2E5LE

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2e5lE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2e5lE02
4WYQB 5A2QC 4DV0I 1FWLA 3VYYA 2E5LE 4DU7A 1RQ0A 1Z0GA 3ZM7A 1N32E 3PYGA 2B3TB 3LPSA 2LJPA 3J80Q 2MDRA 2JVAA 2E5LI 1S16A 3J7Yp 5GMDA 1UILA 2L33A 4M2ZA 2CPNA 4DV5E 4LF7I 1N32I 1QZRA 3J81Q 3QT6A 2UUCE 3ZZUA 4LF6E 3C4BA 1O0WA 4ED4A 2Q2EB 1PKPA 4HACB 4DV5I 1KVKA 2A2CA 2IHR1 2UUCI 4PRXA 4LF6I 3F0NA 1H7UA 4JI3E 4DXLA 1XNRE 3D4JA 2V2VA 5IT9C 2UXCE 2L2MA 2A2DA 4MYTA 4JI0E 4JI3I 4B3TE 3M6AA 1YYOA 1XNRI 2LUPB 1HNZE 4P52A 1Z0EA 2UXCI 4JV5I 4JI0I 4LF9E 4JI5E 4DR4E 2UXDE 3LTOA 4GKJE 4B3TI 4OX9E 1Z5AA 1HNZI 4DV3I 1IBME 4LF9I 1Z59A 4JI5I 4DR4I 3K17A 4GKJI 4OX9I 2V2ZA 3T1HE 1RC7A 1MU5A 4WUDA 4LFCE 1XMOE 1KKHA 4PU9A 2LBSB 1IBMI 4JI7E 1FKAE 3K1JA 1FWKA 2J7KA 1FJGE 3LLHA 1HNWE 4I3HA 4LFCI 3WU3A 1XMOI 1Z0TA 3PYEA 4JI7I 4Z7CA 3J7AM 2RS7A 2DIXA 2ZM6E 1STUA 4B3SE 1WUUA 3ZZTA 4K0KE 2N3HA 2JY9A 2NUGA 2UUAI 3J81C 4X65E 4DR6E 2E1RA 4LF8E 3PYFA 4ZVIA 4NXME 3WU5A 1NHIA 4AQYE 2ZM6I 1I94I 4B3SI 4K0KI 1Z0WA 4LFBE 4HACA 4DV4E 4X65I 4X8WA 4DR6I 1UHZA 4DR2E 1ZM3A 1ZM2A 5LL6R 2L3CA 1T4OA 4DPYA 2HK2A 4X62E 2R3VA 4DU8A 4LFBI 4DV4I 2L3JA 2RSMA 4DR2I 4KQVA 1H7SA 4LF4E 3B82A 2NUFA 1Z0CA 3HULA 1N0UA 3P1XA 1ZM9A 1KTVA 4X62I 3ADGA 4YHHE 2ZBKB 1X48A 1H73A 4YY3E 2NUEA 3GONA 1DI2A 4DR5E 5LMUE 3ZZ0A 4LF4I 1T4NA 1IBLE 1HNXE 2BM0A 1U2RA 4YHHI 1KIJA 4YY3I 1GQEA 4DR5I 5LMUI 3C4TA 3B78A 2DEJA 3ADLA 1N34E 2GS8A 1H72C 2RS6A 1HNXI 2HHHE 4USKA 3QT7A 4DR3E 1K47A 2NPFA 5LMNE 1H74A 4JI8E 1NHHA 1N34I 1MX0A 3QT5A 4UTGA 1XMQE 1D6TA 4DPTA 2HHHI 2N3GA 4HY1A 4USMA 3T1YE 4DR3I 2V34A 4URLA 4DR1E 5LMNI 1YZ9A 4JI8I 1IBKE 1RREA 4FWGA 1XMQI 1N0VC 3PYDA 3T1YI 1S4EA 2UXDI 2DEIA 4DR1I 3Q1QA 1NHJA 1IBKI 2B7VA 4JG4A 4FN5A 3CWVA 3LNUA 4JYAE 1J26A 4NXNE 4B3RE 1DARA 2HFUA 3T1HI 4X64E 2EZ6A 3WU4A 1XNQE 4X66E 1ZM4A 4JYAI 1B62A 2OI2A 1MG7A 2LUQA 4NXNI 4B3RI 3H4LA 1RR9A 4M30A 1FJGI 4JI4E 3QT8A 4R1FA 1HNWI 4Z7YA 2HFSA 1Z0BA 4FW9A 3JAMQ 4X64I 2R42A 1XNQI 1YYWA 4X66I 1ZBTA 4JI6E 2DMYA 1ZXMA 5FLXC 4DPXA 4JI4I 4B3ME 4WFTA 4LF8I 4HXZA 4NXMI 4JI6I 1Z5BA 1T4LB 4AQYI 4XTJA 1PVGA 2BV3A 4JI2E 4B3MI 2VQFE 4DR7E 5CFFE 4PRVA 4GKKE 4P7AA 1J5EE 2UUBE 3ZKBA 1N33E 2XEXA 4JI2I 2LTRA 4WUCA 2LRSA 2VQFI 4DR7I 4GKKI 4LF7E 1NZ0A 1J5EI 2UUBI 5FLXQ 1N33I 4DUYE 2V8PA 3ADJA 2UXBE 4DV1E 1WHNA 1PIEA 3V5RA 3J7AG 4DUYI 1IBLI 2UXBI 1Z0VA 1ELOA 4KHPE 3ZKDA 4DV1I 1A6FA 4JI1E 4RPFA 4MYUA 5A2QQ 4DV7E 4LFAE 1WHQA 4M1KA 1B63A 1EKZA 2EFGA 4DUZE 4KHPI 3VYXA 4JI1I 4WUBA 1N36E 2V2QA 3WU6A 2F4VE 4DPWA 4DKKA 4DV7I 1UEKA 4LFAI 2VF3A 4JV5E 4DPUA 5L3JA 3JAMC 4DUZI 3V2UC 2X36A 1OJ4A 4UT4A 5GMEA 1EI1A 1N36I 2B7TA 2F4VI 4DV6E 2AJ4A 4DV3E 4HYMA 2L2KB 2KHXA 2VQEE 2L2NA 4FWHA 1VISA 3B8HA 1HR0E 4DV6I 4EMDA 2VQEI 3OTOE 1BKNA 4FWDA 1HR0I 2WW4A 2CZ9A 5IT9Q 3ADIA 1YYKA 2HK3A 2X7IA 4LF5E 2BM1A 1X49A 3OTOI 1FNMA 2HKEA 1XHKA 2HKJA 2UU9E 1EA6A 2NA2A 1QU6A 5IWAE 2UUAE 1Z5CA 5BR8E 3J80C 2RTXA 1X47A 2YT4A 4LF5I 4DV2E 3HTXA 2UU9I 2LTSA 1I94E 2DB2A 5IWAI 4DV0E 5BR8I 4OOGC 1FI4A 4DV2I 2LJHA 1ZXNA 2ZITA
chains in the Genus database with same CATH superfamily
4WYQB 5A2QC 2WP8B 5F3WA 4DV0I 2EPCA 1FWLA 2EPOA 3VYYA 4FW5A 5DRQA 2E5LE 2BR2B 2EMFA 4R8OA 1ZBQA 4DU7A 1RQ0A 5AE2A 1Z0GA 2EM3A 2YRMA 3ZM7A 4TUGA 1N32E 2GPIA 1ZAAC 3PYGA 4LCHA 2B3TB 3LPSA 2LJPA 2EN8A 1JK1A 3J80Q 3H1CA 2MDRA 2EMWA 2JVAA 2NABA 4O5GA 2E5LI 3HPZA 2BA1G 4NHRA 1S16A 3J7Yp 5GMDA 1UILA 2L33A 5K36F 4M2ZA 2CPNA 2IERA 4DV5E 4MU1A 4LF7I 1N32I 3IWDA 2IOPA 3L7ZB 5DRRA 1Z1BA 3Q6NA 2JOBA 2I9IA 1QZRA 5DNXA 3J81Q 3QT6A 5KL2A 3BF2A 2UUCE 3ZZUA 2CTDA 3L00A 4LF6E 3C4BA 1O0WA 3C6MA 2V89A 4X9JA 2JP9A 4LCGA 1A1KA 1RMDA 4ED4A 2EM6A 2EPUA 2Q2EB 5C0XD 1BB8A 1PKPA 1UDQA 3GCMA 4HACB 1P47A 4DV5I 1YH8A 1KVKA 2A2CA 3CDIA 2IHR1 3P3CA 2R1FA 2YSOA 2UUCI 4PRXA 4LF6I 2EN4A 2BA0G 3F0NA 2ENCA 1H7UA 2DLQA 4JI3E 2FTXB 4DXLA 2LV2A 3K85A 4MU0A 1XNRE 5JEAF 2EL6A 2EPRA 5KL3A 3D4JA 2V2VA 2JT2A 2JEAB 5IT9C 2EOIA 2Z5CB 2UXCE 3U1YA 2EQ0A 2L2MA 1NEIA 4I8OA 4U3BA 2C39A 2A2DA 2YZTA 4JI0E 4WXCA 4IZJA 4MYTA 4OKGA 4KWYA 3FIGA 2EE8A 4JI3I 3F6GA 4B3TE 5LLQA 1YYOA 3M6AA 1XNRI 2Z5BA 2EJ4A 2Q8UA 4R03A 4RH8A 2LUPB 1A1LA 3U1KA 4R2CA 4F54A 2ELZA 2GQ0A 1HNZE 2YTPA 4P52A 1Z0EA 1UN6B 4L8NA 4J8ZA 2UXCI 2EMIA 3M99B 4JV5I 