1NZ0A

Rnase p protein from thermotoga maritima
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
ERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGMDYSRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIPKGFDIVVIPRKKLSEEFERVDFWTVREKLLNLLKRIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component
publication title High-resolution structure of RNase P protein from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 34
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1nz0A00
1PKPA 1MU5A 4JI6E 3Q1QA 1Z0VA 5FLXQ 1N32I 4JI2I 1FJGI 3ZM7A 4DR3I 4XTJA 5LMNE 4HY1A 4DR7I 4DV4I 1H73A 1OJ4A 3LTOA 4LF6E 1KIJA 3T1HI 4FW9A 4GKKE 5A2QC 1ZM4A 1I94I 5LL6R 4LFBI 5IWAI 1HNXI 4DR2E 4NXMI 1RR9A 4DV6I 1XNQE 2V8PA 3JAMQ 4USMA 2UXCE 3QT6A 4FWDA 4DUYE 1Z5BA 2HFSA 1H74A 1KVKA 4AQYI 4DV7E 1IBLI 2X7IA 1N34I 2HKEA 4NXNI 1WUUA 1IBKI 2UUAE 5LMUE 4LF4I 4P52A 1N36E 4USKA 4YY3I 4LF8I 1HNZI 4JI7E 2F4VI 2WW4A 1D6TA 4LF9E 1Z0CA 3LPSA 3ZKBA 2UXDI 4X64E 2HHHI 5A2QQ 3ZZ0A 4DR6I 5GMDA 4Z7YA 4DR7E 3M6AA 1FKAE 1Z0EA 1N0VC 4MYUA 4DR1I 4LFAI 4FN5A 4ZVIA 1N33E 4MYTA 4X65I 3JAMC 4B3RE 2UXBI 4DPWA 2VQEE 1IBMI 2ZBKB 4URLA 4DR4I 1XHKA 3B8HA 3WU4A 4B3SI 3K1JA 4WUDA 4AQYE 1Z0WA 1NHIA 2VQFI 3PYEA 1N34E 4B3MI 4NXNE 4DV0I 5L3JA 4LF7I 1ELOA 4UTGA 3H4LA 3ZZUA 1XMOI 4JI8E 4DUZE 3F0NA 2XEXA 4I3HA 3WU3A 1XMQI 2DEIA 4LF8E 1FNMA 2UU9I 4OX9E 1HNZE 4ED4A 4X62I 2BM1A 1FI4A 4DV2I 4K0KE 3J7AM 2CZ9A 4DPUA 1FWKA 2X36A 2UUBE 4DPYA 1Z0BA 4DV3E 4KHPE 4YHHI 3B78A 2GS8A 4KQVA 4B3TI 4LFCI 3PYFA 4DR5I 1NHJA 4JI1I 4DXLA 4JI3I 3CWVA 3PYDA 2E5LI 4LF5I 2UUCI 1S4EA 4JI4E 4HACA 1J5EE 1HR0E 4HXZA 5BR8I 1PIEA 4JV5E 4PRXA 3D4JA 2ZM6I 1XNRE 3V2UC 4Z7CA 1Z0GA 2A2DA 4UT4A 4JI5E 4X66I 3WU6A 4DPTA 1QZRA 3ZKDA 4WUCA 3T1YI 2EFGA 4JI6I 4HACB 2VQFE 1Z5AA 5LMNI 4JYAE 1HNWE 3OTOE 1Z0TA 1N32E 4JI2E 1FJGE 1B63A 4DR3E 1BKNA 4GKKI 4R1FA 4DV4E 1ZXNA 5GMEA 1ZM2A 4DPXA 4DV5I 3T1HE 3HULA 2OI2A 4RPFA 4DR2I 3J80Q 4PU9A 1I94E 3V5RA 1XNQI 4LFBE 2A2CA 2UXCI 5IWAE 4DUYI 1HNXE 4NXME 1NHHA 4DV6E 4LFCE 2DEJA 1FWLA 2R42A 2HK2A 2E5LE 1VISA 2R3VA 2HKJA 1IBLE 5LMUI 1IBKE 1N36I 1EA6A 1N0UA 1H7SA 1Z5CA 4JI7I 2V34A 1Z59A 4LF4E 1H7UA 4YY3E 2V2QA 2F4VE 3T1YE 2BV3A 4EMDA 3QT5A 3J7AG 1NZ0A 2E1RA 2J7KA 2UXDE 3PYGA 2HHHE 2BM0A 1S16A 1KKHA 1MX0A 4DR6E 4JI0I 1N33I 4DV1I 5IT9C 3B82A 3J80C 2HFUA 1KTVA 4B3RI 2VQEI 4DV5E 4DR1E 4LFAE 4GKJI 2ZITA 4FWHA 1H72C 4X65E 2UXBE 3GONA 1IBME 1ZM9A 4DR4E 2V2VA 4M1KA 1DARA 4DU8A 4DU7A 1A6FA 2LJPA 3J81C 4P7AA 4B3SE 3WU5A 1EI1A 4JI8I 4DUZI 1U2RA 1MG7A 4B3ME 4DV0E 4JG4A 4LF7E 4LF6I 4OX9I 1XMOE 4PRVA 4FWGA 4K0KI 5FLXC 1XMQE 2UU9E 2UUBI 3K17A 4X62E 3ZZTA 4DV3I 4KHPI 2Q2EB 4DV2E 3QT8A 5IT9Q 3QT7A 1PVGA 4YHHE 4DV7I 1ZXMA 4JI4I 4B3TE 4DR5E 2V2ZA 4JI0E 1J5EI 4JI1E 4DV1E 1HR0I 4JI3E 2HK3A 2VF3A 1RREA 4LF5E 2UUCE 4JV5I 2UUAI 1B62A 4HYMA 2NPFA 1XNRI 4GKJE 5BR8E 1ZM3A 4JI5I 3J81Q 1K47A 2ZM6E 4LF9I 2AJ4A 1UEKA 4X66E 4WUBA 4JYAI 1HNWI 3LNUA 4X64I 3OTOI
