1NZ0A

Rnase p protein from thermotoga maritima
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
ERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGMDYSRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIPKGFDIVVIPRKKLSEEFERVDFWTVREKLLNLLKRIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of RNase P protein from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component
total genus 34
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1nz0A00
4FWGA 4USMA 4ZVIA 2CZ9A 1B63A 4DR1I 2E5LE 5LMNE 3ZKBA 4DV1E 4LF7I 3J81C 5A2QQ 1IBLI 4DR3E 3Q1QA 4DV7E 1I94I 1N36I 1HNZE 2X36A 1N0UA 4KQVA 2ZM6E 3M6AA 1PKPA 1IBKI 2E1RA 2V8PA 4YHHI 5IT9C 3QT8A 1HNWI 4PRVA 2VQFI 3QT7A 1XNRE 3K1JA 4AQYI 1B62A 5LL6R 4UTGA 2ZITA 1ZM2A 1HR0E 1RREA 5A2QC 3HULA 4X64I 1Z59A 1N0VC 3T1YE 2HHHI 4DV5I 3V5RA 4X66E 1Z5CA 3JAMC 1ZXNA 3J7AG 4DU7A 4JI8E 2GS8A 4P7AA 4HACA 4B3SI 1HNXE 4DR1E 3J81Q 4LF5I 1Z0CA 5LMNI 1NHIA 4LF7E 4DV3E 4DPUA 4DV0I 4PU9A 3WU3A 1H7SA 1I94E 4OX9I 5GMEA 4LFAE 2UXDI 1PIEA 1XNQI 4FWHA 3JAMQ 4DV2I 2ZM6I 4KHPI 4MYUA 4DPYA 4YHHE 4DV6E 4JI5E 4DR4I 2V2QA 3ZZTA 4Z7YA 5BR8E 4WUCA 4AQYE 5L3JA 4DUYI 4JI4I 1N33I 3ZZ0A 2DEIA 1H7UA 4B3RI 1EA6A 4DR7E 3T1YI 4B3TE 2HHHE 4DV5E 4X66I 4HY1A 3QT5A 3CWVA 5IWAE 4EMDA 1N34I 4XTJA 1N32I 1FI4A 4B3SE 4LF5E 1A6FA 2XEXA 4HXZA 4DV3I 4X62E 4GKJE 3OTOE 3ZM7A 2UXBE 2UXDE 4DR5E 2UUBE 1H74A 2E5LI 4DV2E 2VF3A 3B8HA 2UUCI 4I3HA 1XHKA 4KHPE 4LF4I 4JI1E 4LFCE 1H73A 1Z0TA 4JI7I 1N36E 1HNZI 1D6TA 1ZXMA 2J7KA 2EFGA 4DUZI 4URLA 3V2UC 1QZRA 4JI2E 4JYAE 1FJGE 1KVKA 1PVGA 4GKKI 4DUYE 4JI4E 1N33E 1KTVA 3T1HE 2VQFE 1WUUA 4B3MI 2VQEI 4DR2E 4FN5A 1Z5BA 4R1FA 1NHJA 1NZ0A 4FWDA 1J5EI 4USKA 1MU5A 1FWKA 1XMOI 2UXCI 4X62I 2HKJA 1ELOA 4JI8I 2X7IA 4JV5E 4X65E 3H4LA 1HNXI 4DR5I 2UUCE 5FLXC 4LF4E 4JI1I 4DV0E 4LFCI 4YY3E 4OX9E 1IBMI 3PYEA 3B78A 1OJ4A 2V34A 1XNQE 4WUDA 2WW4A 1FJGI 1KIJA 4GKKE 2ZBKB 4DPXA 1RR9A 3WU4A 3T1HI 4DR4E 2V2ZA 2LJPA 4LFBE 2BM1A 5BR8I 2VQEE 1K47A 2F4VI 2AJ4A 4Z7CA 4LF8E 2Q2EB 2UU9E 1ZM9A 4PRXA 4LF9I 2NPFA 4DR7I 3J80Q 3K17A 4B3TI 3LNUA 1XMQE 2HKEA 2UUAE 1XMOE 4LF6E 3PYDA 2UXCE 5IWAI 2BM0A 4DR6E 1N34E 1FWLA 1N32E 5FLXQ 4JI0I 4DXLA 2DEJA 5LMUI 5IT9Q 4ED4A 3J7AM 4GKJI 2R42A 4YY3I 4P52A 4DV7I 3OTOI 2UXBI 3PYGA 2UUBI 2HK3A 4HYMA 4DV4I 4NXME 1H72C 1Z0BA 4JI7E 1HNWE 2R3VA 4DUZE 1BKNA 2V2VA 4JI2I 4JYAI 4K0KI 4WUBA 1XNRI 4NXNI 2HFSA 1U2RA 2F4VE 4LF8I 2UU9I 1MX0A 3LTOA 4B3ME 1EI1A 4UT4A 4DR2I 4X64E 3ZZUA 4JG4A 4M1KA 1XMQI 4JI3E 2UUAI 1KKHA 1S4EA 4LF6I 1J5EE 4DPTA 3WU6A 4JI6I 4JI0E 1VISA 4HACB 5LMUE 1MG7A 1ZM4A 4RPFA 1FKAE 3QT6A 1Z0GA 4JV5I 4LFAI 4X65I 1Z0VA 1FNMA 1UEKA 3F0NA 4DV1I 4MYTA 1DARA 4DV4E 1IBLE 4FW9A 4DR3I 4NXMI 3GONA 4DV6I 1IBME 4JI5I 4DPWA 2HFUA 4K0KE 1Z5AA 1IBKE 4NXNE 2BV3A 1ZM3A 3WU5A 1S16A 4LFBI 4B3RE 3LPSA 1Z0WA 5GMDA 3B82A 1HR0I 4JI3I 2OI2A 3J80C 4LF9E 2A2CA 3ZKDA 3PYFA 4DU8A 4JI6E 2HK2A 1Z0EA 3D4JA 1NHHA 2A2DA 4DR6I
