2E5LE

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 30
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2e5lE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2e5lE02
2X36A 2UXCI 4JI0I 1H7SA 2LJPA 2J7KA 1GQEA 3J7AG 1KVKA 3P1XA 1Z0BA 3K1JA 4LF5I 2A2DA 4X62I 4JI6I 1U2RA 4HYMA 4WUBA 2WW4A 2NUGA 2UUCI 1FI4A 2E1RA 2IHR1 4HY1A 4HACA 1N0VC 2DB2A 4URLA 4WYQB 2V2ZA 4DV2E 4DV6I 2UXBE 1Z5CA 2XEXA 4X66E 4JV5I 4X65I 1HNWI 4DR3I 4UTGA 4DXLA 4JG4A 1WHQA 4LFCI 1N36E 2DMYA 1ZBTA 4OX9I 4LF9I 4OX9E 4LFAI 1ZXNA 2RS6A 1B63A 2LJHA 1HNXE 3ADLA 1H73A 1EKZA 3ZKDA 4EMDA 1DI2A 1UHZA 2NA2A 3QT5A 4HACB 2UXBI 4JI8E 4DKKA 2AJ4A 1QZRA 2LUQA 4Z7YA 2F4VI 4XTJA 1HNWE 1HNZE 4WFTA 1XNQE 1KTVA 5IWAI 1MU5A 4UT4A 1S16A 4JI3I 1N36I 2CZ9A 5LMUE 4FW9A 1FKAE 3J80Q 1FWLA 4DV5E 3ZM7A 1N33I 2RS7A 3JAMQ 2ZM6I 1HR0E 4YY3I 2L2MA 3QT8A 1N32E 1DARA 1N34I 5GMEA 2VQEE 1XNRI 1FNMA 3OTOE 2L2NA 1RC7A 3C4TA 4DV3E 2V2VA 4DR2I 1NHHA 1VISA 3B78A 4JI1I 4P7AA 1PIEA 2ZITA 4B3RI 2HKJA 1H7UA 1J5EI 1N0UA 1WUUA 1T4OA 1ZM2A 4DR5E 4DR6E 4JYAE 4X64E 2UUBE 4LFBI 3T1HE 2JY9A 2UUAI 2KHXA 4FWHA 4NXNI 4OOGC 3J7AM 4YHHI 2UXCE 5A2QQ 4LF8I 2X7IA 2BM1A 4DUZE 4LF4I 2BV3A 5A2QC 4GKJI 1OJ4A 4DR4E 1XMOE 5GMDA 4RPFA 3C4BA 4X64I 4DR7E 4JI2I 1NZ0A 1Z0VA 3PYEA 2CPNA 1XHKA 4LFAE 2ZBKB 3H4LA 2L3CA 4M1KA 4B3ME 4LF8E 1A6FA 4JI5I 4K0KI 4JI4I 4DV4E 1XNRE 4MYUA 4DU8A 1XMOI 1PKPA 3PYFA 1B62A 1Z0TA 4GKKE 2F4VE 1WHNA 2VQFE 1ELOA 2LRSA 5IT9C 4DV0I 3HTXA 1N33E 4B3MI 2HHHE 3GONA 1IBMI 3ZZTA 4DV1I 1N34E 3J81Q 2UU9E 4JI8I 2R3VA 3T1HI 4B3SE 4ZVIA 2JVAA 1IBLE 3QT7A 4JI4E 3V5RA 1RREA 2VQFI 3WU3A 1Z5BA 1D6TA 1MX0A 3ADIA 4DR2E 4JI7I 1Z0EA 1H74A 3PYDA 4GKJE 4LF9E 1ZM9A 2DEIA 4ED4A 5BR8E 2GS8A 4JI6E 5BR8I 4DV0E 4DPUA 1I94E 3VYYA 2UUAE 4KHPI 4MYTA 2LUPB 1H72C 1X47A 5LMNI 1O0WA 2L2KB 2VQEI 4AQYI 4WUCA 1BKNA 4WUDA 1NHIA 1UEKA 2Q2EB 4B3SI 4JI7E 4DR4I 4DPTA 4B3RE 4P52A 1RR9A 1KIJA 1KKHA 1IBKI 2DIXA 4LF6E 1HNXI 4JI3E 2OI2A 3LTOA 4I3HA 5FLXC 5LL6R 2DEJA 1ZXMA 4LF7I 1IBME 2HK3A 4R1FA 1UILA 3OTOI 3ADJA 2RSMA 5LMNE 4NXMI 2E5LE 1STUA 4DR5I 1ZM3A 4DR6I 1IBLI 4KHPE 3QT6A 4USMA 1J26A 1FJGE 5IWAE 2BM0A 1IBKE 2A2CA 2HFUA 3J80C 2V34A 4NXNE 1YZ9A 4X66I 2L3JA 2V2QA 3T1YE 4LF5E 2ZM6E 3Q1QA 1T4NA 1K47A 2HHHI 1X48A 1Z5AA 4DPYA 1I94I 3WU6A 1Z59A 2B7TA 4KQVA 2E5LI 4DU7A 2UXDE 2HKEA 4JI0E 4DR1E 4HXZA 1EA6A 2UXDI 4PRXA 1EI1A 3T1YI 3V2UC 4DV3I 4DV6E 4DV2I 3B8HA 4DV7I 4DV7E 4DR3E 1YYOA 1N32I 2LTRA 1YYWA 4DPXA 4Z7CA 4JYAI 1NHJA 3ZZ0A 2VF3A 2EZ6A 4M30A 3WU4A 4FWGA 4JI1E 4GKKI 2YT4A 5CFFE 2HK2A 5LMUI 3K17A 2UUCE 2R42A 2NUEA 3D4JA 3ADGA 4LFBE 2UUBI 3F0NA 4B3TE 4DUYI 4DR7I 3PYGA 3VYXA 3LPSA 3JAMC 4M2ZA 3LNUA 2EFGA 2LTSA 3M6AA 4USKA 1HR0I 4DV1E 3J7Yp 1HNZI 3WU5A 4NXME 1XMQI 3B82A 1XMQE 4DPWA 2B7VA 1MG7A 4X8WA 5L3JA 1Z0CA 2NPFA 3CWVA 2L33A 1XNQI 1Z0GA 4LF6I 4PRVA 4FWDA 5IT9Q 4FN5A 4JI2E 1FWKA 1T4LB 4DUYE 4B3TI 4DV5I 2NUFA 4LF7E 1QU6A 2HFSA 1S4EA 1RQ0A 3J81C 2MDRA 1ZM4A 4JI5E 4K0KE 2LBSB 2N3GA 1X49A 1FJGI 4JV5E 1YYKA 4PU9A 2UU9I 3ZKBA 4LF4E 4DUZI 4DV4I 4DR1I 1PVGA 3HULA 3LLHA 4YHHE 2V8PA 4X62E 2N3HA 4X65E 5FLXQ 1Z0WA 3ZZUA 4YY3E 1J5EE 4LFCE 2RTXA 2B3TB 4AQYE
chains in the Genus database with same CATH superfamily
5KL3A 4O24A 2X36A 5K36A 4FW4A 2EPRA 4JI0I 1H7SA 2LJPA 2UXCI 2J7KA 1GQEA 1GTKA 1SFEA 2ODRC 2RQLA 2VE7C 3J7AG 1KVKA 2PO1A 3P1XA 1Z0BA 4OZEA 3K1JA 4LF5I 4ZYEA 5IXMB 5DNYA 3F6HA 1DQ3A 2V86A 3TQMA 1IQSA 2A2DA 1B69A 5FWKA 4X62I 1X3CA 4JI6I 1U2RA 2V85A 3AV0A 2JYAA 3HPSA 4HYMA 2PNMA 2EM3A 4WUBA 1HK7A 2WW4A 2NUGA 2EOOA 1UN6B 2UUCI 2YRMA 1FI4A 2E1RA 3JTZA 1Y4UA 4N4RB 5C0XC 1YUIA 5JEAE 1YSAC 2IHR1 4LTYA 2EORA 4BA2A 3UHMA 4P7DA 3CDJA 4HY1A 2LO3A 4HACA 1N0VC 3K85A 2DB2A 1X6HA 4URLA 4WYQB 2V2ZA 2WCC3 4MU3A 2EMAA 4DV2E 4DV6I 2UXBE 1Z5CA 2LCEA 2VESA 4F2JC 2EJ4A 1G2FC 2XEXA 4X66E 4JV5I 2LJUA 4OO1D 4X65I 1HNWI 2CG9A 4DR3I 4UTGA 1OYRA 2JP9A 4DXLA 4GQUA 4JG4A 1WHQA 4LFCI 2EL5A 1N36E 2DMYA 1ZBTA 4OX9I 2E72A 2EOJA 4LF9I 3EQ1A 1USUA 2PO2B 3QG5C 4OX9E 4LFAI 2PNZA 1ZXNA 2RS6A 5A69A 2LJHA 1HNXE 3ADLA 1B63A 1H73A 3P06A 4IFDB 1EKZA 3ZKDA 4EMDA 4R03A 1MGTA 2NN6C 2EM9A 1DI2A 2GO3A 1UHZA 2NA2A 3QT5A 4HACB 1ZR9A 3JU0A 1PDAA 4R2AA 2UXBI 2BR2A 5AC4A 4JI8E 4DKKA 2YTFA 2EMLA 2HJJA 5A6BA 2BA1D 1YFHA 5C0XA 2AJ4A 1QZRA 1R6MA 2EQ1A 2LUQA 4Z7YA 2YSPA 2N8XA 