1NZ0A

Rnase p protein from thermotoga maritima
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
b'ERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGMDYSRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIPKGFDIVVIPRKKLSEEFERVDFWTVREKLLNLLKRIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component
molecule tags Hydrolase
source organism Thermotoga maritima
publication title High-resolution structure of RNase P protein from Thermotoga maritima.
pubmed doi rcsb
total genus 34
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1nz0A00
3LTOA 1RREA 4M1KA 4YY3I 3LNUA 2NPFA 3CWVA 1HNXE 3JAMQ 1Z5CA 4GKJI 5GMEA 1XMOI 1EI1A 4JI5I 4MYUA 1N33I 2VQEI 2UUBI 2UXDE 4DV5I 4X62I 2ZM6E 1HNWE 1KTVA 1HNXI 2DEIA 4LF9E 1B63A 4B3RE 3Q1QA 4JI1E 4LF8E 4JV5I 4JI6E 3H4LA 1WUUA 3PYGA 4X62E 4DPUA 4URLA 4DV5E 2ZM6I 4DV0E 1N32E 1Z0GA 4YHHI 4RPFA 4PRXA 1MU5A 3M6AA 1FKAE 4FN5A 4P52A 1N0UA 3QT8A 4JI0E 4WUCA 2BM0A 4GKJE 5LMNI 4YHHE 2HK2A 2UUAI 2VF3A 4K0KI 2E5LE 3QT6A 3ZZTA 4DR3I 4OX9E 4JI3E 1VISA 5L3JA 1FJGI 4DV7I 4B3RI 2F4VI 4DR5E 4DPTA 4HACB 4JI2I 1DARA 4LF5E 4JI0I 2Q2EB 1ZM9A 2R3VA 5A2QC 1J5EE 4DR1E 4X64I 4LF7I 1PKPA 1N0VC 1ELOA 5GMDA 1XMQE 3D4JA 4DR6I 5A2QQ 4DR1I 4WUDA 1D6TA 1FWLA 1N34E 1U2RA 2UXCI 1IBKI 4JYAE 1MG7A 1XNRI 3B82A 1Z0EA 2UXCE 2R42A 1EA6A 1H74A 1H72C 4DV7E 4X65I 4DV3E 1FNMA 4HY1A 4LFCI 4B3ME 2VQFI 1Z5BA 1N36I 4P7AA 2ZBKB 3J80C 1NHIA 2OI2A 4XTJA 4DV3I 5LMUE 1Z5AA 5FLXC 1PVGA 3K1JA 4DPXA 1NHJA 4JI7I 2CZ9A 3T1HI 1I94I 4DU8A 2XEXA 4B3SI 4USMA 4FWDA 2E1RA 1N32I 4DV0I 4B3TE 4FWHA 3B8HA 2F4VE 4JG4A 4PRVA 4DV6E 1J5EI 4B3MI 3J80Q 4LF8I 1IBME 4DPWA 4X65E 3WU4A 5LL6R 5LMNE 1S16A 1B62A 4ED4A 3WU6A 2HFSA 4LF6I 2UUAE 3JAMC 4LF4I 2HK3A 1HNZE 4GKKI 4X66E 1ZXMA 2HKEA 2V8PA 1XMOE 1H73A 3V5RA 4DR2E 4ZVIA 2UU9E 1FI4A 3QT5A 1HNZI 4JI5E 3K17A 1Z0VA 1Z0TA 5FLXQ 4X66I 3QT7A 4DR5I 4USKA 4NXNE 3ZKBA 4DV1E 4AQYE 4LF4E 4UT4A 5LMUI 1XMQI 1A6FA 4JI1I 1Z0CA 2HFUA 2ZITA 4AQYI 4DR7I 4DU7A 3WU3A 5BR8E 1NZ0A 4DV1I 2V2QA 1N33E 1XNRE 2A2CA 3J7AG 3B78A 4UTGA 2UXDI 2EFGA 1KVKA 4DUYE 2BM1A 2VQEE 2UU9I 4LF6E 4B3SE 4YY3E 1KKHA 1ZM4A 1ZM3A 4NXME 4DUZE 1H7UA 4JI8E 1IBMI 3J81Q 4DPYA 1HR0I 4KQVA 4JV5E 4JI3I 4FW9A 3PYEA 4DXLA 4EMDA 1FWKA 2UUCE 1UEKA 4LF9I 3HULA 4HXZA 1KIJA 4LFAI 2J7KA 5IT9Q 3WU5A 1Z59A 1QZRA 4GKKE 4DR2I 4LF5I 2HKJA 1IBLE 4DV2E 1MX0A 2WW4A 1IBKE 3V2UC 4DV4E 3PYDA 4JI7E 5IWAE 3T1YE 4LFBI 3OTOE 4LF7E 4X64E 3ZZ0A 2AJ4A 3PYFA 1HR0E 1OJ4A 3F0NA 4DV4I 1HNWI 5IT9C 3ZKDA 4B3TI 4JI4I 5IWAI 1S4EA 4Z7CA 4I3HA 1Z0WA 3T1HE 1I94E 2V2VA 1ZXNA 2BV3A 4DUYI 1N34I 2V2ZA 4JYAI 2GS8A 1XNQE 3ZZUA 2A2DA 4HYMA 4DR4I 4KHPI 5BR8I 1N36E 3LPSA 2HHHE 2UXBI 4DR6E 4Z7YA 1K47A 4LFCE 2UUCI 3T1YI 4DR4E 4KHPE 4DV6I 3OTOI 2UXBE 1XNQI 4OX9I 2DEJA 3ZM7A 2E5LI 4NXNI 4WUBA 4DV2I 1BKNA 4DUZI 2V34A 1ZM2A 2UUBE 2X36A 4NXMI 4HACA 2LJPA 1IBLI 4JI4E 4JI2E 4PU9A 4R1FA 4FWGA 4LFAE 4DR7E 3GONA 1RR9A 1XHKA 1Z0BA 4LFBE 4MYTA 4DR3E 3J81C 2VQFE 4K0KE 1FJGE 1H7SA 4JI8I 4JI6I 1PIEA 3J7AM 1NHHA 2HHHI 2X7IA
