1NZ0A

Rnase p protein from thermotoga maritima
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
ERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGMDYSRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIPKGFDIVVIPRKKLSEEFERVDFWTVREKLLNLLKRIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component
publication title High-resolution structure of RNase P protein from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 34
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1nz0A00
1PKPA 2ZBKB 1N0UA 3D4JA 4DR6E 2UXDE 4LF7I 4JI1E 1Z0VA 2HHHI 4DR2I 2UXCI 2F4VE 3JAMC 5BR8E 4LF4E 2UUAE 1BKNA 1KVKA 4B3TI 4LFAE 1PVGA 1PIEA 3V5RA 4NXNI 4B3RE 3T1YE 1J5EE 5LMUI 1H74A 4URLA 1EA6A 4JYAE 4LFCE 3K17A 4DV3I 4WUDA 1RR9A 4LF7E 1U2RA 4DR2E 4AQYI 2NPFA 2R3VA 2GS8A 4YHHI 2DEJA 4JI7E 4FN5A 3J80C 4DV0E 4DR7E 4JI4E 1Z0BA 4FWDA 4NXNE 3QT5A 1EI1A 2X36A 5LMUE 4MYTA 3WU3A 2HFSA 2HFUA 4LF8I 1MX0A 4X64I 4DV3E 1XMOI 3J81Q 4P7AA 4DUZI 4X65E 1HNXI 4AQYE 4YY3I 4DV1I 4Z7CA 1ZM9A 1Z5AA 5FLXQ 5A2QC 2J7KA 5L3JA 3ZKDA 2UUCE 1ZXMA 3GONA 4DV5I 4X62I 3ZZTA 4X66E 4DR3E 3PYGA 4NXMI 4LF6E 1IBLI 4DU7A 4LF8E 1Z0WA 4X64E 1ELOA 3QT7A 4DR6I 3WU5A 3T1HI 1HNXE 2V8PA 2F4VI 4PRVA 2HK3A 1DARA 4GKJI 2X7IA 2E5LE 4USKA 1XNQE 3PYFA 4KHPE 1HNWI 4DV6E 4B3RI 3T1YI 4DXLA 4RPFA 4NXME 1IBLE 2R42A 5LMNE 4HACB 2HKEA 3T1HE 4ED4A 4PRXA 3V2UC 3LPSA 1Z0GA 4GKJE 2AJ4A 4B3SI 4JI7I 4UT4A 1HR0E 4DV0I 4DV7I 4DR7I 4JI4I 1HNWE 4FWGA 1ZM4A 4DU8A 3QT8A 4FW9A 2WW4A 4USMA 4ZVIA 1ZXNA 1NHJA 1Z0TA 3B82A 2UU9E 4MYUA 4X65I 4DUYE 3QT6A 3J7AM 3HULA 2E1RA 5IT9C 1N0VC 3H4LA 4B3SE 4JI2I 5IWAE 4DV7E 1MG7A 2UUCI 4DV4I 4GKKI 4JI8I 4X66I 1QZRA 4DR3I 1XNRE 4LF6I 2UUBE 4JI5E 1XMQE 1FWKA 1ZM3A 1H72C 2ZM6E 2OI2A 3ZKBA 2UXBI 1NHIA 3M6AA 2E5LI 5GMDA 1XNQI 4KHPI 4JI2E 2LJPA 4DV6I 1Z0EA 3B8HA 3ZZUA 1H73A 3ZZ0A 4LFBI 5LL6R 4DV4E 4DR4E 4GKKE 4K0KI 4JI8E 2HK2A 4DPWA 1N32E 5LMNI 4LF9E 4HYMA 4DR5I 1FWLA 3JAMQ 1MU5A 4DV2I 2UXBE 1NZ0A 4I3HA 3WU4A 1FNMA 1OJ4A 1HR0I 3F0NA 2V2QA 3PYEA 4B3MI 4LFBE 1WUUA 3J81C 4K0KE 1ZM2A 3WU6A 1K47A 4JI0E 4M1KA 4HACA 2V34A 2UU9I 4WUCA 4JI3I 4DR5E 5FLXC 4DUYI 4LF5I 3ZM7A 2HKJA 4DV2E 2XEXA 1HNZI 1S4EA 2V2ZA 3J80Q 2VF3A 5IWAI 1N36I 4UTGA 3OTOE 1FJGE 4B3ME 2BV3A 1B63A 2CZ9A 2V2VA 1D6TA 1XNRI 2UUBI 1A6FA 1IBMI 4JI5I 1XMQI 1N34E 1IBKI 4JI3E 4DR1I 1I94E 1UEKA 2ZM6I 4HXZA 4LF5E 3J7AG 1HNZE 1N33E 1KIJA 5A2QQ 1Z5BA 4OX9I 1NHHA 4P52A 1N36E 2A2CA 3K1JA 1B62A 4DPYA 4DR4I 1Z59A 2HHHE 2UXCE 2EFGA 1IBME 4XTJA 2VQEI 1N32I 4B3TE 1H7UA 1IBKE 4LF9I 4DR1E 3CWVA 4JI6I 1Z5CA 1Z0CA 4HY1A 4OX9E 4DPUA 1S16A 4Z7YA 4DPXA 4PU9A 4JG4A 1XHKA 3PYDA 1FI4A 4WUBA 2VQFI 2VQEE 4JV5I 4JI0I 3B78A 4EMDA 4YHHE 1FKAE 3LTOA 1H7SA 2DEIA 4JI6E 1VISA 3LNUA 3OTOI 1FJGI 1XMOE 2A2DA 2Q2EB 2UXDI 4DUZE 1KTVA 1KKHA 4JI1I 4R1FA 2VQFE 4YY3E 4DV1E 4JV5E 5BR8I 4LF4I 2UUAI 1N34I 2ZITA 4LFAI 1RREA 1I94I 1J5EI 1N33I 5IT9Q 4DV5E 2BM0A 3Q1QA 4DPTA 2BM1A 4JYAI 5GMEA 4X62E 4KQVA 4LFCI 4FWHA
