3GMEA

Crystal structure of polynucleotide phosphorylase in complex with rnase e and manganese
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
545
structure length
482
Chain Sequence
b'MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFRPSEGETLIARLIDRPIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPVNEALNARVTDKQERYLHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTDTFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQAINAPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyribonucleotide nucleotidyltransferase
publication title Crystal structure of Escherichia coli polynucleotide phosphorylase core bound to RNase E, RNA and manganese: implications for catalytic mechanism and RNA degradosome assembly.
pubmed doi rcsb
molecule tags Transferase / protein binding
total genus 128
structure length 482
sequence length 545
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 3gmeA02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gmeA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gmeA01
4IFDA 4OO1F 5K36A 5JEAF 4BA2A 2JEBA 2BR2B 2NN6D 5C0XB 2WNRA 4AIDA 5K36F 2BA1D 2BA0G 3CDJA 5C0XE 3M85G 2NN6F 4OO1C 5JEAC 1E3PA 2JE6B 2C38A 2PO1A 4OO1B 5JEAB 1UDSA 2WP8A 2PO0B 4AIMA 4IFDF 2PNZB 5C0XA 4BA1B 2PO2B 2NN6C 4AM3A 3HKMA 4OO1E 5JEAE 3GLLA 3GCMA 2BA1G 1R6LA 2NN6B 2C37A 3CDIA 2JEAB 2C39B 3L7ZB 5C0XD 4NBQA 4IFDC 5K36C 1WHUA 2JE6A 3M7ND 2BR2A 3H1CA 4OO1A 3H36A 5JEAA 2NN6E 4IFDB 5K36B 4BA2B 2PO0A 2JEBB 2PNZA 3U1KA 2WNRB 5C0XF 1E3HA 3DD6A 2PO2A 2WP8B 2BA0D 3GMEA 1UDNA 1OYSA 4IFDE 5K36E 3M85D 4OO1D 1OYPA 5JEAD 2NN6A 2JEAA 2C39A 3L7ZA 3B4TA 1UDQA 1UDOA 2C37B 4IFDD 5K36D 1OYRA 1R6MA 5C0XC 2C38B 4BA1A 2PO1B 3KRNA 3M7NG
chains in the Genus database with same CATH superfamily
3IH2A 2EJRA 1FYKA 3EYIA 1AA7A 2X1DA 4C2TA 3ZMSA 2XAUA 3LOCA 2YSRA 3ZQFA 4KDPA 3Q3SA 3MKLA 4V19K 2O03A 3M8FA 3T1YI 2X6YA 4LG0A 1BI3A 1A6FA 4JX4A 3R61A 4XLEA 3G1LA 3CCSI 4OZEA 4DQ2A 3IH3A 1RR9A 1G8XA 4XN3A 4LLGF 2WV1A 4A3IJ 1BOAA 2JPBA 1TQIA 3PIOF 4I0AA 1Y6ZA 3KYCB 3TP3A 3HOXJ 1D1CA 3ZQ7A 1R1TA 1JJ6C 4JI8E 2UWMA 5FLMJ 3LSPA 2DT5A 2AE8A 5K7ZA 2A6TA 3TP0A 3MCZA 3FXRA 2HHHI 2OD5A 3P76A 1YS7A 2F4OB 3A02A 2JUGA 1XD7A 4IHWA 1FSHA 4RM3A 2KHMA 4PDKA 4BA1B 2A61A 3ZZ0A 4MTEA 1OKRA 1VI0A 3JTGA 4N4NB 4IS9A 4KITB 1KQ8A 2JA5J 4B3ME 1FWLA 1YHCA 5D5WB 2V2QA 3K1JA 2TDXA 1R1UA 3QOPA 4D5FA 5IYDJ 2BXZA 3IKTA 2Y2ZA 4KISA 4XLCA 2K27A 3L7WA 5J1RA 2C37A 4C30A 4Y52J 2WAFA 2EFGA 2MG4A 1WKMA 1YJWI 2YX4A 2G7UA 2DCEA 2F4IA 2XVCA 3CD6I 3QOEA 5EZGA 4DR7E 5IOZA 1B72B 3AL0C 1J5EE 4B3RI 1HXDA 5FFZA 2EINH 5HDKA 2EFWA 4YIFA 1XB4A 4IO9F 4LF4I 3ESWB 1IBLI 1W4MA 4DV7I 2E60A 2LKSA 4W1UA 4IOAF 2MFZA 1RKWA 1Z7LA 3OYGA 5EG0A 3U1KA 2YPRA 3U21A 1HNXE 2IGMA 2O5RA 2OTLI 3DD6A 2E1MB 4UXNA 4A3BJ 3MKWB 4KN4X 2K3PA 3ZQCA 2M8EA 1FMVA 1S8NA 1PKPA 1CF7A 1HSJA 1OYPA 1IC8A 5JEAD 3UNGC 5DCFA 2VBYA 4MFEA 3GVAA 1H0MA 3HPHA 2DQLA 3RKWA 3SZPA 1S3JA 1MX0A 5LGTA 5ED4A 2I10A 4KIBA 4KUMA 3SDBA 2NXNB 5B66C 4PUSA 3QQAA 2VUMJ 3FMRA 4HDUA 5D8LB 3KRNA 3M7GA 1EI1A 3E7LA 4OOIA 1N33I 4M6XA 4ZDLA 4MLOA 2D5VA 1H73A 4DPUA 3TEDA 1T08B 5M5WJ 4N3OA 4CZCA 4CCLA 3ABMH 2ZKZA 3SZGA 5CQEA 4IOCF 5EEGA 5FB2A 1LE8B 1NHAA 2TRTA 2HFSA 5D5XB 2E7WA 2NVUB 1OCTC 1N34I 2HOAA 3PNTA 2ISYA 1X4OA 2ZO4A 4I76A 1N75A 4ESBA 4CICA 4IJAA 4J01A 4GXOA 2IGKA 2Y75A 3B78A 1ON1A 2EQRA 3OR2C 5J6XA 4DV3I 5IWAE 3A01A 1J5YA 3J7AO 4ZDPA 1LUJB 4D5CA 3PL8A 4HZFA 3QODA 2ADUA 3D5SC 2O61A 3J81C 2NPFA 4JI5E 4DUZI 4XK4A 3FISA 2CQXA 1HBXG 1RZ4A 3JRIA 4UUTA 1O57A 4M73A 2BHYA 2Z99A 3J7ZI 2R7UA 4FW4A 4NXMI 1Z6TA 2XASA 2LRDA 3VSLA 3WTXC 4LF7E 5GMEA 3I64A 4F91B 1Y1VJ 2PN6A 4UHTA 4EGZA 1ZH5A 4XR6A 2IS2A 1MNEA 2QGUA 4IL6C 3FXJA 2VT3A 3CC4I 2G0EA 3DTKA 1LJ9A 3A0BC 4LIVA 2E19A 3LQQA 4BYYA 4OKGA 5HNHA 1HNZE 3KYDB 1RHYA 2EV0A 2QQ8A 5F1RA 2X6WA 1QZEA 4PFOA 1UAAA 1MH3A 3LAPA 1WJAA 1W7PA 3LSKA 2EIJH 2LTPA 4FT8A 1MNMC 4FX4A 2DEJA 1XNRE 2F5CA 2Z16A 4E7KA 3ZRGA 3OOUA 3WU1B 3HRUA 3BR0A 2UXDE 4M3FA 1MSFC 4NQWA 1X58A 5GTHC 1HLVA 3S16J 3WTTC 3KPHA 3BTJA 4R8HA 3CO6C 3DEUA 3S1MJ 3QRFF 1V54H 4L9NA 3VYUB 2XRNA 4CCJA 3IL2A 2R5YA 2F1DA 4U3DA 4BA2B 4BHCA 5B1AH 4GKKI 2YX7A 3PYDA 4WXHA 4Y17A 3E97A 1W5TA 4A12A 1B63A 3FKIJ 4URLA 2JWTA 3S1NJ 3AG2H 4U0VA 4RGXA 4F93B 2STTA 3IRRA 1DP3A 1MJ9A 2CVEA 1IN7A 1MDMA 4J3DA 1TBXA 2EIMH 3VYSB 2HVSA 4DV0I 1KONA 2M4KA 2OCEA 4PSWA 1D8JA 3CQZJ 2FOWA 2XPVA 3P9KA 2XAGA 2XC7A 2W25A 2DO7A 4UVBA 1JT0A 2C39A 1MIJA 3GTPJ 5L3FA 5KNLA 3ZQGA 4BXUA 2JRMA 2B63J 3HIFA 1I1SA 4PU9A 4RA2A 1SFOJ 3UHMA 5HNFA 3D1NI 2C37B 2XPUA 3V2UC 2L2OA 2Q0OA 5K5RA 4ASNA 2K9LA 2E5NA 1R6MA 4AYBN 2O9LA 3J7AY 1H72C 1FBUA 2L0KA 2HTSA 4JYKA 2FE3A 2GXGA 3OS0A 3BG6A 3CJTB 2EBIA 2JEBA 4RM2A 4M3EA 2MYSA 4IHTA 1IV8A 2A69F 2X1CA 3GBGA 3HPGA 5IP7J 4DR1I 5K7FA 2QVOA 5E3MA 2M87A 1B8IA 1VQ9I 3IUOA 3ZMUA 1KKHA 2LFBA 4XKCA 5FKOA 4YG2F 1SC7A 5L3JA 3UR3C 1RC9A 1ONVA 2YU9J 3BCAA 3HSEA 5EEHA 3S32A 3K17A 4JI1E 2FF4A 2DMTA 1BBYA 3AKZA 5IT9K 2YUSA 4E7JA 4HBLA 4QIWN 5FD5A 1WRJA 4OMYA 5LMNI 3S8PA 2Z9OA 1J2XA 2X85A 4NDLA 1ZXNA 4CCOA 3AFHA 3V42A 5DD4A 4BQQA 3PNVA 2FX0A 5LEKA 5HOOA 3V7CA 4PJ0C 2ZBKB 4CO8A 2CYYA 4AIMA 3BQZA 4DR4E 3M6AA 2W7NA 2VQCA 1I6XA 4G12A 1DUXC 4GFBA 2KJCA 4P52A 4ZVIA 1TP4A 3N4MA 3OYDA 2D1HA 1LVKA 1WVRA 1FTZA 3WE2A 1FT9A 4DU8A 1MW7A 3SJMA 2R7VA 2GZWA 2AQFA 3JW4A 3KZYA 3PO2J 2XAJA 2ZCWA 2KFDA 4JBAA 3JRDA 1AWCA 1GV5A 3L2CA 1FYMA 4DV2I 2PBIA 2FNPA 2WTEA 1VQ7I 3DV8A 4RS8A 5F1JA 2E36A 3F22A 5FRNA 3H9GA 3P3CA 3OTOI 3EUKL 4RLFA 4ZJZA 1APLC 5FD6A 1KVKA 3Q9VA 2E1MC 4MYTA 4B3MI 4S0HB 5K36B 5GADJ 3OSGA 1HR0I 1I1GA 2PNZA 3FXUA 2PMZN 1FKAE 4GCVA 1WWXA 1Y4SA 4DR2I 4Z2YA 2XAQA 1E3HA 4OX9I 2KDOA 2IS4A 1WJBA 1LEBA 4ANJA 1U3EM 1MBGA 3ERMA 2PFBA 3KZZA 3QT5A 1JT6A 2MH9A 1Y0NA 3BZ6A 3BROA 2W1OA 2VLAA 3RKQA 5M5YJ 4E6KG 3DF8A 1R4NB 1MBHA 1UFMA 1BR1A 3H92A 3GLXA 2UXNA 4P5OA 1R7JA 5E1ZB 4B3AA 2WB1A 4LOMA 4HYEA 2J65A 1SVOA 2MH2A 1PYVA 4QNKA 4EGYA 3KEOA 4NHJA 2DOEA 4M9XA 3KETA 3Q0VA 2V8PA 1U9OA 4U7DA 3FIWA 3T0YA 1W7PB 1EH8A 3I55I 2Y31A 5EYRA 1D0XA 2F5VA 4KMFA 1ZG5A 1FNNA 1YOVB 2GO3A 3B82A 2OJED 3CMAI 4E7IA 4IPAA 1G2HA 3T8TA 2Z5BA 4GYGA 5DNXA 4LCHA 4UVAA 1SVLA 2XF6A 4JYAE 3JTHA 4DV4E 1ETOA 3CJRB 3TOBA 1FOYA 2R5YB 2CV2A 3PO3J 4NXNE 4XKWA 2N8GA 3QPHA 2VPRA 3J81Z 3NZKA 1AKHB 4BQNA 2XUBA 3I0TA 3CCMI 3BG9A 1YTYA 1A36A 1LDJA 2XSDC 1YW7A 1QVTA 3CUOA 4IVNA 4B3XA 2GIVA 3V8LA 1WUUA 5D5UB 1U9NA 4QWQA 2O0YA 2DA5A 2A3SA 1SFEA 2DJNA 2M34A 3FHNA 3IAS2 3LWFA 4XKVA 2GA1A 5F0CA 1TW2A 1MDMB 1WI9A 1JGGA 1JI8A 1XNQI 1QO0D 1DGWY 1LNWA 3I71A 4DW6A 2JE6B 4AVPA 1U2RA 4UB6C 3RSNA 2VESA 4P9FA 2MLGA 4PCQA 5F64A 1X3ZB 4YFXF 3BPVA 2DI3A 2HZDA 3LSGA 4G94A 4CCKA 2KZVA 2HKJA 3S93A 5J47A 2L9SA 2P0WA 3OMYA 1XC5A 2CQNA 3HEFA 1H8AC 4XONA 3GTLJ 3I58A 1TT0A 3BZKA 3J7AG 2A07F 4IKFA 2BGCA 2VJIA 1KU7A 4HNTA 4FHTA 1B8IB 3S2DJ 5IWAI 2OI2A 4IRIA 3IC7A 1VQ8I 1V5GA 4XOPA 3J7AM 3GLLA 1QPMA 2ZJPF 3DFGA 4JI5I 1LKXA 2M7AA 2XAHA 1U5TA 2Y0SN 2ZNYA 2MSYA 4KT6A 1WHUA 4O5VA 2DLLA 2O6GE 4LF7I 4JV5I 3HKZA 1K6YA 4DUYI 3FK7A 3E5XA 3H1CA 2VQHA 2FOKA 4ITVA 4X1EA 5J1UA 2HVRA 4MU0A 4B3RE 4AU7A 3H36A 4LF4E 1I3QJ 2BY3A 4WF2A 1K78A 3PJRA 4DV7E 4IFDB 4B8XA 3CCQI 3LMMA 4L0YB 3JRCA 4MHGA 2B7EA 4LF9E 1HOMA 3TL4X 5D4RA 2W24A 1CGPA 5CVIA 5EZHA 3ASNH 4XBFA 3M07A 2LY9A 2K9MA 1Y8RB 2OUMA 2FA5A 1IXRC 2IS1A 4BE2A 2K40A 3B6CA 5F27A 3GTGJ 2DA4A 3FXOA 5HDNA 5ELWA 1FYLA 3H0DA 1POGA 4GQUA 5K36E 1EJ9A 4BJTA 1N78A 5E20A 4GDFA 3OIOA 2NN6A 2Z5EA 4P7AA 3D5RC 2UXDI 2V79A 1YIOA 4KNYA 3M9AA 4UT4A 3OS2A 3SEZA 4FE7A 4L5JA 4F55A 2HQ5A 3CESA 2RKHA 4RAGA 4YY3E 2DT6A 2W48A 1YX5A 2IXSA 2L4AA 1KYZA 3H5NA 4FX0A 5CKTA 3PFIA 1UG0A 4AWXB 5FLXQ 1DARA 4HSTA 