2E5LE

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
total genus 30
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2e5lE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2e5lE02
3B78A 1N32I 1YYWA 2A2DA 1UILA 3VYXA 3B82A 5LMNI 1HNWE 2CPNA 4X62E 1STUA 4DV1E 3T1HI 1WHNA 1IBKI 3JAMC 1U2RA 2NUFA 4DR1E 4DR7E 3ADJA 4OX9E 2KHXA 1HR0E 1KKHA 3PYEA 1N36I 1BKNA 3OTOE 4DV4E 2LJHA 2E1RA 2OI2A 2UUBE 3J7AM 2RSMA 3QT6A 4DPXA 3H4LA 3GONA 1HNZE 2X36A 1RQ0A 2YT4A 2UXDE 4DV3E 1H72C 3K17A 4JI8I 4X65I 1XNRE 4PU9A 1Z0EA 4DKKA 4FWGA 3QT7A 5LMUE 4X62I 3LLHA 4M30A 4DV1I 4MYTA 2V2QA 4DPUA 4JYAI 4DR6I 1Z0GA 2DEJA 4JI2E 4OX9I 1A6FA 4B3TE 4DUZI 2HHHE 1I94E 4KQVA 4UT4A 4JI3I 4JI7E 4DV4I 3PYFA 2V2VA 1IBME 1J5EE 4B3RE 2JY9A 4WUDA 2UXDI 3F0NA 1J26A 4LFBI 1XNRI 4JI0E 1FKAE 2L2NA 4LF9E 1S16A 3WU3A 4X64I 2HKJA 1XNQI 2V2ZA 4USMA 5LMUI 3P1XA 4K0KE 1H74A 5LMNE 4GKJE 1MX0A 4JI6E 1YYKA 3T1HE 4R1FA 4B3TI 2HHHI 1IBKE 4KHPE 1Z0VA 1I94I 4LF4E 4JI7I 4FWDA 4DR2I 1DI2A 4DV2E 5LL6R 1Z0BA 4UTGA 4LFAI 4DUYI 1J5EI 2RTXA 1T4LB 4B3RI 4LF5E 2Q2EB 2LBSB 1UEKA 1Z5BA 2XEXA 4DR5I 3HULA 4DV0E 3J80Q 4JI8E 1KVKA 4X65E 1O0WA 3CWVA 4LF9I 4AQYE 4OOGC 2V34A 2N3GA 4M1KA 2F4VE 4K0KI 1Z59A 3WU5A 4GKJI 3Q1QA 1FI4A 4JI6I 2JVAA 4GKKE 2LJPA 4KHPI 4LF4I 4JYAE 4DR6E 2L3CA 1IBLE 4JV5E 5FLXC 2ZITA 3LNUA 4DV2I 4LF7I 1Z0TA 4DUZE 3T1YE 1N34E 2L2KB 4JI3E 3K1JA 3J80C 4LF5I 4URLA 1XMOE 1RC7A 3ZZ0A 4ZVIA 4EMDA 1X47A 3VYYA 4DV0I 3ADLA 4USKA 4JI4E 4FW9A 4AQYI 1KTVA 4HACB 4FWHA 4LFBE 4B3ME 3D4JA 3HTXA 4DV5I 2F4VI 1X48A 4HACA 2DB2A 2LUPB 1HNXE 1Z0WA 2WW4A 4X64E 1XNQE 2HKEA 2NA2A 1FWKA 4M2ZA 4RPFA 1N33I 3ZZUA 4GKKI 1X49A 1QU6A 1N0UA 2EFGA 2LTRA 4X8WA 3V2UC 2UXBI 1IBLI 2DEIA 4FN5A 4JV5I 2HK2A 3T1YI 1OJ4A 4WUBA 1N34I 4DR2E 2NUEA 2AJ4A 1XMOI 4LFAE 4DUYE 3ZKDA 4NXMI 1KIJA 2UUCI 4P7AA 4DR4E 4JI4I 1EKZA 1Z0CA 4DR5E 1FNMA 4B3MI 5IT9C 4LF6I 1HNXI 2ZBKB 4DXLA 4I3HA 1H7UA 2BV3A 4JI1I 1VISA 5GMEA 5A2QQ 3ZKBA 2VQFI 1UHZA 2NUGA 1FJGE 4NXNE 1ZM3A 1NHHA 1WUUA 3ZM7A 1FWLA 1ZXMA 5CFFE 2L2MA 1T4OA 1RR9A 3PYDA 4LF7E 1XMQI 2UUAE 1Z5CA 4DV6I 3PYGA 1K47A 5FLXQ 4DR4I 4DR3I 2L33A 1ZM9A 3C4BA 3ZZTA 2ZM6E 3LPSA 3C4TA 2V8PA 1ZXNA 1ZM4A 4HXZA 5A2QC 4X66E 1H73A 2E5LE 3J81Q 4DV5E 4DU7A 3LTOA 1EA6A 1RREA 4LFCE 4WUCA 2N3HA 1N33E 1MG7A 1Z5AA 1FJGI 4NXNI 4LF8E 2GS8A 2B7VA 2UXBE 4PRXA 2RS7A 1WHQA 4DPWA 1YYOA 2UUAI 1T4NA 1EI1A 1PIEA 2DIXA 1PKPA 1S4EA 4ED4A 2UU9E 4PRVA 4WYQB 4NXME 3J81C 2BM1A 2UUCE 2HFSA 2ZM6I 1QZRA 2LTSA 2EZ6A 1YZ9A 4XTJA 4B3SE 4JI5I 4X66I 2X7IA 2LRSA 2E5LI 2B3TB 5GMDA 4LF6E 4LFCI 3V5RA 4MYUA 2MDRA 2A2CA 4DV7I 4WFTA 4JI1E 4LF8I 3M6AA 2R3VA 5IT9Q 4YHHE 2VQFE 2BM0A 4DU8A 1DARA 1XMQE 1B63A 1HNWI 3WU4A 2UU9I 4DV6E 2HFUA 2VQEE 3QT8A 4Z7CA 5L3JA 1NHJA 3QT5A 5BR8E 4DPYA 4DR3E 4B3SI 4DR1I 1PVGA 4DR7I 1HR0I 3J7Yp 2RS6A 3OTOI 2UXCE 1ZBTA 1NHIA 1H7SA 2UUBI 1MU5A 1HNZI 5IWAE 4YHHI 4DV3I 4P52A 2LUQA 3ADGA 1D6TA 4YY3E 1B62A 1N32E 2B7TA 2HK3A 2DMYA 1NZ0A 2VQEI 3WU6A 5BR8I 1GQEA 1ZM2A 2CZ9A 1ELOA 4JI2I 1N0VC 4HY1A 2VF3A 1XHKA 3B8HA 2UXCI 4DPTA 2J7KA 4JI5E 3J7AG 4Z7YA 1N36E 1IBMI 5IWAI 3JAMQ 2IHR1 2R42A 4HYMA 2L3JA 4DV7E 4JG4A 2NPFA 4JI0I 4YY3I 3ADIA
chains in the Genus database with same CATH superfamily
3B78A 1N32I 1YYWA 1ZAAC 2EPKX 5A6AA 2A2DA 2WNRA 1HK7A 3L00A 1GTKA 1UILA 1N3GA 2R1FA 3VYXA 3P3GA 4FW5A 3B82A 4AIMA 2YTPA 2RQLA 5LMNI 2I9IA 2YTNA 2YU8A 2EOMA 1HNWE 2CPNA 2CSHA 1Y60A 2HJJA 4X62E 2BA1D 4IFDE 1STUA 2EOIA 4DV1E 1UDSA 2Z5EA 3T1HI 1WHNA 5LLQA 2GHFA 1IBKI 3JAMC 2EORA 2MDGA 1L4SA 4P7DA 4MLQA 1U2RA 2NUFA 2EL5A 2LVHA 4DR1E 4DR7E 2C39B 3ADJA 3THOB 4OX9E 4OO1E 2KHXA 1HR0E 1KKHA 3PYEA 1N36I 3BF2A 1BKNA 2LJUA 2WCC3 1DQ3A 3OTOE 5A6KA 2O3ZA 5KL3A 2C39A 1A1LA 1JK1A 4DV4E 2ENCA 5DNLA 2LJHA 2E1RA 3RMPA 4IFDF 2OI2A 2UUBE 3J7AM 2RSMA 1G2DC 3QT6A 4DPXA 3BBGA 1DGCA 4MLVA 3H4LA 3H1CA 2ODRD 3GONA 2EOXA 3UK3C 1HNZE 2X36A 1RQ0A 2EPNA 2YT4A 2UXDE 1RHYA 4DV3E 2FTXB 1H72C 3K17A 5KL7A 1KYQA 4JI8I 1A1KA 4X65I 2EPLX 5K36F 2EMCA 2YRKA 1A1IA 2YTEA 1XNRE 1E3PA 4PU9A 1PJSA 2LE2A 1Z0EA 4DKKA 4OZEA 2EMGA 4FWGA 5C0XE 2CVEA 1B69A 4R03A 3OMLA 4BMJA 5LMUE 3QT7A 4X62I 3LLHA 2WBUA 4F6MA 4M30A 4DV1I 2M7QA 2PO1B 3IWBA 2EM6A 3Q6MA 4MYTA 4O5GA 4F2JC 2EWLA 2EM3A 2L92A 3KZYA 2V2QA 4DPUA 1E3HA 2JT2A 4U3DA 2PO1A 2YSOA 4O43A 5DNYA 1Z0GA 4N3OA 4DR6I 