3GMEA

Crystal structure of polynucleotide phosphorylase in complex with rnase e and manganese
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
545
structure length
482
Chain Sequence
MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFRPSEGETLIARLIDRPIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPVNEALNARVTDKQERYLHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTDTFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQAINAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli polynucleotide phosphorylase core bound to RNase E, RNA and manganese: implications for catalytic mechanism and RNA degradosome assembly.
pubmed doi rcsb
molecule tags Transferase / protein binding
molecule keywords Polyribonucleotide nucleotidyltransferase
total genus 128
structure length 482
sequence length 545
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 3gmeA02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gmeA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gmeA01
1WHUA 2PO0B 4IFDE 4BA1A 3U1KA 2PO1A 4IFDA 5JEAB 5C0XB 2NN6E 1UDQA 4NBQA 2JEBB 2NN6C 2BR2A 2C39B 5C0XF 1OYSA 3GLLA 4OO1F 2BA1D 4IFDB 3M85D 2NN6A 1R6MA 2WP8A 3B4TA 1UDNA 3KRNA 2BR2B 2C39A 2C38B 3CDIA 5JEAA 4AIDA 3DD6A 2BA0G 3HKMA 4AM3A 2BA0D 5K36A 3H1CA 4OO1A 2PNZB 4OO1D 2JE6A 1OYRA 4IFDC 2NN6D 2NN6F 2WNRA 2PO0A 4BA1B 1UDOA 1E3HA 3CDJA 3GCMA 5C0XD 4BA2B 2JEAA 4IFDF 5K36D 3M7ND 1OYPA 1R6LA 5C0XC 5C0XE 3L7ZB 3M85G 2C38A 2C37A 2JEBA 4OO1E 5K36F 5C0XA 5JEAD 2PO2A 3H36A 5JEAF 2BA1G 3M7NG 4AIMA 4BA2A 2NN6B 3L7ZA 2WP8B 2WNRB 5JEAC 4OO1B 1UDSA 3GMEA 2JEAB 4IFDD 2PO1B 4OO1C 2C37B 5K36E 2PNZA 5K36C 2JE6B 1E3PA 2PO2B 5JEAE 5K36B
chains in the Genus database with same CATH superfamily
2NRAC 1W4MA 1AWCA 4LGWA 4IFDA 1Z6TA 3E6MA 1I5ZA 2JWTA 4KYWA 4HPQA 5CKTA 4KT6A 5DS9A 3ZZTA 4HV6A 3GTJJ 3A2KA 2MLGA 4ZTJA 1SAUA 4N4OB 1KZHA 3KP7A 1NG7A 4HNVA 5FD5A 4PJLA 3GLLA 3E1SA 1SD6A 5B66C 2CMPA 3ZMVA 3F23A 1Z05A 4PFOA 4LMYA 4BY1J 4P52A 2L7MP 4RBOA 2ZBKB 2CZ9A 4AVPA 3ZZ0A 3ROUA 3O2PE 1IW7F 2K3PA 5CPRB 1T0FA 