2E5LE

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 30
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2e5lE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2e5lE02
2VF3A 3ZKBA 2UU9I 1H73A 1A6FA 4JI8I 2EFGA 1XNQE 3J80Q 4NXMI 4LF9I 1Z0EA 1WHQA 2UXDI 1IBLI 1WHNA 4B3SI 1T4NA 1K47A 2NUFA 3ZZTA 2UUBI 2HK3A 4DV4E 3T1HE 1I94I 1HR0E 1X49A 4LF4I 1ZM4A 4LF7I 4HACA 4B3SE 1N34I 2UUBE 2LJHA 4M2ZA 4LF6I 5L3JA 1HR0I 1U2RA 2L2NA 4K0KE 5GMEA 1Z0VA 3K1JA 2BM0A 4FN5A 4UT4A 4AQYI 4LF6E 2NPFA 2DMYA 1FNMA 1FWLA 2B7TA 1UEKA 1I94E 4URLA 2B3TB 2VQEI 2N3HA 2UU9E 4XTJA 1N34E 2HHHI 1UILA 2A2CA 4ED4A 2B7VA 4LF9E 3D4JA 2RS6A 3B78A 3ADLA 4P52A 3VYYA 2J7KA 2A2DA 5FLXC 4JV5I 4DXLA 4DR6E 2V2VA 4OX9E 4DV7I 4PRVA 4WUBA 3B82A 1KTVA 3B8HA 4OOGC 2NUGA 5FLXQ 3T1YI 4JI5E 4LFAE 1ZM3A 3LPSA 4R1FA 4JI6I 4DR2E 4DV6I 3WU3A 2UXCE 3V5RA 4M30A 4FW9A 1HNWI 5IT9C 1XHKA 2R3VA 4DR3E 2XEXA 4DR7I 4LFCE 1MX0A 4DV7E 4DV2I 4DR1E 1N36E 4X66I 3ADJA 1IBME 3WU4A 1KIJA 3K17A 1N0VC 4JI7E 2EZ6A 3P1XA 3PYGA 2L2MA 1X48A 2F4VE 2N3GA 4HY1A 4JYAE 3M6AA 4JI7I 3ZZ0A 3PYEA 4USMA 1H74A 1ZM2A 2HFUA 3HTXA 2IHR1 1S4EA 3PYDA 1QZRA 2LTRA 4AQYE 1PIEA 2V2ZA 2RTXA 1MG7A 3T1HI 4X65I 4DR2I 4LF4E 2L33A 4JI2I 4YY3E 1N32E 4B3RI 2X36A 1Z5CA 1HNXE 1YYKA 5BR8E 1T4LB 1B63A 5LMUI 4GKJE 3ADIA 2NUEA 1HNZI 3QT6A 4LFCI 4DR5E 2V34A 5LL6R 5LMUE 1T4OA 4LFBI 5LMNE 4NXME 1Z5BA 4NXNI 4FWDA 1IBKE 4X65E 1RR9A 4DV3I 3QT8A 4DUZE 2HKJA 1UHZA 2HHHE 5A2QC 5LMNI 1FKAE 1KVKA 2L2KB 4RPFA 3VYXA 1ZXMA 3V2UC 3J7Yp 2HKEA 2UUCE 2UXBI 1N0UA 2KHXA 3H4LA 4LF5E 4X8WA 4DV1E 2LRSA 2UUAE 1OJ4A 2HK2A 3ADGA 1XNRI 2DEIA 4LFAI 4JI8E 4PRXA 1ZBTA 4DU7A 3ZKDA 4DPWA 4JI1E 1XMOE 4DU8A 2F4VI 4GKKE 1NZ0A 1XNRE 1EI1A 1IBLE 5GMDA 2L3JA 4UTGA 2UXBE 4LFBE 3GONA 4DR7E 4Z7CA 3JAMC 4K0KI 4KQVA 4DV1I 4DPUA 4HACB 1ZM9A 4DPXA 4DUZI 4DR4E 1EKZA 1Z0GA 1FI4A 4JG4A 3J7AM 1N33I 1QU6A 4MYUA 1N32I 4B3ME 3T1YE 1H7UA 2LJPA 4HXZA 2CZ9A 2BV3A 2OI2A 2JVAA 1VISA 4JI3I 2LUQA 1Z5AA 5A2QQ 4YHHE 4DUYE 3CWVA 4DR4I 4I3HA 3QT7A 4JI0I 4JI1I 1RQ0A 4B3RE 1H72C 2VQFI 2L3CA 4GKKI 1BKNA 1Z59A 5BR8I 1Z0BA 4KHPE 4JI4E 1YYOA 1X47A 3OTOI 4WUDA 2ZBKB 4EMDA 1MU5A 4B3TE 2MDRA 2V2QA 2HFSA 2WW4A 5IWAE 4WUCA 2LUPB 4LF7E 3J80C 3J81C 2UXCI 3Q1QA 4DKKA 4B3TI 5IWAI 1Z0TA 4WYQB 4KHPI 2BM1A 4X62I 1KKHA 1ELOA 5CFFE 1O0WA 1NHIA 2UUCI 4DR1I 3J7AG 1STUA 1RREA 3OTOE 4LF5I 1XNQI 1IBMI 1GQEA 4YHHI 1HNZE 2CPNA 4X64I 4DV5I 4OX9I 3WU6A 1DI2A 4JI6E 1IBKI 4X64E 3ZM7A 4JI4I 4YY3I 4DV0E 1FJGI 4DV3E 1H7SA 4X66E 1N36I 2YT4A 2DEJA 3F0NA 4JV5E 4PU9A 2E1RA 3C4BA 1D6TA 1NHJA 4DR6I 4JI3E 2UXDE 1Z0WA 4JYAI 1B62A 2GS8A 3HULA 1RC7A 1J26A 2AJ4A 4NXNE 1YZ9A 1YYWA 4GKJI 4X62E 1FJGE 2V8PA 4B3MI 2E5LE 3JAMQ 2Q2EB 4DR5I 1PVGA 4DPYA 1J5EE 3J81Q 4JI2E 3PYFA 2DB2A 4USKA 1XMOI 4LF8E 1EA6A 4DV5E 2RSMA 4M1KA 1NHHA 4ZVIA 1XMQE 1J5EI 3LNUA 3WU5A 1WUUA 3LLHA 4JI0E 5IT9Q 4DV0I 4HYMA 2VQFE 2VQEE 1PKPA 1XMQI 4FWGA 2LTSA 2LBSB 4DV4I 1DARA 1ZXNA 4MYTA 2ZITA 2RS7A 4DV6E 3LTOA 2DIXA 4LF8I 4FWHA 2R42A 2UUAI 4DPTA 1HNWE 4Z7YA 4DR3I 2X7IA 1S16A 2ZM6E 1Z0CA 4WFTA 3C4TA 4DV2E 2E5LI 4JI5I 3QT5A 1HNXI 4DUYI 2JY9A 1N33E 2ZM6I 2NA2A 4P7AA 1FWKA 3ZZUA
chains in the Genus database with same CATH superfamily
4WX9A 2CTDA 2VF3A 3ZKBA 2UU9I 4IS1C 4LCGA 2I9IA 2V88A 1IQOA 2EPLX 2M4IA 1H73A 1A6FA 2EMXA 4FW5A 4N3OA 4JI8I 5K36F 2EPAA 2EFGA 4TUIA 2EPRA 3UK3C 1XNQE 1USUA 3J80Q 4GQUA 1G2DC 4HEIA 4NXMI 2EWLA 2YRHA 4LF9I 1X6FA 4GEQB 1Z0EA 1WHQA 5IXMB 2EMHA 2UXDI 2N8XA 1IBLI 5A6JA 1WHNA 4B3SI 2C38A 2V83A 1ZAAC 1T4NA 1K47A 1AAYA 5ADZA 4R2PA 2NUFA 3ZZTA 2UUBI 2HK3A 4DV4E 2EMKA 5KL5A 3T1HE 1I94I 2L92A 1HR0E 4FW7A 1X49A 2EM9A 1UBDC 2EN4A 4LF4I 2WP8A 1ZM4A 4LF7I 5JEAB 4R2EA 3C6MA 3QG5C 4B3SE 3FIGA 4HACA 5DNLA 5DRQA 1YUJA 1N34I 2UUBE 3KZYA 2LJHA 5K36A 2D9HA 2E72A 4M2ZA 4LF6I 4OO1A 1A1GA 5L3JA 1HR0I 2WCC3 1U2RA 5EL9A 2L2NA 4IFDD 2EM3A 4BS9A 4K0KE 5GMEA 1Z0VA 2KOUA 4LCFA 3M7NG 3ZOQB 1SR9A 2IOPA 3K1JA 4P7DA 1PJTA 2BM0A 3H1CA 4FN5A 4UT4A 4LU9A 5FWKA 4AQYI 4R2CA 4BA1A 5A6AA 2YU5A 4LF6E 2EOJA 2NPFA 2DMYA 2NN6D 1FNMA 1FWLA 2IESA 2H36X 2B7TA 2EL5A 2FTXB 2K4VA 3EPHA 1UEKA 1I94E 2DLKA 2CGEA 3U1YA 4URLA 4IZKA 5DRPA 4L8NA 1B69A 2B3TB 2VQEI 2FGGA 2JOXA 2N3HA 2UU9E 4HTGA 4IFDB 4DMIA 4XTJA 1E3HA 1N34E 2ENAA 4MU3A 2HHHI 1UILA 4NZVA 2A2CA 2EMBA 4ED4A 2B7VA 