4JYAI 2Q8UA 1MEYC 1PJTA 1KJKA 4JI2E 2DEJA 2PO2B 4OX9I 2YTQA 3BGHA 1A6FA 2EN7A 5FWKA 3M7NG 4B3TE 4DUZI 2HHHE 2VF1A 3EPHA 1I94E 4KQVA 2PO2A 1X3CA 1EH8A 2DLKA 4JI7E 4R2QA 4UT4A 4DV4I 3LMLA 4AIDA 4JI3I 3CDJA 3HJCA 2Z5BB 4BHCA 3PYFA 2V2VA 2N8XA 1IBME 1J5EE 2Z5BA 2G7HA 1LLMC 4B3RE 2YU5A 2JY9A 4WUDA 4R2EA 4N4RB 1USVA 2UXDI 3VK6A 2EOYA 3IWDA 2EP3A 4BC9A 4FK5C 3F0NA 1J26A 4AM3A 4LFBI 1XNRI 5ADZA 4JI0E 4IJDA 1BB8A 1FKAE 2L2NA 4LF9E 2WZOA 1S16A 3WU3A 4X64I 2E72A 2HKJA 1XNQI 2V2ZA 2YTJA 4USMA 3P1XA 5LMUI 2HGHA 4K0KE 2BB8A 5JEAF 4ZYGA 1H74A 4IFDC 4BCAA 1T38A 5LMNE 4LPFA 2JOBA 2M1SA 4GKJE 1AH5A 4WXCA 1MX0A 4JI6E 1YYKA 3PS2A 3T1HE 4R1FA 1XXEA 4B3TI 3U1YA 4LCHA 1UBDC 1IBKE 4KHPE 1Z0VA 3P3CA 1MGTA 5KL4A 4LF4E 1I94I 4JI7I 4FWDA 5K36C 4DR2I 3EPLA 2VESA 1DI2A 4DV2E 1WRJA 5LL6R 3P76A 2B9DA 3VHTB 3H09A 5AE1A 1Z0BA 2YTFA 2C37B 4UTGA 4DUYI 1J5EI 4LFAI 2RTXA 3HPSA 1T4LB 2EPMX 4WPYA 4B3RI 2EN8A 2C37A 3JU0A 4LF5E 2EN6A 2Q2EB 3B4TA 4LCGA 2LBSB 2EE8A 1TF6A 2CTDA 1UEKA 2BA0G 2FGGA 1USUA 1Z5BA 4GQUA 2ENHA 3P06A 2XEXA 2M4IA 4DR5I 4RH8A 1A1FA 4R2PA 5AE2A 4BC7A 5A6BA 3HULA 4DV0E 3J80Q 4JI8E 1KVKA 4X65E 1O0WA 2EMKA 3CWVA 4LF9I 3AV0A 4AQYE 2WP8B 4OOGC 2V34A 2N3GA 2E1MA 2RSIA 4R2CA 3F6HA 2EM2A 5A69A 2EOEA 2EJ4A 2F4VE 3CDIA 4M1KA 4IFDB 4K0KI 2BA1G 2WP8A 1IMUA 1Z59A 3THNA 1IQOA 4Q35B 1OYRA 2VE7C 5AC4A 3WU5A 4GKJI 4IFDA 2K7IA 2V87A 3Q1QA 4GEQB 2EPZA 1FI4A 2EMAA 4JI6I 4LCFA 2JVAA 4ZYHA 1AAYA 4GKKE 2EM9A 2LJPA 4R2DA 4FW7A 4F9CB 4LF4I 4KHPI 4JYAE 5K36B 4DR6E 2EN4A 2L3CA 4MDTA 1IBLE 1OYSA 4JV5E 5FLXC 3AUZA 2MKNA 2ZITA 3LNUA 3P3EA 4DV2I 5K36A 1EH7A 4LF7I 1Z0TA 4BBYA 4DUZE 3T1YE 3M85D 1N34E 2GO4A 2L2KB 1A1JA 4JI3E 3DF6A 2O1VA 3K1JA 3MHHC 4U3BA 4HTGA 5DRQA 3J80C 4LF5I 3U1KA 1P47A 2YTGA 4URLA 5JEAC 1XMOE 1SR9A 1RC7A 3K85A 3F6GA 3ZZ0A 2KONA 2V85A 2GPIA 4LU9A 4ZVIA 5DNXA 1X47A 2V83A 3VYYA 4EMDA 4DV0I 2HC5A 3ADLA 4OO1F 2EN1A 4USKA 4ZYEA 4JI4E 4FW9A 3EPKA 4AQYI 1PJQA 1KTVA 2PNMA 4HACB 4FWHA 4LFBE 2EOOA 2DRPA 4B3ME 3D4JA 3HTXA 4DV5I 2F4VI 2NN6E 1X48A 4HACA 2DB2A 2O1WA 2LUPB 1HNXE 1Z0WA 2V8QB 2WW4A 4X64E 2GLIA 1X6HA 1XNQE 1WJPA 2V86A 2DSYA 2YRMA 2HKEA 2EM7A 2NA2A 1FWKA 1T39A 4M2ZA 4RPFA 1N33I 3ZZUA 4GKKI 5F3WA 2M9AA 1X49A 1QU6A 4WX9A 1N0UA 2LTRA 4X8WA 2EFGA 3V2UC 1WXRA 2UXBI 1IBLI 2DEIA 1A1GA 4FN5A 4JV5I 4R8OA 2HK2A 2EMLA 1X5WA 2EMYA 1UDOA 3T1YI 3GCMA 1A1HA 1OJ4A 4WUBA 1N34I 5IV8B 1X6EA 5C0XF 2K4VA 4DR2E 2NUEA 2H36X 2AJ4A 5JEAB 2WBTA 1XMOI 2YTDA 2EM8A 2ELZA 4DUYE 4LFAE 4I8OA 3ZKDA 2WBSA 5JEAA 3IWCA 4NXMI 2CT1A 2EOQA 5A6BD 1KIJA 2UUCI 4RHBB 2ADRA 2A25A 1F2IG 2EMXA 4P7AA 4DR4E 1YPNA 1JK2A 1TF3A 4JI4I 1EKZA 4YY3I 1Z0CA 5KL2A 4DR5E 4TUGA 1FNMA 4QNKA 2JPAA 1BBGA 4B3MI 2MKDA 5IT9C 4LF6I 2J65A 3JTZA 1HNXI 4IFDD 2V89A 2ZBKB 2PNZB 4DXLA 4I3HA 4F6NA 4JI0I 1H7UA 2EMFA 2BV3A 5DRPA 3L7ZB 5AASA 1OYPA 4JI1I 2IOQA 2PNZA 1VISA 5GMEA 2LCEA 5A2QQ 3L7ZA 2GQ0A 3ZKBA 2VQFI 1UHZA 2EN3A 3MSWA 5K36D 2NUGA 1FJGE 2EPUA 1YUJA 4NXNE 2JYAA 1ZM3A 4X9JA 1NHHA 1WUUA 4OO1C 5EKWA 2EL4A 2VRDA 4TUIA 3ZM7A 1FWLA 1ZXMA 5CFFE 2L2MA 2EPXA 4OKGA 1T4OA 1UN6B 1RR9A 3PYDA 4LF7E 2IERA 1XMQI 3HQ1A 5KL5A 4FW4A 3DJWA 2UUAE 5AE3A 1Z5CA 2IOPA 4DV6I 1NCSA 2O1TA 2JXPA 1Y6ZA 4QNJA 3PYGA 2DGCA 1K47A 2JEBB 5FLXQ 4ZYDA 4DR4I 4DR3I 4IZJA 3TQMA 2L33A 2PRTA 4KWYA 2EN2A 1ZM9A 3C4BA 2JEBA 3ZZTA 4R2SA 1UDNA 2ZM6E 2Z5CB 3C4TA 3LPSA 1NEIA 4IZKB 2V8PA 3C6MA 5TSEA 1ZXNA 1ZM4A 1R6MA 2YWQA 2Z5CA 5A2QC 4HXZA 4IZKA 2NN6C 2EM4A 2EOHA 4MU3A 2DLQA 2LMZA 4X66E 1YSAC 1YUIA 2EPAA 2E5LE 1H73A 2CG9A 4DV5E 5C0XC 4DU7A 2L6MA 3J81Q 3LTOA 1EA6A 2ENAA 2BR2B 3KRNA 1RREA 1ZBQA 4LFCE 1UDQA 2F8BA 2EM5A 2BR2A 2D9HA 2CGEA 4WUCA 2RPCA 2EOFA 2N3HA 1N33E 1MG7A 1Z5AA 3NZKA 3PS3A 3PRYA 4NXNI 3QG5C 4OO1B 4LF8E 1FJGI 2LO3A 2EPPA 1GZ6A 2GS8A 2B7VA 3M85G 4NHRA 2UXBE 4LOMA 4PRXA 4OO1A 2RS7A 2GO3A 4ISAA 4MU4A 1WHQA 4DPWA 2EPRA 3BIDA 1YYOA 2UUAI 5JEAD 1T4NA 1EI1A 1PIEA 2DIXA 4M9VC 5IXMB 1Y4SA 2JR1A 2YTOA 1PKPA 4L5NC 1S4EA 4R2AA 2UU9E 4PRVA 4ED4A 4WYQB 4J8ZA 4NXME 3J81C 2BM1A 2UUCE 2HFSA 2JP9A 2ZM6I 3ZOQB 2BBGA 1QZRA 2LTSA 2EZ6A 1YZ9A 2NN6B 4XTJA 4B3SE 4JI5I 4P78A 2EQ0A 2YSPA 4X66I 5C0XB 2YZTA 2LRSA 2NN6A 2X7IA 2E5LI 5K36E 4O4KA 2JE6B 2B3TB 5GMDA 5C0XA 1IQSA 1QNTA 2MC6A 1Z1BA 4LF6E 2EM0A 1Y5YA 4LFCI 3V5RA 4MYUA 2MDRA 4Q28A 4F9BB 2JE6A 2R76A 2V88A 2A2CA 