1NZ0A

Rnase p protein from thermotoga maritima
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
ERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGMDYSRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIPKGFDIVVIPRKKLSEEFERVDFWTVREKLLNLLKRIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of RNase P protein from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component
total genus 34
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1nz0A00
3D4JA 1XNQI 2X7IA 2ZBKB 4DV1E 1S4EA 4DV7E 4DR2I 1EI1A 2UUAI 3CWVA 1ZXMA 4DR2E 4JYAE 4DV7I 4DV1I 1J5EE 1XNQE 4URLA 2HFUA 1Z0CA 2E5LI 4JI0I 4HY1A 1PIEA 3T1HE 1D6TA 4HACB 4ZVIA 4DR5E 4WUDA 4PRXA 4I3HA 4X66E 4LFBE 2BM1A 2UU9I 4OX9E 4LF6I 4UT4A 3WU4A 2ZM6I 2F4VI 2J7KA 4DV0I 1KVKA 4FN5A 3ZZUA 3K17A 5FLXQ 1PVGA 3T1YE 2CZ9A 4JI1I 4JI5I 1XNRE 4YHHI 5LMUE 4DR4E 4USMA 2UUBI 4HACA 3H4LA 1N32E 4PRVA 4DR6I 1N33I 4EMDA 2V8PA 4JI7I 3QT6A 4FWGA 2DEJA 1U2RA 1H72C 2UXBE 1DARA 3LNUA 4DV5E 4HYMA 1IBKE 2BM0A 4DV6E 1IBLI 4NXMI 4K0KE 1XMOI 1HNXI 4X64E 1N36I 4DR1I 3JAMC 4DPXA 1B63A 4DR4I 4LF4E 4GKKE 1BKNA 5LMUI 4X62E 5BR8I 1FJGE 2Q2EB 2V34A 3J81C 2ZM6E 2UU9E 2GS8A 2VF3A 4X66I 1OJ4A 4B3SI 1A6FA 3J81Q 3J80C 3T1HI 2E1RA 2NPFA 1Z0EA 4DPTA 3PYFA 3Q1QA 4LF9E 4JYAI 4LF8E 1HNZI 4LFCE 4AQYI 1RREA 4JI6E 1HR0E 2X36A 1XMOE 4K0KI 4DV6I 4LFAE 1IBKI 4DV5I 2VQEE 2HKEA 4KHPE 2HFSA 4M1KA 2HKJA 4DR7I 3ZZ0A 3LTOA 4FWHA 4FW9A 2HK2A 4DV4E 5IWAE 4UTGA 4YY3I 2VQFI 4JI1E 4JI5E 1FWLA 4DU7A 4LF7I 4B3MI 2HK3A 1KKHA 1Z5AA 4PU9A 3ZM7A 4FWDA 1KTVA 4LFBI 1MG7A 4HXZA 4DR5I 1IBMI 2AJ4A 5LL6R 3WU6A 2V2VA 4LF7E 3B78A 2E5LE 1WUUA 4DR3E 3JAMQ 4ED4A 1B62A 1Z0GA 1NHJA 3V2UC 5LMNE 5IWAI 4DV4I 3B82A 4XTJA 4DXLA 2V2QA 2UXCE 1Z0BA 3QT5A 2BV3A 4KHPI 2VQEI 1RR9A 4Z7YA 4B3TE 1ZM2A 5A2QC 3J80Q 3V5RA 4DV2I 4JG4A 4WUBA 2UXDI 4JI3E 1Z0VA 1Z0TA 1H7SA 4JI8I 4B3RI 4LFCI 1HNZE 4DUZE 4JV5E 2XEXA 4LF9I 4P52A 1N0UA 4Z7CA 2HHHE 1IBME 1H74A 3GONA 3HULA 2ZITA 4DPYA 3OTOE 1XMQE 1HNWI 3B8HA 4KQVA 1Z5CA 4GKJI 4JI4I 1FJGI 2R42A 4X62I 4LF4I 4GKKI 3M6AA 1ZM3A 1XHKA 4JI4E 4YY3E 4DR1E 3PYEA 1EA6A 2R3VA 1HNWE 1IBLE 4NXME 3OTOI 1XMQI 4DR7E 1MX0A 3QT7A 2WW4A 3PYDA 3K1JA 1K47A 3ZZTA 1UEKA 2HHHI 3PYGA 4LFAI 1MU5A 2UUCI 1ZXNA 4JV5I 4JI6I 4DUYI 5FLXC 1FI4A 4X65I 4AQYE 4X65E 4LF8I 1XNRI 3T1YI 4DUYE 4JI3I 4P7AA 4DV0E 2UUCE 2A2CA 4LF6E 4OX9I 4DV2E 1FKAE 3WU3A 3F0NA 4MYUA 1N0VC 1Z59A 4B3SE 2DEIA 3ZKBA 3J7AM 4JI0E 1NHHA 1Z5BA 1KIJA 1J5EI 4MYTA 5LMNI 2UUAE 5BR8E 1S16A 2LJPA 4DR3I 1QZRA 4GKJE 3LPSA 5L3JA 1N36E 3J7AG 4LF5I 4X64I 1HNXE 4DPWA 4NXNI 1FWKA 1H7UA 5GMDA 1N34E 2UXBI 5IT9C 2EFGA 4R1FA 4B3ME 2OI2A 2A2DA 4JI7E 4DV3I 1N33E 4JI2E 4DR6E 5IT9Q 4USKA 1I94I 4DPUA 3QT8A 1N32I 2VQFE 2UUBE 4DUZI 5GMEA 1H73A 5A2QQ 4YHHE 2V2ZA 4JI8E 4B3RE 1I94E 1NHIA 1ZM9A 4JI2I 4DU8A 4DV3E 2F4VE 1VISA 2UXDE 1PKPA 4RPFA 1FNMA 1ZM4A 3ZKDA 1N34I 4B3TI 1NZ0A 4WUCA 3WU5A 1ELOA 4NXNE 1Z0WA 2UXCI 1HR0I 4LF5E
