1NZ0A

Rnase p protein from thermotoga maritima
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
ERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGMDYSRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIPKGFDIVVIPRKKLSEEFERVDFWTVREKLLNLLKRIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component
publication title High-resolution structure of RNase P protein from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 34
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1nz0A00
2X36A 4DR2I 1FNMA 5FLXQ 1KTVA 3B82A 3B8HA 1KKHA 4LFAE 2AJ4A 3K17A 4DV3I 4KHPE 1Z59A 4FW9A 1N34I 1FKAE 4PRVA 2HHHI 2V8PA 3ZM7A 1Z0GA 4JI5E 4HXZA 2GS8A 4HACA 1Z0WA 1H74A 1N0VC 1IBKE 4LFBI 2UXDE 1VISA 1EI1A 4X64E 1Z5BA 3ZZUA 4XTJA 4DUZE 1XMQE 1Z0CA 1HNZE 2ZITA 2LJPA 3QT7A 2UU9E 5BR8I 3ZZTA 3OTOE 3T1HI 4ED4A 3JAMC 4K0KE 4NXNE 1FJGI 4DR6I 2X7IA 4LF8E 3K1JA 2R42A 1RR9A 4B3SI 1HNXE 4DV5I 4YHHI 4JI7I 2ZM6E 3J81C 1HR0I 1RREA 4WUBA 4LFCI 1HNWI 4MYTA 4OX9E 3WU5A 4LF5E 1NZ0A 1OJ4A 5IWAI 4DV6E 4DR7I 4Z7YA 4KHPI 4DV7E 3J7AG 4LF6E 4DPWA 1D6TA 4X62I 1XMOI 2UXCI 4B3ME 1IBMI 4HY1A 1PIEA 1IBKI 1H73A 3WU4A 1FI4A 3J80Q 1EA6A 2A2DA 2E5LI 1IBLE 2XEXA 5IT9Q 2UUAI 4JYAE 4FN5A 4DV4E 4JI0E 5GMEA 3GONA 1ELOA 2UUBE 2V2QA 1ZM9A 2A2CA 4DV0I 4HACB 4DR1I 4NXNI 4K0KI 3QT6A 4DV2E 4DV1I 1N36E 2VQFE 3CWVA 4LF8I 4JI2E 2HK2A 4Z7CA 4GKJE 4JI8E 3H4LA 4LF7I 4GKKE 4YY3E 1N0UA 4JI1I 1N33E 2F4VE 3T1YI 4UTGA 4WUDA 1N32I 4LF4E 2BM1A 4DPUA 2BM0A 3D4JA 1QZRA 4DV6I 3F0NA 2UUCI 1ZM2A 2VQEE 1MX0A 4JI6E 1Z5CA 4KQVA 3PYDA 2CZ9A 1XHKA 4DR4E 3ZKBA 1U2RA 1H72C 4FWGA 4DU7A 5A2QC 2HFUA 4P52A 2V34A 4UT4A 1XNRE 4M1KA 4NXMI 1J5EI 4LF9E 3M6AA 1ZM4A 3PYGA 3QT8A 4DUYE 2UXBE 4JI4I 4AQYE 4DV4I 4JI0I 4DR2E 4DR5I 1WUUA 2NPFA 4JI3E 1DARA 3JAMQ 4DV3E 4X65E 1N34E 1PKPA 1ZXNA 2HHHE 2ZBKB 4LFAI 4JV5E 4FWHA 4LFBE 4B3TE 4JI5I 2EFGA 2WW4A 3J81Q 4MYUA 1S4EA 4YY3I 2R3VA 1N33I 2F4VI 2UXDI 3ZKDA 4X64I 5BR8E 4DU8A 4DUZI 4X66E 1XMQI 1KIJA 2VQEI 3PYFA 1HNZI 1S16A 1I94E 1XNQE 4DR6E 2UU9I 5FLXC 1BKNA 3LNUA 2HK3A 3OTOI 1FWLA 5L3JA 2VF3A 4B3SE 4DPXA 4DV5E 4YHHE 4JI7E 1HR0E 1NHHA 4LFCE 1HNWE 4AQYI 1HNXI 4HYMA 5IWAE 1B62A 4B3RE 2ZM6I 2OI2A 4JI3I 4OX9I 5LMUE 4LF5I 4DR7E 4X65I 1Z0EA 4X62E 1XMOE 3LPSA 4P7AA 4JV5I 4JG4A 2UXCE 1IBME 4DR3E 4DV7I 1MU5A 2J7KA 4LF6I 2V2ZA 4DPYA 4B3TI 3LTOA 2E5LE 1Z0BA 4B3MI 2UUAE 4R1FA 2DEIA 2E1RA 1IBLI 5LMNE 1UEKA 3WU3A 2HKEA 4USKA 1MG7A 4DPTA 4JYAI 1NHIA 4PRXA 4X66I 4DV0E 5GMDA 4DR1E 2UUBI 1I94I 1XNQI 2HFSA 5LL6R 4I3HA 4DV1E 5A2QQ 3V5RA 4DXLA 4DV2I 1ZXMA 3B78A 1N36I 4LF7E 2VQFI 2V2VA 3Q1QA 1NHJA 4JI2I 4JI1E 3PYEA 4GKJI 3T1YE 4JI8I 1N32E 1H7SA 3J80C 4GKKI 1Z0TA 4EMDA 4PU9A 4B3RI 5IT9C 2UUCE 1Z0VA 5LMUI 4LF4I 2BV3A 3HULA 1B63A 1KVKA 4USMA 2Q2EB 1A6FA 1Z5AA 1FWKA 3V2UC 3WU6A 3J7AM 3QT5A 3T1HE 4FWDA 3ZZ0A 4DR3I 4JI6I 4ZVIA 1FJGE 1K47A 4RPFA 4URLA 4DR4I 4NXME 1J5EE 1ZM3A 4WUCA 4JI4E 2DEJA 1XNRI 2HKJA 4LF9I 4DR5E 5LMNI 1H7UA 4DUYI 1PVGA 2UXBI