2EK5A 4U88A 2KLOA 3DXJF 1KQ8A 2ZMEA 5HDKA 5DEQA 4B1RA 4KA4A 4UT4A 4KISA 4AIDA 4PJMA 5LHIA 4I02A 2B7EA 3LNQA 1BIAA 1USUA 2L01A 1EJ9A 1Y4UA 4LF4E 2DOEA 2VN2A 3O8GA 1WJEA 4EATA 1HA8A 1R58A 1G3SA 1BR4A 1LDJA 3DLAA 3JAMK 2CQQA 2PG4A 1R1TA 2NOJB 3OL3A 1YIJI 3P9KA 1RKTA 3HHGA 2V9PA 3IH4A 3HRTA 3LTOA 1O7FA 3KP6A 4KMFA 4DPTA 2YU3A 1X19A 3HB9A 4MQ9F 3C18A 4B4CA 4FASD 1OCOH 1POGA 3BG5A 4A0YA 2GXAA 2HPMA 4DR5E 2VF3A 2RKHA 4DV1I 1WJCA 1BI0A 3RKYA 4X62I 2AQEA 4ZYAA 2OA4A 4DBQA 1H9TA 5LMNE 2XSDC 4A5MA 5C0XC 3PYFA 4JYAI 5J1UA 1JTXA 4BUPA 4E7KA 4DPXA 2WTEA 1BL0A 1DPRA 5CVVA 3V8KA 4L9NA 2R92J 3CCJI 1BI2A 2E60A 3PIOF 1XNQE 3V7RA 5D6FA 4CCJA 5JEAD 4XLFA 4DV7E 4A3EJ 2VUMJ 1SFEA 2EBIA 2H27A 2GAUA 2BA1G 1FOYA 4JYKA 2E7WA 3JRBA 5LBQA 5F64A 1LNWA 4ED4A 2L9SA 3CMYA 4GO1A 3FMRA 1T39A 4G7OF 4DR4E 1QHHD 1E0EA 1UDSA 3CCYA 5IT9Q 3J80Q 3T1YI 3AAFA 1TW3A 2HQ5A 2MW8A 3Q9SA 4HG2A 4MEYF 4G6QA 1N36E 3GBGA 2F2EA 4PUSA 2EPFA 2O3ZA 4NC7A 3RDIA 2K5CA 4ENJA 2R7VA 3I0TA 2XGCA 3IUOA 4E7HA 2JE6B 3RKXA 2R5YA 1Z6RA 3MZHA 2JUGA 3ASNH 2EH3A 2XPWA 4UVAA 4BA1A 3LFUA 2VPRA 5HVQC 2IA2A 4CXFA 1R4MB 5M3FJ 2VOOA 5J1YA 1XN7A 3HSRA 5HLTA 2F4OB 3OYDA 2D45A 4NBQA 4A2UA 4LFBI 2UZKA 3AG2H 5AIPA 1Z0VA 4MU0A 1AKHA 1GV2A 1LE8B 5L3JA 4DR1I 3HIFA 4LIVA 2TRTA 4QSHA 4URLA 1G8XA 3V4GA 1ETKA 1IXCA 5D4SA 1Z5CA 1E2XA 5A2QQ 3AG1H 1N33E 1K47A 4A3CJ 1UHWA 4WXHA 3DBHB 1PUFB 1Z3YA 5JEAA 4A12A 3QWLA 2JK3A 1NHHA 2LSOA 4B43A 3S2WA 1FTTA 1XPXA 3WU4A 2VQEE 2UXCI 4BY7J 2CQKA 4HAMA 4NQWB 2H1LA 3FX3A 4NC6A 4KHPI 2XAGA 4BA2A 3E6BA 2EFWA 2VOPA 5FKNA 4D7NA 3ULQB 1Z1DA 3HOTA 3QYFA 3RPUD 3S1RJ 4Y17A 9ANTA 3V42A 3HBLA 3ERED 5GMDA 3KZZA 4M3FA 3PIPF 5TRDA 2UXDE 4JP0A 4DR1E 2GOMA 3GFLA 2HPIA 2DYRH 1RKWA 1BI3A 3E5XA 4PSWA 4JK1X 1VQPI 4XLHA 1ZR4A 4PJNA 3GONA 3P3CA 5F0FA 4DIQA 1UCRA 2FMYA 2AXTC 1BBYA 3I4PA 4IX7A 3ERMA 3ZMDA 3QP5A 3RJPA 1LFUP 5DV5A 1FWZA 2IEKA 3BROA 4XN0A 3K1JA 2GQ0A 1YOVB 4M9ZA 4LJZF 3CCUI 4DV6I 3FHNA 3M1CA 1R5ID 3T1BA 3HDDA 4LFAI 1YX5A 3J7AY 4DYQA 3G73A 2JMWA 5HLGA 3I56I 3JRCA 1IC8A 2RV8A 1I6XA 4ON0A 1VQ5I 2KRHA 2CGEA 3PS3A 1JJ6C 1WI3A 