1XGOA 2J7KA 1OFCX 3TBIA 3P3GA 1N33E 2DYRH 2DA7A 4L9TA 5F0FA 3V8JA 1I50J 5DRRA 2Y9ZA 3C2GA 5LLQA 4HDVA 1FJGE 1BR2A 1P92A 4ZYAA 5JLWA 1SMTA 3PUBA 4HPQA 3RPUA 2XAFA 4UUVA 3OIPA 1T95A 1N34E 1NG6A 1P6RA 5HLHA 3OY9A 5EDNA 1EH7A 4CXFA 2Z5CB 5IY5H 2UXCI 4MGRA 1Z5AA 3GTMJ 4G7ZF 4DV3E 2JPCA 4FQGA 1XSDA 3IKVA 3MKYB 3BJ6A 1LFUP 3PUFA 5CPRB 2LY2A 1RUOA 3LPSA 2XKOA 2KP6A 1R1VA 4DXLA 2AHQA 2V9KA 3H5AA 3IV5A 1Z3YA 3OV8A 3OYFA 4EMDA 2GAUA 1JE8A 4NXME 1ON2A 1G3WA 3EETA 5DCMB 2FD5A 2LBFB 1ZM9A 3K69A 3M4OJ 1OCPA 4H0EA 4JI1I 2DAOA 3C1DA 4IHVA 1MJBA 4XRSA 2B0LA 3BDDA 3JAMK 2D2WA 5J8FA 5AONA 1H9GA 1OR7C 2G9WA 4YRVA 2UZKA 1YJ9I 4V2GA 2QQ9A 2PMUA 4XICA 3Q0UA 3QPTA 3PS2A 2GQ0A 3AG3H 2WAQN 3TGNA 2EZHA 3H0GJ 3SQNA 4S05A 1XCBA 5K36C 3CDHA 1RR8C 4IZJA 2RQPA 3MAJA 1D1BA 1KTVA 2E71A 1HK7A 3F0NA 2CJJA 2BY2A 2JRTA 2LKPA 5J40A 5IYCJ 3CCJI 4ENJA 4YEJA 3ABLH 4A93J 1ELOA 2PO0A 2KL4A 4ZZDA 5FWKA 1IN4A 2L9VA 4XRSG 4M74A 4FTHA 3H3VK 3GZ6A 5L3GA 2IOQA 2WNRB 4GKKE 3BZCA 4USMA 4LF5E 3FF5A 2HQAA 2P5KA 4V2FA 1VQMI 3CDLA 5F04A 2IOPA 2M7BA 2VJ5A 1HF0A 4W97A 3EUHA 3BR1A 2W82A 5BS6A 1PP7U 4FWHA 1P4AA 3TDZC 4IZKA 4IFDE 4BE1A 1L3LA 3S14J 5A2QC 1D6TA 5L3DA 4DYQA 1IRFA 5GPAA 1IBKI 2XF5A 3K4NA 1QZRA 2ESHA 2XB0X 2DFHA 2ZMEC 1IZ1A 4DJAA 2NNYA 2CUEA 3CJQB 1FSEA 1U6GA 2P5LC 1XMQI 2J5PA 4CZZA 3PNYA 2E1OA 2Y69H 3FM5A 3JSOA 1USSA 4A6EA 1U5TB 3QU6A 3O6BB 4J00A 4M6YA 3BR3A 4OO1F 4B1RA 5CVRA 2JA7J 3ZR8X 5HDGA 1CQTA 2NN6D 2NVQJ 4FW9A 1XG1A 4DR1E 2CW0F 4NC7A 3RYPA 4TV7A 2FQ4A 2BHZA 2R5ZA 3MWMA 3O3KA 3F6VA 4FE4A 5ICEA 4KIGA 3ZMZA 3HM5A 2LP0A 3TMOA 4DR5I 3KP2A 3DP7A 4DR3I 2DMQA 2HTJA 3QT7A 3F21A 4WWCA 3BJOA 3MKZA 2EPFA 3I4PA 2LDUA 3MZYA 1TWGJ 3Q9SA 1HNWI 2IT0A 1JXSA 2GIZA 1OQYA 4HQEA 1S7EA 5LMNE 2DW4A 2ETHA 4FISA 3V7SA 2VE8A 2Y48A 3M8JA 5FLVA 4X0GA 2XGEA 5B5EC 4C2MJ 4BGDA 2C38A 3NQOA 5E1XA 2JSPA 3A03A 3FHZA 2PO1A 3DQVC 3HYIA 3BPXA 1YRNA 4I0BA 3RPUD 4AYBA 1UDSA 4DV4I 4JYAI 4BBRJ 1J75A 5D6EA 4UUSA 2O1VA 3G6EI 3HTUA 1MMGA 4G8XA 2DT7B 3J7YJ 4NXNI 1OYWA 1JUSA 4OINF 1RI7A 2HZTA 5BPDA 4I2OA 1DPRA 4A3EJ 2XGXA 3CMEI 5CJ9A 2EK5A 1MMDA 5FLXC 4HF0A 2ISZA 4M6VA 1K79A 1W5CC 1G4DA 2PJRB 3ECHA 1N32E 4FW3A 1B4AA 3LSJA 5IT9Q 2IGNA 3LFUA 4R1FA 4DV2E 4CCMA 4JI7I 1NK3P 4IFDC 2K9SA 1RIOH 3KZIC 3OTOE 1GUUA 3K9TA 4BJ6C 4NUBA 1ZLJA 4OO1A 2M30A 4E4HA 4KN7X 2GWRA 1YW9A 1IF1A 2L7ZA 3ZQHA 2ELJA 1HR0E 1RKTA 4RB0A 4EJUA 3K1PA 1Y5YA 3TKYA 4A0YA 2HDCA 3MZ8A 3WTZA 5C0XF 1OCZH 4DR2E 4RB1A 1ZM3A 2BA0D 4OX9E 1TNTA 2ICWG 3BR5A 1W36C 2P5VA 3RKYA 5CVJA 1DU0A 1A35A 4IZJD 5ICCA 2XKPA 4XL9A 2QZ8A 1ZLKA 4K0KI 2BY0A 4ZYGA 1T0FC 2K85A 3WTYC 4BQOA 4X66E 4C3HJ 2CW8A 2VASA 1Z67A 4RMNA 3BTIA 4MU4A 1U8RA 1Z0BA 4DPYA 3R0AA 3S1QJ 3LAJA 4BXXJ 4LCGA 3FXQA 1FPQA 1P4XA 2FNAA 3OYLA 3N97A 2XPWA 4LF9I 2R3SA 3HOSA 3FBNB 1LEAA 5FJ8J 5LMUE 1R49A 2RQQA 2ZB9A 3ZQIA 2LY1A 3I4NJ 3GFIA 4N4OB 4HQMA 5ILUA 4WUBA 5AIQA 1B9MA 3R0JA 4QSHA 1QBJA 4R1HA 5DUKA 3IAM2 3WGIA 2XV4S 1H74A 2MABA 2YR2A 4D0PA 3CC7I 1B6AA 3QWLA 3UKGA 4CUGA 3BG3A 1AU7A 4YHHE 1V5EA 5K36F 1K83J 5GTIC 2HFUA 2BA1D 2PI0A 3U2RA 1VTNC 3E5UA 3F8NA 1VQNI 4ENMA 4QLCU 4YY3I 1STZA 2A5YB 4I09A 1Z0GA 4JOMA 3S2WA 2IBDA 3HXLA 2LH9A 1MH4A 2MD5A 3QPLA 2IS6A 1USTA 1XNQE 1Z77A 3ZZTA 4C9YA 4D7NA 2VBWA 3AG1H 3N05A 4PK4A 5B3SH 2D1VA 2BXYA 1DP7P 1FJGI 5JEAB 1A6QA 2VXDA 3PIPF 3V4GA 2HYJA 4CYCA 4I01A 3EDPA 5C0XA 1TZLA 1ETVA 2JQ7A 1RRJA 1Y0UA 3I5UA 2M4GA 2VOOA 1FP1D 2JK3A 3EUAA 3ECOA 1UG2A 1ZQ3P 1XMAA 5IPAA 4BAYA 2L5QA 1ZARA 1YS6A 4Y7NJ 5E3LA 2C6YA 1QU3A 3FXKA 2R7QA 1XGNA 3S3OA 1O3TA 1TWFJ 3Q6MA 2A68F 2P7VB 2K9NA 3CUQB 1M1EB 4DNCA 1GDTA 2DOFA 1YLFA 2KIFA 2VF3A 2QQAA 2ECCA 2VQGA 1XCVA 5C44J 3F0CA 2ZXHA 4WX9A 4HY1A 2CUZA 1T56A 3KX2A 1I5ZA 2BV6A 2HU9A 2IA2A 4JX5A 4EM2A 4JV5E 4DPTA 4DUYE 4YIRX 2R7RA 2R3VA 2WW4A 3HRSA 1TLHB 3WU6A 3SFIA 3DXJF 5F0HA 4G6DA 1BC8C 3SYTA 1Z59A 1BL0A 1MBKA 3SFZA 2RDPA 4B43A 3BR6A 5TRDA 1QGPA 5LRSA 5A2QZ 4MFDA 2CRGA 4B4CA 4UUSB 3FMQA 1EV7A 2BM0A 4LG0B 2CO5A 4YFNF 4HRIA 3CZ6A 2CS3A 2K9QA 4I3HA 5F6FA 4LOCA 4EMSA 1Z9CA 1OYSA 2DODA 3P5JA 3T8RA 3S17J 4OO1D 2EZKA 4DZPA 2ESNA 4NNJA 4MYUA 4ZYEA 2EZLA 5AIPA 2HS5A 5H20A 3X2QH 3L7ZA 4A3KJ 2L9RA 3Q5FA 2ID6A 4HF2A 1UDQA 4GGGA 1KZHA 1IG7A 2KLOA 2R7FA 1UMQA 3M8EA 4IEJA 4ED4A 1ETYA 5DEQA 2BBYA 3G1OA 1N25A 1J09A 4JX6A 4BY7J 2CWEA 4BL0B 2VB6A 2STWA 3H35A 3TDUC 3W6KB 1KIJA 3Q1QA 4A69C 4Q5SF 1EH6A 4LF5I 1PIEA 1R36A 2V6CA 5LL6R 5IT9C 2VJJA 3GW2A 4OAZA 3P9CA 4L5EA 1X19A 3B73A 4YFKF 3JSPA 1OMIA 5M3FJ 1MBEA 1Z0WA 1S4EA 2I8DA 2VQFE 4DV5E 2IRFG 3RIRA 4AIDA 2EILH 2X4HA 4FN5A 2V1XA 2HOEA 1Z0EA 2DFEA 4BY1J 4RLQA 1Z0CA 1IN6A 4M72A 2V4JC 1WJEA 1AOYA 4PSXA 1ZGJA 4BH9A 2NOGA 1GV2A 4XSXF 1TC3C 3V8KA 2VC0A 4IHSA 5BR8I 2EV5A 1BJAA 2EH3A 1VNDA 2UXCE 4KFCA 1FWZA 1HCRA 2MBFA 4MQVA 1XPXA 5FO5A 3U1YA 4JI6E 2ZSHB 4XN0A 2H8RA 1HW1A 3DBRB 3LSRA 5FLXZ 2WP8A 1IXCA 4DOZA 4DU7A 5EG0B 2QA4I 2R7ZJ 4E7LA 2E2IJ 3DKXA 3TO9A 3LSMA 3KP4A 2K7LA 1BI2A 2OV7A 1N0UA 5LHHA 4R79A 5JEAE 3GTOJ 3KP7A 4LF8I 2CU7A 1S5LC 5E1WA 4U3BA 3WGHA 1MMNA 1CF7B 1K61A 5LBQA 2OAZA 3WU0A 1E2XA 3MN2A 3K6GA 3G71I 3WU5A 1BI1A 5ICGA 4XRMA 5DRQA 5C0XD 2V7FA 3FM3A 1YJNI 3REOA 2XSJC 4ENKA 4BXFA 1P7JA 4HNUA 2XF7A 4HNVA 3M7ND 2M5WA 1A31A 2JJ7A 1IV6A 1ZELA 3IRQA 3CC2I 1Y8QB 2DJIA 1LQ1A 4N0BA 1RUNA 2L4MA 2NYXA 4GYIA 1MJAA 2HK2A 1VQKI 1S16A 3K4LA 4PRVA 3OYKA 1VQPI 2QBYA 2UU9E 4IRGA 1K7AA 2HK3A 4UNOA 4USKA 1N32I 5KAFC 3CF5F 5LHGA 3JAMQ 1F43A 1HQCA 2W57A 4P96A 3W2AA 2EA4A 3K4BA 3I59A 2GS8A 1KU9A 3J80K 3M85D 1J0RA 2XGDA 3D5LA 1ZKGA 2VONA 2QLZA 4BUPA 4MQYA 2RNJA 3B02A 2JEAA 4LMYA 2DEIA 2JZYA 2HKXA 3O2PE 4LPFA 1YE9A 3BR2A 3A01B 3B4TA 1IBKE 1JTXA 2DMPA 2M45A 3P9IA 4K2EA 2V34A 1RREA 5LFAA 4LK0F 2V26A 4OIRF 1FEXA 1XMQE 5K36D 4HG2A 2L3DA 1IDYA 4I7HA 2UV1A 2VXZA 2A6HF 1G6NA 5EF6A 1MU5A 3ZZUA 3GWZA 1UEKA 3A0HC 3PRYA 5CLSA 3GTJJ 2R7OA 1T98A 5J1YA 2NVTJ 3RKXA 2E7XA 3WHBA 2NS8A 4CYDA 4DV1I 4NC6A 2LG4A 2Q2EA 2DOAA 2D45A 2LNBA 4D9JA 4X66I 2RN7A 1W1WE 2JMWA 2HGCA 4EATA 4KT5C 2HKOA 1RNLA 2L7MP 3CCEI 4DR5E 4QTRA 2R7DA 2M1BA 3EQLF 4X62I 4DR3E 4F92B 5GPCA 4Q48A 3HUGA 2GQQA 1E3OC 1HNWE 1GLNA 4RGRA 1MGTA 1T38A 5JEAC 5LMUI 2EFPA 1QPIA 1USUA 1MNDA 3WTSC 1H89C 3EYYA 2I5UA 3T5XA 3VSKA 3JRBA 3HOZJ 1O7FA 3FBIB 1E17A 1D1AA 3KLOA 4NQWB 2NVYJ 5DYMA 2RC4A 3C2HA 1QRYA 2CUFA 4WUDA 3FZVA 5HODA 2W84A 2R7XA 1SD5A 3F8MA 4HF1A 2ZXIA 1H9TA 3ZKDA 4YHHI 1Z5BA 1VQ6I 3S15J 2E1RA 3PFYA 2DQRA 2NNNA 1HKQA 3PYEA 3OYHA 2FBHA 4MU1A 3P7NA 2JA8J 2HYGD 2DPDA 5JI6A 3VYTB 1A04A 4P55A 2VKHA 4XNFA 4BEHA 4L9VA 4PGHA 2HPMA 1SMYF 1SD7A 1KA8A 4QPQA 3CO7C 5D4SA 2C39B 3GZ5A 2A05A 1PUFA 3ASOH 4A5NA 1X1CA 2KRHA 4B3TI 4KYWA 2G7HA 2AS5F 4IXAA 4XIDA 4JI7E 1DPUA 4CSWA 1HA8A 1HKTA 3WU3A 5H2FC 2E2JJ 3KEQA 3LA7A 3KFWX 5TISC 1MSEC 2VODA 3GFJA 4A3FJ 4WUCA 2XIGA 2PMHA 1MKMA 2JEBB 2DTZA 4A2UA 5GMDA 1QZZA 3HOVJ 2X6XA 2PO2A 1T6SA 4M3GA 2WP8B 2VKVA 2COMA 2QSHX 5K5OA 1U78A 2KRFA 2RREA 1X3WB 3HBLA 4K0KE 3TOAA 4DPXA 5BPIA 2BY1A 3B6AA 1N77A 1ENHA 4MTDA 4WXDA 1X2MA 2QSGX 2BYVE 2BW3A 2KIMA 1DGRM 2LF8A 3K1MA 5F08A 5IT9Z 3DU6A 1NHHA 3WTUC 4IFDD 2HFHA 2Z33A 3AG4H 4IRHA 3MEXA 4RBOA 3VB2A 3TW7A 1BC7C 2A5WA 1UHSA 3VOEA 3F9KA 3LA3A 5H6QA 2UUBI 1JKRC 1QQIA 3E6MA 1ULYA 1WSUA 1LVAA 3V5RA 1ACIA 1YIJI 4D7MA 5L3CA 1MZBA 4B48A 2X9DA 3LNUA 1ZAOA 3GYHX 1UHMA 2QM3A 4Z7YA 1NK2P 1W36D 2TCTA 3HRMA 3I54A 2O3ZA 4H4KC 3QYBA 1PVGA 1IN8A 2BM1A 3CDJA 2ME0A 5FGMA 2XROA 3W3CA 3M1EA 3DBLB 1EKEA 2H09A 2ZJ2A 2EV6A 5JHUA 2O3FA 3S1RJ 5KVRA 4CHUA 3H4LA 3I59B 3K1NA 3WTVC 1MG7A 1E3PA 4HLYA 1S9HA 3MVPA 3JAMC 1D0YA 2AO9A 2FBIA 1YI2I 3FWEA 1HC8A 4DV5I 2VQFI 1HW5A 2KISA 1K47A 2CV0A 4PGGA 1VQLI 3GZNB 2QYOA 3NWTA 4ON0A 1SD6A 2PNZB 2CQKA 2X1EA 2M2EA 3WHCA 1ZREA 2OA4A 3ABUA 1IUYA 3HSRA 