chains in the Genus database with same CATH superfamily
2PNMA 4FWGA 4USMA 2Z5BA 4ZVIA 2CZ9A 1B63A 4DR1I 2E5LE 5LMNE 3ZKBA 4DV1E 5JEAA 3PS2A 4LF7I 3J81C 5A2QQ 1IBLI 4QNJA 4DR3E 1OYPA 3Q1QA 4DV7E 1I94I 2JEBA 1N36I 1HNZE 4IFDC 2X36A 1N0UA 3CDJA 4KQVA 2ZM6E 2F1DA 3M6AA 2WNRB 1PKPA 1IBKI 2E1RA 2V8PA 2Z5CB 4YHHI 1USUA 1USVA 5IT9C 3QT8A 1HNWI 4PRVA 4IFDD 2VQFI 3QT7A 2GO4A 2JE6A 1XNRE 2C39B 3K1JA 4AQYI 1B62A 5LL6R 4UTGA 2ZITA 1ZM2A 1HR0E 1RREA 5C0XA 5A2QC 2JEAA 4IZJB 3Q6MA 3HULA 4U3DA 4IZJA 4X64I 1Z59A 1N0VC 3T1YE 4IFDE 5K36A 2HHHI 4DV5I 5DNXA 3V5RA 2JEAB 4X66E 1Z5CA 3JAMC 1ZXNA 4IFDA 5K36E 3J7AG 5C0XD 4DU7A 4JI8E 1XXEA 2GS8A 4P7AA 2PNZA 4HACA 4B3SI 1HNXE 4DR1E 3J81Q 4LF5I 1Z0CA 5LMNI 3B4TA 1NHIA 4LF7E 4DV3E 4DPUA 2O1WA 2NN6E 4DV0I 4MQYA 4PU9A 3WU3A 1H7SA 1I94E 4OX9I 5GMEA 4LFAE 5K36B 3DD6A 2UXDI 1PIEA 4LPFA 4FWHA 4MU0A 1XNQI 3JAMQ 4DV2I 2ZM6I 3PS1A 4KHPI 4MYUA 2NN6D 4DPYA 2CGEA 4YHHE 4DV6E 3GLLA 4JI5E 3M85G 4DR4I 5ELWA 2NN6B 2V2QA 3ZZTA 4Z7YA 2NN6F 5BR8E 2JE6B 4WUCA 2IESA 4AQYE 5L3JA 4DUYI 4JI4I 1N33I 2PO1B 3ZZ0A 2DEIA 1YH8A 1H7UA 4B3RI 1EA6A 2BA0D 4NBQA 5K36F 4DR7E 1Y6ZA 4J3DA 3T1YI 4B3TE 2HHHE 4DV5E 4X66I 4HY1A 3QT5A 3CWVA 4AIDA 5IWAE 2O3ZA 1HK7A 4EMDA 2IOPA 2VESA 5C0XF 2WP8A 1N34I 4XTJA 1N32I 3P06A 1FI4A 4B3SE 4LF5E 1A6FA 2XEXA 2PO2B 4HXZA 4DV3I 4X62E 4GKJE 2PO0B 3OTOE 3ZM7A 2UXBE 2UXDE 4DR5E 2UUBE 1H74A 2E5LI 1UDOA 4DV2E 1Y4SA 2VF3A 3B8HA 2UUCI 4I3HA 2PO1A 1XHKA 4KHPE 4LF4I 4JI1E 4LFCE 1H73A 1Z0TA 3K85A 1N36E 3GMEA 4JI7I 1HNZI 1D6TA 1ZXMA 4LCFA 2J7KA 2EFGA 4DUZI 4URLA 3V2UC 1QZRA 4JI2E 4JYAE 1FJGE 1KVKA 1PVGA 4GKKI 4FW4A 4DUYE 4JI4E 1N33E 1KTVA 2Z5CA 4MU1A 3T1HE 2VQFE 1WUUA 4B3MI 2VQEI 3M7NG 4DR2E 3KRNA 5JEAB 3HJCA 4FN5A 4U3BA 1Z5BA 2PNZB 4R1FA 1NHJA 1NZ0A 4FWDA 3PS3A 1J5EI 4USKA 1MU5A 1E3PA 2NN6A 1FWKA 1XMOI 2J65A 3H1CA 4BA1B 2UXCI 1P42A 3L7ZA 4X62I 2HKJA 1ELOA 4JI8I 4ISAA 4FW6A 4MDTA 4LCGA 2BA1G 2X7IA 4JV5E 4X65E 3H4LA 1HNXI 4DR5I 1UDQA 1OYRA 3P3GA 2UUCE 5EKWA 5FLXC 5DRRA 4LF4E 4JI1I 4DV0E 4LFCI 4YY3E 4OX9E 2PNLA 1IBMI 2C38B 3PYEA 3B78A 1OJ4A 2V34A 1XNQE 4WUDA 2WW4A 1FJGI 1KIJA 4GKKE 2ZBKB 4DPXA 5K36D 1E3HA 3NZKA 2AE8A 1RHYA 4OO1B 1RR9A 2JEBB 5DRPA 3WU4A 3T1HI 2BA0G 2GQ0A 4DR4E 5JEAF 2V2ZA 2LJPA 4LFBE 2BM1A 5BR8I 4OO1E 2VQEE 1K47A 3PRYA 5K36C 3U1YA 2F4VI 2AJ4A 2C37B 4Z7CA 4LF8E 4BA1A 2Q2EB 2UU9E 2GO3A 1UDSA 4FW5A 1ZM9A 4PRXA 4LF9I 2NPFA 4DR7I 4IS9A 4IZKB 3J80Q 3K17A 2C37A 4B3TI 3LNUA 1XMQE 5FWKA 2HKEA 2UUAE 1XMOE 4LF6E 3PYDA 2UXCE 5IWAI 2BM0A 4AM3A 4DR6E 1N34E 2BR2A 1FWLA 2BA1D 5C0XC 1N32E 4AIMA 4GQUA 5FLXQ 4JI0I 5JEAD 4DXLA 2DEJA 5LMUI 5IT9Q 4ED4A 2JT2A 4LOMA 2WP8B 2R42A 4MU4A 4YY3I 3J7AM 4GKJI 4P52A 4DV7I 4OO1F 1UDNA 3OTOI 2UXBI 3PYGA 4IZKA 2UUBI 2Z5BB 4BA2A 2HK3A 4HYMA 4DV4I 4OZEA 4IFDB 4NXME 