3F0NA

Mus musculus mevalonate pyrophosphate decarboxylase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
401
structure length
387
Chain Sequence
RENLYFDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNGREEDVGQPRLQACLREIRRLARKDTLPLSLSYKVHVASVNNFPTAAGLASSAAGYACLAYTLAQVYGVEGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWHWPQLRILILVVSADKQTGSTVGMQTSVETSTLLKFRAESVVPERMKEMTRCIQEQDFQGFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHHGQTKVAYTFDAGPNAVIFTLEDTVAEFVAAVRHSFPPAANKFLKGLQVAPVLLSDELKAALVVEPSPGGVQYIIATQVGPGPQVLDDTHDHLLGQDGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEVALONATE PYROPHOSPHATE DECARBOXYLASE
publication title Structure of Mus Musculus Mevalonate Pyrophosphate Decarboxylase
rcsb
source organism Mus musculus
molecule tags Lyase
total genus 127
structure length 387
sequence length 401
chains with identical sequence B
ec nomenclature ec 4.1.1.33: Diphosphomevalonate decarboxylase.
pdb deposition date 2008-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF18376 MDD_C Mevalonate 5-diphosphate decarboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3f0nA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3f0nA01
4GKKE 4DUZI 1KTVA 2HK3A 1HR0I 2ZM6I 4JI6E 4YHHE 1IBKE 1FJGI 4FW9A 2J7KA 3ZZ0A 4DR1E 4X62I 4GKJI 4B3MI 4X64E 5FLXC 4DV6E 4DUZE 3ZKDA 4I3HA 1HR0E 4LF9I 4JG4A 5A2QC 4B3TI 3B8HA 2R3VA 3WU3A 2ZBKB 4GKJE 2CZ9A 4WUDA 4OX9I 1BKNA 2DEIA 5LMNI 4ED4A 4HACB 2GS8A 1XNRI 4B3TE 3D4JA 3QT8A 4USKA 4P7AA 2V2QA 4EMDA 5LL6R 4OX9E 1QZRA 5LMNE 3B82A 4DV4I 1H74A 1XNRE 1Z0VA 1XMQE 2VQEI 4X66I 1Z0EA 4DR4I 4LFAE 3CWVA 4FWDA 4DR5E 5LMUE 3QT7A 4LFBE 3J7AM 1ZXNA 1ZM9A 1MX0A 4DPUA 2UUAE 4X65I 3LNUA 4B3RI 4DV7E 4JI8E 4KHPE 1I94I 4DR7I 4JI1I 4B3SE 4DUYE 4JV5E 2HFSA 4R1FA 4LF5E 2F4VE 3K1JA 2HFUA 1I94E 2ZITA 3HULA 1NHHA 2UUBI 2LJPA 4JYAE 1H72C 4DPWA 2E5LI 1NHJA 5FLXQ 1IBLI 1NHIA 1HNXI 4JI2I 4YY3E 1EA6A 5A2QQ 1U2RA 4DV0I 1FWLA 4PU9A 4NXMI 4JI0I 1FWKA 1N33I 1HNWI 3PYDA 3ZKBA 1IBLE 1ZM3A 1HNXE 1ZM2A 2UUCE 3J80Q 4URLA 5BR8E 5GMEA 2UU9I 4LF6E 1N33E 5IT9C 1HNWE 2HHHI 1ZM4A 4JI4E 4PRVA 1K47A 2XEXA 1S4EA 4DV3I 5IWAE 4LF4E 4DR3I 2VQFE 2UU9E 4LF7I 1A6FA 2ZM6E 3JAMC 2OI2A 1PIEA 1FJGE 4WUBA 1NZ0A 2V2ZA 1N36I 4X62E 4B3ME 4K0KI 1H7UA 3OTOI 4P52A 1KVKA 4LF9E 2NPFA 1Z5AA 4DR2I 1Z5CA 2V2VA 3J81C 4K0KE 4DXLA 3OTOE 2A2CA 1XMOI 4DPYA 3GONA 4NXNI 2UXCI 3M6AA 2VF3A 4HXZA 4JI7I 1XMOE 1HNZI 3F0NA 4DPTA 1Z0BA 4DV4E 1Z0TA 4DV2I 3J7AG 2UXCE 2E1RA 2VQEE 4X66E 4DR4E 4JI5I 4JI7E 1MU5A 4DV2E 1DARA 4HY1A 2DEJA 3ZM7A 1IBMI 5IT9Q 4X65E 1PVGA 4B3RE 3T1HI 1S16A 1N0UA 4DR7E 4JI1E 1ELOA 3T1YI 3QT6A 2HK2A 1KKHA 3JAMQ 4USMA 2UUBE 2V34A 4DR6I 3WU5A 4JI3I 3T1YE 2E5LE 1FNMA 4JI2E 1Z59A 4HACA 4LF8I 1WUUA 4DV0E 4UT4A 4JI3E 4NXME 2UXDI 1ZXMA 4JI0E 3J81Q 4DV5I 4DV1I 4FWGA 1H7SA 1XNQI 1FKAE 4PRXA 2Q2EB 4YHHI 2HHHE 2V8PA 4XTJA 4DV5E 3B78A 4DR1I 4DV1E 4DV3E 4DR3E 4X64I 1XNQE 4DV6I 1RREA 3PYEA 5L3JA 4M1KA 4FWHA 4AQYI 5GMDA 4LF7E 1Z0WA 1N34I 4Z7YA 3V2UC 4MYTA 2UXBI 1N36E 4AQYE 3PYGA 3PYFA 1N34E 3LPSA 1XHKA 1UEKA 2UXBE 4DR2E 3WU4A 4FN5A 2R42A 1N0VC 3J80C 1XMQI 1PKPA 1Z5BA 4LFAI 2BM1A 4DR5I 5LMUI 4NXNE 4LFBI 3WU6A 1OJ4A 2X36A 2HKJA 1HNZE 3K17A 1D6TA 4ZVIA 2UUAI 4DV7I 4RPFA 4JI5E 4JI8I 1N32I 4KHPI 4Z7CA 1RR9A 4B3SI 4WUCA 4DUYI 4JV5I 1Z0CA 3ZZTA 2A2DA 4LFCI 4LF5I 2F4VI 1N32E 3H4LA 3QT5A 1Z0GA 1IBME 3T1HE 3ZZUA 2BV3A 4JYAI 1B63A 1EI1A 4LFCE 3LTOA 1H73A 1J5EI 4YY3I 1VISA 1KIJA 4MYUA 1MG7A 4DR6E 2HKEA 1J5EE 4DPXA 2UUCI 3Q1QA 4DU8A 2AJ4A 5BR8I 4LF6I 4LF8E 4JI4I 4GKKI 2WW4A 2EFGA 2UXDE 4JI6I 2X7IA 1IBKI 2BM0A 5IWAI 4LF4I 4UTGA 4KQVA 4HYMA 2VQFI 3V5RA 1B62A 4DU7A 1FI4A
chains in the Genus database with same CATH superfamily
3PW4A 2WRMA 2ADCA 2CG9A 1REVA 1WF2A 2UV8G 2W9CA 1Q0NA 4I0WA 1DFDA 2I5JB 3L3CA 1Q8LA 4FXWA 2MQMA 3CDUA 4P2MA 3M7NG 1FKPA 4IFDA 2CKWA 1X4CA 4ZLPA 5LMNI 2BA1G 3MPVA 4DOZA 3MR6A 3D1QA 3M7ND 5BR8J 2BA1D 3G96A 1ACMB 3NNCA 2RUGA 3IWNC 3CO9A 2G2OA 4LMZA 3BSOA 5IWAJ 1XNRE 2V4JB 1R8CA 2MGZA 1KN6A 3L7PA 2FYXA 3DOMA 1VIXA 3MTKA 2P9GA 4J9VA 3PFEA 5F8HA 3J7YU 2FVCA 3CCJS 1IKWA 2C39A 1KVJA 2AJFE 4ENOA 1NXIA 2DO4A 4M5JA 3ITHB 2DGXA 4B3TJ 3ZC4A 2IYGA 4I7FA 3K7RA 4M5HA 1XMBA 4QPXA 5K36F 4J3DA 3R27A 5FLXQ 1U26A 2EK6A 1HQ2A 1Q82T 3SQOP 1T11A 2BJ8A 4ZVQB 1HW9A 1G3OA 1R0BG 1RABB 3ET6B 4JOUA 4Y65A 4DV7J 1FKOA 1L3TA 4LIWA 2CZVC 3BGOP 4I2PA 4X65J 2RH3A 2J8SA 3GQCA 3OFEA 2AEMA 3FZBA 4DR3I 5K36E 4FBUA 1DTTB 1S1UB 2V94A 2PN6A 1NSAA 1Z1ZA 4YY3J 5B08A 5GMKa 3KLHA 1UW9A 3GR1A 4WUBA 5KFRA 4ECQA 4X4QA 3PHTA 4EFAC 4RNHA 4KV8B 1REGX 1OWXA 4AFFA 1S6PB 3LGNA 2BW7A 2B9EA 1G7CB 1HBNA 4FYXB 4CLFA 4CLLA 3H42A 1BY9A 3GONA 2EKNA 4J9RA 5KFVA 2VQFJ 2V9KA 2M5YA 2FHKA 3BGLA 3KLEA 2EW9A 4DV2I 1Q4RA 1KLNA 3JAMU 1HI1A 2V8GA 2HHSA 4QIWD 2KDOA 3W2WA 1WI6A 4ZCLA 4FNHA 1UVKA 5KG6A 1BQMB 4P2SA 4C6AA 2NYHA 2XSJA 1N0UA 1OY8A 2E5JA 4YOEA 5M2RA 3L9ZA 1T7PA 1DTTA 1WHYA 2CJYB 2HK2A 5L39A 1W2BR 4WFXA 1HPZB 1OMSA 3NGUA 5FDLA 4CLWA 3I31A 2EXUA 1T94A 4KV8A 5B0EA 2BMBA 3BQ0A 4LF7F 2HVZA 1KRPA 5AXNA 4P7VA 1WF1A 1WUUA 4KY3A 2DR8A 5F3TA 1YHCA 4WWSA 4A8XA 4DFPA 2UVUA 4YR0A 4DR2F 2NUHA 2YQ0A 2CQ1A 3FBEA 4FW7A 2VBYA 1U02A 4DV6I 1U0HA 4U7UD 4LF7E 4FPIA 5CXTA 3JYTA 4RU9A 4J9LA 3IC1A 2A10A 2ZBCA 4TU9A 5K36B 3PYGA 1BQMA 5IT9Y 2VKRA 2YKNB 2NXEA 1I5OB 2ABYA 1M1KT 3PJ9A 3I5CA 4DR2E 4M63A 4DF8A 3FQKA 2HMIA 3NWRA 1F60B 1XBWA 5K36D 4WCEQ 1RAOA 1HPZA 3HXMA 3I0SB 2J6TA 4DR5I 3OLBA 4LFBI 3WU6A 4TN2A 3EYZA 1HNZE 3PS3A 3T1YF 2F5GA 1UVJA 3D1OA 3KG4A 4H54A 3M2VB 4AQYJ 1GEHA 3ONQA 4RPFA 4Z7CA 3B4MA 4A4JA 1NCLA 2FC9A 1WSRA 3UVJB 3ISNC 2A2DA 1N52B 3W9JA 4LFCI 4K7QA 3KJVB 1OPZA 3FMBA 2N7YA 3A4TA 2RT3A 4F36A 1RTJB 1SXLA 1VC5A 1AA1B 2EC0A 4O0NA 2DNMA 2FB0A 5E3QA 2DGOA 3GSDA 3GFXA 3TA2A 1J5EE 3FBCA 3W60A 1IKXB 2MPUA 3HHNB 1CJUB 2YKNA 5BR8I 2BW2A 4HDHA 3B54A 5CAAA 4NEZA 1EIYB 2L3MA 2WW4A 1UVIA 5IWAI 3CGIA 2QMXA 3I0SA 1LFWA 3MMBB 2G2YA 3G6YA 1VOMA 2IM1A 2WVBA 5C5JA 4BCAA 4KO0A 2ASLA 3W1YC 1ICEB 1JLBB 1X5TA 1Y5NB 2GO3A 3IMQJ 5GAGU 2EVZA 3KLGB 4B3TI 3R5CA 1WHWA 4LF8J 4OO1C 4TU7A 4DX6A 1ITPA 4IZKA 2BDPA 1IR1A 1AXQA 4PABA 2DITA 2QL7B 3ZFVA 4JV2A 4YHHJ 3QFHA 4LF5F 5F8JA 3BB5A 1Q7LB 2VQEI 1IWAA 5M2PA 3SDEB 1KLMB 4ECSA 3NXZA 2GIRA 4LBHA 3HVRA 2MLXA 1TP7A 3H1CA 5AT1B 3KNAA 1ZM9A 1CJUA 2DH8A 3MAAB 5LSRA 2DNNA 4X65I 2DISA 5AJ3J 4HHUA 2WB1D 4URSA 3K8VA 1SC6A 1U8WA 1U4BA 3E8OA 2ASJA 2LXFA 4ILMA 1USVA 5ELWA 2QRRA 4IG3A 4LF5E 3PW0A 3MMBA 3ELHA 4JI6F 2X1AA 2RRNA 1N88A 1OYRA 3MURP 1RAFB 4KH0B 1EA6A 3J7AN 3KLGA 4GC7A 1OS5A 1BE4A 1YX2A 1FJGF 5KG5A 1VBYA 2DRBA 5JVHQ 1WJ9A 4LF9F 1NSPA 3I5BA 4BBYA 1UVNA 5B0CA 5A76A 1U45A 1TQLA 2MY7A 4CH7A 2CA9A 1KEKA 4OO1E 2M2BA 4K4XA 1B7FA 1WI8A 4JYAJ 3M8QA 1SV5A 4B08A 1CJVA 2V69A 1S49A 5A8KA 2VPXB 1FJGE 3UDEA 2V5HG 