chains in the Genus database with same CATH superfamily
3D4JA 1XNQI 2X7IA 2ZBKB 2CGEA 3HJCA 4DV1E 1S4EA 4DV7E 4DR2I 1EI1A 4AM3A 2UUAI 3CWVA 1ZXMA 4DR2E 4JYAE 4DV7I 4DV1I 4LPFA 1J5EE 1XNQE 4URLA 2Z5CB 2HFUA 4LCFA 1Z0CA 2E5LI 1UDSA 2IOPA 4JI0I 3U1KA 4HY1A 4MU3A 1PIEA 3T1HE 1Y4UA 1D6TA 2O3ZA 4HACB 4ZVIA 4DR5E 4WUDA 4U3BA 2JEBB 4NBQA 4PRXA 5DNXA 4I3HA 4X66E 3U1YA 4LFBE 3H1CA 2BM1A 3L7ZA 2UU9I 1R6MA 4OX9E 4LF6I 4UT4A 3WU4A 2ZM6I 2C39A 2F4VI 2J7KA 4DV0I 1KVKA 4FN5A 3ZZUA 3K17A 5FLXQ 1PVGA 3T1YE 2CZ9A 4JI1I 4JI5I 1XNRE 4YHHI 5LMUE 4DR4E 4USMA 2UUBI 5DRRA 4HACA 3H4LA 1N32E 4OO1C 3M7NG 4PRVA 4DR6I 1N33I 4EMDA 2V8PA 4JI7I 4FW7A 4IFDF 3QT6A 4FWGA 2DEJA 1U2RA 1E3PA 2IOQA 1H72C 2UXBE 2JEAB 1DARA 4FW4A 1Y4SA 3LNUA 4DV5E 2GQ0A 4HYMA 3PS2A 2C37A 1IBKE 2BM0A 4DV6E 1IBLI 4NXMI 4K0KE 2JE6A 1XMOI 2JE6B 1HNXI 3Q6NA 4X64E 1N36I 4DR1I 3JAMC 4DPXA 4IZKA 1B63A 4DR4I 4LF4E 4GKKE 1BKNA 5LMUI 4X62E 5BR8I 4OO1F 2CVEA 1FJGE 2Q2EB 4LCHA 1USVA 1UDQA 1USUA 4OZEA 2V34A 2PNMA 1RHYA 3J81C 2ZM6E 4IFDC 2BA0D 1VI7A 2UU9E 2GS8A 2VF3A 3M85G 1HK7A 3L7ZB 4X66I 1OJ4A 4B3SI 1A6FA 4BA2A 2O1TA 3P3CA 2F1DA 3J81Q 3J80C 3T1HI 2E1RA 2NPFA 1Z0EA 4DPTA 3PYFA 3Q1QA 5DROA 4LF9E 4JYAI 2NN6A 1HNZI 2JT2A 4LF8E 1OYRA 4LFCE 4AQYI 3GMEA 1RREA 2IERA 4FW3A 4JI6E 1R6LA 1HR0E 2X36A 2JEAA 1XMOE 4K0KI 3P06A 4DV6I 4LFAE 1IBKI 2GO4A 3GCMA 4DV5I 2VQEE 1OYSA 2HKEA 5DNLA 4KHPE 4IZJD 2HFSA 4M1KA 4AIMA 4IZKB 2HKJA 4DR7I 2VESA 3ZZ0A 3LTOA 4FWHA 4FW9A 2HK2A 4DV4E 5IWAE 4UTGA 4YY3I 2NN6E 2Z5BB 2VQFI 2BA1G 4JI1E 4JI5E 3Q6MA 4LOMA 1FWLA 4OO1A 4DU7A 2BR2B 4IFDB 4LF7I 2WNRA 2PNLA 2NN6C 4B3MI 2HK3A 1KKHA 1Z5AA 4PU9A 3ZM7A 1UDNA 4FWDA 1KTVA 4LFBI 1MG7A 5K36C 1YH8A 1XXEA 4HXZA 4DR5I 4IZJB 1IBMI 2AJ4A 5LL6R 2CG9A 5K36E 1OYPA 3WU6A 2V2VA 3B78A 4LF7E 2E5LE 1Y60A 1WUUA 4FW6A 4DR3E 3JAMQ 3K85A 4ED4A 2WNRB 1B62A 1Z0GA 1NHJA 3V2UC 5LMNE 5IWAI 2WP8A 3B82A 5EL9A 4DV4I 2NN6F 5JEAD 2AE8A 4XTJA 2O1WA 4LCGA 4DXLA 1YHCA 2V2QA 3M7ND 2UXCE 1Z0BA 3QT5A 5K36F 2BV3A 4KHPI 2O1UA 4BA1B 2VQEI 1RR9A 4Z7YA 4B3TE 1ZM2A 5A2QC 3J80Q 3V5RA 4DV2I 4JG4A 4WUBA 2C38A 2UXDI 4BA2B 4JI3E 1Z0VA 1Z0TA 1H7SA 4MU4A 4JI8I 4B3RI 4MQYA 4LFCI 1HNZE 4IFDE 4DUZE 4JV5E 4MDTA 2XEXA 3CDIA 4LF9I 4BA1A 4P52A 1Y5YA 1N0UA 4IS9A 4Z7CA 2BA0G 3PRYA 2HHHE 5C0XC 3UHMA 5K36B 1IBME 1H74A 1P42A 3GONA 3HULA 2ZITA 4DPYA 3OTOE 3P3GA 1XMQE 2C38B 1HNWI 3B8HA 3NZKA 4KQVA 1Z5CA 5JEAC 2PO1B 4GKJI 4JI4I 2PO2A 4N3OA 1FJGI 5JEAE 2GO3A 2R42A 4X62I 3CDJA 4OO1E 4LF4I 4GKKI 3M6AA 1ZM3A 1XHKA 4JI4E 4YY3E 4DR1E 3PYEA 1EA6A 2R3VA 1HNWE 5C0XF 2NN6B 5FWKA 1IBLE 4NXME 5DRPA 3OTOI 1XMQI 4DR7E 1E3HA 1MX0A 2J65A 5DRQA 3PS1A 1Y6ZA 3QT7A 2WW4A 2C39B 3PYDA 5K36A 3K1JA 5EKWA 1K47A 3ZZTA 1UEKA 2IESA 2PO0A 2PO2B 3HKMA 2HHHI 2NN6D 5JEAF 3PYGA 4LFAI 1MU5A 2UUCI 4IZJA 