3F0NA

Mus musculus mevalonate pyrophosphate decarboxylase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
401
structure length
387
Chain Sequence
b'RENLYFDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNGREEDVGQPRLQACLREIRRLARKDTLPLSLSYKVHVASVNNFPTAAGLASSAAGYACLAYTLAQVYGVEGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWHWPQLRILILVVSADKQTGSTVGMQTSVETSTLLKFRAESVVPERMKEMTRCIQEQDFQGFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHHGQTKVAYTFDAGPNAVIFTLEDTVAEFVAAVRHSFPPAANKFLKGLQVAPVLLSDELKAALVVEPSPGGVQYIIATQVGPGPQVLDDTHDHLLGQDGLPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEVALONATE PYROPHOSPHATE DECARBOXYLASE
publication title Structure of Mus Musculus Mevalonate Pyrophosphate Decarboxylase
rcsb
source organism Mus musculus
molecule tags Lyase
total genus 127
structure length 387
sequence length 401
chains with identical sequence B
ec nomenclature ec 4.1.1.33: Diphosphomevalonate decarboxylase.
pdb deposition date 2008-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF18376 MDD_C Mevalonate 5-diphosphate decarboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3f0nA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3f0nA01
1PKPA 2V2QA 4HY1A 2UUCE 1Z0TA 4PRVA 4DR3E 4DR6I 1XNRI 4DV6E 1ZM9A 3JAMC 4WUBA 4JI8E 4JV5I 4DV7E 4FWDA 4WUCA 4DR2E 4JI6E 1HR0I 4LF4I 4I3HA 1B63A 5LMUE 3QT6A 1FWLA 2J7KA 3ZZ0A 3PYEA 1Z5AA 1Z0GA 3LNUA 4DV0I 4DR6E 1XNRE 1EI1A 1IBME 3V2UC 2E5LI 4JV5E 1Z0CA 1ZXMA 4JI4I 1S16A 1HR0E 3ZKBA 4LF4E 4HACA 1J5EI 4LF7I 1Z59A 4XTJA 2VF3A 1N0UA 2OI2A 4LF5I 4ED4A 2VQEI 4DV0E 2GS8A 2E5LE 5IT9Q 5IWAI 4JI2I 3B78A 1HNZE 4DPUA 3J80Q 1PIEA 3B8HA 3J81Q 1ZM4A 1A6FA 2BV3A 2F4VI 4DR7E 4DV1I 4DPWA 4NXNI 4LF5E 1Z0VA 4DPTA 2VQEE 3T1HE 2CZ9A 1OJ4A 2A2DA 4FW9A 2WW4A 1FWKA 3WU5A 5GMEA 2BM1A 5IWAE 4JI2E 3ZKDA 4DV4I 3V5RA 4DR1I 4R1FA 4JI7I 1VISA 1ZM3A 2X36A 4JI3I 4JI8I 3ZM7A 3QT8A 2F4VE 2UU9E 4GKJI 1N34E 2V34A 4HACB 4DV1E 4DR2I 4NXNE 1MU5A 2ZITA 2UXDI 1Z0WA 2V2VA 4B3MI 4MYTA 1XMOI 2X7IA 1S4EA 4DV4E 4KQVA 4DR1E 4JI7E 1I94E 4LF9I 1H7UA 1IBMI 1H7SA 4X62I 4FWGA 4JI3E 2Q2EB 2HHHI 2BM0A 3QT7A 1RR9A 4GKJE 1ZXNA 4AQYI 1ZM2A 4FN5A 2UXDE 1FKAE 4USKA 3T1YI 4B3ME 2XEXA 5BR8I 4OX9I 1XMOE 4JI1I 4YHHI 3WU6A 4LF9E 4Z7CA 3WU3A 4X62E 3PYDA 3WU4A 2HHHE 4EMDA 2ZBKB 3CWVA 1HNZI 2VQFE 4RPFA 4AQYE 1N36I 3LPSA 1XMQE 4UT4A 3T1YE 5IT9C 1NHJA 2ZM6E 5BR8E 1HNWE 4DR7I 5LL6R 4HYMA 4DV5I 4OX9E 4JI1E 3Q1QA 3J80C 3J81C 4YHHE 4DPYA 4WUDA 3T1HI 3PYFA 5LMNI 4FWHA 1EA6A 2HFSA 2EFGA 1FNMA 4DUYI 1B62A 2UUBI 4B3TI 5A2QQ 4LF8I 1N36E 2DEIA 4X66I 4DR5I 2UU9I 2NPFA 1N34I 4DV5E 3GONA 1ELOA 1Z0EA 4Z7YA 4JI0I 2HK3A 3ZZTA 1K47A 3K1JA 4KHPI 1NZ0A 5LMNE 4B3SI 4DUYE 3HULA 1IBKI 2UUBE 4B3TE 4DV3I 4DPXA 1I94I 4LF8E 3PYGA 1Z5CA 1Z0BA 4X66E 4DR5E 4LFBI 4MYUA 2HFUA 3ZZUA 4DXLA 4ZVIA 4DU7A 4JI0E 3J7AG 4HXZA 4B3RI 4KHPE 1H72C 2R3VA 4B3SE 4PRXA 3K17A 2AJ4A 1IBKE 2UUAI 4DV3E 4GKKI 3OTOI 4JYAI 2HKEA 4DR4E 3M6AA 1XNQI 1MG7A 4LFBE 4DUZI 1KIJA 2VQFI 1N33E 1XMQI 5FLXQ 4B3RE 2ZM6I 1HNWI 1IBLE 1KTVA 4X65I 1N32I 4K0KE 3F0NA 2UUAE 3LTOA 4LFCI 4GKKE 3OTOE 3H4LA 1NHIA 4JYAE 1WUUA 3B82A 1XNQE 4DUZE 3JAMQ 4LF6I 4P52A 1U2RA 5A2QC 4X65E 1N32E 4X64I 4UTGA 4YY3I 4LFCE 1Z5BA 1XHKA 2V8PA 5L3JA 2E1RA 2R42A 3D4JA 4LF6E 1RREA 1HNXI 2UXCI 5GMDA 4M1KA 4LFAI 1H73A 1PVGA 1FJGI 1NHHA 1UEKA 4X64E 3J7AM 4JG4A 4YY3E 1D6TA 4JI4E 2HKJA 1DARA 4DV2I 3QT5A 1BKNA 1J5EE 4LF7E 2UXBI 1KKHA 2LJPA 1HNXE 2UXCE 4USMA 4DR4I 1H74A 4DU8A 4LFAE 4NXMI 4JI5I 2A2CA 1FJGE 4URLA 1N33I 1KVKA 2UUCI 1IBLI 4DR3I 4DV6I 4DV2E 4K0KI 4DV7I 4PU9A 1FI4A 1QZRA 5FLXC 2UXBE 2V2ZA 4JI6I 1N0VC 4P7AA 5LMUI 4NXME 2DEJA 1MX0A 4JI5E 2HK2A
chains in the Genus database with same CATH superfamily
3M1VB 3VAGA 2CQCA 1Q7LB 1FO1A 4DR3E 4KR0B 3BM7A 3SBMA 2HURA 2D3UA 4QYZK 4FW6A 1V3RA 4LT6A 4NI2B 3AJ2A 2XI3A 3HKMA 3PFEA 4G1IA 3RW7A 5F3ZA 1U8WA 3HVTB 2VU5A 1OQ3A 8AT1B 2RKIB 3KK3B 1KN6A 5KT2A 4FYYB 4KY3A 2QZ8A 2DITA 1U1KA 2XGPA 5DDPC 4LF5F 1PYOB 3GJRB 1VRUB 5I42B 3BSCA 3D5MA 9RUBA 2JLGA 3I87A 3DLEB 2ZOGA 2DY9A 1H2VZ 3MOZA 3SEOA 2O5DA 1DTTB 2ZHOA 5I3PA 2EFPA 3TR5A 2GS8A 4FBTA 5IT9Q 2V8VA 2LEBA 3KXDA 4IZJB 1KONA 4WK1A 1A6FA 4WU2A 4U96A 1QDUB 4KFBA 4J9LA 4N5SA 2GFFA 1VQNS 3EMTA 4U7UK 3T1HE 3CSKA 5LL6d 2JDJA 2Z2YB 1Z2ZA 2PE8A 1U2CA 3V4MA 2JC0A 1RDRA 2XMAA 2ZZMA 1TL4A 2FZGB 2HS0A 5DZ6A 4HACB 4DV1E 1RISA 4ECVA 4DBQA 3AQOA 2LDYA 3HHLB 1GQEA 2PA3A 2HNZB 4Y2CA 2BANA 3UNYA 1S0VA 3OL9A 2HBRB 4ENOA 1H7UA 5LJ3Y 2GVDA 3HHNB 3X3UA 2BM0A 2MXYA 4A4JA 2QN6B 3W66A 2UXDE 3NWRA 2ATCB 5C0XA 1WOSA 4LR8A 1M5PC 4P71A 2IAJA 2QLBB 3WU6A 1NMEB 2JT2A 4O44B 1DRZA 4LF9E 2NS1B 2B4OA 3JB9k 5E3QA 4QWCA 1UPPA 4AL6A 2YNFB 2J7UA 2GC8A 5KFEA 4L74A 2OPRA 4DR1J 3LPSA 4W4MA 5IT9C 5LSRA 2BA1D 2I8EA 3LA0A 4HR2A 1H7WA 2XS7A 3FCHA 5IWAF 1ITPA 4JI1E 3M8SA 4KGMA 4MFBA 4X4TA 3KLGB 2VOOA 3LP0B 1U1RA 1Y60A 4N56A 3H2LA 5KFOA 1EA6A 1G1XA 1VBZA 2UUBI 4B3TI 3FKBA 1YJVA 1Q53A 4JV1A 1VRTB 1VCTA 5ETSA 3RZAA 4OYBA 1R8CA 3TNVA 3ENAA 3MAQA 3CNQP 4JI0I 3P76A 2WK4A 3PXGa 1RA7A 2AKWB 4F0MA 4GO5X 1X4DA 4NX9A 3T9ZA 3MTKA 4I64A 2F65A 4F4KA 1Y9OA 5L1JA 3TJAA 1L3KA 3K7RA 2UUAF 4ED2A 4HXZA 3MHYA 1NPPA 1RT2A 2ZH4A 4DX7A 1FK9A 5B0EA 8RUCA 2Z56B 4Y2IA 3SZ2A 1YX2A 2XWXA 4Y65A 2CG8A 2NUHA 1VBXA 3V6HA 3CEDA 5BR8F 2A18A 2EI5A 2MGZB 3QRPA 1GXUA 1IKWA 5HK4A 2VDIA 1XC9A 1NUEA 5B7WA 3K59A 5J1NA 4X66J 4OYXA 5K36F 3FK4A 1RTJB 3WDOA 2PSZA 3HFZB 1TV6B 3I0RA 2H4WB 1OYPA 1S79A 2DNGA 4TN2A 1R8PA 4U6PA 4MU1A 2RRAA 1QY7A 3UW1A 4URSA 1XXEA 3BGUA 4DS5A 3FUYA 4RWXA 4PKDB 3R5GA 1S6UA 4F4YA 2WB1D 1S76D 3PS3A 5HVHA 4R8UB 4ZJOA 2R42A 2LA4A 3A4TA 5I3UB 3B4DA 1S1WA 3MCSA 3DRXA 3D3CJ 1HYSB 1HFEL 3D0IE 4M1KA 2KM8B 3Q8VA 3EZ5A 2MZQA 2MKHA 1S77D 4YQWA 5H9FK 4QWAA 2HIYA 1OS5A 2VPZB 1S1TA 2YWKA 4YB6A 3L95X 4DR4F 1HBNB 4DV2I 5E3AA 1FHTA 1PJ6A 3QIPB 2UXCE 3W9IA 4TYAA 5C42B 2ILYA 1URNA 4DR3F 2I2YA 1FJGE 5ETRA 1HL6A 1JX4A 4FW7A 4RX6A 4IZJD 3W3SA 1NZAA 2V0NA 2NN6E 4A8SA 2MKSA 2V9WA 1WHXA 2QIFA 2VG6B 2KVIA 2OJ3A 1ZS6A 3GZ7A 1WF2A 5G4DA 4JI5E 1KDNA 1S1UB 4X65F 2YWHA 2JFKA 3TZZA 1RWNB 5EWFA 4DR6I 4DV6E 4RBTA 4HT7A 3C66A 1IQTA 1VQ4S 3LGHA 3TWZA 4WUCA 1AFIA 2LU2A 1V3SA 3G6YA 1O51A 1YRXA 3PEHA 4AXJA 3GPAA 2QTWA 4WFAQ 3HHLD 1DFDA 1TKDA 1IR1A 2HVZA 1EJ7L 1Y6ZA 4KKOA 3L7UA 3IR6B 1NSQA 3AODA 4P10A 1J5EF 4G3IA 2DYAA 2E7VA 1L3TA 3UE2A 1X4FA 4QR1A 2Z2ZA 3D28A 4NLXA 4KV8A 3OFFA 4X4UA 4LF5I 4ED4A 4FBUA 2PEBA 1EKRA 2VQEI 4DR2J 2DHAA 4FPIA 1K1QA 4ECWA 2APOA 1HHQA 2HVEA 3V81B 2MZRA 3R6LB 5GAHI 3H90A 2FC9A 2G0CA 2HAFA 1X4HA 4FDFA 3LOUA 4AM3A 3ZFVA 4M95A 1R0AB 4X2BA 3MM9A 3P3GA 1YBUA 2CZ4A 3KHLA 2LEAA 4WFXA 3I82A 4WZMA 4NA1A 4FW3A 4QU7A 2C39B 4O4GA 4JV5F 4F4XA 2EW9A 2DD8S 5FJ4A 5J2QB 2KT3A 5CA5A 1X8DA 1X4GA 4LF4F 4OHWA 2RF2A 1CBKA 2C3UA 5A8RA 1E6YA 4A8WA 