4DV4F 3RTVA 3TVZA 1WDDA 4LF9E 2RRAA 5K14A 1FRJA 5J2QB 4DSJA 1SJ4P 2GIFA 2B6AB 1HBMA 1LXJA 4CCHA 3W61A 4MAKA 4XTTA 4X4TA 1JLEA 1XMOE 3DGVA 2LXIA 4DV4E 5HVHA 2IIHA 3H5SA 3UW1A 4X62J 1RZMA 1IBCB 5EWEA 1T95A 1RHUB 3LQVA 5LJ5Y 2E5LF 2KFZA 4WU3A 1USUA 1IBLF 1LW2B 1S76D 1ZZFA 2HRTA 2MZ1A 1IQTA 2BVZA 3ISND 2IM0A 3AOAA 1JLQA 3LOUA 1KBRA 1CJTA 2KFNA 2KVQE 2HIYA 4LF2A 5FWKA 3V6DB 5DM7Q 2E5LE 4ER8A 1A7GE 4CLYA 3VCDA 4PUOA 3L7UA 2R2SA 1ZXMA 5J2QA 2OPQB 3T5LA 2FZKB 3POTA 1YSJA 3FRYA 1IR0A 1NRKA 1LK5A 5IQQA 4B3OB 4DQRA 4LSLB 2ZBPA 3I6PA 2W2NP 3M30B 1Q81T 1I1GA 2YKPA 2V8PA 1T3NA 2ZOMA 2Y9HA 2K8GA 5KFFA 3TOQA 2UUBJ 3PYEA 2GHWA 1FESA 4AQYI 4A8MP 3C46A 2UXCF 4ZCIA 5KFKA 4OO1B 2FLNA 1IQZA 1U47A 4DV0J 3KDOA 1Y4SA 4RW7A 1WC5A 2YWKA 1MSWD 1HA1A 4Q43A 4DL3A 2DNQA 2IBKA 3OL6A 4OO1D 1Q1KA 3OQ2A 1XNQJ 2JEJA 4N41A 2MKJA 4ETXA 3V6DA 3D1HA 1ZYQA 3TUJC 2DNYA 3BQ1A 3KLVA 4DR1J 3HT3A 4O3PA 1HWIA 3KHHA 4EZ9A 1NSKL 5DDOC 5CD4A 2VL1A 5E2QA 4OYXA 3LGMA 4JI3F 5ETSA 4F4AA 1SC3B 3WHIA 1FT8A 2FY8A 1Z0GA 3M30A 3LPEA 3MM8B 1PJ7A 3K59A 1VFJA 2Y0BB 3KUHA 5CYJA 2ZVSA 2QN6B 2XQCA 2XMTA 1FFGB 3D7SB 3K5OA 4TY8B 1JB0C 3ZXWA 4F0KA 2MZJA 2K1RA 3DLGA 4J9NA 3VAJA 1C0TB 3MCNA 1C1CA 1S0MA 2I0XA 4UQTA 2NSBA 4KQVA 4DCJB 3V5RA 2CRLA 1UWBA 4QYRA 2PA8D 1VQNS 2XMAA 2HRUA 2OAUA 3NBPB 5D4NA 5D3GA 4P2FA 5LJ3Y 4V19J 4I3HA 3CJ8A 3R3TA 2GJIA 5A2QC 4BS2A 2R8KA 3WU3A 1SQGA 2YNFA 5FJ4A 1TZ0A 4F04B 5HMXA 1NKBA 3FMWA 2B8PA 2ILYA 3IXQA 2BYCA 5KFMA 2VODA 2VPYB 2C3UA 1NJIT 3OL9A 3MM8A 4ZLNA 4P7AA 4NYPA 3NGRA 3MM7B 3ZZPA 2DNZA 3PHEA 4PXDA 2VD3A 4AL6A 3NY0A 3FCVA 2HNYA 1Y5LB 3G2XA 2F9DA 4HVZA 5F0WA 1NJZA 4HHHA 3C8YA 1HR0J 3GFZA 1TK5A 5KG0A 1HQEA 1S0OA 1NK7A 5KG2A 1NK9A 2D3O1 2CXEA 3TZWA 3H7HB 5F0UA 4DN9A 2VBWA 1IM6A 2GZOA 1N4LA 4P2XA 4QU7A 4JI1I 2PT0A 3JQKA 4FW6A 5CA5A 1Q53A 1RWVB 2ZITA 2CPXA 1KOHA 2F8HA 4Y2CA 3LO3A 4WKYA 3WIVA 5ETQA 2C3YA 4I2QB 3J7ZT 1FRKA 2LEPA 3D6FB 2ZH7A 2XNQA 1NK5A 3VAMA 2JT2A 2L08A 3GP9A 1SL2A 4QWDA 3PFOA 3IR7B 4LSZB 2NXJA 2MSTA 2J9DE 5GMEA 2FJDB 1JX4A 4KE5A 2BE9B 5LMNF 1PBUA 3H25A 3MZIA 4KGVB 1SJFA 3N0VA 2IA0A 1OSDA 1FHTA 2PMWA 4LT6A 1LV5A 3RAXA 2OI2A 1FRXA 2XY5A 4WIQA 4N76A 3SCKE 1HNXJ 3RB4A 2F4FA 3DM2A 3IBCB 1SH2A 1S1XB 1T9WA 2YX1A 4L75A 4BA2B 2PO1A 3DOLB 5IT9U 2IMWP 4PQUA 3RB6A 2L48A 2CQ0A 2PI5A 4OYZA 1RT2B 3FEXB 3K57A 2ZZMA 5AE1A 5B0AA 1ZH5A 1FX4A 1EKSA 3X3UA 1MU5A 4XIUA 4F3QA 2RB7A 3TA0A 2FLOA 4K0KJ 2DYAA 3BPDA 1VBZA 2BKPA 2VJUA 2KXHA 5A8RB 2DGVA 4ZIWA 4EYHB 2VU5A 1GTHA 2DR9A 2HQ3A 3OXLA 4DR6I 1F2HA 4F4XA 4DR3F 1F9FA 2ZBRA 4PPDA 3SCIE 2PMZD 3AB4B 3RRGA 3LP2B 2RHSB 4Y6IA 4Q8EA 2GNKA 3P4UB 1S1XA 4PAAA 4RNFA 1X7VA 4IOBA 2CNNB 2I9SA 3PM9A 2XO6A 1XNQI 3UCZP 3NP5A 2J0SD 2X1BA 1H7XA 4IR9A 1RT2A 4IFVB 4DR1I 2Z0GA 4DR3E 4RW9A 2WONB 2F8MA 3KKFA 1RDRA 3DU5A 3QSIA 4NZ0A 4J90A 2YKOA 4TVAB 4DV2F 4IH6A 1RAHB 3PXGa 4GVLA 5JEAA 4ZIVA 4RWXA 4DSFA 4QR2A 3WIUA 2CVEA 3TX8A 3DN9A 2HYIB 1E3PA 4DFJA 1Q79A 2BM1A 1KWMA 2RVJA 4DFMA 3NGDA 2X36A 4DLEA 2CNKB 4H4OA 2GX8A 2GO9A 2XNRA 4U7CA 3KWMA 2IAJB 1TK0A 5LL6d 2ATLA 4NMLA 4USVA 3IRWP 4JV5I 4Y2IA 4DBQA 3ZZTA 5AE2A 4RW8B 4QWEA 1TKXA 3FK4A 2C37A 3ZZUA 2BR2B 2KT5A 3ILOA 1VCTA 2RF2B 2U1AA 2JZ5A 1HARA 2ZWPA 4IFVA 3UN3A 3GIIA 3ZTQA 1NPKA 3I4HX 3HHLC 3T9NA 3VALA 2XYPB 4K4SA 2D69A 4PXEA 3MFHA 3VAGA 2Z57B 4IO9Q 3I9V9 3HX9A 2MKHA 3G82A 3BF4A 5K8MA 4DV6F 3PX4A 5CYQB 3NGSA 1X4FA 4P75A 5GADU 2Y0SD 2DGUA 2IOQA 2YH1A 2CQPA 2HWHA 4P72A 1IBMJ 4CRJA 3C6UB 2IJNA 5ETRA 1VGYA 1RT3B 4QQBA 3BO4A 2YKAA 2H9ZA 2Q43A 2F3JA 4OYBA 2M4MA 1HR0I 1UDOA 4IH7A 3KYLA 2ZWOA 3HCXA 4NBQA 4DV6E 3K5LA 2KHCA 1V6HA 4ANEA 3SXLA 1O0PA 2Z2LA 4XDCA 2A6OA 5HLFA 3MD3A 4AIDA 2H48B 1BKNA 1HMVA 3NG8A 3A8KA 3FSXA 3CCUS 3AOCA 1YK9A 1IWGA 2L41A 2BR2A 1XR6A 2RF2A 4ICLB 3MMCB 4GKKJ 3EZOA 1HI8A 1J5OA 4LFCF 1JKHB 3EM1A 2VG5A 2XG8A 3CDWA 1SCJB 3DU6A 1VHIA 4NI2B 4DR5E 4DUZJ 4LFBE 1QAJA 4C11B 5CYQA 2GVZB 4P10A 1HWKA 2MB0B 4F50A 4WYLA 3RB3A 3EXCX 3PS1A 2YPYA 1EJ7L 5DRKA 3J80Y 3C6UA 2HGMA 2ERRA 5BR8F 3NLCA 5J2NA 4B02A 2F8EX 4K2JA 3K1JA 2HFUA 2RKIB 4U3DA 2QFIA 5AE3A 3T19A 4NX9A 1IJEB 5IWAF 3K89A 3QAEA 2ZBQA 1BWEA 4NA3A 1C1BA 1HNXI 2W2QP 1FXDA 4C48A 3Q22A 2OLWA 5A2QQ 1WD6A 1FDBA 2JLGA 3NOGA 1ZM3A 3UD5A 4KHPJ 2FDNA 5KFSA 4ZS6A 2J0WA 2D41A 1ZZNA 4WYWA 5BR8E 1S9FA 3FEZA 1TV6B 3RAMA 1N33E 4B3TF 1X4AA 4DQSA 2KG1A 1I94J 1TL3B 5IWAE 3DYAA 3G6XA 1HYSA 1N5VA 4H4KA 3QPIA 4RUHA 4F25A 4MK9A 3M9NB 4K0KI 2VQEF 4P52A 1QM9A 3W2VA 1U1RA 3OLAA 3GR0A 4RU2A 1Z5CA 3SMZA 3J81C 4PRFA 2E44A 4X65F 2ZH3A 2HQFA 2RKIA 4NXNI 1LEOA 1RT4B 2H51B 3OJUA 2YWHA 1K8AT 2RNEA 2M8HA 1FE4A 3NMAA 3UDVA 3ZNUA 2VQEE 1YI2S 1TU0B 2N7CA 4RBVA 2B5JA 1WOSA 3OVBA 1VYAA 4ALZA 1QVGR 1TV6A 4X65E 4C3MA 5HN0A 4CYUA 1FDDA 1R7IA 3Q8YA 1CC7A 2H5IB 1W7WA 2XZWA 3R5BA 3CCSS 5I3UA 1HNIA 4NMXA 4HH0A 2U2FA 3P3DA 4NLXA 1HHTP 3D9BA 3JQJA 5IV4A 1NHVA 2CJQA 4RBTA 2NXCA 2BE2B 1Z2ZA 2GHPA 3PKYA 1Q5YA 3MUVP 2ZH1A 3A13A 1R6LA 3NMRA 1KSPA 4YR3A 2XC9A 3H98A 4FWGA 5HROA 3VQSA 4AL5A 3R1HA 3UNYA 5U47A 1S0VA 4XTJA 1RAGB 1UAWA 4DV5E 2SXLA 4KAIA 3SSRA 2N3LA 5L3JA 4ZVRB 5DGAA 1DAXA 4WE1B 4CT9A 2PEBA 2X3GA 1R6VA 1FEHA 1WOOA 4NEYA 1S9EB 2WZ1A 3OL7A 5J2MB 2DNPA 2WCXA 1UA0A 5DO2A 2IVYA 3QRRA 3FGVA 2P6SA 4GRSA 4DV3J 5ADZA 2Z5BB 1YZ7A 2FZCB 4ZVIA 2UUAI 5J1PA 1UDQA 5D15A 1R0AA 2P9EA 4N77A 2PA3A 2UXBJ 3QBCA 2W7AA 2MQOA 4N8OA 3PW2A 1KQGB 1OYSA 1LXNA 3VGTA 3CW2C 1FRLA 2LDYA 3R8YA 4X84A 1MU2B 2YNIB 3VGUA 1D9AA 3W63A 1UFLA 4H4MA 4DQPA 1VK8A 4Z2XA 3CO0P 2D3ZA 4AQYF 2VFUA 2JEAB 1F9HA 2YKMB 3UQSA 1U6BA 4GKKI 1S1VB 4LF4I 3ILJA 3AQOA 1NPRA 2M52A 2Z5BA 1EZZB 2K06A 4DUZI 3C2PA 1M1HA 3MM5A 4DG1A 4B9UA 2RRBA 1VQPS 3VQTA 2QGFB 1EETB 1S6OA 1E6VB 1TUVA 4DI6A 3OSPA 3MEGA 4BC9A 4LPFA 1B4SA 4WXWA 2NXNA 5DROA 1BLUA 4NE9C 3I55S 3Q89A 3TAMA 4ELTA 2C42A 2C3MA 1UA1A 3U27A 2VA2A 4KRWA 3GCXP 1ZS6A 1YJWS 4ELUA 1RLCL 1FF2A 2JL9A 5E3PA 4KPCA 4QR1A 2BACA 2DGTA 1SKRA 4X66I 4OFZA 2GJFA 1YJUA 2ZFHA 4X64J 2Q1LA 4KHRA 1RQ0A 2PNZB 1CS4B 2EFOA 2JEAA 2HW3A 4Y34A 2YKMA 4YB7A 3AD8C 5K8NA 1I94I 3AOBA 1YBTA 2CDRB 2DNLA 2A3JA 4YR2A 3R97A 1UFWA 2D9OA 2HNDA 1EETA 3DRPA 5G0RA 5LMUJ 1O8BA 3BYRA 1N48A 1U2RA 4JI0I 2M0GB 3DI6B 1ZM2A 4URLA 4F0HA 4B3RJ 1RAJA 5B0FA 2YKQA 3MEEA 2W25A 1CPZA 2P6TA 3THVA 5F9LA 1B3TA 2GW8A 3R6GB 1M5VC 1QAYA 3MR5A 2PNZA 1CS4A 1N36I 2DNRA 3R5GA 3NNHA 5DRPA 3W66A 3HM9A 1WNEA 5E3RA 2AD9A 4WFZA 4USWA 2YXLA 4UUWA 4DZ6A 4FP9A 3MMJA 4DXLA 3GE9A 2AYGA 4OYPA 2VDHA 1RTZA 2UU9J 1RUSA 2FJWA 4JI1F 4UOCA 2Z2ZA 1TFYA 2XYGB 4K4YA 2LP4A 3N28A 4EYIB 4FW4A 2YVSA 1JLGB 4EI2A 2XI3A 4L3NA 4LRBA 1S1TA 1URNA 1D3WA 5D4OA 2DGSA 1U8SA 2B7CB 2W24A 2YTCA 4ZCMA 1H0HB 2LU1A 5ETLA 3MOJB 4JI1E 3GMGA 3IR6B 2HURA 2R8GA 3QT6A 2AF6A 4ZJQA 2Y1RI 2GCFA 4OI0A 3TNVA 4AT1B 4GQUA 3KK2B 2RQMA 2QA1A 2OPPA 3UR3C 4ZVOB 3WU5A 4FW3A 2EPIA 5CYMA 3MCMA 4DL5A 2UUWA 4ED8A 