1N36I 1USVA 1V5FA 5FKLA 4ESFA 4LFUA 4DIQA 2YU3A 2X0LA 2Q8KA 1S7AA 3OL4A 3KP5A 2JUCA 4X65I 5DD8A 1TQPA 2WY8Q 2Q2EB 2M3AA 4ZYHA 2F5DA 4YIIA 2IPQX 1XDSA 4I02A 4JI6I 1ZR2A 3QT8A 2R4GA 2X48A 1W5SA 2A6EF 2KT0A 2OTJI 1FP2A 1XDUA 4A3DJ 1GXQA 1R58A 3ZP5A 1B62A 1EA3A 1ZHFA 2H8WA 5DRPA 1R5ID 1J7KA 1XMKA 4OWRB 5ILSA 2HOSA 2H94A 2BZTA 4BBSJ 3H5RA 1O3SA 5JFRA 2HOTA 2BR2A 2BEOA 3DEWA 4AIHA 3G4SI 5KCMA 3HULA 4BHPA 4HX7A 1DQUA 1R00A 4MNUA 1TWCJ 2FXAA 4BDYA 4EVIA 1X1AA 1D0ZA 3ZN1A 2Z5BB 1R4MB 5DUIA 3DKWA 2WC2A 3BT9A 1WH5A 2CSOA 4HA8A 3ZMVA 5HS7A 1F1ZA 3FX3A 5K1YA 5C3EJ 2DTRA 3BQYA 2EFQA 3LQRA 2IA1A 1ITYA 1MD0A 2V1UA 4MDTA 1SEUA 4XORA 2DDAA 3VPRA 4JI4E 1ZTRA 5C4JJ 2HWVA 3DCFA 2R42A 4HYMA 1RR7A 2HXIA 5H6RA 1O3RA 2JT1A 1OPCA 2GXBA 4IF4A 3FXLA 4C3IJ 4Z6YA 3QP5A 2UXBE 4JP0A 4D1QA 3PSFA 4IZZA 3JREA 3BCBA 5J3LA 1B72A 4E70A 2ELKA 3BP8A 2VT2A 3BTLA 3PQJA 1PUFB 1P9QC 3OYMA 1I39A 1FWKA 3BWGA 2UU9I 4EQQA 1YW8A 5JHFA 1G3TA 2DK8A 1KGSA 3CCRI 2CMPA 4A3JJ 1Z0TA 4PFPA 3MMYB 4U0WA 4XM3A 2HNHA 4DR6I 4ZTFA 1J9IA 5D5VB 4B47A 1Z5CA 2FJ1A 4A0XA 1T39A 1TTYA 2MW8A 4FW5A 2F2EA 2BA0G 2KZGA 3KP6A 1ETWA 3L2RA 4IQ4A 4WCGA 1QVUA 4HEA2 3CCVI 4E7HA 4OIQF 1W0UA 2LKXA 4E7ZA 2AXLA 2Z1DA 3GTKJ 3PYFA 4AD9A 1ZK8A 3HOWJ 4BE0A 2MLKA 5BR8E 1FMWA 3O8GA 2L01A 5BMZA 1S72I 4HXZA 3VFZA 2CQ7A 2QWWA 4II2A 2WB1N 2KIQA 2KMUA 2BOLA 2OC6A 3RPQA 2BW3B 2LK2A 1KU2A 3ULQB 1VFCA 5KHDA 2F6CA 3RYRA 1K78B 3KE2A 3K7AJ 1JKQC 1YFHA 1GVJA 5FKNA 5M5XJ 4JI3E 4L9JA 1HDDC 3QAHA 1OLTA 1XXEA 1BIBA 1ZYRF 2OPTA 3D4JA 1SVMA 2IA0A 3HKMA 3FXMA 3LL7A 3HJCA 5CVUA 1E0EA 4HSRA 3BC8A 4XLHA 3ZCOA 3S3MA 1AHDP 3GTQJ 1KYWA 1VZ0A 1XSXA 2IERA 4LF8E 4HX4A 2BA1G 1LDKB 2F4MB 4XSZF 4RDUA 2NN6B 2W4SA 5DDGA 3CDIA 3OYNA 2UUCI 1LDDA 2CW7A 4DV6E 3K4MA 1ZR4A 4BQAA 4LF6I 4A3LJ 4LFAE 2LYCA 5ERIA 4NBQA 2AQEA 4AUXA 5JR3A 3K70C 1P42A 4UB8C 2F4VE 3OS1A 1Z91A 2OBPA 3EPZA 1WCMJ 2ME6A 4A0ZA 1XGSA 1PVEA 1S7OA 4FWGA 2VIXA 1WFXA 3CLQA 4CDGA 5E18F 4BDZA 2E1CA 3ZPLA 1WI3A 1K4SA 2DA6A 1D3YA 4CA0A 2LSOA 1R9TJ 3LTOA 5HLIA 2RNGA 2L9NA 2K4JA 2V9VA 3C2BA 3ERED 4FW7A 1W0TA 2V1NA 4MIMA 3HHGA 2VKDA 4LIUA 3H9QA 5A2QK 1UELB 4A3MJ 3DBHB 5GAEJ 4HLXA 4XKBA 1XMXA 5L3EA 4FCYA 4EJTA 3R6SA 3HGYA 3SXYA 4A3GJ 1FX7A 5TGTA 3GONA 1Y6IA 3BG7A 5B1BH 2NVXJ 1P4WA 1XX5A 1R5HA 3CJNA 4XRFA 4B44A 2KRCA 2VC1A 4RB3C 1BN5A 3ROUA 3CCYA 1C0WA 3RJPA 3E1SA 4MQ9F 1HW2A 3Q6NA 3RTRA 1RPWA 4KMUX 2CG4A 3F3XA 4HAMA 3HB9A 4RAZA 3HKZN 1ZRCA 3H3UA 3I53A 3OYJA 5K5QA 3VODA 4BA2A 5LEJA 2BR2B 4UY8I 1QHGA 2IW5A 3ONQA 4DV1E 3QU3A 1O3QA 4DPWA 2XDVA 3KIOA 5GP9A 3CCUI 3WTWC 5IYBJ 4RAFA 3L2UA 3ZMDA 1LPQA 1IBME 3CP2A 1A6IA 5JVGF 3JAMZ 4HW0A 3HDDA 2OU2A 4X62E 1XMOE 2QKLB 1WZ2A 2VE9A 3J80Q 3JRGA 2HQRA 2DU9A 3QP6A 3F8BA 1X4PA 2IP2A 1IXSB 3I56I 2O8KA 4IZJB 5ILVA 1OCOH 1IRXA 4IX7A 4LFCE 2R7WA 2ZFUA 5TJJA 1FC3A 1BJZA 1F9NA 2VJ4A 4OAYA 5J8CA 1IN5A 2PMZA 4HV6A 5FLXK 5LGUA 2PO0B 2CG9A 1LB2A 3GXOA 3K85A 1Y60A 1JTYA 2E5LE 5E17F 1UB9A 4AM3A 2LOOA 1R71A 2X36A 5DV5A 3OYBA 1ZXMA 4DYRA 2P6TA 1F36A 2WADA 3SDGA 3VDXA 1SFXA 4IZKB 1JJ8C 3L09A 1WGXA 1WQ2A 1R6LA 3DWLE 4Q47A 3ZQQA 3LSIA 4L0ZB 1ZRFA 3FMSA 2UUZA 2XB5A 2FUG2 3P06A 4II3A 5CQGA 3NAUA 4B3SE 2XEXA 4B3TE 1JKOC 1BA5A 2VI6A 1BM9A 2VQLA 4N9HA 2UXXA 5FFXA 5JVTA 2V2ZA 5EGOA 3L2QA 2LMDA 1O7LA 2WY7Q 4KA4A 1IDZA 1ETQA 3K2ZA 2NN6E 2ZJQF 3T1HE 2ZBKA 1YYVA 1NHJA 3RI4A 2R7SA 4M9SA 1QNTA 1YG2A 2E5ZA 1K6OA 5EKWA 4Y13A 3R60A 1Y56A 2CGPA 2R5ZB 4EJWA 3KEYA 1XHKA 1IAWA 3QT6A 3DTEA 1D5YA 5E8IA 1EF4A 4JI0E 2O1TA 1OR7A 4IHYA 2RGVA 2E34A 2E35A 5DS9A 1XN7A 4ZYDA 1TW3A 1UDOA 3OWTA 1ZRDA 4M9ZA 3P3EA 1MBJA 3LNQA 3IP4B 3A2KA 2CUJA 2L7KA 2C38B 2PO1B 5D6FA 2UUBE 1YRNB 3M7NG 4GKJE 5K36A 4ETSA 1FBSA 5KAIC 3K4KA 1SANA 3RCOA 2F5FA 3K2AA 4LG3A 4QPOA 4NC8A 4BNCA 1XSVA 4G6QA 4BHBA 4JI4I 1TQMA 1VQ4I 2QQBA 3OL3A 4Y15A 4Q4ZF 3K0LA 2UUAE 1HDPA 2UXBI 1I6HJ 3ZOBA 4ZC3A 2O1WA 1U5TC 3I4MJ 1BKNA 2QF7A 1Z6RA 4HV5A 5EJCA 5HS8A 3F72A 3HOTA 2QSFX 1XS9A 2Y0SA 1WH7A 3V7RA 4KICA 3M85G 4MU3A 2DA2A 3DPLC 2V1DA 2P7CB 1ZM4A 3HHHA 3IWZA 1BIAA 2XRLA 2FEZA 3RZOJ 1YX3A 2WA0A 4YELA 2YS9A 4P1WA 1H7UA 4FASD 2JN6A 3CWVA 4OO1B 2ZMEA 3QPSA 2JTVA 2Y0MA 3W2WA 3F6OA 2J5OA 2IESA 4IFDF 3BY6A 1OJLA 3J81K 1FTTA 1N36E 2M0MA 1YQAA 2LR8A 2NN6C 3SHFA 4LFBI 3HG9A 1AKHA 4B09A 5IP9J 4X65E 4UV8A 4XLPF 1JUPA 3FKJA 3QYEA 1K4TA 1R23A 3D0SA 4U7BA 2RAEA 2O1UA 5M3MJ 3G2BA 3WODF 1YO5C 4LLLA 3JRFA 1YH8A 4IHXA 1VI7A 2HVQA 2R92J 4JG4A 2L02A 2HDWA 2JE6A 2HEOA 1WJFA 2R7TA 2Z2SB 1I27A 3KCCA 5DM6F 5DM7F 4JI3I 4ESJA 3TW6A 3IWFA 4AIKA 1DDNA 1FIPA 4MEYF 2ZM6I 2WBMA 2K5CA 3J80C 2VQEE 4M3DA 9ANTA 2HR3A 2F48A 4DBRA 2BVMA 4P9UA 2VL8A 3BTCA 5LHIA 4A5MA 1YHQI 1FZPB 2CGEA 1Z1DA 4M71A 4JI2I 2DK5A 4HOBA 4DV6I 3C18A 4LFAI 3GX4X 4G6TB 2B9SA 3CMYA 1T8IA 2F4VI 2DMNA 2ZJRF 2H1KA 3GF2A 1OISA 2COBA 1B59A 1NG7A 1G3SA 1TWHJ 1FNMA 1JGSA 4LK1F 4LB5A 1ZN2A 3K4JA 4EM1A 3CTAA 1VF9A 1Z3XA 5ICFA 3T1BA 1MMSA 3A1YA 2KQRA 3CLOA 1GHCA 5DROA 2NAZA 4LJZF 2GM4A 4JQFA 4IFDA 4EM0B 3C3WA 1SAUA 4BS9A 4CYCB 2DN0A 2HQNA 5EGOB 3JRAA 2MC3A 1ZM2A 2OCCH 3NRVA 5C0XB 4E7SA 2PQ8A 2DYSH 4DR6E 2O8XA 3PS3A 5GAHJ 2ZITA 2KPMA 4C2UA 3G1MA 1QZYA 3ZQLA 3VYRB 3R4KA 3FK6A 1WPKA 3HOUJ 5J4YA 4AVZA 2HPIA 2VKEA 3K4CA 5LD2C 3HTSB 2WAQA 3RDIA 1IJWC 1PJRA 2DBBA 3PSIA 2VN2A 4KHPE 3ELKA 1S6LA 2HYFA 1I94E 2K3FA 1L0OC 2EZIA 4JI8I 2EFNA 1REPC 1UZCA 4DBQA 4Z7CA 4ISAA 4O3MA 1I3AA 4QNJA 1T0FA 4I99C 3CMMA 3LA2A 4XQFA 4AQYE 2MC4A 2WV0A 4LB6B 1PUEE 1HKSA 1A5JA 2GO4A 4HACA 2NRAC 1VISA 3OSFA 1JUMA 3GFLA 1BW5A 2FSWA 4OU0A 3DEEA 3U1DA 1WJ5A 5E79C 2XGCA 2WWYA 3U9GA 2V6EA 1IBMI 1R22A 5IT3A 3EUHC 2IEKA 3ABTA 3E6BA 3H9JA 1ZGWA 4PJJA 3WGGA 1XMOI 5JLXA 4Y3OA 2V2VA 4DGWB 2GOMA 3KYLA 2PNMA 1Z7UA 2Y9YA 4OO1E 1U2WA 5CYVA 3CCLI 1W7PD 2X51A 2V9PA 1D5VA 3GCMA 3DPUA 2KJBA 2Z5CA 4PJLA 2DPUA 2P6SA 2H27A 4LFCI 3HRTA 3HGGA 4UV9A 2EIKH 1RETA 2UUCE 1OYYA 2CV1A 3L7ZB 4DR7I 2KKOA 3E3VA 1X3UA 4LF6E 4MO7A 1BOBA 3TO7A 1QHHD 2GOXB 3L9FA 1XGMA 4L18B 3PYGA 1J5EI 2H6CA 2FMYA 5EL9A 1JHHA 2GA2A 4X64E 1R6RA 4ZZLA 4XOTA 1KQ9A 2HXOA 3HSFA 3QYFA 1X2NA 5FROA 4PJMA 2E5LI 5DCMA 2LBFA 4LGWA 1LFPA 3CUQC 1HNXI 2CFOA 2ZMEB 4XTJA 4OIOF 3M1CA 2W85A 3GMEA 1ZG1A 1SFUA 1Y4UA 1UDNA 2DA3A 3L2WA 1IUFA 1HSTA 3B8HA 2M0CA 2ZC2A 4B3SI 2PNLA 4OMZA 4XLNF 3ZM7A 3T1YE 2EB7A 5GAGJ 4BU2A 3PS1A 2DFIA 4LLNA 3W2VA 2OQGA 1JKPC 2JT2A 3CF2A 3BLYA 1ZGAA 2Y30A 3DU5A 1ZG3A 2DDBA 1KQ0A 1KU3A 4Y33A 5IOYA 1BR4A 3SEQA 3T1HI 3H3ZA 2O7OA 3ZGKA 4F3QA 3K70D 3C7JA 2IGOA 2JVHA 2VBZA 3LSHA 2EA2A 1F4KA 5LGNA 5BQTA 2XHKA 4G7HF 2QCOA 3DTIA 4M3BA 3L2VA 2PG4A 2R0QC 1IGNA 4IQJA 4M1KA 2HHHE 1TT5B 1FBQA 4ABZA 2WNRA 3E6DA 2AXTC 5K7HA 2BV3A 3E5QA 2NS0A 3DKYA 4FW6A 5A2QQ 2P4WA 4JI0I 1ETXA 5LRRA 3TO6A 3BG5A 2GXAA 1IRZA 3PM1A 4A3CJ 1FY7A 4DYCA 3DLLF 2CH0A 3MFKA 1EA6A 4RPFA 1FOXA 2ECBA 3GEZA 3NARA 5C0XE 1IW7F 4OO1C 3Q0WA 4U0YA 2ZXWH 3A4CA 3JRHA 2E2HJ 4GKJI 1S29A 4LCFA 3DPTA 1Z0XA 3WG7H 1OCRH 1P7IA 3WU4A 1IO2A 2DA1A 2LREA 2IVMA 3E6CC 1U8BA 5HS9A 2GBYA 1UHWA 2MGQA 3L00A 1D8KA 2UUAI 2M9HA 3L1PA 4WK8F 4RB2C 3HL2A 4GRIA 1IBLE 3MZHA 1H7SA 2QBYB 5DNLA 3F23A 4KIFA 4G9YA 1ETKA 1HNZI 2E1NA 2H6BA 4WXCA 1NZ0A 2LVSA 3MQ0A 3OR1C 2K4BA 3E0JB 2JSCA 2VPLA 2ZFWA 4PZJA 4RAYA 1FI4A 4LITA 4N9IA 3KLNA 3M3YJ 2FRHA 2JEAB 1JHFA 3OIQA 1FOKA 5E3OA 3J80Z 1XNRI 2PX9A 1O4XA 1UCRA 1IRGA 2A2DA 3ABKH 2M8GX 2PLYA 1MMAA 4AC0A 2VOPA 1FLIA 2AJ4A 1NHIA 3SZTA 5KK1A 3DLAA 3IHUA 5HLTA 3LSTA 2RVCA 4NB5A 4S04A 3ZMTA 3K10A 2ID3A 3ZN0A 2ZSIB 3AAFA 1Y1WJ 1GXPA 2R93J 4HACB 3OYEA 3GFMA 3AL0B 2LC2A 5HLGA 3NEUA 2L7FP 4I98B 4RGSA 4F7ZA 4BACA 3HOYJ 1OJ4A 1Z21A 2DFFA 2ELHA 2EWNA 3COAC 2MD0A 4X6AJ 2Z3YA 3RZDJ 1OYIA 2CFXA 3OYIA 2PJRA 4PJNA 3HUGB 5BOXA 1V4RA 1B1BA 3LFKA 3ZXSA 3WU2C 2ACJA 1NH3A 4G7OF 3ISPA 