1ZXNA 4JV5I 4JI6I 1UDOA 4DUYI 3PS3A 4FW5A 5FLXC 1FI4A 4X65I 4AQYE 4MU1A 4X65E 4LF8I 1XNRI 3T1YI 4DUYE 4JI3I 4P7AA 4DV0E 2PNZB 2UUCE 2A2CA 4LF6E 2PO0B 4OX9I 4DV2E 1FKAE 4IFDD 4GQUA 3WU3A 3F0NA 5C0XD 4MYUA 1N0VC 3M85D 1Z59A 4OKGA 2PO1A 4B3SE 2DEIA 3ZKBA 3J7AM 4JI0E 4QNJA 2O1VA 5JEAB 1NHHA 1Z5BA 3DD6A 1KIJA 4OO1D 1J5EI 4AIDA 4MYTA 5LMNI 2UUAE 5BR8E 2Z5BA 1S16A 2LJPA 4DR3I 1QZRA 4GKJE 2Z5EA 3LPSA 3P3EA 5L3JA 1N36E 4LF5I 4X64I 3J7AG 1HNXE 4DPWA 4NXNI 2BA1D 1FWKA 2WP8B 2C37B 5C0XA 1H7UA 5ELWA 5C0XB 5GMDA 1N34E 2UXBI 5IT9C 2EFGA 4R1FA 3P76A 4B3ME 3KRNA 2OI2A 2A2DA 4JI7E 4U3DA 4DV3I 1N33E 4JI2E 4DR6E 5IT9Q 5JEAA 3GLLA 4USKA 2JEBA 4DPUA 1I94I 3QT8A 1N32I 3B4TA 2VQFE 2UUBE 2PNZA 4DUZI 5GMEA 1H73A 5A2QQ 4QNKA 4YHHE 2V2ZA 4JI8E 4B3RE 1I94E 1NHIA 1ZM9A 4ISAA 4JI2I 4OO1B 4DU8A 4DV3E 2BR2A 4IFDA 2F4VE 1VISA 2UXDE 5C0XE 1PKPA 4RPFA 1FNMA 1ZM4A 5K36D 3ZKDA 2Z5CA 4J3DA 1N34I 4B3TI 1NZ0A 4WUCA 3WU5A 1ELOA 4MU0A 4NXNE 1Z0WA 2UXCI 1HR0I 4LF5E
chains in the Genus database with same CATH topology
3D4JA 1XNQI 2X7IA 2ZBKB 2CGEA 3HJCA 4DV1E 1S4EA 4DV7E 4DR2I 1EI1A 2UUAI 3CWVA 1ZXMA 4DR2E 4JYAE 4DV7I 4DV1I 1J5EE 1XNQE 4URLA 2Z5CB 2HFUA 1Z0CA 2E5LI 2IOPA 4JI0I 4HY1A 1PIEA 3T1HE 1Y4UA 1D6TA 4HACB 4ZVIA 4DR5E 4WUDA 4PRXA 4I3HA 4X66E 4LFBE 2BM1A 2UU9I 4OX9E 4LF6I 4UT4A 3WU4A 2ZM6I 2F4VI 2J7KA 4DV0I 1KVKA 4FN5A 3ZZUA 3K17A 5FLXQ 1PVGA 3T1YE 2CZ9A 4JI1I 4JI5I 1XNRE 4YHHI 5LMUE 4DR4E 4USMA 2UUBI 4HACA 3H4LA 1N32E 4PRVA 4DR6I 1N33I 4EMDA 2V8PA 4JI7I 3QT6A 4FWGA 2DEJA 1U2RA 2IOQA 1H72C 2UXBE 1DARA 1Y4SA 3LNUA 4DV5E 2GQ0A 4HYMA 1IBKE 2BM0A 4DV6E 1IBLI 4NXMI 4K0KE 1XMOI 1HNXI 3Q6NA 4X64E 1N36I 4DR1I 3JAMC 4DPXA 4IZKA 1B63A 4DR4I 4LF4E 4GKKE 1BKNA 5LMUI 4X62E 5BR8I 1FJGE 2Q2EB 1USVA 1USUA 2V34A 2PNMA 3J81C 2ZM6E 2UU9E 2GS8A 2VF3A 1HK7A 4X66I 1OJ4A 4B3SI 1A6FA 2O1TA 3J81Q 3J80C 3T1HI 2E1RA 2NPFA 1Z0EA 4DPTA 3PYFA 3Q1QA 4LF9E 4JYAI 4LF8E 1HNZI 4LFCE 4AQYI 1RREA 4JI6E 1HR0E 2X36A 1XMOE 4K0KI 3P06A 4DV6I 4LFAE 1IBKI 4DV5I 2VQEE 2HKEA 4KHPE 4IZJD 2HFSA 4M1KA 4IZKB 2HKJA 4DR7I 3ZZ0A 3LTOA 4FWHA 4FW9A 2HK2A 4DV4E 5IWAE 4UTGA 4YY3I 2Z5BB 2VQFI 4JI1E 4JI5E 3Q6MA 1FWLA 4DU7A 4LF7I 2PNLA 4B3MI 2HK3A 1KKHA 1Z5AA 4PU9A 3ZM7A 4FWDA 1KTVA 4LFBI 1MG7A 4HXZA 4DR5I 4IZJB 1IBMI 2AJ4A 5LL6R 2CG9A 3WU6A 2V2VA 3B78A 4LF7E 2E5LE 1WUUA 4DR3E 3JAMQ 3K85A 4ED4A 1B62A 1Z0GA 1NHJA 3V2UC 5LMNE 5IWAI 4DV4I 3B82A 4XTJA 2O1WA 4DXLA 2V2QA 2UXCE 1Z0BA 3QT5A 2BV3A 4KHPI 2O1UA 2VQEI 1RR9A 4Z7YA 4B3TE 1ZM2A 5A2QC 3J80Q 3V5RA 4DV2I 4JG4A 4WUBA 2UXDI 4JI3E 1Z0VA 1Z0TA 1H7SA 4JI8I 4B3RI 4LFCI 1HNZE 4DUZE 4JV5E 2XEXA 4LF9I 4P52A 1N0UA 4Z7CA 3PRYA 2HHHE 1IBME 1H74A 3GONA 3HULA 2ZITA 4DPYA 3OTOE 1XMQE 1HNWI 3B8HA 4KQVA 1Z5CA 4GKJI 4JI4I 4N3OA 1FJGI 2R42A 4X62I 4LF4I 4GKKI 3M6AA 1ZM3A 1XHKA 4JI4E 4YY3E 4DR1E 3PYEA 1EA6A 2R3VA 1HNWE 1IBLE 4NXME 