3HKMA 4LF9E 2HC5A 3D4JA 3MHHC 2RS6A 4M9VC 2WNRB 3B78A 3ADLA 4P52A 1EH7A 2EL6A 2EMCA 3VYYA 4OO1B 3EPLA 4IFDC 3M85G 2J7KA 2A2DA 1YHCA 4MU4A 2EOIA 5FLXC 2ENHA 4F54A 4JV5I 3CDIA 2EOHA 4DXLA 3CDJA 4WSGA 2WBUA 4DR6E 2V2VA 2V8QB 3RMPA 3GCMA 4OX9E 3OMLA 1Y5YA 4DV7I 4PRVA 4F9CB 4WUBA 3B82A 1KTVA 3B8HA 4OOGC 2NUGA 5FLXQ 2EN1A 2PNZB 2JEBA 2EL4A 3T1YI 4JI5E 1UDSA 1IMUA 4LOMA 4LFAE 1ZM3A 3LPSA 4R1FA 5DRRA 4JI6I 5DROA 4O5GA 2G7HA 2DRPA 2WBSA 4DR2E 4DV6I 1A1JA 3WU3A 4X9JA 3HPSA 2R1FA 2EPOA 2LCEA 2EPCA 2ELYA 3M7ND 4MLVA 2UXCE 3V5RA 4M30A 4FW9A 1HNWI 5IT9C 1R6MA 2GQ0A 2MC5A 2PO1A 3IWDA 1XHKA 4F9BB 2R3VA 2VRDA 2LE2A 4IFDF 4DR3E 2FV4B 2XEXA 3HJCA 4DR7I 3ECRA 1R6LA 4IFDE 4Q28A 4LFCE 1MX0A 2BBGA 5K36D 2NABA 2EMGA 2CG9A 2ODRC 4DV7E 4DV2I 4DR1E 2EMWA 1X5WA 1N36E 2O1TA 3ADJA 1IBME 4ISAA 4X66I 3WU4A 2EOQA 1KIJA 3PS3A 4BA2B 3L00A 1N0VC 2PNZA 5LLQA 3K17A 4JI7E 1T38A 2EM4A 3P1XA 2EZ6A 3PYGA 4IS9A 2L2MA 1X48A 2F4VE 2O1VA 2N3GA 3UHMA 3PS2A 4HY1A 4JYAE 2Q8UA 3M6AA 1WJPA 4JI7I 2LT7A 3ZZ0A 3PYEA 4USMA 1H74A 1E3PA 2WBTA 1F2IG 1ZM2A 2HFUA 3HTXA 2RQLA 2IHR1 1S4EA 3VK6A 3PYDA 2LVHA 1A1FA 2LTRA 1QZRA 4AQYE 1PIEA 2V2ZA 2EORA 4WSPA 2RTXA 1MG7A 4O24A 2BB8A 2EOOA 2M1SA 3P3GA 4X65I 3T1HI 4DR2I 4I8OA 2HGHA 4LF4E 2L33A 1L4SA 2MC6A 4JI2I 2YTNA 4YY3E 1N32E 4B3RI 2EN6A 2X36A 1Z5CA 1EH8A 1HNXE 2BA0G 2DLQA 5BR8E 1T4LB 1YYKA 1B63A 5LMUI 2O1UA 4GKJE 5A6BA 4P78A 2AE8A 4WXDA 3ADIA 2EPMX 2NUEA 2Z5BB 1HNZI 4ZYDA 3QT6A 4LFCI 4DR5E 4ZYEA 2V34A 2ODRD 5LL6R 5KL2A 1LLMC 2EMAA 4LPFA 5KL7A 1SFEA 5LMUE 1T4OA 4LFBI 5LMNE 2C37B 4NXME 2EP3A 1Z5BA 2EPZA 2GO3A 2EMFA 2YTPA 4FWDA 4NXNI 5K36E 1IBKE 1JK1A 2VF1A 4BC9A 4X65E 1ZBQA 1UDOA 4LCHA 1RR9A 3DJWA 5JEAE 2EPUA 3L7ZB 4DV3I 3QT8A 4BMJA 4DUZE 4O43A 2LJUA 1UHZA 2HHHE 5A2QC 2HKJA 3JTZA 5LMNI 1FKAE 1KVKA 2V89A 2L2KB 2LO3A 3B4TA 4RPFA 3VYXA 5C0XC 2EQ3A 1TF3A 3P3CA 1ZXMA 4IZJB 4OO1C 2MKNA 3J7Yp 3V2UC 2HKEA 1PDAA 2J65A 2PO2B 2UUCE 1NCSA 2UXBI 1N0UA 3F6HA 1Y4SA 1Y4UA 2Z5BA 2KHXA 3H4LA 4LF5E 2GPIA 4X8WA 4DV1E 2CSHA 4RHBB 1N3GA 4GZNC 1NEIA 2LRSA 2LV2A 3NZKA 2UUAE 4MDTA 1BBOA 2EM5A 5A6BD 1OJ4A 2HK2A 3ADGA 5AC5A 3DF6A 1XNRI 2DEIA 4LFAI 4JI8E 3EPJA 4PRXA 2YTFA 4F2JC 1ZBTA 4DU7A 1WXRA 1MEYC 3M99B 3ZKDA 3Q6NA 2EN3A 2YSPA 4DPWA 4JI1E 1XMOE 4TUGA 2JP9A 2EM0A 4DU8A 2F4VI 4GKKE 1NZ0A 3P3EA 1XNRE 2EOSA 4LTYA 1IBLE 1EI1A 5GMDA 2L3JA 4UTGA 1MGTA 2UXBE 4FW4A 4MQYA 2YPNA 4LFBE 2GHFA 3THOB 4DR7E 3GONA 4Z7CA 3JAMC 4K0KI 4KQVA 4DV1I 2WP8B 5IT9Q 1X3CA 1OYPA 4DPUA 2EOFA 5JEAA 4HACB 2WZOA 2IERA 1A1HA 1ZM9A 4OZEA 4DPXA 4KZSA 2V86A 2Z5CA 4DUZI 4DR4E 1EKZA 5DNXA 4F9AB 1Z0GA 4BCAA 1FI4A 4JG4A 2E1MA 3J7AM 1N33I 1QU6A 3TQMA 2EQ0A 4MYUA 1N32I 4B3ME 3T1YE 1H7UA 4U3BA 2MKDA 3KZZA 2LJPA 1Y6ZA 4FW3A 4HXZA 4NBQA 2CZ9A 2PRTA 3AV0A 1IQSA 1QNTA 1P47A 1BB8A 2EM6A 3HQ1A 2BV3A 2OI2A 2JVAA 2JOBA 1VISA 4JI3I 2JT2A 2LUQA 1Z5AA 3C6KA 4IZKB 5A2QQ 4BBYA 2YTEA 2J7JA 2JR1A 3MHSC 2LMZA 2R76A 4YHHE 1RMDA 4DUYE 3CWVA 5JEAD 4DR4I 4I3HA 3QT7A 4U3DA 2YRMA 1HK7A 4JI0I 2Z5CB 4JI1I 1RQ0A 4B3RE 1H72C 2VQFI 2L3CA 4GKKI 3LMLA 5AASA 1YPNA 1BKNA 1UDNA 1Z59A 4BHCA 5IV8B 1KJKA 3BBGA 4BA1B 2JWOA 5BR8I 4R2DA 3GLLA 1Z0BA 3VHTB 4KHPE 4JI4E 4NHRA 3PRYA 2JEBB 2BR2B 2YTQA 2L6MA 1YYOA 1X47A 1KYQA 2MDGA 5C0XE 4MU1A 3OTOI 4WUDA 4IFDA 2ZBKB 4WXCA 3DD6A 4EMDA 4J3DA 1MU5A 2EMLA 4B3TE 2MDRA 1YH8A 5A6KA 2HFSA 2V2QA 2WW4A 5IWAE 4WUCA 3BF2A 2LUPB 4LF7E 2WNRA 3GMEA 3U1KA 4WPYA 5T6JA 3J80C 3J81C 2VE7C 2EPPA 2UXCI 1OYSA 3EQ1A 2M9AA 2EOYA 2EPXA 3M85D 2ADRA 3Q1QA 4DKKA 2EJ4A 4AIDA 4B3TI 2V85A 2YTDA 3KWRA 2BA1G 5C0XB 2F8BA 1Z0TA 5IWAI 4WYQB 4ZYGA 2YTOA 1Z1BA 2BM1A 4KHPI 2RPCA 1KKHA 4X62I 1ELOA 2EMYA 5CFFE 1O0WA 4IJDA 4Q35B 1NHIA 2JEAA 2L8TA 2CT1A 2UUCI 3HXLA 3Q6MA 4R2SA 2NN6A 3J7AG 4DR1I 1STUA 1RREA 3OTOE 4LF5I 4N4RB 4BC7A 1XNQI 1IBMI 1GQEA 2EN8A 2BA0D 4YHHI 2EM2A 1P42A 5C0XF 4R2AA 1HNZE 2BR2A 3P06A 2F1DA 2CVEA 2K7IA 2CPNA 2RSIA 4MLQA 1YFHA 1Y60A 3P76A 4X64I 4DV5I 4OX9I 3WU6A 3K6QA 2NN6E 2M7QA 5AC4A 2C39A 1DI2A 1RHYA 1PJSA 2YTJA 2EPKX 2PO1B 5AE1A 3IWBA 3IWCA 5F3WA 3BGHA 4JI6E 1IBKI 4X64E 3ZM7A 2A25A 4QNKA 4YY3I 2EM8A 4JI4I 4J8ZA 4R03A 4DV0E 1TF6A 4DV3E 1FJGI 5K36C 1H7SA 4IZJD 5JEAC 4X66E 1N36I 2YT4A 4F6NA 3BIDA 2O1WA 5C0XA 2DEJA 1XXEA 3F0NA 2DGCA 4JV5E 4PU9A 2E1RA 3C4BA 1D6TA 2GO4A 4BA2A 1PJQA 2EOEA 1UDQA 1NHJA 2NN6F 