2F4VI 4XTJA 1HNWE 2VRDA 1HNZE 4WFTA 3NZKA 1XNQE 1KTVA 5IWAI 1MU5A 2Z5CA 4IZJD 3VHTB 4R2PA 1WJPA 4UT4A 4IFDD 2DLQA 2VF1A 1A1HA 2NN6D 3DD6A 1S16A 2L92A 1EH7A 2DRPA 1N36I 2CZ9A 4QNJA 5LMUE 4FW9A 4JI3I 1X6EA 1FKAE 3J80Q 1FWLA 4DV5E 3ZM7A 1N33I 2RS7A 4R2QA 2KOUA 3JAMQ 1N3GA 2ZM6I 1HR0E 4YY3I 2L2MA 3QT8A 2E1MA 1Y6ZA 1N32E 1P47A 1DARA 2EPZA 1N34I 5GMEA 2FGGA 2PO0B 2VQEE 4OO1B 1XNRI 2WNRB 3C6MA 1FNMA 2C37B 3K6QA 3OTOE 1USVA 4BA2B 2L2NA 1RC7A 2JEAB 2F1DA 4WXCA 3C4TA 2Q8UA 1OYSA 4DV3E 4Q28A 2V2VA 3BIDA 1UDOA 4DR2I 2EN4A 4MDTA 2EMFA 2LT7A 5C0XF 4GEQB 1NHHA 1VISA 2K7IA 3CDIA 2EPXA 3B78A 4JI1I 1A1IA 4P7AA 4WPYA 2YTGA 2JWOA 1PIEA 2ZITA 2HKJA 4B3RI 1H7UA 1P42A 1J5EI 4IS9A 4BHCA 1N0UA 1WUUA 1T4OA 5KL2A 3HJCA 4IZJA 2L6MA 1ZM2A 2V89A 1EH6A 3C6KA 4RH8A 5KL7A 1E3PA 4DR5E 4DR6E 5DROA 2M1SA 4JYAE 5IV8B 4X64E 2EN1A 2UUBE 3M99B 4AM3A 4LFBI 2YTOA 4O4KA 4IZKB 1A1LA 2LMZA 5A6AA 3T1HE 4OO1A 2JY9A 2UUAI 2KHXA 4LCGA 2Z5BB 4FWHA 1G2DC 1A1GA 2J7JA 2Z5EA 5T6JA 1IMUA 2YWQA 4NXNI 4NHRA 4OOGC 1QNTA 1A1KA 4YHHI 3J7AM 1OYPA 3AUZA 2UXCE 2GQ0A 5A2QQ 4LF8I 1PJTA 2X7IA 2EMKA 2BM1A 4DUZE 3U1KA 5A2QC 2BV3A 4LF4I 4GKJI 1OJ4A 4DR4E 1XMOE 3BGHA 3KRNA 5GMDA 2EP3A 4FK5C 4RPFA 3C4BA 1UDSA 1R6LA 1NEIA 4DR7E 2JE6B 4X64I 4JI2I 1WXRA 1NZ0A 5JEAB 1Z0VA 3PYEA 5AE3A 4IFDC 2G7HA 4KWYA 2CPNA 3EPLA 1XHKA 5K36B 3THOB 4LFAE 4FW5A 2ZBKB 1TN9A 3H4LA 4IZKA 3B4TA 2ELZA 2L3CA 4M1KA 4F9AB 4OO1E 4B3ME 4LF8E 1A6FA 2IOPA 4JI5I 4K0KI 4JI4I 2PO0A 2GPIA 4DV4E 3ECRA 1XNRE 2LE2A 2WZOA 4ZYHA 2WBTA 1YUJA 4MYUA 4DU8A 2EPNA 3PS2A 2YTEA 1XMOI 1T39A 1PKPA 2D9HA 3PYFA 1B62A 2ENCA 1Z0TA 1YPNA 2DLKA 5AE2A 2EPKX 4GKKE 2F4VE 2Z5CB 1EH8A 1WHNA 2VQFE 1ELOA 2YTPA 2DSYA 2C38B 2EMWA 2EN7A 3PS1A 1MEYC 2EE8A 4M0VA 1NCSA 4M9VC 2LRSA 5IT9C 2IERA 2NABA 3L7ZA 4ZYDA 3HTXA 4DV0I 1ZU1A 1N33E 4B3MI 2HHHE 2M7QA 4BHBA 3GONA 1IBMI 1ZBQA 2WBUA 4BC7A 2BB8A 3ZZTA 1KJKA 4DV1I 1N34E 5KL4A 2UU9E 2JEBA 4JI8I 2MC5A 2PRTA 2R3VA 4BA1B 3J81Q 3T1HI 4B3SE 3HKMA 4ZVIA 2JVAA 2EM7A 1IBLE 3QT7A 4JI4E 2EOIA 3V5RA 1RREA 2O1VA 2I9IA 2VQFI 2PO2A 3WU3A 1JK1A 1Z5BA 1D6TA 1MX0A 3ADIA 3P3GA 1T38A 4DR2E 4RHBB 4TUGA 4JI7I 5DRQA 1Z0EA 4DMIA 1H74A 5TSEA 4GKJE 4LF9E 3HPZA 3EPKA 3PYDA 5ADZA 1ZM9A 2DEIA 3ZOQB 2K4VA 4O43A 2V87A 1F2IG 4ED4A 5BR8E 2GS8A 5EL9A 4JI6E 3PRYA 2EQ0A 5BR8I 4DV0E 3BBGA 1AH5A 4DPUA 3MHHC 2EL4A 3VYYA 1I94E 1X6FA 2WNRA 2UUAE 2EOYA 4KHPI 4LU9A 4MYTA 2LUPB 1H72C 1X47A 3KZZA 2F8BA 4HEIA 5LMNI 1O0WA 2L2KB 4MU0A 2EN6A 5AC5A 5F3WA 2VQEI 3L7ZB 2YTIA 4WUCA 4AQYI 1BKNA 2EPUA 1NHIA 1UEKA 2Q2EB 3PS3A 4JI7E 4WUDA 4B3SI 2C39A 3F6GA 4DR4I 2C38A 2JR1A 4DPTA 4MLQA 1LLMC 1WRJA 4B3RE 2BA0G 4P52A 2EMYA 2EWLA 1RR9A 1UDQA 3GLLA 1KIJA 1KKHA 1IBKI 2EN3A 3U1YA 2DIXA 4LF6E 2CSHA 1HNXI 4LOMA 4JI3E 4N3OA 2OI2A 3LTOA 5JEAD 1KYQA 5FLXC 4I3HA 2EPMX 5LL6R 4R2CA 4R2DA 2L8TA 2DEJA 5KL6A 1ZXMA 2PO1B 4LF7I 2A25A 2CT1A 1IBME 2HK3A 1JK2A 4R1FA 1UILA 3KWRA 3OTOI 3ADJA 2RSMA 5LMNE 2MDGA 2BR2B 2Z5BA 4NXMI 5K36F 4OO1C 2EPLX 5LLQA 3HXLA 5A6KA 1STUA 2E5LE 1ZM3A 2O1WA 4DR5I 1IBLI 5DNXA 4DR6I 4KHPE 4OO1F 3QT6A 1BB8A 4LCHA 2BBGA 1X5WA 1L4SA 4USMA 2HGHA 1J26A 1FJGE 5JEAA 5IWAE 4F6NA 2BM0A 2JOBA 2CVEA 4MU4A 3EPJA 4ZYGA 1IBKE 2A2CA 3VK6A 3J80C 2HFUA 2V34A 4NXNE 4I8OA 2RSIA 1YZ9A 2AE8A 2IOQA 4J3DA 4MU1A 1Y5YA 5ELWA 4X66I 2L3JA 2V2QA 3T1YE 2EOEA 1Y4SA 4LF5E 4TUIA 2O1TA 2ZM6E 2YU5A 2EN8A 3Q6NA 3P3EA 4LPFA 1VI7A 3Q1QA 1T4NA 4BA1A 1K47A 2HHHI 1ZAAC 3DF6A 2KONA 4P78A 5DRRA 5C0XB 4F9BB 2EPCA 2YTNA 4IFDF 1X48A 1SR9A 2YSOA 1Z5AA 4DPYA 4IFDE 4WSPA 1I94I 3MSWA 3WU6A 2H36X 2EQ3A 1Z59A 2B7TA 4KQVA 2E5LI 4DU7A 2UXDE 3FIGA 2HKEA 4JI0E 4DR1E 4HXZA 1EA6A 2RPCA 3RMPA 2PNZB 4PRXA 2EM6A 2EN2A 2UXDI 2EPPA 1EI1A 4FW6A 3T1YI 2EMBA 5A6JA 2JE6A 3V2UC 2YU8A 4DV3I 2WBSA 1IQOA 4DV6E 4DV2I 4R2RA 4U3DA 3B8HA 2EM5A 2EMZA 1RMDA 4DV7I 3EPHA 2JT2A 2C39B 4DV7E 2V88A 4DR3E 4BBYA 3BF2A 3KZYA 5A6BD 5C0XD 5C0XE 5DNLA 2EOHA 2YPNA 2CGEA 5JEAC 2BA1G 1YYOA 2EPAA 1N32I 2LTRA 1YH8A 1YYWA 1Z1BA 1XXEA 4DPXA 4Z7CA 2JEAA 2GO4A 2GLIA 4FW3A 2NN6B 4HTGA 2DGCA 5K36E 2EOSA 2IESA 4JYAI 4ISAA 3MHSC 2MKDA 1NHJA 2MKNA 2NN6A 3ZZ0A 3H1CA 4IFDA 2VF3A 4X9JA 3M85G 2EZ6A 2FV4B 4L8NA 4M30A 3WU4A 4FWGA 4MQYA 2JXPA 2EOMA 4JI1E 3LMLA 1E3HA 4GKKI 2YT4A 2EM4A 5CFFE 2BA0D 2EMXA 2HK2A 3DJWA 5EKWA 5LMUI 2CTDA 4F6MA 1BBOA 3L00A 3K17A 2ADRA 