chains in the Genus database with same CATH superfamily
1PKPA 2ZBKB 1N0UA 3D4JA 4U3DA 4DR6E 2UXDE 4LF7I 2NN6A 1Z0VA 2HHHI 4DR2I 4JI1E 2UXCI 2F4VE 3JAMC 2Z5CA 2GO4A 5BR8E 2UUAE 4LF4E 1BKNA 1KVKA 4B3TI 4LFAE 1PVGA 4IZKA 1E3HA 2BA0G 4ISAA 1PIEA 3V5RA 4NXNI 4B3RE 3T1YE 1UDQA 1J5EE 5LMUI 1H74A 4URLA 2BR2A 2BR2B 1EA6A 2C37A 4JYAE 3H1CA 4LFCE 3K17A 4DV3I 2J65A 4WUDA 1RR9A 4LF7E 1U2RA 4DR2E 4J3DA 4AQYI 4MQYA 2NPFA 2R3VA 2GS8A 4YHHI 2DEJA 4JI7E 4FN5A 1UDNA 2F1DA 3J80C 3B4TA 4DV0E 4OO1D 4DR7E 2WNRA 4JI4E 1Z0BA 2WNRB 4FWDA 4NXNE 3QT5A 1EI1A 2X36A 5LMUE 1UDOA 4MYTA 3WU3A 2HFSA 4AIMA 2HFUA 4OO1F 4LF8I 1MX0A 4GQUA 4X64I 4DV3E 1XMOI 1OYPA 3J81Q 4P7AA 4DUZI 4X65E 1HNXI 2PO0B 4AQYE 4IFDA 4YY3I 4DV1I 3KRNA 4Z7CA 1ZM9A 1Z5AA 5FLXQ 1Y6ZA 5A2QC 2J7KA 5L3JA 3ZKDA 2UUCE 1ZXMA 5DROA 1RHYA 3GONA 4DV5I 3GCMA 4LCGA 4X62I 5DNLA 3ZZTA 4X66E 4U3BA 4DR3E 3PYGA 4NXMI 4LF6E 1IBLI 4DU7A 4LF8E 1OYRA 1Z0WA 4X64E 2C38B 1ELOA 3QT7A 4DR6I 3WU5A 3T1HI 2NN6F 1HNXE 2V8PA 2F4VI 3PS1A 5DRPA 2O1VA 4IZJA 4PRVA 2HK3A 1DARA 4BA2A 4GKJI 2X7IA 2E5LE 4USKA 1XNQE 4BA1B 3PYFA 2CVEA 4KHPE 4MU1A 1HNWI 4DV6E 1YH8A 3T1YI 4B3RI 2PNLA 4OO1C 4DXLA 4MU3A 1E3PA 4FW5A 4FW4A 4RPFA 5K36F 4NXME 3PRYA 2O1TA 1IBLE 5JEAA 2R42A 5LMNE 4HACB 2HKEA 3T1HE 4ED4A 4PRXA 5DRRA 3V2UC 5JEAB 3LPSA 4MDTA 4FW7A 4NBQA 1Z0GA 4GKJE 2AJ4A 1HK7A 2GO3A 4B3SI 4JI7I 4MU4A 4UT4A 1HR0E 4DV0I 4DV7I 4DR7I 3DD6A 4JI4I 1HNWE 4FWGA 1ZM4A 4DU8A 3QT8A 4FW9A 2WW4A 2PNZB 2GQ0A 4USMA 1Y5YA 4ZVIA 2NN6C 1ZXNA 1NHJA 1Z0TA 5JEAE 3B82A 2UU9E 4MYUA 4X65I 4DUYE 2PNMA 3QT6A 3J7AM 4IFDF 1R6MA 1USUA 1Y4UA 3HULA 2E1RA 5IT9C 3M7ND 1N0VC 3H4LA 4B3SE 2IERA 4JI2I 5IWAE 4DV7E 1MG7A 5DRQA 2PO1A 2PO1B 2UUCI 3P76A 1P42A 5C0XF 5K36C 4N3OA 4DV4I 4GKKI 4JI8I 4X66I 1QZRA 4DR3I 1XNRE 2C39B 3P3GA 2UUBE 4JI5E 4LF6I 1XMQE 1FWKA 1YHCA 2Z5BA 1ZM3A 1H72C 2Z5BB 2ZM6E 2OI2A 2PO0A 3ZKBA 4QNKA 2UXBI 1NHIA 3M6AA 2E5LI 5GMDA 1XNQI 4KHPI 3P3CA 4JI2E 2LJPA 4DV6I 5ELWA 1Z0EA 3B8HA 3ZZUA 1H73A 3ZZ0A 4LFBI 5LL6R 4DV4E 4DR4E 4GKKE 2NN6D 4K0KI 4JI8E 2HK2A 5JEAF 4DPWA 1N32E 2C38A 5LMNI 4LF9E 4HYMA 4DR5I 4IFDC 3PS2A 4LCFA 1FWLA 3JAMQ 1MU5A 4DV2I 2UXBE 4QNJA 1NZ0A 4I3HA 3PS3A 3WU4A 4BA1A 1FNMA 1OJ4A 1HR0I 5K36D 3F0NA 5C0XC 2V2QA 4OO1A 4OO1B 3PYEA 2VESA 3P3EA 2BA1D 4B3MI 2JEAA 2JEAB 4LFBE 4OKGA 3U1YA 1WUUA 3J81C 4K0KE 2IOQA 1ZM2A 3WU6A 1K47A 4JI0E 4M1KA 4HACA 2V34A 2UU9I 4WUCA 4JI3I 4DR5E 3K85A 4AIDA 5FLXC 4DUYI 3GMEA 4LF5I 3ZM7A 2HKJA 4DV2E 2XEXA 1HNZI 1S4EA 2PO2A 2V2ZA 2PO2B 3J80Q 2VF3A 5IWAI 3M85D 1N36I 4UTGA 3OTOE 2O3ZA 1FJGE 2PNZA 4OO1E 4B3ME 5JEAC 2BV3A 1B63A 2CZ9A 2V2VA 1D6TA 1XNRI 2NN6B 2UUBI 1A6FA 1IBMI 4JI5I 4IFDD 4MU0A 2Z5CB 1XMQI 3Q6MA 1N34E 1IBKI 1UDSA 4JI3E 4IZKB 4DR1I 1I94E 1UEKA 1Y60A 4LPFA 2BA0D 