4Y3CA 1UVJA 3MM5B 4USKA 2D9OA 4DV0F 4DOZA 1WKJA 4ZCLA 2B4UA 2K1RB 4YR2A 1XMOE 1HNZF 4NXNJ 5AE2A 5HQLA 4ECTA 1UTAA 1ZPWX 2W2NP 4KHPJ 1W25A 2VQFE 4NYZA 1NK0A 2V67A 1J5OA 1WEZA 5ETVA 1YHCA 1BQMA 4DMZA 2AYMA 3HJVA 5CXTA 3S6EA 3IWLA 1QAJA 2Z5CA 4DPYA 3I5CA 3CDIA 2CPIA 4LRFA 1S1VA 3C16A 4QZVB 2HFSA 2W4CA 3KG4A 2F4VF 1JXEA 1MWZA 3CMQA 3H59A 2OPSB 1N36E 2YWEA 5HQMA 3RTVA 2YNHB 1S6QA 2R7OA 4QR0A 1T3OA 3EVWA 4ZPDA 2AEFA 1XMQJ 2ZM6J 1HNWJ 4PRFA 4PCQA 4N8NA 2F1FA 1QE1A 4HYKA 1K73T 4ICLA 4NEYA 5F9NA 4YHHJ 1CC7A 4DR5E 2VPXB 3HHDA 3IO1A 1S59A 4F3MA 2XNRA 3EDQB 4CNZA 3K5MA 4C3KA 2OSQA 4X62F 4K4TA 2UUAI 3SCJE 3OTOI 3PX4A 1RWWB 1I1GA 1IM4A 2DNLA 4Y2KA 1X4BA 4Q45A 4USWA 2MZSA 2VONA 5LOQA 1N33E 1S9FA 2XC9A 4IFVA 1XBWA 4FF3A 3OL6A 5FLXQ 3FBCA 5DG9A 4PYAA 2PNLA 4PR6A 5D4LA 1KTVA 4CTAB 1X4EA 3H2UB 4LFCI 3I56S 2VIHA 1SKUB 3UNGC 4WYWA 4JYAE 1NDKA 1S1XA 4ZLPA 2WVBA 3CD6S 3WHIA 5D4PA 3NGRA 1EQMA 3CXCR 1OPZA 2QFIA 1W7WA 4XIUA 2BR0A 4P6QA 4OL8A 2B5JA 3QATA 5ELWA 3I32A 2VC1A 1N32E 2AW0A 1AZSB 1BD6A 1BQNA 4OHVA 2GNKA 2B4VA 4I68A 2UXCF 2QL5B 4OHXA 3MGJA 3UI3A 4F04B 1TL3A 3CDEA 1TELA 1U7LA 1FX2A 3M1VA 2AEMA 4DZDA 2BDPA 1Q16B 1XNQJ 2NN6F 4IFDC 2HZCA 4OZLA 1NJWA 1ZBTA 1D6TA 3OL8A 1SJ3P 3O3LA 3DOMB 4LSZB 4NI2A 4WKRA 3R6GB 4B17A 2HQGA 4DR4I 3O5TB 2FVSA 3P5BP 2VJVA 3HVTA 1YRUA 4YB1P 5LM7E 3Q8SB 1FF2A 2RKIA 1GMVA 6FDRA 3DD6A 5L39A 4DR3I 4AE5A 3IBFB 1NO8A 4CIOA 3ISND 2Y0SD 5I42A 5T7LB 5FLXC 2KB2A 1RCOB 3DLEA 4RBVA 2FY1A 2V9KA 4F2RA 4LOMA 1DTTA 2BQRA 2ZBCA 2WHOA 3I5AA 3MR3A 2OPPA 3GILA 2UUCE 2ZWPA 1F5AA 3SV4A 1L3SA 4IFYB 4IFDB 3P45B 2EBGA 1VIXA 2BOAA 4RW9B 5A76A 2YPZA 3QT6A 1NJYA 4HVZA 5EKWA 4TVAB 3GCWP 2KJVA 3OQ2A 3PZPA 4DCJB 1M5KC 1XNRE 4Q5VA 3MZIA 3TX8A 1Y5LB 4CLYA 1BMQB 4HACA 5D3GB 1J5EI 4DV7J 2XMVA 1SV5B 2IRXA 2HNZA 5AJ3F 2G1DA 3GV7B 2CNOB 2JL9A 1UVKA 4I6WA 2G2OA 3BPDA 3T5LA 1EHWA 1Y00A 3ILOA 4M5IA 3CPWR 1F2GA 2DNMA 1U49A 3D6MB 3G86A 3O1LA 4DR7E 2IJNA 4WKYA 4DV1I 5CD4H 3FMBA 3Q86A 1Q0NA 3CJ2A 1FTCA 1JLQB 2ZBIA 4RUBA 5MAOA 4O44A 2B7CB 1ROFA 3QJLA 4R1FA 1VISA 2YNFA 2MQMA 3NY0A 4GVBA 1M1KT 1LV5A 1KLNA 1OMSA 3OVSA 3GJQB 2AZ3A 4P9SA 5L8RC 4ZVUB 2UXDI 3KLGA 3LP0A 4UZBA 1SJ4P 1NB7A 2MTLA 4LF9I 1H6KX 3TO8A 2GMHA 2Q2EB 1FDBA 4PWDB 4L76A 3KHRA 1AT1B 1VRTA 1RR9A 4GKJE 4DSEA 1H0HB 1WORA 4NYPA 4FN5A 5JXSA 2LKZA 1WI6A 2FLNA 1SB6A 4DQPA 3SFGA 4WXWA 1TUVA 1SIZA 4JI1I 2BJ9A 4Y2MA 4DL0C 2F1DA 4DL2A 4RW6A 4QIEA 2KRRA 3RW6A 4F0KA 4L3NA 2DCLA 3KUHA 2DHHA 1HNZI 5HAOA 2QLWA 4JI3J 2EK1A 4M5HA 2BW2A 2YWFA 1YITS 2XY5A 2M7SA 4K4XA 3MMAB 2GJ2A 4RNHA 4DR5F 4B3MJ 1N34F 2QT7A 3AA8A 3PO5A 4HI1A 4C2MA 3IGNA 4K59A 2MGZA 3Q22A 2XYGB 2WCXA 1IR2A 3GONA 3C6UB 4TQRA 4EBDA 2ZFHA 1H98A 5GADI 4K4VA 4CH1A 1K47A 2AJFE 2GJFA 3J81j 1MN7A 1TV6A 4MU3A 4HHHA 2AZ1A 2KG0A 4DUYE 4EFAC 5K36D 3OTEA 4WE1B 5KFSA 3L7PA 4ZVPB 4WFBQ 5KFVA 2G13A 3VGTA 3BQ2A 2L41A 2LA6A 4TNOA 3PRYA 4U67Q 3RBEA 3MMJA 5CCLA 4QIFA 3HFKA 2E7WA 3CD5A 4M5JA 4NOHA 1S9GB 2FZCB 2VC0A 4XPEA 2B7BB 4R8UA 4ES2A 4TYBA 4AQYF 4DV3E 3CJ4A 1N88A 4PQAA 4H4MB 5EX3A 3CD0A 5I3UA 5AE3A 4RBUA 5DG7A 4ILRA 2MZJA 3BS9A 1N32F 5HATA 4LF8J 2N7CA 3W5YA 1IBLE 3HFVA 3MMBA 2RUSA 3ISZA 4QWBA 1TL1B 1HBNA 3KUEA 4DCPB 3QIPA 3W7BA 2ZC3A 5C42A 2EFOA 1KSPA 2DGXA 4P52A 1Q5YA 4MKAA 1UDNA 4NASA 5LMNF 3NCRA 3P96A 4A46A 3BPSP 2DXDA 4KIAA 1Y5NB 1V5VA 3W61A 4R25A 2VG6A 2CXEA 4UY8T 1VS3A 4LRDA 4LF6E 2UXCI 1S1UA 3CCWA 4ELVA 1FJGI 4C48A 1IBKF 2HGNA 1R8BA 2B9EA 4LFBF 4CQ1A 2YX7A 3OUYB 4LF2A 2GQCA 2W25A 3SYZA 4F26A 4DFMA 2QA4S 2KXHA 4B3RF 3UN2A 4JI5I 3LUYA 4P74A 1CS4B 2AD9A 5ETTA 3P6YC 3D6TB 4DV6I 3GIMA 2ZJPQ 2HSEB 2V2ZA 2FJDB 3HT3A 2DNPA 2PO0B 4P7AA 3CB4A 2DEJA 2RS2A 3Q8QB 1KR4A 2J0SD 1L3VA 3QSIA 3J80Y 4LF5J 1KQKA 4QYZJ 2BA0D 3V81A 3AXMA 3ZO7A 4KO0B 4A8KA 3U1KA 2CPJA 1TKTB 2QG9B 1V3ZA 2O3DA 3Q23A 1U45A 1DJ0A 3D67A 4RWWA 2W24A 4CT9A 2HNDB 4RU2A 5DJBA 2Y8YA 8ATCB 4CYUB 1IKYB 3GV5B 2FPHX 1HNXF 1S0NA 1KNZA 1WNEA 4WP9A 5DS7A 4ETZA 2JHEA 4USVA 2C39A 2HEKA 4IQXA 2ZH5A 3H5YA 1JLCB 5J2QA 2RHSB 3VHQA 2IERA 2WNRB 4YUDA 3RG6A 1MROB 3GJSB 3X1LB 3GP9A 3BQ1A 3MM5A 4I6AA 4EK2A 3LH2S 5C0XE 4TY8B 2A2DA 1TAUA 1PYTA 2J0QD 4RLEA 4ZVGA 2KJWA 4GKJF 4OX8A 4OO1F 1RWMB 3FZ2A 2AX1A 1W2IA 3G2XA 5LMUF 3NGUA 2BKPA 4O3OA 3Q8YA 2Q43A 2V8DA 5IC4B 5KFWA 2XLIA 2GO8A 3KYLA 1ZPVA 5B08A 4HDGA 3ITHB 1GX6A 1XMOI 1R43A 3QAUA 4DR1E 1MNEA 1EKSA 1WOOA 4LBIA 2KT5A 2K7KA 5KG6A 1YKWA 1C0TB 2PNZB 4FPRA 5IWAJ 5DRPA 3FNNA 1B64A 3W2WB 4IRDA 1PAUB 3ONQA 3M6VA 3QLHB 4ALZA 1PJ5A 3M2VB 2AJQA 1JJ2R 1BE4A 4RUCA 4MK9A 4K50A 2ZD1B 4OZ5A 1Y0HA 1UFWA 4KPYA 1LWXA 4B9LA 1ZOTA 2JVRA 1N36I 4WXOA 3N5FA 2DXFA 5LL6R 3MDFA 3T3FA 2YQ1A 4DUYF 3M8PB 2PO1B 2QLXA 4O3RA 4ZP6A 4FWHA 2ZH1A 4O4RA 3R9LA 1S4FA 4NCGA 2UU9F 5HMWA 2QV6A 3UPFA 1JK9B 4EEYA 3R5AA 3C19A 2HLUA 4DR5I 1VK8A 1EETB 4OZEA 1H38A 1N34I 1VK3A 1FE0A 4DV3F 4CTAA 3MECB 1RTIB 1I94F 2EC2A 3PX6A 2IVYA 2OSRA 2POKA 1TTHB 5BR8J 1HA1A 3BB5A 2OEKA 1RT5B 1VQOS 4M5NA 4ZK7M 4X66E 4CLWA 2BW7A 3AOCA 4W92B 4OX7A 1IBCB 1HBUB 1YJTA 4RUAA 2OHDA 1YH8A 1AZSA 1KVIA 3FBBA 2R8JA 1RT6B 1O0PA 2N7YA 5E33A 4JYAI 2RSQA 2HKEA 2YH0A 4CT8A 4I2QB 2XLJA 4XDCA 3L9ZA 1UDSA 4ANEA 3PO4A 3BSOA 3DI6B 2VPWB 1TFYA 2LMIA 2NN6D 1N32I 2I6WA 3PACA 3DOMA 3ZNJ1 4LF6F 1MSWD 1WUUA 1A7GE 4DF8A 4DV5F 1DLOB 4L72B 1NPRA 1UWBB 4O0IA 2DJWA 3AHPA 4UOGA 4YS2A 4DR4J 2X1FA 4J9MA 3TUZC 5K8OA 4U7CA 4QCLA 1QUPA 2WZ1A 4PQUB 2AV5A 2PO2B 2BE2B 5T7LA 3DLHA 4CM0A 4DR3J 4R0EA 5DETA 3W63A 4BWMA 5GMDA 3MTJA 2W2MP 3OT9A 5E3PA 4W90B 2B8QA 4NLOA 2XM3A 3M6WA 4NCAA 3LW5C 4IFYA 4IFDA 2HBYB 2EVZA 1P9QC 3P4UB 3VTIA 4ILLA 4Y34A 4OZ2A 4C8ZA 3WC2A 3TZWA 4RW9A 3IR5B 4X65J 3OFHA 4OV6A 3GSIA 1WEXA 2U1AA 3NP5A 4G65A 2MMYA 1NSKL 1XR7A 3U27A 4K0KF 4EZ9A 2XS2A 4KC5A 3CCVS 2UUCI 3NCPA 1M90T 3W8GA 2E1PA 3PKYA 1RAOA 1F9EB 2A10A 1FI4A 1JLFB 4DG1B 5D3GA 1UW9A 1WF0A 2O1TA 2WTFA 1SV5A 4TU9A 1J5EJ 3BDEA 3TZXA 1T05B 1LW0B 4PXBA 1XNRI 5D0RA 3SQOP 3EE3A 1U26A 2HQIA 4DR2E 2ZE2A 1DHMA 1WC5A 4DFKA 1JLQA 4X64F 3ZZ0A 3OLAA 1OYRA 2CVIA 1D8ZA 4TKTA 3PYEA 2IYGA 1XEZA 1HWUA 2XB2D 4NRTA 1EI1A 2ZHAA 2UZAA 2Y3YA 4DSKA 2V4JB 1GXLA 2EXUA 1Z0CA 1U1PA 3KHHA 2P6TA 3I0SB 2RJZA 2KL8A 2GVZB 4OQJA 2J6TA 5KFBA 2PNMA 1AUSL 1REVB 5SUHA 3RB0A 3E3XA 1Y4ZB 3PS1A 2ROEA 3HCXA 5IV4A 4HKQA 4PWDA 1PIEA 3AD7C 4KPCA 3TEHB 2BEFA 2HBZB 1B7FA 3W1YC 4JV5J 1RACB 5KFHA 1Z0VA 3SCLE 4CLPA 2W4PA 3ENVA 1WHVA 1RABB 1OJ4A 4LF4J 1NSPA 5K8NA 2WW4A 2P9CA 3ETOA 1X0FA 3V4IB 4ILMA 4OZNA 4QJVA 1L3UA 2H54B 2DR6A 4DV0J 3QT8A 3I4HX 4XPCA 4GKJI 4NXNE 4FP9A 2V5HG 4OJ1A 1HNZJ 1UZHA 1JKHB 2BR2B 2H5IB 3MMAA 4DEZA 2KFYA 5HLFA 3UN5A 2A1BA 5KFNA 1B0TA 2W8KA 3R2DJ 1U8SA 4O3QA 5IS2A 2FJXA 4OO1B 1CJKB 3HSZA 4I1TA 2FYXA 3CWJA 3P06A 1WTFA 5G0RB 2XEXA 5CZXA 5LSLA 3QNWB 1HNVB 2XO7A 2E5LF 2F4VJ 5J2PA 2HFVA 2ZKUA 1Q7YT 3L7ZB 2L08A 3DOKB 4WE1A 1R7IA 1JJ4A 4JV2A 