2W24A 5EG0B 4UNOA 4XK4A 4OAZA 1R9TJ 3ML6A 4KT5C 4UUTA 1FP1D 4OO1C 1YW7A 2PMZN 3ECOA 4HV5A 2GXBA 2BGCA 4JI8I 1STZA 2M8EA 2CVEA 3FXRA 3IWZA 1G2HA 4MU4A 3V8LA 3H35A 2MH9A 1MW7A 1E3OC 3FWEA 3HG9A 3G3ZA 2K9QA 3KZYA 4A3BJ 4GKJI 4MNUA 4BJ5C 2YR2A 5D6EA 2NNYA 4A3LJ 3PYGA 2V1XA 2E34A 4L0ZB 2KZVA 2NXNB 2RQQA 3K2AA 3TW7A 3JR9A 1O4XA 1RR8C 4D9JA 2QQ8A 1MNEA 2V9VA 1J5EI 2WB1N 3DEWA 3B82A 3Q0VA 2GLOA 2KDZA 3FKIJ 1GVDA 4XL9A 2ME6A 4KJZA 1B72B 3K7AJ 3EQLF 2V79A 3B78A 4BGDA 1D0ZA 2PJRA 2DDAA 1XMOE 3BZCA 3B4TA 2KJBA 2X1EA 3CTAA 2DTZA 1DP7P 4LF5I 3OS2A 4FQGA 2LREA 2IOQA 2CWEA 2IW5A 4LFCI 3TL4X 2EIJH 2Q1ZB 4B47A 4FWGA 3KP2A 4RM3A 2R7SA 3DD6A 4BDZA 3CJTB 2VIXA 4CH7A 3H0DA 3BTIA 3WHBA 1FWLA 5M5YJ 2DFIA 3LL7A 2IXSA 3JRGA 4ESJA 1IBLE 2DCEA 2M7AA 5LHHA 3FXMA 2F4VE 3RYRA 5GAHJ 5FJ8J 2QSHX 4IFDC 1X1AA 3Q9VA 1TT0A 1ZG1A 3PO3J 2NN6F 3EPZA 5FO5A 1D5YA 1Y1VJ 4LF6E 2BHZA 1GXQA 4I6ZA 3E0JB 4D0PA 5EDNA 2HFHA 2ZO4A 3CCRI 4IFDF 2MBFA 1Z91A 4P9FA 2D1VA 5LEJA 4YIRX 5F27A 2ZJRF 1W0UA 2IOPA 2QCOA 1IBME 3A4CA 1Y39A 1V5FA 2DA2A 1H89C 4BXXJ 1VQKI 5FWKA 1MMGA 1ZQ3P 3RKWA 2NVXJ 2FNAA 4M74A 2M4GA 1X1BA 4WUBA 2O8KA 4NXME 4MTDA 4Y15A 5F6FA 3V7CA 2IGKA 4Q48A 5EGOB 2WAFA 4LOCA 1BC8C 2VC1A 2UUAE 4HNTA 2DO7A 3NWTA 2B9SA 1EV7A 1J5YA 3IRQA 4RB2C 2PX9A 2KISA 1Y56A 2LF8A 4N9HA 4A69C 2OZ6A 4FTHA 1Z5BA 2JA2A 2BV6A 2I10A 5C44J 4DR3E 2UU9I 3W3CA 4H4KC 4JI6I 4XLEA 1WKMA 2PNMA 2MABA 2VC0A 3BG9A 4A3KJ 4KN4X 1IRXA 4GFBA 1WCMJ 4GCVA 3WTWC 5DTDA 3PNVA 4BAYA 5EF6A 3IAM2 2M45A 3HOZJ 3H9QA 4B3RE 5DM7F 1IV6A 4HDUA 4DV2I 1UZCA 2R3SA 2R4GA 1RUNA 5FKMA 2LOOA 1USSA 2EFNA 5HS9A 5IT9C 4RB1A 2CG4A 1K79A 4A3MJ 1DARA 1HK7A 4BJ6C 2R7TA 1TQIA 4FWDA 2ZXJA 1KU3A 2DOFA 3C7JA 2E71A 3LAPA 1PP8F 1R7JA 1XCVA 3E3VA 4HX4A 2D5VA 1E17A 3QP6A 1N25A 3R0JA 4CCNA 2JA6J 1D8JA 2BR2A 2ZJ2A 2X6XA 3OIPA 4CYDA 5JFRA 1GLNA 4P5OA 2R5YB 3KX2A 5L3DA 1A6IA 1JT0A 1VQNI 2MA3A 4DV7I 1K6YA 2EJRA 2NS7A 3A01B 2BA1D 4YFNF 2Z5EA 4NUBA 3VSKA 4Z6YA 2NN6A 2M5WA 4IO9F 2V2VA 5EKWA 4XSXF 1UDNA 3F6VA 2Q0OA 2VONA 3AG3H 4WWCA 2ESHA 4J19A 1LUJB 1D1AA 3ZMZA 3S3NA 2DMPA 3F9KA 2DQLA 2IA1A 2FQ3A 2E1CA 4Q5SF 2NNNA 2XEXA 2K9NA 4AQYE 1S4EA 4DR6I 3CC2I 3IC7A 5IYBJ 2RQPA 2DODA 5FKKA 3LQRA 1FOKA 4IRHA 1IDZA 3CLOA 4CYCB 3SHFA 1YW8A 5IYDJ 1JHHA 2PQ8A 1ZG3A 3GTPJ 2HYFA 2O1UA 2NS0A 2EIKH 3IWFA 4DZJA 3IAS2 1R49A 4AUXA 1MGTA 2UXNA 1B4AA 3AL0C 3HTSB 2P5KA 4OOIA 5FRNA 1RETA 4XRFA 1VI7A 1X3WB 1Z7UA 1USVA 3J7AO 5K36D 1JGGA 1R6LA 1ZG5A 2AE8A 2JA8J 1EA6A 3M85G 3HL2A 1QA6A 5IYCJ 2D1HA 3DTEA 1QPMA 4YRVA 1QQIA 3OIQA 3PL8A 2FXAA 3HGGA 3S93A 1XGNA 1ZELA 4EEFG 4ZYGA 3EETA 4BQNA 4IZKA 4A6EA 4LPFA 4MU3A 4X0GA 4U87A 3JCUC 2W25A 2JTVA 4WUCA 5E18F 2IVMA 4JX5A 2XF6A 4I0BA 1MDMA 5FGMA 1K78B 1KU9A 4JV5E 3O3KA 4ZTFA 2OJED 4RGUA 5B1AH 1S8NA 2EZHA 2RAEA 3CMAI 2R5ZB 4RGXA 2O1VA 3CUQB 4M3EA 4Y13A 2IS4A 3HRMA 4ESBA 5J4YA 3LAJA 2HFSA 1GVJA 5C4JJ 1BJAA 4C9YA 2A2DA 4ASNA 1LVAA 3F72A 1U5TA 3D5LA 5K36C 2VODA 3DWLE 2EA4A 2TCTA 2Q8KA 4BJTA 1Z5AA 1D1CA 4JYAE 3RQ4A 1O7LA 2LBFB 4LCFA 3FZVA 3MKZA 3A03A 4C2UA 4IXAA 4IHSA 5JEAB 3BDDA 1IDYA 4UB8C 4RGSA 4KNYA 1Y6ZA 4HQEA 1Y8QB 2UV1A 2MD5A 3CUOA 3GTQJ 2Z9OA 4WXDA 3DBLB 4MHGA 2HNHA 2VBZA 3SFIA 4F7ZA 2QGUA 3BOQA 3HKZA 3HJEA 1ON2A 3VFZA 1VISA 3ZQHA 2Z5BA 1XDUA 2OQGA 2HXIA 3ZM7A 3HOUJ 2IBDA 1DGRM 2HZTA 1T0FC 2FD5A 1WJFA 1FBUA 2FF4A 2OCEA 3K9TA 4LK1F 1K83J 2LKXA 1YJ9I 1SMYF 3MCZA 4HYMA 1V5EA 4IRIA 3B6AA 4DZPA 1YTYA 1A35A 1P92A 1U2RA 1VQ7I 2M2EA 4DR7E 3ZMTA 3IKVA 1F9NA 2GIZA 2WADA 2P7CB 1VNDA 4PK4A 4IVNA 3LSTA 1YRNA 1S16A 3HULA 5KK1A 1MJ9A 1VQMI 4C3IJ 1T33A 4XRMA 1SFOJ 4IZJD 5JI6A 1HSJA 3I55I 1CF7A 2HOSA 1OYRA 3Q6NA 4RMNA 5K5QA 2V8PA 2VXDA 2YX7A 4PRXA 3RYPA 2UXBI 4OX9E 5GPAA 5C0XD 3EDPA 1Y0NA 1RHYA 1SFXA 4DW6A 2ELHA 1KYZA 2FSWA 5JHFA 4OZEA 2HKXA 1YS7A 2FOKA 3CCEI 2VL8A 2H94A 3WGGA 6PAXA 1IUFA 2HR3A 4BXUA 4PFPA 2HTSA 3GEZA 1R71A 3K70C 5C0XE 4U3DA 4X65E 3OYBA 1YLFA 2XSJC 3D5SC 2OUMA 2V2QA 1JT6A 2BHYA 4BBSJ 2QBYA 1UAAA 2X1CA 1HNXI 3T0YA 3PNYA 4M3GA 3H36A 3S1QJ 4Y52J 5H6RA 3DQVC 3OR2C 1FJGE 1EH7A 1RPWA 1ZGAA 2L54A 5AIQA 5B5EC 4ITVA 1Z9CA 1Y1WJ 2X6OA 2A2CA 4E70A 1MZBA 3H3UA 2ZMEC 3I4MJ 4RAYA 3CCQI 3TO9A 1ZRDA 3Q0WA 2XB5A 5DCMA 3G71I 3L00A 2V7FA 