4JI0I 2EMZA 4JI5E 4LF9E 2YTGA 4DR4E 2UXDE 3OMLA 3PRYA 3LTOA 4GKJE 4B3TI 3IWBA 1XXEA 5K36E 1YUIA 4OX9E 4FK5C 2M4IA 2EPAA 1X6HA 4MLVA 5A6KA 1RHYA 2PO1B 2YWQA 4R2DA 2L92A 1Z5AA 5EL9A 2FV4B 1HNZI 4DV3I 2LVHA 1IBME 4O43A 1ZU1A 3EPKA 3LMLA 4WSGA 4LF9I 2EOMA 1Z59A 4JI5I 4DR4I 5KL7A 1IQSA 3K17A 4GKJI 1MEYC 4LOMA 4OX9I 2CSHA 5DNYA 2G7HA 2LMZA 2V2ZA 2F8BA 5EKWA 2VE7C 3T1HE 1RC7A 4WX9A 1MU5A 4WUDA 2EL4A 4LU9A 4LFCE 2V87A 4ZYHA 1XMOE 4BHCA 2MC5A 1TF6A 2LBSB 1KKHA 4LPFA 4PU9A 1IBMI 2EPKX 2K7IA 3THOB 2PO0A 4JI7E 4ZYDA 1FKAE 2YU8A 4P7DA 2WP8A 3K1JA 1FWKA 4IFDD 2MC6A 2PNLA 2EOFA 2BR2A 5JEAE 4FW3A 2J7KA 2WZOA 2EMCA 1FJGE 2A25A 3BBGA 3LLHA 1HNWE 4TUIA 4I3HA 2PO2B 1PJSA 4LFCI 3BIDA 3WU3A 2EM8A 5AASA 1XMOI 1PDAA 1Z0TA 3PYEA 4FW7A 4JI7I 3PS2A 2YTDA 4Z7CA 1WXRA 3J7AM 2HGHA 1L4SA 3P76A 2RS7A 2DIXA 2ZM6E 5K36B 1STUA 1KJKA 4B3SE 5AE1A 1WUUA 3ZZTA 1E3HA 4K0KE 2N3HA 1NCSA 2JY9A 2NUGA 2UUAI 3J81C 3GMEA 2O1WA 4X65E 2PRTA 2EMKA 4DR6E 1PJQA 2L6MA 4LF8E 1OYSA 2E1RA 2O1UA 3GLLA 3L7ZA 3PYFA 4ZVIA 4NXME 4R2PA 2DLKA 4OO1C 3WU5A 1A1JA 1NHIA 2KONA 2K4VA 4AQYE 1X5WA 4AM3A 2YTEA 2ZM6I 1I94I 1LLMC 4B3SI 2O1TA 4K0KI 1Z0WA 2LE2A 4LFBE 4HACA 4DV4E 2NN6C 4X8WA 2EOJA 4X65I 5C0XC 4DR6I 3K6QA 1HK7A 1UHZA 2EPXA 4DR2E 1UDNA 1ZM3A 1ZM2A 5LL6R 1BBOA 1Y6ZA 4FW6A 4F9BB 2L3CA 1ZR9A 1TF3A 5JEAB 1T4OA 4DPYA 2WBSA 4LTYA 4X62E 2HK2A 2R3VA 2JPAA 4DU8A 4GZNC 2BBGA 4LFBI 4DV4I 2PNMA 2L3JA 2JEAA 2EMXA 2V83A 2M1SA 2RSMA 3AV0A 2LCEA 2CT1A 2Z5CA 4DR2I 2YTNA 3HPSA 2E1MA 2V86A 2YTJA 4KQVA 1H7SA 4LF4E 3B82A 4BA1B 3DD6A 2JXPA 2EQ1A 2NUFA 1Z0CA 3HULA 1N0UA 2RQLA 4OO1D 3P1XA 2YRKA 1KTVA 1ZM9A 4GQUA 4X62I 3ADGA 2EOYA 2EOZA 2EPNA 3RMPA 2VRDA 2V8QB 4BMJA 1A1GA 4YHHE 2ZBKB 1X48A 1G2FC 1H73A 2O1VA 2L8TA 4YY3E 2NUEA 3GONA 3EQ1A 2EOOA 1DI2A 2NN6D 3M85D 4DR5E 5LMUE 3ZZ0A 4LF4I 2I13A 1T4NA 2VF1A 1IBLE 4OO1B 3TQMA 2EMLA 1HNXE 2BM0A 3KWRA 2C38B 3PS1A 2EPLX 1QNTA 1AH5A 4ZYGA 5A6BA 1U2RA 2EN6A 4YHHI 2DRPA 2E72A 4BCAA 5IXMB 2F1DA 1KIJA 4YY3I 1GQEA 2EM4A 2CVEA 2ENAA 4DR5I 5C0XB 5LMUI 2JOXA 3C4TA 3B78A 2DEJA 3ADLA 3KZZA 1N34E 2GS8A 3P3GA 2EOSA 1H72C 2RS6A 3VK6A 2DGCA 1HNXI 2HHHE 1WRJA 1UDSA 1OYPA 4USKA 4M9VC 2EN1A 4IS1C 2MKDA 2EWLA 3QT7A 4DR3E 3H09A 4F2JC 1K47A 2NPFA 3IWCA 2D9HA 5LMNE 1USVA 1H74A 4JI8E 1NHHA 5AC4A 1N34I 1MX0A 3QT5A 3DF6A 4UTGA 1XMQE 1D6TA 4DPTA 4IFDC 2HHHI 2N3GA 4HY1A 4USMA 3T1YE 2YRHA 2PO2A 4DR3I 2V34A 2WBTA 2EM2A 4ISAA 4URLA 2JE6B 4DR1E 5LMNI 1YZ9A 2IOQA 4JI8I 4OO1F 1IBKE 1RREA 4FWGA 2MKNA 1XMQI 4L5NC 4AIDA 1N0VC 1EH8A 2EMHA 5K36A 2RSIA 4R2RA 3PYDA 4WSPA 2ELYA 3EPHA 1S4EA 3T1YI 2EP3A 2UXDI 2JEBB 2DEIA 2NN6F 5C0XF 4F6MA 1Y60A 4AIMA 4DR1I 3Q1QA 4BA2B 1AAYA 3UHMA 3MSWA 1Y4UA 1NHJA 1IBKI 1GTKA 2B7VA 2V85A 4JG4A 2DMIA 4FN5A 3CWVA 4MU3A 3LNUA 2EMGA 4HTGA 4JYAE 1J26A 4GEQB 1G2DC 1UBDC 4IZKB 3AUZA 4R2QA 4NXNE 2O3ZA 2FGGA 4B3RE 4IZJD 1DARA 2HFUA 3T1HI 4R2EA 4X64E 2Z5EA 2PNZB 2YU5A 3ZOQB 1SR9A 2EZ6A 1XNQE 4KZSA 4X66E 3EPJA 1ZM4A 3WU4A 5JEAA 4JYAI 1B62A 2C37B 2ODRC 2OI2A 1MG7A 2LUQA 4NXNI 4IFDB 2EN7A 1MGTA 4B3RI 3H4LA 1RR9A 4M30A 3CDJA 2YTOA 1FJGI 2IESA 2JR1A 4IJDA 4JI4E 3QT8A 4R1FA 1T38A 4Z7YA 1HNWI 2HFSA 2RPCA 1Z0BA 4FW9A 3JAMQ 4X64I 3PS3A 1DQ3A 2R42A 4BA1A 3M85G 1XNQI 1JK2A 1YYWA 4X66I 2LJUA 3JTZA 1ZBTA 2EN3A 4JI6E 5DNLA 4WXDA 2DMYA 5TSEA 5DRPA 1Y4SA 1ZXMA 3VHTB 5FLXC 5T6JA 1X6EA 4ZYEA 4DPXA 1P42A 2GLIA 4JI4I 4OO1E 1E3PA 2EL5A 4B3ME 4WFTA 2LT7A 2AE8A 4MDTA 1WJPA 4LF8I 2V88A 4HXZA 4P78A 5ADZA 3P3EA 4NXMI 4JI6I 2NN6E 1Z5BA 5C0XE 1YPNA 3B4TA 2EMAA 2YPNA 3MHSC 4LCFA 1T39A 1T4LB 4AQYI 4R2AA 4XTJA 2ODRD 2EM9A 3HQ1A 1PVGA 2BV3A 4JI2E 4B3MI 5C0XA 3THNA 4BC7A 2VQFE 1DGCA 4DR7E 5CFFE 2EPPA 4GKKE 4PRVA 4IFDF 4P7AA 4BS9A 4N3OA 1X6FA 1J5EE 2UUBE 3JU0A 4MQYA 3ZKBA 3HKMA 1N33E 2CG9A 2XEXA 2CGEA 4RHBB 4JI2I 5AE3A 2LTRA 4WUCA 2LRSA 2VQFI 5IV8B 5A69A 2VESA 4DR7I 4GKKI 1R6MA 1IQOA 3MHHC 4LF7E 3C6KA 1GZ6A 4O24A 2N8XA 1NZ0A 2ADRA 1J5EI 4FW4A 2UUBI 2JWOA 2EOXA 5FLXQ 2WNRB 1N33I 4DUYE 2V8PA 3ADJA 2UXBE 1OYRA 2JE6A 4DV1E 2EMBA 1WHNA 2M9AA 4DMIA 2PO1A 1YUJA 4F9CB 1PIEA 3V5RA 3J7AG 4WPYA 2NN6B 2EPMX 4QNKA 2JEBA 5ELWA 2YTQA 4DUYI 1IBLI 5KL4A 5DROA 2UXBI 1Z0VA 1ELOA 2GO3A 2J65A 4KHPE 5KL6A 3ZKDA 4DV1I 4Q35B 4BA2A 4BC9A 1F2IG 1A6FA 1IMUA 4JI1E 4RPFA 4MYUA 5A2QQ 4DV7E 2B9DA 4LFAE 2EQ3A 4F6NA 4IS9A 