5FWKA 3OTOI 1XMQI 4DR7E 1MX0A 1Y6ZA 3QT7A 2WW4A 3PYDA 3K1JA 1K47A 3ZZTA 1UEKA 2HHHI 3PYGA 4LFAI 1MU5A 2UUCI 4IZJA 1ZXNA 4JV5I 4JI6I 4DUYI 5FLXC 1FI4A 4X65I 4AQYE 4X65E 4LF8I 1XNRI 3T1YI 4DUYE 4JI3I 4DV0E 4P7AA 2UUCE 2A2CA 4LF6E 4OX9I 4DV2E 1FKAE 3WU3A 3F0NA 4MYUA 1N0VC 1Z59A 4B3SE 2DEIA 3ZKBA 3J7AM 4JI0E 2O1VA 1NHHA 1Z5BA 1KIJA 1J5EI 4MYTA 5LMNI 2UUAE 5BR8E 2Z5BA 1S16A 2LJPA 4DR3I 1QZRA 4GKJE 2Z5EA 3LPSA 5L3JA 1N36E 3J7AG 4LF5I 4X64I 1HNXE 4DPWA 4NXNI 1FWKA 1H7UA 5GMDA 1N34E 2UXBI 5IT9C 2EFGA 4R1FA 4B3ME 2OI2A 2A2DA 4JI7E 4DV3I 1N33E 4JI2E 4DR6E 5IT9Q 4USKA 1I94I 4DPUA 3QT8A 1N32I 2VQFE 2UUBE 4DUZI 5GMEA 1H73A 5A2QQ 4YHHE 2V2ZA 4JI8E 4B3RE 1I94E 1NHIA 1ZM9A 4JI2I 4DU8A 4DV3E 2F4VE 1VISA 2UXDE 1PKPA 4RPFA 1FNMA 1ZM4A 3ZKDA 2Z5CA 1N34I 4B3TI 1NZ0A 4WUCA 3WU5A 1ELOA 4NXNE 1Z0WA 2UXCI 1HR0I 4LF5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4J A;  1XNQ I;  2X7I A;  2ZBK B;  4DV1 E;  1S4E A;  4DV7 E;  4DR2 I;  1EI1 A;  2UUA I;  3CWV A;  1ZXM A;  4DR2 E;  4JYA E;  4DV7 I;  4DV1 I;  1J5E E;  1XNQ E;  4URL A;  2HFU A;  1Z0C A;  2E5L I;  4JI0 I;  4HY1 A;  1PIE A;  3T1H E;  1D6T A;  4HAC B;  4ZVI A;  4DR5 E;  4WUD A;  4PRX A;  4I3H A;  4X66 E;  4LFB E;  2BM1 A;  2UU9 I;  4OX9 E;  4LF6 I;  4UT4 A;  3WU4 A;  2ZM6 I;  2F4V I;  2J7K A;  4DV0 I;  1KVK A;  4FN5 A;  3ZZU A;  3K17 A;  5FLX Q;  1PVG A;  3T1Y E;  2CZ9 A;  4JI1 I;  4JI5 I;  1XNR E;  4YHH I;  5LMU E;  4DR4 E;  4USM A;  2UUB I;  4HAC A;  3H4L A;  1N32 E;  4PRV A;  4DR6 I;  1N33 I;  4EMD A;  2V8P A;  4JI7 I;  3QT6 A;  4FWG A;  2DEJ A;  1U2R A;  1H72 C;  2UXB E;  1DAR A;  3LNU A;  4DV5 E;  4HYM A;  1IBK E;  2BM0 A;  4DV6 E;  1IBL I;  4NXM I;  4K0K E;  1XMO I;  1HNX I;  4X64 E;  1N36 I;  4DR1 I;  3JAM C;  4DPX A;  1B63 A;  4DR4 I;  4LF4 E;  4GKK E;  1BKN A;  5LMU I;  4X62 E;  5BR8 I;  1FJG E;  2Q2E B;  2V34 A;  3J81 C;  2ZM6 E;  2UU9 E;  2GS8 A;  2VF3 A;  4X66 I;  1OJ4 A;  4B3S I;  1A6F A;  3J81 Q;  3J80 C;  3T1H I;  2E1R A;  2NPF A;  1Z0E A;  4DPT A;  3PYF A;  3Q1Q A;  4LF9 E;  4JYA I;  4LF8 E;  1HNZ I;  4LFC E;  4AQY I;  1RRE A;  4JI6 E;  1HR0 E;  2X36 A;  1XMO E;  4K0K I;  4DV6 I;  4LFA E;  1IBK I;  4DV5 I;  2VQE E;  2HKE A;  4KHP E;  2HFS A;  4M1K A;  2HKJ A;  4DR7 I;  3ZZ0 A;  3LTO A;  4FWH A;  4FW9 A;  2HK2 A;  4DV4 E;  5IWA E;  4UTG A;  4YY3 I;  2VQF I;  4JI1 E;  4JI5 E;  1FWL A;  4DU7 A;  4LF7 I;  4B3M I;  2HK3 A;  1KKH A;  1Z5A A;  4PU9 A;  3ZM7 A;  4FWD A;  1KTV A;  4LFB I;  1MG7 A;  4HXZ A;  4DR5 I;  1IBM I;  2AJ4 A;  5LL6 R;  3WU6 A;  2V2V A;  4LF7 E;  3B78 A;  2E5L E;  1WUU A;  4DR3 E;  3JAM Q;  4ED4 A;  1B62 A;  1Z0G A;  1NHJ A;  3V2U C;  5LMN E;  5IWA I;  4DV4 I;  3B82 A;  4XTJ A;  4DXL A;  2V2Q A;  2UXC E;  1Z0B A;  3QT5 A;  2BV3 A;  4KHP I;  2VQE I;  1RR9 A;  4Z7Y A;  4B3T E;  1ZM2 A;  5A2Q C;  3J80 