chains in the Genus database with same CATH superfamily
1PKPA 1MU5A 2AE8A 4JI6E 1YHCA 3L7ZB 3Q1QA 1Z0VA 2Z5BB 5FLXQ 1N32I 5K36A 4OO1F 4JI2I 1FJGI 3ZM7A 4DR3I 4XTJA 2CG9A 4MU3A 4QNKA 4HY1A 5LMNE 4BA2A 4DR7I 2WP8A 2NN6D 2Z5CB 2IESA 4DV4I 2CGEA 1R6MA 1R6LA 1H73A 1OJ4A 3LTOA 4LF6E 1KIJA 3T1HI 4FW9A 4GKKE 3GCMA 3M7NG 5A2QC 4QNJA 3P3GA 1ZM4A 1I94I 5LL6R 4LFBI 2WNRB 5IWAI 3K85A 1HNXI 4DR2E 3B4TA 4NXMI 1RR9A 5K36B 2PNMA 4DV6I 1XNQE 2V8PA 3JAMQ 4USMA 2UXCE 3QT6A 2WP8B 4FWDA 4DUYE 1Z5BA 2HFSA 1H74A 1KVKA 4AQYI 4DV7E 5K36E 1IBLI 2X7IA 1N34I 2HKEA 4NXNI 1WUUA 1IBKI 3P76A 4OO1B 1VI7A 2UUAE 5LMUE 4LF4I 4P52A 1N36E 4USKA 4LPFA 4YY3I 4LF8I 4AM3A 1HNZI 4JI7E 1HK7A 2F4VI 2WW4A 1D6TA 4LCFA 4LF9E 1Z0CA 3LPSA 4LCGA 3ZKBA 2UXDI 3PRYA 4X64E 4OKGA 4AIDA 2IOQA 2HHHI 2PO2A 5A2QQ 2JT2A 3ZZ0A 4DR6I 5GMDA 4AIMA 4Z7YA 4DR7E 3M6AA 1USVA 1FKAE 4MQYA 1Z0EA 1N0VC 4MYUA 4DR1I 1Y4SA 4LFAI 4FN5A 4ZVIA 2JEAA 5DNLA 1N33E 4MYTA 5K36C 4X65I 3JAMC 5C0XD 4B3RE 2UXBI 4DPWA 2VQEE 1IBMI 2NN6A 2BA1D 2ZBKB 4URLA 4DR4I 1P42A 2PO2B 1XHKA 1XXEA 3B8HA 1E3PA 1E3HA 3WU4A 2C39B 4B3SI 4IFDD 3K1JA 4WUDA 4AQYE 1Z0WA 1NHIA 2VQFI 2JEAB 3PYEA 1N34E 4B3MI 4NXNE 4DV0I 5L3JA 4LF7I 1ELOA 4UTGA 3KRNA 1OYSA 1YH8A 3H4LA 3ZZUA 1XMOI 2NN6B 3P3CA 4JI8E 4DUZE 3F0NA 2XEXA 4I3HA 3WU3A 1XMQI 2DEIA 4LF8E 1FNMA 1Y5YA 1OYPA 2UU9I 4OX9E 1HNZE 2NN6E 4U3DA 4ED4A 4X62I 2BM1A 1FI4A 3NZKA 4DV2I 4K0KE 3CDJA 3GLLA 3J7AM 2CZ9A 4FW7A 4DPUA 1FWKA 5JEAD 2C38B 2X36A 4BA1A 2BR2A 2UUBE 4DPYA 1Z0BA 4DV3E 4KHPE 4YHHI 3B78A 2GS8A 4KQVA 4B3TI 4LFCI 3PYFA 4DR5I 4BA2B 1NHJA 4JI1I 1Y4UA 4DXLA 4JI3I 3CWVA 3PYDA 2E5LI 1UDNA 3M85D 2UUCI 4LF5I 1S4EA 5DRPA 4JI4E 4HACA 1J5EE 4FW6A 1HR0E 4HXZA 5BR8I 1PIEA 2C37A 2BA0D 4JV5E 4PRXA 2CVEA 3D4JA 4OZEA 2O1UA 1UDOA 2ZM6I 5EL9A 1XNRE 3V2UC 5EKWA 4Z7CA 1Z0GA 2A2DA 3PS2A 4UT4A 2J65A 4JI5E 4X66I 3WU6A 4FW3A 2JE6A 4DPTA 1QZRA 3ZKDA 4WUCA 3T1YI 2EFGA 5C0XA 4JI6I 2Z5EA 2NN6C 4OO1D 4HACB 2VQFE 1Z5AA 5LMNI 4JYAE 1HNWE 3OTOE 1Z0TA 4FW4A 1N32E 4JI2E 1FJGE 1B63A 4DR3E 1BKNA 4GKKI 4IFDA 2NN6F 4IS9A 3M7ND 4R1FA 4DV4E 2PO1A 1ZXNA 5GMEA 1ZM2A 4DPXA 2PNLA 4DV5I 3T1HE 3HULA 4IZJD 2OI2A 4RPFA 1UDQA 5C0XB 4DR2I 4MU1A 3HJCA 3J80Q 4PU9A 1I94E 3V5RA 1XNQI 4LFBE 2A2CA 2UXCI 5IWAE 5C0XE 4DUYI 1HNXE 5DNXA 4NXME 4N3OA 1NHHA 4DV6E 4LFCE 2DEJA 4MU0A 1RHYA 2PO0A 1FWLA 5JEAA 2R42A 3P3EA 2HK2A 3L7ZA 2PNZA 2E5LE 1VISA 2R3VA 2Z5BA 2HKJA 1IBLE 5LMUI 4J3DA 4IFDE 1IBKE 1N36I 4LCHA 1EA6A 2Z5CA 1N0UA 1H7SA 1Z5CA 4JI7I 2O1VA 2V34A 1Z59A 4LF4E 1UDSA 1H7UA 4YY3E 2V2QA 2IOPA 2O1TA 2F4VE 3CDIA 3T1YE 2BV3A 5JEAB 1Y60A 4EMDA 3QT5A 5FWKA 2PNZB 3J7AG 4LOMA 1NZ0A 2E1RA 2J7KA 2GO4A 2UXDE 5DROA 4FW5A 5JEAE 3PYGA 2HHHE 2BM0A 1S16A 1KKHA 1MX0A 3Q6NA 3DD6A 5C0XC 4DR6E 4JI0I 1N33I 