1YX3A 1QGPA 3MZYA 4OO1B 4IL6C 2H6CA 1ZN2A 4EMSA 3HJCA 4DQ2A 3S8PA 3OYGA 1U8RA 1J2XA 5IP6A 1ZM4A 2VQHA 3DCFA 2C37B 2DYSH 5FD6A 3WTVC 3COAC 4Y33A 2DFEA 1T95A 1E3PA 1B6AA 1OR7C 1ZM9A 5HS8A 1X3ZB 4II2A 3G2BA 3B8HA 1FC3A 4I98B 4HX8A 2PO0B 3VOEA 4UUSA 5EL9A 2R5ZA 1BW6A 4DUYE 2XGXA 5K7FA 5HDGA 2G7UA 1IJWC 5ILVA 3MFKA 3LWFA 1JI8A 2KMUA 2R7OA 1EA3A 2XAQA 5K1YA 3P06A 1R4NB 1WVRA 4CZZA 4DBRA 1MNMC 3NEUA 3BTCA 3GZ6A 1QU3A 4DV6E 1T6SA 1S7AA 1C0WA 5CYVA 1S9HA 4ESFA 4LF7E 4E7JA 2GO4A 5HLIA 5HOOA 5J4VA 3OSFA 1YHCA 3HXLA 3ABLH 1QVTA 1BOAA 3HUGA 4GRIA 4QPQA 4C2TA 1H88C 4IZKB 2KHMA 3GLXA 2F1DA 4I3HA 1Z3XA 2Z5CB 4L18B 1QZZA 1W7PA 5CLSA 2QSFX 3BR2A 4AM3A 4DUZE 4N9IA 4LK0F 1KQ0A 2E5LI 5ILUA 3GO5A 2A6EF 3K4BA 1BA5A 4OIOF 4K2EA 4ENKA 4NNJA 1S72I 2CQXA 2LKSA 4F52A 1FIAA 1TWFJ 3L9FA 3P9IA 5CVJA 1X4OA 3RPUA 1ETYA 2CYYA 2M34A 4GGGA 5E20A 4XRSA 1W36D 2UUCI 3WG7H 2XGEA 4Q4ZF 2JEAA 3I5UA 3QODA 5ICCA 3VODA 2KIFA 1ZRCA 3LA7A 1B72A 2E2HJ 1KIJA 3TO7A 1I6HJ 5IOZA 2Z99A 3CESA 1BOBA 2A5WA 1OLTA 1ZM3A 3BJOA 3HYIA 2CFOA 3C2GA 4P1WA 5K5OA 4HY1A 5ICEA 2ICWG 1KU7A 1NZ0A 3I71A 4MQVA 1I27A 3W6JB 5JR3A 1DP3A 1TP4A 1X1DA 2DOAA 1Y0UA 1YITI 2VT3A 1MD0A 2BVMA 1ZR2A 1PP7U 2WWYA 2KPMA 4A3FJ 1MJAA 4PJJA 4V2FA 4G7HF 4A93J 2B63J 2XGDA 1X1CA 4JI3I 2COMA 4EVIA 3G4SI 2M9HA 4RB0A 3F8NA 4DV0I 2M1BA 1U5TC 4G8XA 2JEAB 2UXXA 2EB7A 1Z67A 3F21A 2CV1A 4FX0A 1TBXA 2Z1DA 1P7JA 4G7ZF 4BE1A 2BYVE 4DR2I 1XMXA 3P76A 2QWWA 1JKQC 2XC7A 4JX6A 4Y4RA 4BL0B 5A2QC 3F8FA 2P5VA 2M0MA 3BTJA 4MFEA 4HLYA 4QTRA 3FKJA 1N32E 4FCYA 1XGSA 4LCGA 1DU6A 1JE8A 2OV7A 4GKKI 3R61A 1TT5B 2MGQA 3VYUB 2XDVA 3M07A 5IOYA 1D5VA 1G3WA 4KDPA 2CQNA 2EFQA 2LYCA 4J3DA 4ZH4F 3I64A 5C0XB 3BQYA 4M73A 3V2UC 5F1JA 1W5TA 1QZEA 2MSYA 2QQ9A 3T1HI 1IBKE 3FXLA 4K0KI 3C2BA 2JSPA 5L3BA 4RB3C 2P6TA 3MKLA 3RZOJ 5M5XJ 4XLPF 1HQCA 2A6HF 2KQRA 3WHCA 5HNFA 2JSCA 4OINF 2BE5F 1A6QA 3LFKA 1N0VC 2MH2A 4I2OA 1QZRA 3PRYA 2KDOA 1AHDP 2E2JJ 3VYRB 1R6MA 3JTHA 2H09A 1U6GA 4FX4A 4JI7E 4RLFA 3MN2A 1JXSA 4GYGA 1XMQI 3E6DA 2OAZA 1SFKA 4CYCA 2LLKA 3ZN0A 1VQ6I 1A31A 1TWGJ 3IH3A 3A1YA 2LJPA 3CJNA 4N0BA 1YI2I 5BPIA 1S6LA 4YIFA 2XRLA 4OAYA 2BA0G 3DFGA 4Z7CA 2ZXWH 3N4MA 3LSJA 3NWSA 4MU1A 1JUPA 1BKNA 2HOAA 5FLMJ 3M6AA 1R00A 1D0YA 3C1DA 3KEOA 1XG1A 2J5OA 2I5UA 2JVGA 1IRZA 2VXZA 4P9UA 1PUFA 4XKBA 4YHHI 1E3HA 4BHPA 2CRGA 4EJWA 3D1NI 2GA1A 3QT5A 4B48A 1X2NA 3ECHA 2KL4A 1B1BA 1SEUA 4LLNA 3W2VA 2YPRA 3ZQLA 3Q5FA 3BR5A 5CQEA 5CVUA 4X64I 2E5LE 3PUBA 1ACIA 2GZWA 1OYIA 1TQPA 5DROA 4IOCF 3M8JA 4ETSA 4MO7A 2F5EA 2K4JA 2N8GA 5L3EA 3JAMC 5F08A 2ELKA 3RKQA 4O6JA 3MZ8A 2Y9ZA 1FOXA 3WTSC 4U0WA 4RAGA 4CDGA 5IT9K 3KYDB 5ERIA 5IY5H 3J80K 4UVCA 1GV5A 3GF2A 3RI4A 3HOSA 2G7HA 1OYYA 3GUDA 2DPDA 5IWAI 3MEXA 3K4CA 2O7OA 5BOXA 3A0BC 4O5VA 3QT7A 2BY2A 3OYAA 1IG7A 4V19K 5JEAC 3FM3A 3UNGC 1KONA 1P4XA 2BW3A 4Q47A 5TGTA 4WX9A 1ON1A 3SDGA 3OS1A 3IL2A 1RNLA 3Q6MA 2PO1B 4XORA 1I50J 4H0EA 1P6RA 5J40A 5HDNA 2ZFWA 1J59A 3CJRB 1R6RA 1FYLA 4LD5A 4OX9I 3MD2A 4I09A 3BCAA 4DV1E 1RC9A 4JI0I 2CFXA 2K9LA 4B3XA 2EFGA 2H6BA 3OL4A 4IEJA 4AC0A 1G4DA 1FBQA 2NYXA 5K36B 3F8CA 3GZ5A 3MAJA 5AONA 4IFDE 2DJNA 1H74A 1MG7A 2F5CA 1Y4SA 4DV0E 1EH6A 2ZBKA 4IPAA 3DKYA 2V4JC 2W57A 2QEXI 2PMUA 2CW0F 3R6SA 4M1KA 2XRNA 3H3ZA 5ELWA 3DP7A 2XPVA 3CC7I 2F5VA 1IN4A 4RLQA 4EMDA 2XHKA 1Q1HA 3RZDJ 3CMMA 1XMOI 4V2GA 5LGTA 5FKOA 1X1PA 1ULYA 2M30A 3GVAA 2E5ZA 4RAZA 3K1MA 3BR3A 2V26A 1Y60A 1Z59A 4FW5A 4B3MI 1ZRFA 2IS1A 2C38B 4HRIA 1DPUA 1OCRH 1MMSA 2VBWA 4YELA 2O5RA 1FBSA 2R7XA 1IN6A 1TC3C 5B1BH 2DU9A 3KYLA 3HOVJ 4UV9A 4DV5I 5EYRA 3VSLA 5J3LA 2UXDI 2EWNA 2R3VA 2EFOA 2WAQN 4J00A 4LF6I 4MLOA 3HOXJ 2HK2A 2PFBA 2OQRA 1HDPA 4JI1I 3W2WA 3P9CA 2ZJPF 1K4SA 2HOTA 3ZGKA 3FIWA 4DPUA 3SYTA 4XNFA 4BA1B 3PQJA 2M0CA 3LSPA 1FPQA 1W0TA 3QOEA 2K86A 2FBKA 4FETA 3IHUA 1F43A 4DOZA 3E97A 1MBFA 1ZKGA 1L3LA 2ZKZA 1HW1A 5TISC 1R5HA 5DCMB 2W1OA 5IT9Z 3JRHA 2ZNYA 4CCOA 3BG6A 3J7ZI 4BHBA 1Z0EA 2DDBA 1XTAA 4HEA2 1WJDA 3BCBA 2VJ4A 2C37A 1V3FA 2CUEA 4L5IA 2XAJA 2FRHA 2L3DA 2VJ5A 3L2VA 1MH4A 1JKPC 1J9IA 3BR6A 4LIUA 4GDFA 1H72C 3L2UA 5JLWA 2LY9A 1SMTA 2UU9E 1MNDA 5FFXA 4CUGA 2DEIA 2HHHI 3WTZA 1M1EB 2RNJA 2UUBI 1FMWA 2DA7A 4MFDA 4UHTA 3VWBA 4BQAA 1N77A 4IZJB 5E1ZB 