Q;  3V5R A;  4DV2 I;  4JG4 A;  4WUB A;  2UXD I;  4JI3 E;  1Z0V A;  1Z0T A;  1H7S A;  4JI8 I;  4B3R I;  4LFC I;  1HNZ E;  4DUZ E;  4JV5 E;  2XEX A;  4LF9 I;  4P52 A;  1N0U A;  4Z7C A;  2HHH E;  1IBM E;  1H74 A;  3GON A;  3HUL A;  2ZIT A;  4DPY A;  3OTO E;  1XMQ E;  1HNW I;  3B8H A;  4KQV A;  1Z5C A;  4GKJ I;  4JI4 I;  1FJG I;  2R42 A;  4X62 I;  4LF4 I;  4GKK I;  3M6A A;  1ZM3 A;  1XHK A;  4JI4 E;  4YY3 E;  4DR1 E;  3PYE A;  1EA6 A;  2R3V A;  1HNW E;  1IBL E;  4NXM E;  3OTO I;  1XMQ I;  4DR7 E;  1MX0 A;  3QT7 A;  2WW4 A;  3PYD A;  3K1J A;  1K47 A;  3ZZT A;  1UEK A;  2HHH I;  3PYG A;  4LFA I;  1MU5 A;  2UUC I;  1ZXN A;  4JV5 I;  4JI6 I;  4DUY I;  5FLX C;  1FI4 A;  4X65 I;  4AQY E;  4X65 E;  4LF8 I;  1XNR I;  3T1Y I;  4DUY E;  4JI3 I;  4P7A A;  4DV0 E;  2UUC E;  2A2C A;  4LF6 E;  4OX9 I;  4DV2 E;  1FKA E;  3WU3 A;  3F0N A;  4MYU A;  1N0V C;  1Z59 A;  4B3S E;  2DEI A;  3ZKB A;  3J7A M;  4JI0 E;  1NHH A;  1Z5B A;  1KIJ A;  1J5E I;  4MYT A;  5LMN I;  2UUA E;  5BR8 E;  1S16 A;  2LJP A;  4DR3 I;  1QZR A;  4GKJ E;  3LPS A;  5L3J A;  1N36 E;  3J7A G;  4LF5 I;  4X64 I;  1HNX E;  4DPW A;  4NXN I;  1FWK A;  1H7U A;  5GMD A;  1N34 E;  2UXB I;  5IT9 C;  2EFG A;  4R1F A;  4B3M E;  2OI2 A;  2A2D A;  4JI7 E;  4DV3 I;  1N33 E;  4JI2 E;  4DR6 E;  5IT9 Q;  4USK A;  1I94 I;  4DPU A;  3QT8 A;  1N32 I;  2VQF E;  2UUB E;  4DUZ I;  5GME A;  1H73 A;  5A2Q Q;  4YHH E;  2V2Z A;  4JI8 E;  4B3R E;  1I94 E;  1NHI A;  1ZM9 A;  4JI2 I;  4DU8 A;  4DV3 E;  2F4V E;  1VIS A;  2UXD E;  1PKP A;  4RPF A;  1FNM A;  1ZM4 A;  3ZKD A;  1N34 I;  4B3T I;  1NZ0 A;  4WUC A;  3WU5 A;  1ELO A;  4NXN E;  1Z0W A;  2UXC I;  1HR0 I;  4LF5 E; 
#chains in the Genus database with same CATH topology
 3D4J A;  1XNQ I;  2X7I A;  2ZBK B;  2CGE A;  3HJC A;  4DV1 E;  1S4E A;  4DV7 E;  4DR2 I;  1EI1 A;  4AM3 A;  2UUA I;  3CWV A;  1ZXM A;  4DR2 E;  4JYA E;  4DV7 I;  4DV1 I;  4LPF A;  1J5E E;  1XNQ E;  4URL A;  2Z5C B;  2HFU A;  4LCF A;  1Z0C A;  2E5L I;  1UDS A;  2IOP A;  4JI0 I;  3U1K A;  4HY1 A;  4MU3 A;  1PIE A;  3T1H E;  1Y4U A;  1D6T A;  2O3Z A;  4HAC B;  4ZVI A;  4DR5 E;  4WUD A;  4U3B A;  2JEB B;  4NBQ A;  4PRX A;  5DNX A;  4I3H A;  4X66 E;  3U1Y A;  4LFB E;  3H1C A;  2BM1 A;  3L7Z A;  2UU9 I;  1R6M A;  4OX9 E;  4LF6 I;  4UT4 A;  3WU4 A;  2ZM6 I;  2C39 A;  2F4V I;  2J7K A;  4DV0 I;  1KVK A;  4FN5 A;  3ZZU A;  3K17 A;  5FLX Q;  1PVG A;  3T1Y E;  2CZ9 A;  4JI1 I;  4JI5 I;  1XNR E;  4YHH I;  5LMU E;  4DR4 E;  4USM A;  2UUB I;  5DRR A;  4HAC A;  3H4L A;  1N32 E;  4OO1 C;  3M7N G;  4PRV A;  4DR6 I;  1N33 I;  4EMD A;  2V8P A;  4JI7 I;  4FW7 A;  4IFD F;  3QT6 A;  4FWG A;  2DEJ A;  1U2R A;  1E3P A;  2IOQ A;  1H72 C;  2UXB E;  2JEA B;  1DAR A;  4FW4 A;  1Y4S A;  3LNU A;  4DV5 E;  2GQ0 A;  4HYM A;  3PS2 A;  2C37 A;  1IBK E;  2BM0 