2HJJA 2JEAB 4R2RA 1G2FC 4DR6I 4JI3E 2NN6B 4OO1D 2UXDE 2YTGA 1Z0WA 4JYAI 1B62A 4OKGA 3JU0A 2GS8A 5AE2A 1RC7A 3HULA 4OO1F 1J26A 3H09A 4NXNE 1YUIA 5KL4A 1YZ9A 2AJ4A 5AE3A 4FK5C 4KWYA 1YYWA 4O4KA 1VI7A 4GKJI 2C39B 2EN7A 2YRKA 2PNLA 4X62E 5KL3A 1FJGE 2V8PA 4B3MI 2E5LE 2DMIA 3JAMQ 2EE8A 2EN2A 3EPKA 2Q2EB 1UN6B 4DR5I 1PVGA 2C37A 4DPYA 1A1LA 1YSAC 1J5EE 1OYRA 2EMZA 1USVA 3J81Q 5KL6A 4JI2E 3PYFA 4FW6A 2DB2A 4USKA 1XMOI 4LF8E 1EA6A 2EMIA 1GZ6A 4DV5E 2DSYA 2YTIA 2EM7A 2RSMA 2V87A 1A1IA 4M1KA 1NHHA 4R2QA 3KRNA 4ZVIA 1XMQE 1J5EI 3LNUA 3WU5A 1WUUA 5DNYA 4M0VA 4AIMA 1GTKA 2GLIA 2JYAA 1JK2A 3LLHA 2EOXA 5TSEA 4JI0E 4OO1E 3HPZA 3THNA 1DQ3A 5A69A 2ENCA 4HYMA 5JEAF 2VQFE 4DV0I 2VESA 2PO2A 2VQEE 1DGCA 2PO0B 2JE6A 1PKPA 1XMQI 4FWGA 4QNJA 3PS1A 2KONA 2I13A 2LTSA 2EQ1A 2LBSB 4F6MA 4DV4I 2YZTA 1DARA 2O3ZA 2BA1D 2EPNA 1AH5A 1ZXNA 4MYTA 2ELZA 2Z5EA 2RS7A 2YSOA 4DV6E 2ZITA 3LTOA 1EH6A 2DIXA 3L7ZA 4LF8I 1T39A 4FWHA 5EKWA 2R42A 4R8OA 2PNMA 2UUAI 4DPTA 1HNWE 3K85A 1TN9A 1X6HA 2IOQA 3F6GA 4ZYHA 4L5NC 2B9DA 4Z7YA 4DR3I 2EOMA 2X7IA 2C38B 2EOZA 1S16A 1WRJA 2ZM6E 5C0XD 1Z0CA 2YWQA 4AM3A 4WFTA 3C4TA 1BBGA 4DV2E 2JPAA 4IZJA 3MSWA 2E5LI 4JI5I 2YU8A 5K36B 3QT5A 3AUZA 1HNXI 4BHBA 2JXPA 1ZR9A 2NN6C 1ZU1A 2JY9A 4DUYI 1A1KA 4RH8A 1X6EA 1N33E 2PO0A 2JE6B 5ELWA 2ZM6I 4MU0A 2NA2A 4P7AA 1FWKA 3ZZUA
chains in the Genus database with same CATH topology
2VF3A 3ZKBA 2UU9I 2V88A 2M4IA 1H73A 1A6FA 4N3OA 4JI8I 2EFGA 4TUIA 1XNQE 1USUA 3J80Q 4NXMI 2EWLA 4LF9I 4GEQB 1Z0EA 1WHQA 2UXDI 1IBLI 1WHNA 4B3SI 2V83A 1T4NA 1K47A 5ADZA 2NUFA 3ZZTA 2UUBI 2HK3A 4DV4E 3T1HE 1I94I 2L92A 1HR0E 1X49A 4LF4I 1ZM4A 4LF7I 4HACA 4B3SE 3FIGA 1N34I 2UUBE 2LJHA 4M2ZA 4LF6I 5L3JA 1HR0I 1U2RA 2L2NA 4BS9A 4K0KE 5GMEA 1Z0VA 2KOUA 3ZOQB 1SR9A 2IOPA 3K1JA 4P7DA 2BM0A 4FN5A 4UT4A 5FWKA 4LU9A 4AQYI 4LF6E 2NPFA 2DMYA 1FNMA 1FWLA 2H36X 2B7TA 2FTXB 2K4VA 1UEKA 1I94E 2CGEA 4URLA 4IZKA 4L8NA 2B3TB 2VQEI 2FGGA 2JOXA 2N3HA 2UU9E 4DMIA 4XTJA 1N34E 2HHHI 1UILA 2A2CA 4ED4A 2B7VA 4LF9E 3D4JA 2RS6A 3B78A 3ADLA 4P52A 3VYYA 2J7KA 2A2DA 5FLXC 4F54A 4JV5I 4DXLA 4DR6E 2V2VA 2V8QB 3RMPA 4OX9E 3OMLA 4DV7I 4PRVA 4F9CB 4WUBA 3B82A 1KTVA 3B8HA 4OOGC 2NUGA 5FLXQ 3T1YI 4JI5E 4LFAE 1ZM3A 3LPSA 4R1FA 4JI6I 2G7HA 4DR2E 4DV6I 3WU3A 3HPSA 2UXCE 3V5RA 4M30A 4FW9A 1HNWI 5IT9C 2GQ0A 2MC5A 3IWDA 1XHKA 4F9BB 2R3VA 2LE2A 4DR3E 2FV4B 2XEXA 3HJCA 4DR7I 4Q28A 4LFCE 1MX0A 2CG9A 2ODRC 4DV7E 4DV2I 4DR1E 2O1TA 1N36E 4X66I 3ADJA 1IBME 3WU4A 1KIJA 3K17A 1N0VC 4JI7E 2EZ6A 3P1XA 3PYGA 2L2MA 1X48A 2F4VE 2O1VA 2N3GA 4HY1A 4JYAE 3M6AA 4JI7I 3ZZ0A 3PYEA 4USMA 1H74A 1ZM2A 2HFUA 3HTXA 2IHR1 1S4EA 3VK6A 3PYDA 1QZRA 2LTRA 4AQYE 1PIEA 2V2ZA 4WSPA 2RTXA 1MG7A 2M1SA 3T1HI 4X65I 4DR2I 4I8OA 4LF4E 2L33A 2MC6A 4JI2I 4YY3E 1N32E 4B3RI 2X36A 1Z5CA 1HNXE 1YYKA 5BR8E 1T4LB 1B63A 5LMUI 2O1UA 4GKJE 4P78A 3ADIA 2NUEA 2Z5BB 1HNZI 3QT6A 4LFCI 4DR5E 2V34A 2ODRD 5LL6R 5LMUE 1T4OA 4LFBI 5LMNE 4NXME 1Z5BA 4NXNI 4FWDA 1IBKE 2VF1A 4BC9A 4X65E 1ZBQA 1RR9A 3DJWA 4DV3I 3QT8A 4BMJA 4DUZE 2HKJA 1UHZA 2HHHE 5A2QC 5LMNI 3JTZA 1FKAE 1KVKA 2V89A 2L2KB 4RPFA 3VYXA 1ZXMA 4IZJB 3V2UC 3J7Yp 2HKEA 2UUCE 2UXBI 1N0UA 3F6HA 1Y4SA 1Y4UA 2Z5BA 2KHXA 3H4LA 4LF5E 4X8WA 4DV1E 2LRSA 2UUAE 1OJ4A 2HK2A 3ADGA 3DF6A 1XNRI 2DEIA 4LFAI 4JI8E 4PRXA 1ZBTA 4DU7A 1WXRA 3ZKDA 3Q6NA 4DPWA 4JI1E 1XMOE 4TUGA 4DU8A 2F4VI 4GKKE 1NZ0A 1XNRE 4LTYA 1IBLE 1EI1A 5GMDA 2L3JA 4UTGA 2UXBE 4LFBE 3GONA 4DR7E 4Z7CA 3JAMC 4K0KI 4KQVA 4DV1I 4DPUA 4HACB 2WZOA 1ZM9A 4DPXA 4KZSA 2V86A 2Z5CA 4DUZI 4DR4E 1EKZA 4F9AB 1Z0GA 4BCAA 1FI4A 4JG4A 2E1MA 3J7AM 1N33I 1QU6A 4MYUA 1N32I 4B3ME 3T1YE 1H7UA 2LJPA 1Y6ZA 4HXZA 2CZ9A 3AV0A 3HQ1A 2BV3A 2OI2A 2JVAA 2JOBA 1VISA 4JI3I 2LUQA 1Z5AA 4IZKB 5A2QQ 4BBYA 2JR1A 2LMZA 4YHHE 4DUYE 3CWVA 4DR4I 4I3HA 3QT7A 1HK7A 4JI0I 2Z5CB 4JI1I 1RQ0A 4B3RE 1H72C 2VQFI 2L3CA 4GKKI 3LMLA 5AASA 1BKNA 1Z59A 2JWOA 5BR8I 1Z0BA 4KHPE 4JI4E 3PRYA 2L6MA 1YYOA 1X47A 3OTOI 4WUDA 2ZBKB 4EMDA 1MU5A 4B3TE 2MDRA 2V2QA 2HFSA 2WW4A 5IWAE 4WUCA 2LUPB 4LF7E 4WPYA 5T6JA 3J80C 3J81C 2VE7C 2UXCI 3Q1QA 4DKKA 4B3TI 2V85A 3KWRA 2F8BA 1Z0TA 5IWAI 4WYQB 4KHPI 2BM1A 4X62I 1KKHA 1ELOA 5CFFE 1O0WA 1NHIA 2L8TA 2UUCI 3HXLA 3Q6MA 4DR1I 3J7AG 1STUA 1RREA 3OTOE 4LF5I 4BC7A 1XNQI 1IBMI 1GQEA 4YHHI 1HNZE 3P06A 2CPNA 4X64I 4DV5I 4OX9I 