1H72C 4IZJD 1Z0BA 3Q6NA 4JI7E 5EL9A 1R6LA 3U1KA 1HNWE 2O1UA 2PO0A 3M7ND 2R3VA 4DUZE 1BKNA 2V2VA 4OO1C 4JI2I 1OYSA 4JYAI 4K0KI 4WUBA 1XNRI 3P76A 2HFSA 4NXNI 1U2RA 2F4VE 4LF8I 1Y4UA 2PO2A 2UU9I 5C0XB 1MX0A 4IFDF 3LTOA 2CG9A 5DRQA 3P3EA 4B3ME 1EI1A 1Y60A 4UT4A 4LCHA 4DR2I 4FW7A 4X64E 3ZZUA 4JG4A 4M1KA 5DNLA 1XMQI 4JI3E 2UUAI 1KKHA 1S4EA 4LF6I 3P3CA 4OKGA 1J5EE 3HKMA 4DPTA 2WNRA 3WU6A 2O1VA 4JI6I 4JI0E 1VISA 4HACB 5LMUE 1MG7A 1ZM4A 5JEAC 4RPFA 1FKAE 5JEAE 3QT6A 1Z0GA 3GCMA 4JV5I 4LFAI 4X65I 1Z0VA 1FNMA 1UEKA 3F0NA 1YHCA 4DV1I 4MYTA 1DARA 4DV4E 1IBLE 4FW9A 4DR3I 2IOQA 4NXMI 3GONA 4DV6I 1IBME 1VI7A 4JI5I 3UHMA 4DPWA 2HFUA 2O1TA 4K0KE 4QNKA 1Z5AA 1IBKE 4NXNE 2BV3A 2CVEA 2Z5EA 1ZM3A 3WU5A 4BA2B 4OO1A 1R6MA 1S16A 2C38A 4LFBI 4N3OA 4B3RE 3M85D 4OO1D 3LPSA 1Z0WA 2NN6C 5GMDA 3CDIA 3B82A 1HR0I 4FW3A 4JI3I 2BR2B 2OI2A 1Y5YA 4MU3A 3J80C 5C0XE 5DROA 4LF9E 2A2CA 3ZKDA 3L7ZB 3PYFA 4DU8A 4JI6E 2HK2A 1Z0EA 2C39A 3D4JA 1NHHA 2A2DA 2IERA 4DR6I
chains in the Genus database with same CATH topology
2PNMA 4FWGA 4USMA 2Z5BA 4ZVIA 2CZ9A 1B63A 4DR1I 2E5LE 5LMNE 3ZKBA 4DV1E 4LF7I 3J81C 5A2QQ 1IBLI 4DR3E 3Q1QA 4DV7E 1I94I 1N36I 1HNZE 2X36A 1N0UA 4KQVA 2ZM6E 3M6AA 1PKPA 1IBKI 2E1RA 2V8PA 2Z5CB 4YHHI 1USUA 1USVA 5IT9C 3QT8A 1HNWI 4PRVA 2VQFI 3QT7A 1XNRE 3K1JA 4AQYI 1B62A 5LL6R 4UTGA 2ZITA 1ZM2A 1HR0E 1RREA 5A2QC 4IZJB 3Q6MA 3HULA 4IZJA 4X64I 1Z59A 1N0VC 3T1YE 2HHHI 4DV5I 3V5RA 4X66E 1Z5CA 3JAMC 1ZXNA 3J7AG 4DU7A 4JI8E 2GS8A 4P7AA 4HACA 4B3SI 1HNXE 4DR1E 3J81Q 4LF5I 1Z0CA 5LMNI 1NHIA 4LF7E 4DV3E 4DPUA 2O1WA 4DV0I 4PU9A 3WU3A 1H7SA 1I94E 4OX9I 5GMEA 4LFAE 2UXDI 1PIEA 1XNQI 4FWHA 3JAMQ 4DV2I 2ZM6I 4KHPI 4MYUA 4DPYA 2CGEA 4YHHE 4DV6E 4JI5E 4DR4I 2V2QA 3ZZTA 4Z7YA 5BR8E 4WUCA 4AQYE 5L3JA 4DUYI 4JI4I 1N33I 3ZZ0A 2DEIA 1H7UA 4B3RI 1EA6A 4DR7E 1Y6ZA 3T1YI 4B3TE 2HHHE 4DV5E 4X66I 4HY1A 3QT5A 3CWVA 5IWAE 1HK7A 4EMDA 2IOPA 1N34I 4XTJA 1N32I 3P06A 1FI4A 4B3SE 4LF5E 1A6FA 2XEXA 4HXZA 4DV3I 4X62E 4GKJE 3OTOE 3ZM7A 2UXBE 2UXDE 4DR5E 2UUBE 1H74A 2E5LI 4DV2E 1Y4SA 2VF3A 3B8HA 2UUCI 4I3HA 1XHKA 4KHPE 4LF4I 4JI1E 4LFCE 1H73A 1Z0TA 3K85A 1N36E 4JI7I 1HNZI 1D6TA 1ZXMA 2J7KA 2EFGA 4DUZI 4URLA 3V2UC 1QZRA 4JI2E 4JYAE 1FJGE 1KVKA 1PVGA 4GKKI 4DUYE 4JI4E 1N33E 1KTVA 2Z5CA 3T1HE 2VQFE 1WUUA 4B3MI 2VQEI 4DR2E 3HJCA 4FN5A 1Z5BA 4R1FA 1NHJA 1NZ0A 4FWDA 1J5EI 4USKA 1MU5A 1FWKA 1XMOI 2UXCI 4X62I 2HKJA 1ELOA 4JI8I 2X7IA 4JV5E 4X65E 3H4LA 1HNXI 4DR5I 2UUCE 5FLXC 4LF4E 4JI1I 4DV0E 4LFCI 4YY3E 4OX9E 2PNLA 1IBMI 3PYEA 3B78A 1OJ4A 2V34A 1XNQE 4WUDA 2WW4A 1FJGI 1KIJA 4GKKE 2ZBKB 4DPXA 1RR9A 3WU4A 3T1HI 2GQ0A 4DR4E 2V2ZA 2LJPA 4LFBE 2BM1A 5BR8I 2VQEE 1K47A 3PRYA 2F4VI 2AJ4A 4Z7CA 4LF8E 2Q2EB 2UU9E 1ZM9A 4PRXA 4LF9I 2NPFA 4DR7I 4IZKB 3J80Q 3K17A 4B3TI 3LNUA 1XMQE 5FWKA 2HKEA 2UUAE 1XMOE 4LF6E 3PYDA 2UXCE 5IWAI 2BM0A 4DR6E 1N34E 1FWLA 