1V3FA 5IP6A 4O6JA 1Q1VA 4BKXA 2HDDA 2VQEI 5D8KB 3JCUC 5C0XC 4EV0A 2W00A 5C4XJ 4BA1A 1J59A 1TWAJ 5FRMA 1BI0A 4A6DA 2QEXI 1GVDA 2RV8A 2LD5A 2K02A 2HI3A 3HZJA 5JEAF 2CZ9A 3HC7A 3OYAA 4DUZE 3G3ZA 3W6JB 4CGZA 2EFOA 3KP3A 5BNGA 4KJZA 1XTAA 2ZXJA 3G73A 3W6VA 4UVCA 3JR9A 1NTCA 4ZTJA 1Z05A 3GUDA 2IJLA 5HVQC 2QUFA 3PQKA 4XLFA 2BVLA 2QKMB 4J19A 1VQOI 1F5TA 4ENNA 4EEFG 2DXIA 2FMLA 2JVGA 2NN6F 3RQIA 4RGUA 4BEHB 5DTDA 4GO1A 2LJPA 2WAEA 3S2HJ 1P2FA 3F8FA 4F52A 2FU4A 3GO5A 1QA6A 1WJCA 4OIPF 1R5GA 2Q1ZB 4U88A 1U0JA 3I9V2 3S3NA 2L54A 2H1LA 1TL8A 4EJVA 5J4VA 3VWBA 1SD4A 3FDYA 3ZKBA 3ML6A 1PDNC 4I6ZA 2X6OA 1X1BA 4DR4I 1PP8F 4XLAA 4CH7A 1SAXA 2P8TA 4MEXF 1ODDA 2P81A 2PO2B 4KHPI 4JK1X 3NWSA 3TQNA 5CVVA 2OQRA 1I94I 1LFBA 2K86A 4XMYA 1T33A 4DZJA 2JA6J 4AQYI 1Q1HA 2FQ3A 5EEAA 1VQ5I 1TNSA 3CP8A 4LD5A 1SFKA 3I3LA 6PAXA 2X7IA 3OOPA 4CCNA 2A2CA 1RESA 2KDZA 2JA2A 4DV0E 2CQQA 2NOJB 3RQ4A 4ZDOA 3F8CA 1DU6A 3MD2A 5JEAA 1BW6A 1V55H 1MBFA 2IAIA 1G3YA 2LLKA 1YITI 1GT0C 3VEPA 5E3NA 1ORKA 1LE8A 2OF7A 1Y39A 2ZNZA 5FKMA 2MA3A 1FJLA 2ZM6E 3IH4A 3HJEA 1OCCH 3WE3A 1N0VC 2FBKA 4LFBE 1Z0VA 2QENA 3J81Q 5FKKA 2DMUA 4L5IA 4EJOA 5E8GA 1FOWA 1T2KA 1WJDA 4JI2E 2PJPA 1X1DA 2VBXA 4AIJA 2F5EA 4C3JJ 4FWDA 2LF7A 1ERDA 2BE5F 3BOQA 2OZUA 3O8HA 2NS7A 2HKEA 3CUQA 1G59A 2OZ6A 3WG9A 1FIAA 4X64I 3OYCA 4PRXA 2Z5UA 4Y4RA 4U87A 5L3BA 2PEXA 3BJAA 4HX8A 1B9NA 4BJ5C 1X1PA 4FETA 1UJ8A 1H88C 1OYRA 4UTGA 4ZH4F 2KIUA 4KQVA 2GLOA
chains in the Genus database with same CATH topology
4IFDA 4OO1F 5K36A 5JEAF 4BA2A 2JEBA 2BR2B 2NN6D 5C0XB 2WNRA 4AIDA 5K36F 2BA1D 2BA0G 3CDJA 5C0XE 3M85G 2NN6F 4OO1C 5JEAC 1E3PA 2JE6B 2C38A 2PO1A 4OO1B 5JEAB 1UDSA 2WP8A 2PO0B 4AIMA 4IFDF 2PNZB 5C0XA 4BA1B 2PO2B 2NN6C 4AM3A 3HKMA 4OO1E 5JEAE 3GLLA 3GCMA 2BA1G 1R6LA 2NN6B 2C37A 3CDIA 2JEAB 2C39B 3L7ZB 5C0XD 4NBQA 4IFDC 5K36C 1WHUA 2JE6A 3M7ND 2BR2A 3H1CA 4OO1A 3H36A 5JEAA 2NN6E 4IFDB 5K36B 4BA2B 2PO0A 2JEBB 2PNZA 3U1KA 2WNRB 5C0XF 1E3HA 3DD6A 2PO2A 2WP8B 2BA0D 3GMEA 1UDNA 1OYSA 4IFDE 5K36E 3M85D 4OO1D 1OYPA 5JEAD 2NN6A 2JEAA 2C39A 3L7ZA 3B4TA 1UDQA 1UDOA 2C37B 4IFDD 5K36D 1OYRA 1R6MA 5C0XC 2C38B 4BA1A 2PO1B 3KRNA 3M7NG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD A;  4OO1 F;  5K36 A;  5JEA F;  4BA2 A;  2JEB A;  2BR2 B;  2NN6 D;  5C0X B;  2WNR A;  4AID A;  5K36 F;  2BA1 D;  2BA0 G;  3CDJ A;  5C0X E;  3M85 G;  2NN6 F;  4OO1 C;  5JEA C;  1E3P A;  2JE6 B;  2C38 A;  2PO1 A;  4OO1 B;  5JEA B;  1UDS A;  2WP8 A;  2PO0 B;  4AIM A;  4IFD F;  2PNZ B;  5C0X A;  4BA1 B;  2PO2 B;  2NN6 C;  4AM3 A;  3HKM A;  4OO1 E;  5JEA E;  3GLL A;  3GCM A;  2BA1 G;  1R6L A;  2NN6 B;  2C37 A;  3CDI A;  2JEA B;  2C39 B;  3L7Z B;  5C0X D;  4NBQ A;  4IFD C;  5K36 C;  1WHU A;  2JE6 A;  3M7N D;  2BR2 A;  3H1C A;  4OO1 A;  3H36 A;  5JEA A;  2NN6 E;  4IFD B;  5K36 B;  4BA2 B;  2PO0 A;  2JEB B;  2PNZ A;  3U1K A;  2WNR B;  5C0X F;  1E3H A;  3DD6 A;  2PO2 A;  2WP8 B;  2BA0 D;  3GME A;  1UDN A;  1OYS A;  4IFD E;  5K36 E;  3M85 D;  4OO1 D;  1OYP A;  5JEA D;  2NN6 A;  2JEA A;  2C39 A;  3L7Z A;  3B4T A;  1UDQ A;  1UDO A;  2C37 B;  4IFD D;  5K36 D;  1OYR A;  1R6M A;  5C0X C;  2C38 B;  4BA1 A;  2PO1 B;  3KRN A;  3M7N G; 
#chains in the Genus database with same CATH topology
 3IH2 A;  2EJR A;  1FYK A;  3EYI A;  1AA7 A;  2X1D A;  4C2T A;  3ZMS A;  2XAU A;  3LOC A;  2YSR A;  3ZQF A;  4KDP A;  3Q3S A;  3MKL A;  4V19 K;  2O03 A;  3M8F A;  3T1Y I;  2X6Y A;  4LG0 A;  1BI3 A;  1A6F A;  4JX4 A;  3R61 A;  4XLE A;  3G1L A;  3CCS I;  4OZE A;  4DQ2 A;  3IH3 A;  1RR9 A;  1G8X A;  4XN3 A;  4LLG F;  2WV1 A;  4A3I J;  1BOA A;  2JPB A;  1TQI A;  3PIO F;  4I0A A;  1Y6Z A;  3KYC B;  3TP3 A;  3HOX J;  1D1C A;  3ZQ7 A;  1R1T A;  1JJ6 C;  4JI8 E;  2UWM A;  5FLM J;  3LSP A;  2DT5 A;  2AE8 A;  5K7Z A;  2A6T A;  3TP0 A;  3MCZ A;  3FXR A;  2HHH I;  2OD5 A;  3P76 A;  1YS7 A;  2F4O B;  3A02 A;  2JUG A;  1XD7 A;  4IHW A;  1FSH A;  4RM3 A;  2KHM A;  4PDK A;  4BA1 B;  2A61 A;  3ZZ0 A;  4MTE A;  1OKR A;  1VI0 A;  3JTG A;  4N4N B;  4IS9 A;  4KIT B;  1KQ8 A;  2JA5 J;  4B3M E;  1FWL A;  1YHC A;  5D5W B;  2V2Q A;  3K1J A;  2TDX A;  1R1U A;  3QOP A;  4D5F A;  5IYD J;  2BXZ A;  3IKT A;  2Y2Z A;  4KIS A;  4XLC A;  2K27 A;  3L7W A;  5J1R A;  2C37 A;  4C30 A;  4Y52 J;  2WAF A;  2EFG A;  2MG4 A;  1WKM A;  1YJW I;  2YX4 A;  2G7U A;  2DCE A;  2F4I A;  2XVC A;  3CD6 I;  3QOE A;  5EZG A;  4DR7 E;  5IOZ A;  1B72 B;  3AL0 C;  1J5E E;  4B3R I;  1HXD A;  5FFZ A;  2EIN H;  5HDK A;  2EFW A;  4YIF A;  1XB4 A;  4IO9 F;  4LF4 I;  3ESW B;  1IBL I;  1W4M A;  4DV7 I;  2E60 A;  2LKS A;  4W1U A;  4IOA F;  2MFZ A;  1RKW A;  1Z7L A;  3OYG A;  5EG0 A;  3U1K A;  2YPR A;  3U21 A;  1HNX E;  2IGM A;  2O5R A;  2OTL I;  3DD6 A;  2E1M B;  4UXN A;  4A3B J;  3MKW B;  4KN4 X;  2K3P A;  3ZQC A;  2M8E A;  1FMV A;  1S8N A;  1PKP A;  1CF7 A;  1HSJ A;  1OYP A;  1IC8 A;  5JEA D;  3UNG C;  5DCF A;  2VBY A;  4MFE A;  3GVA A;  1H0M A;  3HPH A;  2DQL A;  3RKW A;  3SZP A;  1S3J A;  1MX0 A;  5LGT A;  5ED4 A;  2I10 A;  4KIB A;  4KUM A;  3SDB A;  2NXN B;  5B66 C;  4PUS A;  3QQA A;  2VUM J;  3FMR A;  4HDU A;  5D8L B;  3KRN A;  3M7G A;  1EI1 A;  3E7L A;  4OOI A;  1N33 I;  4M6X A;  4ZDL A;  4MLO A;  2D5V A;  1H73 A;  4DPU A;  3TED A;  1T08 B;  5M5W J;  4N3O A;  4CZC A;  4CCL A;  3ABM H;  2ZKZ A;  3SZG A;  5CQE A;  4IOC F;  5EEG A;  5FB2 A;  1LE8 B;  1NHA A;  2TRT A;  2HFS A;  5D5X B;  2E7W A;  2NVU B;  1OCT C;  1N34 I;  2HOA A;  3PNT A;  2ISY A;  1X4O A;  2ZO4 A;  4I76 A;  1N75 A;  4ESB A;  4CIC A;  4IJA A;  4J01 A;  4GXO A;  2IGK A;  2Y75 A;  3B78 A;  1ON1 A;  2EQR A;  3OR2 C;  5J6X A;  4DV3 I;  5IWA E;  3A01 A;  1J5Y A;  3J7A O;  4ZDP A;  1LUJ B;  4D5C A;  3PL8 A;  4HZF A;  3QOD A;  2ADU A;  3D5S C;  2O61 A;  3J81 C;  2NPF A;  4JI5 E;  4DUZ I;  4XK4 A;  3FIS A;  2CQX A;  1HBX G;  1RZ4 A;  3JRI A;  4UUT A;  1O57 A;  4M73 A;  2BHY A;  2Z99 A;  3J7Z I;  2R7U A;  4FW4 A;  4NXM I;  1Z6T A;  2XAS A;  2LRD A;  3VSL A;  3WTX C;  4LF7 E;  5GME A;  3I64 A;  4F91 B;  1Y1V J;  2PN6 A;  4UHT A;  4EGZ A;  1ZH5 A;  4XR6 A;  2IS2 A;  1MNE A;  2QGU A;  4IL6 C;  3FXJ A;  2VT3 A;  3CC4 I;  2G0E A;  3DTK A;  1LJ9 A;  3A0B C;  4LIV A;  2E19 A;  3LQQ A;  4BYY A;  4OKG A;  5HNH A;  1HNZ E;  3KYD B;  1RHY A;  2EV0 A;  2QQ8 A;  5F1R A;  2X6W A;  1QZE A;  4PFO A;  1UAA A;  1MH3 A;  3LAP A;  1WJA A;  1W7P A;  3LSK A;  2EIJ H;  2LTP A;  4FT8 A;  1MNM C;  4FX4 A;  2DEJ A;  1XNR E;  2F5C A;  2Z16 A;  4E7K A;  3ZRG A;  3OOU A;  3WU1 B;  3HRU A;  3BR0 A;  2UXD E;  4M3F A;  1MSF C;  4NQW A;  1X58 A;  5GTH C;  1HLV A;  3S16 J;  3WTT C;  3KPH A;  3BTJ A;  4R8H A;  3CO6 C;  3DEU A;  3S1M J;  3QRF F;  1V54 H;  4L9N A;  3VYU B;  2XRN A;  4CCJ A;  3IL2 A;  2R5Y A;  2F1D A;  4U3D A;  4BA2 B;  4BHC A;  5B1A H;  4GKK I;  2YX7 A;  3PYD A;  4WXH A;  4Y17 A;  3E97 A;  1W5T A;  4A12 A;  1B63 A;  3FKI J;  4URL A;  2JWT A;  3S1N J;  3AG2 H;  4U0V A;  4RGX A;  4F93 B;  2STT A;  3IRR A;  1DP3 A;  1MJ9 A;  2CVE A;  1IN7 A;  1MDM A;  4J3D A;  1TBX A;  2EIM H;  3VYS B;  2HVS A;  4DV0 I;  1KON A;  2M4K A;  2OCE A;  4PSW A;  1D8J A;  3CQZ J;  2FOW A;  2XPV A;  3P9K A;  2XAG A;  2XC7 A;  2W25 A;  2DO7 A;  4UVB A;  1JT0 A;  2C39 A;  1MIJ A;  3GTP J;  5L3F A;  5KNL A;  3ZQG A;  4BXU A;  2JRM A;  2B63 J;  3HIF A;  1I1S A;  4PU9 A;  4RA2 A;  1SFO J;  3UHM A;  5HNF A;  3D1N I;  2C37 B;  2XPU A;  3V2U C;  2L2O A;  2Q0O A;  5K5R A;  4ASN A;  2K9L A;  2E5N A;  1R6M A;  4AYB N;  2O9L A;  3J7A Y;  1H72 C;  1FBU A;  2L0K A;  2HTS A;  4JYK A;  2FE3 A;  2GXG A;  3OS0 A;  3BG6 A;  3CJT B;  2EBI A;  2JEB A;  4RM2 A;  4M3E A;  2MYS A;  