3WU6A 3K6QA 2M7QA 1DI2A 5AE1A 3IWBA 3IWCA 5F3WA 4JI6E 1IBKI 4X64E 3ZM7A 4JI4I 4YY3I 4J8ZA 4R03A 4DV0E 1FJGI 4DV3E 1H7SA 4IZJD 4X66E 1N36I 2YT4A 2O1WA 2DEJA 3F0NA 4JV5E 4PU9A 2E1RA 3C4BA 1D6TA 1NHJA 4DR6I 4JI3E 2UXDE 1Z0WA 4JYAI 1B62A 3JU0A 2GS8A 5AE2A 1RC7A 3HULA 1J26A 3H09A 4NXNE 2AJ4A 1YZ9A 5AE3A 1YYWA 4GKJI 2PNLA 4X62E 1FJGE 2V8PA 4B3MI 2E5LE 3JAMQ 2Q2EB 4DR5I 1PVGA 4DPYA 1J5EE 1USVA 3J81Q 4JI2E 3PYFA 2DB2A 4USKA 1XMOI 4LF8E 1EA6A 1GZ6A 4DV5E 2DSYA 2V87A 2RSMA 4M1KA 1NHHA 4ZVIA 1XMQE 1J5EI 3LNUA 3WU5A 1WUUA 5DNYA 4M0VA 3LLHA 4JI0E 5IT9Q 3HPZA 1DQ3A 4DV0I 4HYMA 2VQFE 2VQEE 1PKPA 1XMQI 4FWGA 2KONA 2LTSA 2LBSB 4DV4I 2YZTA 1DARA 1ZXNA 4MYTA 2Z5EA 2ZITA 2RS7A 4DV6E 3LTOA 2DIXA 4LF8I 4FWHA 2R42A 4R8OA 2PNMA 2UUAI 4DPTA 1HNWE 3K85A 2IOQA 3F6GA 4L5NC 2B9DA 4Z7YA 4DR3I 2X7IA 1S16A 2ZM6E 1Z0CA 4WFTA 3C4TA 4IZJA 4DV2E 3MSWA 2E5LI 4JI5I 3QT5A 3AUZA 1HNXI 4DUYI 2JY9A 1N33E 2ZM6I 2NA2A 4P7AA 1FWKA 3ZZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VF3 A;  3ZKB A;  2UU9 I;  1H73 A;  1A6F A;  4JI8 I;  2EFG A;  1XNQ E;  3J80 Q;  4NXM I;  4LF9 I;  1Z0E A;  1WHQ A;  2UXD I;  1IBL I;  1WHN A;  4B3S I;  1T4N A;  1K47 A;  2NUF A;  3ZZT A;  2UUB I;  2HK3 A;  4DV4 E;  3T1H E;  1I94 I;  1HR0 E;  1X49 A;  4LF4 I;  1ZM4 A;  4LF7 I;  4HAC A;  4B3S E;  1N34 I;  2UUB E;  2LJH A;  4M2Z A;  4LF6 I;  5L3J A;  1HR0 I;  1U2R A;  2L2N A;  4K0K E;  5GME A;  1Z0V A;  3K1J A;  2BM0 A;  4FN5 A;  4UT4 A;  4AQY I;  4LF6 E;  2NPF A;  2DMY A;  1FNM A;  1FWL A;  2B7T A;  1UEK A;  1I94 E;  4URL A;  2B3T B;  2VQE I;  2N3H A;  2UU9 E;  4XTJ A;  1N34 E;  2HHH I;  1UIL A;  2A2C A;  4ED4 A;  2B7V A;  4LF9 E;  3D4J A;  2RS6 A;  3B78 A;  3ADL A;  4P52 A;  3VYY A;  2J7K A;  2A2D A;  5FLX C;  4JV5 I;  4DXL A;  4DR6 E;  2V2V A;  4OX9 E;  4DV7 I;  4PRV A;  4WUB A;  3B82 A;  1KTV A;  3B8H A;  4OOG C;  2NUG A;  5FLX Q;  3T1Y I;  4JI5 E;  4LFA E;  1ZM3 A;  3LPS A;  4R1F A;  4JI6 I;  4DR2 E;  4DV6 I;  3WU3 A;  2UXC E;  3V5R A;  4M30 A;  4FW9 A;  1HNW I;  5IT9 C;  1XHK A;  2R3V A;  4DR3 E;  2XEX A;  4DR7 I;  4LFC E;  1MX0 A;  4DV7 E;  4DV2 I;  4DR1 E;  1N36 E;  4X66 I;  3ADJ A;  1IBM E;  3WU4 A;  1KIJ A;  3K17 A;  1N0V C;  4JI7 E;  2EZ6 A;  3P1X A;  3PYG A;  2L2M A;  1X48 A;  2F4V E;  2N3G A;  4HY1 A;  4JYA E;  3M6A A;  4JI7 I;  3ZZ0 A;  3PYE A;  4USM A;  1H74 A;  1ZM2 A;  2HFU A;  3HTX A;  2IHR 1;  1S4E A;  3PYD A;  1QZR A;  2LTR A;  4AQY E;  1PIE A;  2V2Z A;  2RTX A;  1MG7 A;  3T1H I;  4X65 I;  4DR2 I;  4LF4 E;  2L33 A;  4JI2 I;  4YY3 E;  1N32 E;  4B3R I;  2X36 A;  1Z5C A;  1HNX E;  1YYK A;  5BR8 E;  1T4L B;  1B63 A;  5LMU I;  4GKJ E;  3ADI A;  2NUE A;  1HNZ I;  3QT6 A;  4LFC I;  4DR5 E;  2V34 A;  5LL6 R;  5LMU E;  1T4O A;  4LFB I;  5LMN E;  4NXM E;  1Z5B A;  4NXN I;  4FWD A;  1IBK E;  4X65 E;  1RR9 A;  4DV3 I;  3QT8 A;  4DUZ E;  2HKJ A;  1UHZ A;  2HHH E;  5A2Q C;  5LMN I;  1FKA E;  1KVK A;  2L2K B;  4RPF A;  3VYX A;  1ZXM A;  3V2U C;  3J7Y p;  2HKE A;  2UUC E;  2UXB I;  1N0U A;  2KHX A;  3H4L A;  4LF5 E;  4X8W A;  4DV1 E;  2LRS A;  2UUA E;  1OJ4 A;  2HK2 A;  3ADG A;  1XNR I;  2DEI A;  4LFA I;  4JI8 E;  4PRX A;  1ZBT A;  4DU7 A;  3ZKD A;  4DPW A;  4JI1 E;  1XMO E;  4DU8 A;  2F4V I;  4GKK E;  1NZ0 A;  1XNR E;  1EI1 A;  1IBL E;  5GMD A;  2L3J A;  4UTG A;  2UXB E;  4LFB E;  3GON A;  4DR7 E;  4Z7C A;  3JAM C;  4K0K I;  4KQV A;  4DV1 I;  4DPU A;  4HAC B;  1ZM9 A;  4DPX A;  4DUZ I;  4DR4 E;  1EKZ A;  1Z0G A;  1FI4 A;  4JG4 A;  3J7A M;  1N33 I;  1QU6 A;  4MYU A;  1N32 I;  4B3M E;  3T1Y E;  1H7U A;  2LJP A;  4HXZ A;  2CZ9 A;  2BV3 A;  2OI2 A;  2JVA A;  1VIS A;  4JI3 I;  2LUQ A;  1Z5A A;  5A2Q Q;  4YHH E;  4DUY E;  3CWV A;  4DR4 I;  4I3H A;  3QT7 A;  4JI0 I;  4JI1 I;  1RQ0 A;  4B3R E;  1H72 C;  2VQF I;  2L3C A;  4GKK I;  1BKN A;  1Z59 A;  5BR8 I;  1Z0B A;  4KHP E;  4JI4 E;  1YYO A;  1X47 A;  3OTO I;  4WUD A;  2ZBK B;  4EMD A;  1MU5 A;  4B3T E;  2MDR A;  2V2Q A;  2HFS A;  2WW4 A;  5IWA E;  4WUC A;  2LUP B;  4LF7 E;  3J80 C;  3J81 C;  2UXC I;  3Q1Q A;  4DKK A;  4B3T I;  5IWA I;  1Z0T A;  4WYQ B;  4KHP I;  2BM1 A;  4X62 I;  1KKH A;  1ELO A;  5CFF E;  1O0W A;  1NHI A;  2UUC I;  4DR1 I;  3J7A G;  1STU A;  1RRE A;  3OTO E;  4LF5 I;  1XNQ I;  1IBM I;  1GQE A;  4YHH