1N32E 5FLXQ 4JI0I 4DXLA 2DEJA 5LMUI 5IT9Q 4ED4A 3J7AM 4GKJI 2R42A 4YY3I 4P52A 4DV7I 3OTOI 2UXBI 3PYGA 4IZKA 2UUBI 2Z5BB 2HK3A 4HYMA 4DV4I 4NXME 1H72C 4IZJD 1Z0BA 3Q6NA 4JI7E 1HNWE 2O1UA 2R3VA 4DUZE 1BKNA 2V2VA 4JI2I 4JYAI 4K0KI 4WUBA 1XNRI 4NXNI 2HFSA 1U2RA 2F4VE 4LF8I 1Y4UA 2UU9I 1MX0A 3LTOA 2CG9A 4B3ME 1EI1A 4UT4A 4DR2I 4X64E 3ZZUA 4JG4A 4M1KA 1XMQI 4JI3E 2UUAI 1KKHA 1S4EA 4LF6I 1J5EE 4DPTA 3WU6A 2O1VA 4JI6I 4JI0E 1VISA 4HACB 5LMUE 1MG7A 1ZM4A 4RPFA 1FKAE 3QT6A 1Z0GA 4JV5I 4LFAI 4X65I 1Z0VA 1FNMA 1UEKA 3F0NA 4DV1I 4MYTA 1DARA 4DV4E 1IBLE 4FW9A 4DR3I 2IOQA 4NXMI 3GONA 4DV6I 1IBME 4JI5I 4DPWA 2HFUA 2O1TA 4K0KE 1Z5AA 1IBKE 4NXNE 2BV3A 2Z5EA 1ZM3A 3WU5A 1S16A 4LFBI 4N3OA 4B3RE 3LPSA 1Z0WA 5GMDA 3B82A 1HR0I 4JI3I 2OI2A 3J80C 4LF9E 2A2CA 3ZKDA 3PYFA 4DU8A 4JI6E 2HK2A 1Z0EA 3D4JA 1NHHA 2A2DA 4DR6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWG A;  4USM A;  4ZVI A;  2CZ9 A;  1B63 A;  4DR1 I;  2E5L E;  5LMN E;  3ZKB A;  4DV1 E;  4LF7 I;  3J81 C;  5A2Q Q;  1IBL I;  4DR3 E;  3Q1Q A;  4DV7 E;  1I94 I;  1N36 I;  1HNZ E;  2X36 A;  1N0U A;  4KQV A;  2ZM6 E;  3M6A A;  1PKP A;  1IBK I;  2E1R A;  2V8P A;  4YHH I;  5IT9 C;  3QT8 A;  1HNW I;  4PRV A;  2VQF I;  3QT7 A;  1XNR E;  3K1J A;  4AQY I;  1B62 A;  5LL6 R;  4UTG A;  2ZIT A;  1ZM2 A;  1HR0 E;  1RRE A;  5A2Q C;  3HUL A;  4X64 I;  1Z59 A;  1N0V C;  3T1Y E;  2HHH I;  4DV5 I;  3V5R A;  4X66 E;  1Z5C A;  3JAM C;  1ZXN A;  3J7A G;  4DU7 A;  4JI8 E;  2GS8 A;  4P7A A;  4HAC A;  4B3S I;  1HNX E;  4DR1 E;  3J81 Q;  4LF5 I;  1Z0C A;  5LMN I;  1NHI A;  4LF7 E;  4DV3 E;  4DPU A;  4DV0 I;  4PU9 A;  3WU3 A;  1H7S A;  1I94 E;  4OX9 I;  5GME A;  4LFA E;  2UXD I;  1PIE A;  1XNQ I;  4FWH A;  3JAM Q;  4DV2 I;  2ZM6 I;  4KHP I;  4MYU A;  4DPY A;  4YHH E;  4DV6 E;  4JI5 E;  4DR4 I;  2V2Q A;  3ZZT A;  4Z7Y A;  5BR8 E;  4WUC A;  4AQY E;  5L3J A;  4DUY I;  4JI4 I;  1N33 I;  3ZZ0 A;  2DEI A;  1H7U A;  4B3R I;  1EA6 A;  4DR7 E;  3T1Y I;  4B3T E;  2HHH E;  4DV5 E;  4X66 I;  4HY1 A;  3QT5 A;  3CWV A;  5IWA E;  4EMD A;  1N34 I;  4XTJ A;  1N32 I;  1FI4 A;  4B3S E;  4LF5 E;  1A6F A;  2XEX A;  4HXZ A;  4DV3 I;  4X62 E;  4GKJ E;  3OTO E;  3ZM7 A;  2UXB E;  2UXD E;  4DR5 E;  2UUB E;  1H74 A;  2E5L I;  4DV2 E;  2VF3 A;  3B8H A;  2UUC I;  4I3H A;  1XHK A;  4KHP E;  4LF4 I;  4JI1 E;  4LFC E;  1H73 A;  1Z0T A;  4JI7 I;  1N36 E;  1HNZ I;  1D6T A;  1ZXM A;  2J7K A;  2EFG A;  4DUZ I;  4URL A;  3V2U C;  1QZR A;  4JI2 E;  4JYA E;  1FJG E;  1KVK A;  1PVG A;  4GKK I;  4DUY E;  4JI4 E;  1N33 E;  1KTV A;  3T1H E;  2VQF E;  1WUU A;  4B3M I;  2VQE I;  4DR2 E;  4FN5 A;  1Z5B A;  4R1F A;  1NHJ A;  1NZ0 A;  4FWD A;  1J5E I;  4USK A;  1MU5 A;  1FWK A;  1XMO I;  2UXC I;  4X62 I;  2HKJ A;  1ELO A;  4JI8 I;  2X7I A;  4JV5 E;  4X65 E;  3H4L A;  1HNX I;  4DR5 I;  2UUC E;  5FLX