2ZM6I 4HXZA 4LF5E 3CDIA 3J7AG 4LOMA 1HNZE 1N33E 5C0XD 1KIJA 1Y4SA 3M7NG 5A2QQ 1Z5BA 2IESA 2C37B 2O1WA 4OX9I 5K36A 1NHHA 4P52A 1N36E 5K36B 2A2CA 3K1JA 1B62A 2JT2A 3P06A 3UHMA 2CG9A 4DPYA 3Q6NA 4DR4I 1Z59A 3HKMA 2C39A 2HHHE 4IZJD 2EFGA 1IBME 2UXCE 4XTJA 2NN6E 2VQEI 1N32I 4B3TE 1H7UA 1IBKE 4LF9I 4DR1E 1XXEA 3CWVA 4JI6I 1Z5CA 5EKWA 1Z0CA 3NZKA 3GLLA 4FW6A 4HY1A 4OX9E 5DNXA 5JEAD 4DPUA 5K36E 1S16A 4Z7YA 4DPXA 4PU9A 4JG4A 1XHKA 3PYDA 1FI4A 4WUBA 4IS9A 2VQEE 2VQFI 4JV5I 4LCHA 4IFDB 4JI0I 3B78A 4EMDA 4YHHE 4FW3A 4AM3A 1FKAE 1VI7A 3LTOA 1H7SA 2JE6A 1USVA 2JE6B 4OZEA 2DEIA 4JI6E 2IOPA 5C0XA 5C0XB 5FWKA 5EL9A 1VISA 3LNUA 3OTOI 3CDJA 1FJGI 2BA1G 1XMOE 2CGEA 2A2DA 2Q2EB 2UXDI 4DUZE 3L7ZA 1KTVA 1KKHA 4JI1I 3L7ZB 1R6LA 4R1FA 2VQFE 4YY3E 4IZJB 4DV1E 4JV5E 4BA2B 5BR8I 4LF4I 2JEBA 2UUAI 1N34I 2JEBB 2ZITA 4LFAI 2O1UA 4IFDE 1RREA 1I94I 2AE8A 1J5EI 1N33I 5IT9Q 4DV5E 2BM0A 3Q1QA 4DPTA 2BM1A 5C0XE 5GMEA 4JYAI 4X62E 3M85G 4KQVA 2WP8A 3U1KA 3HJCA 4LFCI 2WP8B 1OYSA 2Z5EA 4FWHA
chains in the Genus database with same CATH topology
1PKPA 2ZBKB 1N0UA 3D4JA 4DR6E 2UXDE 4LF7I 4JI1E 1Z0VA 2HHHI 4DR2I 2UXCI 2F4VE 3JAMC 2Z5CA 5BR8E 4LF4E 2UUAE 1BKNA 1KVKA 4B3TI 4LFAE 1PVGA 4IZKA 1PIEA 3V5RA 4NXNI 4B3RE 3T1YE 1J5EE 5LMUI 1H74A 4URLA 1EA6A 4JYAE 4LFCE 3K17A 4DV3I 4WUDA 1RR9A 4LF7E 1U2RA 4DR2E 4AQYI 2NPFA 2R3VA 2GS8A 4YHHI 2DEJA 4JI7E 4FN5A 3J80C 4DV0E 4DR7E 4JI4E 1Z0BA 4FWDA 4NXNE 3QT5A 1EI1A 2X36A 5LMUE 4MYTA 3WU3A 2HFSA 2HFUA 4LF8I 1MX0A 4X64I 4DV3E 1XMOI 3J81Q 4P7AA 4DUZI 4X65E 1HNXI 4AQYE 4YY3I 4DV1I 4Z7CA 1ZM9A 1Z5AA 5FLXQ 1Y6ZA 5A2QC 2J7KA 5L3JA 3ZKDA 2UUCE 1ZXMA 3GONA 4DV5I 4X62I 3ZZTA 4X66E 4DR3E 3PYGA 4NXMI 4LF6E 1IBLI 4DU7A 4LF8E 1Z0WA 4X64E 1ELOA 3QT7A 4DR6I 3WU5A 3T1HI 1HNXE 2V8PA 2F4VI 2O1VA 4IZJA 4PRVA 2HK3A 1DARA 4GKJI 2X7IA 2E5LE 4USKA 1XNQE 3PYFA 4KHPE 1HNWI 4DV6E 4B3RI 3T1YI 2PNLA 4DXLA 4RPFA 4NXME 3PRYA 2O1TA 1IBLE 2R42A 5LMNE 4HACB 2HKEA 3T1HE 4ED4A 4PRXA 3V2UC 3LPSA 1Z0GA 4GKJE 2AJ4A 1HK7A 4B3SI 4JI7I 4UT4A 1HR0E 4DV0I 4DV7I 4DR7I 4JI4I 1HNWE 4FWGA 1ZM4A 4DU8A 3QT8A 4FW9A 2WW4A 2GQ0A 4USMA 4ZVIA 1ZXNA 1NHJA 1Z0TA 3B82A 2UU9E 4MYUA 4X65I 4DUYE 2PNMA 3QT6A 3J7AM 1USUA 1Y4UA 3HULA 2E1RA 5IT9C 1N0VC 3H4LA 4B3SE 4JI2I 5IWAE 4DV7E 1MG7A 2UUCI 4N3OA 4DV4I 4GKKI 4JI8I 4X66I 1QZRA 4DR3I 1XNRE 4LF6I 2UUBE 4JI5E 1XMQE 1FWKA 2Z5BA 1ZM3A 1H72C 2Z5BB 2ZM6E 2OI2A 3ZKBA 2UXBI 1NHIA 3M6AA 2E5LI 5GMDA 1XNQI 4KHPI 4JI2E 2LJPA 4DV6I 1Z0EA 3B8HA 3ZZUA 1H73A 3ZZ0A 4LFBI 5LL6R 4DV4E 4DR4E 4GKKE 4K0KI 4JI8E 2HK2A 4DPWA 1N32E 5LMNI 4LF9E 4HYMA 4DR5I 1FWLA 3JAMQ 1MU5A 4DV2I 2UXBE 1NZ0A 4I3HA 3WU4A 1FNMA 1OJ4A 1HR0I 3F0NA 2V2QA 3PYEA 4B3MI 4LFBE 1WUUA 3J81C 4K0KE 2IOQA 1ZM2A 3WU6A 1K47A 4JI0E 4M1KA 4HACA 2V34A 2UU9I 4WUCA 4JI3I 4DR5E 3K85A 5FLXC 4DUYI 4LF5I 3ZM7A 2HKJA 4DV2E 2XEXA 1HNZI 1S4EA 2V2ZA 3J80Q 2VF3A 