4IZKA 1WHQA 4N4RB 1A1FA 2H36X 1B63A 1EKZA 4M1KA 2EFGA 4DUZE 2GO4A 4KHPI 3EPLA 2EOEA 3VYXA 4JI1I 4WUBA 4IFDE 1N36E 2PNZA 2V2QA 2F4VE 2M7QA 3WU6A 4DPWA 4DKKA 2EPZA 2J7JA 3KZYA 2C37A 3M7NG 4DV7I 1UEKA 4LFAI 2VF3A 4IFDA 4JV5E 2EM7A 4DPUA 5L3JA 3JAMC 1YSAC 4Q28A 4DUZI 2EM5A 4M0VA 3V2UC 2X36A 1OJ4A 4NBQA 4UT4A 5GMEA 1EI1A 4O4KA 5A6JA 1N36I 2B7TA 2MDGA 5A6BD 1BBGA 2BA1D 2F4VI 4BBYA 4DV6E 1A1HA 2JYAA 4DV3E 1SFEA 2L2KB 2AJ4A 3KRNA 4HYMA 1YHCA 4J3DA 1KYQA 2KHXA 1B69A 4F9AB 2VQEE 5K36C 2L2NA 4FWHA 1VISA 2WBUA 3ECRA 3B8HA 1HR0E 2YSPA 5AC5A 3Q6MA 4EMDA 4DV6I 1N3GA 3QG5C 5FWKA 4NZVA 1USUA 2VQEI 3OTOE 2ENHA 1BKNA 3NZKA 4OZEA 2EN2A 4FWDA 1HR0I 2R76A 2BA0D 2WW4A 2CZ9A 2C39B 5IT9Q 3ADIA 1Y5YA 4IZJB 4R2SA 1YYKA 2HK3A 4U3DA 2X7IA 1YFHA 3UK3C 3BGHA 2HC5A 2YTFA 2BB8A 1X49A 4BHBA 4LF5E 2BM1A 2Z5BB 1PJTA 5JEAC 1FNMA 3OTOI 3M7ND 2HKEA 2EORA 1XHKA 2HKJA 5K36D 2UU9E 1EA6A 1EH7A 2NA2A 1QU6A 3DJWA 5A6AA 3F6HA 2DSYA 5BR8E 5IWAE 2UUAE 1Z5CA 3J80C 2RTXA 1X47A 2YT4A 4LF5I 4DV2E 3HTXA 2WNRA 3P06A 1R6LA 5KL5A 4OO1A 2C38A 2UU9I 4MU4A 2LTSA 1I94E 4HEIA 4QNJA 2DB2A 2LO3A 2KOUA 1X3CA 2EM0A 2GHFA 4DV0E 3HJCA 2EOHA 5IWAI 4OOGC 1VI7A 5BR8I 1TN9A 2NN6A 1FI4A 4DV2I 2HJJA 2YTIA 2LJHA 4MLQA 2EMYA 2EOQA 3HXLA 1ZXNA 2ZITA 2WCC3 1EH6A 1A1IA 5JEAD 1UDOA 2PO0B
chains in the Genus database with same CATH topology
4WYQB 5A2QC 5F3WA 4DV0I 1FWLA 3VYYA 2E5LE 4R8OA 1ZBQA 4DU7A 1RQ0A 5AE2A 1Z0GA 3ZM7A 4TUGA 1N32E 3PYGA 2B3TB 3LPSA 2LJPA 3J80Q 2MDRA 2JVAA 2E5LI 3HPZA 1S16A 3J7Yp 5GMDA 1UILA 2L33A 4M2ZA 2CPNA 4DV5E 4LF7I 1N32I 3IWDA 2IOPA 3Q6NA 2JOBA 1QZRA 3J81Q 3QT6A 2UUCE 3ZZUA 4LF6E 3C4BA 1O0WA 2V89A 4ED4A 2Q2EB 1PKPA 4HACB 4DV5I 1KVKA 2A2CA 2IHR1 2UUCI 4PRXA 4LF6I 3F0NA 1H7UA 4JI3E 2FTXB 4DXLA 3K85A 1XNRE 3D4JA 2V2VA 5IT9C 2Z5CB 2UXCE 2L2MA 4I8OA 2A2DA 2YZTA 4JI0E 4IZJA 4MYTA 3FIGA 4JI3I 3F6GA 4B3TE 3M6AA 1YYOA 1XNRI 2Z5BA 4R03A 2LUPB 4F54A 2GQ0A 1HNZE 4P52A 1Z0EA 4L8NA 4J8ZA 2UXCI 4JV5I 4JI0I 4LF9E 4JI5E 4DR4E 2UXDE 3OMLA 3PRYA 3LTOA 4GKJE 4B3TI 3IWBA 4OX9E 2M4IA 2L92A 1Z5AA 1HNZI 2FV4B 4DV3I 1IBME 3LMLA 4LF9I 1Z59A 4JI5I 4DR4I 3K17A 4GKJI 4OX9I 5DNYA 2G7HA 2LMZA 2V2ZA 2F8BA 2VE7C 3T1HE 1RC7A 1MU5A 4WUDA 4LFCE 4LU9A 2V87A 1XMOE 2MC5A 1KKHA 2LBSB 4PU9A 1IBMI 4JI7E 1FKAE 4P7DA 3K1JA 1FWKA 2MC6A 2PNLA 2J7KA 2WZOA 1FJGE 3LLHA 1HNWE 4TUIA 4I3HA 4LFCI 3WU3A 5AASA 1XMOI 1Z0TA 3PYEA 4JI7I 4Z7CA 1WXRA 3J7AM 2RS7A 2DIXA 2ZM6E 1STUA 4B3SE 5AE1A 1WUUA 3ZZTA 4K0KE 2N3HA 2JY9A 2NUGA 2UUAI 3J81C 2O1WA 4X65E 4DR6E 2E1RA 2O1UA 2L6MA 4LF8E 3PYFA 4ZVIA 4NXME 3WU5A 1NHIA 2KONA 2K4VA 4AQYE 2ZM6I 1I94I 4B3SI 2O1TA 4K0KI 1Z0WA 2LE2A 4LFBE 4HACA 4DV4E 4X65I 4X8WA 4DR6I 3K6QA 1HK7A 1UHZA 4DR2E 1ZM3A 1ZM2A 5LL6R 1Y6ZA 4F9BB 2L3CA 1T4OA 4DPYA 2HK2A 4LTYA 4X62E 2R3VA 4DU8A 4LFBI 4DV4I 2PNMA 2L3JA 2V83A 2M1SA 2RSMA 3AV0A 2Z5CA 4DR2I 3HPSA 2E1MA 2V86A 4KQVA 1H7SA 4LF4E 3B82A 2NUFA 1Z0CA 3HULA 1N0UA 3P1XA 1ZM9A 1KTVA 4X62I 3ADGA 3RMPA 2V8QB 4BMJA 4YHHE 2ZBKB 1X48A 1H73A 2O1VA 2L8TA 4YY3E 2NUEA 3GONA 1DI2A 4DR5E 5LMUE 3ZZ0A 4LF4I 1T4NA 2VF1A 1IBLE 1HNXE 2BM0A 3KWRA 1U2RA 4YHHI 4BCAA 1KIJA 4YY3I 1GQEA 4DR5I 5LMUI 2JOXA 3C4TA 3B78A 2DEJA 3ADLA 1N34E 2GS8A 1H72C 2RS6A 3VK6A 1HNXI 2HHHE 4USKA 2EWLA 3QT7A 4DR3E 3H09A 1K47A 2NPFA 3IWCA 1USVA 5LMNE 1H74A 4JI8E 1NHHA 1N34I 1MX0A 3QT5A 3DF6A 4UTGA 1XMQE 1D6TA 4DPTA 2HHHI 2N3GA 4HY1A 4USMA 3T1YE 4DR3I 2V34A 4URLA 4DR1E 5LMNI 1YZ9A 2IOQA 4JI8I 1IBKE 1RREA 4FWGA 1XMQI 4L5NC 1N0VC 3PYDA 4WSPA 3T1YI 1S4EA 2UXDI 2DEIA 4DR1I 3Q1QA 3MSWA 1Y4UA 1NHJA 1IBKI 2B7VA 2V85A 4JG4A 4FN5A 3CWVA 3LNUA 4JYAE 1J26A 4GEQB 4IZKB 3AUZA 4NXNE 2FGGA 4B3RE 4IZJD 1DARA 2HFUA 3T1HI 4X64E 2Z5EA 3ZOQB 1SR9A 2EZ6A 1XNQE 4KZSA 4X66E 3WU4A 1ZM4A 4JYAI 1B62A 2ODRC 2OI2A 1MG7A 2LUQA 4NXNI 4B3RI 3H4LA 1RR9A 4M30A 1FJGI 2JR1A 4JI4E 3QT8A 4R1FA 1HNWI 4Z7YA 2HFSA 1Z0BA 4FW9A 3JAMQ 4X64I 1DQ3A 2R42A 1XNQI 1YYWA 4X66I 3JTZA 1ZBTA 4JI6E 2DMYA 1Y4SA 1ZXMA 5FLXC 5T6JA 4DPXA 4JI4I 4B3ME 4WFTA 4LF8I 2V88A 4HXZA 4P78A 5ADZA 4NXMI 4JI6I 1Z5BA 1T4LB 4AQYI 4XTJA 2ODRD 3HQ1A 1PVGA 2BV3A 4JI2E 4B3MI 4BC7A 2VQFE 4DR7E 5CFFE 4PRVA 4GKKE 4P7AA 4BS9A 4N3OA 1J5EE 2UUBE 3ZKBA 3JU0A 1N33E 2CG9A 2XEXA 2CGEA 4JI2I 5AE3A 2LTRA 4WUCA 2LRSA 2VQFI 4DR7I 4GKKI 4LF7E 1GZ6A 1NZ0A 1J5EI 2UUBI 2JWOA 5FLXQ 