chains in the Genus database with same CATH superfamily
2X36A 5EKWA 4DR2I 4AIMA 1FNMA 5FLXQ 1KTVA 3B82A 1UDSA 4FW4A 3B8HA 1KKHA 4LFAE 5DRPA 2AJ4A 3K17A 4DV3I 1XXEA 4KHPE 1Z59A 4FW9A 4N3OA 1N34I 1FKAE 4PRVA 2HHHI 2V8PA 3ZM7A 2O1UA 4OO1C 1Z0GA 4JI5E 4HXZA 2GS8A 1UDQA 2Z5CA 2C39B 4HACA 1Z0WA 3P76A 1H74A 1N0VC 2NN6E 1IBKE 4LFBI 2UXDE 3Q6MA 5C0XD 1VISA 5JEAE 1EI1A 2JE6B 4X64E 1Z5BA 4FW6A 3ZZUA 4XTJA 4DUZE 5K36C 1XMQE 4IFDF 1Z0CA 1HNZE 2ZITA 4IZKB 2LJPA 3QT7A 2UU9E 4MDTA 5BR8I 3ZZTA 3OTOE 2VESA 3T1HI 4ED4A 3JAMC 4K0KE 4NXNE 1FJGI 4DR6I 2PO2A 2X7IA 4OO1F 3GMEA 4MU1A 4LF8E 4OO1E 3K1JA 2IERA 2R42A 5EL9A 1RR9A 4B3SI 2NN6B 2O3ZA 2C38A 3PRYA 1HNXE 4DV5I 4YHHI 4JI7I 3B4TA 2ZM6E 3J81C 1HR0I 1RREA 4WUBA 4LFCI 1HNWI 4MYTA 4OX9E 2PO1B 3WU5A 2PNMA 4LF5E 1NZ0A 1OJ4A 4NBQA 5K36F 5IWAI 1P42A 3CDJA 4DV6E 5K36E 4BA1B 4OKGA 4LCFA 4DR7I 4Z7YA 4KHPI 4DV7E 2PO0B 3J7AG 2IOPA 4LF6E 4DPWA 1D6TA 1OYSA 4X62I 1XMOI 4LPFA 3H1CA 2UXCI 4B3ME 1IBMI 5DROA 4HY1A 1PIEA 1IBKI 1H73A 3WU4A 1FI4A 3J80Q 4U3BA 1EA6A 4IFDA 2A2DA 3UHMA 2E5LI 1IBLE 2XEXA 5IT9Q 2UUAI 4GQUA 5DNLA 2PNZA 2CVEA 4JYAE 4FN5A 3U1KA 4DV4E 4JI0E 5GMEA 1USVA 3GONA 1ELOA 2WNRA 3PS3A 1UDOA 2UUBE 4IFDC 4OO1A 2Z5CB 2V2QA 4MU0A 1ZM9A 2A2CA 4DV0I 4HACB 3K85A 5ELWA 2JEBA 2NN6D 4DR1I 4NXNI 4K0KI 3QT6A 4DV2E 4DV1I 3L7ZA 1N36E 2VQFE 4IZJA 3CWVA 4LF8I 4QNKA 3P3EA 3PS2A 4JI2E 2HK2A 4Z7CA 4GKJE 5C0XC 4JI8E 4LCHA 3H4LA 1YH8A 1UDNA 4LF7I 5K36A 3CDIA 4GKKE 2GO3A 4YY3E 1N0UA 4JI1I 1N33E 2Z5EA 2F4VE 4FW7A 1VI7A 3T1YI 4UTGA 4WUDA 1N32I 4LF4E 2BM1A 3P06A 4DPUA 4BA2A 2BM0A 3D4JA 1OYRA 1QZRA 4DV6I 2PO2B 3F0NA 2UUCI 4ISAA 2IOQA 1ZM2A 2VQEE 1MX0A 4FW5A 4JI6E 1Z5CA 4KQVA 4IFDE 3PYDA 2CZ9A 3M7NG 1XHKA 4DR4E 3ZKBA 1U2RA 2C38B 1H72C 4FWGA 4DU7A 5A2QC 2HFUA 4P52A 2V34A 4QNJA 4UT4A 1XNRE 1OYPA 2C39A 4M1KA 4NXMI 1J5EI 4LF9E 5C0XF 2CGEA 1Y6ZA 3M6AA 4OZEA 1ZM4A 3PYGA 4LOMA 5C0XE 3QT8A 4DUYE 2UXBE 4JI4I 5DRRA 4AQYE 4DV4I 4JI0I 1Y4UA 4DR2E 4DR5I 1WUUA 2NPFA 5JEAB 4JI3E 1DARA 1E3PA 3JAMQ 4DV3E 3DD6A 4X65E 1N34E 1PKPA 1ZXNA 5DNXA 2HHHE 2ZBKB 1RHYA 3Q6NA 4LFAI 4JV5E 4IFDB 4FWHA 4LFBE 1HK7A 2BA0G 1E3HA 2J65A 2PNZB 5FWKA 1Y5YA 4B3TE 4JI5I 2GQ0A 2EFGA 2WW4A 3J81Q 3GLLA 4MYUA 5DRQA 1S4EA 2WNRB 4YY3I 2R3VA 4LCGA 1N33I 2F4VI 2UXDI 4OO1B 3ZKDA 4X64I 3P3CA 2JEBB 5BR8E 4DU8A 4DUZI 4X66E 2Z5BA 1XMQI 3L7ZB 3M85G 3KRNA 1KIJA 4IZJB 1USUA 2VQEI 3PYFA 4U3DA 1S16A 1I94E 1HNZI 1XNQE 4DR6E 2UU9I 5FLXC 1BKNA 5C0XA 3LNUA 2BA1G 2HK3A 2WP8A 3OTOI 2PO0A 2C37A 1FWLA 5K36B 5L3JA 2VF3A 4B3SE 2BA0D 4FW3A 4DPXA 4DV5E 4YHHE 4JI7E 5JEAD 1HR0E 4BA2B 1NHHA 4LFCE 1HNWE 4AQYI 1HNXI 2F1DA 4MU3A 4HYMA 1YHCA 5IWAE 1B62A 4IS9A 2ZM6I 4B3RE 2OI2A 4JI3I 4IFDD 4OX9I 5LMUE 4LF5I 4DR7E 4X65I 3HKMA 2JEAA 1Z0EA 3M85D 2BR2A 