I;  1HNZ E;  2CPN A;  4X64 I;  4DV5 I;  4OX9 I;  3WU6 A;  1DI2 A;  4JI6 E;  1IBK I;  4X64 E;  3ZM7 A;  4JI4 I;  4YY3 I;  4DV0 E;  1FJG I;  4DV3 E;  1H7S A;  4X66 E;  1N36 I;  2YT4 A;  2DEJ A;  3F0N A;  4JV5 E;  4PU9 A;  2E1R A;  3C4B A;  1D6T A;  1NHJ A;  4DR6 I;  4JI3 E;  2UXD E;  1Z0W A;  4JYA I;  1B62 A;  2GS8 A;  3HUL A;  1RC7 A;  1J26 A;  2AJ4 A;  4NXN E;  1YZ9 A;  1YYW A;  4GKJ I;  4X62 E;  1FJG E;  2V8P A;  4B3M I;  2E5L E;  3JAM Q;  2Q2E B;  4DR5 I;  1PVG A;  4DPY A;  1J5E E;  3J81 Q;  4JI2 E;  3PYF A;  2DB2 A;  4USK A;  1XMO I;  4LF8 E;  1EA6 A;  4DV5 E;  2RSM A;  4M1K A;  1NHH A;  4ZVI A;  1XMQ E;  1J5E I;  3LNU A;  3WU5 A;  1WUU A;  3LLH A;  4JI0 E;  5IT9 Q;  4DV0 I;  4HYM A;  2VQF E;  2VQE E;  1PKP A;  1XMQ I;  4FWG A;  2LTS A;  2LBS B;  4DV4 I;  1DAR A;  1ZXN A;  4MYT A;  2ZIT A;  2RS7 A;  4DV6 E;  3LTO A;  2DIX A;  4LF8 I;  4FWH A;  2R42 A;  2UUA I;  4DPT A;  1HNW E;  4Z7Y A;  4DR3 I;  2X7I A;  1S16 A;  2ZM6 E;  1Z0C A;  4WFT A;  3C4T A;  4DV2 E;  2E5L I;  4JI5 I;  3QT5 A;  1HNX I;  4DUY I;  2JY9 A;  1N33 E;  2ZM6 I;  2NA2 A;  4P7A A;  1FWK A;  3ZZU A; 
#chains in the Genus database with same CATH topology
 4WX9 A;  2CTD A;  2VF3 A;  3ZKB A;  2UU9 I;  4IS1 C;  4LCG A;  2I9I A;  2V88 A;  1IQO A;  2EPL X;  2M4I A;  1H73 A;  1A6F A;  2EMX A;  4FW5 A;  4N3O A;  4JI8 I;  5K36 F;  2EPA A;  2EFG A;  4TUI A;  2EPR A;  3UK3 C;  1XNQ E;  1USU A;  3J80 Q;  4GQU A;  1G2D C;  4HEI A;  4NXM I;  2EWL A;  2YRH A;  4LF9 I;  1X6F A;  4GEQ B;  1Z0E A;  1WHQ A;  5IXM B;  2EMH A;  2UXD I;  2N8X A;  1IBL I;  5A6J A;  1WHN A;  4B3S I;  2C38 A;  2V83 A;  1ZAA C;  1T4N A;  1K47 A;  1AAY A;  5ADZ A;  4R2P A;  2NUF A;  3ZZT A;  2UUB I;  2HK3 A;  4DV4 E;  2EMK A;  5KL5 A;  3T1H E;  1I94 I;  2L92 A;  1HR0 E;  4FW7 A;  1X49 A;  2EM9 A;  1UBD C;  2EN4 A;  4LF4 I;  2WP8 A;  1ZM4 A;  4LF7 I;  5JEA B;  4R2E A;  3C6M A;  3QG5 C;  4B3S E;  3FIG A;  4HAC A;  5DNL A;  5DRQ A;  1YUJ A;  1N34 I;  2UUB E;  3KZY A;  2LJH A;  5K36 A;  2D9H A;  2E72 A;  4M2Z A;  4LF6 I;  4OO1 A;  1A1G A;  5L3J A;  1HR0 I;  2WCC 3;  1U2R A;  5EL9 A;  2L2N A;  4IFD D;  2EM3 A;  4BS9 A;  4K0K E;  5GME A;  1Z0V A;  2KOU A;  4LCF A;  3M7N G;  3ZOQ B;  1SR9 A;  2IOP A;  3K1J A;  4P7D A;  1PJT A;  2BM0 A;  3H1C A;  4FN5 A;  4UT4 A;  4LU9 A;  5FWK A;  4AQY I;  4R2C A;  4BA1 A;  5A6A A;  2YU5 A;  4LF6 E;  2EOJ A;  2NPF A;  2DMY A;  2NN6 D;  1FNM A;  1FWL A;  2IES A;  2H36 X;  2B7T A;  2EL5 A;  2FTX B;  2K4V A;  3EPH A;  1UEK A;  1I94 E;  2DLK A;  2CGE A;  3U1Y A;  4URL A;  4IZK A;  5DRP A;  4L8N A;  1B69 A;  2B3T B;  2VQE I;  2FGG A;  2JOX A;  2N3H A;  2UU9 E;  4HTG A;  4IFD B;  4DMI A;  4XTJ A;  1E3H A;  1N34 E;  2ENA A;  4MU3 A;  2HHH I;  1UIL A;  4NZV A;  2A2C A;  2EMB A;  4ED4 A;  2B7V A;  3HKM A;  4LF9 E;  2HC5 A;  3D4J A;  3MHH C;  2RS6 A;  4M9V C;  2WNR B;  3B78 A;  3ADL A;  4P52 A;  1EH7 A;  2EL6 A;  2EMC A;  3VYY A;  4OO1 B;  3EPL A;  4IFD C;  3M85 G;  2J7K A;  2A2D A;  1YHC A;  4MU4 A;  2EOI A;  5FLX C;  2ENH A;  4F54 A;  4JV5 I;  3CDI A;  2EOH A;  4DXL A;  3CDJ A;  4WSG A;  2WBU A;  4DR6 E;  2V2V A;  2V8Q B;  3RMP A;  3GCM A;  4OX9 E;  3OML A;  1Y5Y A;  4DV7 I;  4PRV A;  4F9C B;  4WUB A;  3B82 A;  1KTV A;  3B8H A;  4OOG C;  2NUG A;  5FLX Q;  2EN1 A;  2PNZ B;  2JEB A;  2EL4 A;  3T1Y I;  4JI5 E;  1UDS A;  1IMU A;  4LOM A;  4LFA E;  1ZM3 A;  3LPS A;  4R1F A;  5DRR A;  4JI6 I;  5DRO A;  4O5G A;  2G7H A;  2DRP A;  2WBS A;  4DR2 E;  4DV6 I;  1A1J A;  3WU3 A;  4X9J A;  3HPS A;  2R1F A;  2EPO A;  2LCE A;  2EPC A;  2ELY A;  3M7N D;  4MLV A;  2UXC E;  3V5R A;  4M30 A;  4FW9 A;  1HNW I;  5IT9 C;  1R6M A;  2GQ0 A;  2MC5 A;  2PO1 A;  3IWD A;  1XHK A;  4F9B B;  2R3V A;  2VRD A;  2LE2 A;  4IFD F;  4DR3 E;  2FV4 B;  2XEX A;  3HJC A;  4DR7 I;  3ECR A;  1R6L A;  4IFD E;  4Q28 A;  4LFC E;  1MX0 A;  2BBG A;  5K36 D;  2NAB A;  2EMG A;  2CG9 A;  2ODR C;  4DV7 E;  4DV2 I;  4DR1 E;  2EMW A;  1X5W A;  1N36 E;  2O1T A;  3ADJ A;  1IBM E;  4ISA A;  4X66 I;  3WU4 A;  2EOQ A;  1KIJ A;  3PS3 A;  4BA2 B;  3L00 A;  1N0V C;  2PNZ A;  5LLQ A;  3K17 A;  4JI7 E;  1T38 A;  2EM4 A;  3P1X A;  2EZ6 A;  3PYG A;  4IS9 A;  2L2M A;  1X48 A;  2F4V E;  2O1V A;  2N3G A;  3UHM A;  3PS2 A;  4HY1 