3UHMA 4DV1I 5IT9C 3B82A 3J80C 4OO1A 2HFUA 1KTVA 3GMEA 4B3RI 2VQEI 2F1DA 4MU4A 4DV5E 4DR1E 4LFAE 4GKJI 2ZITA 4FWHA 5C0XF 1H72C 4X65E 2VESA 2UXBE 3GONA 4IFDC 1IBME 4BA1B 2BR2B 2BA1G 5K36D 1ZM9A 4DR4E 2V2VA 4M1KA 4IZJA 1DARA 4DU8A 4IZKA 3Q6MA 1A6FA 4DU7A 2LJPA 3J81C 2IERA 4IFDF 4P7AA 4B3SE 3WU5A 1EI1A 5DRRA 4JI8I 4DUZI 1U2RA 1MG7A 3U1KA 4B3ME 4U3BA 3OTOI 4DV0E 2C37B 4JG4A 4LF7E 4OO1E 4LF6I 4OX9I 2O3ZA 1XMOE 4PRVA 3P06A 4FWGA 5JEAC 4K0KI 5FLXC 4MDTA 1XMQE 4IZJB 2JE6B 2UU9E 4IZKB 2UUBI 2JEBA 3K17A 4X62E 3ZZTA 4DV3I 4KHPI 2Q2EB 4DV2E 2O1WA 3QT8A 5IT9Q 5JEAF 3QT7A 1PVGA 3H1CA 3HKMA 4GQUA 4YHHE 2C39A 4DV7I 1ZXMA 4JI4I 5DRQA 4B3TE 1OYRA 4DR5E 4NBQA 4IFDB 2V2ZA 4JI0E 1J5EI 4JI1E 4DV1E 1HR0I 4JI3E 2HK3A 2PO1B 2VF3A 3M85G 1RREA 4LF5E 2UUCE 4JV5I 2GQ0A 1USUA 1B62A 2UUAI 4HYMA 2JEBB 3PS3A 2NPFA 1XNRI 4GKJE 5BR8E 1ZM3A 2BA0G 4JI5I 5ELWA 3J81Q 3U1YA 1K47A 2ZM6E 4LF9I 2GO3A 5K36F 2AJ4A 4OO1C 1UEKA 4ISAA 4X66E 3PS1A 2C38A 4WUBA 4JYAI 1HNWI 3LNUA 4X64I 2PO0B 1Y6ZA 2WNRA
chains in the Genus database with same CATH topology
1PKPA 1MU5A 4JI6E 3Q1QA 1Z0VA 2Z5BB 5FLXQ 1N32I 4JI2I 1FJGI 3ZM7A 4DR3I 4XTJA 2CG9A 5LMNE 4HY1A 4DR7I 2Z5CB 4DV4I 2CGEA 1H73A 1OJ4A 3LTOA 4LF6E 1KIJA 3T1HI 4FW9A 4GKKE 5A2QC 1ZM4A 1I94I 5LL6R 4LFBI 5IWAI 3K85A 1HNXI 4DR2E 4NXMI 1RR9A 2PNMA 4DV6I 1XNQE 2V8PA 3JAMQ 4USMA 2UXCE 3QT6A 4FWDA 4DUYE 1Z5BA 2HFSA 1H74A 1KVKA 4AQYI 4DV7E 1IBLI 2X7IA 1N34I 2HKEA 4NXNI 1WUUA 1IBKI 2UUAE 5LMUE 4LF4I 4P52A 1N36E 4USKA 4YY3I 4LF8I 1HNZI 4JI7E 1HK7A 2F4VI 2WW4A 1D6TA 4LF9E 1Z0CA 3LPSA 1Y6ZA 3ZKBA 2UXDI 3PRYA 4X64E 2IOQA 2HHHI 5A2QQ 3ZZ0A 4DR6I 5GMDA 4Z7YA 4DR7E 3M6AA 1USVA 1FKAE 1Z0EA 1N0VC 4MYUA 4DR1I 1Y4SA 4LFAI 4FN5A 4ZVIA 1N33E 4MYTA 4X65I 3JAMC 4B3RE 2UXBI 4DPWA 2VQEE 1IBMI 2ZBKB 4URLA 4DR4I 1XHKA 3B8HA 3WU4A 4B3SI 3K1JA 4WUDA 4AQYE 1Z0WA 1NHIA 2VQFI 3PYEA 1N34E 4B3MI 4NXNE 4DV0I 5L3JA 4LF7I 1ELOA 4UTGA 3H4LA 3ZZUA 1XMOI 4JI8E 4DUZE 3F0NA 2XEXA 4I3HA 3WU3A 1XMQI 2DEIA 4LF8E 1FNMA 2UU9I 4OX9E 1HNZE 4ED4A 4X62I 2BM1A 1FI4A 4DV2I 4K0KE 3J7AM 2CZ9A 4DPUA 1FWKA 2X36A 2UUBE 4DPYA 1Z0BA 4DV3E 4KHPE 4YHHI 3B78A 2GS8A 4KQVA 4B3TI 4LFCI 3PYFA 4DR5I 1NHJA 4JI1I 1Y4UA 4DXLA 4JI3I 3CWVA 3PYDA 2E5LI 4LF5I 2UUCI 1S4EA 4JI4E 4HACA 1J5EE 1HR0E 4HXZA 5BR8I 1PIEA 4JV5E 4PRXA 3D4JA 2O1UA 2ZM6I 1XNRE 3V2UC 4Z7CA 1Z0GA 2A2DA 4UT4A 4JI5E 4X66I 3WU6A 4DPTA 1QZRA 3ZKDA 4WUCA 3T1YI 2EFGA 4JI6I 2Z5EA 4HACB 2VQFE 1Z5AA 5LMNI 4JYAE 1HNWE 3OTOE 1Z0TA 1N32E 4JI2E 1FJGE 1B63A 4DR3E 1BKNA 4GKKI 4R1FA 4DV4E 1ZXNA 5GMEA 1ZM2A 4DPXA 2PNLA 4DV5I 3T1HE 3HULA 4IZJD 2OI2A 4RPFA 4DR2I 3HJCA 3J80Q 4PU9A 1I94E 3V5RA 1XNQI 4LFBE 2A2CA 2UXCI 5IWAE 4DUYI 1HNXE 4NXME 4N3OA 1NHHA 4DV6E 4LFCE 2DEJA 1FWLA 2R42A 2HK2A 2E5LE 1VISA 2R3VA 2Z5BA 2HKJA 1IBLE 5LMUI 1IBKE 1N36I 1EA6A 2Z5CA 1N0UA 1H7SA 1Z5CA 4JI7I 2O1VA 2V34A 1Z59A 4LF4E 