C;  4LF4 E;  4JI1 I;  4DV0 E;  4LFC I;  4YY3 E;  4OX9 E;  1IBM I;  3PYE A;  3B78 A;  1OJ4 A;  2V34 A;  1XNQ E;  4WUD A;  2WW4 A;  1FJG I;  1KIJ A;  4GKK E;  2ZBK B;  4DPX A;  1RR9 A;  3WU4 A;  3T1H I;  4DR4 E;  2V2Z A;  2LJP A;  4LFB E;  2BM1 A;  5BR8 I;  2VQE E;  1K47 A;  2F4V I;  2AJ4 A;  4Z7C A;  4LF8 E;  2Q2E B;  2UU9 E;  1ZM9 A;  4PRX A;  4LF9 I;  2NPF A;  4DR7 I;  3J80 Q;  3K17 A;  4B3T I;  3LNU A;  1XMQ E;  2HKE A;  2UUA E;  1XMO E;  4LF6 E;  3PYD A;  2UXC E;  5IWA I;  2BM0 A;  4DR6 E;  1N34 E;  1FWL A;  1N32 E;  5FLX Q;  4JI0 I;  4DXL A;  2DEJ A;  5LMU I;  5IT9 Q;  4ED4 A;  3J7A M;  4GKJ I;  2R42 A;  4YY3 I;  4P52 A;  4DV7 I;  3OTO I;  2UXB I;  3PYG A;  2UUB I;  2HK3 A;  4HYM A;  4DV4 I;  4NXM E;  1H72 C;  1Z0B A;  4JI7 E;  1HNW E;  2R3V A;  4DUZ E;  1BKN A;  2V2V A;  4JI2 I;  4JYA I;  4K0K I;  4WUB A;  1XNR I;  4NXN I;  2HFS A;  1U2R A;  2F4V E;  4LF8 I;  2UU9 I;  1MX0 A;  3LTO A;  4B3M E;  1EI1 A;  4UT4 A;  4DR2 I;  4X64 E;  3ZZU A;  4JG4 A;  4M1K A;  1XMQ I;  4JI3 E;  2UUA I;  1KKH A;  1S4E A;  4LF6 I;  1J5E E;  4DPT A;  3WU6 A;  4JI6 I;  4JI0 E;  1VIS A;  4HAC B;  5LMU E;  1MG7 A;  1ZM4 A;  4RPF A;  1FKA E;  3QT6 A;  1Z0G A;  4JV5 I;  4LFA I;  4X65 I;  1Z0V A;  1FNM A;  1UEK A;  3F0N A;  4DV1 I;  4MYT A;  1DAR A;  4DV4 E;  1IBL E;  4FW9 A;  4DR3 I;  4NXM I;  3GON A;  4DV6 I;  1IBM E;  4JI5 I;  4DPW A;  2HFU A;  4K0K E;  1Z5A A;  1IBK E;  4NXN E;  2BV3 A;  1ZM3 A;  3WU5 A;  1S16 A;  4LFB I;  4B3R E;  3LPS A;  1Z0W A;  5GMD A;  3B82 A;  1HR0 I;  4JI3 I;  2OI2 A;  3J80 C;  4LF9 E;  2A2C A;  3ZKD A;  3PYF A;  4DU8 A;  4JI6 E;  2HK2 A;  1Z0E A;  3D4J A;  1NHH A;  2A2D A;  4DR6 I; 
#chains in the Genus database with same CATH topology
 2PNM A;  4FWG A;  4USM A;  2Z5B A;  4ZVI A;  2CZ9 A;  1B63 A;  4DR1 I;  2E5L E;  5LMN E;  3ZKB A;  4DV1 E;  5JEA A;  3PS2 A;  4LF7 I;  3J81 C;  5A2Q Q;  1IBL I;  4QNJ A;  4DR3 E;  1OYP A;  3Q1Q A;  4DV7 E;  1I94 I;  2JEB A;  1N36 I;  1HNZ E;  4IFD C;  2X36 A;  1N0U A;  3CDJ A;  4KQV A;  2ZM6 E;  2F1D A;  3M6A A;  2WNR B;  1PKP A;  1IBK I;  2E1R A;  2V8P A;  2Z5C B;  4YHH I;  1USU A;  1USV A;  5IT9 C;  3QT8 A;  1HNW I;  4PRV A;  4IFD D;  2VQF I;  3QT7 A;  2GO4 A;  2JE6 A;  1XNR E;  2C39 B;  3K1J A;  4AQY I;  1B62 A;  5LL6 R;  4UTG A;  2ZIT A;  1ZM2 A;  1HR0 E;  1RRE A;  5C0X A;  5A2Q C;  2JEA A;  4IZJ B;  3Q6M A;  3HUL A;  4U3D A;  4IZJ A;  4X64 I;  1Z59 A;  1N0V C;  3T1Y E;  4IFD E;  5K36 A;  2HHH I;  4DV5 I;  5DNX A;  3V5R A;  2JEA B;  4X66 E;  1Z5C A;  3JAM C;  1ZXN A;  4IFD A;  5K36 E;  3J7A G;  5C0X D;  4DU7 A;  4JI8 E;  1XXE A;  2GS8 A;  4P7A A;  2PNZ A;  4HAC A;  4B3S I;  1HNX E;  4DR1 E;  3J81 Q;  4LF5 I;  1Z0C A;  5LMN I;  3B4T A;  1NHI A;  4LF7 E;  4DV3 E;  4DPU A;  2O1W A;  2NN6 E;  4DV0 I;  4MQY A;  4PU9 A;  3WU3 