A;  4JYA E;  2Q8U A;  3M6A A;  1WJP A;  4JI7 I;  2LT7 A;  3ZZ0 A;  3PYE A;  4USM A;  1H74 A;  1E3P A;  2WBT A;  1F2I G;  1ZM2 A;  2HFU A;  3HTX A;  2RQL A;  2IHR 1;  1S4E A;  3VK6 A;  3PYD A;  2LVH A;  1A1F A;  2LTR A;  1QZR A;  4AQY E;  1PIE A;  2V2Z A;  2EOR A;  4WSP A;  2RTX A;  1MG7 A;  4O24 A;  2BB8 A;  2EOO A;  2M1S A;  3P3G A;  4X65 I;  3T1H I;  4DR2 I;  4I8O A;  2HGH A;  4LF4 E;  2L33 A;  1L4S A;  2MC6 A;  4JI2 I;  2YTN A;  4YY3 E;  1N32 E;  4B3R I;  2EN6 A;  2X36 A;  1Z5C A;  1EH8 A;  1HNX E;  2BA0 G;  2DLQ A;  5BR8 E;  1T4L B;  1YYK A;  1B63 A;  5LMU I;  2O1U A;  4GKJ E;  5A6B A;  4P78 A;  2AE8 A;  4WXD A;  3ADI A;  2EPM X;  2NUE A;  2Z5B B;  1HNZ I;  4ZYD A;  3QT6 A;  4LFC I;  4DR5 E;  4ZYE A;  2V34 A;  2ODR D;  5LL6 R;  5KL2 A;  1LLM C;  2EMA A;  4LPF A;  5KL7 A;  1SFE A;  5LMU E;  1T4O A;  4LFB I;  5LMN E;  2C37 B;  4NXM E;  2EP3 A;  1Z5B A;  2EPZ A;  2GO3 A;  2EMF A;  2YTP A;  4FWD A;  4NXN I;  5K36 E;  1IBK E;  1JK1 A;  2VF1 A;  4BC9 A;  4X65 E;  1ZBQ A;  1UDO A;  4LCH A;  1RR9 A;  3DJW A;  5JEA E;  2EPU A;  3L7Z B;  4DV3 I;  3QT8 A;  4BMJ A;  4DUZ E;  4O43 A;  2LJU A;  1UHZ A;  2HHH E;  5A2Q C;  2HKJ A;  3JTZ A;  5LMN I;  1FKA E;  1KVK A;  2V89 A;  2L2K B;  2LO3 A;  3B4T A;  4RPF A;  3VYX A;  5C0X C;  2EQ3 A;  1TF3 A;  3P3C A;  1ZXM A;  4IZJ B;  4OO1 C;  2MKN A;  3J7Y p;  3V2U C;  2HKE A;  1PDA A;  2J65 A;  2PO2 B;  2UUC E;  1NCS A;  2UXB I;  1N0U A;  3F6H A;  1Y4S A;  1Y4U A;  2Z5B A;  2KHX A;  3H4L A;  4LF5 E;  2GPI A;  4X8W A;  4DV1 E;  2CSH A;  4RHB B;  1N3G A;  4GZN C;  1NEI A;  2LRS A;  2LV2 A;  3NZK A;  2UUA E;  4MDT A;  1BBO A;  2EM5 A;  5A6B D;  1OJ4 A;  2HK2 A;  3ADG A;  5AC5 A;  3DF6 A;  1XNR I;  2DEI A;  4LFA I;  4JI8 E;  3EPJ A;  4PRX A;  2YTF A;  4F2J C;  1ZBT A;  4DU7 A;  1WXR A;  1MEY C;  3M99 B;  3ZKD A;  3Q6N A;  2EN3 A;  2YSP A;  4DPW A;  4JI1 E;  1XMO E;  4TUG A;  2JP9 A;  2EM0 A;  4DU8 A;  2F4V I;  4GKK E;  1NZ0 A;  3P3E A;  1XNR E;  2EOS A;  4LTY A;  1IBL E;  1EI1 A;  5GMD A;  2L3J A;  4UTG A;  1MGT A;  2UXB E;  4FW4 A;  4MQY A;  2YPN A;  4LFB E;  2GHF A;  3THO B;  4DR7 E;  3GON A;  4Z7C A;  3JAM C;  4K0K I;  4KQV A;  4DV1 I;  2WP8 B;  5IT9 Q;  1X3C A;  1OYP A;  4DPU A;  2EOF A;  5JEA A;  4HAC B;  2WZO A;  2IER A;  1A1H A;  1ZM9 A;  4OZE A;  4DPX A;  4KZS A;  2V86 A;  2Z5C A;  4DUZ I;  4DR4 E;  1EKZ A;  5DNX A;  4F9A B;  1Z0G A;  4BCA A;  1FI4 A;  4JG4 A;  2E1M A;  3J7A M;  1N33 I;  1QU6 A;  3TQM A;  2EQ0 A;  4MYU A;  1N32 I;  4B3M E;  3T1Y E;  1H7U A;  4U3B A;  2MKD A;  3KZZ A;  2LJP A;  1Y6Z A;  4FW3 A;  4HXZ A;  4NBQ A;  2CZ9 A;  2PRT A;  3AV0 A;  1IQS A;  1QNT A;  1P47 A;  1BB8 A;  2EM6 A;  3HQ1 A;  2BV3 A;  2OI2 A;  2JVA A;  2JOB A;  1VIS A;  4JI3 I;  2JT2 A;  2LUQ A;  1Z5A A;  3C6K A;  4IZK B;  5A2Q Q;  4BBY A;  2YTE A;  2J7J A;  2JR1 A;  3MHS C;  2LMZ A;  2R76 A;  4YHH E;  1RMD A;  4DUY E;  3CWV A;  5JEA D;  4DR4 I;  4I3H A;  3QT7 A;  4U3D A;  2YRM A;  1HK7 A;  4JI0 I;  2Z5C B;  4JI1 I;  1RQ0 A;  4B3R E;  1H72 C;  2VQF I;  2L3C A;  4GKK I;  3LML A;  5AAS A;  1YPN A;  1BKN A;  1UDN A;  1Z59 A;  4BHC A;  5IV8 B;  1KJK A;  3BBG A;  4BA1 B;  2JWO A;  5BR8 I;  4R2D A;  3GLL A;  1Z0B A;  3VHT B;  4KHP E;  4JI4 E;  4NHR A;  3PRY A;  2JEB B;  2BR2 B;  2YTQ A;  2L6M A;  1YYO A;  1X47 A;  1KYQ A;  2MDG A;  5C0X E;  4MU1 A;  3OTO I;  4WUD A;  4IFD A;  2ZBK B;  4WXC A;  3DD6 A;  4EMD A;  4J3D A;  1MU5 A;  2EML A;  4B3T E;  2MDR A;  1YH8 A;  5A6K A;  2HFS A;  2V2Q A;  2WW4 A;  5IWA E;  4WUC A;  3BF2 A;  2LUP B;  4LF7 E;  2WNR A;  3GME A;  3U1K A;  4WPY A;  5T6J A;  3J80 C;  3J81 C;  2VE7 C;  2EPP A;  2UXC I;  1OYS A;  3EQ1 A;  2M9A A;  2EOY A;  2EPX A;  3M85 D;  2ADR A;  3Q1Q A;  4DKK A;  2EJ4 A;  4AID A;  4B3T I;  2V85 A;  2YTD A;  3KWR A;  2BA1 G;  5C0X B;  2F8B A;  1Z0T A;  5IWA I;  4WYQ B;  4ZYG A;  2YTO A;  1Z1B A;  2BM1 A;  4KHP I;  2RPC A;  1KKH A;  4X62 I;  1ELO A;  2EMY A;  5CFF E;  1O0W A;  4IJD A;  4Q35 B;  1NHI A;  2JEA A;  2L8T A;  2CT1 A;  2UUC I;  3HXL A;  3Q6M A;  4R2S A;  2NN6 A;  3J7A G;  4DR1 I;  1STU A;  1RRE A;  3OTO E;  4LF5 I;  4N4R B;  4BC7 A;  1XNQ I;  1IBM I;  1GQE A;  2EN8 A;  2BA0 D;  4YHH I;  2EM2 A;  1P42 A;  5C0X F;  4R2A A;  1HNZ E;  