5IWAI 1N36I 4UTGA 3OTOE 1FJGE 4B3ME 2BV3A 1B63A 2CZ9A 2V2VA 1D6TA 1XNRI 2UUBI 1A6FA 1IBMI 4JI5I 2Z5CB 1XMQI 3Q6MA 1N34E 1IBKI 4JI3E 4IZKB 4DR1I 1I94E 1UEKA 2ZM6I 4HXZA 4LF5E 3J7AG 1HNZE 1N33E 1KIJA 1Y4SA 5A2QQ 1Z5BA 2O1WA 4OX9I 1NHHA 4P52A 1N36E 2A2CA 3K1JA 1B62A 3P06A 2CG9A 4DPYA 3Q6NA 4DR4I 1Z59A 2HHHE 4IZJD 2EFGA 1IBME 2UXCE 4XTJA 2VQEI 1N32I 4B3TE 1H7UA 1IBKE 4LF9I 4DR1E 3CWVA 4JI6I 1Z5CA 1Z0CA 4HY1A 4OX9E 4DPUA 1S16A 4Z7YA 4DPXA 4PU9A 4JG4A 1XHKA 3PYDA 1FI4A 4WUBA 2VQFI 2VQEE 4JV5I 4JI0I 3B78A 4EMDA 4YHHE 1FKAE 3LTOA 1H7SA 1USVA 2DEIA 4JI6E 2IOPA 5FWKA 1VISA 3LNUA 3OTOI 1FJGI 1XMOE 2CGEA 2A2DA 2Q2EB 2UXDI 4DUZE 1KTVA 1KKHA 4JI1I 4R1FA 2VQFE 4YY3E 4IZJB 4DV1E 4JV5E 5BR8I 4LF4I 2UUAI 1N34I 2ZITA 4LFAI 2O1UA 1RREA 1I94I 1J5EI 1N33I 5IT9Q 4DV5E 2BM0A 3Q1QA 4DPTA 2BM1A 4JYAI 5GMEA 4X62E 4KQVA 3HJCA 4LFCI 2Z5EA 4FWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKP A;  2ZBK B;  1N0U A;  3D4J A;  4DR6 E;  2UXD E;  4LF7 I;  4JI1 E;  1Z0V A;  2HHH I;  4DR2 I;  2UXC I;  2F4V E;  3JAM C;  5BR8 E;  4LF4 E;  2UUA E;  1BKN A;  1KVK A;  4B3T I;  4LFA E;  1PVG A;  1PIE A;  3V5R A;  4NXN I;  4B3R E;  3T1Y E;  1J5E E;  5LMU I;  1H74 A;  4URL A;  1EA6 A;  4JYA E;  4LFC E;  3K17 A;  4DV3 I;  4WUD A;  1RR9 A;  4LF7 E;  1U2R A;  4DR2 E;  4AQY I;  2NPF A;  2R3V A;  2GS8 A;  4YHH I;  2DEJ A;  4JI7 E;  4FN5 A;  3J80 C;  4DV0 E;  4DR7 E;  4JI4 E;  1Z0B A;  4FWD A;  4NXN E;  3QT5 A;  1EI1 A;  2X36 A;  5LMU E;  4MYT A;  3WU3 A;  2HFS A;  2HFU A;  4LF8 I;  1MX0 A;  4X64 I;  4DV3 E;  1XMO I;  3J81 Q;  4P7A A;  4DUZ I;  4X65 E;  1HNX I;  4AQY E;  4YY3 I;  4DV1 I;  4Z7C A;  1ZM9 A;  1Z5A A;  5FLX Q;  5A2Q C;  2J7K A;  5L3J A;  3ZKD A;  2UUC E;  1ZXM A;  3GON A;  4DV5 I;  4X62 I;  3ZZT A;  4X66 E;  4DR3 E;  3PYG A;  4NXM I;  4LF6 E;  1IBL I;  4DU7 A;  4LF8 E;  1Z0W A;  4X64 E;  1ELO A;  3QT7 A;  4DR6 I;  3WU5 A;  3T1H I;  1HNX E;  2V8P A;  2F4V I;  4PRV A;  2HK3 A;  1DAR A;  4GKJ I;  2X7I A;  2E5L E;  4USK A;  1XNQ E;  3PYF A;  4KHP E;  1HNW I;  4DV6 E;  4B3R I;  3T1Y I;  4DXL A;  4RPF A;  4NXM E;  1IBL E;  2R42 A;  5LMN E;  4HAC B;  2HKE A;  3T1H E;  4ED4 A;  4PRX A;  3V2U C;  3LPS A;  1Z0G A;  4GKJ E;  2AJ4 A;  4B3S I;  4JI7 I;  4UT4 A;  1HR0 E;  4DV0 I;  4DV7 I;  4DR7 I;  4JI4 I;  1HNW E;  4FWG A;  1ZM4 A;  4DU8 A;  3QT8 A;  4FW9 A;  2WW4 A;  4USM A;  4ZVI A;  1ZXN A;  1NHJ A;  1Z0T A;  3B82 A;  2UU9 E;  4MYU A;  4X65 I;  4DUY E;  3QT6 A;  3J7A M;  3HUL A;  2E1R A;  5IT9 C;  1N0V C;  3H4L A;  4B3S E;  4JI2 I;  5IWA E;  4DV7 E;  1MG7 A;  2UUC I;  4DV4 I;  4GKK I;  4JI8 I;  4X66 I;  1QZR A;  4DR3 I;  1XNR E;  4LF6 I;  2UUB E;  4JI5 E;  1XMQ E;  1FWK A;  1ZM3 A;  1H72 C;  2ZM6 E;  2OI2 A;  3ZKB A;  2UXB I;  1NHI A;  3M6A A;  2E5L I;  5GMD A;  1XNQ I;  4KHP I;  4JI2 E;  2LJP A;  4DV6 I;  1Z0E