1NZAA 3J81Q 2BQRA 1FRIA 2XS2A 3AH6A 3C15B 3I4PA 2DO0A 4YDDB 2QL5B 4MH8A 2CJBA 2V8VA 3EDQB 3BBFA 3PY8A 1SKUB 2QTWA 4YS2A 3ULHA 1RXOB 1FEEA 1UZDA 4RJVA 1JLGA 1X0FA 1XWLA 4ECYA 1X0PA 3M2UA 3KK1B 5EGYA 5DDQC 2UXBI 3NCQA 2LXUA 4CLSA 2GFFA 5THWA 4LRCA 5FD1A 3W8PA 2EC2A 1QLNA 1PSDA 2OPRB 4FN5A 4F0MA 1LOUA 4PXBA 3BKUA 2FQQB 3OSNA 1N5TA 3I56S 2W4DA 4LFAI 1RHRB 1YJVA 3PRYA 2R7OA 4FYYB 1OYEA 1NZ8A 4DHVA 1UDSA 2AP6A 2FHJA 3AA9A 4PG5A 2JEFA 1NH8A 5L46A 3C15A 3R9LA 2PD1A 4DDFA 1R27B 1N32E 2LECA 4EU0A 1VRUA 1FXRA 3VWSA 4EO8A 3J80U 1Q8IA 4KFBA 3SQGA 4AYBD 1XNQF 5KFYA 1VISA 1RU1A 5D4PA 3M8SA 3AB2B 5KFLA 2GMJA 4DR6E 4DR1F 2HKEA 2PNMA 1CQMA 4I64A 2FHMA 3MXHP 1D8YA 2M7SA 3CD7A 3MMAB 4ECWA 3GZ7A 2VG6A 1H98A 3WC2A 2W01A 5HBMA 1JLFA 3HSJA 4F3MA 3Q24A 3EMTA 2WVEA 3THTA 2UVRA 1U1KA 4DR1E 3I82A 4WP8A 5IM0A 5I3QA 1FA0A 2BRKA 1JLAB 2MMYA 3QIDA 4EUVA 2J6SA 4GKJE 3OHBA 2QLFB 2UVWA 2UUCJ 4Q0BB 1S6QB 3OTDA 3CJ2A 2Y1JA 1EQMA 3FRZA 1CJKB 3B82A 4JV5F 1LNQA 2VFVA 3Q0AA 2DY9A 3BJYA 3IFEA 1IBKJ 5HQ8A 3S6EA 1VRQC 4WIIA 3AD9C 1AFIA 5KFNA 4ZVEA 2XYHB 4FPRA 1HLWA 4F8RA 1U24A 2EG1A 1MX0A 3HSDA 1GFWB 3ILIA 2QT7A 3QLHB 8RUCA 4B3RI 4WZQA 3KG1A 3MM6B 5I4MA 2PE8A 2N3OA 4JV5E 2ZNZA 1LW0A 2AKWB 4OX9J 1URRA 5KFQA 2WVCA 2QJ3A 4ZA1A 4WF9Q 4PYAA 2ZHAA 1RYRA 3EUNA 4WU2A 4ZVSB 2B7BB 4CO1A 4ISAA 2VOPA 1K0TA 2XWXA 1RYSA 2LQ9A 3GV7B 2Z5CA 2OH2A 2DR6A 1HR0F 5K5MA 2B9YA 4ZHRA 4ERDA 3IS9A 3BO3A 5EDWA 3J80Q 4Q0BA 4B3SJ 1SIZA 4RKUC 4OX6A 4DUYJ 2UU9I 1HNWE 2F4VJ 4OYOA 1WDTA 3DLBA 1RWPB 4RX6A 2GQCA 4DL4A 2YH0A 1L3SA 3OVSA 3DMJA 5KFGA 2Z5EA 4N56A 3HKZD 1PIEA 2V2ZA 2VBZA 3R1LA 1WKLA 3IM9A 4WP9A 2MKIA 4CWBA 5HMWA 3MM6A 5HP1B 2MQ8A 3IWXA 4JI4J 2BE7D 3CPWR 1NKCA 4MFBB 1WC6A 1O5JA 2KHDA 1SUQA 2RMLA 5JUMA 2JHEA 3GV5B 3GFHA 2HHHJ 4X4SA 4P73A 4XDDA 1NH7A 2HZAA 4FF3A 4AE5A 2GVDB 1HNXF 1YKWA 2FC8A 2ZJPQ 2FJBB 3TAPA 3QRPA 3T5KA 1VC0A 1VLYA 5L1LA 2IA6A 4KT0C 4CM2A 3RUBL 2W9AA 1AYEA 1SKWA 1HD0A 3NOCA 1RWNB 4RNOA 3CCRS 1RTIB 4O0IA 2E7VA 4I6WA 2XCAA 2DR7A 4K0KF 1QAIA 3BKFA 4LBPA 3M8WA 2OD6A 3QGPA 4J9KA 2N4DA 2I1RA 5A0YB 3B78A 4CLTA 2FZGB 4J9QA 3OFHA 1YTYA 5GMDA 3M6WA 4NXNF 2F1FA 5C24B 3V2UC 2ZD1A 2NYIA 1RAIB 1AB8A 1RA7A 2LU2A 2YQ1A 1UP1A 2C2EA 3CCWA 4DPOA 4HDGA 4IR1A 4F4WA 3HD2A 5BYSA 3E01B 2CPEA 1RT1B 4CQ1A 2FJAB 5IQ6A 2VG7B 1P9YA 3DRRB 4IFYA 1NMEB 1MLAA 2KB2A 4I69A 4OHVA 4NXNE 2GO8A 3O8WA 1RTIA 4BA1A 1SVDA 2C28A 2DH9A 1KNZA 2XMUA 3OBIA 4RW6A 3BN4A 2KYXA 3ZZRA 3CDIA 1RTHB 4WUCA 1QE1B 4U7UK 1RCXB 3W9IA 1RTDA 3CNQP 3SEOA 1MWYA 4LREA 3EGZA 4ES3A 3IM8A 4Q44A 1FKAF 3GIMA 2ACYA 5D8HB 4A8WA 4YEAA 4IFDC 3D6HB 2GIQA 2WVFA 3JSMA 5DRQA 1VMBA 5D0EA 4IOAQ 2O1UA 1PYTA 4ANCA 3JSBA 5F3ZA 2EBEA 5T14A 3PW7A 1MG7A 1TMMA 2LQBA 1SL0A 2UUCI 1C0UA 2YWFA 1R0CB 3TANA 1CEZA 1OQ6A 1WKJA 1RT1A 4WK1A 1IBKI 4QZVB 4L76A 2VG7A 2CADA 1B62A 4ED0A 4WZMA 2V6AA 1P42A 4MU4A 4N8NA 2WP8B 2E5IA 2B0GA 2P8IA 1U2CA 4FW9A 3CB4A 4GO5X 2VC0A 3ZKDA 1UFKA 1VQKS 1Y60A 2NPIA 1V5IB 3W7BA 3TQEA 2RDJA 2JEBB 2OIHA 2BX6A 2CWXA 4NYZA 3KFWX 1RTHA 4OYMA 1QE1A 4IQXA 1KFDA 4CI0B 4MJKA 2BRLA 4OX9I 2HQIA 2UUAF 5DRRA 5CCMA 2CJXB 1OY9A 4HACB 1SPBP 2G4BA 4LF6J 2CNLB 3X1LB 1M1GA 1XN9A 1N5YB 1Z0VA 3KDNA 3R7NB 1Z0EA 3CDBA 4I67A 4FWDA 4LCGA 4WTOB 4IFDE 4YN3B 1NB7A 4CO0A 5KG3A 2M70A 2UUAE 1L3UA 2DRDA 3C14A 2Y8WA 4IDKA 1XNRJ 4GKKF 4L6V3 3HULA 4QBUA 3SBMA 4LF4F 5KFXA 1S97A 2NN6A 2KZZA 3HLUA 5KT3A 4DUZF 2HS0A 1WF0A 3OPKA 1P6TA 4DR4J 3D54A 2YWEA 2XTJP 5E0OA 2J0XA 1U09A 2E7WA 1VJQA 2GAHC 2I8EA 3GJRB 1HL6A 4IRKA 4M5DB 3W62A 4ECZA 2HHHI 1ZM4A 2A18A 1B99A 4OHYA 1N54B 4OZNA 4LF4E 2IC3A 2PO0A 4R5PA 2PO2A 3BGRB 1B0TA 1UCNA 5HI7A 1JWWA 2BKNA 3JAMC 2K7KA 4DZDA 3SV4A 4U8YA 5FIIA 4X2BA 1EQ0A 3P06A 1N6QB 5DG7A 4X66F 1G2EA 1CLFA 4Y0FA 3C16A 1BXNA 3MM9B 5E3AA 3OTOE 2A2CA 2O66A 3OR2B 3AA8A 4DPYA 5C2CA 3OXGA 1L3VA 1I94F 2HHXA 2H3EB 4O3SA 3HSZA 4K5RA 3U1NA 1FFWB 2UP1A 1C4CA 1FFSB 1HWJA 2K2PA 4MTPA 5DG8A 5IT4A 2M8DB 4X66E 4M5MA 1D09B 2BUNA 4JI7E 2YX7A 4ZVTB 4DN0A 4KGKA 1K9MT 1LWCB 4A46A 5DQHA 5I3PA 3N6LA 4MMOA 1REVB 1T8EA 3DLEA 2QA4G 3Q8PB 2P2CB 2W9CB 4DMZA 5IFMA 5CH7B 4M5DA 4JI0F 3T1HI 1PBAA 1S79A 4IFDB 1FKPB 1U1LA 3L7OA 1KONA 5D77A 1O6XA 3E51A 3ZNJ1 3Q2SC 2R4FA 2FGOA 1OIAA 2E1CA 1SB6A 3CCZA 1MMDA 1DLOA 4IFDD 1WG1A 2CVIA 3TZZA 3QJJA 2ROGA 1JNZB 2MGZB 1CSJA 3AXMA 1Z59A 2DHHA 3IO1A 3DOMB 2N4CA 2QLXA 4JI0E 3KJNB 1N36F 3EPIA 1R8PA 3MR2A 1IKWB 2C39B 1VQ9S 3US5A 3RAQA 1S72S 2DBBA 4QIEA 2WNRA 3BPSP 4DV1E 3SSQA 1B70B 1F0XA 1MWZA 4FWHA 4I7FB 1R8BA 5HAOA 4UF4A 4TLQA 2VOOA 3BBCA 2E5GA 1LWCA 1JMTA 2ZEJA 1N36E 4EZ6A 1N34E 2AZ3A 5GADI 1M90T 4UY85 4OX8A 1G6BA 1FKOB 4C3KA 4BWMA 5K36C 3MECA 1VQLS 3CMES 1Z5BA 2QA2A 3MTJA 4I2PB 4QYZK 1YIJS 4LIRA 2R8JA 4LF7J 5L1JA 2KXFA 4I4BA 5A6PA 2C2MB 4IZJA 4PG7A 3TARA 4OHXA 2XLJA 1AZSB 4XPEA 1S10A 1VLOA 3BGFA 3NS7B 1R6MA 3ZZYA 3LGHA 3KLHB 4NLQA 3P6YC 3QO9A 5K9FA 2D1CA 3OR1A 1TL1A 4OI1A 4AIMA 3M6VA 1VK3A 4M8LA 2DH7A 4X4OA 1TR0A 3BSCA 4FYVB 2XWYA 3K85A 3ZO7A 3TZXA 4NLTA 3RW6A 2BV3A 4RW4A 1HBNB 2MQPA 4FKXA 4K50A 1Q7YT 3QIPA 2ZUAA 3VZHA 1HNZJ 2QV6A 1M5KC 2CNOB 1FRHA 2ZH8A 1U6ZA 1IKYA 3KHLA 3KLEB 2ZKTA 3T6JA 4NASA 1WEZA 4OZJA 2XHWA 4GC6A 4LF6I 3R7BB 3W2WB 2UXBF 5BJRA 2XZDB 1GAOA 1NK8A 2BM0A 2L9DA 1U0SA 5KFTA 2ACMA 5HJYA 3LAMA 4NA2A 1U6FA 4C8KA 4YMEA 3P3CA 2XSJB 2ZM6I 4L74A 1H7WA 1MMNA 2CUYA 3RB0A 1WELA 1K73T 4Y2KA 1WOPA 1AZSA 3PTWA 4LFAF 3RW7A 2KU7A 3D68A 1J5EJ 2M3DA 1QDUB 3U1KA 2CPDA 5FDLB 3TEHB 2ZVIA 5C7PA 4ZJOA 3NRBA 4ED4A 5MLCV 2EFNA 1GXLA 1EB0A 1XNRI 3KUGA 4OYAA 2QLJB 2DB1A 3MPUB 5KFIA 5H9EJ 3NKYA 2CQGA 1T9XA 4CT8A 1FVSA 2DXDA 1T03A 1OYDA 1H74A 3SFUA 1KVIA 1RT5A 4ZOSA 2QE5A 4J9OA 2F40A 4DR4I 4LFAE 3KG0A 2DHSA 4CLPA 1U0HB 1YGYA 4O44A 2AQ4A 2QC3A 2Y1LB 3JYTB 2QEXS 3LNUA 3I96A 2GO4A 5CZVA 1RWMB 2RUSA 2R8IA 4X4PA 3I5AA 2HMIB 2FLLA 2MY8A 1UJ4A 5DDPC 5HSPA 2HQGA 2LA6A 2HS4A 5A8WB 2QL9B 2PDAA 2XZTB 4AXJA 4USUA 1UJ5A 2DCUB 2QA4S 1PAUB 2HQCA 2H5JB 2KYZA 4LF5J 3HMJG 1WKKA 3M8YA 4DR7J 3TO8A 3CC4S 1C4AA 3UCUP 4A8SA 3PV8A 1RLDA 3IGVA 2O67A 3CDJA 1WC0A 4OZ1A 5LOQA 3GSIA 3LF0A 1RBAA 4NRUA 2HFOA 1WG5A 2J8AA 2AJ2A 1RT6A 3H0PA 1VBKA 3A3NB 2I6WA 5KFHA 4B3RF 1RHJB 2J9EA 3T5HA 4HTJA 4LSNA 1BQNA 2YNHB 4J5OA 2O5DA 5FLXY 4QCLA 4RLEA 5I42B 1KHWA 2ZC4A 2M9KA 5A8WA 2WHOA 1GMUA 2LEAA 1Y9OA 4LF9J 2IM2A 4OV6A 2G0IA 4KO0B 2QLBB 3VHQA 3KJFB 2AJ1A 3CJ4A 3PEJA 1QAXA 4ILRA 3WBZA 4NWBA 4ZLJA 1JXLA 4ELVA 4B3RE 1VDHA 4HKQA 2JX2A 5L9NA 1MNEA 4OI2A 1ELOA 4IZKB 5C0XA 4C98A 1XMOJ 2J65A 2UU9F 2NLWA 4UZBA 2KH9A 4FYWB 4IRDA 2VBXA 1F9EB 4DV4J 3JAMQ 4DX8H 3W65A 3OJSA 2HBZB 1OPIA 2E66A 1A6LA 4PWDA 3T1YE 1BMQB 1NDKA 1TVRA 3GCMA 4K4ZA 2NS1B 2BANB 3H5YA 1C2PA 5MAOA 3CCVS 5ETVA 3VF0B 2OEJA 3IG1A 4LCFA 1XERA 4UT4A 3DLKA 4I1TA 3QWPA 2W9BB 4BLGA 2YBVA 4OIXA 2YNHA 4B9MA 5I42A 4UOHA 2V2KA 4F26A 4IG3B 2MSSA 3RBDA 2DNHA 