4X62E 3U1YA 1XMOE 3LPSA 4P7AA 4JV5I 4JG4A 2NN6F 2UXCE 1R6LA 4AM3A 1IBME 4DR3E 4DV7I 1MU5A 2BA1D 2J7KA 4MU4A 4LF6I 4OO1D 2V2ZA 1R6MA 4DPYA 5JEAF 4B3TI 3LTOA 2E5LE 1Z0BA 4B3MI 2UUAE 4R1FA 2DEIA 1Y60A 4IZJD 2E1RA 2JT2A 2O1VA 1IBLI 5LMNE 1UEKA 2GO4A 3WU3A 2HKEA 4USKA 1MG7A 4DPTA 4JYAI 1NHIA 4PRXA 5K36D 4X66I 4DV0E 5GMDA 2JE6A 3GCMA 4DR1E 2UUBI 1I94I 1XNQI 2HFSA 4J3DA 5LL6R 4I3HA 4DV1E 5A2QQ 1Y4SA 3V5RA 4DXLA 4IZKA 4DV2I 1ZXMA 3B78A 1N36I 4LF7E 2VQFI 2V2VA 3Q1QA 1NHJA 3M7ND 2O1WA 4JI2I 4JI1E 3PYEA 2O1TA 4GKJI 3T1YE 4JI8I 1N32E 3P3GA 2Z5BB 1H7SA 3J80C 4GKKI 2PNLA 1Z0TA 4EMDA 4PU9A 2IESA 4B3RI 2NN6A 5IT9C 2UUCE 1Z0VA 5C0XB 5LMUI 4LF4I 2BV3A 3HULA 2WP8B 5JEAA 1B63A 2C37B 1KVKA 2PO1A 4USMA 3PS1A 2Q2EB 1A6FA 1Z5AA 1FWKA 3V2UC 3WU6A 3J7AM 3QT5A 3T1HE 4FWDA 3ZZ0A 4DR3I 4JI6I 4ZVIA 1FJGE 2NN6C 1K47A 4RPFA 4BA1A 4URLA 4DR4I 4NXME 1J5EE 5JEAC 2AE8A 1ZM3A 4WUCA 4MQYA 4JI4E 2DEJA 1XNRI 2HKJA 4AIDA 4LF9I 4DR5E 3NZKA 5LMNI 1H7UA 2JEAB 4DUYI 1PVGA 2CG9A 3HJCA 2UXBI 2BR2B
chains in the Genus database with same CATH topology
2X36A 4DR2I 1FNMA 5FLXQ 1KTVA 3B82A 3B8HA 1KKHA 4LFAE 2AJ4A 3K17A 4DV3I 4KHPE 1Z59A 4FW9A 4N3OA 1N34I 1FKAE 4PRVA 2HHHI 2V8PA 3ZM7A 2O1UA 1Z0GA 4JI5E 4HXZA 2GS8A 2Z5CA 4HACA 1Z0WA 1H74A 1N0VC 1IBKE 4LFBI 2UXDE 3Q6MA 1VISA 1EI1A 4X64E 1Z5BA 3ZZUA 4XTJA 4DUZE 1XMQE 1Z0CA 1HNZE 2ZITA 4IZKB 2LJPA 3QT7A 2UU9E 5BR8I 3ZZTA 3OTOE 3T1HI 4ED4A 3JAMC 4K0KE 4NXNE 1FJGI 4DR6I 2X7IA 4LF8E 3K1JA 2R42A 1RR9A 4B3SI 3PRYA 1HNXE 4DV5I 4YHHI 4JI7I 2ZM6E 3J81C 1HR0I 1RREA 4WUBA 4LFCI 1HNWI 4MYTA 4OX9E 3WU5A 2PNMA 4LF5E 1NZ0A 1OJ4A 5IWAI 4DV6E 4DR7I 4Z7YA 4KHPI 4DV7E 3J7AG 2IOPA 4LF6E 4DPWA 1D6TA 4X62I 1XMOI 2UXCI 4B3ME 1IBMI 4HY1A 1PIEA 1IBKI 1H73A 3WU4A 1FI4A 3J80Q 1EA6A 2A2DA 2E5LI 1IBLE 2XEXA 5IT9Q 2UUAI 4JYAE 4FN5A 4DV4E 4JI0E 5GMEA 1USVA 3GONA 1ELOA 2UUBE 2Z5CB 2V2QA 1ZM9A 2A2CA 4DV0I 4HACB 3K85A 4DR1I 4NXNI 4K0KI 3QT6A 4DV2E 4DV1I 1N36E 2VQFE 4IZJA 3CWVA 4LF8I 4JI2E 2HK2A 4Z7CA 4GKJE 4JI8E 3H4LA 4LF7I 4GKKE 4YY3E 1N0UA 4JI1I 1N33E 2Z5EA 2F4VE 3T1YI 4UTGA 4WUDA 1N32I 4LF4E 2BM1A 3P06A 4DPUA 2BM0A 3D4JA 1QZRA 4DV6I 3F0NA 2UUCI 2IOQA 1ZM2A 2VQEE 1MX0A 4JI6E 1Z5CA 4KQVA 3PYDA 2CZ9A 1XHKA 4DR4E 3ZKBA 1U2RA 1H72C 4FWGA 4DU7A 5A2QC 2HFUA 4P52A 2V34A 4UT4A 1XNRE 4M1KA 4NXMI 1J5EI 4LF9E 2CGEA 1Y6ZA 3M6AA 1ZM4A 3PYGA 3QT8A 4DUYE 2UXBE 4JI4I 4AQYE 4DV4I 4JI0I 1Y4UA 4DR2E 4DR5I 1WUUA 2NPFA 4JI3E 1DARA 3JAMQ 4DV3E 4X65E 1N34E 1PKPA 1ZXNA 2HHHE 2ZBKB 3Q6NA 4LFAI 4JV5E 4FWHA 4LFBE 1HK7A 5FWKA 4B3TE 4JI5I 2GQ0A 2EFGA 2WW4A 3J81Q 4MYUA 1S4EA 4YY3I 2R3VA 1N33I 2F4VI 2UXDI 3ZKDA 4X64I 5BR8E 4DU8A 4DUZI 4X66E 2Z5BA 1XMQI 1KIJA 4IZJB 1USUA 2VQEI 3PYFA 1HNZI 1S16A 1I94E 1XNQE 4DR6E 2UU9I 5FLXC 1BKNA 3LNUA 2HK3A 3OTOI 1FWLA 5L3JA 2VF3A 4B3SE 4DPXA 4DV5E 4YHHE 4JI7E 1HR0E 1NHHA 4LFCE 1HNWE 4AQYI 1HNXI 4HYMA 