4DV7I 2EMHA 2ELYA 4WFTA 4JI1E 2EPOA 1VI7A 4LF8I 2YTIA 2R3VA 3M6AA 5IT9Q 2EMZA 4IS1C 4YHHE 4O24A 2JOXA 2VQFE 2BM0A 2ODRC 1ZR9A 3K6QA 2C38B 4DU8A 4BA1B 2NN6F 3Q6NA 2J7JA 3EPJA 2EPCA 2C38A 5DRRA 4BA1A 2HHHI 1DARA 1P42A 1XMQE 2JWOA 1B63A 4HEIA 4F9AB 2IESA 4IZJD 3WU4A 1HNWI 2UU9I 4DV6E 2HFUA 2L8TA 4MQYA 2NABA 2VQEE 2PNLA 3QT8A 4Z7CA 5L3JA 1NHJA 3QT5A 5ELWA 5BR8E 1G2FC 4L8NA 2AE8A 2I13A 4DPYA 3GMEA 3UHMA 4BHBA 4DR3E 4B3SI 4MU1A 4DR1I 1PVGA 4DR7I 1HR0I 3HXLA 3J7Yp 2RS6A 3OTOI 4NBQA 2KOUA 4DMIA 4F54A 4GZNC 2UXCE 5AC5A 4FW6A 5EL9A 1PDAA 1ZBTA 3ECRA 5KL6A 1NHIA 1YH8A 3M7ND 4WSPA 1H7SA 4WSGA 2EQ3A 2UUBI 1MU5A 1HNZI 5IWAE 2LT7A 2EQ1A 2EMWA 5JEAE 1TN9A 3HPZA 4YHHI 4OO1D 4DV3I 4P52A 2MC5A 1Y4UA 4MU0A 2LUQA 1ZU1A 1EH6A 2EOJA 4FW3A 4KZSA 3ADGA 1D6TA 3FIGA 2EOSA 3KWRA 2EL6A 2PO0B 4YY3E 1B62A 1YFHA 2DMIA 1YHCA 1N32E 3M99B 4IS9A 2B7TA 3EQ1A 2PO0A 2HK3A 2DMYA 1NZ0A 5T6JA 2VQEI 3C6KA 4WXDA 4J3DA 3WU6A 4IZJB 5BR8I 1GQEA 1ZM2A 1BBOA 2LV2A 2YPNA 1R6LA 3MHSC 2CZ9A 1ELOA 1RMDA 4JI2I 2FV4B 1N0VC 2F1DA 2NN6D 4NZVA 5DROA 2EMIA 4HY1A 2VF3A 1XHKA 3DD6A 3GLLA 5C0XD 5A6JA 2O1UA 3B8HA 2JEAB 2UXCI 4DPTA 2J7KA 4JI5E 3J7AG 3KZZA 3PS1A 4Z7YA 4M0VA 2EOZA 2JEAA 1N36E 2EMBA 1IBMI 1SFEA 5IWAI 3JAMQ 2IHR1 4R2RA 3HKMA 2YRHA 2R42A 4BS9A 2L3JA 4HYMA 4DV7E 4JG4A 4BA2B 4LTYA 4BA2A 2NPFA 2WNRB 2BA0D 1X6FA 3ADIA
chains in the Genus database with same CATH topology
3B78A 1N32I 1YYWA 2A2DA 1HK7A 1UILA 3VYXA 3B82A 5LMNI 1HNWE 2CPNA 4X62E 1STUA 4DV1E 2Z5EA 3T1HI 1WHNA 1IBKI 3JAMC 4P7DA 1U2RA 2NUFA 4DR1E 4DR7E 3ADJA 4OX9E 2KHXA 1HR0E 1KKHA 3PYEA 1N36I 1BKNA 1DQ3A 3OTOE 4DV4E 2LJHA 2E1RA 3RMPA 2OI2A 2UUBE 3J7AM 2RSMA 3QT6A 4DPXA 3H4LA 2ODRD 3GONA 1HNZE 2X36A 1RQ0A 2YT4A 2UXDE 4DV3E 2FTXB 1H72C 3K17A 4JI8I 4X65I 1XNRE 4PU9A 2LE2A 1Z0EA 4DKKA 4FWGA 4R03A 3OMLA 4BMJA 5LMUE 3QT7A 4X62I 3LLHA 4M30A 4DV1I 2M7QA 3IWBA 3Q6MA 4MYTA 2EWLA 2L92A 2V2QA 4DPUA 4JYAI 4DR6I 1Z0GA 5DNYA 4N3OA 2DEJA 4JI2E 4OX9I 1A6FA 5FWKA 4B3TE 4DUZI 2HHHE 2VF1A 1I94E 4KQVA 4UT4A 4JI3I 4JI7E 4DV4I 3LMLA 3HJCA 2Z5BB 3PYFA 2V2VA 1IBME 1J5EE 2Z5BA 2G7HA 4B3RE 2JY9A 4WUDA 2UXDI 1USVA 3VK6A 3IWDA 4BC9A 3F0NA 1J26A 4LFBI 1XNRI 5ADZA 4JI0E 1FKAE 2L2NA 4LF9E 2WZOA 1S16A 3WU3A 4X64I 2HKJA 1XNQI 2V2ZA 4USMA 5LMUI 3P1XA 4K0KE 1H74A 4BCAA 5LMNE 2JOBA 2M1SA 4GKJE 1MX0A 4JI6E 1YYKA 3T1HE 4R1FA 4B3TI 2HHHI 1IBKE 4KHPE 1Z0VA 1I94I 4LF4E 4JI7I 4FWDA 4DR2I 1DI2A 4DV2E 5LL6R 2B9DA 1Z0BA 3H09A 5AE1A 4UTGA 4LFAI 4DUYI 1J5EI 2RTXA 3HPSA 1T4LB 4B3RI 4WPYA 3JU0A 4LF5E 2Q2EB 2LBSB 1UEKA 2FGGA 1USUA 1Z5BA 3P06A 2XEXA 2M4IA 4DR5I 5AE2A 4BC7A 3HULA 4DV0E 3J80Q 4JI8E 1KVKA 4X65E 1O0WA 3CWVA 4LF9I 3AV0A 4AQYE 4OOGC 2V34A 2N3GA 2E1MA 2CG9A 3F6HA 4M1KA 2F4VE 4K0KI 1Z59A 2VE7C 3WU5A 4GKJI 2V87A 3Q1QA 4GEQB 1FI4A 4JI6I 2JVAA 4GKKE 2LJPA 4KHPI 4F9CB 4LF4I 4JYAE 4DR6E 2L3CA 1IBLE 4JV5E 5FLXC 3AUZA 2ZITA 3LNUA 4DV2I 4LF7I 1Z0TA 4BBYA 4DUZE 3T1YE 1N34E 2L2KB 4JI3E 3K1JA 3DF6A 2O1VA 3J80C 4LF5I 4URLA 1XMOE 1SR9A 1RC7A 3K85A 3F6GA 3ZZ0A 2KONA 2V85A 4ZVIA 4LU9A 4EMDA 1X47A 2V83A 3VYYA 4DV0I 3ADLA 4USKA 4JI4E 4FW9A 4AQYI 1KTVA 2PNMA 4HACB 4FWHA 4LFBE 4B3ME 3D4JA 3HTXA 4DV5I 2F4VI 1X48A 4HACA 2DB2A 2O1WA 2LUPB 1HNXE 1Z0WA 2V8QB 2WW4A 4X64E 1XNQE 2V86A 2DSYA 2HKEA 2NA2A 1FWKA 4M2ZA 4RPFA 1N33I 3ZZUA 4GKKI 5F3WA 1X49A 1QU6A 1N0UA 2EFGA 2LTRA 4X8WA 3V2UC 1WXRA 2UXBI 1IBLI 2DEIA 4FN5A 4JV5I 4R8OA 2HK2A 3T1YI 1OJ4A 4WUBA 1N34I 2K4VA 4DR2E 2NUEA 2H36X 2AJ4A 1XMOI 4LFAE 4DUYE 3ZKDA 4I8OA 3IWCA 4NXMI 1KIJA 2UUCI 4P7AA 4DR4E 4JI4I 1EKZA 1Z0CA 4DR5E 1FNMA 4TUGA 4B3MI 5IT9C 4LF6I 3JTZA 1HNXI 2V89A 2ZBKB 4DXLA 4I3HA 1H7UA 2BV3A 5AASA 4JI1I 2IOQA 1VISA 5GMEA 5A2QQ 2GQ0A 3ZKBA 2VQFI 1UHZA 3MSWA 2NUGA 1FJGE 4NXNE 1ZM3A 1NHHA 1WUUA 4TUIA 3ZM7A 1FWLA 1ZXMA 5CFFE 2L2MA 1T4OA 1RR9A 3PYDA 4LF7E 1XMQI 3HQ1A 3DJWA 2UUAE 5AE3A 1Z5CA 2IOPA 4DV6I 2O1TA 1Y6ZA 3PYGA 1K47A 5FLXQ 4DR4I 4DR3I 4IZJA 2L33A 1ZM9A 3C4BA 3ZZTA 2ZM6E 2Z5CB 3C4TA 3LPSA 4IZKB 2V8PA 1ZXNA 1ZM4A 2Z5CA 4HXZA 5A2QC 4IZKA 4X66E 2LMZA 1H73A 2E5LE 3J81Q 4DV5E 4DU7A 2L6MA 3LTOA 1EA6A 1RREA 1ZBQA 4LFCE 2F8BA 2CGEA 4WUCA 2N3HA 1N33E 1MG7A 1Z5AA 3PRYA 1FJGI 4NXNI 4LF8E 1GZ6A 2GS8A 2B7VA 2UXBE 4PRXA 2RS7A 1WHQA 4DPWA 1YYOA 2UUAI 1T4NA 1EI1A 1PIEA 2DIXA 1Y4SA 2JR1A 1PKPA 4L5NC 1S4EA 4ED4A 2UU9E 4PRVA 