chains in the Genus database with same CATH superfamily
2C39A 3LTOA 1RREA 4ISAA 4M1KA 4YY3I 3LNUA 2NPFA 3U1YA 3CWVA 1HNXE 3JAMQ 2VESA 1Z5CA 4GKJI 5JEAD 5GMEA 5DRRA 1XMOI 1EI1A 4JI5I 4MYUA 1N33I 2VQEI 2UUBI 2UXDE 4DV5I 4X62I 1Y5YA 2ZM6E 3K85A 1HNWE 1KTVA 1HNXI 2DEIA 4GQUA 2BA0G 4LF9E 1B63A 4B3RE 3Q1QA 4JI1E 2C38A 4OKGA 5C0XC 4LF8E 2NN6E 4JV5I 4JI6E 3H4LA 1WUUA 3PYGA 5K36B 4X62E 5EKWA 4DPUA 4URLA 2ZM6I 4DV0E 4DV5E 5JEAB 1N32E 1Z0GA 4YHHI 4RPFA 4PRXA 1MU5A 3M6AA 1FKAE 2PNLA 4FN5A 4P52A 1N0UA 3QT8A 3CDJA 4JI0E 5K36F 4WUCA 2PNZA 4U3BA 2BM0A 1UDNA 4U3DA 4GKJE 2Z5BA 5LMNI 4YHHE 2HK2A 2WP8A 2UUAI 5DRQA 2VF3A 3L7ZB 2O1VA 4BA1A 2E5LE 3QT6A 3ZZTA 4K0KI 4DR3I 4OX9E 4JI3E 1VISA 2AE8A 4IZJA 2JEAA 5L3JA 1FJGI 4IFDB 4DV7I 4B3RI 2Z5CB 5DROA 2O1WA 3P06A 3CDIA 3HJCA 1OYRA 2F4VI 4DR5E 4DPTA 4QNJA 4HACB 4JI2I 1DARA 4IS9A 3PRYA 3U1KA 2WNRB 1YHCA 4LF5E 4JI0I 2BA1D 2O1UA 2CG9A 3P3EA 2Q2EB 4IZKB 4OO1C 3HKMA 1ZM9A 4IFDD 2R3VA 5A2QC 4J3DA 1J5EE 5K36A 4DR1E 2GO3A 4X64I 4LF7I 1PKPA 5K36C 1N0VC 2O3ZA 1ELOA 3P3CA 5GMDA 1XMQE 3D4JA 3GCMA 4DR6I 3B4TA 5A2QQ 4DR1I 4WUDA 1D6TA 4MQYA 1FWLA 1N34E 2J65A 3PS2A 1U2RA 3PS3A 2UXCI 1Y60A 1IBKI 1R6MA 2GO4A 5DNXA 4JYAE 1MG7A 4BA1B 1XNRI 3DD6A 3B82A 1Z0EA 4MDTA 2UXCE 2R42A 1EA6A 1H74A 1H72C 4DV7E 4X65I 4OO1D 4DV3E 1FNMA 4HY1A 4FW6A 4LFCI 4B3ME 2VQFI 1Z5BA 1N36I 4P7AA 2ZBKB 3J80C 1NHIA 2OI2A 4XTJA 4MU3A 5LMUE 4DV3I 5K36E 4NBQA 1Z5AA 5FLXC 1PVGA 5C0XB 3K1JA 4DPXA 1NHJA 4JI7I 2CZ9A 3T1HI 1I94I 4DU8A 4OO1E 2XEXA 4B3SI 1HK7A 2F1DA 4IZKA 1OYSA 4USMA 2GQ0A 3M85D 4FWDA 2E1RA 1N32I 1RHYA 4DV0I 4B3TE 4FWHA 1Y6ZA 2WNRA 3B8HA 2F4VE 2Z5EA 4JG4A 4PRVA 4DV6E 2PO0B 3L7ZA 4N3OA 1J5EI 3Q6NA 4B3MI 3UHMA 3J80Q 4LF8I 2C37A 2PO0A 5ELWA 1IBME 4DPWA 5DNLA 4X65E 3WU4A 5LL6R 1VI7A 5LMNE 1S16A 4IFDA 1B62A 4ED4A 4AM3A 3WU6A 2NN6F 2HFSA 3P3GA 2UUAE 3JAMC 4LF6I 4LF4I 2HK3A 1HNZE 4FW4A 4GKKI 4X66E 1ZXMA 2HKEA 4AIDA 2V8PA 1XMOE 1H73A 3V5RA 4BA2A 2JEBB 2IOQA 4DR2E 4ZVIA 2UU9E 1FI4A 3QT5A 1HNZI 4JI5E 5C0XD 3K17A 1Z0VA 1Z0TA 5FLXQ 4X66I 3QT7A 2PNZB 4DR5I 4USKA 4NXNE 3ZKBA 4DV1E 4AQYE 4LF4E 4UT4A 2BR2B 5LMUI 1XMQI 1A6FA 4JI1I 2C37B 1Z0CA 4QNKA 2HFUA 2ZITA 4AQYI 2NN6B 3M7NG 5C0XA 4DR7I 4FW5A 2PNMA 4DU7A 1UDQA 3WU3A 5BR8E 2O1TA 5C0XE 2JEBA 1R6LA 1NZ0A 4DV1I 2V2QA 2Z5CA 1Y4UA 1N33E 2IESA 1XNRE 2A2CA 5JEAF 3B78A 3J7AG 4UTGA 2UXDI 1P42A 4LPFA 2EFGA 1KVKA 4DUYE 2BM1A 2VQEE 2UU9I 3GMEA 2PO1B 4LF6E 4B3SE 4YY3E 2JEAB 1OYPA 1KKHA 1USVA 1ZM4A 1ZM3A 4FW3A 4NXME 4IFDF 4DUZE 1H7UA 4JI8E 1IBMI 3J81Q 2NN6A 4DPYA 4AIMA 1HR0I 1Y4SA 4KQVA 4JV5E 4JI3I 3KRNA 4FW9A 3PYEA 4IZJD 1UDSA 4DXLA 2C39B 4EMDA 1FWKA 2UUCE 1UEKA 4IZJB 4LF9I 3HULA 4IFDE 4HXZA 1KIJA 4LFAI 2J7KA 5IT9Q 2BA0D 