1RWXB 3EDRB 2D3UA 1Z0WA 4JUZA 3K2YA 4OLOA 4QW9A 3JS9A 3VAKA 1RHQB 1S1WB 2VPZB 4QPTA 1YBAA 4HYKA 2FVQA 4QU6A 4C8MA 4WK3A 2ALYB 4IYQA 4KKOB 1PGZA 2VC1A 3IAS9 1SH0A 3UR0A 1ZA2B 1MW7A 2OHDA 1VQ4S 1SJ1A 3EE3A 2HS3A 2JFKA 4O4RA 2BANA 5K20B 3M8QB 1SV5B 5EN1A 4Q2LA 1CJVB 3H40A 1RGVA 3VGSA 1P9QC 4DV7I 5A8KB 1JNRB 4U96A 3IRXA 3HDSA 1K44A 2W9BA 4U3BA 3AFGA 2PNLA 3QAUA 3DHXA 1SJ3P 5LT5A 3GYXB 4M94A 2KN4A 1Q86T 5K14B 4G3IA 2KRRA 1RU2A 2PIIA 1J5EI 4YY3I 2YNGB 2AEFA 1HBMB 1XMQJ 1WTFA 3B4DA 2WOMB 1JLEB 4EGLA 3O2IA 3RGIA 2Z4PA 5ETTA 4DPXA 3KRNA 1H2TZ 4ZDNA 1S1WA 2B3TB 2OD4A 2A6MA 4Y2AA 2VQFI 4KKOA 1KTVA 2W7OA 2VB6A 4JI6E 2VHGA 5HATA 1NHKL 4B9TA 1JLQB 3MPWA 4R0JA 4ID5A 1CJTB 4NLOA 2VJVA 5IOLA 1ROFA 5B09A 3EWGA 2AYBA 3C66A 3UD4P 3OXFA 3LWMA 2ZBKB 2HBQB 3AD7C 2CJKA 4WUDA 1PYOB 3MCSA 2ZE2A 2OFGX 2M88A 2R2TA 2CG4A 4PUOB 3QT8A 2V2QA 1YHQS 1ZAVA 1HWUA 3POTB 5SUHA 1X4DA 2ZH6A 3OV7A 3I9ZA 4K4VA 3TUPA 3Q8QB 2GHVC 2YNGA 4J7CA 4F4KA 1BD6A 1NJXA 2WOMA 2H4WB 3KLFA 3GU0A 2AGQA 3UI3A 4IOCQ 1KFSA 1EP4A 3RU0A 4M5LA 5HVFA 4DR7I 2XMKA 3PACA 7AT1B 4RW7B 2UUCF 4CLUA 5KG7A 3QMQA 2XI2A 2KJWA 4R1FA 5D0RA 1UKUA 1FDNA 2RD5C 1EAYC 1GMWA 1Q95G 4BWJA 2MTLA 4NOHA 3MCOA 1IBKF 3CJRA 3ENWA 3P76A 2C2NA 1U2FA 3HPOA 4NYOA 2ZZTA 2FY1A 5T7LA 3JTPA 3PRVA 2JC1A 1IBLE 2Z30B 1Y6ZA 3NGTA 2UUCE 3L95X 2C1EB 1EHWA 4IUFA 4DSEA 1VJWA 5IT9C 3DRSB 3EICA 2VESA 4ZVGA 1JJCB 4OX9F 1RKJA 2PGCA 4YB5A 2KM8C 1GX6A 1FNXH 3U1MA 1Y4ZB 3D2WA 3HZGA 3M1VA 2MKYA 5KFEA 3HKMA 3KHGA 1KVKA 3R5JB 2XMWA 1F2GA 1Z5AA 4LQ3A 2K1RB 3DLGB 1YZ6A 6FD1A 4B3SF 1XMOI 1CULA 3BH7B 2OSQA 1Y3JA 1NSQA 2MXYA 3HKWA 1C1CB 4TNOA 3I87A 3M6AA 3FFIA 2MLYA 1F1BB 3IGNA 1NB2A 4ZKAA 4JV0A 1X4BA 1UWBB 2ZJRQ 2UXCE 3CJKA 3DGPA 1FO1A 3D66A 3RRKA 1FJ7A 3CCLS 5D3GB 4KBIA 4CO2A 3O6QA 3HD1A 4ZP9A 3GMEA 1JLCA 3DRSA 2EK1A 2IESA 2YNFB 4Q45A 4C0BA 1RISA 1PJ6A 2FVSA 3QRQA 4X4RA 5KFUA 1FD8A 4OLPA 4IKAA 5IV3A 2HHHF 2HVDA 4USMA 2V34A 2OEKA 1FJCA 4C97A 4CO3A 3CCTA 1FWPA 2HNYB 1F5CA 4LF8I 4JI3E 2J0QD 4ES2A 1HQEB 5HMZA 1JIHA 1X4HA 3OW2R 1H2UX 3M2RA 2C22A 1HQUB 3O5TB 4CTAB 2RHQB 3ISZA 4PG6A 4YHHI 2HHHE 2PEHA 1JQGA 4OI4A 3P45B 4P6QA 4MU0A 3R5AA 2FJXA 1NBEB 5J1NA 3V4IB 3O44A 4MYTA 2XSFA 4PKDB 2HFNA 5JEAF 4CO5A 2Y1IA 2IOPA 1VQ6S 3FJ2A 3H2LA 1F6TA 3N5FA 3MPDA 3LW5C 3D3CJ 5A6WA 4L73A 5DS7A 1WTBA 1YBUA 1XMQI 2BEFA 2KRBA 3T1HF 3PIOQ 4DR3J 1HBOA 1NK6A 4OYIA 3OUYA 4ED2A 3DHWC 1S6UA 1OJ4A 5DQIA 1RBOB 1WG4A 2E7XA 2LEBA 3KLIA 1VRTA 3KK3B 5JEAE 1E3HA 1IR2A 2DXEA 4A47A 1RR9A 4F4ZA 1QVFR 3LALA 1KHVA 5GAEU 1SJRA 1U1NA 1HQUA 2CDQA 4CTAA 3FSIA 1JXVA 3DM2B 1S9GA 3T1HE 4JYAI 3VVTA 2ROEA 1B63A 2PO1B 2HFVA 1XTZA 3AHPA 2OGUA 4PQUB 3DLJA 1KIJA 2DT9A 3V4IA 2W4PA 3R7SB 4RBUA 2IHR1 2IDEA 1T0TV 2ZDPA 4ECXA 2IBOA 2AW0A 3CC7S 2Q6CA 2RS8A 2Q79A 1KD1T 2KM8B 4UTGA 4MK8A 2MZRA 2EG2A 4F7VA 2FTRA 4ED5A 3NEKA 3MD1A 3G86A 2ZDOA 2IERA 4IRCA 3M05A 4X62I 1M5OC 3KK3A 1A0OB 4ES1A 3FCHA 4FXVA 4PCQA 2HIQA 4ECTA 5H9FK 1UETA 2VASA 3D0HE 3KTQA 4EBEA 2PC6A 4IG0B 5LMNE 2FVPA 1HBUA 3DXBA 4G1QA 1M5HA 2RILA 2GQ2A 3MEDA 4DSKA 3M8PA 5FLXU 4UY8T 1E6YB 3CDEA 4RW9B 3HT0A 2BA9A 3Q8SB 4RZRA 1WC1A 5E7OB 2E1AA 4LQ9A 1WSVA 4N5SA 3V81A 4ZPVR 3OFFA 5JEAB 4LF6F 5DLFA 2LKZA 3D28A 1L3KA 4NCGA 2B51A 2KT3A 4RNMA 3BEGB 3TJ9A 1NHHA 2UUBI 2G13A 4M5NA 2CGEA 4HTIA 1BWVA 2B4OA 4DR5J 2MLZA 2CPIA 4LFBJ 5HQMA 4OZ2A 4DX5A 1YRUA 1YJ7A 2ZM6F 1VQ5S 1D9DA 5JEAD 4DV0I 3JSRA 2CIMA 4C8ZA 4H4OB 2Y8YA 2R7VA 1LWFA 2ZOGA 3WDOA 4C7QA 3GV8B 1X9WA 2V4QA 4NLDA 4LF6E 4IG0A 1LQ9A 3DDKA 3FBBA 2ATCB 3V6KA 1PO6A 1KQKA 1X9SA 1TKXB 2C37B 1KC8T 1XNRF 1R8HA 1D9FA 4OJGA 1FK9A 2WTFA 2ZM6E 2XM3A 3BN7A 4A8KA 2W1BA 6AT1B 1NZ0A 1E6YA 1RJJA 2DJWA 4DL7A 3A1YG 4DR4F 2R8HA 3C6TA 2RE1A 3AY0A 2AHOB 3G82B 2VKZG 1XIQA 4HT7A 4NXMJ 2JE6B 4WP3A 2ZNYA 3M4XA 1N33J 1K1QA 3H5XA 5F8GA 9ATCB 1FTRA 1TKTA 2JSXA 1SJQA 3HSGA 3BSNA 4C8LA 4K4TA 3F0NA 2YQ3A 4MKBA 1T02A 4FF1A 1TELA 4DR4E 2UZAA 4R25A 3BM7A 4FNIA 3BH6B 4ECVA 4DV2E 1R89A 3VVUA 4ZN1A 3DOKA 5L38A 4GVBA 3GG0A 2LQ5A 1Y10A 2C38B 5IT9Q 2HHQA 1OQ3A 5HLFB 2UV8A 3D6TB 1HMVB 3HP6A 2BJ7A 3Q86A 1AT1B 4N3OA 5H9FJ 2CWKA 4KIAA 4ECRA 1KKHA 4C0OC 3KOAA 2I5JA 2JC0A 3H90A 2VQEJ 2DD8S 4IQMA 1J5OB 3CD5A 2VG5B 2A1BA 3KMSA 3L09A 3TVKA 2Z2MA 3DKDA 2BZ2A 4YDXA 2JE6A 4PR6A 2DTJA 1GXTA 2I38A 2GAGC 3VAHA 2V4JA 2E1PA 7FDRA 1VQ7S 4NCAA 4AXIA 3GG1A 1NHUA 5HQLA 2KJVA 1ZTWA 5EWGA 1U49A 1Y7PA 4AL7A 5J2NB 3BSAA 1WEYA 2XLIA 3TX0A 5AXLA 5B0GA 2KKHA 4KSEB 3JSYA 6FDRA 2JVRA 2EFVA 3OTCA 5GAHI 3ITHA 1XR7A 4J9UE 2G0CA 1C1BB 3NAIA 4IO1A 2C38A 2D74B 3TUZC 3K5MA 4YB1P 2HZCA 3BDPA 1X5OA 2AGPA 4A8OA 4DUTA 3BBBA 4CLZA 4DV5J 1Q8BA 1DBDA 3WX4A 2LLZA 3K5NA 3H2UB 1KR4A 3CIZA 1HKAA 1Q8KA 2R2UA 2XY6A 2OEMA 2MDAA 3DYAB 3ET6A 1HYSB 1R6YA 1SC4B 1RSCA 1UEVA 1F5BA 3MEKA 2NSCA 1BQXA 2HSEB 2PSZA 2R2RA 3C19A 1Z0CA 3O1LA 3W2VB 1QTNB 1S1UA 1FE0A 3F41A 1GMVA 1AROP 5EWFA 4F2SA 4LFCE 5EUHA 2AWZA 3M85G 3OTBA 4DF4A 3M85D 2E9RX 1S6PA 2HHPA 2VA3A 5F8LA 3T1AA 2BJ3A 2APOA 2AJ4A 2CQ3A 4TY9A 2B5JB 3NCPA 3KXDA 2X7IA 3M8RA 4WXOA 1YG0A 2VPWB 1W2IA 4I68A 3G6ES 4DU7A 5L1KA 5DJBA 5IC6B 4CYUB 2W2MP 3R6LB 3UDCA 4NLWA 3OVAA 2DR5A 1HNZF 3VGVA 4ZPWR 5I3UB 1HNIB 2H54B 3PX6A 4S0MA 1H3DA 4C8OA 4NPOA 5HMYA 2MKKA 1ZTTA 3SFGA 1YLXA 2HZVA 3CMQA 4DV7F 2BXJA 4ZK7M 4B3TE 3D4JA 4JB8B 5LM7E 3D0IE 2PFFB 1EARA 3M9OB 3QNWB 5HROB 4K4WA 3T3FA 4ZVUB 5F9NA 3QGGA 3CJ0A 3ZTPA 1APSA 3CWVA 3QT7A 3GWCA 1NDPA 3CD6S 4ZVHA 4OI3A 1J5EF 4YY3F 4MKVA 3FVYA 4DV7E 5D4LA 5D0GA 2X1FA 3NZKA 2J7UA 4A48A 1WWHA 4FBTA 2QSWA 2IJRA 4C8NA 1ZAXA 2KZMA 1ZPWX 5F41A 2VQFF 2EFQA 5DNLA 4LR9A 2OMOA 5K36A 4YY3E 5HVGA 1HNVB 4MT1A 1ZAWA 4NXMI 4WKRA 1N33I 2QIFA 3HHEA 2OELA 1S77D 2RDIA 2GGPB 1N5QA 3U1YA 2B4PA 1R0AB 1GNKA 4PRVA 2WSCC 4ZJLA 2JEIA 2R7UA 1BGXT 2VQFE 5C42B 4O3OA 2D7SA 2IYIA 4Y3CA 3M2VA 4CNZA 4BHQA 4OJ3A 2NXUA 1MWQA 3A8IA 1HWLA 2ROPA 4RO0A 3T5JA 2HAFA 3TW0A 3UVJA 4J37A 4J91A 3LP0B 4ZPCA 3GFYA 4JI2J 4H4MB 5L9XA 4XO0A 3KJVA 4CP5A 2CAJA 2V8HA 4KPYA 4OZLA 2WVDA 3N01A 4F67A 3PVXA 2FJVA 3EGVA 4Z37A 1RTJA 2B8QA 4O23A 3MHYA 4LRAA 4DR7F 4F3OA 1SIWB 2AYMA 4LF1A 1IKXA 1HNVA 2GV1A 5A2QY 1A9NB 2DGWA 3MM5B 1HHQA 4DG1B 3TI0A 1RWWB 2V8DA 4ED7A 4HI2A 3Q6MA 3WQPA 3OHAA 2GGPA 2DEJA 3MEGB 1RAAB 4OZ3A 4M95A 1IBMI 2CQ4A 2B43A 1WHXA 3TR5A 1XC9A 1S16A 3A8JA 3TAMB 2DNGA 4OO1F 4DR7E 1SQEA 1O51A 5KFZA 1P1TA 2VFRA 5C42A 1Y5YA 1XEZA 4DS5A 2BJEA 1P27B 1JLBA 1PJ5A 1FVQA 2OFHX 2XBPA 3NGKA 3LP0A 2P5VA 1RP5A 2ZKUA 2V0NA 4JI5J 3GLLA 2YWWA 5AXKA 3ZZOA 2QO3A 1K1SA 2E5HA 4DV5I 5D0HA 1FTCA 2MZQA 2KXNB 4JI1J 1H7SA 4ILLA 2QZ8A 3SDEA 3GTYX 1KLMA 1WC3A 5L8RC 3Q6NA 1NO8A 3AJDA 4ZP7A 1XMOF 3BR9A 2F65A 5C2GA 3MAAA 4L72B 3AT1B 2HNDB 3KUEA 4WFYA 2LMIA 3DRPB 5G0RB 4IS9A 3VAIA 4AQYE 3BR8A 1CVJA 3LPSA 1G4CA 1UPPA 2X51A 3QYYA 1PAEX 4DWIA 3GB0A 5LSLA 3PR4A 3J80C 1AUDA 2WB4A 1PKPA 5HK4A 5B7WA 1MN7A 