A;  3B8H A;  3ZZU A;  1H73 A;  3ZZ0 A;  4LFB I;  5LL6 R;  4DV4 E;  4DR4 E;  4GKK E;  4K0K I;  4JI8 E;  2HK2 A;  4DPW A;  1N32 E;  5LMN I;  4LF9 E;  4HYM A;  4DR5 I;  1FWL A;  3JAM Q;  1MU5 A;  4DV2 I;  2UXB E;  1NZ0 A;  4I3H A;  3WU4 A;  1FNM A;  1OJ4 A;  1HR0 I;  3F0N A;  2V2Q A;  3PYE A;  4B3M I;  4LFB E;  1WUU A;  3J81 C;  4K0K E;  1ZM2 A;  3WU6 A;  1K47 A;  4JI0 E;  4M1K A;  4HAC A;  2V34 A;  2UU9 I;  4WUC A;  4JI3 I;  4DR5 E;  5FLX C;  4DUY I;  4LF5 I;  3ZM7 A;  2HKJ A;  4DV2 E;  2XEX A;  1HNZ I;  1S4E A;  2V2Z A;  3J80 Q;  2VF3 A;  5IWA I;  1N36 I;  4UTG A;  3OTO E;  1FJG E;  4B3M E;  2BV3 A;  1B63 A;  2CZ9 A;  2V2V A;  1D6T A;  1XNR I;  2UUB I;  1A6F A;  1IBM I;  4JI5 I;  1XMQ I;  1N34 E;  1IBK I;  4JI3 E;  4DR1 I;  1I94 E;  1UEK A;  2ZM6 I;  4HXZ A;  4LF5 E;  3J7A G;  1HNZ E;  1N33 E;  1KIJ A;  5A2Q Q;  1Z5B A;  4OX9 I;  1NHH A;  4P52 A;  1N36 E;  2A2C A;  3K1J A;  1B62 A;  4DPY A;  4DR4 I;  1Z59 A;  2HHH E;  2UXC E;  2EFG A;  1IBM E;  4XTJ A;  2VQE I;  1N32 I;  4B3T E;  1H7U A;  1IBK E;  4LF9 I;  4DR1 E;  3CWV A;  4JI6 I;  1Z5C A;  1Z0C A;  4HY1 A;  4OX9 E;  4DPU A;  1S16 A;  4Z7Y A;  4DPX A;  4PU9 A;  4JG4 A;  1XHK A;  3PYD A;  1FI4 A;  4WUB A;  2VQF I;  2VQE E;  4JV5 I;  4JI0 I;  3B78 A;  4EMD A;  4YHH E;  1FKA E;  3LTO A;  1H7S A;  2DEI A;  4JI6 E;  1VIS A;  3LNU A;  3OTO I;  1FJG I;  1XMO E;  2A2D A;  2Q2E B;  2UXD I;  4DUZ E;  1KTV A;  1KKH A;  4JI1 I;  4R1F A;  2VQF E;  4YY3 E;  4DV1 E;  4JV5 E;  5BR8 I;  4LF4 I;  2UUA I;  1N34 I;  2ZIT A;  4LFA I;  1RRE A;  1I94 I;  1J5E I;  1N33 I;  5IT9 Q;  4DV5 E;  2BM0 A;  3Q1Q A;  4DPT A;  2BM1 A;  4JYA I;  5GME A;  4X62 E;  4KQV A;  4LFC I;  4FWH A; 
#chains in the Genus database with same CATH topology
 1PKP A;  2ZBK B;  1N0U A;  3D4J A;  4U3D A;  4DR6 E;  2UXD E;  4LF7 I;  2NN6 A;  1Z0V A;  2HHH I;  4DR2 I;  4JI1 E;  2UXC I;  2F4V E;  3JAM C;  2Z5C A;  2GO4 A;  5BR8 E;  2UUA E;  4LF4 E;  1BKN A;  1KVK A;  4B3T I;  4LFA E;  1PVG A;  4IZK A;  1E3H A;  2BA0 G;  4ISA A;  1PIE A;  3V5R A;  4NXN I;  4B3R E;  3T1Y E;  1UDQ A;  1J5E E;  5LMU I;  1H74 A;  4URL A;  2BR2 A;  2BR2 B;  1EA6 A;  2C37 A;  4JYA E;  3H1C A;  4LFC E;  3K17 A;  4DV3 I;  2J65 A;  4WUD A;  1RR9 A;  4LF7 E;  1U2R A;  4DR2 E;  4J3D A;  4AQY I;  4MQY A;  2NPF A;  2R3V A;  2GS8 A;  4YHH I;  2DEJ A;  4JI7 E;  4FN5 A;  1UDN A;  2F1D A;  3J80 C;  3B4T A;  4DV0 E;  4OO1 D;  4DR7 E;  2WNR A;  4JI4 E;  1Z0B A;  2WNR B;  4FWD A;  4NXN E;  3QT5 A;  1EI1 A;  2X36 A;  5LMU E;  1UDO A;  4MYT A;  3WU3 A;  2HFS A;  4AIM A;  2HFU A;  4OO1 F;  4LF8 I;  1MX0 A;  4GQU A;  4X64 I;  4DV3 E;  1XMO I;  1OYP A;  3J81 Q;  4P7A A;  4DUZ I;  4X65 E;  1HNX I;  2PO0 B;  4AQY E;  4IFD A;  4YY3 I;  4DV1 I;  3KRN A;  4Z7C A;  1ZM9 A;  1Z5A A;  5FLX Q;  1Y6Z A;  5A2Q C;  2J7K A;  5L3J A;  3ZKD A;  2UUC E;  1ZXM A;  5DRO A;  1RHY A;  3GON A;  4DV5 I;  3GCM A;  4LCG A;  4X62 I;  5DNL A;  3ZZT A;  4X66 E;  4U3B A;  4DR3 E;  3PYG A;  4NXM I;  4LF6 E;  1IBL I;  4DU7 A;  4LF8 E;  1OYR A;  1Z0W A;  4X64 E;  2C38 B;  1ELO A;  3QT7 A;  4DR6 I;  3WU5 A;  3T1H I;  2NN6 F;  1HNX E;  2V8P A;  2F4V I;  3PS1 A;  5DRP A;  2O1V A;  4IZJ A;  4PRV A;  2HK3 A;  1DAR A;  4BA2 A;  4GKJ I;  2X7I A;  2E5L E;  4USK A;  1XNQ E;  4BA1 B;  3PYF A;  2CVE A;  4KHP E;  4MU1 A;  1HNW I;  4DV6 E;  1YH8 A;  3T1Y I;  4B3R I;  2PNL A;  4OO1 C;  4DXL A;  4MU3 A;  1E3P A;  4FW5 A;  4FW4 A;  4RPF A;  5K36 F;  4NXM E;  3PRY A;  2O1T A;  1IBL E;  5JEA A;  2R42 A;  5LMN E;  4HAC B;  2HKE A;  3T1H E;  4ED4 A;  4PRX A;  5DRR A;  3V2U C;  5JEA B;  3LPS A;  4MDT A;  4FW7 A;  4NBQ A;  1Z0G A;  4GKJ E;  2AJ4 A;  1HK7 A;  2GO3 A;  4B3S I;  4JI7 I;  4MU4 A;  4UT4 A;  1HR0 E;  4DV0 I;  4DV7 I;  4DR7 I;  3DD6 A;  4JI4 I;  1HNW E;  4FWG A;  1ZM4 A;  4DU8 A;  3QT8 A;  4FW9 A;  2WW4 A;  2PNZ B;  2GQ0 A;  4USM A;  1Y5Y A;  4ZVI A;  2NN6 C;  1ZXN A;  1NHJ A;  1Z0T A;  5JEA E;  3B82 A;  2UU9 E;  4MYU A;  4X65 I;  4DUY E;  2PNM A;  3QT6 A;  3J7A M;  4IFD F;  1R6M A;  1USU A;  1Y4U A;  3HUL A;  2E1R A;  5IT9 C;  3M7N D;  1N0V C;  3H4L A;  4B3S E;  2IER A;  4JI2 I;  5IWA E;  4DV7 E;  1MG7 A;  5DRQ A;  2PO1 A;  2PO1 B;  2UUC I;  3P76 A;  1P42 A;  5C0X F;  5K36 C;  4N3O A;  4DV4 I;  4GKK I;  4JI8 I;  4X66 I;  1QZR A;  4DR3 I;  1XNR E;  2C39 B;  3P3G A;  2UUB E;  4JI5 E;  4LF6 I;  1XMQ E;  1FWK A;  1YHC A;  2Z5B A;  1ZM3 A;  1H72 C;  2Z5B B;  2ZM6 E;  2OI2 A;  2PO0 A;  3ZKB A;  4QNK A;  2UXB I;  1NHI A;  3M6A A;  2E5L I;  5GMD A;  1XNQ I;  4KHP I;  3P3C A;  4JI2 E;  2LJP A;  4DV6 I;  5ELW A;  1Z0E A;  3B8H A;  3ZZU A;  1H73 A;  3ZZ0 A;  4LFB I;  5LL6 R;  4DV4 E;  4DR4 E;  4GKK E;  2NN6 D;  4K0K I;  4JI8 E;  2HK2 A;  5JEA F;  4DPW A;  1N32 E;  2C38 A;  5LMN I;  4LF9 E;  4HYM A;  4DR5 I;  4IFD C;  3PS2 A;  4LCF A;  1FWL A;  3JAM Q;  1MU5 A;  4DV2 I;  2UXB E;  4QNJ A;  1NZ0 A;  4I3H A;  3PS3 A;  3WU4 A;  4BA1 A;  1FNM A;  1OJ4 A;  1HR0 I;  5K36 D;  3F0N A;  5C0X C;  2V2Q A;  4OO1 A;  4OO1 B;  3PYE A;  2VES A;  3P3E A;  2BA1 D;  4B3M I;  2JEA A;  2JEA B;  4LFB E;  4OKG A;  3U1Y A;  1WUU A;  3J81 C;  4K0K E;  2IOQ A;  1ZM2 A;  3WU6 A;  1K47 A;  4JI0 E;  4M1K A;  4HAC A;  2V34 A;  2UU9 I;  4WUC A;  4JI3 I;  4DR5 E;  3K85 A;  4AID A;  5FLX C;  4DUY I;  3GME A;  4LF5 I;  3ZM7 A;  2HKJ A;  4DV2 E;  2XEX A;  1HNZ I;  1S4E A;  2PO2 A;  2V2Z A;  2PO2 B;  3J80 Q;  2VF3 A;  5IWA I;  3M85 D;  1N36 I;  4UTG A;  3OTO E;  2O3Z A;  1FJG E;  2PNZ A;  4OO1 E;  4B3M E;  5JEA C;  2BV3 A;  1B63 A;  2CZ9 A;  2V2V A;  1D6T A;  1XNR I;  2NN6 B;  2UUB I;  1A6F A;  1IBM I;  4JI5 I;  4IFD D;  4MU0 A;  2Z5C B;  1XMQ I;  3Q6M A;  1N34 E;  