2WP8B 3WU5A 3M85G 3GLLA 1Z59A 1QZRA 5K36D 4GKKE 2Z5BB 2JE6B 2PO2B 4DR2I 4LF5I 3NZKA 2HKJA 1IBLE 4DV2E 1MX0A 5JEAC 2WW4A 3P76A 1IBKE 4IFDC 2CGEA 3V2UC 4DV4E 3PYDA 4JI7E 2BR2A 2IERA 5IWAE 3T1YE 4LFBI 5JEAA 5FWKA 3OTOE 4OO1F 4LF7E 4X64E 3ZZ0A 2IOPA 4OZEA 2AJ4A 2PO2A 1USUA 2JE6A 2NN6C 3PYFA 1HR0E 5EL9A 1OJ4A 3F0NA 4DV4I 1HNWI 5IT9C 3ZKDA 4B3TI 4JI4I 2PO1A 5IWAI 1S4EA 4Z7CA 4I3HA 1Z0WA 4OO1B 3T1HE 4LCGA 1I94E 2V2VA 1ZXNA 2BV3A 4DUYI 1N34I 2V2ZA 4BA2B 4JYAI 2GS8A 4LOMA 1XNQE 4LCFA 3ZZUA 2A2DA 4HYMA 4DR4I 4KHPI 5BR8I 1N36E 3LPSA 4OO1A 2HHHE 2UXBI 4MU4A 4DR6E 3H1CA 4Z7YA 1K47A 4LFCE 2UUCI 3T1YI 4DR4E 4KHPE 4DV6I 3PS1A 3OTOI 5JEAE 2UXBE 1XNQI 4OX9I 2DEJA 3ZM7A 2E5LI 1UDOA 4NXNI 1XXEA 4WUBA 1E3HA 4DV2I 2NN6D 1BKNA 1YH8A 4DUZI 2V34A 2C38B 1ZM2A 2UUBE 2X36A 4NXMI 4HACA 4MU1A 4FW7A 2LJPA 2BA1G 1IBLI 4JI4E 4JI2E 2JT2A 4LCHA 4PU9A 4R1FA 1E3PA 5C0XF 3M7ND 4MU0A 4FWGA 4LFAE 4DR7E 3GONA 3Q6MA 1RR9A 5DRPA 1XHKA 1Z0BA 4LFBE 4MYTA 2CVEA 3J81C 2VQFE 4DR3E 4K0KE 1FJGE 1H7SA 4JI8I 4JI6I 1PIEA 3J7AM 1NHHA 2HHHI 2X7IA
chains in the Genus database with same CATH topology
3LTOA 1RREA 4M1KA 4YY3I 3LNUA 2NPFA 3CWVA 1HNXE 3JAMQ 1Z5CA 4GKJI 5GMEA 1XMOI 1EI1A 4JI5I 4MYUA 1N33I 2VQEI 2UUBI 2UXDE 4DV5I 4X62I 2ZM6E 3K85A 1HNWE 1KTVA 1HNXI 2DEIA 4LF9E 1B63A 4B3RE 3Q1QA 4JI1E 4LF8E 4JV5I 4JI6E 3H4LA 1WUUA 3PYGA 4X62E 4DPUA 4URLA 4DV5E 2ZM6I 4DV0E 1N32E 1Z0GA 4YHHI 4RPFA 4PRXA 1MU5A 3M6AA 1FKAE 2PNLA 4FN5A 4P52A 1N0UA 3QT8A 4JI0E 4WUCA 2BM0A 4GKJE 2Z5BA 5LMNI 4YHHE 2HK2A 2UUAI 2VF3A 2O1VA 4K0KI 2E5LE 3QT6A 3ZZTA 4DR3I 4OX9E 4JI3E 1VISA 4IZJA 5L3JA 1FJGI 4DV7I 4B3RI 2Z5CB 2O1WA 3P06A 3HJCA 2F4VI 4DR5E 4DPTA 4HACB 4JI2I 1DARA 3PRYA 4LF5E 4JI0I 2O1UA 2CG9A 2Q2EB 4IZKB 1ZM9A 2R3VA 5A2QC 1J5EE 4DR1E 4X64I 4LF7I 1PKPA 1N0VC 1ELOA 5GMDA 1XMQE 3D4JA 4DR6I 5A2QQ 4DR1I 4WUDA 1D6TA 1FWLA 1N34E 1U2RA 2UXCI 1IBKI 4JYAE 1MG7A 1XNRI 3B82A 1Z0EA 2UXCE 2R42A 1EA6A 1H74A 1H72C 4DV7E 4X65I 4DV3E 1FNMA 4HY1A 4LFCI 4B3ME 2VQFI 1Z5BA 1N36I 4P7AA 2ZBKB 3J80C 1NHIA 2OI2A 4XTJA 4DV3I 5LMUE 1Z5AA 5FLXC 1PVGA 3K1JA 4DPXA 1NHJA 4JI7I 2CZ9A 3T1HI 1I94I 4DU8A 2XEXA 4B3SI 1HK7A 4IZKA 4USMA 2GQ0A 4FWDA 2E1RA 1N32I 4DV0I 4B3TE 4FWHA 1Y6ZA 3B8HA 2F4VE 2Z5EA 4JG4A 4PRVA 4DV6E 4N3OA 1J5EI 3Q6NA 4B3MI 3J80Q 4LF8I 1IBME 4DPWA 4X65E 3WU4A 5LL6R 5LMNE 1S16A 1B62A 4ED4A 3WU6A 2HFSA 4LF6I 2UUAE 3JAMC 4LF4I 2HK3A 1HNZE 4GKKI 4X66E 1ZXMA 2HKEA 2V8PA 1XMOE 1H73A 3V5RA 2IOQA 4DR2E 4ZVIA 2UU9E 1FI4A 3QT5A 1HNZI 4JI5E 3K17A 1Z0VA 1Z0TA 5FLXQ 4X66I 3QT7A 4DR5I 4USKA 4NXNE 3ZKBA 4DV1E 4AQYE 4LF4E 4UT4A 5LMUI 1XMQI 1A6FA 4JI1I 1Z0CA 2HFUA 2ZITA 4AQYI 4DR7I 2PNMA 4DU7A 3WU3A 5BR8E 2O1TA 1NZ0A 4DV1I 2V2QA 2Z5CA 1Y4UA 1N33E 1XNRE 2A2CA 3J7AG 3B78A 4UTGA 2UXDI 2EFGA 1KVKA 4DUYE 2BM1A 2VQEE 2UU9I 4LF6E 4B3SE 4YY3E 1KKHA 1USVA 1ZM4A 1ZM3A 4NXME 4DUZE 1H7UA 4JI8E 1IBMI 