4G6VB 1UW4A 5RUBA 4N7TA 3UE2A 1UDNA 2B9XA 3MEEB 2RAQA 4NLGA 1EX8A 1N5SA 3PX0A 4XPCA 2KO1A 2BBEA 1OSCA 4KHPI 1RE1B 2E1MC 4WFNQ 3I0RB 2JH3A 2CFXA 5JMNA 5EL9A 3RBEA 2XGPA 1MROB 4LF8F 2IVFB 1OYPA 3SCJE 2HBYB 3PNIA 3KJQB 1F3FA 3CMAS 3P49B 4WBFA 4O3RA 3B6BA 2BA0G 4V1Ak 2HHUA 1CQNA 2EKYA 1DZ5A 2BA0D 5F8NA 4YHHF 1FJEB 3CSKA 1T9UA 1RT7B 3TAQA 3UN2A 4KGZB 4UQGA 1FDAA 4LF8E 3QSYB 4CH1A 2B6AA 2ADBA 1N32J 4JI8J 4TU8A 4MU1A 1S1TB 5AJ3F 3EXYA 1NLKL 1KQSR 3IN5A 5J1EB 4O4GB 1FD2A 4QIGA 4YHHE 1FCAA 1D1UA 4KQZA 1XMQF 5KFCA 3N6MA 4DR6J 3DXSX 1LW2A 3R5DA 2OPPB 2R3VA 3FC9A 2Z56B 3I0RA 1MN9A 5CYMB 3HO1A 2B56A 1MROA 4QJVA 4RL1A 4FVCA 1F5AA 2C3PA 3V6JA 5ETPA 3ETOA 3TP2A 2DNKA 1PKUA 4GMKA 5L1IA 3VR1A 1VQYA 4OV1A 4FF4A 1XMQE 1PYSB 5JXSA 1RBLA 2W4CA 3OT9A 2GQ0A 4JYAF 5DETA 3CJ3A 2JNJA 3LANA 3J7AM 1RT7A 1ZXNA 2AE8A 2OPQA 4GKJJ 3UO0A 3OTEA 4B3MJ 4HHJA 2XY7A 1HK7A 3M2UB 3IBFB 4B3OA 2IJFA 4LSLA 1UVLA 2C2RA 5IS2A 2BABA 2CQHA 4FS2A 5J1EA 4O4GA 3HF5A 5KFJA 2G1DA 2HPUA 2DPJA 2Z2YB 2G0JA 4OO1A 1S59A 1XK8A 4NLVA 4JYAE 4DPWA 2HNZB 1NHIA 1QSSA 4JI2I 2JDJA 1VC6A 1FWLA 1FWKA 1U7LA 4X62F 5CQGA 5KFPA 2QMUB 1U1OA 4JV5J 4FZVA 5ITHA 4OKGA 4E2FB 2XS7A 1JXEA 2L9WA 2XEXA 4DV3I 2CZ4A 3M32B 4LRFA 2NZ4A 1VRUB 2FHJD 4KFBB 3SQGB 4NLYA 3N9UC 4YB6A 4KJIA 1S57A 2LFVA 3N5BA 3K58A 3CCMS 4X62E 1ZBTA 2EWHA 2NPFA 1T3OA 3VV2B 3N79A 4LUBA 2BJ1A 1HNWJ 3PKMA 3NS5A 4LVOP 1S4FA 1NDLA 3CE8A 2LQ8A 3TZYA 5ETKA 3W64A 1Z4UA 2VG6B 4RNNA 1U25A 4TY8A 4W92B 3J81j 4ZP8A 5HBMB 3ZZZA 1JLFB 2HNZA 1R8AA 3RYLA 3QWUA 2QMWA 3D3BJ 3HI9A 2VFTA 2C3OA 3DDNA 3LP1B 2VZ9A 1C0TA 1QJHA 2LA4A 4JI5I 2UUBF 4KHMA 2O01C 2LVWA 4DEZA 4NL5A 5IM0B 3NS6A 1QSYA 4DV0F 1SH3A 3PCOB 2YY3A 5DZ6A 2XCPA 4PZVA 1W26A 3NBPA 2J6UA 4X4VA 1HI0P 3M32A 3E3XA 3GYNA 1DJ0A 2RQKA 4U8VA 4KTQA 1F3VA 2UUBE 2DVIA 1FRMA 1FNMA 2COLA 2HHWA 4LBIA 4D3GA 3GIRA 3PW5A 1QSLA 4DV0E 3MWBA 2W7PA 3MM7A 3H59A 3H8YA 4OHWA 3NWGA 3ENAA 3IWLA 1P1LA 2Q2EB 2OJ3A 4C2MA 3Q8RB 5KFWA 1LW0B 3CVKA 4X64I 4TQRA 3LP1A 2W8LA 3PZPA 1XNQE 1AFJA 2MJNA 3JTNA 1R43A 4Z7YA 3FSYA 3A8EA 2JLEA 1TL5A 1NK0A 3PYFA 1QTMA 2Z5CB 4XK8C 3H4DA 5H1SV 4ZHRB 2HWTA 3IS9B 3HHDA 4L3KA 3TVYA 4PG4A 2Z8QA 3SV3A 2I2YA 2YWGA 4I2QA 1J27A 4E98A 4PXCA 4B9NA 3FDSA 5LMUI 3F73A 1XQIA 3DRXA 3DMJB 3HK2A 3MF5A 3HHKA 5KT6A 1N32I 4JI8I 5T41A 3J81Y 2RU9A 2V9WA 3UCGA 1KDNA 3KMQA 4J9PA 2DXFA 5DG9A 1NEEA 1VQ8S 1U48A 4PWWA 3LTOA 3EJMA 4NXNJ 1H73A 3LPYA 1YITS 4NZ7A 1SUQB 3PS2A 3FKBA 5K8OA 2JLFA 4HT5A 4CO4A 3EPGA 4FXDA 2LCWA 1GX5A 1V9OA 3R2DJ 1NPPA 1R3NA 4OQJA 4I6AA 5D78A 1JJHA 4BA2A 3W3SA 2XMMA 3DOLA 4DQIA 2CYYA 1U1QA 2F7VA 4USIA 1QD1A 3BGUA 4DSLA 5CCLA 2J76E 4QOTA 1RWUA 3ZZ0A 4GKJI 4B3MI 4C9DA 1NM2A 3PRDA 2C2OB 4ED6A 4R0EA 1ZA1B 1HR0E 1RAEB 4ZPTR 4I56A 2IFXA 5AXMA 1I6JA 3B8HA 2BKOA 2CZ9A 1RWOB 3ETMA 3QJPA 2AZ1A 2NN6C 3MAHA 5A8RA 3QGHA 4USKA 1UMJA 1WHVA 3EGWB 4LR8A 3CXCR 2BOPA 3JTOA 4PEOA 2CPYA 3DLHA 5E41A 3M7VA 1WC4A 4IH5A 3LP2A 3NCRA 1XJWB 1AW0A 3GJSB 3G6VA 5B0DA 3DNCA 1GT8A 2IRXA 1RHMB 4M5IA 5A2QU 2CPFA 4M5KA 2NZCA 3QQCD 2ZD1B 3CUNA 2QYGA 2HFSA 1MMLA 2V68A 3CCQS 4USTA 2J9DA 2WONA 2K3KA 4FW5A 5KT7A 3LWLA 2DRAA 2NN6F 1H72C 2OPSB 3EX7B 4IFYB 2X3DA 8AT1B 2OUGA 5F8MA 1M5SA 2UUAJ 4PU9A 2H5EA 3GLJA 1HNWI 2MHNA 1HNXE 3CJQA 4KGXB 3PEHA 4BA1B 3Q2TC 4NCBA 3G71S 1RKIA 4OMFG 4MIWA 4FDFA 4RW6B 3FQLA 1RTDB 2NN6E 1UL3A 1HHSA 3FEYB 2H1YA 4DR5F 2IAJA 4LFBF 2RDDA 3DCAA 3PJWA 3AQPA 2ZH5A 3JSMB 1GTEA 4RW8A 3Q83A 1G1XA 1TUWA 3J7A1 1CG2A 4G1PA 1RA6A 2WSFC 3FBFA 4K0KE 1C0UB 3T6BA 4QNKA 4LF4J 3S8SA 2EBGA 2JFDA 2V50A 2HFZA 2OPSA 4RWWA 2XB2D 1NJYA 1S99A 2QSFA 5DM6Q 2HLUA 2BQUA 4MIBA 4QWAA 4ZCKA 2H4YB 3CULA 3W5YA 2KVIA 5IXUA 3OTOJ 2O1TA 4NXMF 1Y3KA 1RT3A 4UW2A 3H4BA 1N33F 4UOGA 4BDPA 1U1MA 2PO4A 5EX0A 3L7ZB 4DL6A 1QY7A 1DHMA 2VH7A 1DRZA 3MR3A 1P8GA 4MKAA 4X66J 1M0SA 4NLUA 4JI7J 2R7RA 1YJTA 2AX0A 2AT1B 2LDIA 5GAHU 4MK7A 4NXME 4W90B 3LUYA 5KFAA 4ICLA 4ZP6A 3MMCA 5GAEI 2V4RA 1JKHA 2KL8A 2F1DA 3C14B 1FKAE 2NREA 1U1PA 4NI2A 1YWXA 2Q3PA 2AV5A 5KAKA 3FZ2A 3MR7A 4C11A 1YRTA 4IDKB 2NUUG 4M1KA 2GVZA 3P5TL 3NL0A 3GILA 4G65A 1LFPA 3AODA 4EEYA 1UVMA 4K59A 2ASYA 2NN6B 4EBCA 1SKSA 5KOWA 4JI0J 2RU3A 3AAWB 1PC4A 2IMOA 2DIUA 3UN5A 2FIUA 4LR7A 4B17A 1NJWA 2R42A 2UXDJ 3L7ZA 4MIAA 5JVGQ 2NN6D 4PG8A 1IBMF 2E9TA 4WPAA 4DV1J 4PPZA 4ZPAA 3U7JA 5KTQA 2DHAA 4Q8FA 3TQ1A 2IC3B 1SI9A 2PO0B 4R5PB 3K17A 2AMCB 2PO2B 1D6TA 1N56A 2VICA 1BUXA 5M2UA 4PQAA 1N36J 3DD6A 1N34J 4QWCA 4B3SI 1S12A 3P3EA 4DUYI 1W25A 3HHLB 1Q78A 2XLKA 1TL3A 2F4VI 3R2CJ 3QT5A 1IBME 3C16B 1RACB 4ECUA 2FUG9 3IA0A 3CWJA 4DV5F 3IAM9 4F02A 3P96A 3HHLD 1DQAA 4QNJA 4BC7A 2UVVA 1RI7A 1X5SA 4MYUA 2ZJQQ 2C2DA 4QR0A 3BYPA 4PYDA 1TFWA 3EVOA 2W2OP 3TUIC 1Y00A 2FHOB 1PG5B 5G4DA 4UOFA 4JI4I 1L5UA 2EFGA 2DGQA 1RT4A 1V3SA 3DLEB 4P74A 1OY6A 1VQSA 2WAQD 1I3OB 4GKKE 1Y4UA 2J9CA 5GVQA 1RHYA 4P9SA 3W5XA 4OZEA 1X31C 4DUZE 2IM3A 1ZETA 1DLOB 5DLGA 3HHLA 1VHFA 5DDRC 2GS8A 2X1GA 2LQJA 4KHPF 2CPZA 4NRTA 4LRDA 4EBDA 1TKZB 5CABA 2WK4A 1Y0HA 3QZ7A 4TQSA 4KC5A 2H65B 1TL4A 2BE2A 4ATNA 4FF2A 2WNRB 5E5NA 4DS4A 1GH8A 4EK2A 3PG9A 1SBRA 2MJUA 2CQDA 2ZZNA 4CIOA 3TA1A 1KP6A 4KHPE 2ALZA 5LSOA 1BHNA 4C0HA 2DNOA 1S7HA 1YDLA 2CJAA 4ZITA 1I94E 4WE1A 2VONA 3ADAC 2DIVA 2MHEA 3RR8A 4LFAJ 4EO6A 4OJHA 2O1VA 3MECB 4R8UB 4Q7AA 1NAQA 1S9EA 2MKSA 1EKRA 4ETZA 3V4MA 3GYGA 3J7YI 4UUXA 2MEWA 1VI7A 5J2MA 4P71A 5KT5A 3HZEA 4IZJB 2F9JA 1K0VA 3D0GE 3WX8A 3HFKA 1DURA 3CJTA 2K7JA 3PO4A 2N82B 1I51B 2HGNA 3QO9B 2V67A 3OR1B 1TL1B 2AX1A 1TKZA 1TAQA 4IZJD 5ETMA 4WFAQ 2FD2A 4RW4B 3PDNA 4LJMA 3PIPQ 3QIPB 2BQ3A 1HD1A 3G8TA 3G8SA 1Z2LA 1H7UA 1WACA 3OTOI 2AEJA 5C0XC 4MKYA 2XS5A 2G9OA 1IKYB 3BREA 2MQLA 4DQQA 2J7WA 4ID8A 1MU2A 2WBMA 2QFJA 2YNIA 3M9MB 3HVTB 3FUYA 3HVWA 4JI7I 2AYEA 2W2PP 4R8UA 4DPTA 1VBXA 3SI8A 5HL7Q 5DNXA 2O3DA 2CQ2A 2CJ9A 3Q8UA 3SZ2A 2XGQA 3JB9k 5CD4H 2RS2A 2MQNA 4XAKA 4JI2F 1S1VA 3D5MA 4HY1A 3FCWA 5KG4A 4CH0S 1YJRA 2FPHX 1PVGA 3J81U 4CZCA 1VIOA 4DR2J 5C0XF 4K4UA 1SC1B 3PO5A 1E6VA 3PRBA 4U67Q 1T03B 4DV3F 1UWAA 2ZH4A 1NK4A 1X4GA 1HFEL 1RT5B 3ILLA 2Y3YA 4JI2E 4TYBA 1YJNS 2ZH9A 3BDEA 3DRYA 1R31A 2UXDI 4O44B 5C0XE 2EI5A 4DV1I 5CHCB 3HVTA 4FS1A 2FGCA 1JK9B 3U02A 1DY3A 2IRYA 4DV3E 2DKOB 3M6UA 4MDTA 3ZTRA 2HVEA 1RREA 3T1YJ 4CM0A 1N34I 1H2VZ 4TYAA 2XULA 4RUBA 1HIYA 1TAUA 4ED1A 4AD6A 1BC6A 5LXRA 2G2ZA 4JI5F 4FYDA 1UEKA 2UXBE 3RJMB 4QIVA 3WU4A 2R7WA 2NCKL 1Q5VA 2JWNA 8ATCB 2OMLA 2YX4A 1H38A 2HKJA 3LH2S 2ZH2A 4DJBA 1J2VA 3DI6A 1D0EA 3QJLA 3ZTSA 5E33A 4JI5E 2FJEB 1RB0A 1V5VA 3QGIA 2QG9B 4V19X 2ZC3A 2B9WA 1YRXA 1DQ8A 4ZVPB 4KYZA 2R7XA 2D9PA 1LKZA 3HJFA 1RT6B 4KB7A 3MOZA 3EZUA 3DDIA 3CDAA 1LWEB 4LSNB 3U1LA 1BQNB 1X8DA 1YVFA 3OD2A 4MU3A 4X64F 1HW8A 2R7QA 3Q1QA 4K2XA 3RG6A 4QYZJ 4CLKA 3UNGC 1JJ4A 2Q6BA 4USJC 1D8ZA 1S48A 2IDLA 3W5ZA 3D6MB 2HK3A 3I32A 3GPAA 4A8FA 2RJZA 4RUCA 