5IWAE 1B62A 4B3RE 2ZM6I 2OI2A 4JI3I 4OX9I 5LMUE 4LF5I 4DR7E 4X65I 1Z0EA 4X62E 1XMOE 3LPSA 4P7AA 4JV5I 4JG4A 2UXCE 1IBME 4DR3E 4DV7I 1MU5A 2J7KA 4LF6I 2V2ZA 4DPYA 4B3TI 3LTOA 2E5LE 1Z0BA 4B3MI 2UUAE 4R1FA 2DEIA 4IZJD 2E1RA 2O1VA 1IBLI 5LMNE 1UEKA 3WU3A 2HKEA 4USKA 1MG7A 4DPTA 4JYAI 1NHIA 4PRXA 4X66I 4DV0E 5GMDA 4DR1E 2UUBI 1I94I 1XNQI 2HFSA 5LL6R 4I3HA 4DV1E 5A2QQ 1Y4SA 3V5RA 4DXLA 4IZKA 4DV2I 1ZXMA 3B78A 1N36I 4LF7E 2VQFI 2V2VA 3Q1QA 1NHJA 2O1WA 4JI2I 4JI1E 3PYEA 2O1TA 4GKJI 3T1YE 4JI8I 1N32E 2Z5BB 1H7SA 3J80C 4GKKI 2PNLA 1Z0TA 4EMDA 4PU9A 4B3RI 5IT9C 2UUCE 1Z0VA 5LMUI 4LF4I 2BV3A 3HULA 1B63A 1KVKA 4USMA 2Q2EB 1A6FA 1Z5AA 1FWKA 3V2UC 3WU6A 3J7AM 3QT5A 3T1HE 4FWDA 3ZZ0A 4DR3I 4JI6I 4ZVIA 1FJGE 1K47A 4RPFA 4URLA 4DR4I 4NXME 1J5EE 1ZM3A 4WUCA 4JI4E 2DEJA 1XNRI 2HKJA 4LF9I 4DR5E 5LMNI 1H7UA 4DUYI 1PVGA 2CG9A 3HJCA 2UXBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X36 A;  4DR2 I;  1FNM A;  5FLX Q;  1KTV A;  3B82 A;  3B8H A;  1KKH A;  4LFA E;  2AJ4 A;  3K17 A;  4DV3 I;  4KHP E;  1Z59 A;  4FW9 A;  1N34 I;  1FKA E;  4PRV A;  2HHH I;  2V8P A;  3ZM7 A;  1Z0G A;  4JI5 E;  4HXZ A;  2GS8 A;  4HAC A;  1Z0W A;  1H74 A;  1N0V C;  1IBK E;  4LFB I;  2UXD E;  1VIS A;  1EI1 A;  4X64 E;  1Z5B A;  3ZZU A;  4XTJ A;  4DUZ E;  1XMQ E;  1Z0C A;  1HNZ E;  2ZIT A;  2LJP A;  3QT7 A;  2UU9 E;  5BR8 I;  3ZZT A;  3OTO E;  3T1H I;  4ED4 A;  3JAM C;  4K0K E;  4NXN E;  1FJG I;  4DR6 I;  2X7I A;  4LF8 E;  3K1J A;  2R42 A;  1RR9 A;  4B3S I;  1HNX E;  4DV5 I;  4YHH I;  4JI7 I;  2ZM6 E;  3J81 C;  1HR0 I;  1RRE A;  4WUB A;  4LFC I;  1HNW I;  4MYT A;  4OX9 E;  3WU5 A;  4LF5 E;  1NZ0 A;  1OJ4 A;  5IWA I;  4DV6 E;  4DR7 I;  4Z7Y A;  4KHP I;  4DV7 E;  3J7A G;  4LF6 E;  4DPW A;  1D6T A;  4X62 I;  1XMO I;  2UXC I;  4B3M E;  1IBM I;  4HY1 A;  1PIE A;  1IBK I;  1H73 A;  3WU4 A;  1FI4 A;  3J80 Q;  1EA6 A;  2A2D A;  2E5L I;  1IBL E;  2XEX A;  5IT9 Q;  2UUA I;  4JYA E;  4FN5 A;  4DV4 E;  4JI0 E;  5GME A;  3GON A;  1ELO A;  2UUB E;  2V2Q A;  1ZM9 A;  2A2C A;  4DV0 I;  4HAC B;  4DR1 I;  4NXN I;  4K0K I;  3QT6 A;  4DV2 E;  4DV1 I;  1N36 E;  2VQF E;  3CWV A;  4LF8 I;  4JI2 E;  2HK2 A;  4Z7C A;  4GKJ E;  4JI8 E;  3H4L A;  4LF7 I;  4GKK E;  4YY3 E;  1N0U A;  4JI1 I;  1N33 E;  2F4V E;  3T1Y I;  4UTG A;  4WUD A;  1N32 I;  4LF4 E;  2BM1 A;  4DPU A;  2BM0 A;  3D4J A;  1QZR A;  4DV6 I;  3F0N A;  2UUC I;  1ZM2 A;  2VQE E;  1MX0 A;  4JI6 E;  1Z5C A;  4KQV A;  3PYD A;  2CZ9 A;  1XHK A;  4DR4 E;  3ZKB A;  1U2R A;  1H72 C;  4FWG A;  4DU7 A;  5A2Q C;  2HFU A;  4P52 A;  2V34 A;  4UT4 A;  1XNR E;  4M1K A;  4NXM I;  1J5E I;  4LF9 E;  3M6A A;  1ZM4 A;  3PYG A;  3QT8 A;  4DUY E;  2UXB E;  4JI4 I;  4AQY E;  4DV4 I;  4JI0 I;  4DR2 E;  4DR5 I;  1WUU A;  2NPF A;  4JI3 E;  1DAR A;  3JAM Q;  4DV3 E;  4X65 E;  1N34 E;  1PKP A;  1ZXN A;  2HHH