2BR2 A;  3P06 A;  2F1D A;  2CVE A;  2K7I A;  2CPN A;  2RSI A;  4MLQ A;  1YFH A;  1Y60 A;  3P76 A;  4X64 I;  4DV5 I;  4OX9 I;  3WU6 A;  3K6Q A;  2NN6 E;  2M7Q A;  5AC4 A;  2C39 A;  1DI2 A;  1RHY A;  1PJS A;  2YTJ A;  2EPK X;  2PO1 B;  5AE1 A;  3IWB A;  3IWC A;  5F3W A;  3BGH A;  4JI6 E;  1IBK I;  4X64 E;  3ZM7 A;  2A25 A;  4QNK A;  4YY3 I;  2EM8 A;  4JI4 I;  4J8Z A;  4R03 A;  4DV0 E;  1TF6 A;  4DV3 E;  1FJG I;  5K36 C;  1H7S A;  4IZJ D;  5JEA C;  4X66 E;  1N36 I;  2YT4 A;  4F6N A;  3BID A;  2O1W A;  5C0X A;  2DEJ A;  1XXE A;  3F0N A;  2DGC A;  4JV5 E;  4PU9 A;  2E1R A;  3C4B A;  1D6T A;  2GO4 A;  4BA2 A;  1PJQ A;  2EOE A;  1UDQ A;  1NHJ A;  2NN6 F;  2HJJ A;  2JEA B;  4R2R A;  1G2F C;  4DR6 I;  4JI3 E;  2NN6 B;  4OO1 D;  2UXD E;  2YTG A;  1Z0W A;  4JYA I;  1B62 A;  4OKG A;  3JU0 A;  2GS8 A;  5AE2 A;  1RC7 A;  3HUL A;  4OO1 F;  1J26 A;  3H09 A;  4NXN E;  1YUI A;  5KL4 A;  1YZ9 A;  2AJ4 A;  5AE3 A;  4FK5 C;  4KWY A;  1YYW A;  4O4K A;  1VI7 A;  4GKJ I;  2C39 B;  2EN7 A;  2YRK A;  2PNL A;  4X62 E;  5KL3 A;  1FJG E;  2V8P A;  4B3M I;  2E5L E;  2DMI A;  3JAM Q;  2EE8 A;  2EN2 A;  3EPK A;  2Q2E B;  1UN6 B;  4DR5 I;  1PVG A;  2C37 A;  4DPY A;  1A1L A;  1YSA C;  1J5E E;  1OYR A;  2EMZ A;  1USV A;  3J81 Q;  5KL6 A;  4JI2 E;  3PYF A;  4FW6 A;  2DB2 A;  4USK A;  1XMO I;  4LF8 E;  1EA6 A;  2EMI A;  1GZ6 A;  4DV5 E;  2DSY A;  2YTI A;  2EM7 A;  2RSM A;  2V87 A;  1A1I A;  4M1K A;  1NHH A;  4R2Q A;  3KRN A;  4ZVI A;  1XMQ E;  1J5E I;  3LNU A;  3WU5 A;  1WUU A;  5DNY A;  4M0V A;  4AIM A;  1GTK A;  2GLI A;  2JYA A;  1JK2 A;  3LLH A;  2EOX A;  5TSE A;  4JI0 E;  4OO1 E;  3HPZ A;  3THN A;  1DQ3 A;  5A69 A;  2ENC A;  4HYM A;  5JEA F;  2VQF E;  4DV0 I;  2VES A;  2PO2 A;  2VQE E;  1DGC A;  2PO0 B;  2JE6 A;  1PKP A;  1XMQ I;  4FWG A;  4QNJ A;  3PS1 A;  2KON A;  2I13 A;  2LTS A;  2EQ1 A;  2LBS B;  4F6M A;  4DV4 I;  2YZT A;  1DAR A;  2O3Z A;  2BA1 D;  2EPN A;  1AH5 A;  1ZXN A;  4MYT A;  2ELZ A;  2Z5E A;  2RS7 A;  2YSO A;  4DV6 E;  2ZIT A;  3LTO A;  1EH6 A;  2DIX A;  3L7Z A;  4LF8 I;  1T39 A;  4FWH A;  5EKW A;  2R42 A;  4R8O A;  2PNM A;  2UUA I;  4DPT A;  1HNW E;  3K85 A;  1TN9 A;  1X6H A;  2IOQ A;  3F6G A;  4ZYH A;  4L5N C;  2B9D A;  4Z7Y A;  4DR3 I;  2EOM A;  2X7I A;  2C38 B;  2EOZ A;  1S16 A;  1WRJ A;  2ZM6 E;  5C0X D;  1Z0C A;  2YWQ A;  4AM3 A;  4WFT A;  3C4T A;  1BBG A;  4DV2 E;  2JPA A;  4IZJ A;  3MSW A;  2E5L I;  4JI5 I;  2YU8 A;  5K36 B;  3QT5 A;  3AUZ A;  1HNX I;  4BHB A;  2JXP A;  1ZR9 A;  2NN6 C;  1ZU1 A;  2JY9 A;  4DUY I;  1A1K A;  4RH8 A;  1X6E A;  1N33 E;  2PO0 A;  2JE6 B;  5ELW A;  2ZM6 I;  4MU0 A;  2NA2 A;  4P7A A;  1FWK A;  3ZZU A; 
#chains in the Genus database with same CATH homology
 2VF3 A;  3ZKB A;  2UU9 I;  2V88 A;  2M4I A;  1H73 A;  1A6F A;  4N3O A;  4JI8 I;  2EFG A;  4TUI A;  1XNQ E;  1USU A;  3J80 Q;  4NXM I;  2EWL A;  4LF9 I;  4GEQ B;  1Z0E A;  1WHQ A;  2UXD I;  1IBL I;  1WHN A;  4B3S I;  2V83 A;  1T4N A;  1K47 A;  5ADZ A;  2NUF A;  3ZZT A;  2UUB I;  2HK3 A;  4DV4 E;  3T1H E;  1I94 I;  2L92 A;  1HR0 E;  1X49 A;  4LF4 I;  1ZM4 A;  4LF7 I;  4HAC A;  4B3S E;  3FIG A;  1N34 I;  2UUB E;  2LJH A;  4M2Z A;  4LF6 I;  5L3J A;  1HR0 I;  1U2R A;  2L2N A;  4BS9 A;  4K0K E;  5GME A;  1Z0V A;  2KOU A;  3ZOQ B;  1SR9 A;  2IOP A;  3K1J A;  4P7D A;  2BM0 A;  4FN5 A;  4UT4 A;  5FWK A;  4LU9 A;  4AQY I;  4LF6 E;  2NPF A;  2DMY A;  1FNM A;  1FWL A;  2H36 X;  2B7T A;  2FTX B;  2K4V A;  1UEK A;  1I94 E;  2CGE A;  4URL A;  4IZK A;  4L8N A;  2B3T B;  2VQE I;  2FGG A;  2JOX A;  2N3H A;  2UU9 E;  4DMI A;  4XTJ A;  1N34 E;  2HHH I;  1UIL A;  2A2C A;  4ED4 A;  2B7V A;  4LF9 E;  3D4J A;  2RS6 A;  3B78 A;  3ADL A;  4P52 A;  3VYY A;  2J7K A;  2A2D A;  5FLX C;  4F54 A;  4JV5 I;  4DXL A;  4DR6 E;  2V2V A;  2V8Q B;  3RMP A;  4OX9 E;  3OML A;  4DV7 I;  4PRV A;  4F9C B;  4WUB A;  3B82 A;  1KTV A;  3B8H A;  4OOG C;  2NUG A;  5FLX Q;  3T1Y I;  4JI5 E;  4LFA E;  1ZM3 A;  3LPS A;  4R1F A;  4JI6 I;  2G7H A;  4DR2 E;  4DV6 I;  3WU3 A;  3HPS A;  2UXC E;  3V5R A;  4M30 A;  4FW9 A;  1HNW I;  5IT9 C;  2GQ0 A;  2MC5 A;  3IWD A;  1XHK A;  4F9B B;  2R3V A;  2LE2 A;  4DR3 E;  2FV4 B;  2XEX A;  3HJC A;  4DR7 I;  4Q28 A;  4LFC E;  1MX0 A;  2CG9 A;  2ODR