2UUCE 2R42A 2NUEA 4OKGA 1UBDC 4AIMA 2O3ZA 3D4JA 1TF3A 3M85D 3ADGA 1A1FA 2PNLA 4LFBE 2UUBI 3F0NA 4B3TE 4DUYI 4DR7I 3PYGA 4IS1C 2J65A 3VYXA 2NN6F 3LPSA 2MC6A 2EOQA 4U3BA 2EPOA 3IWCA 4FW7A 3JAMC 2EOFA 4M2ZA 2EFGA 2LTSA 3LNUA 4WX9A 3M6AA 4NBQA 4USKA 2EOZA 4J8ZA 1HR0I 2EM8A 4DV1E 1RHYA 1Y60A 3J7Yp 2YTQA 4BC9A 1HNZI 1GZ6A 2YZTA 3WU5A 4NXME 1XMQI 2R76A 2JOXA 4IZJB 3B82A 4WXDA 1XMQE 2LVHA 3IWBA 4R2EA 4DPWA 4GZNC 2DMIA 2B7VA 2YTJA 1MG7A 4X8WA 5L3JA 1Z0CA 5KL5A 3CWVA 3P76A 2NPFA 2L33A 1XNQI 2YRHA 2O1UA 1Z0GA 3GCMA 2EMIA 4PRVA 4FWDA 4LF6I 4FN5A 3M7ND 5IT9Q 4KZSA 4JI2E 1FWKA 1T4LB 2I13A 2M4IA 4DUYE 4DV5I 4B3TI 2EOXA 2M9AA 3OMLA 1PJSA 2NUFA 4LF7E 1QU6A 4Q35B 2HFSA 1S4EA 2C37A 1UDNA 1RQ0A 3GMEA 1TF6A 1PJQA 2ENAA 3J81C 5DRPA 2MDRA 2NN6E 1ZM4A 3IWDA 4JI5E 4K0KE 1YHCA 2ODRD 2YRKA 2LBSB 2JPAA 2B9DA 2N3GA 3UK3C 1X49A 4BS9A 1AAYA 2R1FA 4MLVA 3Q6MA 1FJGI 4JV5E 1YYKA 5JEAF 4PU9A 5AE1A 4R8OA 2EL6A 4LCFA 2UU9I 3ZKBA 3HQ1A 2EMGA 4LF4E 4F54A 4DUZI 2EM2A 2GHFA 4DV4I 4DR1I 1A1JA 2WP8A 1PVGA 3HULA 3LLHA 2ENHA 4YHHE 2V8PA 5K36D 2YTDA 4BCAA 4X62E 2N3HA 4X65E 5FLXQ 4QNKA 4WSGA 1Z0WA 4L5NC 2WP8B 4O5GA 2EMCA 3ZZUA 4F9CB 3M7NG 4YY3E 2EMHA 2LV2A 1J5EE 2V8QB 3THNA 4AIDA 4LFCE 2V83A 1DGCA 2RTXA 2JEBB 2FTXB 2HC5A 5K36C 2B3TB 4BMJA 4IJDA 1BBGA 3P3CA 4NZVA 5AASA 4AQYE 2EM0A 2ELYA 3H09A 4R2SA
chains in the Genus database with same CATH topology
2X36A 2UXCI 4JI0I 1H7SA 2LJPA 2J7KA 1GQEA 3J7AG 2ODRC 2VE7C 1KVKA 3P1XA 1Z0BA 3K1JA 4LF5I 5DNYA 3F6HA 1DQ3A 2V86A 2A2DA 5FWKA 4X62I 4JI6I 1U2RA 2V85A 3AV0A 3HPSA 4HYMA 2PNMA 4WUBA 1HK7A 2WW4A 2NUGA 2UUCI 1FI4A 2E1RA 3JTZA 1Y4UA 2IHR1 4LTYA 4P7DA 4HY1A 4HACA 1N0VC 3K85A 2DB2A 4URLA 4WYQB 2V2ZA 4DV2E 4DV6I 2UXBE 1Z5CA 2XEXA 4X66E 4JV5I 4X65I 1HNWI 2CG9A 4DR3I 4UTGA 4DXLA 4JG4A 1WHQA 4LFCI 1N36E 2DMYA 1ZBTA 4OX9I 4LF9I 1USUA 4OX9E 4LFAI 1ZXNA 2RS6A 1B63A 2LJHA 1HNXE 3ADLA 1H73A 3P06A 1EKZA 3ZKDA 4EMDA 4R03A 1DI2A 1UHZA 2NA2A 3QT5A 4HACB 3JU0A 2UXBI 4JI8E 4DKKA 2AJ4A 1QZRA 2LUQA 4Z7YA 2F4VI 4XTJA 1HNWE 1HNZE 4WFTA 1XNQE 1KTVA 5IWAI 1MU5A 2Z5CA 4IZJD 4UT4A 2VF1A 1S16A 2L92A 4JI3I 1N36I 2CZ9A 5LMUE 4FW9A 1FKAE 3J80Q 1FWLA 4DV5E 3ZM7A 1N33I 2RS7A 2KOUA 3JAMQ 2ZM6I 1HR0E 4YY3I 2L2MA 3QT8A 2E1MA 1Y6ZA 1N32E 1DARA 1N34I 5GMEA 2FGGA 2VQEE 1XNRI 1FNMA 3K6QA 3OTOE 1USVA 2L2NA 1RC7A 3C4TA 4DV3E 4Q28A 2V2VA 4DR2I 4GEQB 1NHHA 1VISA 3B78A 4JI1I 4P7AA 4WPYA 1PIEA 2JWOA 2ZITA 4B3RI 2HKJA 1H7UA 1J5EI 1N0UA 1WUUA 1T4OA 3HJCA 4IZJA 2L6MA 1ZM2A 2V89A 4DR5E 4DR6E 2M1SA 4JYAE 4X64E 2UUBE 4LFBI 4IZKB 2LMZA 3T1HE 2JY9A 2UUAI 2KHXA 2Z5BB 4FWHA 2Z5EA 5T6JA 4NXNI 4OOGC 3J7AM 4YHHI 2GQ0A 3AUZA 2UXCE 5A2QQ 4LF8I 2X7IA 2BM1A 4DUZE 4LF4I 5A2QC 2BV3A 4GKJI 1OJ4A 4DR4E 1XMOE 5GMDA 4RPFA 3C4BA 4X64I 4DR7E 4JI2I 1WXRA 1NZ0A 1Z0VA 3PYEA 5AE3A 2G7HA 2CPNA 1XHKA 4LFAE 2ZBKB 3H4LA 4IZKA 2L3CA 4M1KA 4F9AB 4B3ME 4LF8E 1A6FA 2IOPA 4JI5I 4K0KI 4JI4I 4DV4E 1XNRE 4MYUA 4DU8A 2LE2A 2WZOA 1XMOI 1PKPA 3PYFA 1B62A 1Z0TA 5AE2A 4GKKE 2Z5CB 2F4VE 1WHNA 2VQFE 1ELOA 2DSYA 4M0VA 2LRSA 5IT9C 4DV0I 3HTXA 1N33E 4B3MI 2HHHE 2M7QA 3GONA 1IBMI 1ZBQA 4BC7A 3ZZTA 4DV1I 1N34E 3J81Q 2UU9E 4JI8I 2MC5A 2R3VA 3T1HI 4B3SE 4ZVIA 2JVAA 1IBLE 3QT7A 4JI4E 3V5RA 1RREA 2O1VA 2VQFI 3WU3A 1Z5BA 1D6TA 1MX0A 3ADIA 4DR2E 4TUGA 4JI7I 1Z0EA 4DMIA 1H74A 3PYDA 4GKJE 4LF9E 3HPZA 5ADZA 1ZM9A 2DEIA 3ZOQB 2K4VA 2V87A 4ED4A 5BR8E 2GS8A 4JI6E 3PRYA 5BR8I 4DV0E 4DPUA 1I94E 3VYYA 2UUAE 4KHPI 4LU9A 4MYTA 2LUPB 1H72C 1X47A 2F8BA 5LMNI 1O0WA 2L2KB 5F3WA 2VQEI 4AQYI 4WUCA 1BKNA 4WUDA 1NHIA 1UEKA 2Q2EB 4B3SI 4JI7E 3F6GA 4DR4I 2JR1A 4DPTA 4B3RE 4P52A 2EWLA 1RR9A 1KIJA 1KKHA 1IBKI 2DIXA 4LF6E 1HNXI 4JI3E 4N3OA 2OI2A 3LTOA 4I3HA 5FLXC 5LL6R 3H09A 2DEJA 2L8TA 1ZXMA 4LF7I 1IBME 2HK3A 4R1FA 1UILA 3KWRA 3OTOI 3ADJA 2RSMA 5LMNE 2Z5BA 4NXMI 2E5LE 3HXLA 1STUA 4DR5I 1ZM3A 2O1WA 4DR6I 1IBLI 4KHPE 3QT6A 4USMA 1J26A 1FJGE 5IWAE 2BM0A 2JOBA 1IBKE 2A2CA 3VK6A 3J80C 2HFUA 2V34A 4NXNE 4I8OA 1YZ9A 2IOQA 4X66I 2L3JA 2V2QA 3T1YE 1Y4SA 4LF5E 4TUIA 2O1TA 2ZM6E 3Q6NA 3Q1QA 1T4NA 1K47A 2HHHI 3DF6A 2KONA 4P78A 4F9BB 1X48A 1SR9A 1Z5AA 4DPYA 4WSPA 1I94I 3MSWA 3WU6A 2H36X 1Z59A 2B7TA 4KQVA 2E5LI 4DU7A 2UXDE 3FIGA 2HKEA 4JI0E 4DR1E 4HXZA 1EA6A 2UXDI 3RMPA 4PRXA 1EI1A 3T1YI 3V2UC 4DV3I 4DV6E 4DV2I 3B8HA 4DV7I 4DV7E 2V88A 4DR3E 