E;  2ZBK B;  4LFA I;  4JV5 E;  4FWH A;  4LFB E;  4B3T E;  4JI5 I;  2EFG A;  2WW4 A;  3J81 Q;  4MYU A;  1S4E A;  4YY3 I;  2R3V A;  1N33 I;  2F4V I;  2UXD I;  3ZKD A;  4X64 I;  5BR8 E;  4DU8 A;  4DUZ I;  4X66 E;  1XMQ I;  1KIJ A;  2VQE I;  3PYF A;  1HNZ I;  1S16 A;  1I94 E;  1XNQ E;  4DR6 E;  2UU9 I;  5FLX C;  1BKN A;  3LNU A;  2HK3 A;  3OTO I;  1FWL A;  5L3J A;  2VF3 A;  4B3S E;  4DPX A;  4DV5 E;  4YHH E;  4JI7 E;  1HR0 E;  1NHH A;  4LFC E;  1HNW E;  4AQY I;  1HNX I;  4HYM A;  5IWA E;  1B62 A;  4B3R E;  2ZM6 I;  2OI2 A;  4JI3 I;  4OX9 I;  5LMU E;  4LF5 I;  4DR7 E;  4X65 I;  1Z0E A;  4X62 E;  1XMO E;  3LPS A;  4P7A A;  4JV5 I;  4JG4 A;  2UXC E;  1IBM E;  4DR3 E;  4DV7 I;  1MU5 A;  2J7K A;  4LF6 I;  2V2Z A;  4DPY A;  4B3T I;  3LTO A;  2E5L E;  1Z0B A;  4B3M I;  2UUA E;  4R1F A;  2DEI A;  2E1R A;  1IBL I;  5LMN E;  1UEK A;  3WU3 A;  2HKE A;  4USK A;  1MG7 A;  4DPT A;  4JYA I;  1NHI A;  4PRX A;  4X66 I;  4DV0 E;  5GMD A;  4DR1 E;  2UUB I;  1I94 I;  1XNQ I;  2HFS A;  5LL6 R;  4I3H A;  4DV1 E;  5A2Q Q;  3V5R A;  4DXL A;  4DV2 I;  1ZXM A;  3B78 A;  1N36 I;  4LF7 E;  2VQF I;  2V2V A;  3Q1Q A;  1NHJ A;  4JI2 I;  4JI1 E;  3PYE A;  4GKJ I;  3T1Y E;  4JI8 I;  1N32 E;  1H7S A;  3J80 C;  4GKK I;  1Z0T A;  4EMD A;  4PU9 A;  4B3R I;  5IT9 C;  2UUC E;  1Z0V A;  5LMU I;  4LF4 I;  2BV3 A;  3HUL A;  1B63 A;  1KVK A;  4USM A;  2Q2E B;  1A6F A;  1Z5A A;  1FWK A;  3V2U C;  3WU6 A;  3J7A M;  3QT5 A;  3T1H E;  4FWD A;  3ZZ0 A;  4DR3 I;  4JI6 I;  4ZVI A;  1FJG E;  1K47 A;  4RPF A;  4URL A;  4DR4 I;  4NXM E;  1J5E E;  1ZM3 A;  4WUC A;  4JI4 E;  2DEJ A;  1XNR I;  2HKJ A;  4LF9 I;  4DR5 E;  5LMN I;  1H7U A;  4DUY I;  1PVG A;  2UXB I; 
#chains in the Genus database with same CATH topology
 2X36 A;  5EKW A;  4DR2 I;  4AIM A;  1FNM A;  5FLX Q;  1KTV A;  3B82 A;  1UDS A;  4FW4 A;  3B8H A;  1KKH A;  4LFA E;  5DRP A;  2AJ4 A;  3K17 A;  4DV3 I;  1XXE A;  4KHP E;  1Z59 A;  4FW9 A;  4N3O A;  1N34 I;  1FKA E;  4PRV A;  2HHH I;  2V8P A;  3ZM7 A;  2O1U A;  4OO1 C;  1Z0G A;  4JI5 E;  4HXZ A;  2GS8 A;  1UDQ A;  2Z5C A;  2C39 B;  4HAC A;  1Z0W A;  3P76 A;  1H74 A;  1N0V C;  2NN6 E;  1IBK E;  4LFB I;  2UXD E;  3Q6M A;  5C0X D;  1VIS A;  5JEA E;  1EI1 A;  2JE6 B;  4X64 E;  1Z5B A;  4FW6 A;  3ZZU A;  4XTJ A;  4DUZ E;  5K36 C;  1XMQ E;  4IFD F;  1Z0C A;  1HNZ E;  2ZIT A;  4IZK B;  2LJP A;  3QT7 A;  2UU9 E;  4MDT A;  5BR8 I;  3ZZT A;  3OTO E;  2VES A;  3T1H I;  4ED4 A;  3JAM C;  4K0K E;  4NXN E;  1FJG I;  4DR6 I;  2PO2 A;  2X7I A;  4OO1 F;  3GME A;  4MU1 A;  4LF8 E;  4OO1 E;  3K1J A;  2IER A;  2R42 A;  5EL9 A;  1RR9 A;  4B3S I;  2NN6 B;  2O3Z A;  2C38 A;  3PRY A;  1HNX E;  4DV5 I;  4YHH I;  4JI7 I;  3B4T A;  2ZM6 E;  3J81 C;  1HR0 I;  1RRE A;  4WUB A;  4LFC I;  1HNW I;  4MYT A;  4OX9 E;  2PO1 B;  3WU5 A;  2PNM A;  