1H7UA 4YY3E 2V2QA 2IOPA 2O1TA 2F4VE 3T1YE 2BV3A 4EMDA 3QT5A 5FWKA 3J7AG 1NZ0A 2E1RA 2J7KA 2UXDE 3PYGA 2HHHE 2BM0A 1S16A 1KKHA 1MX0A 3Q6NA 4DR6E 4JI0I 1N33I 4DV1I 5IT9C 3B82A 3J80C 2HFUA 1KTVA 4B3RI 2VQEI 4DV5E 4DR1E 4LFAE 4GKJI 2ZITA 4FWHA 1H72C 4X65E 2UXBE 3GONA 1IBME 1ZM9A 4DR4E 2V2VA 4M1KA 4IZJA 1DARA 4DU8A 4IZKA 3Q6MA 1A6FA 4DU7A 2LJPA 3J81C 4P7AA 4B3SE 3WU5A 1EI1A 4JI8I 4DUZI 1U2RA 1MG7A 4B3ME 4DV0E 4JG4A 4LF7E 4LF6I 4OX9I 1XMOE 4PRVA 3P06A 4FWGA 4K0KI 5FLXC 1XMQE 4IZJB 2UU9E 4IZKB 2UUBI 3K17A 4X62E 3ZZTA 4DV3I 4KHPI 2Q2EB 4DV2E 2O1WA 3QT8A 5IT9Q 3QT7A 1PVGA 4YHHE 4DV7I 1ZXMA 4JI4I 4B3TE 4DR5E 2V2ZA 4JI0E 1J5EI 4JI1E 4DV1E 1HR0I 4JI3E 2HK3A 2VF3A 1RREA 4LF5E 2UUCE 4JV5I 2GQ0A 1USUA 1B62A 2UUAI 4HYMA 2NPFA 1XNRI 4GKJE 5BR8E 1ZM3A 4JI5I 3J81Q 1K47A 2ZM6E 4LF9I 2AJ4A 1UEKA 4X66E 4WUBA 4JYAI 1HNWI 3LNUA 4X64I 3OTOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKP A;  1MU5 A;  4JI6 E;  3Q1Q A;  1Z0V A;  5FLX Q;  1N32 I;  4JI2 I;  1FJG I;  3ZM7 A;  4DR3 I;  4XTJ A;  5LMN E;  4HY1 A;  4DR7 I;  4DV4 I;  1H73 A;  1OJ4 A;  3LTO A;  4LF6 E;  1KIJ A;  3T1H I;  4FW9 A;  4GKK E;  5A2Q C;  1ZM4 A;  1I94 I;  5LL6 R;  4LFB I;  5IWA I;  1HNX I;  4DR2 E;  4NXM I;  1RR9 A;  4DV6 I;  1XNQ E;  2V8P A;  3JAM Q;  4USM A;  2UXC E;  3QT6 A;  4FWD A;  4DUY E;  1Z5B A;  2HFS A;  1H74 A;  1KVK A;  4AQY I;  4DV7 E;  1IBL I;  2X7I A;  1N34 I;  2HKE A;  4NXN I;  1WUU A;  1IBK I;  2UUA E;  5LMU E;  4LF4 I;  4P52 A;  1N36 E;  4USK A;  4YY3 I;  4LF8 I;  1HNZ I;  4JI7 E;  2F4V I;  2WW4 A;  1D6T A;  4LF9 E;  1Z0C A;  3LPS A;  3ZKB A;  2UXD I;  4X64 E;  2HHH I;  5A2Q Q;  3ZZ0 A;  4DR6 I;  5GMD A;  4Z7Y A;  4DR7 E;  3M6A A;  1FKA E;  1Z0E A;  1N0V C;  4MYU A;  4DR1 I;  4LFA I;  4FN5 A;  4ZVI A;  1N33 E;  4MYT A;  4X65 I;  3JAM C;  4B3R E;  2UXB I;  4DPW A;  2VQE E;  1IBM I;  2ZBK B;  4URL A;  4DR4 I;  1XHK A;  3B8H A;  3WU4 A;  4B3S I;  3K1J A;  4WUD A;  4AQY E;  1Z0W A;  1NHI A;  2VQF I;  3PYE A;  1N34 E;  4B3M I;  4NXN E;  4DV0 I;  5L3J A;  4LF7 I;  1ELO A;  4UTG A;  3H4L A;  3ZZU A;  1XMO I;  4JI8 E;  4DUZ E;  3F0N A;  2XEX A;  4I3H A;  3WU3 A;  1XMQ I;  2DEI A;  4LF8 E;  1FNM A;  2UU9 I;  4OX9 E;  1HNZ E;  4ED4 A;  4X62 I;  2BM1 A;  1FI4 A;  4DV2 I;  4K0K E;  3J7A M;  2CZ9 A;  4DPU A;  1FWK A;  2X36 A;  2UUB E;  4DPY A;  1Z0B A;  4DV3 E;  4KHP E;  4YHH I;  3B78 A;  2GS8 A;  4KQV A;  4B3T I;  4LFC I;  3PYF A;  4DR5 I;  1NHJ A;  4JI1 I;  4DXL A;  4JI3 I;  3CWV A;  3PYD A;  2E5L I;  4LF5 I;  2UUC I;  1S4E A;  4JI4 E;  4HAC A;  1J5E E;  1HR0 E;  4HXZ A;  5BR8 I;  1PIE A;  4JV5 E;  4PRX A;  3D4J A;  2ZM6 I;  1XNR E;  3V2U C;  4Z7C A;  1Z0G A;  2A2D A;  4UT4 A;  4JI5 E;  4X66 I;  3WU6 A;  4DPT A;  1QZR A;  3ZKD A;  4WUC A;  3T1Y I;  2EFG A;  4JI6 I;  4HAC B;  2VQF E;  1Z5A A;  5LMN I;  4JYA E;  1HNW