4G1QA 2IOPA 3DFEA 3G6XA 2CJXB 1XMQE 2AF6A 2ZM6E 1C1BB 1HNWE 2Z4PA 2GGPB 2VV5A 2OD6A 4DPOA 4LVOP 4EBEA 5DLFA 3HLUA 3Q1QA 4YHHE 4WUDA 2AGQA 1K8AT 3CMES 2LQ9A 3HD1A 4DUYI 1YRTA 1AYEA 2RH3A 2J9CA 1WKLA 2UU9I 2NPFA 2BMBA 5A8WB 4X62J 2R9LA 4DV4F 3AA9A 1DQAA 3DDNA 3ZZTA 4JI7F 1TL1A 4DFPA 5L1IA 5LSOA 1RWXB 2QE5A 2ATLA 2HRUA 4DV3I 1I94I 4CRJA 2AIRB 1NLKL 2X1AA 2Z57B 4NA3A 3Q8PB 2FHJD 1JJHA 4WYLA 2KYXA 2J9EA 3LALA 4ZVIA 1VQPS 1H72C 3AQPA 2NQPA 5BXIA 4ZS6A 5KFGA 1QAIA 2GQ0A 1U48A 1U0SA 2ZBQA 1NHKL 4JOUA 1Z2LA 2G0JA 3CDWA 4N7TA 4TLRA 4OX6A 2Q79A 3GR0A 4M63A 4F7VA 2ZNZA 3RUBL 1U1NA 2UXCJ 2FIUA 2R7VA 4IS9A 3H4LA 4CO4A 3B82A 3NG8A 3JTPA 1XNQE 3OUYA 3CUNA 4LF6I 2BE9B 3TAMB 3MM7A 2MJNA 4IDKB 1B0VA 1CS4A 3DU6A 1NDCA 4O3SA 2HVDA 4OZ0A 2PO0A 4FXVA 3IM8A 1VFJA 5HROB 3IMQJ 4CLKA 2VODA 3OFEA 3DYAB 4KTQA 1TVRB 4MDTA 2V69A 2C2OB 1NHHA 1YJRA 2YX1A 1C2PA 1DTQB 3Q6MA 5KT5A 4ZPWR 1F60B 3C15B 2F8EX 3K5LA 4ECQA 4IG3B 2PMZD 2LJPA 4CH0S 4LCHA 1F2HA 2IA0A 2HNDA 3RAMA 4QNKA 3OR2B 4ZVTB 2QMXA 4B9UA 1UCNA 4N77A 4ZJQA 2PEHA 3UDCA 2LQJA 4CYUA 2CJAA 3EGVA 1IKYA 1WHWA 4K0KI 2V50A 5CZVA 4E8UA 2DT9A 3LP2B 2NCKL 4EUVA 5DM7Q 1VRQC 2VOPA 3HZEA 2Z2LA 2HK2A 2Y1LB 1RSCA 3GIIA 4HHJA 2MSSA 4ZA1A 7FD1A 2WNRA 2UVWA 4M5GA 3V6DB 1ACMB 1MROA 3GB0A 4DV7E 3UCGA 5AJ3J 1NKEA 3DRSB 2H48B 5IQQA 2C2RA 2XY7A 2J7KA 3ILLA 3I6PA 2KKHA 1FVSA 1HK7A 2MKCA 3KLEA 1B70B 4FW4A 1XQIA 4LF7F 1HMVB 1NHVA 3E01B 2OMLA 4OO1D 4ECRA 4FS1A 2WBMA 2PA8D 3VQTA 2M8HA 4ZLLA 3H42A 5K5MA 3FEZA 1C0TA 3NNCA 3D68A 2PNZA 3QMQA 2HHSA 2G9OA 4LQ3A 3K5PA 3UD3P 1C4AA 3MR7A 2GAHC 4N47A 2VDHA 3QLHA 2FTRA 1HHTP 3M2VA 5LJ5Y 2HPUA 1JMTA 2ZH6A 3RGIA 2BM1A 3KHGA 1PCAA 2ZD1A 3VV2B 4DR1I 3HSJA 1TQLA 1JXLA 3TVKA 4ERDA 3K5OA 3PRBA 9ATCB 4AFFA 2EEYA 3OHAA 1MU5A 3VAMA 4CLSA 5U47A 3QFHA 1X9WA 2V2VA 1QAYA 3M8PA 4G1PA 2PO1A 4MFBB 1IN0A 3C8YA 4UOHA 2FQQB 4DQRA 5K8PA 3NBPA 1VMBA 4JI3E 3DLJA 4WZQA 2XMMA 1FJ7A 2V8GA 4B3ME 2XBPA 1DZ5A 1RTIA 2J9DA 1IXKA 2IOQA 1N34J 4QPXA 5F3TA 1RT5A 3K8VA 3WU3A 2X1BA 2ZHBA 3LGNA 1BWEA 5DLGA 2RDIA 4MH8A 4MT1A 4P7TA 2RNEA 1HBUA 2DPJA 1D9AA 2VUGA 2KI2A 3H2VE 1NAQA 1RT2B 3VQSA 1RT6A 4UQTA 1GK8A 2OEMA 2BJ7A 2IC3B 1FNMA 2DISA 5B0CA 1TP7A 4DFJA 2PT0A 4I2QA 5FLXY 4JP8A 2JOQA 4X66I 3CCLS 3H8YA 2Z5EA 3MUTP 4IG0B 5IC6B 1OY8A 3TX0A 2XG8A 4AQYJ 1NK6A 3KK1B 4X4NA 3FEXB 2E1MC 5KFQA 3MXHP 1USVA 5K9FA 1C1CB 4LF8E 4CLTA 4HDHA 4I56A 3FBFA 1DAXA 1DLOA 3LAMA 3CO9A 5H9EK 2DNOA 1UWBA 4I69A 4FYDA 4DXLA 4CZCA 1IJFB 4UF4A 1T94A 1X5PA 4B3OA 1AFJA 1T8EA 4PQUA 5DZ7A 1RLDA 2BE2A 4JV0A 1CULA 1LXNA 3R1LA 2ASLA 1EAYC 5ETLA 5LMNJ 4ZVRB 2MY8A 3IN5A 1HARA 2GQ2A 3GG0A 4FKYA 4LRAA 2JX2A 2WONB 4ELTA 3C46A 3DGVA 1AW0A 2W4DA 1ZETA 3A3PB 3EUNA 4NBQA 3ZTRA 5KFMA 2I9SA 1CSJA 1W26A 1IBKJ 2W9BB 7FDRA 3FRZA 4LFBJ 4C3LA 2XY6A 1X5TA 4BC9A 4ECSA 4DG1A 1JLFA 2PO4A 3GYGA 4B3RJ 1NB2A 5DROA 2CJKA 3QIDA 3LPEA 5FDLA 2FLLA 2HNYB 3KUGA 1RCXB 4F36A 5AXMA 4HTIA 3H0PA 1BGXT 1T05A 1LW0A 2DCUB 1ZTTA 5HI7A 1RE1B 3QJJA 2NXUA 4ZDNA 4PPZA 2GQQA 4BA2B 1MLAA 5JEAC 2G0IA 3HF5A 4USMA 4J9PA 4WFYA 2EC0A 2DB1A 4USJC 1SH2A 2BOPA 3D1QA 4I0WA 4DV7F 1N4LA 1FDNA 2N4DA 1IKVB 3SQGB 4CLZA 2CPDA 2V4JA 1TZ0A 1PSDA 4K2JA 3I0SA 4ZVQB 2GVZA 3KLVA 2IJRA 1XTZA 1CJUB 1Q5VA 2DH9A 2C28A 6AT1B 2RS8A 5C0XD 4WU3A 1REVA 2VFTA 2V2QA 2A0FB 1BWVA 3N01A 4TU7A 3IBCB 3Q0AA 1Q8KA 5I4MA 3QJPA 1HNXJ 1E3PA 3SSQA 3PW2A 3QSYB 2VG7B 5F8IA 1X4CA 3BEGB 4C0BA 1B63A 5JEAB 4OFZA 1F0XA 3NAHA 1UA1A 1YDLA 1HBOA 2UXBJ 2H4YB 4B08A 1Z0GA 3LNUA 1KEKA 3V4IA 3Q2SC 1RHKB 5F8LA 1CLFA 2DR9A 2UVUA 1VJQA 2ASJA 2DNYA 5L1LA 2E66A 2CRLA 1LOUA 3OBIA 1R6LA 4LF7I 2PN6A 5GAHU 1JKHA 5F8JA 3HKWA 1S5ZA 2BR2A 5DDRC 2YBVA 4WPAA 5LMUJ 1WHYA 5KG0A 3GYXB 3B78A 4IR1A 1GMUA 1W2BR 2H9ZA 3BJYA 2AE8A 4BA1A 2MDAA 2RF2B 1UP1A 1N5QA 1OY9A 2F8MA 5G0RA 3NMRA 2EWHA 4NXNI 4J90A 1HNVA 2RQ4A 4DPTA 4DL3A 3M32B 3R5CA 3LO3A 4JI3F 1P42A 1X5SA 3L7ZA 3DOKA 5IWAE 3JAMY 2E44A 3LPYA 4LR7A 2VZ9A 4Z37A 5KG3A 1F3VA 4B3MF 3EGWB 1JLEB 2H3EB 2K8GA 1C1BA 1J5OB 1BC6A 2GGPA 1LKZA 2HVIA 3B4TA 5D0EA 1U25A 4K5SA 3MEDB 2OLWA 4OYMA 4OYWA 4PG8A 4HH0A 2XCPA 1R27B 1ZYQA 4DI6A 1ZAVA 4DUYJ 1GTEA 3IG1B 4U8VA 5A8WA 2FHKA 2JFDA 2RT3A 1FERA 2ROPA 1VC5A 2ZJQQ 4OI2A 2UU9J 3CC7S 4YHHI 5LXYA 5KT4A 4NZ0A 3PJXA 3TVZA 4IRKA 4U3BA 1R89A 2IRUA 3RJMB 1VQ7S 2HWTA 2FLPA 1I94J 5E7OB 2KZMA 5BR8E 4HYMA 1YJUA 3MPDA 4JI2F 4S0MA 4Q8EA 3THTA 4OI0A 4NLTA 2GCFA 1FFGB 3MEGB 1BXNA 5KG5A 2JEBA 3UD4P 3KDNA 2M5YA 3P3CA 4KAIA 3I9V9 2E5HA 4K2XA 2ZH3A 3NL0A 4KYZA 4ZPCA 3TRGA 2NR0A 1D9FA 5ADZA 3U1YA 3A13A 4QQBA 1TK5A 4QNJA 4DPXA 3IWXA 2DNHA 4AIDA 2IDEA 3ZTQA 1RAHB 3BREA 3MUVP 3BO4A 3SDEB 1RHJB 3TAMA 1UETA 5HJXA 2CJ9A 3K5NA 1YQHA 4LF6J 2J7WA 1PBUA 3HMJG 2HHHF 1BQNB 3Q2TC 3E51A 4DV5J 4OMFG 2GIFA 4IZKB 1S72S 5HROA 3T1YF 4DR4E 3GFHA 1XNQI 3T1AA 3GQCA 1TL3B 1V9OA 3DYAA 5DDOC 3NWGA 4Q43A 2RQCA 1TVRA 2BZ2A 3QZ7A 2E5JA 1S99A 1DTQA 5IOLA 4MK7A 1T9YA 4IFDE 5F8HA 4HH1A 2HRYA 1WELA 3C15A 2R7WA 4IG3A 4KSEB 4ANDA 3MCNA 1K1SA 1TL7B 1TAQA 2HGMA 3UCUP 3OR2A 1Y5YA 4O3NA 4DUTA 4X65E 4DX5A 2ASYA 2MKKA 1N5VA 1XHKA 2VD3A 2BRKA 3CCTA 5LXRA 3GFYA 3EXCX 3LP2A 3JQMA 1FNXH 3D4JA 3M7ND 1U4BA 1WC6A 2M2BA 4K0KJ 5C25B 2CNNB 1NM2A 3BBBA 3TUIC 4NYOA 1FRIA 4WK3A 4WBFA 2C1EB 3PJ9A 2OPPB 3W5ZA 3MPWA 1T03B 1UKUA 2V2KA 3V6DA 2XMKA 5SZTA 2VESA 4WF9Q 1J5EE 3RR7A 3BGOP 3IAM9 3DRSA 1LEOA 2HBQB 2IMWP 1SKWA 4ES3A 2YKPA 2IPOB 2OH2A 1HMVA 2NZ4A 3TANA 1FEEA 1RBAA 3E01A 4DV7I 4PU9A 2ZC4A 2VJUA 4F3QA 2ZDOA 4X64J 5HMZA 4OHZA 4MU4A 1WD6A 1LFPA 1QLNA 3T19A 2DK2A 3EYZA 2M0GB 2OFHX 2AEJA 3OJSA 5BYQA 1Q81T 1RHRB 1NSAA 2E5IA 3PHEA 2CWXA 3CO0P 3UDEA 2CQ2A 5E5NA 5GAEI 1EIYB 5D78A 2IFXA 3TAPA 5HMXA 2BRLA 3MAHA 3HI9A 1K0TA 4JV5E 3G87A 4GVBB 4LF4E 3DHWC 3TOQA 3FSXA 2XMWA 1AA1B 1FRMA 3O2IA 2RU3A 3JTNA 3QGHA 3OL7A 4DV0E 1S6PB 4LR9A 1WSVA 4WCEQ 4NE9C 4X4OA 2K2PA 1HNZE 2F9DA 2RB7A 4NMLA 2EKYA 4DN0A 1UJ5A 2ZZTA 3BKFA 1X9MA 4OJGA 5KFPA 2DGVA 3MFIA 2MQ8A 1Y5IB 4KJIA 4QIWD 4CM2A 3HSGA 1HR0J 3PW4A 1R6VA 3IA0A 4USHA 1JJCB 3D9BA 4RW6B 2R4FA 3TVYA 4JI3I 2XTJP 3OSNA 2F4VE 2E5LJ 4C8MA 1LFWA 2NXJA 3M8ZA 4B3MI 5KAKA 3KWMA 1UL3A 4EO6A 4J9QA 1WDDA 4LCFA 2IC3A 1HI0P 4B9NA 4C8KA 2V94A 3UVJB 3ZNUA 1M5SA 4IG0A 3ULHA 1CPZA 3OLBA 4DWIA 3KK1A 2B43A 2QO3A 2IVFB 4ZVSB 3D66A 1S0OA 1C1CA 4X62E 2RQKA 4E0DA 2AJ0A 1FXLA 1ZAWA 4DV4J 2D3OR 3CGIA 1MMDA 4JI7J 2X51A 1IR0A 2AU0A 4F25A 5GADU 4NLDA 3M6XA 2WSFC 4NLVA 2NYIA 2OKQA 3RB4A 1RHUB 4CO2A 1I5OB 4LF8I 1LK5A 2Y8WA 1VGYA 1M5OC 4GVLA 2VBZA 2GJIA 2WONA 4ETXA 3MMBB 2QSFA 2G2YA 2V4QA 1ZA2B 1NBEB 4AD6A 1SQGA 1RTZA 2QA4G 2W9BA 1ICEB 3EZUA 2N4CA 4LRBA 3KKFA 4IFDF 2BJDA 2M8DB 1V5IB 3K17A 3NCQA 2JEIA 3ICLA 1OSCA 1X5OA 2OMOA 2HNYA 3CJTA 3H25A 2D1CA 4J9UE 1MG7A 1HWKA 4QW8A 1S49A 4DQSA 3J81Y 3KG1A 4JBCA 3K89A 2K7JA 3FEYB 5DQHA 2HQ3A 1KQFB 2AGPA 2AMCB 4BA2A 2JEGA 3R3TA 