A;  4DV6 E;  1IBL I;  4NXM I;  4K0K E;  2JE6 A;  1XMO I;  2JE6 B;  1HNX I;  3Q6N A;  4X64 E;  1N36 I;  4DR1 I;  3JAM C;  4DPX A;  4IZK A;  1B63 A;  4DR4 I;  4LF4 E;  4GKK E;  1BKN A;  5LMU I;  4X62 E;  5BR8 I;  4OO1 F;  2CVE A;  1FJG E;  2Q2E B;  4LCH A;  1USV A;  1UDQ A;  1USU A;  4OZE A;  2V34 A;  2PNM A;  1RHY A;  3J81 C;  2ZM6 E;  4IFD C;  2BA0 D;  1VI7 A;  2UU9 E;  2GS8 A;  2VF3 A;  3M85 G;  1HK7 A;  3L7Z B;  4X66 I;  1OJ4 A;  4B3S I;  1A6F A;  4BA2 A;  2O1T A;  3P3C A;  2F1D A;  3J81 Q;  3J80 C;  3T1H I;  2E1R A;  2NPF A;  1Z0E A;  4DPT A;  3PYF A;  3Q1Q A;  5DRO A;  4LF9 E;  4JYA I;  2NN6 A;  1HNZ I;  2JT2 A;  4LF8 E;  1OYR A;  4LFC E;  4AQY I;  3GME A;  1RRE A;  2IER A;  4FW3 A;  4JI6 E;  1R6L A;  1HR0 E;  2X36 A;  2JEA A;  1XMO E;  4K0K I;  3P06 A;  4DV6 I;  4LFA E;  1IBK I;  2GO4 A;  3GCM A;  4DV5 I;  2VQE E;  1OYS A;  2HKE A;  5DNL A;  4KHP E;  4IZJ D;  2HFS A;  4M1K A;  4AIM A;  4IZK B;  2HKJ A;  4DR7 I;  2VES A;  3ZZ0 A;  3LTO A;  4FWH A;  4FW9 A;  2HK2 A;  4DV4 E;  5IWA E;  4UTG A;  4YY3 I;  2NN6 E;  2Z5B B;  2VQF I;  2BA1 G;  4JI1 E;  4JI5 E;  3Q6M A;  4LOM A;  1FWL A;  4OO1 A;  4DU7 A;  2BR2 B;  4IFD B;  4LF7 I;  2WNR A;  2PNL A;  2NN6 C;  4B3M I;  2HK3 A;  1KKH A;  1Z5A A;  4PU9 A;  3ZM7 A;  1UDN A;  4FWD A;  1KTV A;  4LFB I;  1MG7 A;  5K36 C;  1YH8 A;  1XXE A;  4HXZ A;  4DR5 I;  4IZJ B;  1IBM I;  2AJ4 A;  5LL6 R;  2CG9 A;  5K36 E;  1OYP A;  3WU6 A;  2V2V A;  3B78 A;  4LF7 E;  2E5L E;  1Y60 A;  1WUU A;  4FW6 A;  4DR3 E;  3JAM Q;  3K85 A;  4ED4 A;  2WNR B;  1B62 A;  1Z0G A;  1NHJ A;  3V2U C;  5LMN E;  5IWA I;  2WP8 A;  3B82 A;  5EL9 A;  4DV4 I;  2NN6 F;  5JEA D;  2AE8 A;  4XTJ A;  2O1W A;  4LCG A;  4DXL A;  1YHC A;  2V2Q A;  3M7N D;  2UXC E;  1Z0B A;  3QT5 A;  5K36 F;  2BV3 A;  4KHP I;  2O1U A;  4BA1 B;  2VQE I;  1RR9 A;  4Z7Y A;  4B3T E;  1ZM2 A;  5A2Q C;  3J80 Q;  3V5R A;  4DV2 I;  4JG4 A;  4WUB A;  2C38 A;  2UXD I;  4BA2 B;  4JI3 E;  1Z0V A;  1Z0T A;  1H7S A;  4MU4 A;  4JI8 I;  4B3R I;  4MQY A;  4LFC I;  1HNZ E;  4IFD E;  4DUZ E;  4JV5 E;  4MDT A;  2XEX A;  3CDI A;  4LF9 I;  4BA1 A;  4P52 A;  1Y5Y A;  1N0U A;  4IS9 A;  4Z7C A;  2BA0 G;  3PRY A;  2HHH E;  5C0X C;  3UHM A;  5K36 B;  1IBM E;  1H74 A;  1P42 A;  3GON A;  3HUL A;  2ZIT A;  4DPY A;  3OTO E;  3P3G A;  1XMQ E;  2C38 B;  1HNW I;  3B8H A;  3NZK A;  4KQV A;  1Z5C A;  5JEA C;  2PO1 B;  4GKJ I;  4JI4 I;  2PO2 A;  4N3O A;  1FJG I;  5JEA E;  2GO3 A;  2R42 A;  4X62 I;  3CDJ A;  4OO1 E;  4LF4 I;  4GKK I;  3M6A A;  1ZM3 A;  1XHK A;  4JI4 E;  4YY3 E;  4DR1 E;  3PYE A;  1EA6 A;  2R3V A;  1HNW E;  5C0X F;  2NN6 B;  5FWK A;  1IBL E;  4NXM E;  5DRP A;  3OTO I;  1XMQ I;  4DR7 E;  1E3H A;  1MX0 A;  2J65 A;  5DRQ A;  3PS1 A;  1Y6Z A;  3QT7 A;  2WW4 A;  2C39 B;  3PYD A;  5K36 A;  3K1J A;  5EKW A;  1K47 A;  