A;  1ROF A;  2VUG A;  1KDN A;  2GVD B;  4J5O A;  2V5H G;  1RAJ A;  3ITH B;  3BO4 A;  2C2R A;  5HN0 A;  2PT0 A;  4F3M A;  3VAH A;  4DR7 E;  2X1G A;  2UVW A;  4QR0 A;  2DR7 A;  4P2S A;  2FHJ A;  1CS4 B;  2JVO A;  1FXL A;  1YZ6 A;  2BW2 A;  4P52 A;  4RNO A;  1YBU A;  2X1B A;  3MZI A;  3QFW A;  3KK2 A;  5HVH A;  3DLB A;  2XZT B;  1NUE A;  4H4K A;  1HBO A;  4MJK A;  1UJ4 A;  4Z2X A;  2J6S A;  1PAE X;  3P8B B;  3QJJ A;  1FX4 A;  5IT4 A;  3EWG A;  2HW3 A;  4KFB A;  2VQE E;  5ELW A;  4CT8 A;  4R8U B;  4UZB A;  3QT5 A;  3MED A;  2ZM6 J;  4WUB A;  3T3F A;  4CLU A;  1X5S A;  3BR9 A;  1FF2 A;  3CJ8 A;  3M8Z A;  2HQF A;  3FQL A;  3MED B;  4IH7 A;  2E29 A;  4N77 A;  3E01 B;  2C2M B;  2WSF C;  4QOT A;  3J7Z 5;  1N34 J;  1RT6 A;  2E44 A;  5K8O A;  2R8I A;  1BC6 A;  4K2X A;  1QTM A;  3P6Y C;  3AA8 A;  3FNN A;  2ZC4 A;  2BR2 A;  4DUY I;  1HNZ J;  2XS5 A;  3M2R A;  2E7W A;  1EP4 B;  2H9Z A;  2NN6 C;  3CJK A;  3GV5 B;  3M8P A;  3U1N A;  3LPE A;  1YTY A;  4DWI A;  1FO1 A;  3R1L A;  3EGZ A;  3KUE A;  1C4C A;  3WX8 A;  4Q44 A;  4LQ3 A;  1K1Q A;  2P9E A;  4NLT A;  3M9N B;  3RAX A;  3VGU A;  2BA9 A;  3UD5 A;  1FA0 A;  1LWF A;  3G87 A;  4P7T A;  4IZJ D;  1AZS A;  3SQG B;  1HI0 P;  2C38 A;  3TYT A;  1ZH5 A;  3BQ1 A;  1JQG A;  3UDE A;  4D3H A;  1F0X A;  2C2D A;  4DZD A;  2IVY A;  4EO6 A;  4ZP9 A;  5KFQ A;  1WWH A;  5CYQ A;  3TI0 A;  4WK1 A;  3I0R B;  1QVG R;  4Q5V A;  2LQ8 A;  2VG7 A;  3M2V B;  3MD3 A;  2N4C A;  4RNN A;  3M2V A;  3D28 A;  4YHH I;  4DX5 A;  1S0V A;  2KRB A;  1TKZ A;  3PYD A;  3Q86 A;  2H4Y B;  1Q1K A;  4R5P A;  4IZJ A;  2KO1 A;  2CNL B;  3ZTS A;  3MOJ B;  3Q8Y A;  1TKZ B;  2HFN A;  4NLS A;  3AD9 C;  4ZPD A;  4KPC A;  4U9R A;  2L08 A;  1SKS A;  3NWR A;  1KN6 A;  1SQE A;  1BHN A;  1GMV A;  3DGP A;  1VIX A;  3ETO A;  3DXB A;  3B78 A;  3M30 B;  1V3Z A;  3MMB A;  4HDG A;  4USJ C;  5JMN A;  3DGP B;  3M30 A;  4MDT A;  2ZE2 A;  1TV6 A;  5ETS A;  2KXF A;  4OYP A;  2QT7 A;  3EGN A;  1VRU B;  4A46 A;  3OLB