4WYQB 4J8ZA 4NXME 3J81C 2BM1A 2UUCE 2HFSA 2ZM6I 3ZOQB 1QZRA 2LTSA 2EZ6A 1YZ9A 4XTJA 4B3SE 4JI5I 4P78A 4X66I 2YZTA 2LRSA 2X7IA 2E5LI 2B3TB 5GMDA 2MC6A 4LF6E 4LFCI 3V5RA 4MYUA 2MDRA 4Q28A 4F9BB 2V88A 2A2CA 4DV7I 4WFTA 4JI1E 4LF8I 3M6AA 2R3VA 5IT9Q 4YHHE 2JOXA 2VQFE 2BM0A 2ODRC 3K6QA 4DU8A 3Q6NA 1DARA 1XMQE 2JWOA 1B63A 4F9AB 4IZJD 3WU4A 1HNWI 2UU9I 4DV6E 2HFUA 2L8TA 2VQEE 2PNLA 3QT8A 4Z7CA 5L3JA 1NHJA 3QT5A 5BR8E 4L8NA 4DPYA 4DR3E 4B3SI 4DR1I 1PVGA 4DR7I 1HR0I 3HXLA 3J7Yp 2RS6A 3OTOI 2KOUA 4DMIA 4F54A 2UXCE 1ZBTA 1NHIA 4WSPA 1H7SA 2UUBI 1MU5A 1HNZI 5IWAE 3HPZA 4YHHI 4DV3I 4P52A 2MC5A 1Y4UA 2LUQA 4KZSA 3ADGA 1D6TA 3FIGA 3KWRA 4YY3E 1B62A 1N32E 2B7TA 2HK3A 2DMYA 1NZ0A 5T6JA 2VQEI 3WU6A 4IZJB 5BR8I 1GQEA 1ZM2A 2CZ9A 1ELOA 4JI2I 2FV4B 1N0VC 4HY1A 2VF3A 1XHKA 2O1UA 3B8HA 2UXCI 4DPTA 2J7KA 4JI5E 3J7AG 4Z7YA 4M0VA 1N36E 1IBMI 5IWAI 3JAMQ 2IHR1 2R42A 4BS9A 2L3JA 4HYMA 4DV7E 4JG4A 4LTYA 2NPFA 4JI0I 4YY3I 3ADIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B78 A;  1N32 I;  1YYW A;  2A2D A;  1UIL A;  3VYX A;  3B82 A;  5LMN I;  1HNW E;  2CPN A;  4X62 E;  1STU A;  4DV1 E;  3T1H I;  1WHN A;  1IBK I;  3JAM C;  1U2R A;  2NUF A;  4DR1 E;  4DR7 E;  3ADJ A;  4OX9 E;  2KHX A;  1HR0 E;  1KKH A;  3PYE A;  1N36 I;  1BKN A;  3OTO E;  4DV4 E;  2LJH A;  2E1R A;  2OI2 A;  2UUB E;  3J7A M;  2RSM A;  3QT6 A;  4DPX A;  3H4L A;  3GON A;  1HNZ E;  2X36 A;  1RQ0 A;  2YT4 A;  2UXD E;  4DV3 E;  1H72 C;  3K17 A;  4JI8 I;  4X65 I;  1XNR E;  4PU9 A;  1Z0E A;  4DKK A;  4FWG A;  3QT7 A;  5LMU E;  4X62 I;  3LLH A;  4M30 A;  4DV1 I;  4MYT A;  2V2Q A;  4DPU A;  4JYA I;  4DR6 I;  1Z0G A;  2DEJ A;  4JI2 E;  4OX9 I;  1A6F A;  4B3T E;  4DUZ I;  2HHH E;  1I94 E;  4KQV A;  4UT4 A;  4JI3 I;  4JI7 E;  4DV4 I;  3PYF A;  2V2V A;  1IBM E;  1J5E E;  4B3R E;  2JY9 A;  4WUD A;  2UXD I;  3F0N A;  1J26 A;  4LFB I;  1XNR I;  4JI0 E;  1FKA E;  2L2N A;  4LF9 E;  1S16 A;  3WU3 A;  4X64 I;  2HKJ A;  1XNQ I;  2V2Z A;  4USM A;  5LMU I;  3P1X A;  4K0K E;  1H74 A;  5LMN E;  4GKJ E;  1MX0 A;  4JI6 E;  1YYK A;  3T1H E;  4R1F A;  4B3T I;  2HHH I;  1IBK E;  4KHP E;  1Z0V A;  1I94 I;  4LF4 E;  4JI7 I;  4FWD A;  4DR2 I;  1DI2 A;  4DV2 E;  5LL6 R;  1Z0B A;  4UTG A;  4LFA I;  4DUY I;  1J5E I;  2RTX A;  1T4L B;  4B3R I;  4LF5 E;  2Q2E B;  2LBS B;  1UEK A;  1Z5B A;  2XEX A;  4DR5 I;  3HUL A;  4DV0 E;  3J80 Q;  4JI8 E;  1KVK A;  4X65 E;  1O0W A;  3CWV A;  4LF9 I;  4AQY E;  4OOG C;  2V34 A;  2N3G A;  4M1K A;  2F4V E;  4K0K I;  1Z59 A;  3WU5 A;  4GKJ I;  3Q1Q A;  1FI4 A;  4JI6 I;  2JVA A;  4GKK E;  2LJP A;  4KHP I;  4LF4 I;  4JYA E;  4DR6 E;  2L3C A;  1IBL E;  4JV5 E;  5FLX C;  2ZIT A;  3LNU A;  4DV2 I;  4LF7 I;  1Z0T A;  4DUZ E;  3T1Y E;  1N34 E;  2L2K B;  4JI3 E;  3K1J A;  3J80 C;  4LF5 I;  4URL A;  1XMO E;  1RC7 A;  3ZZ0 A;  4ZVI A;  4EMD A;  1X47 A;  3VYY A;  4DV0 I;  3ADL A;  4USK A;  4JI4 E;  4FW9 A;  4AQY I;  1KTV A;  4HAC B;  4FWH A;  4LFB E;  4B3M E;  3D4J A;  3HTX A;  4DV5 I;  2F4V I;  1X48 A;  4HAC A;  2DB2 A;  2LUP B;  1HNX E;  1Z0W A;  2WW4 A;  4X64 E;  1XNQ E;  2HKE A;  2NA2 A;  1FWK A;  4M2Z A;  4RPF A;  1N33 I;  3ZZU A;  4GKK I;  1X49 A;  1QU6 A;  1N0U A;  2EFG A;  2LTR A;  4X8W A;  3V2U C;  2UXB I;  1IBL I;  2DEI A;  4FN5 A;  4JV5 I;  2HK2 A;  3T1Y I;  1OJ4 A;  4WUB A;  1N34 I;  4DR2 E;  2NUE A;  2AJ4 A;  1XMO I;  4LFA E;  4DUY E;  3ZKD A;  4NXM I;  1KIJ A;  2UUC I;  4P7A A;  4DR4 E;  4JI4 I;  1EKZ A;  1Z0C A;  4DR5 E;  1FNM A;  4B3M I;  5IT9 C;  4LF6 I;  1HNX I;  2ZBK B;  4DXL A;  4I3H A;  1H7U A;  2BV3 A;  4JI1 I;  1VIS A;  5GME A;  5A2Q Q;  3ZKB A;  2VQF I;  1UHZ A;  2NUG A;  1FJG E;  4NXN E;  1ZM3 A;  1NHH A;  1WUU A;  3ZM7 A;  1FWL A;  1ZXM A;  5CFF E;  2L2M A;  1T4O A;  1RR9 A;  3PYD A;  4LF7 E;  1XMQ I;  2UUA E;  1Z5C A;  4DV6 I;  3PYG A;  1K47 A;  5FLX Q;  4DR4 I;  4DR3 I;  2L33 A;  1ZM9 A;  3C4B A;  3ZZT A;  2ZM6 E;  3LPS A;  3C4T A;  2V8P A;  1ZXN A;  1ZM4 A;  4HXZ A;  5A2Q C;  4X66 E;  1H73 A;  2E5L E;  3J81 Q;  4DV5 E;  4DU7 A;  3LTO A;  1EA6 A;  1RRE A;  4LFC E;  4WUC A;  2N3H A;  1N33 E;  1MG7 A;  1Z5A A;  1FJG I;  4NXN I;  4LF8 E;  2GS8 A;  2B7V A;  2UXB E;  4PRX A;  2RS7 A;  1WHQ A;  4DPW A;  1YYO A;  2UUA I;  1T4N A;  1EI1 A;  1PIE A;  2DIX A;  