4IHT A;  1IV8 A;  2A69 F;  2X1C A;  3GBG A;  3HPG A;  5IP7 J;  4DR1 I;  5K7F A;  2QVO A;  5E3M A;  2M87 A;  1B8I A;  1VQ9 I;  3IUO A;  3ZMU A;  1KKH A;  2LFB A;  4XKC A;  5FKO A;  4YG2 F;  1SC7 A;  5L3J A;  3UR3 C;  1RC9 A;  1ONV A;  2YU9 J;  3BCA A;  3HSE A;  5EEH A;  3S32 A;  3K17 A;  4JI1 E;  2FF4 A;  2DMT A;  1BBY A;  3AKZ A;  5IT9 K;  2YUS A;  4E7J A;  4HBL A;  4QIW N;  5FD5 A;  1WRJ A;  4OMY A;  5LMN I;  3S8P A;  2Z9O A;  1J2X A;  2X85 A;  4NDL A;  1ZXN A;  4CCO A;  3AFH A;  3V42 A;  5DD4 A;  4BQQ A;  3PNV A;  2FX0 A;  5LEK A;  5HOO A;  3V7C A;  4PJ0 C;  2ZBK B;  4CO8 A;  2CYY A;  4AIM A;  3BQZ A;  4DR4 E;  3M6A A;  2W7N A;  2VQC A;  1I6X A;  4G12 A;  1DUX C;  4GFB A;  2KJC A;  4P52 A;  4ZVI A;  1TP4 A;  3N4M A;  3OYD A;  2D1H A;  1LVK A;  1WVR A;  1FTZ A;  3WE2 A;  1FT9 A;  4DU8 A;  1MW7 A;  3SJM A;  2R7V A;  2GZW A;  2AQF A;  3JW4 A;  3KZY A;  3PO2 J;  2XAJ A;  2ZCW A;  2KFD A;  4JBA A;  3JRD A;  1AWC A;  1GV5 A;  3L2C A;  1FYM A;  4DV2 I;  2PBI A;  2FNP A;  2WTE A;  1VQ7 I;  3DV8 A;  4RS8 A;  5F1J A;  2E36 A;  3F22 A;  5FRN A;  3H9G A;  3P3C A;  3OTO I;  3EUK L;  4RLF A;  4ZJZ A;  1APL C;  5FD6 A;  1KVK A;  3Q9V A;  2E1M C;  4MYT A;  4B3M I;  4S0H B;  5K36 B;  5GAD J;  3OSG A;  1HR0 I;  1I1G A;  2PNZ A;  3FXU A;  2PMZ N;  1FKA E;  4GCV A;  1WWX A;  1Y4S A;  4DR2 I;  4Z2Y A;  2XAQ A;  1E3H A;  4OX9 I;  2KDO A;  2IS4 A;  1WJB A;  1LEB A;  4ANJ A;  1U3E M;  1MBG A;  3ERM A;  2PFB A;  3KZZ A;  3QT5 A;  1JT6 A;  2MH9 A;  1Y0N A;  3BZ6 A;  3BRO A;  2W1O A;  2VLA A;  3RKQ A;  5M5Y J;  4E6K G;  3DF8 A;  1R4N B;  1MBH A;  1UFM A;  1BR1 A;  3H92 A;  3GLX A;  2UXN A;  4P5O A;  1R7J A;  5E1Z B;  4B3A A;  2WB1 A;  4LOM A;  4HYE A;  2J65 A;  1SVO A;  2MH2 A;  1PYV A;  4QNK A;  4EGY A;  3KEO A;  4NHJ A;  2DOE A;  4M9X A;  3KET A;  3Q0V A;  2V8P A;  1U9O A;  4U7D A;  3FIW A;  3T0Y A;  1W7P B;  1EH8 A;  3I55 I;  2Y31 A;  5EYR A;  1D0X A;  2F5V A;  4KMF A;  1ZG5 A;  1FNN A;  1YOV B;  2GO3 A;  3B82 A;  2OJE D;  3CMA I;  4E7I A;  4IPA A;  1G2H A;  3T8T A;  2Z5B A;  4GYG A;  5DNX A;  4LCH A;  4UVA A;  1SVL A;  2XF6 A;  4JYA E;  3JTH A;  4DV4 E;  1ETO A;  3CJR B;  3TOB A;  1FOY A;  2R5Y B;  2CV2 A;  3PO3 J;  4NXN E;  4XKW A;  2N8G A;  3QPH A;  2VPR A;  3J81 Z;  3NZK A;  1AKH B;  4BQN A;  2XUB A;  3I0T A;  3CCM I;  3BG9 A;  1YTY A;  1A36 A;  1LDJ A;  2XSD C;  1YW7 A;  1QVT A;  3CUO A;  4IVN A;  4B3X A;  2GIV A;  3V8L A;  1WUU A;  5D5U B;  1U9N A;  4QWQ A;  2O0Y A;  2DA5 A;  2A3S A;  1SFE A;  2DJN A;  2M34 A;  3FHN A;  3IAS 2;  3LWF A;  4XKV A;  2GA1 A;  5F0C A;  1TW2 A;  1MDM B;  1WI9 A;  1JGG A;  1JI8 A;  1XNQ I;  1QO0 D;  1DGW Y;  1LNW A;  3I71 A;  4DW6 A;  2JE6 B;  4AVP A;  1U2R A;  4UB6 C;  3RSN A;  2VES A;  4P9F A;  2MLG A;  4PCQ A;  5F64 A;  1X3Z B;  4YFX F;  3BPV A;  2DI3 A;  2HZD A;  3LSG A;  4G94 A;  4CCK A;  2KZV A;  2HKJ A;  3S93 A;  5J47 A;  2L9S A;  2P0W A;  3OMY A;  1XC5 A;  2CQN A;  3HEF A;  1H8A C;  4XON A;  3GTL J;  3I58 A;  1TT0 A;  3BZK A;  3J7A G;  2A07 F;  4IKF A;  2BGC A;  2VJI A;  1KU7 A;  4HNT A;  4FHT A;  1B8I B;  3S2D J;  5IWA I;  2OI2 A;  4IRI A;  3IC7 A;  1VQ8 I;  1V5G A;  4XOP A;  3J7A M;  3GLL A;  1QPM A;  2ZJP F;  3DFG A;  4JI5 I;  1LKX A;  2M7A A;  2XAH A;  1U5T A;  2Y0S N;  2ZNY A;  2MSY A;  4KT6 A;  1WHU A;  4O5V A;  2DLL A;  2O6G E;  4LF7 I;  4JV5 I;  3HKZ A;  1K6Y A;  4DUY I;  3FK7 A;  3E5X A;  3H1C A;  2VQH A;  2FOK A;  4ITV A;  4X1E A;  5J1U A;  2HVR A;  4MU0 A;  4B3R E;  4AU7 A;  3H36 A;  4LF4 E;  1I3Q J;  2BY3 A;  4WF2 A;  1K78 A;  3PJR A;  4DV7 E;  4IFD B;  4B8X A;  3CCQ I;  3LMM A;  4L0Y B;  3JRC A;  4MHG A;  2B7E A;  4LF9 E;  1HOM A;  3TL4 X;  5D4R A;  2W24 A;  1CGP A;  5CVI A;  5EZH A;  3ASN H;  4XBF A;  3M07 A;  2LY9 A;  2K9M A;  1Y8R B;  2OUM A;  2FA5 A;  1IXR C;  2IS1 A;  4BE2 A;  2K40 A;  3B6C A;  5F27 A;  3GTG J;  2DA4 A;  3FXO A;  5HDN A;  5ELW A;  1FYL A;  3H0D A;  1POG A;  4GQU A;  5K36 E;  1EJ9 A;  4BJT A;  1N78 A;  5E20 A;  4GDF A;  3OIO A;  2NN6 A;  2Z5E A;  4P7A A;  3D5R C;  2UXD I;  2V79 A;  1YIO A;  4KNY A;  3M9A A;  4UT4 A;  3OS2 A;  3SEZ A;  4FE7 A;  4L5J A;  4F55 A;  2HQ5 A;  3CES A;  2RKH A;  4RAG A;  4YY3 E;  2DT6 A;  2W48 A;  1YX5 A;  2IXS A;  2L4A A;  1KYZ A;  3H5N A;  4FX0 A;  5CKT A;  3PFI A;  1UG0 A;  4AWX B;  5FLX Q;  1DAR A;  4HST A;  1XGO A;  2J7K A;  1OFC X;  3TBI A;  3P3G A;  1N33 E;  2DYR H;  2DA7 A;  4L9T A;  5F0F A;  3V8J A;  1I50 J;  5DRR A;  2Y9Z A;  3C2G A;  5LLQ A;  4HDV A;  1FJG E;  1BR2 A;  1P92 A;  4ZYA A;  5JLW A;  1SMT A;  3PUB A;  4HPQ A;  3RPU A;  2XAF A;  4UUV A;  3OIP A;  1T95 A;  1N34 E;  1NG6 A;  1P6R A;  5HLH A;  3OY9 A;  5EDN A;  1EH7 A;  4CXF A;  2Z5C B;  5IY5 H;  2UXC I;  4MGR A;  1Z5A A;  3GTM J;  4G7Z F;  4DV3 E;  2JPC A;  4FQG A;  1XSD A;  3IKV A;  3MKY B;  3BJ6 A;  1LFU P;  3PUF A;  5CPR B;  2LY2 A;  1RUO A;  3LPS A;  2XKO A;  2KP6 A;  1R1V A;  4DXL A;  2AHQ A;  2V9K A;  3H5A A;  3IV5 A;  1Z3Y A;  3OV8 A;  3OYF A;  4EMD A;  2GAU A;  1JE8 A;  4NXM E;  1ON2 A;  1G3W A;  3EET A;  5DCM B;  2FD5 A;  2LBF B;  1ZM9 A;  3K69 A;  3M4O J;  1OCP A;  4H0E A;  4JI1 I;  2DAO A;  3C1D A;  4IHV A;  1MJB A;  4XRS A;  2B0L A;  3BDD A;  3JAM K;  2D2W A;  5J8F A;  5AON A;  1H9G A;  1OR7 C;  2G9W A;  4YRV A;  2UZK A;  1YJ9 I;  4V2G A;  2QQ9 A;  2PMU A;  4XIC A;  3Q0U A;  3QPT A;  3PS2 A;  2GQ0 A;  3AG3 H;  2WAQ N;  3TGN A;  2EZH A;  3H0G J;  3SQN A;  4S05 A;  1XCB A;  5K36 C;  3CDH A;  1RR8 C;  4IZJ A;  2RQP A;  3MAJ A;  1D1B A;  1KTV A;  2E71 A;  1HK7 A;  3F0N A;  2CJJ A;  2BY2 A;  2JRT A;  2LKP A;  5J40 A;  5IYC J;  3CCJ I;  4ENJ A;  4YEJ A;  3ABL H;  4A93 J;  1ELO A;  2PO0 A;  2KL4 A;  4ZZD A;  5FWK A;  1IN4 A;  2L9V A;  4XRS G;  4M74 A;  4FTH A;  3H3V K;  3GZ6 A;  5L3G A;  2IOQ A;  2WNR B;  4GKK E;  3BZC A;  4USM A;  4LF5 E;  3FF5 A;  2HQA A;  2P5K A;  4V2F A;  1VQM I;  3CDL A;  5F04 A;  2IOP A;  2M7B A;  2VJ5 A;  1HF0 A;  4W97 A;  3EUH A;  3BR1 A;  2W82 A;  5BS6 A;  1PP7 U;  4FWH A;  1P4A A;  3TDZ C;  4IZK A;  4IFD E;  4BE1 A;  1L3L A;  3S14 J;  5A2Q C;  1D6T A;  5L3D A;  4DYQ A;  1IRF A;  5GPA A;  1IBK I;  2XF5 A;  3K4N A;  1QZR A;  2ESH A;  2XB0 X;  2DFH A;  2ZME C;  1IZ1 A;  4DJA A;  2NNY A;  2CUE A;  3CJQ B;  1FSE A;  1U6G A;  2P5L C;  1XMQ I;  2J5P A;  4CZZ A;  3PNY A;  2E1O A;  2Y69 H;  3FM5 A;  3JSO A;  1USS A;  4A6E A;  1U5T B;  3QU6 A;  3O6B B;  4J00 A;  4M6Y A;  3BR3 A;  4OO1 F;  4B1R A;  5CVR A;  2JA7 J;  3ZR8 X;  5HDG A;  1CQT A;  2NN6 D;  2NVQ J;  4FW9 A;  1XG1 A;  4DR1 E;  2CW0 F;  4NC7 A;  3RYP A;  4TV7 A;  2FQ4 A;  2BHZ A;  2R5Z A;  3MWM A;  3O3K A;  3F6V A;  4FE4 A;  5ICE A;  4KIG A;  3ZMZ A;  3HM5 A;  2LP0 A;  3TMO A;  4DR5 I;  3KP2 A;  3DP7 A;  4DR3 I;  2DMQ A;  2HTJ A;  3QT7 A;  3F21 A;  4WWC A;  3BJO A;  3MKZ A;  2EPF A;  3I4P A;  2LDU A;  3MZY A;  1TWG J;  3Q9S A;  1HNW I;  2IT0 A;  1JXS A;  2GIZ A;  1OQY A;  4HQE A;  1S7E A;  5LMN E;  2DW4 A;  2ETH A;  4FIS A;  3V7S A;  2VE8 A;  2Y48 A;  3M8J A;  5FLV A;  4X0G A;  2XGE A;  5B5E C;  4C2M J;  4BGD A;  2C38 A;  3NQO A;  5E1X A;  2JSP A;  3A03 A;  3FHZ A;  2PO1 A;  3DQV C;  3HYI A;  3BPX A;  1YRN A;  4I0B A;  3RPU D;  4AYB A;  1UDS A;  4DV4 I;  4JYA I;  4BBR J;  1J75 A;  5D6E A;  4UUS A;  2O1V A;  3G6E I;  3HTU A;  1MMG A;  4G8X A;  2DT7 B;  3J7Y J;  4NXN I;  1OYW A;  1JUS A;  4OIN F;  1RI7 A;  2HZT A;  5BPD A;  4I2O A;  1DPR A;  4A3E J;  2XGX A;  3CME I;  5CJ9 A;  2EK5 A;  1MMD A;  5FLX C;  4HF0 A;  2ISZ A;  4M6V A;  1K79 A;  1W5C C;  1G4D A;  2PJR B;  3ECH A;  1N32 E;  4FW3 A;  1B4A A;  3LSJ A;  5IT9 