C;  4DV7 E;  4DV2 I;  4DR1 E;  2O1T A;  1N36 E;  4X66 I;  3ADJ A;  1IBM E;  3WU4 A;  1KIJ A;  3K17 A;  1N0V C;  4JI7 E;  2EZ6 A;  3P1X A;  3PYG A;  2L2M A;  1X48 A;  2F4V E;  2O1V A;  2N3G A;  4HY1 A;  4JYA E;  3M6A A;  4JI7 I;  3ZZ0 A;  3PYE A;  4USM A;  1H74 A;  1ZM2 A;  2HFU A;  3HTX A;  2IHR 1;  1S4E A;  3VK6 A;  3PYD A;  1QZR A;  2LTR A;  4AQY E;  1PIE A;  2V2Z A;  4WSP A;  2RTX A;  1MG7 A;  2M1S A;  3T1H I;  4X65 I;  4DR2 I;  4I8O A;  4LF4 E;  2L33 A;  2MC6 A;  4JI2 I;  4YY3 E;  1N32 E;  4B3R I;  2X36 A;  1Z5C A;  1HNX E;  1YYK A;  5BR8 E;  1T4L B;  1B63 A;  5LMU I;  2O1U A;  4GKJ E;  4P78 A;  3ADI A;  2NUE A;  2Z5B B;  1HNZ I;  3QT6 A;  4LFC I;  4DR5 E;  2V34 A;  2ODR D;  5LL6 R;  5LMU E;  1T4O A;  4LFB I;  5LMN E;  4NXM E;  1Z5B A;  4NXN I;  4FWD A;  1IBK E;  2VF1 A;  4BC9 A;  4X65 E;  1ZBQ A;  1RR9 A;  3DJW A;  4DV3 I;  3QT8 A;  4BMJ A;  4DUZ E;  2HKJ A;  1UHZ A;  2HHH E;  5A2Q C;  5LMN I;  3JTZ A;  1FKA E;  1KVK A;  2V89 A;  2L2K B;  4RPF A;  3VYX A;  1ZXM A;  4IZJ B;  3V2U C;  3J7Y p;  2HKE A;  2UUC E;  2UXB I;  1N0U A;  3F6H A;  1Y4S A;  1Y4U A;  2Z5B A;  2KHX A;  3H4L A;  4LF5 E;  4X8W A;  4DV1 E;  2LRS A;  2UUA E;  1OJ4 A;  2HK2 A;  3ADG A;  3DF6 A;  1XNR I;  2DEI A;  4LFA I;  4JI8 E;  4PRX A;  1ZBT A;  4DU7 A;  1WXR A;  3ZKD A;  3Q6N A;  4DPW A;  4JI1 E;  1XMO E;  4TUG A;  4DU8 A;  2F4V I;  4GKK E;  1NZ0 A;  1XNR E;  4LTY A;  1IBL E;  1EI1 A;  5GMD A;  2L3J A;  4UTG A;  2UXB E;  4LFB E;  3GON A;  4DR7 E;  4Z7C A;  3JAM C;  4K0K I;  4KQV A;  4DV1 I;  4DPU A;  4HAC B;  2WZO A;  1ZM9 A;  4DPX A;  4KZS A;  2V86 A;  2Z5C A;  4DUZ I;  4DR4 E;  1EKZ A;  4F9A B;  1Z0G A;  4BCA A;  1FI4 A;  4JG4 A;  2E1M A;  3J7A M;  1N33 I;  1QU6 A;  4MYU A;  1N32 I;  4B3M E;  3T1Y E;  1H7U A;  2LJP A;  1Y6Z A;  4HXZ A;  2CZ9 A;  3AV0 A;  3HQ1 A;  2BV3 A;  2OI2 A;  2JVA A;  2JOB A;  1VIS A;  4JI3 I;  2LUQ A;  1Z5A A;  4IZK B;  5A2Q Q;  4BBY A;  2JR1 A;  2LMZ A;  4YHH E;  4DUY E;  3CWV A;  4DR4 I;  4I3H A;  3QT7 A;  1HK7 A;  4JI0 I;  2Z5C B;  4JI1 I;  1RQ0 A;  4B3R E;  1H72 C;  2VQF I;  2L3C A;  4GKK I;  3LML A;  5AAS A;  1BKN A;  1Z59 A;  2JWO A;  5BR8 I;  1Z0B A;  4KHP E;  4JI4 E;  3PRY A;  2L6M A;  1YYO A;  1X47 A;  3OTO I;  4WUD A;  2ZBK B;  4EMD A;  1MU5 A;  4B3T E;  2MDR A;  2V2Q A;  2HFS A;  2WW4 A;  5IWA E;  4WUC A;  2LUP B;  4LF7 E;  4WPY A;  5T6J A;  3J80 C;  3J81 C;  2VE7 C;  2UXC I;  3Q1Q A;  4DKK A;  4B3T I;  2V85 A;  3KWR A;  2F8B A;  1Z0T A;  5IWA I;  4WYQ B;  4KHP I;  2BM1 A;  4X62 I;  1KKH A;  1ELO A;  5CFF E;  1O0W A;  1NHI A;  2L8T A;  2UUC I;  3HXL A;  3Q6M A;  4DR1 I;  3J7A G;  1STU A;  1RRE A;  3OTO E;  4LF5 I;  4BC7 A;  1XNQ I;  1IBM I;  1GQE A;  4YHH I;  1HNZ E;  3P06 A;  2CPN A;  4X64 I;  4DV5 I;  4OX9 I;  3WU6 A;  3K6Q A;  2M7Q A;  1DI2 A;  5AE1 A;  3IWB A;  3IWC A;  5F3W A;  4JI6 E;  1IBK I;  4X64 E;  3ZM7 A;  4JI4 I;  4YY3 I;  4J8Z A;  4R03 A;  4DV0 E;  1FJG I;  4DV3 E;  1H7S A;  4IZJ D;  4X66 E;  1N36 I;  2YT4 A;  2O1W A;  2DEJ A;  3F0N A;  4JV5 E;  4PU9 A;  2E1R A;  3C4B A;  1D6T A;  1NHJ A;  4DR6 I;  4JI3 E;  2UXD E;  1Z0W A;  4JYA I;  1B62 A;  3JU0 A;  2GS8 A;  5AE2 A;  1RC7 A;  3HUL A;  1J26 A;  3H09 A;  4NXN E;  2AJ4 A;  1YZ9 A;  5AE3 A;  1YYW A;  4GKJ I;  2PNL A;  4X62 E;  1FJG E;  2V8P A;  4B3M I;  2E5L E;  3JAM Q;  2Q2E B;  4DR5 I;  1PVG A;  4DPY A;  1J5E E;  1USV A;  3J81 Q;  4JI2 E;  3PYF A;  2DB2 A;  4USK A;  1XMO I;  4LF8 E;  1EA6 A;  1GZ6 A;  4DV5 E;  2DSY A;  2V87 A;  2RSM A;  4M1K A;  1NHH A;  4ZVI A;  1XMQ E;  1J5E I;  3LNU A;  3WU5 A;  1WUU A;  5DNY A;  4M0V A;  3LLH A;  4JI0 E;  5IT9 Q;  3HPZ A;  1DQ3 A;  4DV0 I;  4HYM A;  2VQF E;  2VQE E;  1PKP A;  1XMQ I;  4FWG A;  2KON A;  2LTS A;  2LBS B;  4DV4 I;  2YZT A;  1DAR A;  1ZXN A;  4MYT A;  2Z5E A;  2ZIT A;  2RS7 A;  4DV6 E;  3LTO A;  2DIX A;  4LF8 I;  4FWH A;  2R42 A;  4R8O A;  2PNM A;  2UUA I;  4DPT A;  1HNW E;  3K85 A;  2IOQ A;  3F6G A;  4L5N C;  2B9D A;  4Z7Y A;  4DR3 I;  2X7I A;  1S16 A;  2ZM6 E;  1Z0C A;  4WFT A;  3C4T A;  4IZJ A;  4DV2 E;  3MSW A;  2E5L I;  4JI5 I;  3QT5 A;  3AUZ A;  1HNX I;  4DUY I;  2JY9 A;  1N33 E;  2ZM6 I;  2NA2 A;  4P7A A;  1FWK A;  3ZZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...