1PKP A;  1S4E A;  4ED4 A;  2UU9 E;  4PRV A;  4WYQ B;  4NXM E;  3J81 C;  2BM1 A;  2UUC E;  2HFS A;  2ZM6 I;  1QZR A;  2LTS A;  2EZ6 A;  1YZ9 A;  4XTJ A;  4B3S E;  4JI5 I;  4X66 I;  2X7I A;  2LRS A;  2E5L I;  2B3T B;  5GMD A;  4LF6 E;  4LFC I;  3V5R A;  4MYU A;  2MDR A;  2A2C A;  4DV7 I;  4WFT A;  4JI1 E;  4LF8 I;  3M6A A;  2R3V A;  5IT9 Q;  4YHH E;  2VQF E;  2BM0 A;  4DU8 A;  1DAR A;  1XMQ E;  1B63 A;  1HNW I;  3WU4 A;  2UU9 I;  4DV6 E;  2HFU A;  2VQE E;  3QT8 A;  4Z7C A;  5L3J A;  1NHJ A;  3QT5 A;  5BR8 E;  4DPY A;  4DR3 E;  4B3S I;  4DR1 I;  1PVG A;  4DR7 I;  1HR0 I;  3J7Y p;  2RS6 A;  3OTO I;  2UXC E;  1ZBT A;  1NHI A;  1H7S A;  2UUB I;  1MU5 A;  1HNZ I;  5IWA E;  4YHH I;  4DV3 I;  4P52 A;  2LUQ A;  3ADG A;  1D6T A;  4YY3 E;  1B62 A;  1N32 E;  2B7T A;  2HK3 A;  2DMY A;  1NZ0 A;  2VQE I;  3WU6 A;  5BR8 I;  1GQE A;  1ZM2 A;  2CZ9 A;  1ELO A;  4JI2 I;  1N0V C;  4HY1 A;  2VF3 A;  1XHK A;  3B8H A;  2UXC I;  4DPT A;  2J7K A;  4JI5 E;  3J7A G;  4Z7Y A;  1N36 E;  1IBM I;  5IWA I;  3JAM Q;  2IHR 1;  2R42 A;  4HYM A;  2L3J A;  4DV7 E;  4JG4 A;  2NPF A;  4JI0 I;  4YY3 I;  3ADI A; 
#chains in the Genus database with same CATH topology
 3B78 A;  1N32 I;  1YYW A;  1ZAA C;  2EPK X;  5A6A A;  2A2D A;  2WNR A;  1HK7 A;  3L00 A;  1GTK A;  1UIL A;  1N3G A;  2R1F A;  3VYX A;  3P3G A;  4FW5 A;  3B82 A;  4AIM A;  2YTP A;  2RQL A;  5LMN I;  2I9I A;  2YTN A;  2YU8 A;  2EOM A;  1HNW E;  2CPN A;  2CSH A;  1Y60 A;  2HJJ A;  4X62 E;  2BA1 D;  4IFD E;  1STU A;  2EOI A;  4DV1 E;  1UDS A;  2Z5E A;  3T1H I;  1WHN A;  5LLQ A;  2GHF A;  1IBK I;  3JAM C;  2EOR A;  2MDG A;  1L4S A;  4P7D A;  4MLQ A;  1U2R A;  2NUF A;  2EL5 A;  2LVH A;  4DR1 E;  4DR7 E;  2C39 B;  3ADJ A;  3THO B;  4OX9 E;  4OO1 E;  2KHX A;  1HR0 E;  1KKH A;  3PYE A;  1N36 I;  3BF2 A;  1BKN A;  2LJU A;  2WCC 3;  1DQ3 A;  3OTO E;  5A6K A;  2O3Z A;  5KL3 A;  2C39 A;  1A1L A;  1JK1 A;  4DV4 E;  2ENC A;  5DNL A;  2LJH A;  2E1R A;  3RMP A;  4IFD F;  2OI2 A;  2UUB E;  3J7A M;  2RSM A;  1G2D C;  3QT6 A;  4DPX A;  3BBG A;  1DGC A;  4MLV A;  3H4L A;  3H1C A;  2ODR D;  3GON A;  2EOX A;  3UK3 C;  1HNZ E;  2X36 A;  1RQ0 A;  2EPN A;  2YT4 A;  2UXD E;  1RHY A;  4DV3 E;  2FTX B;  1H72 C;  3K17 A;  5KL7 A;  1KYQ A;  4JI8 I;  1A1K A;  4X65 I;  2EPL X;  5K36 F;  2EMC A;  2YRK A;  1A1I A;  2YTE A;  1XNR E;  1E3P A;  4PU9 A;  1PJS A;  2LE2 A;  1Z0E A;  4DKK A;  4OZE A;  2EMG A;  4FWG A;  5C0X E;  2CVE A;  1B69 A;  4R03 A;  3OML A;  4BMJ A;  5LMU E;  3QT7 A;  4X62 I;  3LLH A;  2WBU A;  4F6M A;  4M30 A;  4DV1 I;  2M7Q A;  2PO1 B;  3IWB A;  2EM6 A;  3Q6M A;  4MYT A;  4O5G A;  4F2J C;  2EWL A;  2EM3 A;  2L92 A;  3KZY A;  2V2Q A;  4DPU A;  1E3H A;  2JT2 A;  4U3D A;  2PO1 A;  2YSO A;  4O43 A;  5DNY A;  1Z0G A;  4N3O A;  4DR6 I;  4JYA I;  2Q8U A;  1MEY C;  1PJT A;  1KJK A;  4JI2 E;  2DEJ A;  2PO2 B;  4OX9 I;  2YTQ A;  3BGH A;  1A6F A;  2EN7 A;  5FWK A;  3M7N G;  4B3T E;  4DUZ I;  2HHH E;  2VF1 A;  3EPH A;  1I94 E;  4KQV A;  2PO2 A;  1X3C A;  1EH8 A;  2DLK A;  4JI7 E;  4R2Q A;  4UT4 A;  4DV4 I;  3LML A;  4AID A;  4JI3 I;  3CDJ A;  3HJC A;  2Z5B B;  4BHC A;  3PYF A;  2V2V A;  2N8X A;  1IBM E;  1J5E E;  2Z5B A;  2G7H A;  1LLM C;  4B3R E;  2YU5 A;  2JY9 A;  4WUD A;  4R2E A;  4N4R B;  1USV A;  2UXD I;  3VK6 A;  2EOY A;  3IWD A;  2EP3 A;  4BC9 A;  4FK5 C;  3F0N A;  1J26 A;  4AM3 A;  4LFB I;  1XNR I;  5ADZ A;  4JI0 E;  4IJD A;  1BB8 A;  1FKA E;  2L2N A;  4LF9 E;  2WZO A;  1S16 A;  3WU3 A;  4X64 I;  2E72 A;  2HKJ A;  1XNQ I;  2V2Z A;  2YTJ A;  4USM A;  3P1X A;  5LMU I;  2HGH A;  4K0K E;  2BB8 A;  5JEA F;  4ZYG A;  1H74 A;  4IFD C;  4BCA A;  1T38 A;  5LMN E;  4LPF A;  2JOB A;  2M1S A;  4GKJ E;  1AH5 A;  4WXC A;  1MX0 A;  4JI6 E;  1YYK A;  3PS2 A;  3T1H E;  4R1F A;  1XXE A;  4B3T I;  3U1Y A;  4LCH A;  1UBD C;  1IBK E;  4KHP E;  1Z0V A;  3P3C A;  1MGT A;  5KL4 A;  4LF4 E;  1I94 I;  4JI7 I;  4FWD A;  5K36 C;  4DR2 I;  3EPL A;  2VES A;  1DI2 A;  4DV2 E;  1WRJ A;  5LL6 R;  3P76 A;  2B9D A;  3VHT B;  3H09 A;  5AE1 A;  1Z0B A;  2YTF A;  2C37 B;  4UTG A;  4DUY I;  1J5E I;  4LFA I;  2RTX A;  3HPS A;  1T4L B;  2EPM X;  4WPY A;  4B3R I;  2EN8 A;  2C37 A;  3JU0 A;  4LF5 E;  2EN6 A;  2Q2E B;  3B4T A;  4LCG A;  2LBS B;  