4BBYA 2CGEA 1YYOA 1N32I 2LTRA 1YYWA 4DPXA 4Z7CA 4JYAI 1NHJA 3ZZ0A 2VF3A 2EZ6A 2FV4B 4L8NA 4M30A 3WU4A 4FWGA 4JI1E 3LMLA 4GKKI 2YT4A 5CFFE 2HK2A 3DJWA 5LMUI 3K17A 2UUCE 2R42A 2NUEA 3D4JA 3ADGA 2PNLA 4LFBE 2UUBI 3F0NA 4B3TE 4DUYI 4DR7I 3PYGA 3VYXA 3LPSA 2MC6A 3IWCA 3JAMC 4M2ZA 3LNUA 2EFGA 2LTSA 3M6AA 4USKA 1HR0I 4J8ZA 4DV1E 3J7Yp 4BC9A 1HNZI 1GZ6A 2YZTA 3WU5A 4NXME 1XMQI 2JOXA 4IZJB 3B82A 1XMQE 3IWBA 4DPWA 2B7VA 1MG7A 4X8WA 5L3JA 1Z0CA 2NPFA 3CWVA 2L33A 1XNQI 2O1UA 1Z0GA 4LF6I 4PRVA 4FWDA 5IT9Q 4FN5A 4KZSA 4JI2E 1FWKA 1T4LB 2M4IA 4DUYE 4DV5I 4B3TI 3OMLA 2NUFA 4LF7E 1QU6A 2HFSA 1S4EA 1RQ0A 3J81C 2MDRA 1ZM4A 3IWDA 4JI5E 4K0KE 2ODRD 2LBSB 2B9DA 2N3GA 3Q6MA 1X49A 4BS9A 1FJGI 4JV5E 1YYKA 4PU9A 4R8OA 2UU9I 3ZKBA 3HQ1A 4LF4E 4DUZI 4F54A 4DV4I 4DR1I 1PVGA 3HULA 3LLHA 4YHHE 2V8PA 4BCAA 4X62E 2N3HA 4X65E 5FLXQ 1Z0WA 4L5NC 3ZZUA 4F9CB 4YY3E 1J5EE 2V8QB 4LFCE 2V83A 2RTXA 2FTXB 2B3TB 4BMJA 5AASA 4AQYE 5AE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X36 A;  2UXC I;  4JI0 I;  1H7S A;  2LJP A;  2J7K A;  1GQE A;  3J7A G;  1KVK A;  3P1X A;  1Z0B A;  3K1J A;  4LF5 I;  2A2D A;  4X62 I;  4JI6 I;  1U2R A;  4HYM A;  4WUB A;  2WW4 A;  2NUG A;  2UUC I;  1FI4 A;  2E1R A;  2IHR 1;  4HY1 A;  4HAC A;  1N0V C;  2DB2 A;  4URL A;  4WYQ B;  2V2Z A;  4DV2 E;  4DV6 I;  2UXB E;  1Z5C A;  2XEX A;  4X66 E;  4JV5 I;  4X65 I;  1HNW I;  4DR3 I;  4UTG A;  4DXL A;  4JG4 A;  1WHQ A;  4LFC I;  1N36 E;  2DMY A;  1ZBT A;  4OX9 I;  4LF9 I;  4OX9 E;  4LFA I;  1ZXN A;  2RS6 A;  1B63 A;  2LJH A;  1HNX E;  3ADL A;  1H73 A;  1EKZ A;  3ZKD A;  4EMD A;  1DI2 A;  1UHZ A;  2NA2 A;  3QT5 A;  4HAC B;  2UXB I;  4JI8 E;  4DKK A;  2AJ4 A;  1QZR A;  2LUQ A;  4Z7Y A;  2F4V I;  4XTJ A;  1HNW E;  1HNZ E;  4WFT A;  1XNQ E;  1KTV A;  5IWA I;  1MU5 A;  4UT4 A;  1S16 A;  4JI3 I;  1N36 I;  2CZ9 A;  5LMU E;  4FW9 A;  1FKA E;  3J80 Q;  1FWL A;  4DV5 E;  3ZM7 A;  1N33 I;  2RS7 A;  3JAM Q;  2ZM6 I;  1HR0 E;  4YY3 I;  2L2M A;  3QT8 A;  1N32 E;  1DAR A;  1N34 I;  5GME A;  2VQE E;  1XNR I;  1FNM A;  3OTO E;  2L2N A;  1RC7 A;  3C4T A;  4DV3 E;  2V2V A;  4DR2 I;  1NHH A;  1VIS A;  3B78 A;  4JI1 I;  4P7A A;  1PIE A;  2ZIT A;  4B3R I;  2HKJ A;  1H7U A;  1J5E I;  1N0U A;  1WUU A;  1T4O A;  1ZM2 A;  4DR5 E;  4DR6 E;  4JYA E;  4X64 E;  2UUB E;  4LFB I;  3T1H E;  2JY9 A;  2UUA I;  2KHX A;  4FWH A;  4NXN I;  4OOG C;  3J7A M;  4YHH I;  2UXC E;  5A2Q Q;  4LF8 I;  2X7I A;  2BM1 A;  4DUZ E;  4LF4 I;  2BV3 A;  5A2Q C;  4GKJ I;  1OJ4 A;  4DR4 E;  1XMO E;  5GMD A;  4RPF A;  3C4B A;  4X64 I;  4DR7 E;  4JI2 I;  1NZ0 A;  1Z0V A;  3PYE A;  2CPN A;  1XHK A;  4LFA E;  2ZBK B;  3H4L A;  2L3C A;  4M1K A;  4B3M E;  4LF8 E;  1A6F A;  4JI5 I;  4K0K I;  4JI4 I;  4DV4 E;  1XNR E;  4MYU A;  4DU8 A;  1XMO I;  1PKP A;  3PYF A;  1B62 A;  1Z0T A;  4GKK E;  2F4V E;  1WHN A;  2VQF E;  1ELO A;  2LRS A;  5IT9 C;  4DV0 I;  3HTX A;  1N33 E;  4B3M I;  2HHH E;  3GON A;  1IBM I;  3ZZT A;  4DV1 I;  1N34 E;  3J81 Q;  2UU9 E;  4JI8 I;  2R3V A;  3T1H I;  4B3S E;  4ZVI A;  2JVA A;  1IBL E;  3QT7 A;  4JI4 E;  3V5R A;  1RRE A;  2VQF I;  3WU3 A;  1Z5B A;  1D6T A;  1MX0 A;  3ADI A;  4DR2 E;  4JI7 I;  1Z0E A;  1H74 A;  3PYD A;  4GKJ E;  4LF9 E;  1ZM9 A;  2DEI A;  4ED4 A;  5BR8 E;  2GS8 A;  4JI6 E;  5BR8 I;  4DV0 E;  4DPU A;  1I94 E;  3VYY A;  2UUA E;  4KHP I;  4MYT A;  2LUP B;  1H72 C;  1X47 A;  5LMN I;  1O0W A;  2L2K B;  2VQE I;  4AQY I;  4WUC A;  1BKN A;  4WUD A;  1NHI A;  1UEK A;  2Q2E B;  4B3S I;  4JI7 E;  4DR4 I;  4DPT A;  4B3R E;  4P52 A;  1RR9 A;  1KIJ A;  1KKH A;  1IBK I;  2DIX A;  4LF6 E;  1HNX I;  4JI3 E;  2OI2 A;  3LTO A;  4I3H A;  5FLX C;  5LL6 R;  2DEJ A;  1ZXM A;  4LF7 I;  1IBM E;  2HK3 A;  4R1F A;  1UIL A;  3OTO I;  3ADJ A;  2RSM A;  5LMN E;  4NXM I;  2E5L E;  1STU A;  4DR5 I;  1ZM3 A;  4DR6 I;  1IBL I;  4KHP E;  3QT6 A;  4USM A;  1J26 A;  1FJG E;  5IWA E;  2BM0 A;  1IBK E;  2A2C A;  2HFU A;  3J80 C;  2V34 A;  4NXN E;  1YZ9 A;  4X66 I;  2L3J A;  2V2Q A;  3T1Y E;  4LF5 E;  2ZM6 E;  3Q1Q A;  1T4N A;  1K47 A;  2HHH I;  1X48 A;  1Z5A A;  4DPY A;  1I94 I;  3WU6 A;  1Z59 A;  2B7T A;  4KQV A;  2E5L I;  4DU7 A;  2UXD E;  2HKE A;  4JI0 E;  4DR1 E;  4HXZ A;  1EA6 A;  2UXD I;  4PRX A;  1EI1 A;  3T1Y I;  3V2U C;  4DV3 