1IBK I;  1UDS A;  4JI3 E;  4IZK B;  4DR1 I;  1I94 E;  1UEK A;  1Y60 A;  4LPF A;  2BA0 D;  2ZM6 I;  4HXZ A;  4LF5 E;  3CDI A;  3J7A G;  4LOM A;  1HNZ E;  1N33 E;  5C0X D;  1KIJ A;  1Y4S A;  3M7N G;  5A2Q Q;  1Z5B A;  2IES A;  2C37 B;  2O1W A;  4OX9 I;  5K36 A;  1NHH A;  4P52 A;  1N36 E;  5K36 B;  2A2C A;  3K1J A;  1B62 A;  2JT2 A;  3P06 A;  3UHM A;  2CG9 A;  4DPY A;  3Q6N A;  4DR4 I;  1Z59 A;  3HKM A;  2C39 A;  2HHH E;  4IZJ D;  2EFG A;  1IBM E;  2UXC E;  4XTJ A;  2NN6 E;  2VQE I;  1N32 I;  4B3T E;  1H7U A;  1IBK E;  4LF9 I;  4DR1 E;  1XXE A;  3CWV A;  4JI6 I;  1Z5C A;  5EKW A;  1Z0C A;  3NZK A;  3GLL A;  4FW6 A;  4HY1 A;  4OX9 E;  5DNX A;  5JEA D;  4DPU A;  5K36 E;  1S16 A;  4Z7Y A;  4DPX A;  4PU9 A;  4JG4 A;  1XHK A;  3PYD A;  1FI4 A;  4WUB A;  4IS9 A;  2VQE E;  2VQF I;  4JV5 I;  4LCH A;  4IFD B;  4JI0 I;  3B78 A;  4EMD A;  4YHH E;  4FW3 A;  4AM3 A;  1FKA E;  1VI7 A;  3LTO A;  1H7S A;  2JE6 A;  1USV A;  2JE6 B;  4OZE A;  2DEI A;  4JI6 E;  2IOP A;  5C0X A;  5C0X B;  5FWK A;  5EL9 A;  1VIS A;  3LNU A;  3OTO I;  3CDJ A;  1FJG I;  2BA1 G;  1XMO E;  2CGE A;  2A2D A;  2Q2E B;  2UXD I;  4DUZ E;  3L7Z A;  1KTV A;  1KKH A;  4JI1 I;  3L7Z B;  1R6L A;  4R1F A;  2VQF E;  4YY3 E;  4IZJ B;  4DV1 E;  4JV5 E;  4BA2 B;  5BR8 I;  4LF4 I;  2JEB A;  2UUA I;  1N34 I;  2JEB B;  2ZIT A;  4LFA I;  2O1U A;  4IFD E;  1RRE A;  1I94 I;  2AE8 A;  1J5E I;  1N33 I;  5IT9 Q;  4DV5 E;  2BM0 A;  3Q1Q A;  4DPT A;  2BM1 A;  5C0X E;  5GME A;  4JYA I;  4X62 E;  3M85 G;  4KQV A;  2WP8 A;  3U1K A;  3HJC A;  4LFC I;  2WP8 B;  1OYS A;  2Z5E A;  4FWH A; 
#chains in the Genus database with same CATH homology
 1PKP A;  2ZBK B;  1N0U A;  3D4J A;  4DR6 E;  2UXD E;  4LF7 I;  4JI1 E;  1Z0V A;  2HHH I;  4DR2 I;  2UXC I;  2F4V E;  3JAM C;  2Z5C A;  5BR8 E;  4LF4 E;  2UUA E;  1BKN A;  1KVK A;  4B3T I;  4LFA E;  1PVG A;  4IZK A;  1PIE A;  3V5R A;  4NXN I;  4B3R E;  3T1Y E;  1J5E E;  5LMU I;  1H74 A;  4URL A;  1EA6 A;  4JYA E;  4LFC E;  3K17 A;  4DV3 I;  4WUD A;  1RR9 A;  4LF7 E;  1U2R A;  4DR2 E;  4AQY I;  2NPF A;  2R3V A;  2GS8 A;  4YHH I;  2DEJ A;  4JI7 E;  4FN5 A;  3J80 C;  4DV0 E;  4DR7 E;  4JI4 E;  1Z0B A;  4FWD A;  4NXN E;  3QT5 A;  1EI1 A;  2X36 A;  5LMU E;  4MYT A;  3WU3 A;  2HFS A;  2HFU A;  4LF8 I;  1MX0 A;  4X64 I;  4DV3 E;  1XMO I;  3J81 Q;  4P7A A;  4DUZ I;  4X65 E;  1HNX I;  4AQY E;  4YY3 I;  4DV1 I;  4Z7C A;  1ZM9 A;  1Z5A A;  5FLX Q;  1Y6Z A;  5A2Q C;  2J7K A;  5L3J A;  3ZKD A;  2UUC E;  1ZXM A;  3GON A;  4DV5 I;  4X62 I;  3ZZT A;  4X66 E;  4DR3 E;  3PYG A;  4NXM I;  4LF6 E;  1IBL I;  4DU7 A;  4LF8 E;  1Z0W A;  4X64 E;  1ELO A;  3QT7 A;  4DR6 I;  3WU5 A;  3T1H I;  1HNX E;  2V8P A;  2F4V I;  2O1V A;  4IZJ A;  4PRV A;  2HK3 A;  1DAR A;  4GKJ I;  2X7I A;  2E5L E;  4USK A;  1XNQ E;  3PYF A;  4KHP E;  1HNW