3G4SS 4ZN3A 4NLRA 2J7KA 4ZLLA 5C0XB 4X64E 1FX2A 5LMUF 2HBRB 3EVWA 4PWDB 3RBZA 1TVRB 2J5AA 2DEIA 2HGLA 3FNNA 5DZ7A 4W98A 2OTLS 5C0XD 1UPMB 3IG1B 4QWBA 4Y00A 4HL9A 1N32F 4JI8F 4DSIA 3RZAA 3IBWA 3DLKB 5IZHA 1QZRA 3HJCA 3KK2A 3H20A 4JI6J 2R7TA 1LWEA 1TK8A 2DY1A 3KHRA 2DCLA 3EVMA 3WC0A 1B64A 2MKCA 1NNDA 3IR5B 5LMUE 1KQFB 5GAGI 4FKYA 4HEA9 2OTJS 4DR6F 1FJGJ 1UTAA 5K8PA 2KG0A 4DPUA 1TUGB 4JI8E 5IT0A 4TKTA 1X5PA 2JOQA 3RBXA 3TWZA 2ZHBA 1T9TA 2BR0A 2YPZA 4G1IA 2POKA 1QUPA 3CEDA 1B0VA 2R7SA 1SL1A 4JBCA 3KK1A 2HVHA 1NHJA 2PFDA 2UUTA 1LWXA 2BJ9A 2HLTA 3IP0A 3K8WA 5KT2A 3CCES 1UEUA 2OPRA 2ZBIA 3PYDA 3ZKBA 1YJ9S 4GKJF 4B3MF 5HJXA 3M6XA 2DPIA 3IRXB 4RR5A 1VR6A 4OZ5A 5ETOA 4U9RA 3HJVA 1S4EA 2HVIA 3NNAA 2UU9E 4LF7I 4ANDA 2GMLA 4DFKA 2E5LJ 4B3ME 1IBLJ 1NUEA 1TKDA 2D3OR 4DR2I 1UJ6A 2DHGA 4X4NA 4N47A 2GQQA 2FVRA 4OL8A 2IY5B 5C25B 2VF3A 7FD1A 4U6PA 4HXZA 2CPJA 1HNZI 2HWIA 1KS2A 5KOXA 2FLPA 5KT4A 3BQ2A 3MUTP 2E1RA 4OX7A 3ICLA 2AU0A 1Y11A 3MGJA 5DQGA 3GIKA 3MMAA 5IC4B 1M5PC 2PI4A 3BKTA 4ID5B 2GC8A 4RUAA 2MZSA 3BS9A 3ZM7A 1IXKA 3CIMA 2PMHA 3ZTOA 1JJ2R 3H2VE 4E8UA 1HNWF 1IJFB 2ZE2B 3THPA 2BJDA 5KFBA 2E9ZA 5LXYA 3T1YI 2ZHOA 2MQQA 2KFYA 3Q8VA 1VQOS 3UD3P 2Z58B 2K3IA 1JLAA 2HG4A 2UXCJ 2JJ4D 3TEGA 4ZPBA 3KLFB 1S6QA 2RSQA 1OO0B 2V63A 4NLSA 1X9MA 4F2RA 1CJKA 4WFBQ 3F56A 3L4BC 3NAHA 1EP4B 4OZ0A 4DCPB 1WEXA 3JXOA 5C25A 4K8RA 4PRXA 3UFCX 2KT2A 3V6HA 3QATA 4UZCA 1X60A 4J9MA 2O1WA 1Q16B 2GA7A 2OSRA 1LK7A 3QLHA 2C2KB 3CTRA 1WORA 3TRGA 4O3QA 1S0NA 2QX0A 4JI3J 1V3RA 5T7LB 3N6NA 4E0DA 4W4MA 2GJ2A 1GMWD 4LCHA 3PJXA 4I6YA 3BZQA 4HR2A 2B4UA 3S1TA 5F8IA 3JAMY 5J2PB 2AIRB 3A3OB 2JVOA 3W8GA 9RUBA 4WTYA 2IPOB 4F4YA 3M1VB 3P8BB 2C2ZB 3BO2A 2XO7A 1RCOB 5JJBA 2MZTA 4LF5I 3OL8A 3AXKA 3H4LA 2VIHA 1CC8A 4YQWA 3O3LA 3BV8A 1CULB 2HRYA 1IVZA 3FFIB 1KTQA 3M8ZA 4JV1A 2F63A 5HP1A 4EWTA 5KG1A 3EGNA 4DU8A 3CJKB 3K5PA 3DGPB 4MFBA 2NQPA 3K0JA 4ED3A 4JI6I 1VS3A 4B9LA 4KGMA 2Q66A 3T1HJ 1JLCB 1TL7B 3H5UA 4HYMA 2WBRA 3MI7X 4DL0C 1FI4A 5J2PA 5E3CA 3GJTB 2MYFA 1IBKE 4ZMMA 3GCWP 1KOOA 1FJGI 1FXLA 4K5SA 2GVDA 4TLRA 5FLXC 4LF9I 4JG4A 5HO4A 2O3ZA 3VTIA 2XMVA 1DTQB 1NKEA 2QLWA 1AUSL 2RIJA 1IN0A 3HVAA 4EMDA 3LA0A 5LL6R 4OX9E 4B9SA 4DUYF 3RRHA 4AM3A 3M2RB 4DV4I 2F4VF 2WSEC 4U95A 2ZUGA 4MQYA 2RQCA 1VQMS 3VZIA 2VUGA 4URGA 2ILZA 1B0PA 4JP8A 2CQBA 4A8YA 1UZHA 2CQIA 2JEGA 2VDIA 4Y2MA 4A8QA 2DHXA 3GJQB 4NLPA 1YH8A 1TTHB 4B3SE 4KR0B 1TL7A 5A0YA 4AUKA 4DUYE 1DQ9A 4FVMA 5LMNJ 1RK8A 4DL2A 1QUVA 2F4VE 4JI4F 1RADB 3W9HA 4URQU 5C24A 3CJ5A 2LJPA 3MAQA 3CC2S 2E5LI 2P9CA 4WJBA 1IBLI 1CBKA 3TYTA 2L9NA 5JEAC 1HBOB 3CF5Q 3OUYB 1DTQA 2G1HA 3E01A 3KLIB 1VRTB 2CQCA 2KI2A 2GMHA 3AJ1A 4C3LA 2XHCA 2EEYA 1B7YB 5KFOA 2QYCA 2O1PA 2HEKA 3HFVA 3DRRA 4C4WA 2XMJA 4NA1A 4JI4E 4J9SA 1K47A 4KH1B 5EX3A 1S7IA 3Q23A 5ETNA 3C3LA 2AJQA 1S9GB 2HQDA 1S5ZA 4HI1A 1A6FA 2E29A 2KTQA 4IFDF 1IKVB 3T41A 2VV5A 1XXEA 4YUDA 2IRUA 2V2VA 2ASDA 3DC2A 1RWKB 3MPYA 1H6KX 3OFGA 3UWTA 3G9CA 3TJ8A 2AJ0A 1IUJA 2UXCI 3SCLE 3S7RA 4Y28C 2CPHA 1ZPVA 3MDFA 2ZM6J 1Z0BA 1Z0TA 4HLBA 3J7AG 5BXIA 3GIJA 5B0BA 3UPFA 3HFZB 4YP3A 2OKQA 3MFIA 3P5BP 3QZ8A 1DARA 1SQFA 2ZOFA 1GQEA 3CT9A 5DGBA 4D3HA 5BYQA 1PCAA 2JRSA 2WP8A 4QIFA 3B4TA 2DK2A 5D6GA 4ZVFA 4Q5VA 2JEBA 1HBUB 1N8RT 4JI3I 4G1QB 1IKVA 3UHMA 1T05B 2EFPA 4DV2J 4HACA 2CG8A 3MEDB 4DLGA 3VAFA 1T9VA 3M8PB 1IM4A 4OI6A 3A3PB 1XR5A 3OTOF 4LOMA 1N5YA 1ULRA 2R9LA 3ENVA 3S01A 2W8KA 2B4VA 2HAIA 3JQMA 5KFDA 3V81B 3AJ2A 4NCGB 3LAKA 3MUMP 4CDIA 4PWUA 1Y5IB 4JI7F 2AGOA 1T9YA 4OJ1A 3G87A 1FERA 4P7TA 2OP5A 5EHHA 2HHVA 5CZXA 4GO7X 5SZTA 1XHKA 3PR5B 1NU4A 4C8YA 1LWFB 3EZ5A 1N0VC 3WZ0A 1NDCA 2IVMA 3A12A 1X4EA 1GXUA 1ZOTA 3D67A 5BYRA 4LVNP 4DCOB 2RQ4A 3KNGA 4CNYA 2NR0A 1TMJA 1T05A 4Q2MA 4O3NA 3SYZA 4OYWA 1FK9B 4DV6J 3F44A 4OHZA 4DX7A 3J7Z5 1RHKB 2OO4A 2WW8A 2VFSA 4B9VA 3C6TB 4H4KC 4X4UA 4YFUA 2UXDF 3ENQA 3BGRA 1FNOA 1YQHA 3DFEA 3SSSA 5HANA 2HHTA 3TJAA 1EI1A 3SIPB 1TKTB 3CD0A 3T9ZA 5EKWA 4DV1F 1N6QA 3G8QA 3N4WA 2A0FB 4NZ6A 5H9EK 3QFWA 3P3GA 4USHA 1GK8A 4M5GA 4HH1A 3CJSA 3MM9A 1V3ZA 3OR2A 1PC5A 1N34F 3UDLA 4TXSA 4QW8A 2BOAA 2UXDE 1PILA 3DLLQ 2LYVA 3DOKB 3RR7A 4GVBB 4ZPDA 3E2EA 4ITSA 4LFCJ
chains in the Genus database with same CATH topology
2Z5BA 4GKKE 4DUZI 1Y4UA 1KTVA 2HK3A 1HR0I 2ZM6I 4JI6E 4YHHE 1IBKE 1FJGI 4FW9A 2J7KA 3ZZ0A 4DR1E 4X62I 4GKJI 4B3MI 2CG9A 4X64E 5FLXC 4DV6E 4DUZE 3ZKDA 4I3HA 1HR0E 4LF9I 4JG4A 5A2QC 4B3TI 3B8HA 2R3VA 3WU3A 2ZBKB 4GKJE 2CZ9A 4WUDA 4OX9I 1BKNA 2DEIA 5LMNI 4ED4A 4HACB 2GS8A 4IZKA 1XNRI 4B3TE 3D4JA 3QT8A 4USKA 4P7AA 2V2QA 4EMDA 5LL6R 4OX9E 1QZRA 5LMNE 3B82A 3HJCA 4DV4I 1H74A 1XNRE 1Z0VA 1XMQE 2VQEI 4X66I 1Z0EA 4DR4I 4LFAE 3CWVA 4FWDA 4DR5E 2GQ0A 5LMUE 3QT7A 4LFBE 3J7AM 1ZXNA 1ZM9A 1MX0A 4DPUA 2UUAE 4X65I 3LNUA 4B3RI 1HK7A 4DV7E 4JI8E 4KHPE 1I94I 4DR7I 4JI1I 4B3SE 4DUYE 4JV5E 1USVA 2HFSA 4R1FA 4LF5E 2F4VE 3K1JA 2HFUA 1I94E 2ZITA 3HULA 1NHHA 2UUBI 2LJPA 2CGEA 4JYAE 1H72C 4DPWA 2E5LI 1NHJA 2O1VA 5FLXQ 1IBLI 1NHIA 1HNXI 4JI2I 4YY3E 2Z5CA 1EA6A 5A2QQ 1U2RA 4DV0I 1FWLA 4PU9A 4NXMI 4JI0I 1FWKA 1N33I 1HNWI 3PYDA 3ZKBA 1IBLE 1ZM3A 4IZJB 1HNXE 1ZM2A 1Y6ZA 2UUCE 3J80Q 4URLA 5BR8E 5GMEA 2UU9I 4LF6E 1N33E 5IT9C 1HNWE 2HHHI 1ZM4A 4JI4E 4PRVA 1K47A 2XEXA 1S4EA 4DV3I 5IWAE 4LF4E 4DR3I 4IZJD 2VQFE 2UU9E 4LF7I 1A6FA 2ZM6E 3JAMC 2Z5EA 2OI2A 1PIEA 1FJGE 4WUBA 1NZ0A 2V2ZA 3P06A 1N36I 4X62E 4B3ME 4K0KI 1H7UA 3OTOI 4P52A 1KVKA 4LF9E 2NPFA 1Z5AA 4DR2I 1Z5CA 2V2VA 3J81C 4K0KE 4DXLA 3OTOE 2A2CA 1XMOI 4DPYA 3GONA 4NXNI 2UXCI 3M6AA 2VF3A 4HXZA 4JI7I 1XMOE 1HNZI 3F0NA 4DPTA 1Z0BA 4DV4E 1Z0TA 4DV2I 3J7AG 2UXCE 2E1RA 2VQEE 4X66E 4DR4E 4JI5I 4JI7E 1MU5A 1USUA 4DV2E 1DARA 3Q6MA 4HY1A 2DEJA 3ZM7A 1IBMI 2O1TA 5IT9Q 4X65E 1PVGA 4B3RE 3T1HI 1S16A 1N0UA 4DR7E 4JI1E 1ELOA 3T1YI 3QT6A 4IZKB 2HK2A 4N3OA 1KKHA 3JAMQ 4USMA 5FWKA 2UUBE 2V34A 4DR6I 3WU5A 4JI3I 3T1YE 2E5LE 1FNMA 4JI2E 1Z59A 4HACA 4LF8I 1WUUA 4DV0E 4UT4A 4JI3E 4NXME 2UXDI 1ZXMA 4JI0E 3J81Q 4DV5I 4DV1I 4FWGA 1H7SA 1XNQI 1FKAE 4PRXA 2Q2EB 4YHHI 2HHHE 2V8PA 4XTJA 4DV5E 3B78A 3Q6NA 4DR1I 4DV1E 4DV3E 4DR3E 4X64I 1XNQE 4DV6I 1RREA 3PYEA 2O1WA 5L3JA 4M1KA 4FWHA 4AQYI 5GMDA 4LF7E 1Z0WA 1N34I 4Z7YA 3V2UC 4MYTA 2UXBI 1N36E 1Y4SA 4AQYE 3PYGA 3PYFA 2Z5CB 1N34E 3LPSA 2IOPA 1XHKA 1UEKA 2UXBE 4DR2E 3WU4A 4FN5A 2R42A 1N0VC 3J80C 1XMQI 1PKPA 1Z5BA 4LFAI 2BM1A 2Z5BB 4DR5I 5LMUI 4NXNE 4LFBI 3WU6A 1OJ4A 2X36A 2HKJA 1HNZE 3K17A 3PRYA 4IZJA 1D6TA 4ZVIA 2UUAI 4DV7I 4RPFA 4JI5E 4JI8I 1N32I 4KHPI 4Z7CA 1RR9A 4B3SI 4WUCA 4DUYI 4JV5I 1Z0CA 3ZZTA 2A2DA 2PNLA 4LFCI 4LF5I 2F4VI 1N32E 3H4LA 3QT5A 1Z0GA 1IBME 3K85A 3T1HE 3ZZUA 2BV3A 4JYAI 1B63A 1EI1A 4LFCE 3LTOA 1H73A 1J5EI 4YY3I 1VISA 1KIJA 2O1UA 4MYUA 1MG7A 4DR6E 2HKEA 2PNMA 1J5EE 4DPXA 2UUCI 3Q1QA 4DU8A 2AJ4A 5BR8I 4LF6I 4LF8E 2IOQA 4JI4I 4GKKI 2WW4A 2EFGA 2UXDE 