3ZZT A;  1UEK A;  2IES A;  2PO0 A;  2PO2 B;  3HKM A;  2HHH I;  2NN6 D;  5JEA F;  3PYG A;  4LFA I;  1MU5 A;  2UUC I;  4IZJ A;  1ZXN A;  4JV5 I;  4JI6 I;  1UDO A;  4DUY I;  3PS3 A;  4FW5 A;  5FLX C;  1FI4 A;  4X65 I;  4AQY E;  4MU1 A;  4X65 E;  4LF8 I;  1XNR I;  3T1Y I;  4DUY E;  4JI3 I;  4P7A A;  4DV0 E;  2PNZ B;  2UUC E;  2A2C A;  4LF6 E;  2PO0 B;  4OX9 I;  4DV2 E;  1FKA E;  4IFD D;  4GQU A;  3WU3 A;  3F0N A;  5C0X D;  4MYU A;  1N0V C;  3M85 D;  1Z59 A;  4OKG A;  2PO1 A;  4B3S E;  2DEI A;  3ZKB A;  3J7A M;  4JI0 E;  4QNJ A;  2O1V A;  5JEA B;  1NHH A;  1Z5B A;  3DD6 A;  1KIJ A;  4OO1 D;  1J5E I;  4AID A;  4MYT A;  5LMN I;  2UUA E;  5BR8 E;  2Z5B A;  1S16 A;  2LJP A;  4DR3 I;  1QZR A;  4GKJ E;  2Z5E A;  3LPS A;  3P3E A;  5L3J A;  1N36 E;  4LF5 I;  4X64 I;  3J7A G;  1HNX E;  4DPW A;  4NXN I;  2BA1 D;  1FWK A;  2WP8 B;  2C37 B;  5C0X A;  1H7U A;  5ELW A;  5C0X B;  5GMD A;  1N34 E;  2UXB I;  5IT9 C;  2EFG A;  4R1F A;  3P76 A;  4B3M E;  3KRN A;  2OI2 A;  2A2D A;  4JI7 E;  4U3D A;  4DV3 I;  1N33 E;  4JI2 E;  4DR6 E;  5IT9 Q;  5JEA A;  3GLL A;  4USK A;  2JEB A;  4DPU A;  1I94 I;  3QT8 A;  1N32 I;  3B4T A;  2VQF E;  2UUB E;  2PNZ A;  4DUZ I;  5GME A;  1H73 A;  5A2Q Q;  4QNK A;  4YHH E;  2V2Z A;  4JI8 E;  4B3R E;  1I94 E;  1NHI A;  1ZM9 A;  4ISA A;  4JI2 I;  4OO1 B;  4DU8 A;  4DV3 E;  2BR2 A;  4IFD A;  2F4V E;  1VIS A;  2UXD E;  5C0X E;  1PKP A;  4RPF A;  1FNM A;  1ZM4 A;  5K36 D;  3ZKD A;  2Z5C A;  4J3D A;  1N34 I;  4B3T I;  1NZ0 A;  4WUC A;  3WU5 A;  1ELO A;  4MU0 A;  4NXN E;  1Z0W A;  2UXC I;  1HR0 I;  4LF5 E; 
#chains in the Genus database with same CATH homology
 3D4J A;  1XNQ I;  2X7I A;  2ZBK B;  2CGE A;  3HJC A;  4DV1 E;  1S4E A;  4DV7 E;  4DR2 I;  1EI1 A;  2UUA I;  3CWV A;  1ZXM A;  4DR2 E;  4JYA E;  4DV7 I;  4DV1 I;  1J5E E;  1XNQ E;  4URL A;  2Z5C B;  2HFU A;  1Z0C A;  2E5L I;  2IOP A;  4JI0 I;  4HY1 A;  1PIE A;  3T1H E;  1Y4U A;  1D6T A;  4HAC B;  4ZVI A;  4DR5 E;  4WUD A;  4PRX A;  4I3H A;  4X66 E;  4LFB E;  2BM1 A;  2UU9 I;  4OX9 E;  4LF6 I;  4UT4 A;  3WU4 A;  2ZM6 I;  2F4V I;  2J7K A;  4DV0 I;  1KVK A;  4FN5 A;  3ZZU A;  3K17 A;  5FLX Q;  1PVG A;  3T1Y E;  2CZ9 A;  4JI1 I;  4JI5 I;  1XNR E;  4YHH I;  5LMU E;  4DR4 E;  4USM A;  2UUB I;  4HAC A;  3H4L A;  1N32 E;  4PRV A;  4DR6 I;  1N33 I;  4EMD A;  2V8P A;  4JI7 I;  3QT6 A;  4FWG A;  2DEJ A;  1U2R A;  2IOQ A;  1H72 C;  2UXB E;  1DAR A;  1Y4S A;  3LNU A;  4DV5 E;  2GQ0 A;  4HYM A;  1IBK E;  2BM0 A;  4DV6 E;  1IBL I;  4NXM I;  4K0K E;  1XMO I;  1HNX I;  3Q6N A;  4X64 E;  1N36 I;  4DR1 I;  3JAM C;  4DPX A;  4IZK A;  1B63 A;  4DR4 I;  4LF4 E;  4GKK E;  1BKN A;  5LMU I;  4X62 E;  5BR8 I;  1FJG E;  2Q2E B;  1USV A;  1USU A;  2V34 A;  2PNM A;  3J81 C;  2ZM6 E;  2UU9 E;  2GS8 A;  2VF3 A;  1HK7 A;  4X66 I;  1OJ4 A;  4B3S