2EE8 A;  1TF6 A;  2CTD A;  1UEK A;  2BA0 G;  2FGG A;  1USU A;  1Z5B A;  4GQU A;  2ENH A;  3P06 A;  2XEX A;  2M4I A;  4DR5 I;  4RH8 A;  1A1F A;  4R2P A;  5AE2 A;  4BC7 A;  5A6B A;  3HUL A;  4DV0 E;  3J80 Q;  4JI8 E;  1KVK A;  4X65 E;  1O0W A;  2EMK A;  3CWV A;  4LF9 I;  3AV0 A;  4AQY E;  2WP8 B;  4OOG C;  2V34 A;  2N3G A;  2E1M A;  2RSI A;  4R2C A;  3F6H A;  2EM2 A;  5A69 A;  2EOE A;  2EJ4 A;  2F4V E;  3CDI A;  4M1K A;  4IFD B;  4K0K I;  2BA1 G;  2WP8 A;  1IMU A;  1Z59 A;  3THN A;  1IQO A;  4Q35 B;  1OYR A;  2VE7 C;  5AC4 A;  3WU5 A;  4GKJ I;  4IFD A;  2K7I A;  2V87 A;  3Q1Q A;  4GEQ B;  2EPZ A;  1FI4 A;  2EMA A;  4JI6 I;  4LCF A;  2JVA A;  4ZYH A;  1AAY A;  4GKK E;  2EM9 A;  2LJP A;  4R2D A;  4FW7 A;  4F9C B;  4LF4 I;  4KHP I;  4JYA E;  5K36 B;  4DR6 E;  2EN4 A;  2L3C A;  4MDT A;  1IBL E;  1OYS A;  4JV5 E;  5FLX C;  3AUZ A;  2MKN A;  2ZIT A;  3LNU A;  3P3E A;  4DV2 I;  5K36 A;  1EH7 A;  4LF7 I;  1Z0T A;  4BBY A;  4DUZ E;  3T1Y E;  3M85 D;  1N34 E;  2GO4 A;  2L2K B;  1A1J A;  4JI3 E;  3DF6 A;  2O1V A;  3K1J A;  3MHH C;  4U3B A;  4HTG A;  5DRQ A;  3J80 C;  4LF5 I;  3U1K A;  1P47 A;  2YTG A;  4URL A;  5JEA C;  1XMO E;  1SR9 A;  1RC7 A;  3K85 A;  3F6G A;  3ZZ0 A;  2KON A;  2V85 A;  2GPI A;  4LU9 A;  4ZVI A;  5DNX A;  1X47 A;  2V83 A;  3VYY A;  4EMD A;  4DV0 I;  2HC5 A;  3ADL A;  4OO1 F;  2EN1 A;  4USK A;  4ZYE A;  4JI4 E;  4FW9 A;  3EPK A;  4AQY I;  1PJQ A;  1KTV A;  2PNM A;  4HAC B;  4FWH A;  4LFB E;  2EOO A;  2DRP A;  4B3M E;  3D4J A;  3HTX A;  4DV5 I;  2F4V I;  2NN6 E;  1X48 A;  4HAC A;  2DB2 A;  2O1W A;  2LUP B;  1HNX E;  1Z0W A;  2V8Q B;  2WW4 A;  4X64 E;  2GLI A;  1X6H A;  1XNQ E;  1WJP A;  2V86 A;  2DSY A;  2YRM A;  2HKE A;  2EM7 A;  2NA2 A;  1FWK A;  1T39 A;  4M2Z A;  4RPF A;  1N33 I;  3ZZU A;  4GKK I;  5F3W A;  2M9A A;  1X49 A;  1QU6 A;  4WX9 A;  1N0U A;  2LTR A;  4X8W A;  2EFG A;  3V2U C;  1WXR A;  2UXB I;  1IBL I;  2DEI A;  1A1G A;  4FN5 A;  4JV5 I;  4R8O A;  2HK2 A;  2EML A;  1X5W A;  2EMY A;  1UDO A;  3T1Y I;  3GCM A;  1A1H A;  1OJ4 A;  4WUB A;  1N34 I;  5IV8 B;  1X6E A;  5C0X F;  2K4V A;  4DR2 E;  2NUE A;  2H36 X;  2AJ4 A;  5JEA B;  2WBT A;  1XMO I;  2YTD A;  2EM8 A;  2ELZ A;  4DUY E;  4LFA E;  4I8O A;  3ZKD A;  2WBS A;  5JEA A;  3IWC A;  4NXM I;  2CT1 A;  2EOQ A;  5A6B D;  1KIJ A;  2UUC I;  4RHB B;  2ADR A;  2A25 A;  1F2I G;  2EMX A;  4P7A A;  4DR4 E;  1YPN A;  1JK2 A;  1TF3 A;  4JI4 I;  1EKZ A;  4YY3 I;  1Z0C A;  5KL2 A;  4DR5 E;  4TUG A;  1FNM A;  4QNK A;  2JPA A;  1BBG A;  4B3M I;  2MKD A;  5IT9 C;  4LF6 I;  2J65 A;  3JTZ A;  1HNX I;  4IFD D;  2V89 A;  2ZBK B;  2PNZ B;  4DXL A;  4I3H A;  4F6N A;  4JI0 I;  1H7U A;  2EMF A;  2BV3 A;  5DRP A;  3L7Z B;  5AAS A;  1OYP A;  4JI1 I;  2IOQ A;  2PNZ A;  1VIS A;  5GME A;  2LCE A;  5A2Q Q;  3L7Z A;  2GQ0 A;  3ZKB A;  2VQF I;  1UHZ A;  2EN3 A;  3MSW A;  5K36 D;  2NUG A;  1FJG E;  2EPU A;  1YUJ A;  4NXN E;  2JYA A;  1ZM3 A;  4X9J A;  1NHH A;  1WUU A;  4OO1 C;  5EKW A;  2EL4 A;  2VRD A;  4TUI A;  3ZM7 A;  1FWL A;  1ZXM A;  5CFF E;  2L2M A;  2EPX A;  4OKG A;  1T4O A;  1UN6 B;  1RR9 A;  3PYD A;  4LF7 E;  2IER A;  1XMQ I;  3HQ1 A;  5KL5 A;  4FW4 A;  3DJW A;  2UUA E;  5AE3 A;  1Z5C A;  2IOP A;  4DV6 I;  1NCS A;  2O1T A;  2JXP A;  1Y6Z A;  4QNJ A;  3PYG A;  2DGC A;  1K47 A;  2JEB B;  5FLX Q;  4ZYD A;  4DR4 I;  4DR3 I;  4IZJ A;  3TQM A;  2L33 A;  2PRT A;  4KWY A;  2EN2 A;  1ZM9 A;  3C4B A;  2JEB A;  3ZZT A;  4R2S A;  1UDN A;  2ZM6 E;  2Z5C B;  3C4T A;  3LPS A;  1NEI A;  4IZK B;  2V8P A;  3C6M A;  5TSE A;  1ZXN A;  1ZM4 A;  1R6M A;  2YWQ A;  2Z5C A;  5A2Q C;  4HXZ A;  4IZK A;  2NN6 C;  2EM4 A;  2EOH A;  4MU3 A;  2DLQ A;  2LMZ A;  4X66 E;  1YSA C;  1YUI A;  2EPA A;  2E5L E;  1H73 A;  2CG9 A;  4DV5 E;  5C0X C;  4DU7 A;  2L6M A;  3J81 Q;  3LTO A;  1EA6 A;  2ENA A;  2BR2 B;  3KRN A;  1RRE A;  1ZBQ A;  4LFC E;  1UDQ A;  2F8B A;  2EM5 A;  2BR2 A;  2D9H A;  2CGE A;  4WUC A;  2RPC A;  2EOF A;  2N3H A;  1N33 E;  1MG7 A;  1Z5A A;  3NZK A;  3PS3 A;  3PRY A;  4NXN I;  3QG5 C;  4OO1 B;  4LF8 E;  1FJG I;  2LO3 A;  2EPP A;  1GZ6 A;  2GS8 A;  2B7V A;  3M85 G;  4NHR A;  2UXB E;  4LOM A;  4PRX A;  4OO1 A;  2RS7 A;  2GO3 A;  4ISA A;  4MU4 A;  1WHQ A;  4DPW A;  2EPR A;  3BID A;  