2BYCA 4F4ZA 2IJFA 4Y6IA 3JAMU 4ED7A 2ZOFA 1U02A 4J7CA 2R7TA 3M6UA 3RU0A 3SQGA 1IKVA 1T9XA 2IM1A 2GHPA 2DTJA 2Y9HA 2W1BA 2CQ0A 1YSJA 3CCQS 1CJUA 2CQBA 3VAIA 3JXOA 2R8KA 3NS5A 4PG4A 2C3MA 3GR1A 1VC6A 2L9DA 1PVGA 5ETKA 4JG4A 5KFCA 4USTA 3IGVA 3ETMA 4ECUA 3JSRA 1HKAA 2VG7A 2QYGA 5JEAA 2MLZA 2BVZA 1SPBP 3JSMB 2Q3PA 3P3DA 4BLGA 1RAIB 3FJ2A 4P7VA 3HZGA 1UA0A 3NAIA 5AXLA 4DUZF 3CJ5A 2ZH9A 3N28A 1SJRA 1FRLA 4UUWA 1U0HB 2R2RA 2Y0BB 4LIWA 3PRVA 4NXME 2Z30B 4JUZA 4A8MP 4LF7J 4HY1A 4RUHA 2ROGA 1Z0TA 2CPEA 1KHVA 3OV7A 1RP5A 2QMUB 4A8XA 4LFAJ 2QLJB 2ACYA 2FHOB 2HIQA 1KWMA 3S01A 5A6PA 3ZZOA 2LEPA 2KHDA 2MY7A 4ZCMA 3TP2A 1M5HA 3NEKA 1FWLA 1RGVA 3M32A 5H1SV 4LSNB 1SJFA 1QTNB 4JI4F 2HQCA 4RW4B 1HQEB 3VF0B 2HS4A 4Q0BA 1PBAA 4FF4A 2Z2MA 1S16A 3GFZA 3ZKBA 1JLEA 2K3KA 4OV1A 3AH6A 2OI2A 2LCWA 3KOAA 1JB0C 2DY1A 5K8MA 2KTQA 3MEDA 1NK5A 1HIYA 5IWAI 1ZTWA 2BACA 1YJWS 2FHMA 1RTDA 4DPUA 3RRGA 2XZWA 1VQ8S 4ED6A 2AP6A 3IG1A 4ZIVA 4MU0A 2CZ9A 3JQJA 1RAFB 1G4CA 2C2MB 2OEJA 2FC8A 2J9DE 2MPUA 1SC3B 3HX9A 5GMEA 2ZDPA 1KHWA 3V5RA 2BBEA 4JI6F 4H54A 2XZDB 4I7FB 3HSDA 4ID5B 1USUA 1PJ7A 5KFRA 1N34E 2W2PP 3R5BA 2OUGA 2DR5A 2AQ4A 4F4AA 1WJ9A 3R8YA 1IBMF 2HFZA 5C24B 4PWUA 1KFDA 1FKPB 4FVMA 4QYRA 1JNRB 4NCGB 3MEGA 4X4QA 5KFJA 2HQFA 4A8YA 4MTPA 5DDQC 1ZXNA 1N54B 4Y28C 3BGRB 3C2PA 2JE6A 4RO0A 2XS5A 4DJBA 5BR8I 3AY0A 4UZCA 4MQYA 2F4FA 4F3OA 4P2MA 4ZKAA 2XSFA 3N6LA 3DRPB 1J27A 3KFWX 3PS2A 3O8WA 3NGKA 1EZZB 2ZBKB 2FY8A 4OZ1A 3TJ8A 3T6JA 4AQYE 1JIHA 4YP3A 3SDEA 3HKZD 4HT5A 3M30B 3HT0A 4OJHA 1FKOB 3MEEB 5KFKA 2C42A 4KH1B 1WTBA 4F50A 1SQFA 4BBYA 4IZKA 3OTCA 5HANA 4FYWB 4ECXA 3BGFA 4MJKA 1VC0A 1YJNS 4J9VA 2DH7A 4Z7YA 5K14B 2HVHA 4LIRA 2GW8A 2PMWA 5LMNE 1Y3JA 2E9RX 1H3DA 3ENWA 4DN9A 1TL7A 5H9EJ 3CULA 1H7XA 3CE8A 2WW8A 2I5JA 1QUVA 4W98A 4UW2A 3J7AG 3VAKA 1VQYA 5ITHA 3D54A 1FRXA 3LAKA 1FFWB 2LVWA 4URQU 1IBKE 1UW4A 2YQ0A 5C25A 3BV8A 1RT7B 4LFBE 3G8QA 1FJCA 3BKUA 1IQZA 5DNXA 4OLPA 3NOCA 2MKYA 2LECA 3H98A 3FBEA 4B3RE 2RQMA 1T03A 2J65A 3C14B 3OXGA 4X65I 2D74B 5EWEA 3S8SA 3D0GE 1QSLA 4URGA 3G4SS 1SUQB 4L73A 5D4OA 1A0OB 5B0FA 2PIIA 4ANCA 2AX0A 3MMCB 1UFLA 3GIJA 2DHXA 4WTOB 4GC7A 1BHNA 2L9WA 4J9OA 2CPHA 1Z5BA 4V19X 4HTJA 4PZVA 4OI1A 2WSEC 3K2YA 1EB0A 4Q2LA 2CFXA 2CYYA 4FNIA 3W9JA 1RREA 4JI0F 5DRQA 1RXOB 2VG5B 2IM0A 1X9SA 2GZOA 2W9AA 1TFWA 3TA2A 4K4ZA 3DXSX 5AXNA 4U7UD 1DARA 3CCSS 4NXMF 2OO4A 1IWGA 1YG0A 5KFYA 2Y1IA 4R5PB 3O44A 3R5JB 5E2QA 5M2UA 1KKHA 2OGUA 2YQ3A 1QSYA 2ZE2B 1SKRA 1UVMA 1B3TA 4J9RA 1HNXE 4C97A 2HAIA 4ZPAA 2D69A 5CH7B 3OR1B 2WVFA 4KH0B 1UAWA 3PIOQ 4FS2A 1LW2B 1RKIA 2UXBE 3BH6B 4USUA 3DNCA 4GRSA 1U6FA 1D3WA 1ZH5A 2UV8G 1WEYA 2FZKB 1TKZB 2JRSA 3JYTB 1HI8A 5A2QY 1S6PA 3BO2A 4N76A 2B9YA 4QWEA 2BA0G 4K4YA 1VI7A 3S7RA 4JV5I 4FW5A 2LXUA 3BH7B 4OO1E 3AB4B 1UJ6A 2VBYA 2DGTA 4LF4I 5LMUE 4NWBA 1QJHA 1HI1A 1D0EA 5CABA 1F9FA 3F41A 4DV0I 3CCRS 4IQMA 4JI4I 1FDDA 2MZ1A 3H1CA 3DN9A 3PV8A 3RYLA 2CNLB 2VF3A 2C2KB 2M70A 2HWHA 2PC6A 3DLLQ 4DV2F 2J0WA 5HLFB 2GO3A 3OXFA 2HHUA 1HBMB 5B09A 1RYRA 3TA1A 3UVJA 2CQ3A 3QQCD 3PTWA 4MKVA 2DNQA 1HW9A 2A3JA 3UO0A 2F4VI 4ECZA 2HRTA 2W9CB 1H2UX 2WSCC 2RIJA 4FNHA 4C8YA 4XK8C 3EVOA 3MFHA 3RBZA 5A8KB 5J2PB 4JI8F 2V8HA 2X1GA 1X60A 2CG4A 3N79A 4YDXA 2WBRA 1ZM3A 4G1QB 1BY9A 2IRYA 5HP1B 4RNFA 2UU9E 1FVQA 1FRHA 3M8YA 1Y7PA 3KRNA 2LQ5A 3ET6B 1PILA 4MYTA 4DR6F 3M9MB 4PUOB 1FTRA 4ZCKA 3GE9A 1I94E 3DLGA 1SH3A 4X4SA 1IBMI 4X62I 3EX7B 4C0OC 4DSJA 4OYIA 5CYMA 1P1LA 3QT7A 3VR1A 2QL9B 4AIMA 5KG2A 1VQ5S 4JI2J 1YHQS 2PGCA 1WI8A 4UOFA 3RR8A 4OYOA 2GO9A 1ZA1B 2ZVIA 3DLKB 2P6SA 5KT3A 4PXEA 3BN4A 1TMJA 4MIBA 3GFXA 2ZH8A 5E41A 2VQEF 3JSYA 3CJQA 3HHLC 4IO1A 3H4DA 2OPQA 2LXFA 4IFDD 4BC7A 2EFGA 3M85D 2H5JB 1R6YA 1HW8A 2RVJA 3OD2A 3DM2B 3AAWB 2XZTB 1YBTA 2KG1A 3J7A1 4DV5E 4ITSA 2HHHJ 2IBKA 2MHNA 3PW7A 4EWTA 2UVRA 1LWFB 3HPOA 2DGUA 4J91A 3T1YJ 1OIAA 4YEAA 3TUPA 5KFTA 4DX8H 4AL7A 3F44A 1UDQA 4FZVA 3IM9A 2FD2A 1T7PA 1XERA 2XWYA 3G8TA 1TKXB 2AGOA 1VQ6S 4OKGA 3R1HA 3MM7B 1S48A 2ADBA 1RAGB 2C38B 4ZN3A 2VFSA 2XMJA 1KC8T 4K4SA 2QA1A 4BWJA 2NUUG 2VKRA 3RBDA 3D6HB 2E7XA 5KFDA 4ES1A 3N9UC 2PI4A 4K0KE 2BQUA 2FJAB 1XWLA 3LP1B 2O1UA 4LJMA 2M3DA 1HLWA 1F5BA 4B3SJ 2A6OA 1UEVA 1WC0A 2O1WA 5EUHA 3M8QB 4M5MA 3TI0A 5T14A 3UR0A 3EDRB 3JSMA 1RAJA 2NXEA 1EX8A 4PABA 1YJ7A 4U3DA 1NRKA 1FX4A 4AUKA 2V8PA 1RI7A 1FXRA 1E3HA 2B51A 1U0HA 1R6MA 5C2CA 1UJ4A 2RHQB 1N5SA 1HQUB 1RLCL 1H73A 3SXLA 2MLXA 5JMNA 3TA0A 4EZ6A 4KE5A 4X64E 3J7AM 2ALZA 2UXBF 3US5A 2OD4A 1TUGB 3T5KA 4Y0FA 2WB4A 1B99A 1RJJA 2IY5B 2BKNA 2KXFA 4NXMI 4LSNA 1GNKA 3OXLA 2VHGA 4RW4A 1RWOB 1HQEA 1LQ9A 1KVKA 2IYIA 3OTOF 3KLEB 3R7NB 3DOLA 4FXWA 4OYPA 2GX8A 2DHSA 1C4CA 4HLBA 3U1MA 4ZVEA 1TL5A 3NOGA 3RAQA 5B0BA 2PI5A 2ZBPA 3UDLA 2KM8C 1MX0A 1URRA 5ETPA 2J6SA 2RD5C 3EVMA 1PKPA 2CA9A 4LFCF 2RU9A 1NKBA 2RRBA 2IMOA 4E2FB 4I2PA 2DRAA 4ED8A 3RB3A 3NNHA 3VAJA 2B4PA 1C0UB 1A6LA 1Z5AA 3OJUA 4DF4A 1KLMA 5ETNA 2F40A 4I7FA 1NKCA 1GTHA 4ID5A 1N5YB 1ZXMA 3FCWA 2RRNA 5EWGA 1HR0E 4WJBA 2BJEA 2LYVA 1GX5A 1S12A 3VGSA 3KLIB 1QTMA 3UDVA 2HHPA 5C24A 2GIQA 3A8IA 4G6VB 1FKPA 2R2UA 2E5LE 4XO0A 3CT9A 2YH1A 2HZAA 3NBPB 4OIXA 4RNOA 3KLHB 3J7Z5 3ZTOA 5I3QA 5F0UA 2HGLA 1EQ0A 3BGRA 3OPKA 1RZMA 1VQKS 3AJ1A 4DPWA 2XULA 4Y2AA 4J37A 3NS7B 2HFNA 2F7VA 3DRPA 4ZCIA 4LUBA 3HK2A 1MWQA 1AROP 3J7YI 5J1EB 5THWA 3W60A 3AOBA 2BJ3A 4DSLA 3PHTA 4QU6A 3G96A 4JI8I 1NH8A 7AT1B 3PR4A 3GTYX 2DHGA 3M30A 1SI9A 5CHCB 1FKOA 3MEEA 4DHVA 3T41A 2O3ZA 4DL7A 4RW7A 4DV4E 2M52A 4I4BA 4JI7E 3CMAS 5GAGI 3ISNC 4FWGA 2B9WA 3NNAA 1LNQA 4AQYI 3OTBA 1YWXA 3MCMA 1KBRA 1NK9A 1HWJA 5K14A 3TZYA 3DRRB 3Q83A 3VGUA 2ABYA 2W7AA 2QC3A 5DM6Q 1WKKA 3FVYA 1Q8BA 4NLRA 2LU1A 3CWVA 1PAEX 1RTHB 1R0CB 2Y1RI 3T1HF 3FCVA 3G6ES 3QWUA 1S10A 3D1HA 3I5BA 4B3OB 3GMGA 1RKJA 3MAAB 1RADB 1U24A 5LMNI 3NGSA 3R27A 1CULB 5A2QU 4DV1F 3TEGA 4NLGA 3M8WA 1RT7A 3F73A 5E3CA 3K58A 3BN7A 5H9FJ 3HVRA 1XN9A 1FD2A 1M1GA 1P8GA 3Q89A 1L5UA 3CDUA 2PD1A 3C14A 4P2SA 2HLTA 1GEHA 2KYZA 4F02A 1UEUA 5J2NB 4OX9J 1O6XA 1IBKI 5KTQA 3JSBA 3DKDA 1SUQA 3H40A 3S1TA 2UXDF 3AD8C 3PFOA 4QIGA 4LFBI 2MSTA 2DGWA 1U09A 3MMCA 1N6QB 2WOMB 4B3RI 4LF9F 4KB7A 2C2EA 4PRXA 2H1YA 3NZKA 3MWBA 3D3BJ 3PX0A 3MD1A 4M94A 3TQ1A 5FDLB 1XR5A 4LPFA 3IS9A 2VG5A 2Q6BA 4EU0A 5IT9Y 4UOCA 2NREA 4JI1F 4OI3A 4WIIA 3KJVB 3AT1B 3RRHA 1JLBB 2AJ2A 4CO5A 3W9HA 4BCAA 3WIUA 1PG5B 4L75A 4R5PA 5AE1A 2A6MA 3MPYA 5JEAE 2XGQA 4X4RA 1IWAA 4KBIA 3AFGA 5JJBA 3HD2A 2V4RA 4Q7AA 5HBMB 5F8GA 4OHYA 3H20A 2BUNA 1UVIA 3OR1A 2YNIB 2XYPB 3CF5Q 2CQGA 5C5JA 3CCUS 5GMKa 1LW2A 3KJQB 3MOJB 2DIVA 3VAFA 3ZZYA 1TKZA 1HNXI 2YNGB 3JYTA 3TW0A 2FJEB 2W8LA 3L09A 4MIWA 2HG4A 3ZTPA 3GSDA 3FDSA 2MQOA 2P9EA 4DUZJ 2COLA 3R5DA 1RHMB 2JEJA 2QRRA 2C2DA 1UWAA 5J2MB 2CVEA 1BKNA 1RHYA 4LF7E 4DLGA 2P2CB 4DDFA 2UXBI 3UFCX 1NU4A 2BJ8A 4FKXA 4DU8A 1UPMB 