4LF5 E;  1NZ0 A;  1OJ4 A;  4NBQ A;  5K36 F;  5IWA I;  1P42 A;  3CDJ A;  4DV6 E;  5K36 E;  4BA1 B;  4OKG A;  4LCF A;  4DR7 I;  4Z7Y A;  4KHP I;  4DV7 E;  2PO0 B;  3J7A G;  2IOP A;  4LF6 E;  4DPW A;  1D6T A;  1OYS A;  4X62 I;  1XMO I;  4LPF A;  3H1C A;  2UXC I;  4B3M E;  1IBM I;  5DRO A;  4HY1 A;  1PIE A;  1IBK I;  1H73 A;  3WU4 A;  1FI4 A;  3J80 Q;  4U3B A;  1EA6 A;  4IFD A;  2A2D A;  3UHM A;  2E5L I;  1IBL E;  2XEX A;  5IT9 Q;  2UUA I;  4GQU A;  5DNL A;  2PNZ A;  2CVE A;  4JYA E;  4FN5 A;  3U1K A;  4DV4 E;  4JI0 E;  5GME A;  1USV A;  3GON A;  1ELO A;  2WNR A;  3PS3 A;  1UDO A;  2UUB E;  4IFD C;  4OO1 A;  2Z5C B;  2V2Q A;  4MU0 A;  1ZM9 A;  2A2C A;  4DV0 I;  4HAC B;  3K85 A;  5ELW A;  2JEB A;  2NN6 D;  4DR1 I;  4NXN I;  4K0K I;  3QT6 A;  4DV2 E;  4DV1 I;  3L7Z A;  1N36 E;  2VQF E;  4IZJ A;  3CWV A;  4LF8 I;  4QNK A;  3P3E A;  3PS2 A;  4JI2 E;  2HK2 A;  4Z7C A;  4GKJ E;  5C0X C;  4JI8 E;  4LCH A;  3H4L A;  1YH8 A;  1UDN A;  4LF7 I;  5K36 A;  3CDI A;  4GKK E;  2GO3 A;  4YY3 E;  1N0U A;  4JI1 I;  1N33 E;  2Z5E A;  2F4V E;  4FW7 A;  1VI7 A;  3T1Y I;  4UTG A;  4WUD A;  1N32 I;  4LF4 E;  2BM1 A;  3P06 A;  4DPU A;  4BA2 A;  2BM0 A;  3D4J A;  1OYR A;  1QZR A;  4DV6 I;  2PO2 B;  3F0N A;  2UUC I;  4ISA A;  2IOQ A;  1ZM2 A;  2VQE E;  1MX0 A;  4FW5 A;  4JI6 E;  1Z5C A;  4KQV A;  4IFD E;  3PYD A;  2CZ9 A;  3M7N G;  1XHK A;  4DR4 E;  3ZKB A;  1U2R A;  2C38 B;  1H72 C;  4FWG A;  4DU7 A;  5A2Q C;  2HFU A;  4P52 A;  2V34 A;  4QNJ A;  4UT4 A;  1XNR E;  1OYP A;  2C39 A;  4M1K A;  4NXM I;  1J5E I;  4LF9 E;  5C0X F;  2CGE A;  1Y6Z A;  3M6A A;  4OZE A;  1ZM4 A;  3PYG A;  4LOM A;  5C0X E;  3QT8 A;  4DUY E;  2UXB E;  4JI4 I;  5DRR A;  4AQY E;  4DV4 I;  4JI0 I;  1Y4U A;  4DR2 E;  4DR5 I;  1WUU A;  2NPF A;  5JEA B;  4JI3 E;  1DAR A;  1E3P A;  3JAM Q;  4DV3 E;  3DD6 A;  4X65 E;  1N34 E;  1PKP A;  1ZXN A;  5DNX A;  2HHH E;  2ZBK B;  1RHY A;  3Q6N A;  4LFA I;  4JV5 E;  4IFD B;  4FWH A;  4LFB E;  1HK7 A;  2BA0 G;  1E3H A;  2J65 A;  2PNZ B;  5FWK A;  1Y5Y A;  4B3T E;  4JI5 I;  2GQ0 A;  2EFG A;  2WW4 A;  3J81 Q;  3GLL A;  4MYU A;  5DRQ A;  1S4E A;  2WNR B;  4YY3 I;  2R3V A;  4LCG A;  1N33 I;  2F4V I;  2UXD I;  4OO1 B;  3ZKD A;  4X64 I;  3P3C A;  2JEB B;  5BR8 E;  4DU8 A;  4DUZ I;  4X66 E;  2Z5B A;  1XMQ I;  3L7Z B;  3M85 G;  3KRN A;  1KIJ A;  4IZJ B;  1USU A;  2VQE I;  3PYF A;  4U3D A;  1S16 A;  1I94 E;  1HNZ I;  1XNQ E;  4DR6 E;  2UU9 I;  5FLX C;  1BKN A;  5C0X A;  3LNU A;  2BA1 G;  2HK3 A;  2WP8 A;  3OTO I;  2PO0 A;  2C37 A;  1FWL A;  5K36 B;  5L3J A;  2VF3 A;  4B3S E;  2BA0 D;  4FW3 A;  4DPX A;  4DV5 E;  4YHH E;  4JI7 E;  5JEA D;  1HR0 E;  4BA2 B;  1NHH A;  4LFC E;  1HNW E;  4AQY I;  1HNX I;  2F1D A;  4MU3 A;  4HYM A;  1YHC A;  5IWA E;  1B62 A;  4IS9 A;  2ZM6 I;  4B3R E;  2OI2 A;  4JI3 I;  4IFD D;  