1N33I 4DUYE 2V8PA 3ADJA 2UXBE 4DV1E 1WHNA 4DMIA 4F9CB 1PIEA 3V5RA 3J7AG 4WPYA 4DUYI 1IBLI 2UXBI 1Z0VA 1ELOA 4KHPE 3ZKDA 4DV1I 4BC9A 1A6FA 4JI1E 4RPFA 4MYUA 5A2QQ 4DV7E 2B9DA 4LFAE 4IZKA 1WHQA 4M1KA 2H36X 1B63A 1EKZA 2EFGA 4DUZE 4KHPI 3VYXA 4JI1I 4WUBA 1N36E 2V2QA 3WU6A 2F4VE 2M7QA 4DPWA 4DKKA 4DV7I 1UEKA 4LFAI 2VF3A 4JV5E 4DPUA 5L3JA 3JAMC 4DUZI 4Q28A 4M0VA 3V2UC 2X36A 1OJ4A 4UT4A 5GMEA 1EI1A 1N36I 2B7TA 2F4VI 4BBYA 4DV6E 2AJ4A 4DV3E 4HYMA 2L2KB 2KHXA 4F9AB 2VQEE 2L2NA 4FWHA 1VISA 3B8HA 1HR0E 3Q6MA 4EMDA 4DV6I 5FWKA 1USUA 2VQEI 3OTOE 1BKNA 4FWDA 1HR0I 2WW4A 2CZ9A 5IT9Q 3ADIA 4IZJB 1YYKA 2HK3A 2X7IA 4LF5E 2Z5BB 2BM1A 1X49A 3OTOI 1FNMA 2HKEA 1XHKA 2HKJA 2UU9E 1EA6A 2NA2A 1QU6A 2UUAE 3DJWA 3F6HA 2DSYA 5BR8E 5IWAE 1Z5CA 3J80C 2RTXA 1X47A 2YT4A 4LF5I 4DV2E 3HTXA 3P06A 2UU9I 2LTSA 1I94E 2DB2A 2KOUA 5IWAI 4DV0E 3HJCA 5BR8I 4OOGC 1FI4A 4DV2I 2LJHA 3HXLA 1ZXNA 2ZITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYQ B;  5A2Q C;  4DV0 I;  1FWL A;  3VYY A;  2E5L E;  4DU7 A;  1RQ0 A;  1Z0G A;  3ZM7 A;  1N32 E;  3PYG A;  2B3T B;  3LPS A;  2LJP A;  3J80 Q;  2MDR A;  2JVA A;  2E5L I;  1S16 A;  3J7Y p;  5GMD A;  1UIL A;  2L33 A;  4M2Z A;  2CPN A;  4DV5 E;  4LF7 I;  1N32 I;  1QZR A;  3J81 Q;  3QT6 A;  2UUC E;  3ZZU A;  4LF6 E;  3C4B A;  1O0W A;  4ED4 A;  2Q2E B;  1PKP A;  4HAC B;  4DV5 I;  1KVK A;  2A2C A;  2IHR 1;  2UUC I;  4PRX A;  4LF6 I;  3F0N A;  1H7U A;  4JI3 E;  4DXL A;  1XNR E;  3D4J A;  2V2V A;  5IT9 C;  2UXC E;  2L2M A;  2A2D A;  4MYT A;  4JI0 E;  4JI3 I;  4B3T E;  3M6A A;  1YYO A;  1XNR I;  2LUP B;  1HNZ E;  4P52 A;  1Z0E A;  2UXC I;  4JV5 I;  4JI0 I;  4LF9 E;  4JI5 E;  4DR4 E;  2UXD E;  3LTO A;  4GKJ E;  4B3T I;  4OX9 E;  1Z5A A;  1HNZ I;  4DV3 I;  1IBM E;  4LF9 I;  1Z59 A;  4JI5 I;  4DR4 I;  3K17 A;  4GKJ I;  4OX9 I;  2V2Z A;  3T1H E;  1RC7 A;  1MU5 A;  4WUD A;  4LFC E;  1XMO E;  1KKH A;  4PU9 A;  2LBS B;  1IBM I;  4JI7 E;  1FKA E;  3K1J A;  1FWK A;  2J7K A;  1FJG E;  3LLH A;  1HNW E;  4I3H A;  4LFC I;  3WU3 A;  1XMO I;  1Z0T A;  3PYE A;  4JI7 I;  4Z7C A;  3J7A M;  2RS7 A;  2DIX A;  2ZM6 E;  1STU A;  4B3S E;  1WUU A;  3ZZT A;  4K0K E;  2N3H A;  2JY9 A;  2NUG A;  2UUA I;  3J81 C;  4X65 E;  4DR6 E;  2E1R A;  4LF8 E;  3PYF A;  4ZVI A;  4NXM E;  3WU5 A;  1NHI A;  4AQY E;  2ZM6 I;  1I94 I;  4B3S I;  4K0K I;  1Z0W A;  4LFB E;  4HAC A;  4DV4 E;  4X65 I;  4X8W A;  4DR6 I;  1UHZ A;  4DR2 E;  1ZM3 A;  1ZM2 A;  5LL6 R;  2L3C A;  1T4O A;  4DPY A;  2HK2 A;  4X62 E;  2R3V A;  4DU8 A;  4LFB I;  4DV4 I;  2L3J A;  2RSM A;  4DR2 I;  4KQV A;  1H7S A;  4LF4 E;  3B82 A;  2NUF A;  1Z0C A;  3HUL A;  1N0U A;  3P1X A;  1ZM9 A;  1KTV A;  4X62 I;  3ADG A;  4YHH E;  2ZBK B;  1X48 A;  1H73 A;  4YY3 E;  2NUE A;  3GON A;  1DI2 A;  4DR5 E;  5LMU E;  3ZZ0 A;  4LF4 I;  1T4N A;  1IBL E;  1HNX E;  2BM0 A;  1U2R A;  4YHH I;  1KIJ A;  4YY3 I;  1GQE A;  4DR5 I;  5LMU I;  3C4T A;  3B78 A;  2DEJ A;  3ADL A;  1N34 E;  2GS8 A;  1H72 C;  2RS6 A;  1HNX I;  2HHH E;  4USK A;  3QT7 A;  4DR3 E;  1K47 A;  2NPF A;  5LMN E;  1H74 A;  4JI8 E;  1NHH A;  1N34 I;  1MX0 A;  3QT5 A;  4UTG A;  1XMQ E;  1D6T A;  4DPT A;  2HHH I;  2N3G A;  4HY1 A;  4USM A;  3T1Y E;  4DR3 I;  2V34 A;  4URL A;  4DR1 E;  5LMN I;  1YZ9 A;  4JI8 I;  1IBK E;  1RRE A;  4FWG A;  1XMQ I;  1N0V C;  3PYD A;  3T1Y I;  1S4E A;  2UXD I;  2DEI A;  4DR1 I;  3Q1Q A;  1NHJ A;  1IBK I;  2B7V A;  4JG4 A;  4FN5 A;  3CWV A;  3LNU A;  4JYA E;  1J26 A;  4NXN E;  4B3R E;  1DAR A;  2HFU A;  3T1H I;  4X64 E;  2EZ6 A;  3WU4 A;  1XNQ E;  4X66 E;  1ZM4 A;  4JYA I;  1B62 A;  2OI2 A;  1MG7 A;  2LUQ A;  4NXN I;  4B3R I;  3H4L A;  1RR9 A;  4M30 A;  1FJG I;  4JI4 E;  3QT8 A;  4R1F A;  1HNW I;  4Z7Y A;  2HFS A;  1Z0B A;  4FW9 A;  3JAM Q;  4X64 I;  2R42 A;  1XNQ I;  1YYW A;  4X66 I;  1ZBT A;  4JI6 E;  2DMY A;  1ZXM A;  5FLX C;  4DPX A;  4JI4 I;  4B3M E;  4WFT A;  4LF8 I;  4HXZ A;  4NXM I;  4JI6 I;  1Z5B A;  1T4L B;  4AQY I;  4XTJ A;  1PVG A;  2BV3 A;  4JI2 E;  4B3M I;  2VQF E;  4DR7 E;  5CFF E;  4PRV A;  4GKK E;  4P7A A;  1J5E E;  2UUB E;  3ZKB A;  1N33 E;  2XEX A;  4JI2 I;  2LTR A;  4WUC A;  2LRS A;  2VQF I;  4DR7 I;  4GKK I;  4LF7 E;  1NZ0 A;  1J5E I;  2UUB I;  5FLX Q;  1N33 I;  4DUY E;  2V8P A;  3ADJ A;  2UXB E;  4DV1 E;  1WHN A;  1PIE A;  3V5R A;  3J7A G;  4DUY I;  1IBL I;  2UXB I;  1Z0V A;  1ELO A;  4KHP E;  3ZKD A;  4DV1 I;  1A6F A;  4JI1 E;  4RPF A;  4MYU A;  5A2Q Q;  4DV7 E;  4LFA E;  1WHQ A;  4M1K A;  1B63 A;  1EKZ A;  2EFG A;  4DUZ E;  4KHP I;  3VYX A;  4JI1 I;  4WUB A;  1N36 E;  2V2Q A;  3WU6 A;  2F4V E;  4DPW A;  4DKK A;  4DV7 I;  1UEK A;  4LFA I;  2VF3 A;  4JV5 E;  4DPU A;  5L3J A;  3JAM C;  4DUZ I;  3V2U C;  2X36 A;  1OJ4 A;  4UT4 A;  5GME A;  1EI1 A;  1N36 I;  2B7T A;  2F4V I;  4DV6 E;  2AJ4 A;  4DV3 E;  4HYM A;  2L2K B;  2KHX A;  2VQE E;  2L2N A;  4FWH A;  1VIS A;  3B8H A;  1HR0 E;  4DV6 I;  4EMD A;  2VQE I;  3OTO E;  1BKN A;  4FWD A;  1HR0 I;  2WW4 A;  2CZ9 A;  5IT9 Q;  3ADI A;  1YYK A;  2HK3 A;  2X7I A;  4LF5 E;  2BM1 A;  1X49 A;  3OTO I;  1FNM A;  2HKE A;  1XHK A;  2HKJ A;  2UU9 E;  1EA6 A;  2NA2 A;  1QU6 A;  5IWA E;  2UUA E;  1Z5C A;  5BR8 E;  3J80 C;  2RTX A;  1X47 A;  2YT4 A;  4LF5 I;  4DV2 E;  3HTX A;  2UU9 I;  2LTS A;  1I94 E;  2DB2 A;  5IWA I;  4DV0 E;  5BR8 I;  4OOG C;  1FI4 A;  4DV2 I;  2LJH A;  1ZXN A;  2ZIT A; 
#chains in the Genus database with same CATH topology
 4WYQ B;  5A2Q C;  2WP8 B;  5F3W A;  4DV0 I;  2EPC A;  1FWL A;  2EPO A;  3VYY A;  4FW5 A;  5DRQ A;  2E5L E;  2BR2 B;  2EMF A;  4R8O A;  1ZBQ A;  4DU7 A;  1RQ0 A;  5AE2 A;  1Z0G A;  2EM3 A;  2YRM A;  3ZM7 A;  4TUG A;  1N32 E;  2GPI A;  1ZAA C;  3PYG A;  4LCH A;  2B3T B;  3LPS A;  2LJP A;  2EN8 A;  1JK1 A;  3J80 Q;  3H1C A;  2MDR A;  2EMW A;  2JVA A;  2NAB A;  4O5G A;  2E5L I;  3HPZ A;  2BA1 G;  4NHR A;  1S16 A;  3J7Y p;  5GMD A;  1UIL A;  2L33 A;  5K36 F;  4M2Z A;  2CPN A;  2IER A;  4DV5 E;  4MU1 A;  4LF7 I;  1N32 I;  3IWD A;  2IOP A;  3L7Z B;  5DRR A;  1Z1B A;  3Q6N A;  2JOB A;  2I9I A;  1QZR A;  5DNX A;  3J81 Q;  3QT6 A;  5KL2 A;  3BF2 A;  2UUC E;  3ZZU A;  2CTD A;  3L00 A;  4LF6 E;  3C4B A;  1O0W A;  3C6M A;  2V89 A;  4X9J A;  2JP9 A;  4LCG A;  1A1K A;  1RMD A;  4ED4 A;  2EM6 A;  2EPU A;  2Q2E B;  5C0X D;  1BB8 A;  1PKP A;  1UDQ A;  3GCM A;  4HAC B;  1P47 A;  4DV5 I;  1YH8 A;  1KVK A;  2A2C A;  3CDI A;  2IHR 1;  3P3C A;  2R1F A;  2YSO A;  2UUC I;  4PRX A;  4LF6 I;  2EN4 A;  2BA0 G;  3F0N A;  2ENC A;  1H7U A;  2DLQ A;  4JI3 E;  2FTX B;  4DXL A;  2LV2 A;  3K85 A;  4MU0 A;  1XNR E;  5JEA F;  2EL6 A;  2EPR A;  5KL3 A;  3D4J A;  2V2V A;  2JT2 A;  2JEA B;  5IT9 C;  2EOI A;  2Z5C B;  2UXC E;  3U1Y A;  2EQ0 A;  2L2M A;  1NEI A;  4I8O A;  4U3B A;  2C39 A;  2A2D A;  2YZT A;  4JI0 E;  4WXC A;  4IZJ A;  4MYT A;  4OKG A;  4KWY A;  3FIG A;  2EE8 A;  4JI3 I;  3F6G A;  4B3T E;  5LLQ A;  1YYO A;  3M6A A;  1XNR I;  2Z5B A;  2EJ4 A;  2Q8U A;  4R03 A;  4RH8 A;  2LUP B;  1A1L A;  3U1K A;  4R2C A;  4F54 A;  2ELZ A;  2GQ0 A;  1HNZ E;  2YTP A;  4P52 A;  1Z0E A;  1UN6 B;  4L8N A;  4J8Z A;  2UXC I;  2EMI A;  3M99 B;  4JV5 I;  4JI0 I;  2EMZ A;  4JI5 E;  4LF9 E;  2YTG A;  4DR4 E;  2UXD E;  3OML A;  3PRY A;  3LTO A;  4GKJ E;  4B3T I;  3IWB A;  1XXE A;  5K36 E;  1YUI A;  4OX9 E;  4FK5 C;  2M4I A;  2EPA A;  1X6H A;  4MLV A;  5A6K A;  1RHY A;  2PO1 B;  2YWQ A;  4R2D A;  2L92 A;  1Z5A A;  5EL9 A;  2FV4 B;  1HNZ I;  4DV3 I;  2LVH A;  1IBM E;  4O43 A;  1ZU1 A;  3EPK A;  3LML A;  4WSG A;  4LF9 I;  2EOM A;  1Z59 A;  4JI5 I;  4DR4 I;  5KL7 A;  1IQS A;  3K17 A;  4GKJ I;  1MEY C;  4LOM A;  4OX9 I;  2CSH A;  5DNY A;  2G7H A;  2LMZ A;  2V2Z A;  2F8B A;  5EKW A;  2VE7 C;  3T1H E;  1RC7 A;  4WX9 A;  1MU5 A;  4WUD A;  2EL4 A;  4LU9 A;  4LFC E;  2V87 A;  4ZYH A;  1XMO E;  4BHC A;  2MC5 A;  1TF6 A;  2LBS B;  1KKH A;  4LPF A;  4PU9 A;  1IBM I;  2EPK X;  2K7I A;  3THO B;  2PO0 A;  4JI7 E;  4ZYD A;  1FKA E;  2YU8 A;  4P7D A;  2WP8 A;  3K1J A;  1FWK A;  4IFD D;  2MC6 A;  2PNL A;  2EOF A;  2BR2 A;  5JEA E;  4FW3 A;  2J7K A;  2WZO A;  2EMC A;  1FJG E;  2A25 A;  3BBG A;  3LLH A;  1HNW E;  4TUI A;  4I3H A;  2PO2 B;  1PJS A;  4LFC I;  3BID A;  3WU3 A;  2EM8 A;  5AAS A;  1XMO I;  1PDA A;  1Z0T A;  3PYE A;  4FW7 A;  4JI7 I;  3PS2 A;  2YTD A;  4Z7C A;  1WXR A;  3J7A M;  2HGH A;  1L4S A;  3P76 A;  2RS7 A;  2DIX A;  2ZM6 E;  5K36 B;  1STU A;  1KJK A;  4B3S E;  5AE1 A;  1WUU A;  3ZZT A;  1E3H A;  4K0K E;  2N3H A;  1NCS A;  2JY9 A;  2NUG A;  2UUA I;  3J81 C;  3GME