Q;  2IGN A;  3LFU A;  4R1F A;  4DV2 E;  4CCM A;  4JI7 I;  1NK3 P;  4IFD C;  2K9S A;  1RIO H;  3KZI C;  3OTO E;  1GUU A;  3K9T A;  4BJ6 C;  4NUB A;  1ZLJ A;  4OO1 A;  2M30 A;  4E4H A;  4KN7 X;  2GWR A;  1YW9 A;  1IF1 A;  2L7Z A;  3ZQH A;  2ELJ A;  1HR0 E;  1RKT A;  4RB0 A;  4EJU A;  3K1P A;  1Y5Y A;  3TKY A;  4A0Y A;  2HDC A;  3MZ8 A;  3WTZ A;  5C0X F;  1OCZ H;  4DR2 E;  4RB1 A;  1ZM3 A;  2BA0 D;  4OX9 E;  1TNT A;  2ICW G;  3BR5 A;  1W36 C;  2P5V A;  3RKY A;  5CVJ A;  1DU0 A;  1A35 A;  4IZJ D;  5ICC A;  2XKP A;  4XL9 A;  2QZ8 A;  1ZLK A;  4K0K I;  2BY0 A;  4ZYG A;  1T0F C;  2K85 A;  3WTY C;  4BQO A;  4X66 E;  4C3H J;  2CW8 A;  2VAS A;  1Z67 A;  4RMN A;  3BTI A;  4MU4 A;  1U8R A;  1Z0B A;  4DPY A;  3R0A A;  3S1Q J;  3LAJ A;  4BXX J;  4LCG A;  3FXQ A;  1FPQ A;  1P4X A;  2FNA A;  3OYL A;  3N97 A;  2XPW A;  4LF9 I;  2R3S A;  3HOS A;  3FBN B;  1LEA A;  5FJ8 J;  5LMU E;  1R49 A;  2RQQ A;  2ZB9 A;  3ZQI A;  2LY1 A;  3I4N J;  3GFI A;  4N4O B;  4HQM A;  5ILU A;  4WUB A;  5AIQ A;  1B9M A;  3R0J A;  4QSH A;  1QBJ A;  4R1H A;  5DUK A;  3IAM 2;  3WGI A;  2XV4 S;  1H74 A;  2MAB A;  2YR2 A;  4D0P A;  3CC7 I;  1B6A A;  3QWL A;  3UKG A;  4CUG A;  3BG3 A;  1AU7 A;  4YHH E;  1V5E A;  5K36 F;  1K83 J;  5GTI C;  2HFU A;  2BA1 D;  2PI0 A;  3U2R A;  1VTN C;  3E5U A;  3F8N A;  1VQN I;  4ENM A;  4QLC U;  4YY3 I;  1STZ A;  2A5Y B;  4I09 A;  1Z0G A;  4JOM A;  3S2W A;  2IBD A;  3HXL A;  2LH9 A;  1MH4 A;  2MD5 A;  3QPL A;  2IS6 A;  1UST A;  1XNQ E;  1Z77 A;  3ZZT A;  4C9Y A;  4D7N A;  2VBW A;  3AG1 H;  3N05 A;  4PK4 A;  5B3S H;  2D1V A;  2BXY A;  1DP7 P;  1FJG I;  5JEA B;  1A6Q A;  2VXD A;  3PIP F;  3V4G A;  2HYJ A;  4CYC A;  4I01 A;  3EDP A;  5C0X A;  1TZL A;  1ETV A;  2JQ7 A;  1RRJ A;  1Y0U A;  3I5U A;  2M4G A;  2VOO A;  1FP1 D;  2JK3 A;  3EUA A;  3ECO A;  1UG2 A;  1ZQ3 P;  1XMA A;  5IPA A;  4BAY A;  2L5Q A;  1ZAR A;  1YS6 A;  4Y7N J;  5E3L A;  2C6Y A;  1QU3 A;  3FXK A;  2R7Q A;  1XGN A;  3S3O A;  1O3T A;  1TWF J;  3Q6M A;  2A68 F;  2P7V B;  2K9N A;  3CUQ B;  1M1E B;  4DNC A;  1GDT A;  2DOF A;  1YLF A;  2KIF A;  2VF3 A;  2QQA A;  2ECC A;  2VQG A;  1XCV A;  5C44 J;  3F0C A;  2ZXH A;  4WX9 A;  4HY1 A;  2CUZ A;  1T56 A;  3KX2 A;  1I5Z A;  2BV6 A;  2HU9 A;  2IA2 A;  4JX5 A;  4EM2 A;  4JV5 E;  4DPT A;  4DUY E;  4YIR X;  2R7R A;  2R3V A;  2WW4 A;  3HRS A;  1TLH B;  3WU6 A;  3SFI A;  3DXJ F;  5F0H A;  4G6D A;  1BC8 C;  3SYT A;  1Z59 A;  1BL0 A;  1MBK A;  3SFZ A;  2RDP A;  4B43 A;  3BR6 A;  5TRD A;  1QGP A;  5LRS A;  5A2Q Z;  4MFD A;  2CRG A;  4B4C A;  4UUS B;  3FMQ A;  1EV7 A;  2BM0 A;  4LG0 B;  2CO5 A;  4YFN F;  4HRI A;  3CZ6 A;  2CS3 A;  2K9Q A;  4I3H A;  5F6F A;  4LOC A;  4EMS A;  1Z9C A;  1OYS A;  2DOD A;  3P5J A;  3T8R A;  3S17 J;  4OO1 D;  2EZK A;  4DZP A;  2ESN A;  4NNJ A;  4MYU A;  4ZYE A;  2EZL A;  5AIP A;  2HS5 A;  5H20 A;  3X2Q H;  3L7Z A;  4A3K J;  2L9R A;  3Q5F A;  2ID6 A;  4HF2 A;  1UDQ A;  4GGG A;  1KZH A;  1IG7 A;  2KLO A;  2R7F A;  1UMQ A;  3M8E A;  4IEJ A;  4ED4 A;  1ETY A;  5DEQ A;  2BBY A;  3G1O A;  1N25 A;  1J09 A;  4JX6 A;  4BY7 J;  2CWE A;  4BL0 B;  2VB6 A;  2STW A;  3H35 A;  3TDU C;  3W6K B;  1KIJ A;  3Q1Q A;  4A69 C;  4Q5S F;  1EH6 A;  4LF5 I;  1PIE A;  1R36 A;  2V6C A;  5LL6 R;  5IT9 C;  2VJJ A;  3GW2 A;  4OAZ A;  3P9C A;  4L5E A;  1X19 A;  3B73 A;  4YFK F;  3JSP A;  1OMI A;  5M3F J;  1MBE A;  1Z0W A;  1S4E A;  2I8D A;  2VQF E;  4DV5 E;  2IRF G;  3RIR A;  4AID A;  2EIL H;  2X4H A;  4FN5 A;  2V1X A;  2HOE A;  1Z0E A;  2DFE A;  4BY1 J;  4RLQ A;  1Z0C A;  1IN6 A;  4M72 A;  2V4J C;  1WJE A;  1AOY A;  4PSX A;  1ZGJ A;  4BH9 A;  2NOG A;  1GV2 A;  4XSX F;  1TC3 C;  3V8K A;  2VC0 A;  4IHS A;  5BR8 I;  2EV5 A;  1BJA A;  2EH3 A;  1VND A;  2UXC E;  4KFC A;  1FWZ A;  1HCR A;  2MBF A;  4MQV A;  1XPX A;  5FO5 A;  3U1Y A;  4JI6 E;  2ZSH B;  4XN0 A;  2H8R A;  1HW1 A;  3DBR B;  3LSR A;  5FLX Z;  2WP8 A;  1IXC A;  4DOZ A;  4DU7 A;  5EG0 B;  2QA4 I;  2R7Z J;  4E7L A;  2E2I J;  3DKX A;  3TO9 A;  3LSM A;  3KP4 A;  2K7L A;  1BI2 A;  2OV7 A;  1N0U A;  5LHH A;  4R79 A;  5JEA E;  3GTO J;  3KP7 A;  4LF8 I;  2CU7 A;  1S5L C;  5E1W A;  4U3B A;  3WGH A;  1MMN A;  1CF7 B;  1K61 A;  5LBQ A;  2OAZ A;  3WU0 A;  1E2X A;  3MN2 A;  3K6G A;  3G71 I;  3WU5 A;  1BI1 A;  5ICG A;  4XRM A;  5DRQ A;  5C0X D;  2V7F A;  3FM3 A;  1YJN I;  3REO A;  2XSJ C;  4ENK A;  4BXF A;  1P7J A;  4HNU A;  2XF7 A;  4HNV A;  3M7N D;  2M5W A;  1A31 A;  2JJ7 A;  1IV6 A;  1ZEL A;  3IRQ A;  3CC2 I;  1Y8Q B;  2DJI A;  1LQ1 A;  4N0B A;  1RUN A;  2L4M A;  2NYX A;  4GYI A;  1MJA A;  2HK2 A;  1VQK I;  1S16 A;  3K4L A;  4PRV A;  3OYK A;  1VQP I;  2QBY A;  2UU9 E;  4IRG A;  1K7A A;  2HK3 A;  4UNO A;  4USK A;  1N32 I;  5KAF C;  3CF5 F;  5LHG A;  3JAM Q;  1F43 A;  1HQC A;  2W57 A;  4P96 A;  3W2A A;  2EA4 A;  3K4B A;  3I59 A;  2GS8 A;  1KU9 A;  3J80 K;  3M85 D;  1J0R A;  2XGD A;  3D5L A;  1ZKG A;  2VON A;  2QLZ A;  4BUP A;  4MQY A;  2RNJ A;  3B02 A;  2JEA A;  4LMY A;  2DEI A;  2JZY A;  2HKX A;  3O2P E;  4LPF A;  1YE9 A;  3BR2 A;  3A01 B;  3B4T A;  1IBK E;  1JTX A;  2DMP A;  2M45 A;  3P9I A;  4K2E A;  2V34 A;  1RRE A;  5LFA A;  4LK0 F;  2V26 A;  4OIR F;  1FEX A;  1XMQ E;  5K36 D;  4HG2 A;  2L3D A;  1IDY A;  4I7H A;  2UV1 A;  2VXZ A;  2A6H F;  1G6N A;  5EF6 A;  1MU5 A;  3ZZU A;  3GWZ A;  1UEK A;  3A0H C;  3PRY A;  5CLS A;  3GTJ J;  2R7O A;  1T98 A;  5J1Y A;  2NVT J;  3RKX A;  2E7X A;  3WHB A;  2NS8 A;  4CYD A;  4DV1 I;  4NC6 A;  2LG4 A;  2Q2E A;  2DOA A;  2D45 A;  2LNB A;  4D9J A;  4X66 I;  2RN7 A;  1W1W E;  2JMW A;  2HGC A;  4EAT A;  4KT5 C;  2HKO A;  1RNL A;  2L7M P;  3CCE I;  4DR5 E;  4QTR A;  2R7D A;  2M1B A;  3EQL F;  4X62 I;  4DR3 E;  4F92 B;  5GPC A;  4Q48 A;  3HUG A;  2GQQ A;  1E3O C;  1HNW E;  1GLN A;  4RGR A;  1MGT A;  1T38 A;  5JEA C;  5LMU I;  2EFP A;  1QPI A;  1USU A;  1MND A;  3WTS C;  1H89 C;  3EYY A;  2I5U A;  3T5X A;  3VSK A;  3JRB A;  3HOZ J;  1O7F A;  3FBI B;  1E17 A;  1D1A A;  3KLO A;  4NQW B;  2NVY J;  5DYM A;  2RC4 A;  3C2H A;  1QRY A;  2CUF A;  4WUD A;  3FZV A;  5HOD A;  2W84 A;  2R7X A;  1SD5 A;  3F8M A;  4HF1 A;  2ZXI A;  1H9T A;  3ZKD A;  4YHH I;  1Z5B A;  1VQ6 I;  3S15 J;  2E1R A;  3PFY A;  2DQR A;  2NNN A;  1HKQ A;  3PYE A;  3OYH A;  2FBH A;  4MU1 A;  3P7N A;  2JA8 J;  2HYG D;  2DPD A;  5JI6 A;  3VYT B;  1A04 A;  4P55 A;  2VKH A;  4XNF A;  4BEH A;  4L9V A;  4PGH A;  2HPM A;  1SMY F;  1SD7 A;  1KA8 A;  4QPQ A;  3CO7 C;  5D4S A;  2C39 B;  3GZ5 A;  2A05 A;  1PUF A;  3ASO H;  4A5N A;  1X1C A;  2KRH A;  4B3T I;  4KYW A;  2G7H A;  2AS5 F;  4IXA A;  4XID A;  4JI7 E;  1DPU A;  4CSW A;  1HA8 A;  1HKT A;  3WU3 A;  5H2F C;  2E2J J;  3KEQ A;  3LA7 A;  3KFW X;  5TIS C;  1MSE C;  2VOD A;  3GFJ A;  4A3F J;  4WUC A;  2XIG A;  2PMH A;  1MKM A;  2JEB B;  2DTZ A;  4A2U A;  5GMD A;  1QZZ A;  3HOV J;  2X6X A;  2PO2 A;  1T6S A;  4M3G A;  2WP8 B;  2VKV A;  2COM A;  2QSH X;  5K5O A;  1U78 A;  2KRF A;  2RRE A;  1X3W B;  3HBL A;  4K0K E;  3TOA A;  4DPX A;  5BPI A;  2BY1 A;  3B6A A;  1N77 A;  1ENH A;  4MTD A;  4WXD A;  1X2M A;  2QSG X;  2BYV E;  2BW3 A;  2KIM A;  1DGR M;  2LF8 A;  3K1M A;  5F08 A;  5IT9 Z;  3DU6 A;  1NHH A;  3WTU C;  4IFD D;  2HFH A;  2Z33 A;  3AG4 H;  4IRH A;  3MEX A;  4RBO A;  3VB2 A;  3TW7 A;  1BC7 C;  2A5W A;  1UHS A;  3VOE A;  3F9K A;  3LA3 A;  5H6Q A;  2UUB I;  1JKR C;  1QQI A;  3E6M A;  1ULY A;  1WSU A;  1LVA A;  3V5R A;  1ACI A;  1YIJ I;  4D7M A;  5L3C A;  1MZB A;  4B48 A;  2X9D A;  3LNU A;  1ZAO A;  3GYH X;  1UHM A;  2QM3 A;  4Z7Y A;  1NK2 P;  1W36 D;  2TCT A;  3HRM A;  3I54 A;  2O3Z A;  4H4K C;  3QYB