4OX9 I;  5LMU E;  4LF5 I;  4DR7 E;  4X65 I;  3HKM A;  2JEA A;  1Z0E A;  3M85 D;  2BR2 A;  4X62 E;  3U1Y A;  1XMO E;  3LPS A;  4P7A A;  4JV5 I;  4JG4 A;  2NN6 F;  2UXC E;  1R6L A;  4AM3 A;  1IBM E;  4DR3 E;  4DV7 I;  1MU5 A;  2BA1 D;  2J7K A;  4MU4 A;  4LF6 I;  4OO1 D;  2V2Z A;  1R6M A;  4DPY A;  5JEA F;  4B3T I;  3LTO A;  2E5L E;  1Z0B A;  4B3M I;  2UUA E;  4R1F A;  2DEI A;  1Y60 A;  4IZJ D;  2E1R A;  2JT2 A;  2O1V A;  1IBL I;  5LMN E;  1UEK A;  2GO4 A;  3WU3 A;  2HKE A;  4USK A;  1MG7 A;  4DPT A;  4JYA I;  1NHI A;  4PRX A;  5K36 D;  4X66 I;  4DV0 E;  5GMD A;  2JE6 A;  3GCM A;  4DR1 E;  2UUB I;  1I94 I;  1XNQ I;  2HFS A;  4J3D A;  5LL6 R;  4I3H A;  4DV1 E;  5A2Q Q;  1Y4S A;  3V5R A;  4DXL A;  4IZK A;  4DV2 I;  1ZXM A;  3B78 A;  1N36 I;  4LF7 E;  2VQF I;  2V2V A;  3Q1Q A;  1NHJ A;  3M7N D;  2O1W A;  4JI2 I;  4JI1 E;  3PYE A;  2O1T A;  4GKJ I;  3T1Y E;  4JI8 I;  1N32 E;  3P3G A;  2Z5B B;  1H7S A;  3J80 C;  4GKK I;  2PNL A;  1Z0T A;  4EMD A;  4PU9 A;  2IES A;  4B3R I;  2NN6 A;  5IT9 C;  2UUC E;  1Z0V A;  5C0X B;  5LMU I;  4LF4 I;  2BV3 A;  3HUL A;  2WP8 B;  5JEA A;  1B63 A;  2C37 B;  1KVK A;  2PO1 A;  4USM A;  3PS1 A;  2Q2E B;  1A6F A;  1Z5A A;  1FWK A;  3V2U C;  3WU6 A;  3J7A M;  3QT5 A;  3T1H E;  4FWD A;  3ZZ0 A;  4DR3 I;  4JI6 I;  4ZVI A;  1FJG E;  2NN6 C;  1K47 A;  4RPF A;  4BA1 A;  4URL A;  4DR4 I;  4NXM E;  1J5E E;  5JEA C;  2AE8 A;  1ZM3 A;  4WUC A;  4MQY A;  4JI4 E;  2DEJ A;  1XNR I;  2HKJ A;  4AID A;  4LF9 I;  4DR5 E;  3NZK A;  5LMN I;  1H7U A;  2JEA B;  4DUY I;  1PVG A;  2CG9 A;  3HJC A;  2UXB I;  2BR2 B; 
#chains in the Genus database with same CATH homology
 2X36 A;  4DR2 I;  1FNM A;  5FLX Q;  1KTV A;  3B82 A;  3B8H A;  1KKH A;  4LFA E;  2AJ4 A;  3K17 A;  4DV3 I;  4KHP E;  1Z59 A;  4FW9 A;  4N3O A;  1N34 I;  1FKA E;  4PRV A;  2HHH I;  2V8P A;  3ZM7 A;  2O1U A;  1Z0G A;  4JI5 E;  4HXZ A;  2GS8 A;  2Z5C A;  4HAC A;  1Z0W A;  1H74 A;  1N0V C;  1IBK E;  4LFB I;  2UXD E;  3Q6M A;  1VIS A;  1EI1 A;  4X64 E;  1Z5B A;  3ZZU A;  4XTJ A;  4DUZ E;  1XMQ E;  1Z0C A;  1HNZ E;  2ZIT A;  4IZK B;  2LJP A;  3QT7 A;  2UU9 E;  5BR8 I;  3ZZT A;  3OTO E;  3T1H I;  4ED4 A;  3JAM C;  4K0K E;  4NXN E;  1FJG I;  4DR6 I;  2X7I A;  4LF8 E;  3K1J A;  2R42 A;  1RR9 A;  4B3S I;  3PRY A;  1HNX E;  4DV5 I;  4YHH I;  4JI7 I;  2ZM6 E;  3J81 C;  1HR0 I;  1RRE A;  4WUB A;  4LFC I;  1HNW I;  4MYT A;  4OX9 E;  3WU5 A;  2PNM A;  4LF5 E;  1NZ0 A;  1OJ4 A;  5IWA I;  4DV6 E;  4DR7 I;  4Z7Y A;  4KHP I;  4DV7 E;  3J7A G;  2IOP A;  4LF6 E;  4DPW A;  1D6T A;  4X62 I;  1XMO I;  2UXC I;  4B3M E;  1IBM I;  4HY1 A;  1PIE A;  1IBK I;  1H73 A;  3WU4 A;  1FI4 A;  3J80 Q;  1EA6 A;  2A2D A;  2E5L I;  1IBL E;  2XEX A;  5IT9 Q;  2UUA I;  4JYA E;  4FN5 A;  4DV4 E;  4JI0 E;  5GME A;  1USV A;  3GON A;  1ELO A;  2UUB E;  