4LFAE 3W2VB 2YPYA 3A8EA 1HBOB 5M2RA 1TUWA 1QVFR 4HHUA 2G1HA 3BZQA 5CD4A 2CNKB 3Q8UA 4KGZB 4CLFA 3HHEA 1D1UA 5K36C 2VBXA 3KNGA 1APSA 3ELHA 1S57A 1G7CB 4JI4J 5LMUI 5BJRA 3SFUA 4ED1A 1T11A 2QYCA 4PRVA 1NEEA 2CPXA 1HR0F 3R2CJ 1HBMA 2JWNA 4PWWA 4BA1B 1K9MT 2VA2A 1UVLA 2W9CA 4B9VA 4IH6A 1Y4SA 4DQQA 1FCAA 4PXCA 5A8KA 3HJCA 3MCOA 4TLQA 4QR2A 1D09B 2QSWA 3D1OA 1M0SA 1R8HA 2RMLA 3FMWA 2DH8A 2VH7A 5HP1A 1S9EB 1T9UA 2MB0B 5K36B 2EG1A 4DQIA 1Q4RA 2Z8QA 2DBBA 1FJGF 3ET6A 4CO0A 3RBXA 3DDKA 4JI6J 3VALA 4PUOA 1U2FA 2BKOA 3MPVA 2FJBB 2P5VA 1LXJA 2GA7A 3BSAA 3J80U 3MEKA 5KFAA 2YXLA 4JI5F 4WFZA 1IBMJ 1ZAXA 4F67A 3QWPA 2DO4A 1NK7A 4C3MA 4KGVB 4DV6F 2G2ZA 3DLKA 2V68A 1NK4A 3KK3A 5BYRA 1B4SA 4OLOA 4J9NA 3WQPA 1VRUA 5DGBA 3WX4A 1MN9A 2V34A 1WDTA 3EM1A 2LQBA 1Z0WA 3MI7X 4LMZA 2WVEA 3QPIA 3EGZA 2X7IA 2HHTA 4KQVA 3DM2A 4IZJA 3KK2B 2JEBB 4IYQA 2WVDA 4ZP8A 3CCES 2QL7B 3MM8B 2QMWA 5ETQA 1QVGR 1SCJB 1JLGB 4EYHB 1NZ8A 1T3NA 1PC4A 5HVFA 1VR6A 4ED0A 4CDIA 1LWFA 1E6VB 2BJ1A 2BABA 3QAEA 4WWSA 4UQGA 5DQIA 3WU4A 4Y00A 1KS2A 1TKXA 1SJQA 3F56A 4DV5I 3THVA 3U7JA 1RT3B 4EYIB 3HHLA 5AT1B 2C38A 3NRBA 3T1HI 5F0WA 2NXNA 3I31A 4H4KC 4NMXA 4MK8A 4C11B 1B62A 2J8SA 4NL5A 3PJWA 2DEIA 2AYEA 4TU8A 3CJ3A 2CDRB 4P2FA 2Z58B 4M5LA 3LP1A 2F63A 3FQKA 1VQSA 1QM9A 1CG2A 1SC1B 3SCKE 3G82B 1Z0BA 4PG6A 2ZNYA 3M8QA 2PMHA 1XMOF 2DPIA 2VFVA 3BBFA 4USIA 4WP8A 4EO8A 2YWGA 4DSFA 4OYAA 1OY6A 2R3VA 4NLUA 2V63A 2KXNB 3IRXB 5JEAF 2UUWA 2VQFF 5B0DA 1OSDA 2MQLA 2VPYB 1B0PA 1HQUA 2UUBJ 4B3TJ 2GHVC 5M2PA 1HQ2A 2LP4A 3CCMS 2C37B 1VQLS 3UN3A 3C6TB 1AUDA 4GKKE 3WBZA 1N36F 1WWHA 3A1YG 2EBEA 1H2TZ 4JI0J 2UUTA 1F3FA 3IRWP 5AXKA 3T5HA 4ZIWA 4O0NA 3JAMQ 3DRYA 4NZ6A 4KHMA 1OQ6A 2RILA 1WC3A 1F6TA 2KFNA 3A3NB 2H51B 3CCJS 4NXMJ 3GU0A 4X64I 1RA6A 1RBOB 2JC1A 5IM0B 3W65A 2O1PA 4Q8FA 3GIKA 1X0PA 3EXYA 3NS6A 4LFAF 1XJWB 3NKYA 4X84A 4M5DB 5KOXA 2F3JA 3FGVA 2R7QA 3NMAA 2C3YA 2O67A 3UHMA 4YY3E 1RTJA 4YB5A 2FVPA 3U1LA 2HKJA 1TK0A 1AXQA 4ZHRB 4ZP7A 2IA6A 3MUMP 3GV8B 1N33F 3IC1A 3VZIA 2ILZA 1C0UA 3EICA 1H74A 1HHSA 1XMBA 2DGQA 5D77A 4NEZA 4FF2A 3AD9C 2GV1A 4IUFA 2Y1JA 3DC2A 3T9NA 4JYAF 1N5YA 4PG7A 1VBKA 2R7XA 1RK8A 5GVQA 2E29A 4LSLB 1RWUA 3MM6B 3E8OA 4N8OA 1A9NB 3KLIA 1RT4B 3D2WA 2N3LA 5GAEU 5EL9A 1N0VC 3HM9A 1QAXA 1TU0B 1HYSA 4LBHA 3HVAA 3I55S 3TAQA 1IVZA 4H4OB 3QRRA 3JAMC 4K4WA 2FB0A 3KLHA 2IM3A 2O66A 1GMWD 1FT8A 1HR0I 3P8BB 5KFFA 3ZC4A 4C0HA 2HQDA 3UWTA 4DV2J 4CLUA 1VIOA 2QGFB 3QFWA 3BSNA 5J1EA 2NN6C 2E5LI 2QLFB 4RKUC 5D0HA 4CNYA 3PKMA 5E0OA 1PYSB 3QZ8A 1LWCB 3DGPB 1Z59A 2DRDA 4JI8J 2C3PA 3NGTA 1SXLA 1CVJA 2CDQA 1WACA 2OP5A 5HVGA 5IT9U 2XO6A 1FJEB 2NSBA 2FJWA 5DG8A 1Y4UA 2LDIA 2CAJA 2HS3A 3B8HA 2UVVA 3KJNB 2BV3A 4DR6J 1YJ9S 4X4PA 3VZHA 2UUCF 2DR8A 3DRRA 3MR5A 4D3GA 3H7HB 2IIHA 4U95A 1OWXA 4EBCA 4JI2E 3POTB 4DV4I 1JLAB 2Z5BB 3BR9A 4JI7I 2I38A 2NN6B 4U8YA 1RTHA 4ZJLA 4K7QA 5JUMA 1EARA 2KRBA 2DNNA 1Q78A 3PY8A 3Q8RB 3KG0A 1GFWB 1XNRF 1Q1KA 1SC4B 1RWVB 3MAAA 4C4WA 2VFUA 1N48A 2VQEJ 3WZ0A 2YVSA 2ERRA 4L3KA 1QD1A 3LWLA 1T9TA 2W7PA 1G2EA 3CDJA 4IOBA 3TARA 3BKTA 4K8RA 1BLUA 2XCAA 5J2NA 4ZPBA 1YZ7A 2D9PA 1R0AA 2HHHE 1Q82T 3PM9A 3CVKA 1HWLA 1WG1A 4DR7F 5HL7Q 1SC6A 4EGLA 4RPFA 2Z0GA 4U9RA 1RAEB 1Z4UA 3QO9B 1N6QA 2L3MA 3T1YE 2WOMA 1CJVB 2ASDA 4J9KA 1M5VC 1LK7A 4FXDA 3C3LA 3PYFA 4IRCA 1NK8A 3M05A 2X3DA 2MZTA 2K3IA 1PGZA 3JQKA 1G6BA 4YB7A 1FD8A 2MKIA 1ELOA 3KJVA 5JVGQ 1VOMA 1JLBA 2K1RA 3THPA 2R7UA 3KDOA 5FWKA 2OTJS 1T9WA 3BQ0A 3OW2R 2KHCA 2WP8B 3TYTA 2GO4A 4RR5A 4ZLNA 2HHQA 2ZOMA 4OJ3A 1KTQA 4XAKA 4PAAA 2U2FA 3D7SB 2XHCA 2VB6A 5HBMA 4NLWA 2R8HA 5FD1A 2VASA 3KMQA 4GKKF 4PPDA 1FE4A 2DNRA 2YNIA 3A8KA 2OFGX 3DDIA 3OTDA 4B3SE 1PC5A 5DGAA 3H5SA 3SMZA 3G71S 4FYVB 1MWYA 2OPSA 1TR0A 3M6AA 2YNHA 3BYRA 2YNGA 2IHR1 1KIJA 2VQFI 4QW9A 3UR3C 4ZPVR 2HWIA 1VHIA 3TUJC 3GG1A 3FFIB 5A0YB 3LTOA 5J2MA 5KOWA 4BDPA 1XIQA 3PEJA 5L46A 3W2VA 4YY3F 2KFZA 3H4BA 1WC1A 4YR3A 4AXIA 4C8LA 4UTGA 2B8PA 3SV3A 5HSPA 3K85A 3M7NG 3TJ9A 1CQMA 5KG1A 1D9DA 2UUAJ 4I67A 4V19J 3DMJB 3OTOJ 4LFAI 1UEKA 1U47A 1DY3A 4IOCQ 1WSRA 2KH9A 3R7SB 1Z1ZA 4PG5A 4FVCA 3GWCA 1N8RT 4LFCJ 2I0XA 4KQZA 3M9OB 1IBLF 1SL2A 2RAQA 4J5OA 1GH8A 4C7QA 1Q8IA 4CI0B 4Z2XA 1N33I 2EFVA 3SI8A 2ZWOA 4GC6A 5CYQB 3KLFB 2JEAB 1N5TA 2J8AA 1S9EA 4Q0BB 5K36A 2CZVC 5EHHA 5A6WA 1FRJA 1N56A 2CQDA 2CQ1A 3M9NB 4ZP9A 2D41A 3U02A 2HMIB 4KGXB 1BUXA 1UZDA 2FDNA 1ZM9A 1NXIA 4CCHA 3IAS9 1RTDB 4FWDA 2CQHA 2DGOA 1NNDA 2L48A 1P9YA 4LVNP 5KFZA 5D15A 2HFOA 1S97A 2D7SA 4X4VA 2J6UA 3B6BA 2CG9A 5BYSA 1YLXA 2R7RA 1GMWA 2YKNB 1FDAA 3PW5A 3HHKA 4AL5A 1HNIB 4QWDA 4ZMMA 1HPZB 3BYPA 2AJ1A 2YTCA 4ZOSA 4YN3B 2AYGA 5T41A 2ALYB 3KK2A 4HEA9 3J81Q 1JNZB 2EPIA 2NXCA 2FGCA 2D3O1 1ZM4A 5KFIA 2VICA 2B9XA 1WC4A 3MM8A 2RUGA 5CQGA 1SKSA 2W7OA 2JE6B 2ZH7A 1JLGA 4NCBA 1TK8A 1E6VA 1VDHA 1FA0A 4ER8A 3HP6A 3KMSA 3WU5A 4Q2MA 1FWPA 1B7YB 1F1BB 2IVMA 2D3ZA 1KOHA 3UD5A 2KN4A 3NLCA 2IM2A 4I6YA 2C22A 1GT8A 4ZN1A 1RT3A 2CADA 2E9TA 5KG4A 2CGEA 3MR6A 1I51B 1R31A 4C8OA 2F5GA 3VVUA 2JSXA 1LWEB 1MMNA 2E1AA 1YK9A 4C11A 3T1HJ 3GLLA 3PNIA 4M8LA 3AOAA 3M2UB 1MU2B 5HJYA 3CIZA 3HO1A 1U1LA 1KRPA 3GJTB 2UV8A 2V6AA 5KT6A 3LWMA 4DV1J 4FF1A 4CLLA 1I6JA 2JH3A 3B4MA 2XSJB 5K20B 3CJ8A 3CD7A 3G82A 1SH0A 2OIHA 2F9JA 2I5JB 5C0XF 1NJIT 4DR7I 4ZPTR 3W64A 4OX9E 1IM6A 4QOTA 2NPIA 3M4XA 3GMEA 3J81C 3IRXA 4F8RA 1TMMA 2UXDJ 2J76E 4WTYA 1FFSB 2XYHB 4B9MA 4H4KA 1FXDA 2QFJA 5MLCV 2M88A 4OO1C 1U1QA 1JXVA 4YMEA 3PW0A 5JEAD 4TQSA 1FRKA 4NLQA 1QSSA 4LF9J 3OHBA 2GIRA 3R97A 4ZLJA 4B3SF 1Z0EA 4C98A 4RW8B 2C37A 4DR1F 1CJTB 3K1JA 4J3DA 3FRYA 1Q79A 1NZ0A 3C6TA 4HL9A 5EGYA 3BDPA 5EN1A 4GQUA 4JI1J 1CC8A 3JTOA 3PYGA 1Z5CA 1RT1B 3DHXA 3W8PA 4MYUA 5IV3A 1EP4B 1JQGA 2HFUA 2JLEA 3M2RB 4DU7A 2Q66A 5F41A 4KHPE 4LQ9A 3H5XA 5IM0A 3V6KA 4GKKI 3CW2C 1F5CA 3IXQA 4MKBA 4OZJA 5HMYA 2PFDA 4M5DA 4CWBA 3IBWA 5FLXU 3C6UA 3OFGA 1SJ1A 1KVJA 4EI2A 1YGYA 3CJSA 2KO1A 2YWWA 4ZHRA 2XMTA 4ISAA 5IZHA 1NHIA 3ADAC 1KD1T 5HQ8A 4DUZE 2DRBA 2DKOB 3K0JA 4A8OA 3OVAA 3IP0A 5DNLA 4N41A 5EX0A 2GHWA 4M5KA 1S9GA 4YY3I 1REGX 3BGLA 4X66F 4LSLA 3ZZPA 3ILJA 3MM6A 5D4NA 3EWGA 2JZ5A 3LGMA 4H4MA 4NZ7A 1RT4A 2PFFB 1SVDA 2ZEJA 4F2SA 2G4BA 2GMJA 2AWZA 5KFUA 2MKJA 4BHQA 2FVRA 1OO0B 1RQ0A 4H4OA 3OSPA 2IESA 3PIPQ 4JI4E 2CUYA 3QT5A 3BF4A 5DRKA 3CJKB 2NZCA 1SQEA 2B6AB 1ZZFA 3ENQA 3I4PA 3NXZA 4IH7A 1U6ZA 3CDBA 4URLA 1PO6A 4RL1A 1DBDA 1RB0A 1ULRA 2WRMA 4OI4A 1IBLI 2ZKTA 2MYFA 4YDDB 1JWWA 2C2ZB 4P72A 1LWCA 4OI6A 3DGPA 2VFRA 1NJZA 1S7IA 4ED3A 3WX8A 1X31C 4B9SA 2RDDA 1O5JA 4CO1A 2KVQE 2YKMB 4WUBA 1FJGJ 1Y3KA 4IKAA 1DURA 2FUG9 4K5RA 3MPUB 2R7SA 2CQ4A 4QIVA 4TXSA 5HO4A 4JI6E 1SL1A 3EZOA 1YIJS 4I3HA 1F9HA 4MIAA 3WIVA 4GMKA 1RWPB 1IUJA 3POTA 1JLAA 1IBME 2EG2A 3V2UC 2Z5BA 4JI5J 2NN6A 2CWKA 3SSSA 4AYBD 1RBLA 2XQCA 1IKXB 4DV6J 4XTJA 1DQ8A 2LLZA 1AB8A 1MW7A 5B0AA 3I96A 