3J81Q 4DPYA 1HR0I 1Y4SA 4KQVA 4JV5E 4JI3I 4FW9A 3PYEA 4IZJD 4DXLA 4EMDA 1FWKA 2UUCE 1UEKA 4IZJB 4LF9I 3HULA 4HXZA 1KIJA 4LFAI 2J7KA 5IT9Q 3WU5A 1Z59A 1QZRA 4GKKE 2Z5BB 4DR2I 4LF5I 2HKJA 1IBLE 4DV2E 1MX0A 2WW4A 1IBKE 2CGEA 3V2UC 4DV4E 3PYDA 4JI7E 5IWAE 3T1YE 4LFBI 5FWKA 3OTOE 4LF7E 4X64E 3ZZ0A 2IOPA 2AJ4A 1USUA 3PYFA 1HR0E 1OJ4A 3F0NA 4DV4I 1HNWI 5IT9C 3ZKDA 4B3TI 4JI4I 5IWAI 1S4EA 4Z7CA 4I3HA 1Z0WA 3T1HE 1I94E 2V2VA 1ZXNA 2BV3A 4DUYI 1N34I 2V2ZA 4JYAI 2GS8A 1XNQE 3ZZUA 2A2DA 4HYMA 4DR4I 4KHPI 5BR8I 1N36E 3LPSA 2HHHE 2UXBI 4DR6E 4Z7YA 1K47A 4LFCE 2UUCI 3T1YI 4DR4E 4KHPE 4DV6I 3OTOI 2UXBE 1XNQI 4OX9I 2DEJA 3ZM7A 2E5LI 4NXNI 4WUBA 4DV2I 1BKNA 4DUZI 2V34A 1ZM2A 2UUBE 2X36A 4NXMI 4HACA 2LJPA 1IBLI 4JI4E 4JI2E 4PU9A 4R1FA 4FWGA 4LFAE 4DR7E 3GONA 3Q6MA 1RR9A 1XHKA 1Z0BA 4LFBE 4MYTA 4DR3E 3J81C 2VQFE 4K0KE 1FJGE 1H7SA 4JI8I 4JI6I 1PIEA 3J7AM 1NHHA 2HHHI 2X7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LTO A;  1RRE A;  4M1K A;  4YY3 I;  3LNU A;  2NPF A;  3CWV A;  1HNX E;  3JAM Q;  1Z5C A;  4GKJ I;  5GME A;  1XMO I;  1EI1 A;  4JI5 I;  4MYU A;  1N33 I;  2VQE I;  2UUB I;  2UXD E;  4DV5 I;  4X62 I;  2ZM6 E;  1HNW E;  1KTV A;  1HNX I;  2DEI A;  4LF9 E;  1B63 A;  4B3R E;  3Q1Q A;  4JI1 E;  4LF8 E;  4JV5 I;  4JI6 E;  3H4L A;  1WUU A;  3PYG A;  4X62 E;  4DPU A;  4URL A;  4DV5 E;  2ZM6 I;  4DV0 E;  1N32 E;  1Z0G A;  4YHH I;  4RPF A;  4PRX A;  1MU5 A;  3M6A A;  1FKA E;  4FN5 A;  4P52 A;  1N0U A;  3QT8 A;  4JI0 E;  4WUC A;  2BM0 A;  4GKJ E;  5LMN I;  4YHH E;  2HK2 A;  2UUA I;  2VF3 A;  4K0K I;  2E5L E;  3QT6 A;  3ZZT A;  4DR3 I;  4OX9 E;  4JI3 E;  1VIS A;  5L3J A;  1FJG I;  4DV7 I;  4B3R I;  2F4V I;  4DR5 E;  4DPT A;  4HAC B;  4JI2 I;  1DAR A;  4LF5 E;  4JI0 I;  2Q2E B;  1ZM9 A;  2R3V A;  5A2Q C;  1J5E E;  4DR1 E;  4X64 I;  4LF7 I;  1PKP A;  1N0V C;  1ELO A;  5GMD A;  1XMQ E;  3D4J A;  4DR6 I;  5A2Q Q;  4DR1 I;  4WUD A;  1D6T A;  1FWL A;  1N34 E;  1U2R A;  2UXC I;  1IBK I;  4JYA E;  1MG7 A;  1XNR I;  3B82 A;  1Z0E A;  2UXC E;  2R42 A;  1EA6 A;  1H74 A;  1H72 C;  4DV7 E;  4X65 I;  4DV3 E;  1FNM A;  4HY1 A;  4LFC I;  4B3M E;  2VQF I;  1Z5B A;  1N36 I;  4P7A A;  2ZBK B;  3J80 C;  1NHI A;  2OI2 A;  4XTJ A;  4DV3 I;  5LMU E;  1Z5A A;  5FLX C;  1PVG A;  3K1J A;  4DPX A;  1NHJ A;  4JI7 I;  2CZ9 A;  3T1H I;  1I94 I;  4DU8 A;  2XEX A;  4B3S I;  4USM A;  4FWD A;  2E1R A;  1N32 I;  4DV0 I;  4B3T E;  4FWH A;  3B8H A;  2F4V E;  4JG4 A;  4PRV A;  4DV6 E;  1J5E I;  4B3M I;  3J80 Q;  4LF8 I;  1IBM E;  4DPW A;  4X65 E;  3WU4 A;  5LL6 R;  5LMN E;  1S16 A;  1B62 A;  4ED4 A;  3WU6 A;  2HFS A;  4LF6 I;  2UUA E;  3JAM C;  4LF4 I;  2HK3 A;  1HNZ E;  4GKK I;  4X66 E;  1ZXM A;  2HKE A;  2V8P A;  1XMO E;  1H73 A;  3V5R A;  4DR2 E;  4ZVI A;  2UU9 E;  1FI4 A;  3QT5 A;  1HNZ I;  4JI5 E;  3K17 A;  1Z0V A;  1Z0T A;  5FLX