I;  4DV6 E;  4DV2 I;  3B8H A;  4DV7 I;  4DV7 E;  4DR3 E;  1YYO A;  1N32 I;  2LTR A;  1YYW A;  4DPX A;  4Z7C A;  4JYA I;  1NHJ A;  3ZZ0 A;  2VF3 A;  2EZ6 A;  4M30 A;  3WU4 A;  4FWG A;  4JI1 E;  4GKK I;  2YT4 A;  5CFF E;  2HK2 A;  5LMU I;  3K17 A;  2UUC E;  2R42 A;  2NUE A;  3D4J A;  3ADG A;  4LFB E;  2UUB I;  3F0N A;  4B3T E;  4DUY I;  4DR7 I;  3PYG A;  3VYX A;  3LPS A;  3JAM C;  4M2Z A;  3LNU A;  2EFG A;  2LTS A;  3M6A A;  4USK A;  1HR0 I;  4DV1 E;  3J7Y p;  1HNZ I;  3WU5 A;  4NXM E;  1XMQ I;  3B82 A;  1XMQ E;  4DPW A;  2B7V A;  1MG7 A;  4X8W A;  5L3J A;  1Z0C A;  2NPF A;  3CWV A;  2L33 A;  1XNQ I;  1Z0G A;  4LF6 I;  4PRV A;  4FWD A;  5IT9 Q;  4FN5 A;  4JI2 E;  1FWK A;  1T4L B;  4DUY E;  4B3T I;  4DV5 I;  2NUF A;  4LF7 E;  1QU6 A;  2HFS A;  1S4E A;  1RQ0 A;  3J81 C;  2MDR A;  1ZM4 A;  4JI5 E;  4K0K E;  2LBS B;  2N3G A;  1X49 A;  1FJG I;  4JV5 E;  1YYK A;  4PU9 A;  2UU9 I;  3ZKB A;  4LF4 E;  4DUZ I;  4DV4 I;  4DR1 I;  1PVG A;  3HUL A;  3LLH A;  4YHH E;  2V8P A;  4X62 E;  2N3H A;  4X65 E;  5FLX Q;  1Z0W A;  3ZZU A;  4YY3 E;  1J5E E;  4LFC E;  2RTX A;  2B3T B;  4AQY E; 
#chains in the Genus database with same CATH topology
 5KL3 A;  4O24 A;  2X36 A;  5K36 A;  4FW4 A;  2EPR A;  4JI0 I;  1H7S A;  2LJP A;  2UXC I;  2J7K A;  1GQE A;  1GTK A;  1SFE A;  2ODR C;  2RQL A;  2VE7 C;  3J7A G;  1KVK A;  2PO1 A;  3P1X A;  1Z0B A;  4OZE A;  3K1J A;  4LF5 I;  4ZYE A;  5IXM B;  5DNY A;  3F6H A;  1DQ3 A;  2V86 A;  3TQM A;  1IQS A;  2A2D A;  1B69 A;  5FWK A;  4X62 I;  1X3C A;  4JI6 I;  1U2R A;  2V85 A;  3AV0 A;  2JYA A;  3HPS A;  4HYM A;  2PNM A;  2EM3 A;  4WUB A;  1HK7 A;  2WW4 A;  2NUG A;  2EOO A;  1UN6 B;  2UUC I;  2YRM A;  1FI4 A;  2E1R A;  3JTZ A;  1Y4U A;  4N4R B;  5C0X C;  1YUI A;  5JEA E;  1YSA C;  2IHR 1;  4LTY A;  2EOR A;  4BA2 A;  3UHM A;  4P7D A;  3CDJ A;  4HY1 A;  2LO3 A;  4HAC A;  1N0V C;  3K85 A;  2DB2 A;  1X6H A;  4URL A;  4WYQ B;  2V2Z A;  2WCC 3;  4MU3 A;  2EMA A;  4DV2 E;  4DV6 I;  2UXB E;  1Z5C A;  2LCE A;  2VES A;  4F2J C;  2EJ4 A;  1G2F C;  2XEX A;  4X66 E;  4JV5 I;  2LJU A;  4OO1 D;  4X65 I;  1HNW I;  2CG9 A;  4DR3 I;  4UTG A;  1OYR A;  2JP9 A;  4DXL A;  4GQU A;  4JG4 A;  1WHQ A;  4LFC I;  2EL5 A;  1N36 E;  2DMY A;  1ZBT A;  4OX9 I;  2E72 A;  2EOJ A;  4LF9 I;  3EQ1 A;  1USU A;  2PO2 B;  3QG5 C;  4OX9 E;  4LFA I;  2PNZ A;  1ZXN A;  2RS6 A;  5A69 A;  2LJH A;  1HNX E;  3ADL A;  1B63 A;  1H73 A;  3P06 A;  4IFD B;  1EKZ A;  3ZKD A;  4EMD A;  4R03 A;  1MGT A;  2NN6 C;  2EM9 A;  1DI2 A;  2GO3 A;  1UHZ A;  2NA2 A;  3QT5 A;  4HAC B;  1ZR9 A;  3JU0 A;  1PDA A;  4R2A A;  2UXB I;  2BR2 A;  5AC4 A;  4JI8 E;  4DKK A;  2YTF A;  2EML A;  2HJJ A;  5A6B A;  2BA1 D;  1YFH A;  5C0X A;  2AJ4 A;  1QZR A;  1R6M A;  2EQ1 A;  2LUQ A;  4Z7Y A;  2YSP A;  2N8X A;  2F4V I;  4XTJ A;  1HNW E;  2VRD A;  1HNZ E;  4WFT A;  3NZK A;  1XNQ E;  1KTV A;  5IWA I;  1MU5 A;  2Z5C A;  4IZJ D;  3VHT B;  4R2P A;  1WJP A;  4UT4 A;  4IFD D;  2DLQ A;  2VF1 A;  1A1H A;  2NN6 D;  3DD6 A;  1S16 A;  2L92 A;  1EH7 A;  2DRP A;  1N36 I;  2CZ9 A;  4QNJ A;  5LMU E;  4FW9 A;  4JI3 I;  1X6E A;  1FKA E;  3J80 Q;  1FWL A;  4DV5 E;  3ZM7 A;  1N33 I;  2RS7 A;  4R2Q A;  2KOU A;  3JAM Q;  1N3G A;  2ZM6 I;  1HR0 E;  4YY3 I;  2L2M A;  3QT8 A;  2E1M A;  1Y6Z A;  1N32 E;  1P47 A;  1DAR A;  2EPZ A;  1N34 I;  5GME A;  2FGG A;  2PO0 B;  2VQE E;  4OO1 B;  1XNR I;  2WNR B;  3C6M A;  1FNM A;  2C37 B;  3K6Q A;  3OTO E;  1USV A;  4BA2 B;  2L2N A;  1RC7 A;  2JEA B;  2F1D A;  4WXC A;  3C4T A;  2Q8U A;  1OYS A;  4DV3 E;  4Q28 A;  2V2V A;  3BID A;  1UDO A;  4DR2 I;  2EN4 A;  4MDT A;  2EMF A;  2LT7 A;  5C0X F;  4GEQ B;  1NHH A;  1VIS A;  2K7I A;  3CDI A;  2EPX A;  3B78 A;  4JI1 I;  1A1I A;  4P7A A;  4WPY A;  2YTG A;  2JWO A;  1PIE A;  2ZIT A;  2HKJ A;  4B3R I;  1H7U A;  1P42 A;  1J5E I;  4IS9 A;  4BHC A;  1N0U A;  1WUU A;  1T4O A;  5KL2 A;  3HJC A;  4IZJ A;  2L6M A;  1ZM2 A;  2V89 A;  1EH6 A;  3C6K A;  4RH8 A;  5KL7 A;  1E3P A;  4DR5 E;  4DR6 E;  5DRO A;  2M1S A;  4JYA E;  5IV8 B;  4X64 E;  2EN1 A;  2UUB E;  3M99 B;  4AM3 A;  4LFB I;  2YTO A;  4O4K A;  4IZK B;  1A1L A;  2LMZ A;  5A6A A;  3T1H E;  4OO1 A;  2JY9 A;  2UUA I;  2KHX A;  4LCG A;  2Z5B B;  4FWH A;  1G2D C;  1A1G A;  2J7J