4F91B 2H8WA 2WAEA 1IAWA 4KUMA 5ICGA 2Z33A 2P7VB 4HQMA 2HQRA 3SDBA 4EM1A 3QU6A 1LB2A 3H4LA 4UTGA 2CUZA 5FKLA 5E3NA 3WTUC 2E1RA 4M71A 3JSPA 1VI0A 1J0RA 2XF5A 2R7DA 3REOA 1GDTA 3PS1A 1VQ9I 2FBIA 5BPDA 1OCPA 2XB0X 1VF9A 1RZ4A 1KU2A 2VE9A 3BQZA 3PS2A 5IWAE 1R1UA 1ZAOA 2DMUA 4D7MA 2V34A 3LSKA 3HRSA 3MKWB 4IHWA 2PO2B 4W97A 1YE9A 1WHUA 3T8TA 1RIOH 5GAGJ 5HLHA 1YRNB 3GTOJ 3ZQQA 1F5TA 2UWMA 4NDLA 1HR0E 1KYWA 3K0LA 1RR7A 1XSDA 1D3YA 2VB6A 4G12A 3KIOA 1ZM2A 2JEBB 3BZKA 2GOXB 5C0XF 1T56A 2GQQA 1PDNC 3PJRA 2OU2A 2HKJA 3OOUA 1P9QC 2EIMH 3JAMZ 2VKVA 4XOPA 5L3FA 4LF9I 2CV0A 3H5AA 3M85D 2YUSA 1IUYA 1T38A 3KETA 4XIDA 1FT9A 1GHCA 2V2ZA 3I3LA 2FEZA 2JPBA 3FK6A 4ZVIA 3HPHA 4YY3I 4DR6E 2GWRA 3B6CA 2C39A 3TDUC 1U78A 1LKXA 4LF8E 2MD0A 1ZARA 4OIPF 3V7SA 4BU2A 3MKYB 5E3OA 2OCCH 3H0GJ 4N4NB 2XKOA 4PSXA 4XLNF 2A68F 2X48A 2DMTA 4KIBA 2HGCA 3DTIA 3H1CA 2VQCA 1S29A 1F36A 2XAUA 3HSFA 4B8XA 2EV0A 1Z0BA 2M4KA 2KP6A 2VT2A 5E3MA 4WUDA 2JJ7A 2NN6D 5LGUA 4DUYI 3LA2A 4HSTA 4HZFA 4FW9A 4FWHA 3IH2A 3ZR8X 2XROA 5FLXQ 4B3TE 1NHJA 5FB2A 3VYSB 2IESA 1MBGA 3BP8A 3QPHA 3BJ6A 3A0HC 5JHUA 3SQNA 1G6NA 2X51A 2VBYA 1U9NA 2H8RA 2Y0SA 1WJAA 3ZQIA 2WAQA 3W6KB 4LFBE 4RM2A 1UFMA 4M9XA 5JVGF 3GFJA 3L7ZB 2BY0A 4DV5E 4HW0A 1Z77A 2ZMEB 5KVRA 3S14J 5JLXA 1LVKA 4OO1E 3D4JA 2G9WA 1DUXC 2PNLA 3CWVA 3J81C 2DT5A 1HDDC 4OMYA 5BNGA 3WU6A 2KZGA 3OOPA 2VJIA 2DI3A 2L4MA 5DM6F 3L2RA 2VLAA 2BM0A 3ZZUA 5CQGA 5LMUE 3HOWJ 1X2MA 2IAIA 1IN5A 4TV7A 3K2ZA 3F8BA 3QYBA 4AYBA 2FU4A 4IHXA 3RQIA 4A3DJ 2VKDA 1RI7A 3PUFA 3TBIA 1BN5A 4JV5I 4MGRA 4ZDLA 1R36A 1VFCA 1JGSA 1JUSA 2V6EA 1ITYA 3AKZA 1G59A 1FYKA 2IS2A 3ONQA 4S0HB 1YH8A 1HF0A 3PQKA 2ZJQF 2UUCE 1U9OA 3S17J 4A3IJ 3TMOA 2IS6A 4IHVA 2IJLA 4ENNA 3OYCA 1XB4A 1HNZI 2P81A 3EYYA 2L7KA 3X2QH 3PNTA 4DV4I 4IZJA 1UHMA 3WGHA 2CV2A 4XQFA 2UUAI 1K78A 2K27A 4DV3E 4EGZA 3KP5A 1FLIA 3RPQA 3CMEI 2FE3A 1A04A 3OYIA 3HOYJ 1CGPA 2HKEA 4NXNI 1IXSB 3HC7A 2HYGD 3MVPA 1ZGWA 4EM0B 2JN6A 2HDDA 4QNKA 4JI2E 4OKGA 2W48A 1B9NA 3WTTC 3BG7A 4HACB 1RESA 4IFDB 2PN6A 4BS9A 4Y7NJ 3T8RA 1Z0CA 5BR8I 3FM5A 2CS3A 2BY3A 3L2WA 5EJCA 