Q;  4X66 I;  3QT7 A;  4DR5 I;  4USK A;  4NXN E;  3ZKB A;  4DV1 E;  4AQY E;  4LF4 E;  4UT4 A;  5LMU I;  1XMQ I;  1A6F A;  4JI1 I;  1Z0C A;  2HFU A;  2ZIT A;  4AQY I;  4DR7 I;  4DU7 A;  3WU3 A;  5BR8 E;  1NZ0 A;  4DV1 I;  2V2Q A;  1N33 E;  1XNR E;  2A2C A;  3J7A G;  3B78 A;  4UTG A;  2UXD I;  2EFG A;  1KVK A;  4DUY E;  2BM1 A;  2VQE E;  2UU9 I;  4LF6 E;  4B3S E;  4YY3 E;  1KKH A;  1ZM4 A;  1ZM3 A;  4NXM E;  4DUZ E;  1H7U A;  4JI8 E;  1IBM I;  3J81 Q;  4DPY A;  1HR0 I;  4KQV A;  4JV5 E;  4JI3 I;  4FW9 A;  3PYE A;  4DXL A;  4EMD A;  1FWK A;  2UUC E;  1UEK A;  4LF9 I;  3HUL A;  4HXZ A;  1KIJ A;  4LFA I;  2J7K A;  5IT9 Q;  3WU5 A;  1Z59 A;  1QZR A;  4GKK E;  4DR2 I;  4LF5 I;  2HKJ A;  1IBL E;  4DV2 E;  1MX0 A;  2WW4 A;  1IBK E;  3V2U C;  4DV4 E;  3PYD A;  4JI7 E;  5IWA E;  3T1Y E;  4LFB I;  3OTO E;  4LF7 E;  4X64 E;  3ZZ0 A;  2AJ4 A;  3PYF A;  1HR0 E;  1OJ4 A;  3F0N A;  4DV4 I;  1HNW I;  5IT9 C;  3ZKD A;  4B3T I;  4JI4 I;  5IWA I;  1S4E A;  4Z7C A;  4I3H A;  1Z0W A;  3T1H E;  1I94 E;  2V2V A;  1ZXN A;  2BV3 A;  4DUY I;  1N34 I;  2V2Z A;  4JYA I;  2GS8 A;  1XNQ E;  3ZZU A;  2A2D A;  4HYM A;  4DR4 I;  4KHP I;  5BR8 I;  1N36 E;  3LPS A;  2HHH E;  2UXB I;  4DR6 E;  4Z7Y A;  1K47 A;  4LFC E;  2UUC I;  3T1Y I;  4DR4 E;  4KHP E;  4DV6 I;  3OTO I;  2UXB E;  1XNQ I;  4OX9 I;  2DEJ A;  3ZM7 A;  2E5L I;  4NXN I;  4WUB A;  4DV2 I;  1BKN A;  4DUZ I;  2V34 A;  1ZM2 A;  2UUB E;  2X36 A;  4NXM I;  4HAC A;  2LJP A;  1IBL I;  4JI4 E;  4JI2 E;  4PU9 A;  4R1F A;  4FWG A;  4LFA E;  4DR7 E;  3GON A;  1RR9 A;  1XHK A;  1Z0B A;  4LFB E;  4MYT A;  4DR3 E;  3J81 C;  2VQF E;  4K0K E;  1FJG E;  1H7S A;  4JI8 I;  4JI6 I;  1PIE A;  3J7A M;  1NHH A;  2HHH I;  2X7I A; 
#chains in the Genus database with same CATH topology
 2C39 A;  3LTO A;  1RRE A;  4ISA A;  4M1K A;  4YY3 I;  3LNU A;  2NPF A;  3U1Y A;  3CWV A;  1HNX E;  3JAM Q;  2VES A;  1Z5C A;  4GKJ I;  5JEA D;  5GME A;  5DRR A;  1XMO I;  1EI1 A;  4JI5 I;  4MYU A;  1N33 I;  2VQE I;  2UUB I;  2UXD E;  4DV5 I;  4X62 I;  1Y5Y A;  2ZM6 E;  3K85 A;  1HNW E;  1KTV A;  1HNX I;  2DEI A;  4GQU A;  2BA0 G;  4LF9 E;  1B63 A;  4B3R E;  3Q1Q A;  4JI1 E;  2C38 A;  4OKG A;  5C0X C;  4LF8 E;  2NN6 E;  4JV5 I;  4JI6 E;  3H4L A;  1WUU A;  3PYG A;  5K36 B;  4X62 E;  5EKW A;  4DPU A;  4URL A;  2ZM6 I;  4DV0 E;  4DV5 E;  5JEA B;  1N32 E;  1Z0G A;  4YHH I;  4RPF A;  4PRX A;  1MU5 A;  3M6A A;  1FKA E;  2PNL A;  4FN5 A;  4P52 A;  1N0U A;  3QT8 A;  3CDJ A;  4JI0 E;  5K36 F;  4WUC A;  2PNZ A;  4U3B A;  2BM0 A;  1UDN A;  4U3D A;  4GKJ E;  2Z5B A;  5LMN I;  4YHH E;  2HK2 A;  2WP8 A;  2UUA I;  5DRQ A;  2VF3 A;  3L7Z B;  2O1V A;  4BA1 A;  2E5L E;  3QT6 A;  3ZZT A;  4K0K I;  4DR3 I;  4OX9 E;  4JI3 E;  1VIS A;  2AE8 A;  4IZJ A;  2JEA A;  5L3J A;  1FJG I;  4IFD B;  4DV7 I;  4B3R I;  2Z5C B;  