A;  2Z5E A;  5T6J A;  1IMU A;  2YWQ A;  4NXN I;  4NHR A;  4OOG C;  1QNT A;  1A1K A;  4YHH I;  3J7A M;  1OYP A;  3AUZ A;  2UXC E;  2GQ0 A;  5A2Q Q;  4LF8 I;  1PJT A;  2X7I A;  2EMK A;  2BM1 A;  4DUZ E;  3U1K A;  5A2Q C;  2BV3 A;  4LF4 I;  4GKJ I;  1OJ4 A;  4DR4 E;  1XMO E;  3BGH A;  3KRN A;  5GMD A;  2EP3 A;  4FK5 C;  4RPF A;  3C4B A;  1UDS A;  1R6L A;  1NEI A;  4DR7 E;  2JE6 B;  4X64 I;  4JI2 I;  1WXR A;  1NZ0 A;  5JEA B;  1Z0V A;  3PYE A;  5AE3 A;  4IFD C;  2G7H A;  4KWY A;  2CPN A;  3EPL A;  1XHK A;  5K36 B;  3THO B;  4LFA E;  4FW5 A;  2ZBK B;  1TN9 A;  3H4L A;  4IZK A;  3B4T A;  2ELZ A;  2L3C A;  4M1K A;  4F9A B;  4OO1 E;  4B3M E;  4LF8 E;  1A6F A;  2IOP A;  4JI5 I;  4K0K I;  4JI4 I;  2PO0 A;  2GPI A;  4DV4 E;  3ECR A;  1XNR E;  2LE2 A;  2WZO A;  4ZYH A;  2WBT A;  1YUJ A;  4MYU A;  4DU8 A;  2EPN A;  3PS2 A;  2YTE A;  1XMO I;  1T39 A;  1PKP A;  2D9H A;  3PYF A;  1B62 A;  2ENC A;  1Z0T A;  1YPN A;  2DLK A;  5AE2 A;  2EPK X;  4GKK E;  2F4V E;  2Z5C B;  1EH8 A;  1WHN A;  2VQF E;  1ELO A;  2YTP A;  2DSY A;  2C38 B;  2EMW A;  2EN7 A;  3PS1 A;  1MEY C;  2EE8 A;  4M0V A;  1NCS A;  4M9V C;  2LRS A;  5IT9 C;  2IER A;  2NAB A;  3L7Z A;  4ZYD A;  3HTX A;  4DV0 I;  1ZU1 A;  1N33 E;  4B3M I;  2HHH E;  2M7Q A;  4BHB A;  3GON A;  1IBM I;  1ZBQ A;  2WBU A;  4BC7 A;  2BB8 A;  3ZZT A;  1KJK A;  4DV1 I;  1N34 E;  5KL4 A;  2UU9 E;  2JEB A;  4JI8 I;  2MC5 A;  2PRT A;  2R3V A;  4BA1 B;  3J81 Q;  3T1H I;  4B3S E;  3HKM A;  4ZVI A;  2JVA A;  2EM7 A;  1IBL E;  3QT7 A;  4JI4 E;  2EOI A;  3V5R A;  1RRE A;  2O1V A;  2I9I A;  2VQF I;  2PO2 A;  3WU3 A;  1JK1 A;  1Z5B A;  1D6T A;  1MX0 A;  3ADI A;  3P3G A;  1T38 A;  4DR2 E;  4RHB B;  4TUG A;  4JI7 I;  5DRQ A;  1Z0E A;  4DMI A;  1H74 A;  5TSE A;  4GKJ E;  4LF9 E;  3HPZ A;  3EPK A;  3PYD A;  5ADZ A;  1ZM9 A;  2DEI A;  3ZOQ B;  2K4V A;  4O43 A;  2V87 A;  1F2I G;  4ED4 A;  5BR8 E;  2GS8 A;  5EL9 A;  4JI6 E;  3PRY A;  2EQ0 A;  5BR8 I;  4DV0 E;  3BBG A;  1AH5 A;  4DPU A;  3MHH C;  2EL4 A;  3VYY A;  1I94 E;  1X6F A;  2WNR A;  2UUA E;  2EOY A;  4KHP I;  4LU9 A;  4MYT A;  2LUP B;  1H72 C;  1X47 A;  3KZZ A;  2F8B A;  4HEI A;  5LMN I;  1O0W A;  2L2K B;  4MU0 A;  2EN6 A;  5AC5 A;  5F3W A;  2VQE I;  3L7Z B;  2YTI A;  4WUC A;  4AQY I;  1BKN A;  2EPU A;  1NHI A;  1UEK A;  2Q2E B;  3PS3 A;  4JI7 E;  4WUD A;  4B3S I;  2C39 A;  3F6G A;  4DR4 I;  2C38 A;  2JR1 A;  4DPT A;  4MLQ A;  1LLM C;  1WRJ A;  4B3R E;  2BA0 G;  4P52 A;  2EMY A;  2EWL A;  1RR9 A;  1UDQ A;  3GLL A;  1KIJ A;  1KKH A;  1IBK I;  2EN3 A;  3U1Y A;  2DIX A;  4LF6 E;  2CSH A;  1HNX I;  4LOM A;  4JI3 E;  4N3O A;  2OI2 A;  3LTO A;  5JEA D;  1KYQ A;  5FLX C;  4I3H A;  2EPM X;  5LL6 R;  4R2C A;  4R2D A;  2L8T A;  2DEJ A;  5KL6 A;  1ZXM A;  2PO1 B;  4LF7 I;  2A25 A;  2CT1 A;  1IBM E;  2HK3 A;  1JK2 A;  4R1F A;  1UIL A;  3KWR A;  3OTO I;  3ADJ A;  2RSM A;  5LMN E;  2MDG A;  2BR2 B;  2Z5B A;  4NXM I;  5K36 F;  4OO1 C;  2EPL X;  5LLQ A;  3HXL A;  5A6K A;  1STU A;  2E5L E;  1ZM3 A;  2O1W A;  4DR5 I;  1IBL I;  5DNX A;  4DR6 I;  4KHP E;  4OO1 F;  3QT6 A;  1BB8 A;  4LCH A;  2BBG A;  1X5W A;  1L4S A;  4USM A;  2HGH A;  1J26 A;  1FJG E;  5JEA A;  5IWA E;  4F6N A;  2BM0 A;  2JOB A;  2CVE A;  4MU4 A;  3EPJ A;  4ZYG A;  1IBK E;  2A2C A;  3VK6 A;  3J80 C;  2HFU A;  2V34 A;  4NXN E;  4I8O A;  2RSI A;  1YZ9 A;  2AE8 A;  2IOQ A;  4J3D A;  4MU1 A;  1Y5Y A;  5ELW A;  4X66 I;  2L3J A;  2V2Q A;  3T1Y E;  2EOE A;  1Y4S A;  4LF5 E;  4TUI A;  2O1T A;  2ZM6 E;  2YU5 A;  2EN8 A;  3Q6N A;  3P3E A;  4LPF A;  1VI7 A;  3Q1Q A;  1T4N A;  4BA1 A;  1K47 A;  2HHH I;  1ZAA C;  3DF6 A;  2KON A;  4P78 A;  5DRR A;  5C0X B;  4F9B B;  2EPC A;  2YTN A;  4IFD F;  1X48 A;  1SR9 A;  2YSO A;  1Z5A A;  4DPY A;  4IFD E;  4WSP A;  1I94 I;  3MSW A;  3WU6 A;  2H36 X;  2EQ3 A;  1Z59 A;  2B7T A;  4KQV A;  2E5L I;  4DU7 A;  2UXD E;  3FIG A;  2HKE A;  4JI0 E;  4DR1 E;  4HXZ A;  1EA6 A;  2RPC A;  3RMP A;  2PNZ B;  4PRX A;  2EM6 A;  2EN2 A;  2UXD I;  2EPP A;  1EI1 A;  4FW6 A;  3T1Y I;  2EMB A;  5A6J A;  2JE6 A;  3V2U C;  2YU8 A;  4DV3 I;  2WBS A;  1IQO A;  4DV6 E;  4DV2 I;  4R2R A;  4U3D A;  3B8H A;  2EM5 A;  2EMZ A;  1RMD A;  4DV7 I;  3EPH A;  2JT2 A;  2C39 B;  4DV7 E;  2V88 A;  4DR3 E;  