1YYO A;  2UUA I;  5JEA D;  1T4N A;  1EI1 A;  1PIE A;  2DIX A;  4M9V C;  5IXM B;  1Y4S A;  2JR1 A;  2YTO A;  1PKP A;  4L5N C;  1S4E A;  4R2A A;  2UU9 E;  4PRV A;  4ED4 A;  4WYQ B;  4J8Z A;  4NXM E;  3J81 C;  2BM1 A;  2UUC E;  2HFS A;  2JP9 A;  2ZM6 I;  3ZOQ B;  2BBG A;  1QZR A;  2LTS A;  2EZ6 A;  1YZ9 A;  2NN6 B;  4XTJ A;  4B3S E;  4JI5 I;  4P78 A;  2EQ0 A;  2YSP A;  4X66 I;  5C0X B;  2YZT A;  2LRS A;  2NN6 A;  2X7I A;  2E5L I;  5K36 E;  4O4K A;  2JE6 B;  2B3T B;  5GMD A;  5C0X A;  1IQS A;  1QNT A;  2MC6 A;  1Z1B A;  4LF6 E;  2EM0 A;  1Y5Y A;  4LFC I;  3V5R A;  4MYU A;  2MDR A;  4Q28 A;  4F9B B;  2JE6 A;  2R76 A;  2V88 A;  2A2C A;  4DV7 I;  2EMH A;  2ELY A;  4WFT A;  4JI1 E;  2EPO A;  1VI7 A;  4LF8 I;  2YTI A;  2R3V A;  3M6A A;  5IT9 Q;  2EMZ A;  4IS1 C;  4YHH E;  4O24 A;  2JOX A;  2VQF E;  2BM0 A;  2ODR C;  1ZR9 A;  3K6Q A;  2C38 B;  4DU8 A;  4BA1 B;  2NN6 F;  3Q6N A;  2J7J A;  3EPJ A;  2EPC A;  2C38 A;  5DRR A;  4BA1 A;  2HHH I;  1DAR A;  1P42 A;  1XMQ E;  2JWO A;  1B63 A;  4HEI A;  4F9A B;  2IES A;  4IZJ D;  3WU4 A;  1HNW I;  2UU9 I;  4DV6 E;  2HFU A;  2L8T A;  4MQY A;  2NAB A;  2VQE E;  2PNL A;  3QT8 A;  4Z7C A;  5L3J A;  1NHJ A;  3QT5 A;  5ELW A;  5BR8 E;  1G2F C;  4L8N A;  2AE8 A;  2I13 A;  4DPY A;  3GME A;  3UHM A;  4BHB A;  4DR3 E;  4B3S I;  4MU1 A;  4DR1 I;  1PVG A;  4DR7 I;  1HR0 I;  3HXL A;  3J7Y p;  2RS6 A;  3OTO I;  4NBQ A;  2KOU A;  4DMI A;  4F54 A;  4GZN C;  2UXC E;  5AC5 A;  4FW6 A;  5EL9 A;  1PDA A;  1ZBT A;  3ECR A;  5KL6 A;  1NHI A;  1YH8 A;  3M7N D;  4WSP A;  1H7S A;  4WSG A;  2EQ3 A;  2UUB I;  1MU5 A;  1HNZ I;  5IWA E;  2LT7 A;  2EQ1 A;  2EMW A;  5JEA E;  1TN9 A;  3HPZ A;  4YHH I;  4OO1 D;  4DV3 I;  4P52 A;  2MC5 A;  1Y4U A;  4MU0 A;  2LUQ A;  1ZU1 A;  1EH6 A;  2EOJ A;  4FW3 A;  4KZS A;  3ADG A;  1D6T A;  3FIG A;  2EOS A;  3KWR A;  2EL6 A;  2PO0 B;  4YY3 E;  1B62 A;  1YFH A;  2DMI A;  1YHC A;  1N32 E;  3M99 B;  4IS9 A;  2B7T A;  3EQ1 A;  2PO0 A;  2HK3 A;  2DMY A;  1NZ0 A;  5T6J A;  2VQE I;  3C6K A;  4WXD A;  4J3D A;  3WU6 A;  4IZJ B;  5BR8 I;  1GQE A;  1ZM2 A;  1BBO A;  2LV2 A;  2YPN A;  1R6L A;  3MHS C;  2CZ9 A;  1ELO A;  1RMD A;  4JI2 I;  2FV4 B;  1N0V C;  2F1D A;  2NN6 D;  4NZV A;  5DRO A;  2EMI A;  4HY1 A;  2VF3 A;  1XHK A;  3DD6 A;  3GLL A;  5C0X D;  5A6J A;  2O1U A;  3B8H A;  2JEA B;  2UXC I;  4DPT A;  2J7K A;  4JI5 E;  3J7A G;  3KZZ A;  3PS1 A;  4Z7Y A;  4M0V A;  2EOZ A;  2JEA A;  1N36 E;  2EMB A;  1IBM I;  1SFE A;  5IWA I;  3JAM Q;  2IHR 1;  4R2R A;  3HKM A;  2YRH A;  2R42 A;  4BS9 A;  2L3J A;  4HYM A;  4DV7 E;  4JG4 A;  4BA2 B;  4LTY A;  4BA2 A;  2NPF A;  2WNR B;  2BA0 D;  1X6F A;  3ADI A; 
#chains in the Genus database with same CATH homology
 3B78 A;  1N32 I;  1YYW A;  2A2D A;  1HK7 A;  1UIL A;  3VYX A;  3B82 A;  5LMN I;  1HNW E;  2CPN A;  4X62 E;  1STU A;  4DV1 E;  2Z5E A;  3T1H I;  1WHN A;  1IBK I;  3JAM C;  4P7D A;  1U2R A;  2NUF A;  4DR1 E;  4DR7 E;  3ADJ A;  4OX9 E;  2KHX A;  1HR0 E;  1KKH A;  3PYE A;  1N36 I;  1BKN A;  1DQ3 A;  3OTO E;  4DV4 E;  2LJH A;  2E1R A;  3RMP A;  2OI2 A;  2UUB E;  3J7A M;  2RSM A;  3QT6 A;  4DPX A;  3H4L A;  2ODR D;  3GON A;  1HNZ E;  2X36 A;  1RQ0 A;  2YT4 A;  2UXD E;  4DV3 E;  2FTX B;  1H72 C;  3K17 A;  4JI8 I;  4X65 I;  1XNR E;  4PU9 A;  2LE2 A;  1Z0E A;  4DKK A;  4FWG A;  4R03 A;  3OML A;  4BMJ A;  5LMU E;  3QT7 A;  4X62 I;  3LLH A;  4M30 A;  4DV1 I;  2M7Q A;  3IWB A;  3Q6M A;  4MYT A;  2EWL A;  2L92 A;  2V2Q A;  4DPU A;  4JYA I;  4DR6 I;  1Z0G A;  5DNY A;  4N3O A;  2DEJ A;  4JI2 E;  4OX9 I;  1A6F A;  5FWK A;  4B3T E;  4DUZ I;  2HHH E;  2VF1 A;  1I94 E;  4KQV A;  4UT4 A;  4JI3 I;  4JI7 E;  4DV4 I;  3LML A;  3HJC A;  2Z5B B;  3PYF A;  2V2V A;  1IBM E;  1J5E E;  2Z5B A;  2G7H A;  4B3R E;  2JY9 A;  4WUD A;  2UXD I;  1USV A;  3VK6 A;  3IWD A;  4BC9 A;  3F0N A;  1J26 A;  4LFB I;  1XNR I;  5ADZ A;  4JI0 E;  1FKA E;  2L2N A;  4LF9 E;  2WZO A;  1S16 A;  3WU3 A;  4X64 I;  2HKJ A;  1XNQ I;  2V2Z A;  4USM A;  5LMU I;  3P1X A;  4K0K E;  1H74 A;  4BCA A;  5LMN E;  2JOB A;  2M1S A;  4GKJ E;  1MX0 A;  4JI6 E;  1YYK A;  3T1H E;  4R1F A;  4B3T I;  2HHH I;  1IBK E;  4KHP E;  1Z0V A;  1I94 I;  4LF4 E;  4JI7 I;  4FWD A;  4DR2 I;  1DI2 A;  4DV2 E;  5LL6 