A;  2MJU A;  3ZKD A;  4KHR A;  2D74 B;  5LXY A;  1FDA A;  4NCA A;  3GV8 B;  2E5L F;  3NNA A;  4OZ3 A;  4CLK A;  7FD1 A;  2H54 B;  1HI1 A;  2RVJ A;  4IR9 A;  4QQB A;  3WDO A;  1URR A;  3S8S A;  2M70 A;  2X51 A;  4IOC Q;  1HR0 F;  3IRX B;  4RBT A;  4CH7 A;  1N54 B;  5F41 A;  4C8Z A;  1UEV A;  1MWZ A;  5THW A;  4BCA A;  3HUL A;  4NMX A;  1TUV A;  5K20 B;  1X4H A;  2ZHO A;  4OV1 A;  1GQE A;  4L75 A;  1JLF B;  4A8W A;  2VKZ G;  4ZVT B;  1VQ7 S;  4DV3 E;  4LF8 E;  3MMC B;  1JLF A;  3PKM A;  1WC5 A;  1XNQ J;  2QA2 A;  2QFI A;  1FES A;  2GGP A;  5L9X A;  5LSO A;  2R7W A;  4CLZ A;  4DR3 E;  2HIY A;  2YWF A;  3NCR A;  1CJV B;  4X65 F;  2KN4 A;  5D77 A;  5FDL A;  1G6B A;  3IO1 A;  3KHL A;  3KLH A;  3VAM A;  2JEA B;  1CJV A;  2DGW A;  4ZCL A;  5T14 A;  1D9A A;  2DGS A;  3H2V E;  1H98 A;  1TL7 B;  1WHX A;  3HFZ B;  4PYD A;  4LRB A;  3GJS B;  1WI8 A;  2FIU A;  4X66 J;  3G96 A;  2V68 A;  1TL7 A;  5BYS A;  2KXN B;  2EW9 A;  2ZBK B;  1RTH B;  5ITH A;  1U2R A;  3SYZ A;  3D54 A;  2MMY A;  2WB4 A;  1HNV B;  3BV8 A;  3GYN A;  3N79 A;  3LW5 C;  5DDP C;  3NS6 A;  5KFL A;  3TEG A;  4ECT A;  4MH8 A;  4V19 X;  4DV4 I;  4J91 A;  5ETL A;  4L3N A;  5A0Y B;  5ETR A;  1V3S A;  4BBY A;  4NLX A;  5IM0 A;  3R7N B;  1SV5 A;  1H73 A;  5KFP A;  3G82 A;  3W64 A;  2XLK A;  2CQ3 A;  2W9B B;  3HJF A;  5HBM B;  2HK2 A;  4ID5 A;  2PMW A;  1R6L A;  3HKW A;  3DFE A;  2L9W A;  3D66 A;  1S48 A;  3OTE A;  4GMK A;  4ID5 B;  5HQL A;  2UVR A;  3CC7 S;  2F4V E;  2UV8 A;  4USK A;  5M2P A;  1HNZ F;  1VQN S;  3OTD A;  2C3P A;  1N48 A;  2BJ8 A;  1R0B G;  3KLE A;  5JEA C;  1T05 B;  4DPU A;  1SJ1 A;  3GMG A;  1DJ0 A;  2YVS A;  4KGV B;  3GSI A;  1BQM B;  1U1R A;  1VBY A;  4BA2 B;  4PYA A;  3H0P A;  1WTF A;  3GWC A;  3UQS A;  1L3U A;  4DV4 E;  4ECZ A;  4JI5 E;  4U7U D;  5LJ3 Y;  2HNY B;  2CA9 A;  3GIL A;  1BQN B;  1TKD A;  2F65 A;  4DR6 F;  4Y2M A;  5GAE I;  4P7V A;  4J9M A;  5ETK A;  4DV0 E;  2LFV A;  4AL6 A;  1VQM S;  2JE6 B;  2B9E A;  3FRY