I;  4DV6 E;  4B3R I;  3T1Y I;  2PNL A;  4DXL A;  4RPF A;  4NXM E;  3PRY A;  2O1T A;  1IBL E;  2R42 A;  5LMN E;  4HAC B;  2HKE A;  3T1H E;  4ED4 A;  4PRX A;  3V2U C;  3LPS A;  1Z0G A;  4GKJ E;  2AJ4 A;  1HK7 A;  4B3S I;  4JI7 I;  4UT4 A;  1HR0 E;  4DV0 I;  4DV7 I;  4DR7 I;  4JI4 I;  1HNW E;  4FWG A;  1ZM4 A;  4DU8 A;  3QT8 A;  4FW9 A;  2WW4 A;  2GQ0 A;  4USM A;  4ZVI A;  1ZXN A;  1NHJ A;  1Z0T A;  3B82 A;  2UU9 E;  4MYU A;  4X65 I;  4DUY E;  2PNM A;  3QT6 A;  3J7A M;  1USU A;  1Y4U A;  3HUL A;  2E1R A;  5IT9 C;  1N0V C;  3H4L A;  4B3S E;  4JI2 I;  5IWA E;  4DV7 E;  1MG7 A;  2UUC I;  4N3O A;  4DV4 I;  4GKK I;  4JI8 I;  4X66 I;  1QZR A;  4DR3 I;  1XNR E;  4LF6 I;  2UUB E;  4JI5 E;  1XMQ E;  1FWK A;  2Z5B A;  1ZM3 A;  1H72 C;  2Z5B B;  2ZM6 E;  2OI2 A;  3ZKB A;  2UXB I;  1NHI A;  3M6A A;  2E5L I;  5GMD A;  1XNQ I;  4KHP I;  4JI2 E;  2LJP A;  4DV6 I;  1Z0E A;  3B8H A;  3ZZU A;  1H73 A;  3ZZ0 A;  4LFB I;  5LL6 R;  4DV4 E;  4DR4 E;  4GKK E;  4K0K I;  4JI8 E;  2HK2 A;  4DPW A;  1N32 E;  5LMN I;  4LF9 E;  4HYM A;  4DR5 I;  1FWL A;  3JAM Q;  1MU5 A;  4DV2 I;  2UXB E;  1NZ0 A;  4I3H A;  3WU4 A;  1FNM A;  1OJ4 A;  1HR0 I;  3F0N A;  2V2Q A;  3PYE A;  4B3M I;  4LFB E;  1WUU A;  3J81 C;  4K0K E;  2IOQ A;  1ZM2 A;  3WU6 A;  1K47 A;  4JI0 E;  4M1K A;  4HAC A;  2V34 A;  2UU9 I;  4WUC A;  4JI3 I;  4DR5 E;  3K85 A;  5FLX C;  4DUY I;  4LF5 I;  3ZM7 A;  2HKJ A;  4DV2 E;  2XEX A;  1HNZ I;  1S4E A;  2V2Z A;  3J80 Q;  2VF3 A;  5IWA I;  1N36 I;  4UTG A;  3OTO E;  1FJG E;  4B3M E;  2BV3 A;  1B63 A;  2CZ9 A;  2V2V A;  1D6T A;  1XNR I;  2UUB I;  1A6F A;  1IBM I;  4JI5 I;  2Z5C B;  1XMQ I;  3Q6M A;  1N34 E;  1IBK I;  4JI3 E;  4IZK B;  4DR1 I;  1I94 E;  1UEK A;  2ZM6 I;  4HXZ A;  4LF5 E;  3J7A G;  1HNZ E;  1N33 E;  1KIJ A;  1Y4S A;  5A2Q Q;  1Z5B A;  2O1W A;  4OX9 I;  1NHH A;  4P52 A;  1N36 E;  2A2C A;  3K1J A;  1B62 A;  3P06 A;  2CG9 A;  4DPY A;  3Q6N A;  4DR4 I;  1Z59 A;  2HHH E;  4IZJ D;  2EFG A;  1IBM E;  2UXC E;  4XTJ A;  2VQE I;  1N32 I;  4B3T E;  1H7U A;  1IBK E;  4LF9 I;  4DR1 E;  3CWV A;  4JI6 I;  1Z5C A;  1Z0C A;  4HY1 A;  4OX9 E;  4DPU A;  1S16 A;  4Z7Y A;  4DPX A;  4PU9 A;  4JG4 A;  1XHK A;  3PYD A;  1FI4 A;  4WUB A;  2VQF I;  2VQE E;  4JV5 I;  4JI0 I;  3B78 A;  4EMD A;  4YHH E;  1FKA E;  3LTO A;  1H7S A;  1USV A;  2DEI A;  4JI6 E;  2IOP A;  5FWK A;  1VIS A;  3LNU A;  3OTO I;  1FJG I;  1XMO E;  2CGE A;  2A2D A;  2Q2E B;  2UXD I;  4DUZ E;  1KTV A;  1KKH A;  4JI1 I;  4R1F A;  2VQF E;  4YY3 E;  4IZJ B;  4DV1 E;  4JV5 E;  5BR8 I;  4LF4 I;  2UUA I;  1N34 I;  2ZIT A;  4LFA I;  2O1U A;  1RRE A;  1I94 I;  1J5E I;  1N33 I;  5IT9 Q;  4DV5 E;  2BM0 A;  3Q1Q A;  4DPT A;  2BM1 A;  4JYA I;  5GME A;  4X62 E;  4KQV A;  3HJC A;  4LFC I;  2Z5E A;  4FWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...