4JI6I 2X7IA 1IBKI 2BM0A 5IWAI 4LF4I 4UTGA 4KQVA 4HYMA 2VQFI 3V5RA 1B62A 4DU7A 1FI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK E;  4DUZ I;  1KTV A;  2HK3 A;  1HR0 I;  2ZM6 I;  4JI6 E;  4YHH E;  1IBK E;  1FJG I;  4FW9 A;  2J7K A;  3ZZ0 A;  4DR1 E;  4X62 I;  4GKJ I;  4B3M I;  4X64 E;  5FLX C;  4DV6 E;  4DUZ E;  3ZKD A;  4I3H A;  1HR0 E;  4LF9 I;  4JG4 A;  5A2Q C;  4B3T I;  3B8H A;  2R3V A;  3WU3 A;  2ZBK B;  4GKJ E;  2CZ9 A;  4WUD A;  4OX9 I;  1BKN A;  2DEI A;  5LMN I;  4ED4 A;  4HAC B;  2GS8 A;  1XNR I;  4B3T E;  3D4J A;  3QT8 A;  4USK A;  4P7A A;  2V2Q A;  4EMD A;  5LL6 R;  4OX9 E;  1QZR A;  5LMN E;  3B82 A;  4DV4 I;  1H74 A;  1XNR E;  1Z0V A;  1XMQ E;  2VQE I;  4X66 I;  1Z0E A;  4DR4 I;  4LFA E;  3CWV A;  4FWD A;  4DR5 E;  5LMU E;  3QT7 A;  4LFB E;  3J7A M;  1ZXN A;  1ZM9 A;  1MX0 A;  4DPU A;  2UUA E;  4X65 I;  3LNU A;  4B3R I;  4DV7 E;  4JI8 E;  4KHP E;  1I94 I;  4DR7 I;  4JI1 I;  4B3S E;  4DUY E;  4JV5 E;  2HFS A;  4R1F A;  4LF5 E;  2F4V E;  3K1J A;  2HFU A;  1I94 E;  2ZIT A;  3HUL A;  1NHH A;  2UUB I;  2LJP A;  4JYA E;  1H72 C;  4DPW A;  2E5L I;  1NHJ A;  5FLX Q;  1IBL I;  1NHI A;  1HNX I;  4JI2 I;  4YY3 E;  1EA6 A;  5A2Q Q;  1U2R A;  4DV0 I;  1FWL A;  4PU9 A;  4NXM I;  4JI0 I;  1FWK A;  1N33 I;  1HNW I;  3PYD A;  3ZKB A;  1IBL E;  1ZM3 A;  1HNX E;  1ZM2 A;  2UUC E;  3J80 Q;  4URL A;  5BR8 E;  5GME A;  2UU9 I;  4LF6 E;  1N33 E;  5IT9 C;  1HNW E;  2HHH I;  1ZM4 A;  4JI4 E;  4PRV A;  1K47 A;  2XEX A;  1S4E A;  4DV3 I;  5IWA E;  4LF4 E;  4DR3 I;  2VQF E;  2UU9 E;  4LF7 I;  1A6F A;  2ZM6 E;  3JAM C;  2OI2 A;  1PIE A;  1FJG E;  4WUB A;  1NZ0 A;  2V2Z A;  1N36 I;  4X62 E;  4B3M E;  4K0K I;  1H7U A;  3OTO I;  4P52 A;  1KVK A;  4LF9 E;  2NPF A;  1Z5A A;  4DR2 I;  1Z5C A;  2V2V A;  3J81 C;  4K0K E;  4DXL A;  3OTO E;  2A2C A;  1XMO I;  4DPY A;  3GON A;  4NXN I;  2UXC I;  3M6A A;  2VF3 A;  4HXZ A;  4JI7 I;  1XMO E;  1HNZ I;  3F0N A;  4DPT A;  1Z0B A;  4DV4 E;  1Z0T A;  4DV2 I;  3J7A G;  2UXC E;  2E1R A;  2VQE E;  4X66 E;  4DR4 E;  4JI5 I;  4JI7 E;  1MU5 A;  4DV2 E;  1DAR A;  4HY1 A;  2DEJ A;  3ZM7 A;  1IBM I;  5IT9 Q;  4X65 E;  1PVG A;  4B3R E;  3T1H I;  1S16 A;  1N0U A;  4DR7 E;  4JI1 E;  1ELO A;  3T1Y I;  3QT6 A;  2HK2 A;  1KKH A;  3JAM Q;  4USM A;  2UUB E;  2V34 A;  4DR6 I;  3WU5 A;  4JI3 I;  3T1Y E;  2E5L E;  1FNM A;  4JI2 E;  1Z59 A;  4HAC A;  4LF8 I;  1WUU A;  4DV0 E;  4UT4 A;  4JI3 E;  4NXM E;  2UXD I;  1ZXM A;  4JI0 E;  3J81 Q;  4DV5 I;  4DV1 I;  4FWG A;  1H7S A;  1XNQ I;  1FKA E;  4PRX A;  2Q2E B;  4YHH I;  2HHH E;  2V8P A;  4XTJ A;  4DV5 E;  3B78 A;  4DR1 I;  4DV1 E;  4DV3 E;  4DR3 E;  4X64 I;  1XNQ E;  4DV6 I;  1RRE A;  3PYE A;  5L3J A;  4M1K A;  4FWH A;  4AQY I;  5GMD A;  4LF7 E;  1Z0W A;  1N34 I;  4Z7Y A;  3V2U C;  4MYT A;  2UXB I;  1N36 E;  4AQY E;  3PYG A;  3PYF A;  1N34 E;  3LPS A;  1XHK A;  1UEK A;  2UXB E;  4DR2 E;  3WU4 A;  4FN5 A;  2R42 A;  1N0V C;  3J80 C;  1XMQ I;  1PKP A;  1Z5B A;  4LFA I;  2BM1 A;  4DR5 I;  5LMU I;  4NXN E;  4LFB I;  3WU6 A;  1OJ4 A;  2X36 A;  2HKJ A;  1HNZ E;  3K17 A;  1D6T A;  4ZVI A;  2UUA I;  4DV7 I;  4RPF A;  4JI5 E;  4JI8 I;  1N32 I;  4KHP I;  4Z7C A;  1RR9 A;  4B3S I;  4WUC A;  4DUY I;  4JV5 I;  1Z0C A;  3ZZT A;  2A2D A;  4LFC I;  4LF5 I;  2F4V I;  1N32 E;  3H4L A;  3QT5 A;  1Z0G A;  1IBM E;  3T1H E;  3ZZU A;  2BV3 A;  4JYA I;  1B63 A;  1EI1 A;  4LFC E;  3LTO A;  1H73 A;  1J5E I;  4YY3 I;  1VIS A;  1KIJ A;  4MYU A;  1MG7 A;  4DR6 E;  2HKE A;  1J5E E;  4DPX A;  2UUC I;  3Q1Q A;  4DU8 A;  2AJ4 A;  5BR8 I;  4LF6 I;  4LF8 E;  4JI4 I;  4GKK I;  2WW4 A;  2EFG A;  2UXD E;  4JI6 I;  2X7I A;  1IBK I;  2BM0 A;  5IWA I;  4LF4 I;  4UTG A;  4KQV A;  4HYM A;  2VQF I;  3V5R A;  1B62 A;  4DU7 A;  1FI4 A; 
#chains in the Genus database with same CATH topology
 3PW4 A;  2WRM A;  2ADC A;  2CG9 A;  1REV A;  1WF2 A;  2UV8 G;  2W9C A;  1Q0N A;  4I0W A;  1DFD A;  2I5J B;  3L3C A;  1Q8L A;  4FXW A;  2MQM A;  3CDU A;  4P2M A;  3M7N G;  1FKP A;  4IFD A;  2CKW A;  1X4C A;  4ZLP A;  5LMN I;  2BA1 G;  3MPV A;  4DOZ A;  3MR6 A;  3D1Q A;  3M7N D;  5BR8 J;  2BA1 D;  3G96 A;  1ACM B;  3NNC A;  2RUG A;  3IWN C;  3CO9 A;  2G2O A;  4LMZ A;  3BSO A;  5IWA J;  1XNR E;  2V4J B;  1R8C A;  2MGZ A;  1KN6 A;  3L7P A;  2FYX A;  3DOM A;  1VIX A;  3MTK A;  2P9G A;  4J9V A;  3PFE A;  5F8H A;  3J7Y U;  2FVC A;  3CCJ S;  1IKW A;  2C39 A;  1KVJ A;  2AJF E;  4ENO A;  1NXI A;  2DO4 A;  4M5J A;  3ITH B;  2DGX A;  4B3T J;  3ZC4 A;  2IYG A;  4I7F A;  3K7R A;  4M5H A;  1XMB A;  4QPX A;  5K36 F;  4J3D A;  3R27 A;  5FLX Q;  1U26 A;  2EK6 A;  1HQ2 A;  1Q82 T;  3SQO P;  1T11 A;  2BJ8 A;  4ZVQ B;  1HW9 A;  1G3O A;  1R0B G;  1RAB B;  3ET6 B;  4JOU A;  4Y65 A;  4DV7 J;  1FKO A;  1L3T A;  4LIW A;  2CZV C;  3BGO P;  4I2P A;  4X65 J;  2RH3 A;  2J8S A;  3GQC A;  3OFE A;  2AEM A;  3FZB A;  4DR3 I;  5K36 E;  4FBU A;  1DTT B;  1S1U B;  2V94 A;  2PN6 A;  1NSA A;  1Z1Z A;  4YY3 J;  5B08 A;  5GMK a;  3KLH A;  1UW9 A;  3GR1 A;  4WUB A;  5KFR A;  4ECQ A;  4X4Q A;  3PHT A;  4EFA C;  4RNH A;  4KV8 B;  1REG X;  1OWX A;  4AFF A;  1S6P B;  3LGN A;  2BW7 A;  2B9E A;  1G7C B;  1HBN A;  4FYX B;  4CLF A;  4CLL A;  3H42 A;  1BY9 A;  3GON A;  2EKN A;  4J9R A;  5KFV A;  2VQF J;  2V9K A;  2M5Y A;  2FHK A;  3BGL A;  3KLE A;  2EW9 A;  4DV2 I;  1Q4R A;  1KLN A;  3JAM U;  1HI1 A;  2V8G A;  2HHS A;  4QIW D;  2KDO A;  3W2W A;  1WI6 A;  4ZCL A;  4FNH A;  1UVK A;  5KG6 A;  1BQM B;  4P2S A;  4C6A A;  2NYH A;  2XSJ A;  1N0U A;  1OY8 A;  2E5J A;  4YOE A;  5M2R A;  3L9Z A;  1T7P A;  1DTT A;  1WHY A;  2CJY B;  2HK2 A;  5L39 A;  1W2B R;  4WFX A;  1HPZ B;  1OMS A;  3NGU A;  5FDL A;  4CLW A;  3I31 A;  2EXU A;  1T94 A;  4KV8 A;  5B0E A;  2BMB A;  3BQ0 A;  4LF7 F;  2HVZ A;  1KRP A;  5AXN A;  4P7V A;  1WF1 A;  1WUU A;  4KY3 A;  2DR8 A;  5F3T A;  1YHC A;  4WWS A;  4A8X A;  4DFP A;  2UVU A;  4YR0 A;  4DR2 F;  2NUH A;  2YQ0 A;  2CQ1 A;  3FBE A;  4FW7 A;  2VBY A;  1U02 A;  4DV6 I;  1U0H A;  4U7U D;  4LF7 E;  4FPI A;  5CXT A;  3JYT A;  4RU9 A;  4J9L A;  3IC1 A;  2A10 A;  2ZBC A;  4TU9 A;  5K36 B;  3PYG A;  1BQM A;  5IT9 Y;  2VKR A;  2YKN B;  2NXE A;  1I5O B;  2ABY A;  1M1K T;  3PJ9 A;  3I5C A;  4DR2 E;  4M63 A;  4DF8 A;  3FQK A;  2HMI A;  3NWR A;  1F60 B;  1XBW A;  5K36 D;  4WCE Q;  1RAO A;  1HPZ A;  3HXM A;  3I0S B;  2J6T A;  4DR5 I;  3OLB A;  4LFB I;  3WU6 A;  4TN2 A;  3EYZ A;  1HNZ E;  3PS3 A;  3T1Y F;  2F5G A;  1UVJ A;  3D1O A;  3KG4 A;  4H54 A;  3M2V B;  4AQY J;  1GEH A;  3ONQ A;  4RPF A;  4Z7C A;  3B4M A;  4A4J A;  1NCL A;  2FC9 A;  1WSR A;  3UVJ B;  3ISN C;  2A2D A;  1N52 B;  3W9J A;  4LFC I;  4K7Q A;  3KJV B;  1OPZ A;  3FMB A;  2N7Y A;  3A4T A;  2RT3 A;  4F36 A;  