4BBY A;  3BF2 A;  3KZY A;  5A6B D;  5C0X D;  5C0X E;  5DNL A;  2EOH A;  2YPN A;  2CGE A;  5JEA C;  2BA1 G;  1YYO A;  2EPA A;  1N32 I;  2LTR A;  1YH8 A;  1YYW A;  1Z1B A;  1XXE A;  4DPX A;  4Z7C A;  2JEA A;  2GO4 A;  2GLI A;  4FW3 A;  2NN6 B;  4HTG A;  2DGC A;  5K36 E;  2EOS A;  2IES A;  4JYA I;  4ISA A;  3MHS C;  2MKD A;  1NHJ A;  2MKN A;  2NN6 A;  3ZZ0 A;  3H1C A;  4IFD A;  2VF3 A;  4X9J A;  3M85 G;  2EZ6 A;  2FV4 B;  4L8N A;  4M30 A;  3WU4 A;  4FWG A;  4MQY A;  2JXP A;  2EOM A;  4JI1 E;  3LML A;  1E3H A;  4GKK I;  2YT4 A;  2EM4 A;  5CFF E;  2BA0 D;  2EMX A;  2HK2 A;  3DJW A;  5EKW A;  5LMU I;  2CTD A;  4F6M A;  1BBO A;  3L00 A;  3K17 A;  2ADR A;  2UUC E;  2R42 A;  2NUE A;  4OKG A;  1UBD C;  4AIM A;  2O3Z A;  3D4J A;  1TF3 A;  3M85 D;  3ADG A;  1A1F A;  2PNL A;  4LFB E;  2UUB I;  3F0N A;  4B3T E;  4DUY I;  4DR7 I;  3PYG A;  4IS1 C;  2J65 A;  3VYX A;  2NN6 F;  3LPS A;  2MC6 A;  2EOQ A;  4U3B A;  2EPO A;  3IWC A;  4FW7 A;  3JAM C;  2EOF A;  4M2Z A;  2EFG A;  2LTS A;  3LNU A;  4WX9 A;  3M6A A;  4NBQ A;  4USK A;  2EOZ A;  4J8Z A;  1HR0 I;  2EM8 A;  4DV1 E;  1RHY A;  1Y60 A;  3J7Y p;  2YTQ A;  4BC9 A;  1HNZ I;  1GZ6 A;  2YZT A;  3WU5 A;  4NXM E;  1XMQ I;  2R76 A;  2JOX A;  4IZJ B;  3B82 A;  4WXD A;  1XMQ E;  2LVH A;  3IWB A;  4R2E A;  4DPW A;  4GZN C;  2DMI A;  2B7V A;  2YTJ A;  1MG7 A;  4X8W A;  5L3J A;  1Z0C A;  5KL5 A;  3CWV A;  3P76 A;  2NPF A;  2L33 A;  1XNQ I;  2YRH A;  2O1U A;  1Z0G A;  3GCM A;  2EMI A;  4PRV A;  4FWD A;  4LF6 I;  4FN5 A;  3M7N D;  5IT9 Q;  4KZS A;  4JI2 E;  1FWK A;  1T4L B;  2I13 A;  2M4I A;  4DUY E;  4DV5 I;  4B3T I;  2EOX A;  2M9A A;  3OML A;  1PJS A;  2NUF A;  4LF7 E;  1QU6 A;  4Q35 B;  2HFS A;  1S4E A;  2C37 A;  1UDN A;  1RQ0 A;  3GME A;  1TF6 A;  1PJQ A;  2ENA A;  3J81 C;  5DRP A;  2MDR A;  2NN6 E;  1ZM4 A;  3IWD A;  4JI5 E;  4K0K E;  1YHC A;  2ODR D;  2YRK A;  2LBS B;  2JPA A;  2B9D A;  2N3G A;  3UK3 C;  1X49 A;  4BS9 A;  1AAY A;  2R1F A;  4MLV A;  3Q6M A;  1FJG I;  4JV5 E;  1YYK A;  5JEA F;  4PU9 A;  5AE1 A;  4R8O A;  2EL6 A;  4LCF A;  2UU9 I;  3ZKB A;  3HQ1 A;  2EMG A;  4LF4 E;  4F54 A;  4DUZ I;  2EM2 A;  2GHF A;  4DV4 I;  4DR1 I;  1A1J A;  2WP8 A;  1PVG A;  3HUL A;  3LLH A;  2ENH A;  4YHH E;  2V8P A;  5K36 D;  2YTD A;  4BCA A;  4X62 E;  2N3H A;  4X65 E;  5FLX Q;  4QNK A;  4WSG A;  1Z0W A;  4L5N C;  2WP8 B;  4O5G A;  2EMC A;  3ZZU A;  4F9C B;  3M7N G;  4YY3 E;  2EMH A;  2LV2 A;  1J5E E;  2V8Q B;  3THN A;  4AID A;  4LFC E;  2V83 A;  1DGC A;  2RTX A;  2JEB B;  2FTX B;  2HC5 A;  5K36 C;  2B3T B;  4BMJ A;  4IJD A;  1BBG A;  3P3C A;  4NZV A;  5AAS A;  4AQY E;  2EM0 A;  2ELY A;  3H09 A;  4R2S A; 
#chains in the Genus database with same CATH homology
 2X36 A;  2UXC I;  4JI0 I;  1H7S A;  2LJP A;  2J7K A;  1GQE A;  3J7A G;  2ODR C;  2VE7 C;  1KVK A;  3P1X A;  1Z0B A;  3K1J A;  4LF5 I;  5DNY A;  3F6H A;  1DQ3 A;  2V86 A;  2A2D A;  5FWK A;  4X62 I;  4JI6 I;  1U2R A;  2V85 A;  3AV0 A;  3HPS A;  4HYM A;  2PNM A;  4WUB A;  1HK7 A;  2WW4 A;  2NUG A;  2UUC I;  1FI4 A;  2E1R A;  3JTZ A;  1Y4U A;  2IHR 1;  4LTY A;  4P7D A;  4HY1 A;  4HAC A;  1N0V C;  3K85 A;  2DB2 A;  4URL A;  4WYQ B;  2V2Z A;  4DV2 E;  4DV6 I;  2UXB E;  1Z5C A;  2XEX A;  4X66 E;  4JV5 I;  4X65 I;  1HNW I;  2CG9 A;  4DR3 I;  4UTG A;  4DXL A;  4JG4 A;  1WHQ A;  4LFC I;  1N36 E;  2DMY A;  1ZBT A;  4OX9 I;  4LF9 I;  1USU A;  4OX9 E;  4LFA I;  1ZXN A;  2RS6 A;  1B63 A;  2LJH A;  1HNX E;  3ADL A;  1H73 A;  3P06 A;  1EKZ A;  3ZKD A;  4EMD A;  4R03 A;  1DI2 A;  1UHZ A;  2NA2 A;  3QT5 A;  4HAC B;  3JU0 A;  2UXB I;  4JI8 E;  4DKK A;  2AJ4 A;  1QZR A;  2LUQ A;  4Z7Y A;  2F4V I;  4XTJ A;  1HNW E;  1HNZ E;  4WFT A;  1XNQ E;  1KTV A;  5IWA I;  1MU5 A;  2Z5C A;  4IZJ D;  4UT4 A;  2VF1 A;  1S16 A;  2L92 A;  4JI3 I;  1N36 I;  2CZ9 A;  5LMU E;  4FW9 A;  1FKA E;  3J80 Q;  1FWL A;  4DV5 E;  3ZM7 A;  1N33 I;  2RS7 A;  2KOU A;  3JAM Q;  2ZM6 I;  1HR0 E;  4YY3 I;  2L2M A;  3QT8 A;  2E1M A;  1Y6Z A;  1N32 E;  1DAR A;  1N34 I;  5GME A;  2FGG A;  2VQE E;  1XNR I;  1FNM A;  3K6Q A;  3OTO E;  1USV A;  2L2N A;  1RC7 A;  3C4T A;  4DV3 E;  4Q28 A;  2V2V A;  4DR2 I;  4GEQ B;  1NHH A;  1VIS A;  3B78 A;  4JI1 I;  4P7A A;  4WPY A;  1PIE A;  2JWO A;  2ZIT