A;  1H7S A;  1I94 E;  4OX9 I;  5GME A;  4LFA E;  5K36 B;  3DD6 A;  2UXD I;  1PIE A;  4LPF A;  4FWH A;  4MU0 A;  1XNQ I;  3JAM Q;  4DV2 I;  2ZM6 I;  3PS1 A;  4KHP I;  4MYU A;  2NN6 D;  4DPY A;  2CGE A;  4YHH E;  4DV6 E;  3GLL A;  4JI5 E;  3M85 G;  4DR4 I;  5ELW A;  2NN6 B;  2V2Q A;  3ZZT A;  4Z7Y A;  2NN6 F;  5BR8 E;  2JE6 B;  4WUC A;  2IES A;  4AQY E;  5L3J A;  4DUY I;  4JI4 I;  1N33 I;  2PO1 B;  3ZZ0 A;  2DEI A;  1YH8 A;  1H7U A;  4B3R I;  1EA6 A;  2BA0 D;  4NBQ A;  5K36 F;  4DR7 E;  1Y6Z A;  4J3D A;  3T1Y I;  4B3T E;  2HHH E;  4DV5 E;  4X66 I;  4HY1 A;  3QT5 A;  3CWV A;  4AID A;  5IWA E;  2O3Z A;  1HK7 A;  4EMD A;  2IOP A;  2VES A;  5C0X F;  2WP8 A;  1N34 I;  4XTJ A;  1N32 I;  3P06 A;  1FI4 A;  4B3S E;  4LF5 E;  1A6F A;  2XEX A;  2PO2 B;  4HXZ A;  4DV3 I;  4X62 E;  4GKJ E;  2PO0 B;  3OTO E;  3ZM7 A;  2UXB E;  2UXD E;  4DR5 E;  2UUB E;  1H74 A;  2E5L I;  1UDO A;  4DV2 E;  1Y4S A;  2VF3 A;  3B8H A;  2UUC I;  4I3H A;  2PO1 A;  1XHK A;  4KHP E;  4LF4 I;  4JI1 E;  4LFC E;  1H73 A;  1Z0T A;  3K85 A;  1N36 E;  3GME A;  4JI7 I;  1HNZ I;  1D6T A;  1ZXM A;  4LCF A;  2J7K A;  2EFG A;  4DUZ I;  4URL A;  3V2U C;  1QZR A;  4JI2 E;  4JYA E;  1FJG E;  1KVK A;  1PVG A;  4GKK I;  4FW4 A;  4DUY E;  4JI4 E;  1N33 E;  1KTV A;  2Z5C A;  4MU1 A;  3T1H E;  2VQF E;  1WUU A;  4B3M I;  2VQE I;  3M7N G;  4DR2 E;  3KRN A;  5JEA B;  3HJC A;  4FN5 A;  4U3B A;  1Z5B A;  2PNZ B;  4R1F A;  1NHJ A;  1NZ0 A;  4FWD A;  3PS3 A;  1J5E I;  4USK A;  1MU5 A;  1E3P A;  2NN6 A;  1FWK A;  1XMO I;  2J65 A;  3H1C A;  4BA1 B;  2UXC I;  1P42 A;  3L7Z A;  4X62 I;  2HKJ A;  1ELO A;  4JI8 I;  4ISA A;  4FW6 A;  4MDT A;  4LCG A;  2BA1 G;  2X7I A;  4JV5 E;  4X65 E;  3H4L A;  1HNX I;  4DR5 I;  1UDQ A;  1OYR A;  3P3G A;  2UUC E;  5EKW A;  5FLX C;  5DRR A;  4LF4 E;  4JI1 I;  4DV0 E;  4LFC I;  4YY3 E;  4OX9 E;  2PNL A;  1IBM I;  2C38 B;  3PYE A;  3B78 A;  1OJ4 A;  2V34 A;  1XNQ E;  4WUD A;  2WW4 A;  1FJG I;  1KIJ A;  4GKK E;  2ZBK B;  4DPX A;  5K36 D;  1E3H A;  3NZK A;  2AE8 A;  1RHY A;  4OO1 B;  1RR9 A;  2JEB B;  5DRP A;  3WU4 A;  3T1H I;  2BA0 G;  2GQ0 A;  4DR4 E;  5JEA F;  2V2Z A;  2LJP A;  4LFB E;  2BM1 A;  5BR8 I;  4OO1 E;  2VQE E;  1K47 A;  3PRY A;  5K36 C;  3U1Y A;  2F4V I;  2AJ4 A;  2C37 B;  4Z7C A;  4LF8 E;  4BA1 A;  2Q2E B;  2UU9 E;  2GO3 A;  1UDS A;  4FW5 A;  1ZM9 A;  4PRX A;  4LF9 I;  2NPF A;  4DR7 I;  4IS9 A;  4IZK B;  3J80 Q;  3K17 A;  2C37 A;  4B3T I;  3LNU A;  1XMQ E;  5FWK A;  2HKE A;  2UUA E;  1XMO E;  4LF6 E;  3PYD A;  2UXC E;  5IWA I;  2BM0 A;  4AM3 A;  4DR6 E;  1N34 E;  2BR2 A;  1FWL A;  2BA1 D;  5C0X C;  1N32 E;  4AIM A;  4GQU A;  5FLX Q;  4JI0 I;  5JEA D;  4DXL A;  2DEJ A;  5LMU I;  5IT9 Q;  4ED4 A;  2JT2 A;  4LOM A;  2WP8 B;  2R42 A;  4MU4 A;  4YY3 I;  3J7A M;  4GKJ I;  4P52 A;  4DV7 I;  4OO1 F;  