A;  2O1W A;  4X65 E;  2PRT A;  2EMK A;  4DR6 E;  1PJQ A;  2L6M A;  4LF8 E;  1OYS A;  2E1R A;  2O1U A;  3GLL A;  3L7Z A;  3PYF A;  4ZVI A;  4NXM E;  4R2P A;  2DLK A;  4OO1 C;  3WU5 A;  1A1J A;  1NHI A;  2KON A;  2K4V A;  4AQY E;  1X5W A;  4AM3 A;  2YTE A;  2ZM6 I;  1I94 I;  1LLM C;  4B3S I;  2O1T A;  4K0K I;  1Z0W A;  2LE2 A;  4LFB E;  4HAC A;  4DV4 E;  2NN6 C;  4X8W A;  2EOJ A;  4X65 I;  5C0X C;  4DR6 I;  3K6Q A;  1HK7 A;  1UHZ A;  2EPX A;  4DR2 E;  1UDN A;  1ZM3 A;  1ZM2 A;  5LL6 R;  1BBO A;  1Y6Z A;  4FW6 A;  4F9B B;  2L3C A;  1ZR9 A;  1TF3 A;  5JEA B;  1T4O A;  4DPY A;  2WBS A;  4LTY A;  4X62 E;  2HK2 A;  2R3V A;  2JPA A;  4DU8 A;  4GZN C;  2BBG A;  4LFB I;  4DV4 I;  2PNM A;  2L3J A;  2JEA A;  2EMX A;  2V83 A;  2M1S A;  2RSM A;  3AV0 A;  2LCE A;  2CT1 A;  2Z5C A;  4DR2 I;  2YTN A;  3HPS A;  2E1M A;  2V86 A;  2YTJ A;  4KQV A;  1H7S A;  4LF4 E;  3B82 A;  4BA1 B;  3DD6 A;  2JXP A;  2EQ1 A;  2NUF A;  1Z0C A;  3HUL A;  1N0U A;  2RQL A;  4OO1 D;  3P1X A;  2YRK A;  1KTV A;  1ZM9 A;  4GQU A;  4X62 I;  3ADG A;  2EOY A;  2EOZ A;  2EPN A;  3RMP A;  2VRD A;  2V8Q B;  4BMJ A;  1A1G A;  4YHH E;  2ZBK B;  1X48 A;  1G2F C;  1H73 A;  2O1V A;  2L8T A;  4YY3 E;  2NUE A;  3GON A;  3EQ1 A;  2EOO A;  1DI2 A;  2NN6 D;  3M85 D;  4DR5 E;  5LMU E;  3ZZ0 A;  4LF4 I;  2I13 A;  1T4N A;  2VF1 A;  1IBL E;  4OO1 B;  3TQM A;  2EML A;  1HNX E;  2BM0 A;  3KWR A;  2C38 B;  3PS1 A;  2EPL X;  1QNT A;  1AH5 A;  4ZYG A;  5A6B A;  1U2R A;  2EN6 A;  4YHH I;  2DRP A;  2E72 A;  4BCA A;  5IXM B;  2F1D A;  1KIJ A;  4YY3 I;  1GQE A;  2EM4 A;  2CVE A;  2ENA A;  4DR5 I;  5C0X B;  5LMU I;  2JOX A;  3C4T A;  3B78 A;  2DEJ A;  3ADL A;  3KZZ A;  1N34 E;  2GS8 A;  3P3G A;  2EOS A;  1H72 C;  2RS6 A;  3VK6 A;  2DGC A;  1HNX I;  2HHH E;  1WRJ A;  1UDS A;  1OYP A;  4USK A;  4M9V C;  2EN1 A;  4IS1 C;  2MKD A;  2EWL A;  3QT7 A;  4DR3 E;  3H09 A;  4F2J C;  1K47 A;  2NPF A;  3IWC A;  2D9H A;  5LMN E;  1USV A;  1H74 A;  4JI8 E;  1NHH A;  5AC4 A;  1N34 I;  1MX0 A;  3QT5 A;  3DF6 A;  4UTG A;  1XMQ E;  1D6T A;  4DPT A;  4IFD C;  2HHH I;  2N3G A;  4HY1 A;  4USM A;  3T1Y E;  2YRH A;  2PO2 A;  4DR3 I;  2V34 A;  2WBT A;  2EM2 A;  4ISA A;  4URL A;  2JE6 B;  4DR1 E;  5LMN I;  1YZ9 A;  2IOQ A;  4JI8 I;  4OO1 F;  1IBK E;  1RRE A;  4FWG A;  2MKN A;  1XMQ I;  4L5N C;  4AID A;  1N0V C;  1EH8 A;  2EMH A;  5K36 A;  2RSI A;  4R2R A;  3PYD A;  4WSP A;  2ELY A;  3EPH A;  1S4E A;  3T1Y I;  2EP3 A;  2UXD I;  2JEB B;  2DEI A;  2NN6 F;  5C0X F;  4F6M A;  1Y60 A;  4AIM A;  4DR1 I;  3Q1Q A;  4BA2 B;  1AAY A;  3UHM A;  3MSW A;  1Y4U A;  1NHJ A;  1IBK I;  1GTK A;  2B7V A;  2V85 A;  4JG4 A;  2DMI A;  4FN5 A;  3CWV A;  4MU3 A;  3LNU A;  2EMG A;  4HTG A;  4JYA E;  1J26 A;  4GEQ B;  1G2D C;  1UBD C;  4IZK B;  3AUZ A;  4R2Q A;  4NXN E;  2O3Z A;  2FGG A;  4B3R E;  4IZJ D;  1DAR A;  2HFU A;  3T1H I;  4R2E A;  4X64 E;  2Z5E A;  2PNZ B;  2YU5 A;  3ZOQ B;  1SR9 A;  2EZ6 A;  1XNQ E;  4KZS A;  4X66 E;  3EPJ A;  1ZM4 A;  3WU4 A;  5JEA A;  4JYA I;  1B62 A;  2C37 B;  2ODR C;  2OI2 A;  1MG7 A;  2LUQ A;  4NXN I;  4IFD B;  2EN7 A;  1MGT A;  4B3R I;  3H4L A;  1RR9 A;  4M30 A;  3CDJ A;  2YTO A;  1FJG I;  2IES A;  2JR1 A;  4IJD A;  4JI4 E;  3QT8 A;  4R1F A;  1T38 A;  4Z7Y A;  1HNW I;  2HFS A;  2RPC A;  1Z0B A;  4FW9 A;  3JAM Q;  4X64 I;  3PS3 A;  1DQ3 A;  2R42 A;  4BA1 A;  3M85 G;  1XNQ I;  1JK2 A;  1YYW A;  4X66 I;  2LJU A;  3JTZ A;  1ZBT A;  2EN3 A;  4JI6 E;  5DNL A;  4WXD A;  2DMY A;  5TSE A;  5DRP A;  1Y4S A;  1ZXM A;  3VHT B;  5FLX C;  5T6J A;  1X6E A;  4ZYE A;  4DPX A;  1P42 A;  2GLI A;  4JI4 I;  4OO1 E;  1E3P A;  2EL5 A;  4B3M E;  4WFT A;  2LT7 A;  2AE8 A;  4MDT A;  1WJP A;  4LF8 I;  2V88 A;  4HXZ A;  4P78 A;  5ADZ A;  3P3E A;  4NXM I;  4JI6 I;  2NN6 E;  1Z5B A;  5C0X E;  1YPN A;  3B4T A;  2EMA A;  2YPN A;  3MHS C;  4LCF A;  1T39 A;  1T4L B;  4AQY I;  4R2A A;  4XTJ A;  2ODR D;  2EM9 A;  3HQ1 A;  1PVG A;  2BV3 A;  4JI2 E;  4B3M I;  5C0X A;  3THN A;  4BC7 A;  2VQF E;  1DGC A;  4DR7 E;  5CFF E;  2EPP A;  4GKK E;  4PRV A;  4IFD F;  4P7A A;  4BS9 A;  4N3O A;  1X6F A;  1J5E E;  2UUB E;  3JU0 A;  4MQY A;  3ZKB A;  3HKM A;  1N33 E;  2CG9 A;  2XEX A;  2CGE A;  4RHB B;  4JI2 I;  5AE3 A;  2LTR A;  4WUC