2VA3A 4MAKA 5L9NA 4JI2I 3DLGB 3FZBA 4KO0A 1NH7A 5CYMB 1OYEA 1TKTA 3R7BB 3QYYA 2FLOA 4KGKA 2ZUGA 3KTQA 4NRUA 4UY85 3QBCA 4B9TA 5L1KA 3KJFB 4A48A 3PDNA 4MMOA 4FW9A 2LFVA 1P6TA 3ZKDA 3FC9A 2R2TA 4DR2F 3QGPA 3N4WA 2MJUA 4YOEA 1XK8A 2Q1LA 4IOAQ 2X36A 1KFSA 4P73A 3ZM7A 3QO9A 2MLYA 1CJVA 1YBAA 2DO0A 2ZITA 4RNNA 1VLOA 3L3CA 4IH5A 1FESA 1V6HA 3UCZP 2YKOA 3HXMA 1VBYA 2OPQB 1U1OA 1JLCA 5RUBA 2VKZG 2FVCA 1Q95G 1HWIA 3E2EA 2CJBA 1PKUA 4C9DA 2HHHI 2OTLS 4OX9F 1UDOA 4DZ6A 1ZM2A 1SIWB 4LRCA 5C0XC 1FKAE 3T1YI 4KFBB 1M1HA 4TY8A 1XR6A 2E5GA 2N3OA 2HHVA 1P1TA 2WP8A 5EDWA 2HZVA 3VCDA 4Z7CA 4ZVFA 1FNOA 3GCMA 4EMDA 2JJ4D 2CQIA 2CPYA 2B3TB 4D3HA 4CO3A 2M4MA 2CIMA 4UT4A 3QGGA 5LT5A 1NHJA 1R8AA 2QA2A 1OYDA 2JEFA 5KFLA 3ITHA 3P49B 2BANB 2YY3A 3HJFA 1GAOA 4KHRA 1G3OA 2GVDB 1XMOJ 5A2QQ 4NXNF 3OVBA 3IFEA 2W2OP 3HVWA 2QX0A 4YR0A 3O6QA 5DRRA 2XI2A 4KHPF 2DGSA 2E9ZA 2PDAA 3EPIA 3W2WA 3M8RA 4NLYA 5D0GA 3LANA 6FD1A 5C0XB 1UFKA 5CAAA 2M9KA 2VQFJ 2HK3A 1VYAA 2MHEA 3FFIA 1NDPA 2IAJB 1WF1A 2DR7A 5A0YA 4B3SI 5FIIA 3HULA 1NHUA 2UUBE 5IT4A 4B3TE 3GYNA 1MMLA 1YI2S 3J7AN 4A8FA 3P5TL 2OPRB 2E1CA 4JI0E 1N36J 2KZZA 2EFQA 3IWNC 2HHXA 2AJ4A 2CQPA 2N82B 4HI2A 1XMQF 2ZM6F 1HNWF 5D8HB 2GAGC 3DMJA 2ZVSA 2I1RA 2KU7A 1CQNA 1EETA 1WOPA 3RAXA 3ILIA 4YHHF 4JB8B 3SCIE 3A8JA 4DR5J 3MECA 2CPFA 3SIPB 1Y10A 4DSIA 4ATNA 2ZZNA 3TQEA 5F8NA 4C6AA 1NCLA 4C8NA 3HDSA 4DL4A 4A8QA 4RJVA 1WG4A 1SBRA 2MQNA 2BQ3A 5CYQA 3J7ZT 1U2RA 3KLFA 1X7VA 5A2QC 4ZITA 2CJQA 4A47A 1P27B 3T5JA 2JEAA 3DOLB 2P8IA 1N33J 4NLPA 1FK9B 4IR9A 2IDLA 4R0JA 2E1RA 4NA2A 3VGVA 2ZUAA 1S0MA 2C2NA 4K4UA 3CJRA 2RE1A 3DU5A 3GIRA 1VQ9S 2HMIA 1IKWB 2XMUA 4JYAJ 3CDAA 2BX6A 3DI6A 1T0TV 4IO9Q 2YX4A 2XLKA 3MURP 1KQGB 2HW3A 4WP3A 3ZZZA 3I0RB 4DCOB 4I2PB 1N32J 5KFXA 2ACMA 4XTTA 4DX6A 1HD1A 3JS9A 3RB6A 4DS4A 5IXUA 1U6BA 4CP5A 1KLMB 2EKNA 1XNQF 4DV2E 2YKNA 2W01A 2PO2A 4DLEA 1J2VA 1QZRA 1VLYA 5C7PA 3ZXWA 2XNQA 1HNIA 3CTRA 3N0VA 3U1NA 1HPZA 1S1WB 3BO3A 2QEXS 2FHJA 2LXIA 1T95A 5L9XA 5CCMA 3D6FB 2WVCA 3G9CA 1S1TB 4JI8E 3FSYA 4ZVOB 4ELUA 1T9VA 2DNZA 3ZZRA 5KT7A 1S6OA 1YVFA 2ZBRA 2B56A 3L7OA 3UQSA 2IBOA 4QBUA 2AT1B 4OZ3A 3QGIA 3RRKA 3K8WA 3Q24A 2Q6CA 3NGDA 4DR6E 3A3OB 3LQVA 2VBWA 3PVXA 1RWKB 1U1MA 4RNMA 2KT2A 3A12A 4O23A 2HHWA 2UP1A 2UUCJ 1ZZNA 2AYBA 1Y11A 1N0UA 1S7HA 3IR7B 3DLBA 5JVHQ 3PRDA 1VQMS 2YKAA 1WG5A 1LWEA 4DL6A 1KP6A 4RW7B 1X4AA 2MEWA 4XDDA 3M2UA 3J7YU 4LREA 3J80Q 1MU2A 4N3OA 2C3OA 1XNRJ 1Q86T 3I9ZA 3CC2S 5B0GA 4LF5E 5IQ6A 3KNAA 1IJEB 2J0XA 2VQEE 4RU9A 2QJ3A 3V6JA 2R2SA 2OELA 4KKOB 1FWKA 2EK6A 3D0HE 3N6MA 3M7VA 2L9NA 2XSJA 3L4BC 2MQQA 3G6VA 1FKAF 5GAGU 5J1PA 1OPIA 2FJVA 4DR2I 4O3PA 1RU2A 4KV8B 3W62A 3T6BA 2VL1A 4UUXA 4NPOA 1NJXA 4V1Ak 4DR7J 1S4EA 2R8IA 2BXJA 1H7SA 5DQGA 2ZH2A 5IT0A 2WAQD 3FSIA 3DCAA 2FVQA 2F8HA 1VHFA 3AB2B 4RW8A 4OX9I 1CJTA 1CEZA 2O1VA 2EFNA 4ECYA 4ZVHA 2NYHA 1DQ9A 2CJYB 3CIMA 4NLSA 3MR2A 1Q8LA 5D6GA 3PYDA 1N52B 2YKQA 3MM9B 1RT1A 4RZRA 4LCGA 1EP4A 3M2RA 1D8YA 4B02A 2MQPA 1UVNA 4GKJJ 1RU1A 3J80C 2UUBF 4B3TF 3MF5A 4LBPA 4O4GB 3M85G 3QRQA 2AHOB 3PR5B 2P9GA 1NDLA 3VAHA 2K06A 1HD0A 4F4WA 2JNJA 4OO1A 1CJKA 5HN0A 1NPKA 3IS9B 3CJ0A 4GKKJ 5A8RB 5F9LA 3LF0A 1E6YB 1SL0A 1GXTA 1FEHA 5KG7A 1RYSA 1I3OB 4J9SA 4GO7X 5L38A 4KHPI 5E3RA 3VWSA 4KT0C 3ZTSA 2NSCA 3WC0A 1RUSA 1T02A 4PEOA 3CCZA 3BBCA 1K0VA 2JVOA 2BA9A 3AJDA 3ZZUA 5C2GA 5ETOA 2JLFA 1KQSR 1O8BA 1UMJA 1BQMB 5DO2A 4P2XA 2DVIA 2Z5CB 4ED5A 1KOOA 3PG9A 3SSRA 1S1VB 3C16B 4Q44A 4TY9A 3DXBA 1VJWA 4YY3J 3GCXP 1R3NA 4LF1A 2RDJA 4DUZI 2H65B 1BQXA 1S6QB 5ETMA 1XMQI 3N5BA 1YZ6A 2ZM6I 1HNWI 4E98A 3K57A 2FGOA 4CH7A 4FYXB 2DNKA 3G8SA 4KRWA 3GLJA 3MD3A 3B54A 2J5AA 3F0NA 2UUAE 3OTOE 3H5UA 3N6NA 3CJKA 1QE1B 4PYDA 2B6AA 4ICLB 2BA1G 4DV3J 2BE7D 2ZJRQ 4L6V3 1RAAB 4MKYA 1K44A 3EPGA 2GMLA 3PCOB 2DXEA 3EJMA 4LF8F 4LFCE 3VVTA 1OYSA 2X3GA 5IFMA 5L3JA 5K36E 1YTYA 4DL5A 1IBLJ 2H5EA 3BR8A 5CYJA 4YFUA 2SXLA 1RHQB 4WFNQ 4AT1B 4F0HA 2DIUA 4IFVB 3FQLA 4PXDA 2YKMA 3J81U 4BS2A 2W2QP 2CKWA 5F8MA 2LQ8A 1S1XB 2XHWA 3CC4S 2B0GA 2HYIB 2A2CA 2O01C 4WIQA 3P3EA 3AXKA 4IDKA 3W5XA 4ID8A 2B5JB 4P75A 2KDOA 4QPTA 3EGNA 2NLWA 2OAUA 1IKXA 3Q6NA 4JI6I 2R8GA 2ADCA 4OYZA 2CPZA 1R0BG
chains in the Genus database with same CATH topology
1PKPA 2V2QA 4HY1A 2UUCE 1Z0TA 4PRVA 4DR3E 4DR6I 1XNRI 4DV6E 1ZM9A 3JAMC 4WUBA 4JI8E 4JV5I 4DV7E 4FWDA 4WUCA 4DR2E 4JI6E 1HR0I 4LF4I 4I3HA 1B63A 5LMUE 1Y4SA 3QT6A 1FWLA 2J7KA 3ZZ0A 3PYEA 1Y6ZA 3HJCA 1Z5AA 1Z0GA 3LNUA 1HK7A 4DV0I 4DR6E 1XNRE 1EI1A 1IBME 2CG9A 3V2UC 2Z5BA 2E5LI 4JV5E 1Z0CA 1ZXMA 4JI4I 1S16A 1HR0E 3ZKBA 4LF4E 4HACA 1J5EI 4LF7I 1Z59A 4XTJA 2VF3A 1N0UA 2OI2A 4LF5I 4ED4A 2PNMA 2VQEI 4DV0E 2GS8A 2E5LE 5IT9Q 5IWAI 4JI2I 3B78A 4IZJB 1HNZE 1Y4UA 4DPUA 3J80Q 1PIEA 3B8HA 3J81Q 4N3OA 1ZM4A 1A6FA 2BV3A 2F4VI 4DR7E 4DV1I 4DPWA 4NXNI 4LF5E 1Z0VA 4DPTA 2VQEE 3T1HE 2CZ9A 1OJ4A 2A2DA 4FW9A 2WW4A 1FWKA 3WU5A 5GMEA 2BM1A 5IWAE 4JI2E 3ZKDA 4DV4I 3V5RA 4DR1I 4R1FA 2Z5BB 4JI7I 1VISA 1ZM3A 2X36A 1USUA 4JI3I 4JI8I 3ZM7A 3QT8A 2F4VE 2UU9E 4GKJI 1N34E 2V34A 4HACB 4DV1E 4DR2I 4NXNE 1MU5A 2ZITA 2UXDI 1Z0WA 2V2VA 4B3MI 4MYTA 2CGEA 1XMOI 2X7IA 1S4EA 4DV4E 4KQVA 4DR1E 4JI7E 1I94E 4IZJA 4LF9I 1H7UA 1IBMI 1H7SA 4X62I 4FWGA 4JI3E 2Q2EB 2HHHI 2BM0A 3QT7A 1RR9A 4GKJE 1ZXNA 4AQYI 1ZM2A 3P06A 4FN5A 2UXDE 1FKAE 4USKA 3T1YI 4B3ME 2XEXA 5BR8I 4OX9I 2O1VA 1XMOE 4JI1I 2IOQA 4YHHI 3WU6A 4LF9E 4Z7CA 3WU3A 4X62E 3PYDA 3WU4A 2HHHE 4EMDA 2ZBKB 3CWVA 1HNZI 2VQFE 4RPFA 2IOPA 4AQYE 1N36I 3LPSA 1XMQE 4UT4A 3T1YE 5IT9C 1NHJA 2ZM6E 5BR8E 1HNWE 4DR7I 5LL6R 4HYMA 4DV5I 4OX9E 4JI1E 3Q1QA 3J80C 3J81C 2Z5CA 4YHHE 4DPYA 4WUDA 3T1HI 3PYFA 5LMNI 4FWHA 1EA6A 2HFSA 2EFGA 1FNMA 4DUYI 4IZKA 1B62A 2UUBI 4B3TI 5A2QQ 4LF8I 1N36E 2DEIA 4X66I 4DR5I 2UU9I 2NPFA 1N34I 4DV5E 3GONA 1ELOA 1Z0EA 2Z5EA 4Z7YA 4JI0I 2HK3A 3ZZTA 1K47A 3K1JA 4KHPI 5FWKA 1NZ0A 5LMNE 4B3SI 1USVA 4DUYE 3HULA 1IBKI 2UUBE 4B3TE 4DV3I 4DPXA 1I94I 4LF8E 3PYGA 1Z5CA 1Z0BA 4X66E 4DR5E 4LFBI 4MYUA 3PRYA 2HFUA 3ZZUA 4DXLA 4ZVIA 4DU7A 4JI0E 3J7AG 4HXZA 4B3RI 4KHPE 1H72C 2Z5CB 2R3VA 4B3SE 4PRXA 3K17A 2AJ4A 1IBKE 2UUAI 2GQ0A 4DV3E 4GKKI 3OTOI 4IZKB 4JYAI 2HKEA 4DR4E 3M6AA 1XNQI 1MG7A 4LFBE 4DUZI 1KIJA 2VQFI 1N33E 1XMQI 5FLXQ 4B3RE 2ZM6I 1HNWI 2PNLA 1IBLE 1KTVA 4X65I 1N32I 4K0KE 3F0NA 2UUAE 3LTOA 4LFCI 4GKKE 3OTOE 3H4LA 1NHIA 2O1UA 4JYAE 1WUUA 3B82A 1XNQE 4DUZE 3JAMQ 2O1WA 4LF6I 4P52A 1U2RA 5A2QC 4X65E 1N32E 4X64I 4UTGA 4YY3I 4LFCE 1Z5BA 1XHKA 2V8PA 3K85A 5L3JA 2E1RA 2R42A 3D4JA 4LF6E 1RREA 1HNXI 2UXCI 5GMDA 4M1KA 4LFAI 1H73A 1PVGA 1FJGI 1NHHA 1UEKA 4X64E 3J7AM 4JG4A 4YY3E 3Q6MA 1D6TA 4JI4E 2HKJA 1DARA 4DV2I 3QT5A 1BKNA 1J5EE 4LF7E 2UXBI 1KKHA 2LJPA 1HNXE 2UXCE 4USMA 4DR4I 1H74A 4DU8A 4LFAE 4NXMI 4JI5I 2A2CA 1FJGE 4URLA 1N33I 1KVKA 2UUCI 4IZJD 1IBLI 4DR3I 4DV6I 4DV2E 4K0KI 4DV7I 4PU9A 