A;  4B3R I;  2HKJ A;  1H7U A;  1J5E I;  1N0U A;  1WUU A;  1T4O A;  3HJC A;  4IZJ A;  2L6M A;  1ZM2 A;  2V89 A;  4DR5 E;  4DR6 E;  2M1S A;  4JYA E;  4X64 E;  2UUB E;  4LFB I;  4IZK B;  2LMZ A;  3T1H E;  2JY9 A;  2UUA I;  2KHX A;  2Z5B B;  4FWH A;  2Z5E A;  5T6J A;  4NXN I;  4OOG C;  3J7A M;  4YHH I;  2GQ0 A;  3AUZ A;  2UXC E;  5A2Q Q;  4LF8 I;  2X7I A;  2BM1 A;  4DUZ E;  4LF4 I;  5A2Q C;  2BV3 A;  4GKJ I;  1OJ4 A;  4DR4 E;  1XMO E;  5GMD A;  4RPF A;  3C4B A;  4X64 I;  4DR7 E;  4JI2 I;  1WXR A;  1NZ0 A;  1Z0V A;  3PYE A;  5AE3 A;  2G7H A;  2CPN A;  1XHK A;  4LFA E;  2ZBK B;  3H4L A;  4IZK A;  2L3C A;  4M1K A;  4F9A B;  4B3M E;  4LF8 E;  1A6F A;  2IOP A;  4JI5 I;  4K0K I;  4JI4 I;  4DV4 E;  1XNR E;  4MYU A;  4DU8 A;  2LE2 A;  2WZO A;  1XMO I;  1PKP A;  3PYF A;  1B62 A;  1Z0T A;  5AE2 A;  4GKK E;  2Z5C B;  2F4V E;  1WHN A;  2VQF E;  1ELO A;  2DSY A;  4M0V A;  2LRS A;  5IT9 C;  4DV0 I;  3HTX A;  1N33 E;  4B3M I;  2HHH E;  2M7Q A;  3GON A;  1IBM I;  1ZBQ A;  4BC7 A;  3ZZT A;  4DV1 I;  1N34 E;  3J81 Q;  2UU9 E;  4JI8 I;  2MC5 A;  2R3V A;  3T1H I;  4B3S E;  4ZVI A;  2JVA A;  1IBL E;  3QT7 A;  4JI4 E;  3V5R A;  1RRE A;  2O1V A;  2VQF I;  3WU3 A;  1Z5B A;  1D6T A;  1MX0 A;  3ADI A;  4DR2 E;  4TUG A;  4JI7 I;  1Z0E A;  4DMI A;  1H74 A;  3PYD A;  4GKJ E;  4LF9 E;  3HPZ A;  5ADZ A;  1ZM9 A;  2DEI A;  3ZOQ B;  2K4V A;  2V87 A;  4ED4 A;  5BR8 E;  2GS8 A;  4JI6 E;  3PRY A;  5BR8 I;  4DV0 E;  4DPU A;  1I94 E;  3VYY A;  2UUA E;  4KHP I;  4LU9 A;  4MYT A;  2LUP B;  1H72 C;  1X47 A;  2F8B A;  5LMN I;  1O0W A;  2L2K B;  5F3W A;  2VQE I;  4AQY I;  4WUC A;  1BKN A;  4WUD A;  1NHI A;  1UEK A;  2Q2E B;  4B3S I;  4JI7 E;  3F6G A;  4DR4 I;  2JR1 A;  4DPT A;  4B3R E;  4P52 A;  2EWL A;  1RR9 A;  1KIJ A;  1KKH A;  1IBK I;  2DIX A;  4LF6 E;  1HNX I;  4JI3 E;  4N3O A;  2OI2 A;  3LTO A;  4I3H A;  5FLX C;  5LL6 R;  3H09 A;  2DEJ A;  2L8T A;  1ZXM A;  4LF7 I;  1IBM E;  2HK3 A;  4R1F A;  1UIL A;  3KWR A;  3OTO I;  3ADJ A;  2RSM A;  5LMN E;  2Z5B A;  4NXM I;  2E5L E;  3HXL A;  1STU A;  4DR5 I;  1ZM3 A;  2O1W A;  4DR6 I;  1IBL I;  4KHP E;  3QT6 A;  4USM A;  1J26 A;  1FJG E;  5IWA E;  2BM0 A;  2JOB A;  1IBK E;  2A2C A;  3VK6 A;  3J80 C;  2HFU A;  2V34 A;  4NXN E;  4I8O A;  1YZ9 A;  2IOQ A;  4X66 I;  2L3J A;  2V2Q A;  3T1Y E;  1Y4S A;  4LF5 E;  4TUI A;  2O1T A;  2ZM6 E;  3Q6N A;  3Q1Q A;  1T4N A;  1K47 A;  2HHH I;  3DF6 A;  2KON A;  4P78 A;  4F9B B;  1X48 A;  1SR9 A;  1Z5A A;  4DPY A;  4WSP A;  1I94 I;  3MSW A;  3WU6 A;  2H36 X;  1Z59 A;  2B7T A;  4KQV A;  2E5L I;  4DU7 A;  2UXD E;  3FIG A;  2HKE A;  4JI0 E;  4DR1 E;  4HXZ A;  1EA6 A;  2UXD I;  3RMP A;  4PRX A;  1EI1 A;  3T1Y I;  3V2U C;  4DV3 I;  4DV6 E;  4DV2 I;  3B8H A;  4DV7 I;  4DV7 E;  2V88 A;  4DR3 E;  4BBY A;  2CGE A;  1YYO A;  1N32 I;  2LTR A;  1YYW A;  4DPX A;  4Z7C A;  4JYA I;  1NHJ A;  3ZZ0 A;  2VF3 A;  2EZ6 A;  2FV4 B;  4L8N A;  4M30 A;  3WU4 A;  4FWG A;  4JI1 E;  3LML A;  4GKK I;  2YT4 A;  5CFF E;  2HK2 A;  3DJW A;  5LMU I;  3K17 A;  2UUC E;  2R42 A;  2NUE A;  3D4J A;  3ADG A;  2PNL A;  4LFB E;  2UUB I;  3F0N A;  4B3T E;  4DUY I;  4DR7 I;  3PYG A;  3VYX A;  3LPS A;  2MC6 A;  3IWC A;  3JAM C;  4M2Z A;  3LNU A;  2EFG A;  2LTS A;  3M6A A;  4USK A;  1HR0 I;  4J8Z A;  4DV1 E;  3J7Y p;  4BC9 A;  1HNZ I;  1GZ6 A;  2YZT A;  3WU5 A;  4NXM E;  1XMQ I;  2JOX A;  4IZJ B;  3B82 A;  1XMQ E;  3IWB A;  4DPW A;  2B7V A;  1MG7 A;  4X8W A;  5L3J A;  1Z0C A;  2NPF A;  3CWV A;  2L33 A;  1XNQ I;  2O1U A;  1Z0G A;  4LF6 I;  4PRV A;  4FWD A;  5IT9 Q;  4FN5 A;  4KZS A;  4JI2 E;  1FWK A;  1T4L B;  2M4I A;  4DUY E;  4DV5 I;  4B3T I;  3OML A;  2NUF A;  4LF7 E;  1QU6 A;  2HFS A;  1S4E A;  1RQ0 A;  3J81 C;  2MDR A;  1ZM4 A;  3IWD A;  4JI5 E;  4K0K E;  2ODR D;  2LBS B;  2B9D A;  2N3G A;  3Q6M A;  1X49 A;  4BS9 A;  1FJG I;  4JV5 E;  1YYK A;  4PU9 A;  4R8O A;  2UU9 I;  3ZKB A;  3HQ1 A;  4LF4 E;  4DUZ I;  4F54 A;  4DV4 I;  4DR1 I;  1PVG A;  3HUL A;  3LLH A;  4YHH E;  2V8P A;  4BCA A;  4X62 E;  2N3H A;  4X65 E;  5FLX Q;  1Z0W A;  4L5N C;  3ZZU A;  4F9C B;  4YY3 E;  1J5E E;  2V8Q B;  4LFC E;  2V83 A;  2RTX A;  2FTX B;  2B3T B;  4BMJ A;  5AAS A;  4AQY E;  5AE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...