5DRO A;  2O1W A;  3P06 A;  3CDI A;  3HJC A;  1OYR A;  2F4V I;  4DR5 E;  4DPT A;  4QNJ A;  4HAC B;  4JI2 I;  1DAR A;  4IS9 A;  3PRY A;  3U1K A;  2WNR B;  1YHC A;  4LF5 E;  4JI0 I;  2BA1 D;  2O1U A;  2CG9 A;  3P3E A;  2Q2E B;  4IZK B;  4OO1 C;  3HKM A;  1ZM9 A;  4IFD D;  2R3V A;  5A2Q C;  4J3D A;  1J5E E;  5K36 A;  4DR1 E;  2GO3 A;  4X64 I;  4LF7 I;  1PKP A;  5K36 C;  1N0V C;  2O3Z A;  1ELO A;  3P3C A;  5GMD A;  1XMQ E;  3D4J A;  3GCM A;  4DR6 I;  3B4T A;  5A2Q Q;  4DR1 I;  4WUD A;  1D6T A;  4MQY A;  1FWL A;  1N34 E;  2J65 A;  3PS2 A;  1U2R A;  3PS3 A;  2UXC I;  1Y60 A;  1IBK I;  1R6M A;  2GO4 A;  5DNX A;  4JYA E;  1MG7 A;  4BA1 B;  1XNR I;  3DD6 A;  3B82 A;  1Z0E A;  4MDT A;  2UXC E;  2R42 A;  1EA6 A;  1H74 A;  1H72 C;  4DV7 E;  4X65 I;  4OO1 D;  4DV3 E;  1FNM A;  4HY1 A;  4FW6 A;  4LFC I;  4B3M E;  2VQF I;  1Z5B A;  1N36 I;  4P7A A;  2ZBK B;  3J80 C;  1NHI A;  2OI2 A;  4XTJ A;  4MU3 A;  5LMU E;  4DV3 I;  5K36 E;  4NBQ A;  1Z5A A;  5FLX C;  1PVG A;  5C0X B;  3K1J A;  4DPX A;  1NHJ A;  4JI7 I;  2CZ9 A;  3T1H I;  1I94 I;  4DU8 A;  4OO1 E;  2XEX A;  4B3S I;  1HK7 A;  2F1D A;  4IZK A;  1OYS A;  4USM A;  2GQ0 A;  3M85 D;  4FWD A;  2E1R A;  1N32 I;  1RHY A;  4DV0 I;  4B3T E;  4FWH A;  1Y6Z A;  2WNR A;  3B8H A;  2F4V E;  2Z5E A;  4JG4 A;  4PRV A;  4DV6 E;  2PO0 B;  3L7Z A;  4N3O A;  1J5E I;  3Q6N A;  4B3M I;  3UHM A;  3J80 Q;  4LF8 I;  2C37 A;  2PO0 A;  5ELW A;  1IBM E;  4DPW A;  5DNL A;  4X65 E;  3WU4 A;  5LL6 R;  1VI7 A;  5LMN E;  1S16 A;  4IFD A;  1B62 A;  4ED4 A;  4AM3 A;  3WU6 A;  2NN6 F;  2HFS A;  3P3G A;  2UUA E;  3JAM C;  4LF6 I;  4LF4 I;  2HK3 A;  1HNZ E;  4FW4 A;  4GKK I;  4X66 E;  1ZXM A;  2HKE A;  4AID A;  2V8P A;  1XMO E;  1H73 A;  3V5R A;  4BA2 A;  2JEB B;  2IOQ A;  4DR2 E;  4ZVI A;  2UU9 E;  1FI4 A;  3QT5 A;  1HNZ I;  4JI5 E;  5C0X D;  3K17 A;  1Z0V A;  1Z0T A;  5FLX Q;  4X66 I;  3QT7 A;  2PNZ B;  4DR5 I;  4USK A;  4NXN E;  3ZKB A;  4DV1 E;  4AQY E;  4LF4 E;  4UT4 A;  2BR2 B;  5LMU I;  1XMQ I;  1A6F A;  4JI1 I;  2C37 B;  1Z0C A;  4QNK A;  2HFU A;  2ZIT A;  4AQY I;  2NN6 B;  3M7N G;  5C0X A;  4DR7 I;  4FW5 A;  2PNM A;  4DU7 A;  1UDQ A;  3WU3 A;  5BR8 E;  2O1T A;  5C0X E;  2JEB A;  1R6L A;  1NZ0 A;  4DV1 I;  2V2Q A;  2Z5C A;  1Y4U A;  1N33 E;  2IES A;  1XNR E;  2A2C A;  5JEA F;  3B78 A;  3J7A G;  4UTG A;  2UXD I;  1P42 A;  4LPF A;  2EFG A;  1KVK A;  4DUY E;  2BM1 A;  2VQE E;  2UU9 I;  3GME A;  2PO1 B;  4LF6 E;  4B3S E;  4YY3 E;  2JEA B;  1OYP A;  1KKH A;  1USV A;  1ZM4 A;  1ZM3 A;  4FW3 A;  4NXM E;  4IFD F;  4DUZ E;  1H7U A;  4JI8 E;  1IBM I;  3J81 Q;  2NN6 A;  4DPY A;  4AIM A;  1HR0 I;  1Y4S A;  4KQV A;  4JV5 E;  4JI3 I;  3KRN A;  4FW9 A;  3PYE A;  4IZJ D;  1UDS A;  4DXL A;  2C39 B;  4EMD A;  1FWK A;  2UUC E;  1UEK A;  4IZJ B;  4LF9 I;  3HUL A;  4IFD E;  4HXZ A;  1KIJ A;  4LFA I;  2J7K A;  5IT9 Q;  2BA0 D;  2WP8 B;  3WU5 A;  3M85 G;  3GLL A;  1Z59 A;  1QZR A;  5K36 D;  4GKK E;  2Z5B B;  2JE6 B;  2PO2 B;  4DR2 I;  4LF5 I;  3NZK A;  2HKJ A;  1IBL E;  4DV2 E;  1MX0 A;  5JEA C;  2WW4 A;  3P76 A;  1IBK E;  4IFD C;  2CGE A;  3V2U C;  4DV4 E;  3PYD A;  4JI7 E;  2BR2 A;  2IER A;  5IWA E;  3T1Y E;  4LFB I;  5JEA A;  5FWK A;  3OTO E;  4OO1 F;  4LF7 E;  4X64 E;  3ZZ0 A;  2IOP A;  4OZE A;  2AJ4 A;  2PO2 A;  1USU A;  2JE6 A;  2NN6 C;  3PYF A;  1HR0 E;  5EL9 A;  1OJ4 A;  3F0N A;  4DV4 I;  1HNW I;  5IT9 C;  3ZKD A;  4B3T I;  4JI4 I;  2PO1 A;  5IWA I;  1S4E A;  4Z7C A;  4I3H A;  1Z0W A;  4OO1 B;  3T1H E;  4LCG A;  1I94 E;  2V2V A;  1ZXN A;  2BV3 A;  4DUY I;  1N34 I;  2V2Z A;  4BA2 B;  4JYA I;  2GS8 A;  4LOM A;  1XNQ E;  4LCF A;  3ZZU A;  2A2D A;  4HYM A;  4DR4 I;  4KHP I;  5BR8 I;  1N36 E;  3LPS A;  4OO1 A;  2HHH E;  2UXB I;  4MU4 A;  4DR6 E;  3H1C A;  4Z7Y A;  1K47 A;  4LFC E;  2UUC I;  3T1Y I;  4DR4 E;  4KHP E;  4DV6 I;  3PS1 A;  3OTO I;  5JEA E;  2UXB E;  1XNQ I;  4OX9 I;  2DEJ A;  3ZM7 A;  2E5L I;  1UDO A;  4NXN I;  1XXE A;  4WUB A;  1E3H A;  4DV2 I;  2NN6 D;  1BKN A;  1YH8 A;  4DUZ I;  2V34 A;  2C38 B;  1ZM2 A;  2UUB E;  2X36 A;  4NXM I;  4HAC A;  4MU1 A;  4FW7 A;  2LJP A;  2BA1 G;  1IBL I;  4JI4 E;  4JI2 E;  2JT2 A;  4LCH A;  4PU9 A;  4R1F A;  1E3P A;  5C0X F;  3M7N D;  4MU0 A;  4FWG A;  4LFA E;  4DR7 E;  3GON A;  3Q6M A;  1RR9 A;  5DRP A;  1XHK A;  1Z0B A;  4LFB E;  4MYT A;  2CVE A;  3J81 C;  2VQF E;  4DR3 E;  4K0K E;  1FJG E;  1H7S A;  4JI8 I;  4JI6 I;  1PIE A;  3J7A M;  1NHH A;  2HHH I;  2X7I A; 
#chains in the Genus database with same CATH homology
 3LTO A;  1RRE A;  4M1K A;  4YY3 I;  3LNU A;  2NPF A;  3CWV A;  1HNX E;  3JAM Q;  1Z5C A;  4GKJ I;  5GME A;  1XMO I;  1EI1 A;  4JI5 I;  4MYU A;  1N33 I;  2VQE I;  2UUB I;  2UXD E;  4DV5 I;  4X62 I;  2ZM6 E;  3K85 A;  1HNW E;  1KTV A;  1HNX I;  2DEI A;  4LF9 E;  1B63 A;  4B3R E;  3Q1Q A;  4JI1 E;  4LF8 E;  4JV5 I;  4JI6 E;  3H4L A;  1WUU A;  3PYG A;  4X62 E;  4DPU A;  4URL A;  4DV5 E;  2ZM6 I;  4DV0 E;  1N32 E;  1Z0G A;  4YHH I;  4RPF A;  4PRX A;  1MU5 A;  3M6A A;  1FKA E;  2PNL A;  4FN5 A;  4P52 A;  1N0U A;  3QT8 A;  4JI0 E;  4WUC A;  2BM0 A;  4GKJ E;  2Z5B A;  5LMN I;  4YHH E;  2HK2 A;  2UUA I;  2VF3 A;  2O1V A;  4K0K I;  2E5L E;  3QT6 A;  3ZZT A;  4DR3 I;  4OX9 E;  4JI3 E;  1VIS A;  4IZJ A;  5L3J A;  1FJG I;  4DV7 I;  4B3R I;  2Z5C B;  2O1W A;  3P06 A;  3HJC A;  2F4V I;  4DR5 E;  4DPT A;  4HAC B;  4JI2 I;  1DAR A;  3PRY A;  4LF5 E;  4JI0 I;  2O1U A;  2CG9 A;  2Q2E B;  4IZK B;  1ZM9 A;  2R3V A;  5A2Q C;  1J5E E;  4DR1 E;  4X64 I;  4LF7 I;  1PKP A;  1N0V C;  1ELO A;  5GMD A;  1XMQ E;  3D4J A;  4DR6 I;  5A2Q Q;  4DR1 I;  4WUD A;  1D6T A;  1FWL A;  1N34 E;  1U2R A;  2UXC I;  1IBK I;  4JYA E;  1MG7 A;  