A;  1PVG A;  1IN8 A;  2BM1 A;  3CDJ A;  2ME0 A;  5FGM A;  2XRO A;  3W3C A;  3M1E A;  3DBL B;  1EKE A;  2H09 A;  2ZJ2 A;  2EV6 A;  5JHU A;  2O3F A;  3S1R J;  5KVR A;  4CHU A;  3H4L A;  3I59 B;  3K1N A;  3WTV C;  1MG7 A;  1E3P A;  4HLY A;  1S9H A;  3MVP A;  3JAM C;  1D0Y A;  2AO9 A;  2FBI A;  1YI2 I;  3FWE A;  1HC8 A;  4DV5 I;  2VQF I;  1HW5 A;  2KIS A;  1K47 A;  2CV0 A;  4PGG A;  1VQL I;  3GZN B;  2QYO A;  3NWT A;  4ON0 A;  1SD6 A;  2PNZ B;  2CQK A;  2X1E A;  2M2E A;  3WHC A;  1ZRE A;  2OA4 A;  3ABU A;  1IUY A;  3HSR A;  1N36 I;  1USV A;  1V5F A;  5FKL A;  4ESF A;  4LFU A;  4DIQ A;  2YU3 A;  2X0L A;  2Q8K A;  1S7A A;  3OL4 A;  3KP5 A;  2JUC A;  4X65 I;  5DD8 A;  1TQP A;  2WY8 Q;  2Q2E B;  2M3A A;  4ZYH A;  2F5D A;  4YII A;  2IPQ X;  1XDS A;  4I02 A;  4JI6 I;  1ZR2 A;  3QT8 A;  2R4G A;  2X48 A;  1W5S A;  2A6E F;  2KT0 A;  2OTJ I;  1FP2 A;  1XDU A;  4A3D J;  1GXQ A;  1R58 A;  3ZP5 A;  1B62 A;  1EA3 A;  1ZHF A;  2H8W A;  5DRP A;  1R5I D;  1J7K A;  1XMK A;  4OWR B;  5ILS A;  2HOS A;  2H94 A;  2BZT A;  4BBS J;  3H5R A;  1O3S A;  5JFR A;  2HOT A;  2BR2 A;  2BEO A;  3DEW A;  4AIH A;  3G4S I;  5KCM A;  3HUL A;  4BHP A;  4HX7 A;  1DQU A;  1R00 A;  4MNU A;  1TWC J;  2FXA A;  4BDY A;  4EVI A;  1X1A A;  1D0Z A;  3ZN1 A;  2Z5B B;  1R4M B;  5DUI A;  3DKW A;  2WC2 A;  3BT9 A;  1WH5 A;  2CSO A;  4HA8 A;  3ZMV A;  5HS7 A;  1F1Z A;  3FX3 A;  5K1Y A;  5C3E J;  2DTR A;  3BQY A;  2EFQ A;  3LQR A;  2IA1 A;  1ITY A;  1MD0 A;  2V1U A;  4MDT A;  1SEU A;  4XOR A;  2DDA A;  3VPR A;  4JI4 E;  1ZTR A;  5C4J J;  2HWV A;  3DCF A;  2R42 A;  4HYM A;  1RR7 A;  2HXI A;  5H6R A;  1O3R A;  2JT1 A;  1OPC A;  2GXB A;  4IF4 A;  3FXL A;  4C3I J;  4Z6Y A;  3QP5 A;  2UXB E;  4JP0 A;  4D1Q A;  3PSF A;  4IZZ A;  3JRE A;  3BCB A;  5J3L A;  1B72 A;  4E70 A;  2ELK A;  3BP8 A;  2VT2 A;  3BTL A;  3PQJ A;  1PUF B;  1P9Q C;  3OYM A;  1I39 A;  1FWK A;  3BWG A;  2UU9 I;  4EQQ A;  1YW8 A;  5JHF A;  1G3T A;  2DK8 A;  1KGS A;  3CCR I;  2CMP A;  4A3J J;  1Z0T A;  4PFP A;  3MMY B;  4U0W A;  4XM3 A;  2HNH A;  4DR6 I;  4ZTF A;  1J9I A;  5D5V B;  4B47 A;  1Z5C A;  2FJ1 A;  4A0X A;  1T39 A;  1TTY A;  2MW8 A;  4FW5 A;  2F2E A;  2BA0 G;  2KZG A;  3KP6 A;  1ETW A;  3L2R A;  4IQ4 A;  4WCG A;  1QVU A;  4HEA 2;  3CCV I;  4E7H A;  4OIQ F;  1W0U A;  2LKX A;  4E7Z A;  2AXL A;  2Z1D A;  3GTK J;  3PYF A;  4AD9 A;  1ZK8 A;  3HOW J;  4BE0 A;  2MLK A;  5BR8 E;  1FMW A;  3O8G A;  2L01 A;  5BMZ A;  1S72 I;  4HXZ A;  3VFZ A;  2CQ7 A;  2QWW A;  4II2 A;  2WB1 N;  2KIQ A;  2KMU A;  2BOL A;  2OC6 A;  3RPQ A;  2BW3 B;  2LK2 A;  1KU2 A;  3ULQ B;  1VFC A;  5KHD A;  2F6C A;  3RYR A;  1K78 B;  3KE2 A;  3K7A J;  1JKQ C;  1YFH A;  1GVJ A;  5FKN A;  5M5X J;  4JI3 E;  4L9J A;  1HDD C;  3QAH A;  1OLT A;  1XXE A;  1BIB A;  1ZYR F;  2OPT A;  3D4J A;  1SVM A;  2IA0 A;  3HKM A;  3FXM A;  3LL7 A;  3HJC A;  5CVU A;  1E0E A;  4HSR A;  3BC8 A;  4XLH A;  3ZCO A;  3S3M A;  1AHD P;  3GTQ J;  1KYW A;  1VZ0 A;  1XSX A;  2IER A;  4LF8 E;  4HX4 A;  2BA1 G;  1LDK B;  2F4M B;  4XSZ F;  4RDU A;  2NN6 B;  2W4S A;  5DDG A;  3CDI A;  3OYN A;  2UUC I;  1LDD A;  2CW7 A;  4DV6 E;  3K4M A;  1ZR4 A;  4BQA A;  4LF6 I;  4A3L J;  4LFA E;  2LYC A;  5ERI A;  4NBQ A;  2AQE A;  4AUX A;  5JR3 A;  3K70 C;  1P42 A;  4UB8 C;  2F4V E;  3OS1 A;  1Z91 A;  2OBP A;  3EPZ A;  1WCM J;  2ME6 A;  4A0Z A;  1XGS A;  1PVE A;  1S7O A;  4FWG A;  2VIX A;  1WFX A;  3CLQ A;  4CDG A;  5E18 F;  4BDZ A;  2E1C A;  3ZPL A;  1WI3 A;  1K4S A;  2DA6 A;  1D3Y A;  4CA0 A;  2LSO A;  1R9T J;  3LTO A;  5HLI A;  2RNG A;  2L9N A;  2K4J A;  2V9V A;  3C2B A;  3ERE D;  4FW7 A;  1W0T A;  2V1N A;  4MIM A;  3HHG A;  2VKD A;  4LIU A;  3H9Q A;  5A2Q K;  1UEL B;  4A3M J;  3DBH B;  5GAE J;  4HLX A;  4XKB A;  1XMX A;  5L3E A;  4FCY A;  4EJT A;  3R6S A;  3HGY A;  3SXY A;  4A3G J;  1FX7 A;  5TGT A;  3GON A;  1Y6I A;  3BG7 A;  5B1B H;  2NVX J;  1P4W A;  1XX5 A;  1R5H A;  3CJN A;  4XRF A;  4B44 A;  2KRC A;  2VC1 A;  4RB3 C;  1BN5 A;  3ROU A;  3CCY A;  1C0W A;  3RJP A;  3E1S A;  4MQ9 F;  1HW2 A;  3Q6N A;  3RTR A;  1RPW A;  4KMU X;  2CG4 A;  3F3X A;  4HAM A;  3HB9 A;  4RAZ A;  3HKZ N;  1ZRC A;  3H3U A;  3I53 A;  3OYJ A;  5K5Q A;  3VOD A;  4BA2 A;  5LEJ A;  2BR2 B;  4UY8 I;  1QHG A;  2IW5 A;  3ONQ A;  4DV1 E;  3QU3 A;  1O3Q A;  4DPW A;  2XDV A;  3KIO A;  5GP9 A;  3CCU I;  3WTW C;  5IYB J;  4RAF A;  3L2U A;  3ZMD A;  1LPQ A;  1IBM E;  3CP2 A;  1A6I A;  5JVG F;  3JAM Z;  4HW0 A;  3HDD A;  2OU2 A;  4X62 E;  1XMO E;  2QKL B;  1WZ2 A;  2VE9 A;  3J80 Q;  3JRG A;  2HQR A;  2DU9 A;  3QP6 A;  3F8B A;  1X4P A;  2IP2 A;  1IXS B;  3I56 I;  2O8K A;  4IZJ B;  5ILV A;  1OCO H;  1IRX A;  4IX7 A;  4LFC E;  2R7W A;  2ZFU A;  5TJJ A;  1FC3 A;  1BJZ A;  1F9N A;  2VJ4 A;  4OAY A;  5J8C A;  1IN5 A;  2PMZ A;  4HV6 A;  5FLX K;  5LGU A;  2PO0 B;  2CG9 A;  1LB2 A;  3GXO A;  3K85 A;  1Y60 A;  1JTY A;  2E5L E;  5E17 F;  1UB9 A;  4AM3 A;  2LOO A;  1R71 A;  2X36 A;  5DV5 A;  3OYB A;  1ZXM A;  4DYR A;  2P6T A;  1F36 A;  2WAD A;  3SDG A;  3VDX A;  1SFX A;  4IZK B;  1JJ8 C;  3L09 A;  1WGX A;  1WQ2 A;  1R6L A;  3DWL E;  4Q47 A;  3ZQQ A;  3LSI A;  4L0Z B;  1ZRF A;  3FMS A;  2UUZ A;  2XB5 A;  2FUG 2;  3P06 A;  4II3 A;  5CQG A;  3NAU A;  4B3S E;  2XEX A;  4B3T E;  1JKO C;  1BA5 A;  2VI6 A;  1BM9 A;  2VQL A;  4N9H A;  2UXX A;  5FFX A;  5JVT A;  2V2Z A;  5EGO A;  3L2Q A;  2LMD A;  1O7L A;  2WY7 Q;  4KA4 A;  1IDZ A;  1ETQ A;  3K2Z A;  2NN6 E;  2ZJQ F;  3T1H E;  2ZBK A;  1YYV A;  1NHJ A;  3RI4 A;  2R7S A;  4M9S A;  1QNT A;  1YG2 A;  2E5Z A;  1K6O A;  5EKW A;  4Y13 A;  3R60 A;  1Y56 A;  2CGP A;  2R5Z B;  4EJW A;  3KEY A;  1XHK A;  1IAW A;  3QT6 A;  3DTE A;  1D5Y A;  5E8I A;  1EF4 A;  4JI0 E;  2O1T A;  1OR7 A;  4IHY A;  2RGV A;  2E34 A;  2E35 A;  5DS9 A;  1XN7 A;  4ZYD A;  1TW3 A;  1UDO A;  3OWT A;  1ZRD A;  4M9Z A;  3P3E A;  1MBJ A;  3LNQ A;  3IP4 B;  3A2K A;  2CUJ A;  2L7K A;  2C38 B;  2PO1 B;  5D6F A;  2UUB E;  1YRN B;  3M7N G;  4GKJ E;  5K36 A;  4ETS A;  1FBS A;  5KAI C;  3K4K A;  1SAN A;  3RCO A;  2F5F A;  3K2A A;  4LG3 A;  4QPO A;  4NC8 A;  4BNC A;  1XSV A;  4G6Q A;  4BHB A;  4JI4 I;  1TQM A;  1VQ4 I;  2QQB A;  3OL3 A;  4Y15 A;  4Q4Z F;  3K0L A;  2UUA E;  1HDP A;  2UXB I;  1I6H J;  3ZOB A;  4ZC3 A;  2O1W A;  1U5T C;  3I4M J;  1BKN A;  2QF7 A;  1Z6R A;  4HV5 A;  5EJC A;  5HS8 A;  3F72 A;  3HOT A;  2QSF X;  1XS9 A;  2Y0S A;  1WH7 A;  3V7R A;  4KIC A;  3M85 G;  4MU3 A;  2DA2 A;  3DPL C;  2V1D A;  2P7C B;  1ZM4 A;  3HHH A;  3IWZ A;  1BIA A;  2XRL A;  2FEZ A;  3RZO J;  1YX3 A;  2WA0 A;  4YEL A;  2YS9 A;  4P1W A;  1H7U A;  4FAS D;  2JN6 A;  3CWV A;  4OO1 B;  2ZME A;  3QPS A;  2JTV A;  2Y0M A;  3W2W A;  3F6O A;  2J5O A;  2IES A;  4IFD F;  3BY6 A;  1OJL A;  3J81 K;  1FTT A;  1N36 E;  2M0M A;  1YQA A;  2LR8 A;  2NN6 C;  3SHF A;  4LFB I;  3HG9 A;  1AKH A;  4B09 A;  5IP9 J;  4X65 E;  4UV8 A;  4XLP F;  1JUP A;  3FKJ A;  3QYE A;  1K4T A;  1R23 A;  3D0S A;  4U7B A;  2RAE A;  2O1U A;  5M3M J;  3G2B A;  3WOD F;  1YO5 C;  4LLL A;  3JRF A;  1YH8 A;  4IHX A;  1VI7 A;  2HVQ A;  2R92 J;  4JG4 A;  2L02 A;  2HDW A;  2JE6 A;  2HEO A;  1WJF A;  2R7T A;  2Z2S B;  1I27 A;  3KCC A;  5DM6 F;  5DM7 F;  4JI3 I;  4ESJ A;  3TW6 A;  3IWF A;  4AIK A;  1DDN A;  1FIP A;  4MEY F;  2ZM6 I;  2WBM A;  2K5C A;  3J80 C;  2VQE E;  4M3D A;  9ANT A;  2HR3 A;  2F48 A;  4DBR A;  2BVM A;  4P9U A;  2VL8 A;  3BTC A;  5LHI A;  4A5M A;  1YHQ I;  1FZP B;  2CGE A;  1Z1D A;  4M71 A;  4JI2 I;  2DK5 A;  4HOB A;  4DV6 I;  3C18 A;  4LFA I;  3GX4 X;  4G6T B;  2B9S A;  3CMY A;  1T8I A;  2F4V I;  2DMN A;  2ZJR F;  