1RTJ B;  1SXL A;  1VC5 A;  1AA1 B;  2EC0 A;  4O0N A;  2DNM A;  2FB0 A;  5E3Q A;  2DGO A;  3GSD A;  3GFX A;  3TA2 A;  1J5E E;  3FBC A;  3W60 A;  1IKX B;  2MPU A;  3HHN B;  1CJU B;  2YKN A;  5BR8 I;  2BW2 A;  4HDH A;  3B54 A;  5CAA A;  4NEZ A;  1EIY B;  2L3M A;  2WW4 A;  1UVI A;  5IWA I;  3CGI A;  2QMX A;  3I0S A;  1LFW A;  3MMB B;  2G2Y A;  3G6Y A;  1VOM A;  2IM1 A;  2WVB A;  5C5J A;  4BCA A;  4KO0 A;  2ASL A;  3W1Y C;  1ICE B;  1JLB B;  1X5T A;  1Y5N B;  2GO3 A;  3IMQ J;  5GAG U;  2EVZ A;  3KLG B;  4B3T I;  3R5C A;  1WHW A;  4LF8 J;  4OO1 C;  4TU7 A;  4DX6 A;  1ITP A;  4IZK A;  2BDP A;  1IR1 A;  1AXQ A;  4PAB A;  2DIT A;  2QL7 B;  3ZFV A;  4JV2 A;  4YHH J;  3QFH A;  4LF5 F;  5F8J A;  3BB5 A;  1Q7L B;  2VQE I;  1IWA A;  5M2P A;  3SDE B;  1KLM B;  4ECS A;  3NXZ A;  2GIR A;  4LBH A;  3HVR A;  2MLX A;  1TP7 A;  3H1C A;  5AT1 B;  3KNA A;  1ZM9 A;  1CJU A;  2DH8 A;  3MAA B;  5LSR A;  2DNN A;  4X65 I;  2DIS A;  5AJ3 J;  4HHU A;  2WB1 D;  4URS A;  3K8V A;  1SC6 A;  1U8W A;  1U4B A;  3E8O A;  2ASJ A;  2LXF A;  4ILM A;  1USV A;  5ELW A;  2QRR A;  4IG3 A;  4LF5 E;  3PW0 A;  3MMB A;  3ELH A;  4JI6 F;  2X1A A;  2RRN A;  1N88 A;  1OYR A;  3MUR P;  1RAF B;  4KH0 B;  1EA6 A;  3J7A N;  3KLG A;  4GC7 A;  1OS5 A;  1BE4 A;  1YX2 A;  1FJG F;  5KG5 A;  1VBY A;  2DRB A;  5JVH Q;  1WJ9 A;  4LF9 F;  1NSP A;  3I5B A;  4BBY A;  1UVN A;  5B0C A;  5A76 A;  1U45 A;  1TQL A;  2MY7 A;  4CH7 A;  2CA9 A;  1KEK A;  4OO1 E;  2M2B A;  4K4X A;  1B7F A;  1WI8 A;  4JYA J;  3M8Q A;  1SV5 A;  4B08 A;  1CJV A;  2V69 A;  1S49 A;  5A8K A;  2VPX B;  1FJG E;  3UDE A;  2V5H G;  4DV4 F;  3RTV A;  3TVZ A;  1WDD A;  4LF9 E;  2RRA A;  5K14 A;  1FRJ A;  5J2Q B;  4DSJ A;  1SJ4 P;  2GIF A;  2B6A B;  1HBM A;  1LXJ A;  4CCH A;  3W61 A;  4MAK A;  4XTT A;  4X4T A;  1JLE A;  1XMO E;  3DGV A;  2LXI A;  4DV4 E;  5HVH A;  2IIH A;  3H5S A;  3UW1 A;  4X62 J;  1RZM A;  1IBC B;  5EWE A;  1T95 A;  1RHU B;  3LQV A;  5LJ5 Y;  2E5L F;  2KFZ A;  4WU3 A;  1USU A;  1IBL F;  1LW2 B;  1S76 D;  1ZZF A;  2HRT A;  2MZ1 A;  1IQT A;  2BVZ A;  3ISN D;  2IM0 A;  3AOA A;  1JLQ A;  3LOU A;  1KBR A;  1CJT A;  2KFN A;  2KVQ E;  2HIY A;  4LF2 A;  5FWK A;  3V6D B;  5DM7 Q;  2E5L E;  4ER8 A;  1A7G E;  4CLY A;  3VCD A;  4PUO A;  3L7U A;  2R2S A;  1ZXM A;  5J2Q A;  2OPQ B;  3T5L A;  2FZK B;  3POT A;  1YSJ A;  3FRY A;  1IR0 A;  1NRK A;  1LK5 A;  5IQQ A;  4B3O B;  4DQR A;  4LSL B;  2ZBP A;  3I6P A;  2W2N P;  3M30 B;  1Q81 T;  1I1G A;  2YKP A;  2V8P A;  1T3N A;  2ZOM A;  2Y9H A;  2K8G A;  5KFF A;  3TOQ A;  2UUB J;  3PYE A;  2GHW A;  1FES A;  4AQY I;  4A8M P;  3C46 A;  2UXC F;  4ZCI A;  5KFK A;  4OO1 B;  2FLN A;  1IQZ A;  1U47 A;  4DV0 J;  3KDO A;  1Y4S A;  4RW7 A;  1WC5 A;  2YWK A;  1MSW D;  1HA1 A;  4Q43 A;  4DL3 A;  2DNQ A;  2IBK A;  3OL6 A;  4OO1 D;  1Q1K A;  3OQ2 A;  1XNQ J;  2JEJ A;  4N41 A;  2MKJ A;  4ETX A;  3V6D A;  3D1H A;  1ZYQ A;  3TUJ C;  2DNY A;  3BQ1 A;  3KLV A;  4DR1 J;  3HT3 A;  4O3P A;  1HWI A;  3KHH A;  4EZ9 A;  1NSK L;  5DDO C;  5CD4 A;  2VL1 A;  5E2Q A;  4OYX A;  3LGM A;  4JI3 F;  5ETS A;  4F4A A;  1SC3 B;  3WHI A;  1FT8 A;  2FY8 A;  1Z0G A;  3M30 A;  3LPE A;  3MM8 B;  1PJ7 A;  3K59 A;  1VFJ A;  2Y0B B;  3KUH A;  5CYJ A;  2ZVS A;  2QN6 B;  2XQC A;  2XMT A;  1FFG B;  3D7S B;  3K5O A;  4TY8 B;  1JB0 C;  3ZXW A;  4F0K A;  2MZJ A;  2K1R A;  3DLG A;  4J9N A;  3VAJ A;  1C0T B;  3MCN A;  1C1C A;  1S0M A;  2I0X A;  4UQT A;  2NSB A;  4KQV A;  4DCJ B;  3V5R A;  2CRL A;  1UWB A;  4QYR A;  2PA8 D;  1VQN S;  2XMA A;  2HRU A;  2OAU A;  3NBP B;  5D4N A;  5D3G A;  4P2F A;  5LJ3 Y;  4V19 J;  4I3H A;  3CJ8 A;  3R3T A;  2GJI A;  5A2Q C;  4BS2 A;  2R8K A;  3WU3 A;  1SQG A;  2YNF A;  5FJ4 A;  1TZ0 A;  4F04 B;  5HMX A;  1NKB A;  3FMW A;  2B8P A;  2ILY A;  3IXQ A;  2BYC A;  5KFM A;  2VOD A;  2VPY B;  2C3U A;  1NJI T;  3OL9 A;  3MM8 A;  4ZLN A;  4P7A A;  4NYP A;  3NGR A;  3MM7 B;  3ZZP A;  2DNZ A;  3PHE A;  4PXD A;  2VD3 A;  4AL6 A;  3NY0 A;  3FCV A;  2HNY A;  1Y5L B;  3G2X A;  2F9D A;  4HVZ A;  5F0W A;  1NJZ A;  4HHH A;  3C8Y A;  1HR0 J;  3GFZ A;  1TK5 A;  5KG0 A;  1HQE A;  1S0O A;  1NK7 A;  5KG2 A;  1NK9 A;  2D3O 1;  2CXE A;  3TZW A;  3H7H B;  5F0U A;  4DN9 A;  2VBW A;  1IM6 A;  2GZO A;  1N4L A;  4P2X A;  4QU7 A;  4JI1 I;  2PT0 A;  3JQK A;  4FW6 A;  5CA5 A;  1Q53 A;  1RWV B;  2ZIT A;  2CPX A;  1KOH A;  2F8H A;  4Y2C A;  3LO3 A;  4WKY A;  3WIV A;  5ETQ A;  2C3Y A;  4I2Q B;  3J7Z T;  1FRK A;  2LEP A;  3D6F B;  2ZH7 A;  2XNQ A;  1NK5 A;  3VAM A;  2JT2 A;  2L08 A;  3GP9 A;  1SL2 A;  4QWD A;  3PFO A;  3IR7 B;  4LSZ B;  2NXJ A;  2MST A;  2J9D E;  5GME A;  2FJD B;  1JX4 A;  4KE5 A;  2BE9 B;  5LMN F;  1PBU A;  3H25 A;  3MZI A;  4KGV B;  1SJF A;  3N0V A;  2IA0 A;  1OSD A;  1FHT A;  2PMW A;  4LT6 A;  1LV5 A;  3RAX A;  2OI2 A;  1FRX A;  2XY5 A;  4WIQ A;  4N76 A;  3SCK E;  1HNX J;  3RB4 A;  2F4F A;  3DM2 A;  3IBC B;  1SH2 A;  1S1X B;  1T9W A;  2YX1 A;  4L75 A;  4BA2 B;  2PO1 A;  3DOL B;  5IT9 U;  2IMW P;  4PQU A;  3RB6 A;  2L48 A;  2CQ0 A;  2PI5 A;  4OYZ A;  1RT2 B;  3FEX B;  3K57 A;  2ZZM A;  5AE1 A;  5B0A A;  1ZH5 A;  1FX4 A;  1EKS A;  3X3U A;  1MU5 A;  4XIU A;  4F3Q A;  2RB7 A;  3TA0 A;  2FLO A;  4K0K J;  2DYA A;  3BPD A;  1VBZ A;  2BKP A;  2VJU A;  2KXH A;  5A8R B;  2DGV A;  4ZIW A;  4EYH B;  2VU5 A;  1GTH A;  2DR9 A;  2HQ3 A;  3OXL A;  4DR6 I;  1F2H A;  4F4X A;  4DR3 F;  1F9F A;  2ZBR A;  4PPD A;  3SCI E;  2PMZ D;  3AB4 B;  3RRG A;  3LP2 B;  2RHS B;  4Y6I A;  4Q8E A;  2GNK A;  3P4U B;  1S1X A;  4PAA A;  4RNF A;  1X7V A;  4IOB A;  2CNN B;  2I9S A;  3PM9 A;  2XO6 A;  1XNQ I;  3UCZ P;  3NP5 A;  2J0S D;  2X1B A;  1H7X A;  4IR9 A;  1RT2 A;  4IFV B;  4DR1 I;  2Z0G A;  4DR3 E;  4RW9 A;  2WON B;  2F8M A;  3KKF A;  1RDR A;  3DU5 A;  3QSI A;  4NZ0 A;  4J90 A;  2YKO A;  4TVA B;  4DV2 F;  4IH6 A;  1RAH B;  3PXG a;  4GVL A;  5JEA A;  4ZIV A;  4RWX A;  4DSF A;  4QR2 A;  3WIU A;  2CVE A;  3TX8 A;  3DN9 A;  2HYI B;  1E3P A;  4DFJ A;  1Q79 A;  2BM1 A;  1KWM A;  2RVJ A;  4DFM A;  3NGD A;  2X36 A;  4DLE A;  2CNK B;  4H4O A;  2GX8 A;  2GO9 A;  2XNR A;  4U7C A;  3KWM A;  2IAJ B;  1TK0 A;  5LL6 d;  2ATL A;  4NML A;  4USV A;  3IRW P;  4JV5 I;  4Y2I A;  4DBQ A;  3ZZT A;  5AE2 A;  4RW8 B;  4QWE A;  1TKX A;  3FK4 A;  2C37 A;  3ZZU A;  2BR2 B;  2KT5 A;  3ILO A;  1VCT A;  2RF2 B;  2U1A A;  2JZ5 A;  1HAR A;  2ZWP A;  4IFV A;  3UN3 A;  3GII A;  3ZTQ A;  1NPK A;  3I4H X;  3HHL C;  3T9N A;  3VAL A;  2XYP B;  4K4S A;  2D69 A;  4PXE A;  3MFH A;  3VAG A;  2Z57 B;  4IO9 Q;  3I9V 9;  3HX9 A;  2MKH A;  3G82 A;  3BF4 A;  5K8M A;  4DV6 F;  3PX4 A;  5CYQ B;  3NGS A;  1X4F A;  4P75 A;  5GAD U;  2Y0S D;  2DGU A;  2IOQ A;  2YH1 A;  2CQP A;  2HWH A;  4P72 A;  1I