A;  2LRS A;  2VQF I;  5IV8 B;  5A69 A;  2VES A;  4DR7 I;  4GKK I;  1R6M A;  1IQO A;  3MHH C;  4LF7 E;  3C6K A;  1GZ6 A;  4O24 A;  2N8X A;  1NZ0 A;  2ADR A;  1J5E I;  4FW4 A;  2UUB I;  2JWO A;  2EOX A;  5FLX Q;  2WNR B;  1N33 I;  4DUY E;  2V8P A;  3ADJ A;  2UXB E;  1OYR A;  2JE6 A;  4DV1 E;  2EMB A;  1WHN A;  2M9A A;  4DMI A;  2PO1 A;  1YUJ A;  4F9C B;  1PIE A;  3V5R A;  3J7A G;  4WPY A;  2NN6 B;  2EPM X;  4QNK A;  2JEB A;  5ELW A;  2YTQ A;  4DUY I;  1IBL I;  5KL4 A;  5DRO A;  2UXB I;  1Z0V A;  1ELO A;  2GO3 A;  2J65 A;  4KHP E;  5KL6 A;  3ZKD A;  4DV1 I;  4Q35 B;  4BA2 A;  4BC9 A;  1F2I G;  1A6F A;  1IMU A;  4JI1 E;  4RPF A;  4MYU A;  5A2Q Q;  4DV7 E;  2B9D A;  4LFA E;  2EQ3 A;  4F6N A;  4IS9 A;  4IZK A;  1WHQ A;  4N4R B;  1A1F A;  2H36 X;  1B63 A;  1EKZ A;  4M1K A;  2EFG A;  4DUZ E;  2GO4 A;  4KHP I;  3EPL A;  2EOE A;  3VYX A;  4JI1 I;  4WUB A;  4IFD E;  1N36 E;  2PNZ A;  2V2Q A;  2F4V E;  2M7Q A;  3WU6 A;  4DPW A;  4DKK A;  2EPZ A;  2J7J A;  3KZY A;  2C37 A;  3M7N G;  4DV7 I;  1UEK A;  4LFA I;  2VF3 A;  4IFD A;  4JV5 E;  2EM7 A;  4DPU A;  5L3J A;  3JAM C;  1YSA C;  4Q28 A;  4DUZ I;  2EM5 A;  4M0V A;  3V2U C;  2X36 A;  1OJ4 A;  4NBQ A;  4UT4 A;  5GME A;  1EI1 A;  4O4K A;  5A6J A;  1N36 I;  2B7T A;  2MDG A;  5A6B D;  1BBG A;  2BA1 D;  2F4V I;  4BBY A;  4DV6 E;  1A1H A;  2JYA A;  4DV3 E;  1SFE A;  2L2K B;  2AJ4 A;  3KRN A;  4HYM A;  1YHC A;  4J3D A;  1KYQ A;  2KHX A;  1B69 A;  4F9A B;  2VQE E;  5K36 C;  2L2N A;  4FWH A;  1VIS A;  2WBU A;  3ECR A;  3B8H A;  1HR0 E;  2YSP A;  5AC5 A;  3Q6M A;  4EMD A;  4DV6 I;  1N3G A;  3QG5 C;  5FWK A;  4NZV A;  1USU A;  2VQE I;  3OTO E;  2ENH A;  1BKN A;  3NZK A;  4OZE A;  2EN2 A;  4FWD A;  1HR0 I;  2R76 A;  2BA0 D;  2WW4 A;  2CZ9 A;  2C39 B;  5IT9 Q;  3ADI A;  1Y5Y A;  4IZJ B;  4R2S A;  1YYK A;  2HK3 A;  4U3D A;  2X7I A;  1YFH A;  3UK3 C;  3BGH A;  2HC5 A;  2YTF A;  2BB8 A;  1X49 A;  4BHB A;  4LF5 E;  2BM1 A;  2Z5B B;  1PJT A;  5JEA C;  1FNM A;  3OTO I;  3M7N D;  2HKE A;  2EOR A;  1XHK A;  2HKJ A;  5K36 D;  2UU9 E;  1EA6 A;  1EH7 A;  2NA2 A;  1QU6 A;  3DJW A;  5A6A A;  3F6H A;  2DSY A;  5BR8 E;  5IWA E;  2UUA E;  1Z5C A;  3J80 C;  2RTX A;  1X47 A;  2YT4 A;  4LF5 I;  4DV2 E;  3HTX A;  2WNR A;  3P06 A;  1R6L A;  5KL5 A;  4OO1 A;  2C38 A;  2UU9 I;  4MU4 A;  2LTS A;  1I94 E;  4HEI A;  4QNJ A;  2DB2 A;  2LO3 A;  2KOU A;  1X3C A;  2EM0 A;  2GHF A;  4DV0 E;  3HJC A;  2EOH A;  5IWA I;  4OOG C;  1VI7 A;  5BR8 I;  1TN9 A;  2NN6 A;  1FI4 A;  4DV2 I;  2HJJ A;  2YTI A;  2LJH A;  4MLQ A;  2EMY A;  2EOQ A;  3HXL A;  1ZXN A;  2ZIT A;  2WCC 3;  1EH6 A;  1A1I A;  5JEA D;  1UDO A;  2PO0 B; 
#chains in the Genus database with same CATH homology
 4WYQ B;  5A2Q C;  5F3W A;  4DV0 I;  1FWL A;  3VYY A;  2E5L E;  4R8O A;  1ZBQ A;  4DU7 A;  1RQ0 A;  5AE2 A;  1Z0G A;  3ZM7 A;  4TUG A;  1N32 E;  3PYG A;  2B3T B;  3LPS A;  2LJP A;  3J80 Q;  2MDR A;  2JVA A;  2E5L I;  3HPZ A;  1S16 A;  3J7Y p;  5GMD A;  1UIL A;  2L33 A;  4M2Z A;  2CPN A;  4DV5 E;  4LF7 I;  1N32 I;  3IWD A;  2IOP A;  3Q6N A;  2JOB A;  1QZR A;  3J81 Q;  3QT6 A;  2UUC E;  3ZZU A;  4LF6 E;  3C4B A;  1O0W A;  2V89 A;  4ED4 A;  2Q2E B;  1PKP A;  4HAC B;  4DV5 I;  1KVK A;  2A2C A;  2IHR 1;  2UUC I;  4PRX A;  4LF6 I;  3F0N A;  1H7U A;  4JI3 E;  2FTX B;  4DXL A;  3K85 A;  1XNR E;  3D4J A;  2V2V A;  5IT9 C;  2Z5C B;  2UXC E;  2L2M A;  4I8O A;  2A2D A;  2YZT A;  4JI0 E;  4IZJ A;  4MYT A;  3FIG A;  4JI3 I;  3F6G A;  4B3T E;  3M6A A;  1YYO A;  1XNR I;  2Z5B A;  4R03 A;  2LUP B;  4F54 A;  2GQ0 A;  1HNZ E;  4P52 A;  1Z0E A;  4L8N A;  4J8Z A;  2UXC I;  4JV5 I;  4JI0 I;  4LF9 E;  4JI5 E;  4DR4 E;  2UXD E;  3OML A;  3PRY A;  3LTO A;  4GKJ E;  4B3T I;  3IWB A;  4OX9 E;  2M4I A;  2L92 A;  1Z5A A;  1HNZ I;  2FV4 B;  4DV3 I;  1IBM E;  3LML A;  4LF9 I;  1Z59 A;  4JI5 I;  4DR4 I;  3K17 A;  4GKJ I;  4OX9 I;  5DNY A;  2G7H A;  2LMZ A;  2V2Z A;  2F8B A;  2VE7 C;  3T1H E;  1RC7 A;  1MU5 A;  4WUD A;  4LFC E;  4LU9 A;  2V87 A;  1XMO E;  2MC5 A;  1KKH A;  2LBS B;  4PU9 A;  1IBM I;  4JI7 E;  1FKA E;  4P7D A;  3K1J A;  1FWK A;  2MC6 A;  2PNL A;  2J7K A;  2WZO A;  1FJG E;  3LLH A;  1HNW E;  4TUI A;  4I3H A;  4LFC I;  3WU3 A;  5AAS A;  1XMO I;  1Z0T A;  3PYE