1UDN A;  3OTO I;  2UXB I;  3PYG A;  4IZK A;  2UUB I;  2Z5B B;  4BA2 A;  2HK3 A;  4HYM A;  4DV4 I;  4OZE A;  4IFD B;  4NXM E;  1H72 C;  4IZJ D;  1Z0B A;  3Q6N A;  4JI7 E;  5EL9 A;  1R6L A;  3U1K A;  1HNW E;  2O1U A;  2PO0 A;  3M7N D;  2R3V A;  4DUZ E;  1BKN A;  2V2V A;  4OO1 C;  4JI2 I;  1OYS A;  4JYA I;  4K0K I;  4WUB A;  1XNR I;  3P76 A;  2HFS A;  4NXN I;  1U2R A;  2F4V E;  4LF8 I;  1Y4U A;  2PO2 A;  2UU9 I;  5C0X B;  1MX0 A;  4IFD F;  3LTO A;  2CG9 A;  5DRQ A;  3P3E A;  4B3M E;  1EI1 A;  1Y60 A;  4UT4 A;  4LCH A;  4DR2 I;  4FW7 A;  4X64 E;  3ZZU A;  4JG4 A;  4M1K A;  5DNL A;  1XMQ I;  4JI3 E;  2UUA I;  1KKH A;  1S4E A;  4LF6 I;  3P3C A;  4OKG A;  1J5E E;  3HKM A;  4DPT A;  2WNR A;  3WU6 A;  2O1V A;  4JI6 I;  4JI0 E;  1VIS A;  4HAC B;  5LMU E;  1MG7 A;  1ZM4 A;  5JEA C;  4RPF A;  1FKA E;  5JEA E;  3QT6 A;  1Z0G A;  3GCM A;  4JV5 I;  4LFA I;  4X65 I;  1Z0V A;  1FNM A;  1UEK A;  3F0N A;  1YHC A;  4DV1 I;  4MYT A;  1DAR A;  4DV4 E;  1IBL E;  4FW9 A;  4DR3 I;  2IOQ A;  4NXM I;  3GON A;  4DV6 I;  1IBM E;  1VI7 A;  4JI5 I;  3UHM A;  4DPW A;  2HFU A;  2O1T A;  4K0K E;  4QNK A;  1Z5A A;  1IBK E;  4NXN E;  2BV3 A;  2CVE A;  2Z5E A;  1ZM3 A;  3WU5 A;  4BA2 B;  4OO1 A;  1R6M A;  1S16 A;  2C38 A;  4LFB I;  4N3O A;  4B3R E;  3M85 D;  4OO1 D;  3LPS A;  1Z0W A;  2NN6 C;  5GMD A;  3CDI A;  3B82 A;  1HR0 I;  4FW3 A;  4JI3 I;  2BR2 B;  2OI2 A;  1Y5Y A;  4MU3 A;  3J80 C;  5C0X E;  5DRO A;  4LF9 E;  2A2C A;  3ZKD A;  3L7Z B;  3PYF A;  4DU8 A;  4JI6 E;  2HK2 A;  1Z0E A;  2C39 A;  3D4J A;  1NHH A;  2A2D A;  2IER A;  4DR6 I; 
#chains in the Genus database with same CATH homology
 2PNM A;  4FWG A;  4USM A;  2Z5B A;  4ZVI A;  2CZ9 A;  1B63 A;  4DR1 I;  2E5L E;  5LMN E;  3ZKB A;  4DV1 E;  4LF7 I;  3J81 C;  5A2Q Q;  1IBL I;  4DR3 E;  3Q1Q A;  4DV7 E;  1I94 I;  1N36 I;  1HNZ E;  2X36 A;  1N0U A;  4KQV A;  2ZM6 E;  3M6A A;  1PKP A;  1IBK I;  2E1R A;  2V8P A;  2Z5C B;  4YHH I;  1USU A;  1USV A;  5IT9 C;  3QT8 A;  1HNW I;  4PRV A;  2VQF I;  3QT7 A;  1XNR E;  3K1J A;  4AQY I;  1B62 A;  5LL6 R;  4UTG A;  2ZIT A;  1ZM2 A;  1HR0 E;  1RRE A;  5A2Q C;  4IZJ B;  3Q6M A;  3HUL A;  4IZJ A;  4X64 I;  1Z59 A;  1N0V C;  3T1Y E;  2HHH I;  4DV5 I;  3V5R A;  4X66 E;  1Z5C A;  3JAM C;  1ZXN A;  3J7A G;  4DU7 A;  4JI8 E;  2GS8 A;  4P7A A;  4HAC A;  4B3S I;  1HNX E;  4DR1 E;  3J81 Q;  4LF5 I;  1Z0C A;  5LMN I;  1NHI A;  4LF7 E;  4DV3 E;  4DPU A;  2O1W A;  4DV0 I;  4PU9 A;  3WU3 A;  1H7S A;  1I94 E;  4OX9 I;  5GME A;  4LFA E;  2UXD I;  1PIE A;  1XNQ I;  4FWH A;  3JAM Q;  4DV2 I;  2ZM6 I;  4KHP I;  4MYU A;  4DPY A;  2CGE A;  4YHH E;  4DV6 E;  4JI5 E;  4DR4 I;  2V2Q A;  3ZZT A;  4Z7Y A;  5BR8 E;  4WUC A;  4AQY E;  5L3J A;  4DUY I;  4JI4 I;  1N33 I;  3ZZ0 A;  2DEI A;  1H7U A;  4B3R I;  1EA6 A;  4DR7 E;  1Y6Z A;  3T1Y