1FI4A 1QZRA 5FLXC 2UXBE 2V2ZA 3Q6NA 4JI6I 2O1TA 1N0VC 4P7AA 5LMUI 4NXME 2DEJA 1MX0A 4JI5E 2HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKP A;  2V2Q A;  4HY1 A;  2UUC E;  1Z0T A;  4PRV A;  4DR3 E;  4DR6 I;  1XNR I;  4DV6 E;  1ZM9 A;  3JAM C;  4WUB A;  4JI8 E;  4JV5 I;  4DV7 E;  4FWD A;  4WUC A;  4DR2 E;  4JI6 E;  1HR0 I;  4LF4 I;  4I3H A;  1B63 A;  5LMU E;  3QT6 A;  1FWL A;  2J7K A;  3ZZ0 A;  3PYE A;  1Z5A A;  1Z0G A;  3LNU A;  4DV0 I;  4DR6 E;  1XNR E;  1EI1 A;  1IBM E;  3V2U C;  2E5L I;  4JV5 E;  1Z0C A;  1ZXM A;  4JI4 I;  1S16 A;  1HR0 E;  3ZKB A;  4LF4 E;  4HAC A;  1J5E I;  4LF7 I;  1Z59 A;  4XTJ A;  2VF3 A;  1N0U A;  2OI2 A;  4LF5 I;  4ED4 A;  2VQE I;  4DV0 E;  2GS8 A;  2E5L E;  5IT9 Q;  5IWA I;  4JI2 I;  3B78 A;  1HNZ E;  4DPU A;  3J80 Q;  1PIE A;  3B8H A;  3J81 Q;  1ZM4 A;  1A6F A;  2BV3 A;  2F4V I;  4DR7 E;  4DV1 I;  4DPW A;  4NXN I;  4LF5 E;  1Z0V A;  4DPT A;  2VQE E;  3T1H E;  2CZ9 A;  1OJ4 A;  2A2D A;  4FW9 A;  2WW4 A;  1FWK A;  3WU5 A;  5GME A;  2BM1 A;  5IWA E;  4JI2 E;  3ZKD A;  4DV4 I;  3V5R A;  4DR1 I;  4R1F A;  4JI7 I;  1VIS A;  1ZM3 A;  2X36 A;  4JI3 I;  4JI8 I;  3ZM7 A;  3QT8 A;  2F4V E;  2UU9 E;  4GKJ I;  1N34 E;  2V34 A;  4HAC B;  4DV1 E;  4DR2 I;  4NXN E;  1MU5 A;  2ZIT A;  2UXD I;  1Z0W A;  2V2V A;  4B3M I;  4MYT A;  1XMO I;  2X7I A;  1S4E A;  4DV4 E;  4KQV A;  4DR1 E;  4JI7 E;  1I94 E;  4LF9 I;  1H7U A;  1IBM I;  1H7S A;  4X62 I;  4FWG A;  4JI3 E;  2Q2E B;  2HHH I;  2BM0 A;  3QT7 A;  1RR9 A;  4GKJ E;  1ZXN A;  4AQY I;  1ZM2 A;  4FN5 A;  2UXD E;  1FKA E;  4USK A;  3T1Y I;  4B3M E;  2XEX A;  5BR8 I;  4OX9 I;  1XMO E;  4JI1 I;  4YHH I;  3WU6 A;  4LF9 E;  4Z7C A;  3WU3 A;  4X62 E;  3PYD A;  3WU4 A;  2HHH E;  4EMD A;  2ZBK B;  3CWV A;  1HNZ I;  2VQF E;  4RPF A;  4AQY E;  1N36 I;  3LPS A;  1XMQ E;  4UT4 A;  3T1Y E;  5IT9 C;  1NHJ A;  2ZM6 E;  5BR8 E;  1HNW E;  4DR7 I;  5LL6 R;  4HYM A;  4DV5 I;  4OX9 E;  4JI1 E;  3Q1Q A;  3J80 C;  3J81 C;  4YHH E;  4DPY A;  4WUD A;  3T1H I;  3PYF A;  5LMN I;  4FWH A;  1EA6 A;  2HFS A;  2EFG A;  1FNM A;  4DUY I;  1B62 A;  2UUB I;  4B3T I;  5A2Q Q;  4LF8 I;  1N36 E;  2DEI A;  4X66 I;  4DR5 I;  2UU9 I;  2NPF A;  1N34 I;  4DV5 E;  3GON A;  1ELO A;  1Z0E A;  4Z7Y A;  4JI0 I;  2HK3 A;  3ZZT A;  1K47 A;  3K1J A;  4KHP I;  1NZ0 A;  5LMN E;  4B3S I;  4DUY E;  3HUL A;  1IBK I;  2UUB E;  4B3T E;  4DV3 I;  4DPX A;  1I94 I;  4LF8 E;  3PYG A;  1Z5C A;  1Z0B A;  4X66 E;  4DR5 E;  4LFB I;  4MYU A;  2HFU A;  3ZZU A;  4DXL A;  4ZVI A;  4DU7 A;  4JI0 E;  3J7A G;  4HXZ A;  4B3R I;  4KHP E;  1H72 C;  2R3V A;  4B3S E;  4PRX A;  3K17 A;  2AJ4 A;  1IBK E;  2UUA I;  4DV3 E;  4GKK I;  3OTO I;  4JYA I;  2HKE A;  4DR4 E;  3M6A A;  1XNQ I;  1MG7 A;  4LFB E;  4DUZ I;  1KIJ A;  2VQF I;  1N33 E;  1XMQ I;  5FLX Q;  4B3R E;  2ZM6 I;  1HNW I;  1IBL E;  1KTV A;  4X65 I;  1N32 I;  4K0K E;  3F0N A;  2UUA E;  3LTO A;  4LFC I;  4GKK E;  3OTO E;  3H4L A;  1NHI A;  4JYA E;  1WUU A;  3B82 A;  1XNQ E;  4DUZ E;  3JAM Q;  4LF6 I;  4P52 A;  1U2R A;  5A2Q C;  4X65 E;  1N32 E;  4X64 I;  4UTG A;  4YY3 I;  4LFC E;  1Z5B A;  1XHK A;  2V8P A;  5L3J A;  2E1R A;  2R42 A;  3D4J A;  4LF6 E;  1RRE A;  1HNX I;  2UXC I;  5GMD A;  4M1K A;  4LFA I;  1H73 A;  1PVG A;  1FJG I;  1NHH A;  1UEK A;  4X64 E;  3J7A M;  4JG4 A;  4YY3 E;  1D6T A;  4JI4 E;  2HKJ A;  1DAR A;  4DV2 I;  3QT5 A;  1BKN A;  1J5E E;  4LF7 E;  2UXB I;  1KKH A;  2LJP A;  1HNX E;  2UXC E;  4USM A;  4DR4 I;  1H74 A;  4DU8 A;  4LFA E;  4NXM I;  4JI5 I;  2A2C A;  1FJG E;  4URL A;  1N33 I;  1KVK A;  2UUC I;  1IBL I;  4DR3 I;  4DV6 I;  4DV2 E;  4K0K I;  4DV7 I;  4PU9 A;  1FI4 A;  1QZR A;  5FLX C;  2UXB E;  2V2Z A;  4JI6 I;  1N0V C;  4P7A A;  5LMU I;  4NXM E;  2DEJ A;  1MX0 A;  4JI5 E;  2HK2 A; 
#chains in the Genus database with same CATH topology
 3M1V B;  3VAG A;  2CQC A;  1Q7L B;  1FO1 A;  4DR3 E;  4KR0 B;  3BM7 A;  3SBM A;  2HUR A;  2D3U A;  4QYZ K;  4FW6 A;  1V3R A;  4LT6 A;  4NI2 B;  3AJ2 A;  2XI3 A;  3HKM A;  3PFE A;  4G1I A;  3RW7 A;  5F3Z A;  1U8W A;  3HVT B;  2VU5 A;  1OQ3 A;  8AT1 B;  2RKI B;  3KK3 B;  1KN6 A;  5KT2 A;  4FYY B;  4KY3 A;  2QZ8 A;  2DIT A;  1U1K A;  2XGP A;  5DDP C;  4LF5 F;  1PYO B;  3GJR B;  1VRU B;  5I42 B;  3BSC A;  3D5M A;  9RUB A;  2JLG A;  3I87 A;  3DLE B;  2ZOG A;  2DY9 A;  1H2V Z;  3MOZ A;  3SEO A;  2O5D A;  1DTT B;  2ZHO A;  5I3P A;  2EFP A;  3TR5 A;  2GS8 A;  4FBT A;  5IT9 Q;  2V8V A;  2LEB A;  3KXD A;  4IZJ B;  1KON A;  4WK1 A;  1A6F A;  4WU2 A;  4U96 A;  1QDU B;  4KFB A;  4J9L A;  4N5S A;  2GFF A;  1VQN S;  3EMT A;  4U7U K;  3T1H E;  3CSK A;  5LL6 d;  2JDJ A;  2Z2Y B;  1Z2Z A;  2PE8 A;  1U2C A;  3V4M A;  2JC0 A;  1RDR A;  2XMA A;  2ZZM A;  1TL4 A;  2FZG B;  2HS0 A;  5DZ6 A;  4HAC B;  4DV1 E;  1RIS A;  4ECV A;  4DBQ A;  3AQO A;  2LDY A;  3HHL B;  1GQE A;  2PA3 A;  2HNZ B;  4Y2C A;  2BAN A;  3UNY A;  1S0V A;  3OL9 A;  2HBR B;  4ENO A;  1H7U A;  5LJ3 Y;  2GVD A;  3HHN B;  3X3U A;  2BM0 A;  2MXY A;  4A4J A;  2QN6 B;  3W66 A;  2UXD E;  3NWR A;  2ATC B;  5C0X A;  1WOS A;  4LR8 A;  1M5P C;  4P71 A;  2IAJ A;  2QLB B;  3WU6 A;  1NME B;  2JT2 A;  4O44 B;  1DRZ A;  4LF9 E;  2NS1 B;  2B4O A;  3JB9 k;  5E3Q A;  4QWC A;  1UPP A;  4AL6 A;  2YNF B;  2J7U A;  2GC8 A;  5KFE A;  4L74 A;  2OPR A;  4DR1 J;  3LPS A;  4W4M A;  5IT9 C;  5LSR A;  2BA1 D;  2I8E A;  3LA0 A;  4HR2 A;  1H7W A;  2XS7 A;  3FCH A;  5IWA F;  1ITP A;  4JI1 E;  3M8S A;  4KGM A;  4MFB A;  4X4T A;  3KLG B;  2VOO A;  3LP0 B;  1U1R A;  1Y60 A;  4N56 A;  3H2L A;  5KFO A;  1EA6 A;  1G1X A;  1VBZ A;  2UUB I;  4B3T I;  3FKB A;  1YJV A;  1Q53 A;  4JV1 A;  1VRT B;  1VCT A;  5ETS A;  3RZA A;  4OYB A;  1R8C A;  3TNV A;  3ENA A;  3MAQ A;  3CNQ P;  4JI0 I;  3P76 A;  2WK4 A;  3PXG a;  1RA7 A;  2AKW B;  4F0M A;  4GO5 X;  1X4D A;  4NX9 A;  3T9Z A;  3MTK A;  4I64 A;  2F65 A;  4F4K A;  1Y9O A;  5L1J A;  3TJA A;  1L3K A;  3K7R A;  2UUA F;  4ED2 A;  4HXZ A;  3MHY A;  1NPP A;  1RT2 A;  2ZH4 A;  4DX7 A;  1FK9 A;  5B0E A;  8RUC A;  2Z56 B;  4Y2I A;  3SZ2 A;  1YX2 A;  2XWX A;  4Y65 A;  2CG8 A;  2NUH A;  1VBX A;  3V6H A;  3CED A;  5BR8 F;  2A18 A;  2EI5 A;  2MGZ B;  3QRP A;  1GXU A;  1IKW A;  5HK4 A;  2VDI A;  1XC9 A;  1NUE A;  5B7W A;  3K59 A;  5J1N A;  4X66 J;  4OYX A;  5K36 F;  3FK4 A;  1RTJ B;  3WDO A;  2PSZ A;  3HFZ B;  1TV6 B;  3I0R A;  2H4W B;  1OYP A;  1S79 A;  2DNG A;  4TN2 A;  1R8P A;  4U6P A;  4MU1 A;  2RRA A;  1QY7 A;  3UW1 A;  4URS A;  1XXE A;  3BGU A;  4DS5 A;  3FUY A;  4RWX A;  4PKD B;  3R5G A;  1S6U A;  4F4Y A;  2WB1 D;  1S76 D;  3PS3 A;  5HVH A;  4R8U B;  4ZJO A;  2R42 A;  2LA4 A;  3A4T A;  5I3U B;  3B4D A;  1S1W A;  3MCS A;  3DRX A;  3D3C J;  1HYS B;  1HFE L;  3D0I E;  4M1K A;  