A;  1KVJ A;  1YJR A;  2WVE A;  4DV4 J;  1X4F A;  2M88 A;  2RQM A;  3MR7 A;  4HL9 A;  2B51 A;  4F3Q A;  3CIZ A;  4B3T F;  2Q66 A;  4CP5 A;  5J2N A;  4A47 A;  3M6A A;  5E3C A;  4LJM A;  4JUZ A;  2G9O A;  1GXL A;  5FLX C;  3QMQ A;  4EUV A;  3M85 D;  5DNL A;  4OJ1 A;  2XZW A;  2J6U A;  2MLZ A;  4LF8 I;  2NN6 E;  1W25 A;  2ILZ A;  3I6P A;  2VOO A;  1FXR A;  1T11 A;  1M1H A;  3UFC X;  1YVF A;  4TXS A;  5IZH A;  1L3T A;  5DRQ A;  4RWX A;  2ZH8 A;  2DIV A;  2MQN A;  2DHH A;  2PNZ B;  3JQJ A;  2BZ2 A;  2CNO B;  3DI6 A;  4X64 F;  4FP9 A;  4ED3 A;  2VOP A;  4FW4 A;  3QGG A;  1IBL E;  3LGH A;  2G2O A;  2IYI A;  4MU1 A;  1MU2 A;  5E33 A;  4LSN A;  3QYY A;  3MOZ A;  3J80 U;  3LNU A;  4MU3 A;  4HAC A;  3EYZ A;  4I3H A;  2HBY B;  2DNG A;  4ZPA A;  1J5E F;  2HZC A;  3LP2 B;  2WSE C;  3J80 Y;  1F60 B;  3C15 A;  2CQI A;  5T7L B;  1HR0 J;  4KO0 A;  2BMB A;  2C39 B;  1EI1 A;  4LF4 J;  1EQM A;  4J90 A;  4C8N A;  5DNX A;  3QZ8 A;  3BKU A;  1RP5 A;  5GAG I;  4NXM E;  4B3S J;  2A3J A;  3NXZ A;  5BR8 F;  1BKN A;  2Z2Z A;  4LFC I;  3SEO A;  2XS7 A;  4FWG A;  2YNG B;  4O3P A;  1GK8 A;  2WAQ D;  2DH8 A;  3OR2 A;  4K8R A;  1HBO B;  1RTI A;  1TL1 A;  4KY3 A;  3DRP A;  4Q2M A;  4QIF A;  4Y2A A;  1N32 J;  4FWD A;  5C0X D;  1S1W A;  3I5B A;  1RAI B;  2AJ4 A;  4O44 B;  5KG6 A;  3PX4 A;  2P9C A;  2BAN B;  4R8U A;  1M5P C;  3QFH A;  2V8D A;  4F36 A;  4RU2 A;  2BAN A;  2FC9 A;  2PMH A;  2RDD A;  4A8O A;  3GPA A;  1RUS A;  2XMT A;  3NGT A;  1D1U A;  4MTP A;  1QAJ A;  1RWX B;  5IWA I;  3N4W A;  3HHD A;  4WYW A;  2RH3 A;  2J0S D;  2G0J A;  2VQE J;  4TKT A;  4ECX A;  4KRW A;  2BM1 A;  3KRN A;  1FKP B;  1VHF A;  4NA1 A;  1ZM4 A;  3CJK B;  1Q86 T;  1TKX B;  3GFX A;  1FKP A;  3K89 A;  4NEZ A;  1ITP A;  4DUY E;  2DY9 A;  1R27 B;  3OSN A;  3OTO F;  3LP1 A;  1VC6 A;  3PTW A;  2MHE A;  4FKY A;  4U6P A;  1IKY A;  4CIO A;  2DD8 S;  1F5B A;  1WKL A;  4WE1 A;  4JI0 J;  3NZK A;  4YB7 A;  3J80 C;  1LWF B;  2IPO B;  1NDP A;  2OPP A;  2RKI