E;  3OTO E;  1Z0T A;  1N32 E;  4JI2 E;  1FJG E;  1B63 A;  4DR3 E;  1BKN A;  4GKK I;  4R1F A;  4DV4 E;  1ZXN A;  5GME A;  1ZM2 A;  4DPX A;  4DV5 I;  3T1H E;  3HUL A;  2OI2 A;  4RPF A;  4DR2 I;  3J80 Q;  4PU9 A;  1I94 E;  3V5R A;  1XNQ I;  4LFB E;  2A2C A;  2UXC I;  5IWA E;  4DUY I;  1HNX E;  4NXM E;  1NHH A;  4DV6 E;  4LFC E;  2DEJ A;  1FWL A;  2R42 A;  2HK2 A;  2E5L E;  1VIS A;  2R3V A;  2HKJ A;  1IBL E;  5LMU I;  1IBK E;  1N36 I;  1EA6 A;  1N0U A;  1H7S A;  1Z5C A;  4JI7 I;  2V34 A;  1Z59 A;  4LF4 E;  1H7U A;  4YY3 E;  2V2Q A;  2F4V E;  3T1Y E;  2BV3 A;  4EMD A;  3QT5 A;  3J7A G;  1NZ0 A;  2E1R A;  2J7K A;  2UXD E;  3PYG A;  2HHH E;  2BM0 A;  1S16 A;  1KKH A;  1MX0 A;  4DR6 E;  4JI0 I;  1N33 I;  4DV1 I;  5IT9 C;  3B82 A;  3J80 C;  2HFU A;  1KTV A;  4B3R I;  2VQE I;  4DV5 E;  4DR1 E;  4LFA E;  4GKJ I;  2ZIT A;  4FWH A;  1H72 C;  4X65 E;  2UXB E;  3GON A;  1IBM E;  1ZM9 A;  4DR4 E;  2V2V A;  4M1K A;  1DAR A;  4DU8 A;  4DU7 A;  1A6F A;  2LJP A;  3J81 C;  4P7A A;  4B3S E;  3WU5 A;  1EI1 A;  4JI8 I;  4DUZ I;  1U2R A;  1MG7 A;  4B3M E;  4DV0 E;  4JG4 A;  4LF7 E;  4LF6 I;  4OX9 I;  1XMO E;  4PRV A;  4FWG A;  4K0K I;  5FLX C;  1XMQ E;  2UU9 E;  2UUB I;  3K17 A;  4X62 E;  3ZZT A;  4DV3 I;  4KHP I;  2Q2E B;  4DV2 E;  3QT8 A;  5IT9 Q;  3QT7 A;  1PVG A;  4YHH E;  4DV7 I;  1ZXM A;  4JI4 I;  4B3T E;  4DR5 E;  2V2Z A;  4JI0 E;  1J5E I;  4JI1 E;  4DV1 E;  1HR0 I;  4JI3 E;  2HK3 A;  2VF3 A;  1RRE A;  4LF5 E;  2UUC E;  4JV5 I;  2UUA I;  1B62 A;  4HYM A;  2NPF A;  1XNR I;  4GKJ E;  5BR8 E;  1ZM3 A;  4JI5 I;  3J81 Q;  1K47 A;  2ZM6 E;  4LF9 I;  2AJ4 A;  1UEK A;  4X66 E;  4WUB A;  4JYA I;  1HNW I;  3LNU A;  4X64 I;  3OTO I; 
#chains in the Genus database with same CATH topology
 1PKP A;  1MU5 A;  2AE8 A;  4JI6 E;  1YHC A;  3L7Z B;  3Q1Q A;  1Z0V A;  2Z5B B;  5FLX Q;  1N32 I;  5K36 A;  4OO1 F;  4JI2 I;  1FJG I;  3ZM7 A;  4DR3 I;  4XTJ A;  2CG9 A;  4MU3 A;  4QNK A;  4HY1 A;  5LMN E;  4BA2 A;  4DR7 I;  2WP8 A;  2NN6 D;  2Z5C B;  2IES A;  4DV4 I;  2CGE A;  1R6M A;  1R6L A;  1H73 A;  1OJ4 A;  3LTO A;  4LF6 E;  1KIJ A;  3T1H I;  4FW9 A;  4GKK E;  3GCM A;  3M7N G;  5A2Q C;  4QNJ A;  3P3G A;  1ZM4 A;  1I94 I;  5LL6 R;  4LFB I;  2WNR B;  5IWA I;  3K85 A;  1HNX I;  4DR2 E;  3B4T A;  4NXM I;  1RR9 A;  5K36 B;  2PNM A;  4DV6 I;  1XNQ E;  2V8P A;  3JAM Q;  4USM A;  2UXC E;  3QT6 A;  2WP8 B;  4FWD A;  4DUY E;  1Z5B A;  2HFS A;  1H74 A;  1KVK A;  4AQY I;  4DV7 E;  5K36 E;  1IBL I;  2X7I A;  1N34 I;  2HKE A;  4NXN I;  1WUU A;  1IBK I;  3P76 A;  4OO1 B;  1VI7 A;  2UUA E;  5LMU E;  4LF4 I;  4P52 A;  1N36 E;  4USK A;  4LPF A;  4YY3 I;  4LF8 I;  4AM3 A;  1HNZ I;  4JI7 E;  1HK7 A;  2F4V I;  2WW4 A;  1D6T A;  4LCF A;  4LF9 E;  1Z0C A;  3LPS A;  4LCG A;  3ZKB A;  2UXD I;  3PRY A;  4X64 E;  4OKG A;  4AID A;  2IOQ A;  2HHH I;  2PO2 A;  5A2Q Q;  2JT2 A;  3ZZ0 A;  4DR6 I;  5GMD A;  4AIM A;  4Z7Y A;  4DR7 E;  3M6A A;  1USV A;  1FKA E;  4MQY A;  1Z0E A;  1N0V C;  4MYU A;  4DR1 I;  1Y4S A;  4LFA I;  4FN5 A;  4ZVI A;  2JEA A;  5DNL A;  1N33 E;  4MYT A;  5K36 C;  4X65 I;  3JAM C;  5C0X D;  4B3R E;  2UXB I;  4DPW A;  2VQE E;  1IBM I;  2NN6 A;  2BA1 D;  2ZBK B;  4URL A;  4DR4 I;  1P42 A;  2PO2 B;  1XHK A;  1XXE A;  3B8H A;  1E3P A;  1E3H A;  3WU4 A;  2C39 B;  4B3S I;  4IFD D;  3K1J A;  4WUD A;  4AQY E;  1Z0W A;  1NHI A;  2VQF I;  2JEA B;  3PYE A;  1N34 E;  4B3M I;  4NXN E;  4DV0 I;  5L3J A;  4LF7 I;  1ELO A;  4UTG A;  3KRN A;  1OYS A;  1YH8 A;  3H4L A;  3ZZU A;  1XMO I;  2NN6 B;  3P3C A;  4JI8 E;  4DUZ E;  3F0N A;  2XEX A;  4I3H A;  3WU3 A;  1XMQ I;  2DEI A;  4LF8 E;  1FNM A;  1Y5Y A;  1OYP A;  2UU9 I;  4OX9 E;  1HNZ E;  2NN6 E;  4U3D A;  4ED4 A;  4X62 I;  2BM1 A;  1FI4 A;  3NZK A;  4DV2 I;  4K0K E;  3CDJ A;  3GLL A;  3J7A M;  2CZ9 A;  4FW7 A;  4DPU A;  1FWK A;  5JEA D;  2C38 B;  2X36 A;  4BA1 A;  2BR2 A;  2UUB E;  4DPY A;  1Z0B A;  4DV3 E;  4KHP E;  4YHH I;  3B78 A;  2GS8 A;  4KQV A;  4B3T I;  4LFC I;  3PYF A;  4DR5 I;  4BA2 B;  1NHJ A;  4JI1 I;  1Y4U A;  4DXL A;  4JI3 I;  3CWV A;  3PYD A;  2E5L I;  1UDN A;  3M85 D;  2UUC I;  4LF5 I;  1S4E A;  5DRP A;  4JI4 E;  4HAC A;  1J5E E;  4FW6 A;  1HR0 E;  4HXZ A;  5BR8 I;  1PIE A;  2C37 A;  2BA0 D;  4JV5 E;  4PRX A;  2CVE A;  3D4J A;  4OZE A;  2O1U A;  1UDO A;  2ZM6 I;  5EL9 A;  1XNR E;  3V2U C;  5EKW A;  4Z7C A;  1Z0G A;  2A2D A;  3PS2 A;  4UT4 A;  2J65 A;  4JI5 E;  4X66 I;  3WU6 A;  4FW3 A;  2JE6 A;  4DPT A;  1QZR A;  3ZKD A;  4WUC A;  3T1Y I;  2EFG A;  5C0X A;  4JI6 I;  2Z5E A;  2NN6 C;  4OO1 D;  4HAC B;  2VQF E;  1Z5A A;  5LMN I;  4JYA E;  1HNW E;  3OTO E;  1Z0T A;  4FW4 A;  1N32 E;  4JI2 E;  1FJG E;  1B63 A;  4DR3 E;  1BKN A;  4GKK I;  4IFD A;  2NN6 F;  4IS9 A;  3M7N D;  4R1F A;  4DV4 E;  2PO1 A;  1ZXN A;  5GME A;  1ZM2 A;  4DPX A;  2PNL A;  4DV5 I;  3T1H E;  3HUL A;  4IZJ D;  2OI2 A;  4RPF A;  1UDQ A;  5C0X B;  4DR2 I;  4MU1 A;  3HJC A;  3J80 Q;  4PU9 A;  1I94 E;  3V5R A;  1XNQ I;  4LFB E;  2A2C A;  2UXC I;  5IWA E;  5C0X E;  4DUY I;  1HNX E;  5DNX A;  4NXM E;  4N3O A;  1NHH A;  4DV6 E;  4LFC E;  2DEJ A;  4MU0 A;  1RHY A;  2PO0 A;  1FWL A;  5JEA A;  2R42 A;  3P3E A;  2HK2 A;  3L7Z A;  2PNZ A;  2E5L E;  1VIS A;  2R3V A;  2Z5B A;  2HKJ A;  1IBL E;  5LMU I;  4J3D A;  4IFD E;  1IBK E;  1N36 I;  4LCH A;  1EA6 A;  2Z5C A;  1N0U A;  1H7S A;  1Z5C A;  4JI7 I;  2O1V A;  2V34 A;  1Z59 A;  4LF4 E;  1UDS A;  1H7U A;  4YY3 E;  2V2Q A;  2IOP A;  2O1T A;  2F4V E;  3CDI A;  3T1Y E;  2BV3 A;  5JEA B;  1Y60 A;  4EMD A;  3QT5 A;  5FWK A;  2PNZ B;  3J7A G;  4LOM A;  1NZ0 A;  2E1R A;  2J7K A;  2GO4 A;  2UXD E;  5DRO A;  4FW5 A;  5JEA E;  3PYG A;  2HHH E;  