2KM8 B;  3Q8V A;  3EZ5 A;  2MZQ A;  2MKH A;  1S77 D;  4YQW A;  5H9F K;  4QWA A;  2HIY A;  1OS5 A;  2VPZ B;  1S1T A;  2YWK A;  4YB6 A;  3L95 X;  4DR4 F;  1HBN B;  4DV2 I;  5E3A A;  1FHT A;  1PJ6 A;  3QIP B;  2UXC E;  3W9I A;  4TYA A;  5C42 B;  2ILY A;  1URN A;  4DR3 F;  2I2Y A;  1FJG E;  5ETR A;  1HL6 A;  1JX4 A;  4FW7 A;  4RX6 A;  4IZJ D;  3W3S A;  1NZA A;  2V0N A;  2NN6 E;  4A8S A;  2MKS A;  2V9W A;  1WHX A;  2QIF A;  2VG6 B;  2KVI A;  2OJ3 A;  1ZS6 A;  3GZ7 A;  1WF2 A;  5G4D A;  4JI5 E;  1KDN A;  1S1U B;  4X65 F;  2YWH A;  2JFK A;  3TZZ A;  1RWN B;  5EWF A;  4DR6 I;  4DV6 E;  4RBT A;  4HT7 A;  3C66 A;  1IQT A;  1VQ4 S;  3LGH A;  3TWZ A;  4WUC A;  1AFI A;  2LU2 A;  1V3S A;  3G6Y A;  1O51 A;  1YRX A;  3PEH A;  4AXJ A;  3GPA A;  2QTW A;  4WFA Q;  3HHL D;  1DFD A;  1TKD A;  1IR1 A;  2HVZ A;  1EJ7 L;  1Y6Z A;  4KKO A;  3L7U A;  3IR6 B;  1NSQ A;  3AOD A;  4P10 A;  1J5E F;  4G3I A;  2DYA A;  2E7V A;  1L3T A;  3UE2 A;  1X4F A;  4QR1 A;  2Z2Z A;  3D28 A;  4NLX A;  4KV8 A;  3OFF A;  4X4U A;  4LF5 I;  4ED4 A;  4FBU A;  2PEB A;  1EKR A;  2VQE I;  4DR2 J;  2DHA A;  4FPI A;  1K1Q A;  4ECW A;  2APO A;  1HHQ A;  2HVE A;  3V81 B;  2MZR A;  3R6L B;  5GAH I;  3H90 A;  2FC9 A;  2G0C A;  2HAF A;  1X4H A;  4FDF A;  3LOU A;  4AM3 A;  3ZFV A;  4M95 A;  1R0A B;  4X2B A;  3MM9 A;  3P3G A;  1YBU A;  2CZ4 A;  3KHL A;  2LEA A;  4WFX A;  3I82 A;  4WZM A;  4NA1 A;  4FW3 A;  4QU7 A;  2C39 B;  4O4G A;  4JV5 F;  4F4X A;  2EW9 A;  2DD8 S;  5FJ4 A;  5J2Q B;  2KT3 A;  5CA5 A;  1X8D A;  1X4G A;  4LF4 F;  4OHW A;  2RF2 A;  1CBK A;  2C3U A;  5A8R A;  1E6Y A;  4A8W A;  4Y3C A;  1UVJ A;  3MM5 B;  4USK A;  2D9O A;  4DV0 F;  4DOZ A;  1WKJ A;  4ZCL A;  2B4U A;  2K1R B;  4YR2 A;  1XMO E;  1HNZ F;  4NXN J;  5AE2 A;  5HQL A;  4ECT A;  1UTA A;  1ZPW X;  2W2N P;  4KHP J;  1W25 A;  2VQF E;  4NYZ A;  1NK0 A;  2V67 A;  1J5O A;  1WEZ A;  5ETV A;  1YHC A;  1BQM A;  4DMZ A;  2AYM A;  3HJV A;  5CXT A;  3S6E A;  3IWL A;  1QAJ A;  2Z5C A;  4DPY A;  3I5C A;  3CDI A;  2CPI A;  4LRF A;  1S1V A;  3C16 A;  4QZV B;  2HFS A;  2W4C A;  3KG4 A;  2F4V F;  1JXE A;  1MWZ A;  3CMQ A;  3H59 A;  2OPS B;  1N36 E;  2YWE A;  5HQM A;  3RTV A;  2YNH B;  1S6Q A;  2R7O A;  4QR0 A;  1T3O A;  3EVW A;  4ZPD A;  2AEF A;  1XMQ J;  2ZM6 J;  1HNW J;  4PRF A;  4PCQ A;  4N8N A;  2F1F A;  1QE1 A;  4HYK A;  1K73 T;  4ICL A;  4NEY A;  5F9N A;  4YHH J;  1CC7 A;  4DR5 E;  2VPX B;  3HHD A;  3IO1 A;  1S59 A;  4F3M A;  2XNR A;  3EDQ B;  4CNZ A;  3K5M A;  4C3K A;  2OSQ A;  4X62 F;  4K4T A;  2UUA I;  3SCJ E;  3OTO I;  3PX4 A;  1RWW B;  1I1G A;  1IM4 A;  2DNL A;  4Y2K A;  1X4B A;  4Q45 A;  4USW A;  2MZS A;  2VON A;  5LOQ A;  1N33 E;  1S9F A;  2XC9 A;  4IFV A;  1XBW A;  4FF3 A;  3OL6 A;  5FLX Q;  3FBC A;  5DG9 A;  4PYA A;  2PNL A;  4PR6 A;  5D4L A;  1KTV A;  4CTA B;  1X4E A;  3H2U B;  4LFC I;  3I56 S;  2VIH A;  1SKU B;  3UNG C;  4WYW A;  4JYA E;  1NDK A;  1S1X A;  4ZLP A;  2WVB A;  3CD6 S;  3WHI A;  5D4P A;  3NGR A;  1EQM A;  3CXC R;  1OPZ A;  2QFI A;  1W7W A;  4XIU A;  2BR0 A;  4P6Q A;  4OL8 A;  2B5J A;  3QAT A;  5ELW A;  3I32 A;  2VC1 A;  1N32 E;  2AW0 A;  1AZS B;  1BD6 A;  1BQN A;  4OHV A;  2GNK A;  2B4V A;  4I68 A;  2UXC F;  2QL5 B;  4OHX A;  3MGJ A;  3UI3 A;  4F04 B;  1TL3 A;  3CDE A;  1TEL A;  1U7L A;  1FX2 A;  3M1V A;  2AEM A;  4DZD A;  2BDP A;  1Q16 B;  1XNQ J;  2NN6 F;  4IFD C;  2HZC A;  4OZL A;  1NJW A;  1ZBT A;  1D6T A;  3OL8 A;  1SJ3 P;  3O3L A;  3DOM B;  4LSZ B;  4NI2 A;  4WKR A;  3R6G B;  4B17 A;  2HQG A;  4DR4 I;  3O5T B;  2FVS A;  3P5B P;  2VJV A;  3HVT A;  1YRU A;  4YB1 P;  5LM7 E;  3Q8S B;  1FF2 A;  2RKI A;  1GMV A;  6FDR A;  3DD6 A;  5L39 A;  4DR3 I;  4AE5 A;  3IBF B;  1NO8 A;  4CIO A;  3ISN D;  2Y0S D;  5I42 A;  5T7L B;  5FLX C;  2KB2 A;  1RCO B;  3DLE A;  4RBV A;  2FY1 A;  2V9K A;  4F2R A;  4LOM A;  1DTT A;  2BQR A;  2ZBC A;  2WHO A;  3I5A A;  3MR3 A;  2OPP A;  3GIL A;  2UUC E;  2ZWP A;  1F5A A;  3SV4 A;  1L3S A;  4IFY B;  4IFD B;  3P45 B;  2EBG A;  1VIX A;  2BOA A;  4RW9 B;  5A76 A;  2YPZ A;  3QT6 A;  1NJY A;  4HVZ A;  5EKW A;  4TVA B;  3GCW P;  2KJV A;  3OQ2 A;  3PZP A;  4DCJ B;  1M5K C;  1XNR E;  4Q5V A;  3MZI A;  3TX8 A;  1Y5L B;  4CLY A;  1BMQ B;  4HAC A;  5D3G B;  1J5E I;  4DV7 J;  2XMV A;  1SV5 B;  2IRX A;  2HNZ A;  5AJ3 F;  2G1D A;  3GV7 B;  2CNO B;  2JL9 A;  1UVK A;  4I6W A;  2G2O A;  3BPD A;  3T5L A;  1EHW A;  1Y00 A;  3ILO A;  4M5I A;  3CPW R;  1F2G A;  2DNM A;  1U49 A;  3D6M B;  3G86 A;  3O1L A;  4DR7 E;  2IJN A;  4WKY A;  4DV1 I;  5CD4 H;  3FMB A;  3Q86 A;  1Q0N A;  3CJ2 A;  1FTC A;  1JLQ B;  2ZBI A;  4RUB A;  5MAO A;  4O44 A;  2B7C B;  1ROF A;  3QJL A;  4R1F A;  1VIS A;  2YNF A;  2MQM A;  3NY0 A;  4GVB A;  1M1K T;  1LV5 A;  1KLN A;  1OMS A;  3OVS A;  3GJQ B;  2AZ3 A;  4P9S A;  5L8R C;  4ZVU B;  2UXD I;  3KLG A;  3LP0 A;  4UZB A;  1SJ4 P;  1NB7 A;  2MTL A;  4LF9 I;  1H6K X;  3TO8 A;  2GMH A;  2Q2E B;  1FDB A;  4PWD B;  4L76 A;  3KHR A;  1AT1 B;  1VRT A;  1RR9 A;  4GKJ E;  4DSE A;  1H0H B;  1WOR A;  4NYP A;  4FN5 A;  5JXS A;  2LKZ A;  1WI6 A;  2FLN A;  1SB6 A;  4DQP A;  3SFG A;  4WXW A;  1TUV A;  1SIZ A;  4JI1 I;  2BJ9 A;  4Y2M A;  4DL0 C;  2F1D A;  4DL2 A;  4RW6 A;  4QIE A;  2KRR A;  3RW6 A;  4F0K A;  4L3N A;  2DCL A;  3KUH A;  2DHH A;  1HNZ I;  5HAO A;  2QLW A;  4JI3 J;  2EK1 A;  4M5H A;  2BW2 A;  2YWF A;  1YIT S;  2XY5 A;  2M7S A;  4K4X A;  3MMA B;  2GJ2 A;  4RNH A;  4DR5 F;  4B3M J;  1N34 F;  2QT7 A;  3AA8 A;  3PO5 A;  4HI1 A;  4C2M A;  3IGN A;  4K59 A;  2MGZ A;  3Q22 A;  2XYG B;  2WCX A;  1IR2 A;  3GON A;  3C6U B;  4TQR A;  4EBD A;  2ZFH A;  1H98 A;  5GAD I;  4K4V A;  4CH1 A;  1K47 A;  2AJF E;  2GJF A;  3J81 j;  1MN7 A;  1TV6 A;  4MU3 A;  4HHH A;  2AZ1 A;  2KG0 A;  4DUY E;  4EFA C;  5K36 D;  3OTE A;  4WE1 B;  5KFS A;  3L7P A;  4ZVP B;  4WFB Q;  5KFV A;  2G13 A;  3VGT A;  3BQ2 A;  2L41 A;  2LA6 A;  4TNO A;  3PRY A;  4U67 Q;  3RBE A;  3MMJ A;  5CCL A;  4QIF A;  3HFK A;  2E7W A;  3CD5 A;  4M5J A;  4NOH A;  1S9G B;  2FZC B;  2VC0 A;  4XPE A;  2B7B B;  4R8U A;  4ES2 A;  4TYB A;  4AQY F;  4DV3 E;  3CJ4 A;  1N88 A;  4PQA A;  4H4M B;  5EX3 A;  3CD0 A;  5I3U A;  5AE3 A;  4RBU A;  5DG7 A;  4ILR A;  2MZJ A;  3BS9 A;  1N32 F;  5HAT A;  4LF8 J;  2N7C A;  3W5Y A;  1IBL E;  3HFV A;  3MMB A;  2RUS A;  3ISZ A;  4QWB A;  1TL1 B;  1HBN A;  3KUE A;  4DCP B;  3QIP A;  3W7B A;  2ZC3 A;  5C42 A;  2EFO A;  1KSP A;  2DGX A;  4P52 A;  1Q5Y A;  4MKA A;  1UDN A;  4NAS A;  5LMN F;  3NCR A;  3P96 A;  4A46 A;  3BPS P;  2DXD A;  4KIA A;  1Y5N B;  1V5V A;  3W61 A;  4R25 A;  2VG6 A;  2CXE A;  4UY8 T;  1VS3 A;  4LRD A;  4LF6 E;  2UXC I;  1S1U A;  3CCW A;  4ELV A;  1FJG I;  4C48 A;  1IBK F;  2HGN A;  1R8B A;