R;  2B9D A;  1Z0B A;  3H09 A;  5AE1 A;  4UTG A;  4LFA I;  4DUY I;  1J5E I;  2RTX A;  3HPS A;  1T4L B;  4B3R I;  4WPY A;  3JU0 A;  4LF5 E;  2Q2E B;  2LBS B;  1UEK A;  2FGG A;  1USU A;  1Z5B A;  3P06 A;  2XEX A;  2M4I A;  4DR5 I;  5AE2 A;  4BC7 A;  3HUL A;  4DV0 E;  3J80 Q;  4JI8 E;  1KVK A;  4X65 E;  1O0W A;  3CWV A;  4LF9 I;  3AV0 A;  4AQY E;  4OOG C;  2V34 A;  2N3G A;  2E1M A;  2CG9 A;  3F6H A;  4M1K A;  2F4V E;  4K0K I;  1Z59 A;  2VE7 C;  3WU5 A;  4GKJ I;  2V87 A;  3Q1Q A;  4GEQ B;  1FI4 A;  4JI6 I;  2JVA A;  4GKK E;  2LJP A;  4KHP I;  4F9C B;  4LF4 I;  4JYA E;  4DR6 E;  2L3C A;  1IBL E;  4JV5 E;  5FLX C;  3AUZ A;  2ZIT A;  3LNU A;  4DV2 I;  4LF7 I;  1Z0T A;  4BBY A;  4DUZ E;  3T1Y E;  1N34 E;  2L2K B;  4JI3 E;  3K1J A;  3DF6 A;  2O1V A;  3J80 C;  4LF5 I;  4URL A;  1XMO E;  1SR9 A;  1RC7 A;  3K85 A;  3F6G A;  3ZZ0 A;  2KON A;  2V85 A;  4ZVI A;  4LU9 A;  4EMD A;  1X47 A;  2V83 A;  3VYY A;  4DV0 I;  3ADL A;  4USK A;  4JI4 E;  4FW9 A;  4AQY I;  1KTV A;  2PNM A;  4HAC B;  4FWH A;  4LFB E;  4B3M E;  3D4J A;  3HTX A;  4DV5 I;  2F4V I;  1X48 A;  4HAC A;  2DB2 A;  2O1W A;  2LUP B;  1HNX E;  1Z0W A;  2V8Q B;  2WW4 A;  4X64 E;  1XNQ E;  2V86 A;  2DSY A;  2HKE A;  2NA2 A;  1FWK A;  4M2Z A;  4RPF A;  1N33 I;  3ZZU A;  4GKK I;  5F3W A;  1X49 A;  1QU6 A;  1N0U A;  2EFG A;  2LTR A;  4X8W A;  3V2U C;  1WXR A;  2UXB I;  1IBL I;  2DEI A;  4FN5 A;  4JV5 I;  4R8O A;  2HK2 A;  3T1Y I;  1OJ4 A;  4WUB A;  1N34 I;  2K4V A;  4DR2 E;  2NUE A;  2H36 X;  2AJ4 A;  1XMO I;  4LFA E;  4DUY E;  3ZKD A;  4I8O A;  3IWC A;  4NXM I;  1KIJ A;  2UUC I;  4P7A A;  4DR4 E;  4JI4 I;  1EKZ A;  1Z0C A;  4DR5 E;  1FNM A;  4TUG A;  4B3M I;  5IT9 C;  4LF6 I;  3JTZ A;  1HNX I;  2V89 A;  2ZBK B;  4DXL A;  4I3H A;  1H7U A;  2BV3 A;  5AAS A;  4JI1 I;  2IOQ A;  1VIS A;  5GME A;  5A2Q Q;  2GQ0 A;  3ZKB A;  2VQF I;  1UHZ A;  3MSW A;  2NUG A;  1FJG E;  4NXN E;  1ZM3 A;  1NHH A;  1WUU A;  4TUI A;  3ZM7 A;  1FWL A;  1ZXM A;  5CFF E;  2L2M A;  1T4O A;  1RR9 A;  3PYD A;  4LF7 E;  1XMQ I;  3HQ1 A;  3DJW A;  2UUA E;  5AE3 A;  1Z5C A;  2IOP A;  4DV6 I;  2O1T A;  1Y6Z A;  3PYG A;  1K47 A;  5FLX Q;  4DR4 I;  4DR3 I;  4IZJ A;  2L33 A;  1ZM9 A;  3C4B A;  3ZZT A;  2ZM6 E;  2Z5C B;  3C4T A;  3LPS A;  4IZK B;  2V8P A;  1ZXN A;  1ZM4 A;  2Z5C A;  4HXZ A;  5A2Q C;  4IZK A;  4X66 E;  2LMZ A;  1H73 A;  2E5L E;  3J81 Q;  4DV5 E;  4DU7 A;  2L6M A;  3LTO A;  1EA6 A;  1RRE A;  1ZBQ A;  4LFC E;  2F8B A;  2CGE A;  4WUC A;  2N3H A;  1N33 E;  1MG7 A;  1Z5A A;  3PRY A;  1FJG I;  4NXN I;  4LF8 E;  1GZ6 A;  2GS8 A;  2B7V A;  2UXB E;  4PRX A;  2RS7 A;  1WHQ A;  4DPW A;  1YYO A;  2UUA I;  1T4N A;  1EI1 A;  1PIE A;  2DIX A;  1Y4S A;  2JR1 A;  1PKP A;  4L5N C;  1S4E A;  4ED4 A;  2UU9 E;  4PRV A;  4WYQ B;  4J8Z A;  4NXM E;  3J81 C;  2BM1 A;  2UUC E;  2HFS A;  2ZM6 I;  3ZOQ B;  1QZR A;  2LTS A;  2EZ6 A;  1YZ9 A;  4XTJ A;  4B3S E;  4JI5 I;  4P78 A;  4X66 I;  2YZT A;  2LRS A;  2X7I A;  2E5L I;  2B3T B;  5GMD A;  2MC6 A;  4LF6 E;  4LFC I;  3V5R A;  4MYU A;  2MDR A;  4Q28 A;  4F9B B;  2V88 A;  2A2C A;  4DV7 I;  4WFT A;  4JI1 E;  4LF8 I;  3M6A A;  2R3V A;  5IT9 Q;  4YHH E;  2JOX A;  2VQF E;  2BM0 A;  2ODR C;  3K6Q A;  4DU8 A;  3Q6N A;  1DAR A;  1XMQ E;  2JWO A;  1B63 A;  4F9A B;  4IZJ D;  3WU4 A;  1HNW I;  2UU9 I;  4DV6 E;  2HFU A;  2L8T A;  2VQE E;  2PNL A;  3QT8 A;  4Z7C A;  5L3J A;  1NHJ A;  3QT5 A;  5BR8 E;  4L8N A;  4DPY A;  4DR3 E;  4B3S I;  4DR1 I;  1PVG A;  4DR7 I;  1HR0 I;  3HXL A;  3J7Y p;  2RS6 A;  3OTO I;  2KOU A;  4DMI A;  4F54 A;  2UXC E;  1ZBT A;  1NHI A;  4WSP A;  1H7S A;  2UUB I;  1MU5 A;  1HNZ I;  5IWA E;  3HPZ A;  4YHH I;  4DV3 I;  4P52 A;  2MC5 A;  1Y4U A;  2LUQ A;  4KZS A;  3ADG A;  1D6T A;  3FIG A;  3KWR A;  4YY3 E;  1B62 A;  1N32 E;  2B7T A;  2HK3 A;  2DMY A;  1NZ0 A;  5T6J A;  2VQE I;  3WU6 A;  4IZJ B;  5BR8 I;  1GQE A;  1ZM2 A;  2CZ9 A;  1ELO A;  4JI2 I;  2FV4 B;  1N0V C;  4HY1 A;  2VF3 A;  1XHK A;  2O1U A;  3B8H A;  2UXC I;  4DPT A;  2J7K A;  4JI5 E;  3J7A G;  4Z7Y A;  4M0V A;  1N36 E;  1IBM I;  5IWA I;  3JAM Q;  2IHR 1;  2R42 A;  4BS9 A;  2L3J A;  4HYM A;  4DV7 E;  4JG4 A;  4LTY A;  2NPF A;  4JI0 I;  4YY3 I;  3ADI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...