I;  1A6F A;  2O1T A;  3J81 Q;  3J80 C;  3T1H I;  2E1R A;  2NPF A;  1Z0E A;  4DPT A;  3PYF A;  3Q1Q A;  4LF9 E;  4JYA I;  4LF8 E;  1HNZ I;  4LFC E;  4AQY I;  1RRE A;  4JI6 E;  1HR0 E;  2X36 A;  1XMO E;  4K0K I;  3P06 A;  4DV6 I;  4LFA E;  1IBK I;  4DV5 I;  2VQE E;  2HKE A;  4KHP E;  4IZJ D;  2HFS A;  4M1K A;  4IZK B;  2HKJ A;  4DR7 I;  3ZZ0 A;  3LTO A;  4FWH A;  4FW9 A;  2HK2 A;  4DV4 E;  5IWA E;  4UTG A;  4YY3 I;  2Z5B B;  2VQF I;  4JI1 E;  4JI5 E;  3Q6M A;  1FWL A;  4DU7 A;  4LF7 I;  2PNL A;  4B3M I;  2HK3 A;  1KKH A;  1Z5A A;  4PU9 A;  3ZM7 A;  4FWD A;  1KTV A;  4LFB I;  1MG7 A;  4HXZ A;  4DR5 I;  4IZJ B;  1IBM I;  2AJ4 A;  5LL6 R;  2CG9 A;  3WU6 A;  2V2V A;  3B78 A;  4LF7 E;  2E5L E;  1WUU A;  4DR3 E;  3JAM Q;  3K85 A;  4ED4 A;  1B62 A;  1Z0G A;  1NHJ A;  3V2U C;  5LMN E;  5IWA I;  4DV4 I;  3B82 A;  4XTJ A;  2O1W A;  4DXL A;  2V2Q A;  2UXC E;  1Z0B A;  3QT5 A;  2BV3 A;  4KHP I;  2O1U A;  2VQE I;  1RR9 A;  4Z7Y A;  4B3T E;  1ZM2 A;  5A2Q C;  3J80 Q;  3V5R A;  4DV2 I;  4JG4 A;  4WUB A;  2UXD I;  4JI3 E;  1Z0V A;  1Z0T A;  1H7S A;  4JI8 I;  4B3R I;  4LFC I;  1HNZ E;  4DUZ E;  4JV5 E;  2XEX A;  4LF9 I;  4P52 A;  1N0U A;  4Z7C A;  3PRY A;  2HHH E;  1IBM E;  1H74 A;  3GON A;  3HUL A;  2ZIT A;  4DPY A;  3OTO E;  1XMQ E;  1HNW I;  3B8H A;  4KQV A;  1Z5C A;  4GKJ I;  4JI4 I;  4N3O A;  1FJG I;  2R42 A;  4X62 I;  4LF4 I;  4GKK I;  3M6A A;  1ZM3 A;  1XHK A;  4JI4 E;  4YY3 E;  4DR1 E;  3PYE A;  1EA6 A;  2R3V A;  1HNW E;  1IBL E;  4NXM E;  5FWK A;  3OTO I;  1XMQ I;  4DR7 E;  1MX0 A;  1Y6Z A;  3QT7 A;  2WW4 A;  3PYD A;  3K1J A;  1K47 A;  3ZZT A;  1UEK A;  2HHH I;  3PYG A;  4LFA I;  1MU5 A;  2UUC I;  4IZJ A;  1ZXN A;  4JV5 I;  4JI6 I;  4DUY I;  5FLX C;  1FI4 A;  4X65 I;  4AQY E;  4X65 E;  4LF8 I;  1XNR I;  3T1Y I;  4DUY E;  4JI3 I;  4DV0 E;  4P7A A;  2UUC E;  2A2C A;  4LF6 E;  4OX9 I;  4DV2 E;  1FKA E;  3WU3 A;  3F0N A;  4MYU A;  1N0V C;  1Z59 A;  4B3S E;  2DEI A;  3ZKB A;  3J7A M;  4JI0 E;  2O1V A;  1NHH A;  1Z5B A;  1KIJ A;  1J5E I;  4MYT A;  5LMN I;  2UUA E;  5BR8 E;  2Z5B A;  1S16 A;  2LJP A;  4DR3 I;  1QZR A;  4GKJ E;  2Z5E A;  3LPS A;  5L3J A;  1N36 E;  3J7A G;  4LF5 I;  4X64 I;  1HNX E;  4DPW A;  4NXN I;  1FWK A;  1H7U A;  5GMD A;  1N34 E;  2UXB I;  5IT9 C;  2EFG A;  4R1F A;  4B3M E;  2OI2 A;  2A2D A;  4JI7 E;  4DV3 I;  1N33 E;  4JI2 E;  4DR6 E;  5IT9 Q;  4USK A;  1I94 I;  4DPU A;  3QT8 A;  1N32 I;  2VQF E;  2UUB E;  4DUZ I;  5GME A;  1H73 A;  5A2Q Q;  4YHH E;  2V2Z A;  4JI8 E;  4B3R E;  1I94 E;  1NHI A;  1ZM9 A;  4JI2 I;  4DU8 A;  4DV3 E;  2F4V E;  1VIS A;  2UXD E;  1PKP A;  4RPF A;  1FNM A;  1ZM4 A;  3ZKD A;  2Z5C A;  1N34 I;  4B3T I;  1NZ0 A;  4WUC A;  3WU5 A;  1ELO A;  4NXN E;  1Z0W A;  2UXC I;  1HR0 I;  4LF5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...