2BM0 A;  1S16 A;  1KKH A;  1MX0 A;  3Q6N A;  3DD6 A;  5C0X C;  4DR6 E;  4JI0 I;  1N33 I;  3UHM A;  4DV1 I;  5IT9 C;  3B82 A;  3J80 C;  4OO1 A;  2HFU A;  1KTV A;  3GME A;  4B3R I;  2VQE I;  2F1D A;  4MU4 A;  4DV5 E;  4DR1 E;  4LFA E;  4GKJ I;  2ZIT A;  4FWH A;  5C0X F;  1H72 C;  4X65 E;  2VES A;  2UXB E;  3GON A;  4IFD C;  1IBM E;  4BA1 B;  2BR2 B;  2BA1 G;  5K36 D;  1ZM9 A;  4DR4 E;  2V2V A;  4M1K A;  4IZJ A;  1DAR A;  4DU8 A;  4IZK A;  3Q6M A;  1A6F A;  4DU7 A;  2LJP A;  3J81 C;  2IER A;  4IFD F;  4P7A A;  4B3S E;  3WU5 A;  1EI1 A;  5DRR A;  4JI8 I;  4DUZ I;  1U2R A;  1MG7 A;  3U1K A;  4B3M E;  4U3B A;  3OTO I;  4DV0 E;  2C37 B;  4JG4 A;  4LF7 E;  4OO1 E;  4LF6 I;  4OX9 I;  2O3Z A;  1XMO E;  4PRV A;  3P06 A;  4FWG A;  5JEA C;  4K0K I;  5FLX C;  4MDT A;  1XMQ E;  4IZJ B;  2JE6 B;  2UU9 E;  4IZK B;  2UUB I;  2JEB A;  3K17 A;  4X62 E;  3ZZT A;  4DV3 I;  4KHP I;  2Q2E B;  4DV2 E;  2O1W A;  3QT8 A;  5IT9 Q;  5JEA F;  3QT7 A;  1PVG A;  3H1C A;  3HKM A;  4GQU A;  4YHH E;  2C39 A;  4DV7 I;  1ZXM A;  4JI4 I;  5DRQ A;  4B3T E;  1OYR A;  4DR5 E;  4NBQ A;  4IFD B;  2V2Z A;  4JI0 E;  1J5E I;  4JI1 E;  4DV1 E;  1HR0 I;  4JI3 E;  2HK3 A;  2PO1 B;  2VF3 A;  3M85 G;  1RRE A;  4LF5 E;  2UUC E;  4JV5 I;  2GQ0 A;  1USU A;  1B62 A;  2UUA I;  4HYM A;  2JEB B;  3PS3 A;  2NPF A;  1XNR I;  4GKJ E;  5BR8 E;  1ZM3 A;  2BA0 G;  4JI5 I;  5ELW A;  3J81 Q;  3U1Y A;  1K47 A;  2ZM6 E;  4LF9 I;  2GO3 A;  5K36 F;  2AJ4 A;  4OO1 C;  1UEK A;  4ISA A;  4X66 E;  3PS1 A;  2C38 A;  4WUB A;  4JYA I;  1HNW I;  3LNU A;  4X64 I;  2PO0 B;  1Y6Z A;  2WNR A; 
#chains in the Genus database with same CATH homology
 1PKP A;  1MU5 A;  4JI6 E;  3Q1Q A;  1Z0V A;  2Z5B B;  5FLX Q;  1N32 I;  4JI2 I;  1FJG I;  3ZM7 A;  4DR3 I;  4XTJ A;  2CG9 A;  5LMN E;  4HY1 A;  4DR7 I;  2Z5C B;  4DV4 I;  2CGE A;  1H73 A;  1OJ4 A;  3LTO A;  4LF6 E;  1KIJ A;  3T1H I;  4FW9 A;  4GKK E;  5A2Q C;  1ZM4 A;  1I94 I;  5LL6 R;  4LFB I;  5IWA I;  3K85 A;  1HNX I;  4DR2 E;  4NXM I;  1RR9 A;  2PNM A;  4DV6 I;  1XNQ E;  2V8P A;  3JAM Q;  4USM A;  2UXC E;  3QT6 A;  4FWD A;  4DUY E;  1Z5B A;  2HFS A;  1H74 A;  1KVK A;  4AQY I;  4DV7 E;  1IBL I;  2X7I A;  1N34 I;  2HKE A;  4NXN I;  1WUU A;  1IBK I;  2UUA E;  5LMU E;  4LF4 I;  4P52 A;  1N36 E;  4USK A;  4YY3 I;  4LF8 I;  1HNZ I;  4JI7 E;  1HK7 A;  2F4V I;  2WW4 A;  1D6T A;  4LF9 E;  1Z0C A;  3LPS A;  1Y6Z A;  3ZKB A;  2UXD I;  3PRY A;  4X64 E;  2IOQ A;  2HHH I;  5A2Q Q;  3ZZ0 A;  4DR6 I;  5GMD A;  4Z7Y A;  4DR7 E;  3M6A A;  1USV A;  1FKA E;  1Z0E A;  1N0V C;  4MYU A;  4DR1 I;  1Y4S A;  4LFA I;  4FN5 A;  4ZVI A;  1N33 E;  4MYT A;  4X65 I;  3JAM C;  4B3R E;  2UXB I;  4DPW A;  2VQE E;  1IBM I;  2ZBK B;  4URL A;  4DR4 I;  1XHK A;  3B8H A;  3WU4 A;  4B3S I;  3K1J A;  4WUD A;  4AQY E;  1Z0W A;  1NHI A;  2VQF I;  