1XNR I;  3B82 A;  1Z0E A;  2UXC E;  2R42 A;  1EA6 A;  1H74 A;  1H72 C;  4DV7 E;  4X65 I;  4DV3 E;  1FNM A;  4HY1 A;  4LFC I;  4B3M E;  2VQF I;  1Z5B A;  1N36 I;  4P7A A;  2ZBK B;  3J80 C;  1NHI A;  2OI2 A;  4XTJ A;  4DV3 I;  5LMU E;  1Z5A A;  5FLX C;  1PVG A;  3K1J A;  4DPX A;  1NHJ A;  4JI7 I;  2CZ9 A;  3T1H I;  1I94 I;  4DU8 A;  2XEX A;  4B3S I;  1HK7 A;  4IZK A;  4USM A;  2GQ0 A;  4FWD A;  2E1R A;  1N32 I;  4DV0 I;  4B3T E;  4FWH A;  1Y6Z A;  3B8H A;  2F4V E;  2Z5E A;  4JG4 A;  4PRV A;  4DV6 E;  4N3O A;  1J5E I;  3Q6N A;  4B3M I;  3J80 Q;  4LF8 I;  1IBM E;  4DPW A;  4X65 E;  3WU4 A;  5LL6 R;  5LMN E;  1S16 A;  1B62 A;  4ED4 A;  3WU6 A;  2HFS A;  4LF6 I;  2UUA E;  3JAM C;  4LF4 I;  2HK3 A;  1HNZ E;  4GKK I;  4X66 E;  1ZXM A;  2HKE A;  2V8P A;  1XMO E;  1H73 A;  3V5R A;  2IOQ A;  4DR2 E;  4ZVI A;  2UU9 E;  1FI4 A;  3QT5 A;  1HNZ I;  4JI5 E;  3K17 A;  1Z0V A;  1Z0T A;  5FLX Q;  4X66 I;  3QT7 A;  4DR5 I;  4USK A;  4NXN E;  3ZKB A;  4DV1 E;  4AQY E;  4LF4 E;  4UT4 A;  5LMU I;  1XMQ I;  1A6F A;  4JI1 I;  1Z0C A;  2HFU A;  2ZIT A;  4AQY I;  4DR7 I;  2PNM A;  4DU7 A;  3WU3 A;  5BR8 E;  2O1T A;  1NZ0 A;  4DV1 I;  2V2Q A;  2Z5C A;  1Y4U A;  1N33 E;  1XNR E;  2A2C A;  3J7A G;  3B78 A;  4UTG A;  2UXD I;  2EFG A;  1KVK A;  4DUY E;  2BM1 A;  2VQE E;  2UU9 I;  4LF6 E;  4B3S E;  4YY3 E;  1KKH A;  1USV A;  1ZM4 A;  1ZM3 A;  4NXM E;  4DUZ E;  1H7U A;  4JI8 E;  1IBM I;  3J81 Q;  4DPY A;  1HR0 I;  1Y4S A;  4KQV A;  4JV5 E;  4JI3 I;  4FW9 A;  3PYE A;  4IZJ D;  4DXL A;  4EMD A;  1FWK A;  2UUC E;  1UEK A;  4IZJ B;  4LF9 I;  3HUL A;  4HXZ A;  1KIJ A;  4LFA I;  2J7K A;  5IT9 Q;  3WU5 A;  1Z59 A;  1QZR A;  4GKK E;  2Z5B B;  4DR2 I;  4LF5 I;  2HKJ A;  1IBL E;  4DV2 E;  1MX0 A;  2WW4 A;  1IBK E;  2CGE A;  3V2U C;  4DV4 E;  3PYD A;  4JI7 E;  5IWA E;  3T1Y E;  4LFB I;  5FWK A;  3OTO E;  4LF7 E;  4X64 E;  3ZZ0 A;  2IOP A;  2AJ4 A;  1USU A;  3PYF A;  1HR0 E;  1OJ4 A;  3F0N A;  4DV4 I;  1HNW I;  5IT9 C;  3ZKD A;  4B3T I;  4JI4 I;  5IWA I;  1S4E A;  4Z7C A;  4I3H A;  1Z0W A;  3T1H E;  1I94 E;  2V2V A;  1ZXN A;  2BV3 A;  4DUY I;  1N34 I;  2V2Z A;  4JYA I;  2GS8 A;  1XNQ E;  3ZZU A;  2A2D A;  4HYM A;  4DR4 I;  4KHP I;  5BR8 I;  1N36 E;  3LPS A;  2HHH E;  2UXB I;  4DR6 E;  4Z7Y A;  1K47 A;  4LFC E;  2UUC I;  3T1Y I;  4DR4 E;  4KHP E;  4DV6 I;  3OTO I;  2UXB E;  1XNQ I;  4OX9 I;  2DEJ A;  3ZM7 A;  2E5L I;  4NXN I;  4WUB A;  4DV2 I;  1BKN A;  4DUZ I;  2V34 A;  1ZM2 A;  2UUB E;  2X36 A;  4NXM I;  4HAC A;  2LJP A;  1IBL I;  4JI4 E;  4JI2 E;  4PU9 A;  4R1F A;  4FWG A;  4LFA E;  4DR7 E;  3GON A;  3Q6M A;  1RR9 A;  1XHK A;  1Z0B A;  4LFB E;  4MYT A;  4DR3 E;  3J81 C;  2VQF E;  4K0K E;  1FJG E;  1H7S A;  4JI8 I;  4JI6 I;  1PIE A;  3J7A M;  1NHH A;  2HHH I;  2X7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...