I;  4B3T E;  2HHH E;  4DV5 E;  4X66 I;  4HY1 A;  3QT5 A;  3CWV A;  5IWA E;  1HK7 A;  4EMD A;  2IOP A;  1N34 I;  4XTJ A;  1N32 I;  3P06 A;  1FI4 A;  4B3S E;  4LF5 E;  1A6F A;  2XEX A;  4HXZ A;  4DV3 I;  4X62 E;  4GKJ E;  3OTO E;  3ZM7 A;  2UXB E;  2UXD E;  4DR5 E;  2UUB E;  1H74 A;  2E5L I;  4DV2 E;  1Y4S A;  2VF3 A;  3B8H A;  2UUC I;  4I3H A;  1XHK A;  4KHP E;  4LF4 I;  4JI1 E;  4LFC E;  1H73 A;  1Z0T A;  3K85 A;  1N36 E;  4JI7 I;  1HNZ I;  1D6T A;  1ZXM A;  2J7K A;  2EFG A;  4DUZ I;  4URL A;  3V2U C;  1QZR A;  4JI2 E;  4JYA E;  1FJG E;  1KVK A;  1PVG A;  4GKK I;  4DUY E;  4JI4 E;  1N33 E;  1KTV A;  2Z5C A;  3T1H E;  2VQF E;  1WUU A;  4B3M I;  2VQE I;  4DR2 E;  3HJC A;  4FN5 A;  1Z5B A;  4R1F A;  1NHJ A;  1NZ0 A;  4FWD A;  1J5E I;  4USK A;  1MU5 A;  1FWK A;  1XMO I;  2UXC I;  4X62 I;  2HKJ A;  1ELO A;  4JI8 I;  2X7I A;  4JV5 E;  4X65 E;  3H4L A;  1HNX I;  4DR5 I;  2UUC E;  5FLX C;  4LF4 E;  4JI1 I;  4DV0 E;  4LFC I;  4YY3 E;  4OX9 E;  2PNL A;  1IBM I;  3PYE A;  3B78 A;  1OJ4 A;  2V34 A;  1XNQ E;  4WUD A;  2WW4 A;  1FJG I;  1KIJ A;  4GKK E;  2ZBK B;  4DPX A;  1RR9 A;  3WU4 A;  3T1H I;  2GQ0 A;  4DR4 E;  2V2Z A;  2LJP A;  4LFB E;  2BM1 A;  5BR8 I;  2VQE E;  1K47 A;  3PRY A;  2F4V I;  2AJ4 A;  4Z7C A;  4LF8 E;  2Q2E B;  2UU9 E;  1ZM9 A;  4PRX A;  4LF9 I;  2NPF A;  4DR7 I;  4IZK B;  3J80 Q;  3K17 A;  4B3T I;  3LNU A;  1XMQ E;  5FWK A;  2HKE A;  2UUA E;  1XMO E;  4LF6 E;  3PYD A;  2UXC E;  5IWA I;  2BM0 A;  4DR6 E;  1N34 E;  1FWL A;  1N32 E;  5FLX Q;  4JI0 I;  4DXL A;  2DEJ A;  5LMU I;  5IT9 Q;  4ED4 A;  3J7A M;  4GKJ I;  2R42 A;  4YY3 I;  4P52 A;  4DV7 I;  3OTO I;  2UXB I;  3PYG A;  4IZK A;  2UUB I;  2Z5B B;  2HK3 A;  4HYM A;  4DV4 I;  4NXM E;  1H72 C;  4IZJ D;  1Z0B A;  3Q6N A;  4JI7 E;  1HNW E;  2O1U A;  2R3V A;  4DUZ E;  1BKN A;  2V2V A;  4JI2 I;  4JYA I;  4K0K I;  4WUB A;  1XNR I;  4NXN I;  2HFS A;  1U2R A;  2F4V E;  4LF8 I;  1Y4U A;  2UU9 I;  1MX0 A;  3LTO A;  2CG9 A;  4B3M E;  1EI1 A;  4UT4 A;  4DR2 I;  4X64 E;  3ZZU A;  4JG4 A;  4M1K A;  1XMQ I;  4JI3 E;  2UUA I;  1KKH A;  1S4E A;  4LF6 I;  1J5E E;  4DPT A;  3WU6 A;  2O1V A;  4JI6 I;  4JI0 E;  1VIS A;  4HAC B;  5LMU E;  1MG7 A;  1ZM4 A;  4RPF A;  1FKA E;  3QT6 A;  1Z0G A;  4JV5 I;  4LFA I;  4X65 I;  1Z0V A;  1FNM A;  1UEK A;  3F0N A;  4DV1 I;  4MYT A;  1DAR A;  4DV4 E;  1IBL E;  4FW9 A;  4DR3 I;  2IOQ A;  4NXM I;  3GON A;  4DV6 I;  1IBM E;  4JI5 I;  4DPW A;  2HFU A;  2O1T A;  4K0K E;  1Z5A A;  1IBK E;  4NXN E;  2BV3 A;  2Z5E A;  1ZM3 A;  3WU5 A;  1S16 A;  4LFB I;  4N3O A;  4B3R E;  3LPS A;  1Z0W A;  5GMD A;  3B82 A;  1HR0 I;  4JI3 I;  2OI2 A;  3J80 C;  4LF9 E;  2A2C A;  3ZKD A;  3PYF A;  4DU8 A;  4JI6 E;  2HK2 A;  1Z0E A;  3D4J A;  1NHH A;  2A2D A;  4DR6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...