3PYE A;  1N34 E;  4B3M I;  4NXN E;  4DV0 I;  5L3J A;  4LF7 I;  1ELO A;  4UTG A;  3H4L A;  3ZZU A;  1XMO I;  4JI8 E;  4DUZ E;  3F0N A;  2XEX A;  4I3H A;  3WU3 A;  1XMQ I;  2DEI A;  4LF8 E;  1FNM A;  2UU9 I;  4OX9 E;  1HNZ E;  4ED4 A;  4X62 I;  2BM1 A;  1FI4 A;  4DV2 I;  4K0K E;  3J7A M;  2CZ9 A;  4DPU A;  1FWK A;  2X36 A;  2UUB E;  4DPY A;  1Z0B A;  4DV3 E;  4KHP E;  4YHH I;  3B78 A;  2GS8 A;  4KQV A;  4B3T I;  4LFC I;  3PYF A;  4DR5 I;  1NHJ A;  4JI1 I;  1Y4U A;  4DXL A;  4JI3 I;  3CWV A;  3PYD A;  2E5L I;  4LF5 I;  2UUC I;  1S4E A;  4JI4 E;  4HAC A;  1J5E E;  1HR0 E;  4HXZ A;  5BR8 I;  1PIE A;  4JV5 E;  4PRX A;  3D4J A;  2O1U A;  2ZM6 I;  1XNR E;  3V2U C;  4Z7C A;  1Z0G A;  2A2D A;  4UT4 A;  4JI5 E;  4X66 I;  3WU6 A;  4DPT A;  1QZR A;  3ZKD A;  4WUC A;  3T1Y I;  2EFG A;  4JI6 I;  2Z5E A;  4HAC B;  2VQF E;  1Z5A A;  5LMN I;  4JYA E;  1HNW E;  3OTO E;  1Z0T A;  1N32 E;  4JI2 E;  1FJG E;  1B63 A;  4DR3 E;  1BKN A;  4GKK I;  4R1F A;  4DV4 E;  1ZXN A;  5GME A;  1ZM2 A;  4DPX A;  2PNL A;  4DV5 I;  3T1H E;  3HUL A;  4IZJ D;  2OI2 A;  4RPF A;  4DR2 I;  3HJC A;  3J80 Q;  4PU9 A;  1I94 E;  3V5R A;  1XNQ I;  4LFB E;  2A2C A;  2UXC I;  5IWA E;  4DUY I;  1HNX E;  4NXM E;  4N3O A;  1NHH A;  4DV6 E;  4LFC E;  2DEJ A;  1FWL A;  2R42 A;  2HK2 A;  2E5L E;  1VIS A;  2R3V A;  2Z5B A;  2HKJ A;  1IBL E;  5LMU I;  1IBK E;  1N36 I;  1EA6 A;  2Z5C A;  1N0U A;  1H7S A;  1Z5C A;  4JI7 I;  2O1V A;  2V34 A;  1Z59 A;  4LF4 E;  1H7U A;  4YY3 E;  2V2Q A;  2IOP A;  2O1T A;  2F4V E;  3T1Y E;  2BV3 A;  4EMD A;  3QT5 A;  5FWK A;  3J7A G;  1NZ0 A;  2E1R A;  2J7K A;  2UXD E;  3PYG A;  2HHH E;  2BM0 A;  1S16 A;  1KKH A;  1MX0 A;  3Q6N A;  4DR6 E;  4JI0 I;  1N33 I;  4DV1 I;  5IT9 C;  3B82 A;  3J80 C;  2HFU A;  1KTV A;  4B3R I;  2VQE I;  4DV5 E;  4DR1 E;  4LFA E;  4GKJ I;  2ZIT A;  4FWH A;  1H72 C;  4X65 E;  2UXB E;  3GON A;  1IBM E;  1ZM9 A;  4DR4 E;  2V2V A;  4M1K A;  4IZJ A;  1DAR A;  4DU8 A;  4IZK A;  3Q6M A;  1A6F A;  4DU7 A;  2LJP A;  3J81 C;  4P7A A;  4B3S E;  3WU5 A;  1EI1 A;  4JI8 I;  4DUZ I;  1U2R A;  1MG7 A;  4B3M E;  4DV0 E;  4JG4 A;  4LF7 E;  4LF6 I;  4OX9 I;  1XMO E;  4PRV A;  3P06 A;  4FWG A;  4K0K I;  5FLX C;  1XMQ E;  4IZJ B;  2UU9 E;  4IZK B;  2UUB I;  3K17 A;  4X62 E;  3ZZT A;  4DV3 I;  4KHP I;  2Q2E B;  4DV2 E;  2O1W A;  3QT8 A;  5IT9 Q;  3QT7 A;  1PVG A;  4YHH E;  4DV7 I;  1ZXM A;  4JI4 I;  4B3T E;  4DR5 E;  2V2Z A;  4JI0 E;  1J5E I;  4JI1 E;  4DV1 E;  1HR0 I;  4JI3 E;  2HK3 A;  2VF3 A;  1RRE A;  4LF5 E;  2UUC E;  4JV5 I;  2GQ0 A;  1USU A;  1B62 A;  2UUA I;  4HYM A;  2NPF A;  1XNR I;  4GKJ E;  5BR8 E;  1ZM3 A;  4JI5 I;  3J81 Q;  1K47 A;  2ZM6 E;  4LF9 I;  2AJ4 A;  1UEK A;  4X66 E;  4WUB A;  4JYA I;  1HNW I;  3LNU A;  4X64 I;  3OTO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...