2Z5C B;  2V2Q A;  1ZM9 A;  2A2C A;  4DV0 I;  4HAC B;  3K85 A;  4DR1 I;  4NXN I;  4K0K I;  3QT6 A;  4DV2 E;  4DV1 I;  1N36 E;  2VQF E;  4IZJ A;  3CWV A;  4LF8 I;  4JI2 E;  2HK2 A;  4Z7C A;  4GKJ E;  4JI8 E;  3H4L A;  4LF7 I;  4GKK E;  4YY3 E;  1N0U A;  4JI1 I;  1N33 E;  2Z5E A;  2F4V E;  3T1Y I;  4UTG A;  4WUD A;  1N32 I;  4LF4 E;  2BM1 A;  3P06 A;  4DPU A;  2BM0 A;  3D4J A;  1QZR A;  4DV6 I;  3F0N A;  2UUC I;  2IOQ A;  1ZM2 A;  2VQE E;  1MX0 A;  4JI6 E;  1Z5C A;  4KQV A;  3PYD A;  2CZ9 A;  1XHK A;  4DR4 E;  3ZKB A;  1U2R A;  1H72 C;  4FWG A;  4DU7 A;  5A2Q C;  2HFU A;  4P52 A;  2V34 A;  4UT4 A;  1XNR E;  4M1K A;  4NXM I;  1J5E I;  4LF9 E;  2CGE A;  1Y6Z A;  3M6A A;  1ZM4 A;  3PYG A;  3QT8 A;  4DUY E;  2UXB E;  4JI4 I;  4AQY E;  4DV4 I;  4JI0 I;  1Y4U A;  4DR2 E;  4DR5 I;  1WUU A;  2NPF A;  4JI3 E;  1DAR A;  3JAM Q;  4DV3 E;  4X65 E;  1N34 E;  1PKP A;  1ZXN A;  2HHH E;  2ZBK B;  3Q6N A;  4LFA I;  4JV5 E;  4FWH A;  4LFB E;  1HK7 A;  5FWK A;  4B3T E;  4JI5 I;  2GQ0 A;  2EFG A;  2WW4 A;  3J81 Q;  4MYU A;  1S4E A;  4YY3 I;  2R3V A;  1N33 I;  2F4V I;  2UXD I;  3ZKD A;  4X64 I;  5BR8 E;  4DU8 A;  4DUZ I;  4X66 E;  2Z5B A;  1XMQ I;  1KIJ A;  4IZJ B;  1USU A;  2VQE I;  3PYF A;  1HNZ I;  1S16 A;  1I94 E;  1XNQ E;  4DR6 E;  2UU9 I;  5FLX C;  1BKN A;  3LNU A;  2HK3 A;  3OTO I;  1FWL A;  5L3J A;  2VF3 A;  4B3S E;  4DPX A;  4DV5 E;  4YHH E;  4JI7 E;  1HR0 E;  1NHH A;  4LFC E;  1HNW E;  4AQY I;  1HNX I;  4HYM A;  5IWA E;  1B62 A;  4B3R E;  2ZM6 I;  2OI2 A;  4JI3 I;  4OX9 I;  5LMU E;  4LF5 I;  4DR7 E;  4X65 I;  1Z0E A;  4X62 E;  1XMO E;  3LPS A;  4P7A A;  4JV5 I;  4JG4 A;  2UXC E;  1IBM E;  4DR3 E;  4DV7 I;  1MU5 A;  2J7K A;  4LF6 I;  2V2Z A;  4DPY A;  4B3T I;  3LTO A;  2E5L E;  1Z0B A;  4B3M I;  2UUA E;  4R1F A;  2DEI A;  4IZJ D;  2E1R A;  2O1V A;  1IBL I;  5LMN E;  1UEK A;  3WU3 A;  2HKE A;  4USK A;  1MG7 A;  4DPT A;  4JYA I;  1NHI A;  4PRX A;  4X66 I;  4DV0 E;  5GMD A;  4DR1 E;  2UUB I;  1I94 I;  1XNQ I;  2HFS A;  5LL6 R;  4I3H A;  4DV1 E;  5A2Q Q;  1Y4S A;  3V5R A;  4DXL A;  4IZK A;  4DV2 I;  1ZXM A;  3B78 A;  1N36 I;  4LF7 E;  2VQF I;  2V2V A;  3Q1Q A;  1NHJ A;  2O1W A;  4JI2 I;  4JI1 E;  3PYE A;  2O1T A;  4GKJ I;  3T1Y E;  4JI8 I;  1N32 E;  2Z5B B;  1H7S A;  3J80 C;  4GKK I;  2PNL A;  1Z0T A;  4EMD A;  4PU9 A;  4B3R I;  5IT9 C;  2UUC E;  1Z0V A;  5LMU I;  4LF4 I;  2BV3 A;  3HUL A;  1B63 A;  1KVK A;  4USM A;  2Q2E B;  1A6F A;  1Z5A A;  1FWK A;  3V2U C;  3WU6 A;  3J7A M;  3QT5 A;  3T1H E;  4FWD A;  3ZZ0 A;  4DR3 I;  4JI6 I;  4ZVI A;  1FJG E;  1K47 A;  4RPF A;  4URL A;  4DR4 I;  4NXM E;  1J5E E;  1ZM3 A;  4WUC A;  4JI4 E;  2DEJ A;  1XNR I;  2HKJ A;  4LF9 I;  4DR5 E;  5LMN I;  1H7U A;  4DUY I;  1PVG A;  2CG9 A;  3HJC A;  2UXB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...