2H1K A;  3GF2 A;  1OIS A;  2COB A;  1B59 A;  1NG7 A;  1G3S A;  1TWH J;  1FNM A;  1JGS A;  4LK1 F;  4LB5 A;  1ZN2 A;  3K4J A;  4EM1 A;  3CTA A;  1VF9 A;  1Z3X A;  5ICF A;  3T1B A;  1MMS A;  3A1Y A;  2KQR A;  3CLO A;  1GHC A;  5DRO A;  2NAZ A;  4LJZ F;  2GM4 A;  4JQF A;  4IFD A;  4EM0 B;  3C3W A;  1SAU A;  4BS9 A;  4CYC B;  2DN0 A;  2HQN A;  5EGO B;  3JRA A;  2MC3 A;  1ZM2 A;  2OCC H;  3NRV A;  5C0X B;  4E7S A;  2PQ8 A;  2DYS H;  4DR6 E;  2O8X A;  3PS3 A;  5GAH J;  2ZIT A;  2KPM A;  4C2U A;  3G1M A;  1QZY A;  3ZQL A;  3VYR B;  3R4K A;  3FK6 A;  1WPK A;  3HOU J;  5J4Y A;  4AVZ A;  2HPI A;  2VKE A;  3K4C A;  5LD2 C;  3HTS B;  2WAQ A;  3RDI A;  1IJW C;  1PJR A;  2DBB A;  3PSI A;  2VN2 A;  4KHP E;  3ELK A;  1S6L A;  2HYF A;  1I94 E;  2K3F A;  1L0O C;  2EZI A;  4JI8 I;  2EFN A;  1REP C;  1UZC A;  4DBQ A;  4Z7C A;  4ISA A;  4O3M A;  1I3A A;  4QNJ A;  1T0F A;  4I99 C;  3CMM A;  3LA2 A;  4XQF A;  4AQY E;  2MC4 A;  2WV0 A;  4LB6 B;  1PUE E;  1HKS A;  1A5J A;  2GO4 A;  4HAC A;  2NRA C;  1VIS A;  3OSF A;  1JUM A;  3GFL A;  1BW5 A;  2FSW A;  4OU0 A;  3DEE A;  3U1D A;  1WJ5 A;  5E79 C;  2XGC A;  2WWY A;  3U9G A;  2V6E A;  1IBM I;  1R22 A;  5IT3 A;  3EUH C;  2IEK A;  3ABT A;  3E6B A;  3H9J A;  1ZGW A;  4PJJ A;  3WGG A;  1XMO I;  5JLX A;  4Y3O A;  2V2V A;  4DGW B;  2GOM A;  3KYL A;  2PNM A;  1Z7U A;  2Y9Y A;  4OO1 E;  1U2W A;  5CYV A;  3CCL I;  1W7P D;  2X51 A;  2V9P A;  1D5V A;  3GCM A;  3DPU A;  2KJB A;  2Z5C A;  4PJL A;  2DPU A;  2P6S A;  2H27 A;  4LFC I;  3HRT A;  3HGG A;  4UV9 A;  2EIK H;  1RET A;  2UUC E;  1OYY A;  2CV1 A;  3L7Z B;  4DR7 I;  2KKO A;  3E3V A;  1X3U A;  4LF6 E;  4MO7 A;  1BOB A;  3TO7 A;  1QHH D;  2GOX B;  3L9F A;  1XGM A;  4L18 B;  3PYG A;  1J5E I;  2H6C A;  2FMY A;  5EL9 A;  1JHH A;  2GA2 A;  4X64 E;  1R6R A;  4ZZL A;  4XOT A;  1KQ9 A;  2HXO A;  3HSF A;  3QYF A;  1X2N A;  5FRO A;  4PJM A;  2E5L I;  5DCM A;  2LBF A;  4LGW A;  1LFP A;  3CUQ C;  1HNX I;  2CFO A;  2ZME B;  4XTJ A;  4OIO F;  3M1C A;  2W85 A;  3GME A;  1ZG1 A;  1SFU A;  1Y4U A;  1UDN A;  2DA3 A;  3L2W A;  1IUF A;  1HST A;  3B8H A;  2M0C A;  2ZC2 A;  4B3S I;  2PNL A;  4OMZ A;  4XLN F;  3ZM7 A;  3T1Y E;  2EB7 A;  5GAG J;  4BU2 A;  3PS1 A;  2DFI A;  4LLN A;  3W2V A;  2OQG A;  1JKP C;  2JT2 A;  3CF2 A;  3BLY A;  1ZGA A;  2Y30 A;  3DU5 A;  1ZG3 A;  2DDB A;  1KQ0 A;  1KU3 A;  4Y33 A;  5IOY A;  1BR4 A;  3SEQ A;  3T1H I;  3H3Z A;  2O7O A;  3ZGK A;  4F3Q A;  3K70 D;  3C7J A;  2IGO A;  2JVH A;  2VBZ A;  3LSH A;  2EA2 A;  1F4K A;  5LGN A;  5BQT A;  2XHK A;  4G7H F;  2QCO A;  3DTI A;  4M3B A;  3L2V A;  2PG4 A;  2R0Q C;  1IGN A;  4IQJ A;  4M1K A;  2HHH E;  1TT5 B;  1FBQ A;  4ABZ A;  2WNR A;  3E6D A;  2AXT C;  5K7H A;  2BV3 A;  3E5Q A;  2NS0 A;  3DKY A;  4FW6 A;  5A2Q Q;  2P4W A;  4JI0 I;  1ETX A;  5LRR A;  3TO6 A;  3BG5 A;  2GXA A;  1IRZ A;  3PM1 A;  4A3C J;  1FY7 A;  4DYC A;  3DLL F;  2CH0 A;  3MFK A;  1EA6 A;  4RPF A;  1FOX A;  2ECB A;  3GEZ A;  3NAR A;  5C0X E;  1IW7 F;  4OO1 C;  3Q0W A;  4U0Y A;  2ZXW H;  3A4C A;  3JRH A;  2E2H J;  4GKJ I;  1S29 A;  4LCF A;  3DPT A;  1Z0X A;  3WG7 H;  1OCR H;  1P7I A;  3WU4 A;  1IO2 A;  2DA1 A;  2LRE A;  2IVM A;  3E6C C;  1U8B A;  5HS9 A;  2GBY A;  1UHW A;  2MGQ A;  3L00 A;  1D8K A;  2UUA I;  2M9H A;  3L1P A;  4WK8 F;  4RB2 C;  3HL2 A;  4GRI A;  1IBL E;  3MZH A;  1H7S A;  2QBY B;  5DNL A;  3F23 A;  4KIF A;  4G9Y A;  1ETK A;  1HNZ I;  2E1N A;  2H6B A;  4WXC A;  1NZ0 A;  2LVS A;  3MQ0 A;  3OR1 C;  2K4B A;  3E0J B;  2JSC A;  2VPL A;  2ZFW A;  4PZJ A;  4RAY A;  1FI4 A;  4LIT A;  4N9I A;  3KLN A;  3M3Y J;  2FRH A;  2JEA B;  1JHF A;  3OIQ A;  1FOK A;  5E3O A;  3J80 Z;  1XNR I;  2PX9 A;  1O4X A;  1UCR A;  1IRG A;  2A2D A;  3ABK H;  2M8G X;  2PLY A;  1MMA A;  4AC0 A;  2VOP A;  1FLI A;  2AJ4 A;  1NHI A;  3SZT A;  5KK1 A;  3DLA A;  3IHU A;  5HLT A;  3LST A;  2RVC A;  4NB5 A;  4S04 A;  3ZMT A;  3K10 A;  2ID3 A;  3ZN0 A;  2ZSI B;  3AAF A;  1Y1W J;  1GXP A;  2R93 J;  4HAC B;  3OYE A;  3GFM A;  3AL0 B;  2LC2 A;  5HLG A;  3NEU A;  2L7F P;  4I98 B;  4RGS A;  4F7Z A;  4BAC A;  3HOY J;  1OJ4 A;  1Z21 A;  2DFF A;  2ELH A;  2EWN A;  3COA C;  2MD0 A;  4X6A J;  2Z3Y A;  3RZD J;  1OYI A;  2CFX A;  3OYI A;  2PJR A;  4PJN A;  3HUG B;  5BOX A;  1V4R A;  1B1B A;  3LFK A;  3ZXS A;  3WU2 C;  2ACJ A;  1NH3 A;  4G7O F;  3ISP A;  1V3F A;  5IP6 A;  4O6J A;  1Q1V A;  4BKX A;  2HDD A;  2VQE I;  5D8K B;  3JCU C;  5C0X C;  4EV0 A;  2W00 A;  5C4X J;  4BA1 A;  1J59 A;  1TWA J;  5FRM A;  1BI0 A;  4A6D A;  2QEX I;  1GVD A;  2RV8 A;  2LD5 A;  2K02 A;  2HI3 A;  3HZJ A;  5JEA F;  2CZ9 A;  3HC7 A;  3OYA A;  4DUZ E;  3G3Z A;  3W6J B;  4CGZ A;  2EFO A;  3KP3 A;  5BNG A;  4KJZ A;  1XTA A;  2ZXJ A;  3G73 A;  3W6V A;  4UVC A;  3JR9 A;  1NTC A;  4ZTJ A;  1Z05 A;  3GUD A;  2IJL A;  5HVQ C;  2QUF A;  3PQK A;  4XLF A;  2BVL A;  2QKM B;  4J19 A;  1VQO I;  1F5T A;  4ENN A;  4EEF G;  2DXI A;  2FML A;  2JVG A;  2NN6 F;  3RQI A;  4RGU A;  4BEH B;  5DTD A;  4GO1 A;  2LJP A;  2WAE A;  3S2H J;  1P2F A;  3F8F A;  4F52 A;  2FU4 A;  3GO5 A;  1QA6 A;  1WJC A;  4OIP F;  1R5G A;  2Q1Z B;  4U88 A;  1U0J A;  3I9V 2;  3S3N A;  2L54 A;  2H1L A;  1TL8 A;  4EJV A;  5J4V A;  3VWB A;  1SD4 A;  3FDY A;  3ZKB A;  3ML6 A;  1PDN C;  4I6Z A;  2X6O A;  1X1B A;  4DR4 I;  1PP8 F;  4XLA A;  4CH7 A;  1SAX A;  2P8T A;  4MEX F;  1ODD A;  2P81 A;  2PO2 B;  4KHP I;  4JK1 X;  3NWS A;  3TQN A;  5CVV A;  2OQR A;  1I94 I;  1LFB A;  2K86 A;  4XMY A;  1T33 A;  4DZJ A;  2JA6 J;  4AQY I;  1Q1H A;  2FQ3 A;  5EEA A;  1VQ5 I;  1TNS A;  3CP8 A;  4LD5 A;  1SFK A;  3I3L A;  6PAX A;  2X7I A;  3OOP A;  4CCN A;  2A2C A;  1RES A;  2KDZ A;  2JA2 A;  4DV0 E;  2CQQ A;  2NOJ B;  3RQ4 A;  4ZDO A;  3F8C A;  1DU6 A;  3MD2 A;  5JEA A;  1BW6 A;  1V55 H;  1MBF A;  2IAI A;  1G3Y A;  2LLK A;  1YIT I;  1GT0 C;  3VEP A;  5E3N A;  1ORK A;  1LE8 A;  2OF7 A;  1Y39 A;  2ZNZ A;  5FKM A;  2MA3 A;  1FJL A;  2ZM6 E;  3IH4 A;  3HJE A;  1OCC H;  3WE3 A;  1N0V C;  2FBK A;  4LFB E;  1Z0V A;  2QEN A;  3J81 Q;  5FKK A;  2DMU A;  4L5I A;  4EJO A;  5E8G A;  1FOW A;  1T2K A;  1WJD A;  4JI2 E;  2PJP A;  1X1D A;  2VBX A;  4AIJ A;  2F5E A;  4C3J J;  4FWD A;  2LF7 A;  1ERD A;  2BE5 F;  3BOQ A;  2OZU A;  3O8H A;  2NS7 A;  2HKE A;  3CUQ A;  1G59 A;  2OZ6 A;  3WG9 A;  1FIA A;  4X64 I;  3OYC A;  4PRX A;  2Z5U A;  4Y4R A;  4U87 A;  5L3B A;  2PEX A;  3BJA A;  4HX8 A;  1B9N A;  4BJ5 C;  1X1P A;  4FET A;  1UJ8 A;  1H88 C;  1OYR A;  4UTG A;  4ZH4 F;  2KIU A;  4KQV A;  2GLO A; 
#chains in the Genus database with same CATH homology
 4IFD A;  4OO1 F;  5K36 A;  5JEA F;  4BA2 A;  2JEB A;  2BR2 B;  2NN6 D;  5C0X B;  2WNR A;  4AID A;  5K36 F;  2BA1 D;  2BA0 G;  3CDJ A;  5C0X E;  3M85 G;  2NN6 F;  4OO1 C;  5JEA C;  1E3P A;  2JE6 B;  2C38 A;  2PO1 A;  4OO1 B;  5JEA B;  1UDS A;  2WP8 A;  2PO0 B;  4AIM A;  4IFD F;  2PNZ B;  5C0X A;  4BA1 B;  2PO2 B;  2NN6 C;  4AM3 A;  3HKM A;  4OO1 E;  5JEA E;  3GLL A;  3GCM A;  2BA1 G;  1R6L A;  2NN6 B;  2C37 A;  3CDI A;  2JEA B;  2C39 B;  3L7Z B;  5C0X D;  4NBQ A;  4IFD C;  5K36 C;  1WHU A;  2JE6 A;  3M7N D;  2BR2 A;  3H1C A;  4OO1 A;  3H36 A;  5JEA A;  2NN6 E;  4IFD B;  5K36 B;  4BA2 B;  2PO0 A;  2JEB B;  2PNZ A;  3U1K A;  2WNR B;  5C0X F;  1E3H A;  3DD6 A;  2PO2 A;  2WP8 B;  2BA0 D;  3GME A;  1UDN A;  1OYS A;  4IFD E;  5K36 E;  3M85 D;  4OO1 D;  1OYP A;  5JEA D;  2NN6 A;  2JEA A;  2C39 A;  3L7Z A;  3B4T A;  1UDQ A;  1UDO A;  2C37 B;  4IFD D;  5K36 D;  1OYR A;  1R6M A;  5C0X C;  2C38 B;  4BA1 A;  2PO1 B;  3KRN A;  3M7N G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...