A;  4JI7 I;  4Z7C A;  1WXR A;  3J7A M;  2RS7 A;  2DIX A;  2ZM6 E;  1STU A;  4B3S E;  5AE1 A;  1WUU A;  3ZZT A;  4K0K E;  2N3H A;  2JY9 A;  2NUG A;  2UUA I;  3J81 C;  2O1W A;  4X65 E;  4DR6 E;  2E1R A;  2O1U A;  2L6M A;  4LF8 E;  3PYF A;  4ZVI A;  4NXM E;  3WU5 A;  1NHI A;  2KON A;  2K4V A;  4AQY E;  2ZM6 I;  1I94 I;  4B3S I;  2O1T A;  4K0K I;  1Z0W A;  2LE2 A;  4LFB E;  4HAC A;  4DV4 E;  4X65 I;  4X8W A;  4DR6 I;  3K6Q A;  1HK7 A;  1UHZ A;  4DR2 E;  1ZM3 A;  1ZM2 A;  5LL6 R;  1Y6Z A;  4F9B B;  2L3C A;  1T4O A;  4DPY A;  2HK2 A;  4LTY A;  4X62 E;  2R3V A;  4DU8 A;  4LFB I;  4DV4 I;  2PNM A;  2L3J A;  2V83 A;  2M1S A;  2RSM A;  3AV0 A;  2Z5C A;  4DR2 I;  3HPS A;  2E1M A;  2V86 A;  4KQV A;  1H7S A;  4LF4 E;  3B82 A;  2NUF A;  1Z0C A;  3HUL A;  1N0U A;  3P1X A;  1ZM9 A;  1KTV A;  4X62 I;  3ADG A;  3RMP A;  2V8Q B;  4BMJ A;  4YHH E;  2ZBK B;  1X48 A;  1H73 A;  2O1V A;  2L8T A;  4YY3 E;  2NUE A;  3GON A;  1DI2 A;  4DR5 E;  5LMU E;  3ZZ0 A;  4LF4 I;  1T4N A;  2VF1 A;  1IBL E;  1HNX E;  2BM0 A;  3KWR A;  1U2R A;  4YHH I;  4BCA A;  1KIJ A;  4YY3 I;  1GQE A;  4DR5 I;  5LMU I;  2JOX A;  3C4T A;  3B78 A;  2DEJ A;  3ADL A;  1N34 E;  2GS8 A;  1H72 C;  2RS6 A;  3VK6 A;  1HNX I;  2HHH E;  4USK A;  2EWL A;  3QT7 A;  4DR3 E;  3H09 A;  1K47 A;  2NPF A;  3IWC A;  1USV A;  5LMN E;  1H74 A;  4JI8 E;  1NHH A;  1N34 I;  1MX0 A;  3QT5 A;  3DF6 A;  4UTG A;  1XMQ E;  1D6T A;  4DPT A;  2HHH I;  2N3G A;  4HY1 A;  4USM A;  3T1Y E;  4DR3 I;  2V34 A;  4URL A;  4DR1 E;  5LMN I;  1YZ9 A;  2IOQ A;  4JI8 I;  1IBK E;  1RRE A;  4FWG A;  1XMQ I;  4L5N C;  1N0V C;  3PYD A;  4WSP A;  3T1Y I;  1S4E A;  2UXD I;  2DEI A;  4DR1 I;  3Q1Q A;  3MSW A;  1Y4U A;  1NHJ A;  1IBK I;  2B7V A;  2V85 A;  4JG4 A;  4FN5 A;  3CWV A;  3LNU A;  4JYA E;  1J26 A;  4GEQ B;  4IZK B;  3AUZ A;  4NXN E;  2FGG A;  4B3R E;  4IZJ D;  1DAR A;  2HFU A;  3T1H I;  4X64 E;  2Z5E A;  3ZOQ B;  1SR9 A;  2EZ6 A;  1XNQ E;  4KZS A;  4X66 E;  3WU4 A;  1ZM4 A;  4JYA I;  1B62 A;  2ODR C;  2OI2 A;  1MG7 A;  2LUQ A;  4NXN I;  4B3R I;  3H4L A;  1RR9 A;  4M30 A;  1FJG I;  2JR1 A;  4JI4 E;  3QT8 A;  4R1F A;  1HNW I;  4Z7Y A;  2HFS A;  1Z0B A;  4FW9 A;  3JAM Q;  4X64 I;  1DQ3 A;  2R42 A;  1XNQ I;  1YYW A;  4X66 I;  3JTZ A;  1ZBT A;  4JI6 E;  2DMY A;  1Y4S A;  1ZXM A;  5FLX C;  5T6J A;  4DPX A;  4JI4 I;  4B3M E;  4WFT A;  4LF8 I;  2V88 A;  4HXZ A;  4P78 A;  5ADZ A;  4NXM I;  4JI6 I;  1Z5B A;  1T4L B;  4AQY I;  4XTJ A;  2ODR D;  3HQ1 A;  1PVG A;  2BV3 A;  4JI2 E;  4B3M I;  4BC7 A;  2VQF E;  4DR7 E;  5CFF E;  4PRV A;  4GKK E;  4P7A A;  4BS9 A;  4N3O A;  1J5E E;  2UUB E;  3ZKB A;  3JU0 A;  1N33 E;  2CG9 A;  2XEX A;  2CGE A;  4JI2 I;  5AE3 A;  2LTR A;  4WUC A;  2LRS A;  2VQF I;  4DR7 I;  4GKK I;  4LF7 E;  1GZ6 A;  1NZ0 A;  1J5E I;  2UUB I;  2JWO A;  5FLX Q;  1N33 I;  4DUY E;  2V8P A;  3ADJ A;  2UXB E;  4DV1 E;  1WHN A;  4DMI A;  4F9C B;  1PIE A;  3V5R A;  3J7A G;  4WPY A;  4DUY I;  1IBL I;  2UXB I;  1Z0V A;  1ELO A;  4KHP E;  3ZKD A;  4DV1 I;  4BC9 A;  1A6F A;  4JI1 E;  4RPF A;  4MYU A;  5A2Q Q;  4DV7 E;  2B9D A;  4LFA E;  4IZK A;  1WHQ A;  4M1K A;  2H36 X;  1B63 A;  1EKZ A;  2EFG A;  4DUZ E;  4KHP I;  3VYX A;  4JI1 I;  4WUB A;  1N36 E;  2V2Q A;  3WU6 A;  2F4V E;  2M7Q A;  4DPW A;  4DKK A;  4DV7 I;  1UEK A;  4LFA I;  2VF3 A;  4JV5 E;  4DPU A;  5L3J A;  3JAM C;  4DUZ I;  4Q28 A;  4M0V A;  3V2U C;  2X36 A;  1OJ4 A;  4UT4 A;  5GME A;  1EI1 A;  1N36 I;  2B7T A;  2F4V I;  4BBY A;  4DV6 E;  2AJ4 A;  4DV3 E;  4HYM A;  2L2K B;  2KHX A;  4F9A B;  2VQE E;  2L2N A;  4FWH A;  1VIS A;  3B8H A;  1HR0 E;  3Q6M A;  4EMD A;  4DV6 I;  5FWK A;  1USU A;  2VQE I;  3OTO E;  1BKN A;  4FWD A;  1HR0 I;  2WW4 A;  2CZ9 A;  5IT9 Q;  3ADI A;  4IZJ B;  1YYK A;  2HK3 A;  2X7I A;  4LF5 E;  2Z5B B;  2BM1 A;  1X49 A;  3OTO I;  1FNM A;  2HKE A;  1XHK A;  2HKJ A;  2UU9 E;  1EA6 A;  2NA2 A;  1QU6 A;  2UUA E;  3DJW A;  3F6H A;  2DSY A;  5BR8 E;  5IWA E;  1Z5C A;  3J80 C;  2RTX A;  1X47 A;  2YT4 A;  4LF5 I;  4DV2 E;  3HTX A;  3P06 A;  2UU9 I;  2LTS A;  1I94 E;  2DB2 A;  2KOU A;  5IWA I;  4DV0 E;  3HJC A;  5BR8 I;  4OOG C;  1FI4 A;  4DV2 I;  2LJH A;  3HXL A;  1ZXN A;  2ZIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...