3GFMA 1MMNA 3ZMUA 1GXPA 2BR2B 3J7AG 2TDXA 1APLC 2R7ZJ 4LF4I 5H20A 4X66I 3E5UA 3FXQA 5DDGA 2Y69H 3CO6C 2WB1A 1XCBA 4PCQA 4LFCE 2HTJA 3L1PA 2EINH 2FBHA 1U2WA 2JQ7A 3HZJA 4YEJA 4LOMA 2WY8Q 1MH3A 1BR1A 1D1BA 1QHGA 2QF7A 2KIQA 2Y48A 4F55A 1DDNA 2X7IA 2ID3A 3CUQA 3H92A 4HOBA 2EZLA 2K85A 2C6YA 4JI2I 2QQBA 4JG4A 5KNLA 3CDJA 4HX7A 3RTRA 3CCMI 4ZC3A 3OSGA 1N36I 4MYUA 1XX5A 5BQTA 4AWXB 5BR8E 3BPXA 1IBKI 3G1OA 4K0KE 3ABKH 3WE3A 3U1YA 1XGOA 5D5VB 1ZYRF 3JSOA 4ISAA 3ZOBA 5J47A 1SD5A 5E8GA 3BPVA 4S04A 1O3SA 1MSEC 2DTRA 4L9VA 2QA4I 4OMZA 4MEXF 1CF7B 1WH7A 3TP3A 1MMDA 5DD4A 1PVGA 1CQTA 3PYEA 3I54A 2X36A 5C0XA 4JI0E 4W1UA 1AKHB 4AIKA 4II3A 1Q1VA 3L2QA 1I1GA 2KT0A 2XPUA 4GXOA 5FLXC 2PLYA 2WNRB 1IN7A 2X6WA 3O6BB 1FZPB 5LD2C 1SFUA 4C3HJ 1QBJA 3CCVI 3ZN1A 2NVQJ 5C3EJ 2VQFI 2BXZA 5D5XB 4L5EA 1HLVA 3F6OA 2ZB9A 3K17A 5K5RA 1U8BA 2CH0A 3H9JA 2V1UA 4U7DA 2X4HA 3EYIA 4NQWA 2NOGA 2LC2A 4AYBN 3J81Q 1ETQA 3GWZA 3K4NA 5D8KB 1B8IA 2VKHA 4NXMI 5LMUI 2WBMA 5ICFA 2HWVA 2L02A 3UKGA 3GTGJ 2OPTA 3RSNA 1ZLJA 1WJBA 1H7SA 1UG2A 1P7IA 4DJAA 1Z0XA 3KP3A 1ETVA 1YG2A 2F4MB 2LRDA 2ZSHB 2DJIA 2E7XA 3S3MA 1OYSA 3OYLA 4DR5I 2M3AA 2L2OA 4C3JJ 4J01A 3K1PA 2HK3A 1XC5A 4IOAF 2YSRA 1PUEE 5DUIA 2E1MC 4QLCU 5D5WB 3TOAA 2WV1A 4YIIA 2LDUA 1I94I 1WJ5A 2X6YA 2JZYA 2ZFUA 2E1NA 2DA6A 4E4HA 4P96A 3I58A 1MDMB 1S3JA 3TGNA 2DMNA 4DUZI 2YS9A 4OIQF 4HSRA 1A5JA 3KRNA 3JAMQ 4B3SI 3ZQFA 4JI5I 2RN7A 1FNMA 3OIOA 3K4LA 3M3YJ 1N75A 4DV3I 2CG9A 4C30A 2BA0D 4QNJA 1BC7C 1Y8RB 4KMUX 1K4TA 3BC8A 1PKPA 3PSIA 2K3FA 3VPRA 1MJBA 4FW7A 5F04A 1XNRI 1V55H 3TW6A 2CU7A 2L9RA 1G3YA 3G1MA 4E7ZA 1LE8A 2O0YA 4U7BA 1TNTA 2F4IA 4YG2F 2Z5UA 5FFZA 3CF2A 3FBNB 4C2MJ 3U9GA 2FNPA 3Q3SA 3PSFA 2F5DA 3TOBA 4ZYDA 3KEQA 5LGNA 1W7PD 4KIGA 2FUG2 4R1HA 4X66E 5A2QZ 3IV5A 3M7ND 4UUSB 2R42A 1FMVA 4GKJE 3ZRGA 4Z7YA 2NS8A 1SAXA 3DEUA 5BMZA 1YFHA 2QLZA 3M7GA 2GS8A 1HNWI 5CJ9A 3K4JA 1JKOC 3WU1B 2D2WA 2J5PA 3VB2A 3H9GA 1FOWA 2AXLA 2HI3A 3TKYA 1YQAA 1XXEA 5L3CA 3VYTB 2VASA 1WRJA 4PU9A 3WTYC 4HXZA 5JEAF 1J5EE 2QKLB 1KVKA 2DA3A 3OYEA 1EI1A 1YW9A 5E1WA 4IQJA 4EV0A 3ZQ7A 3OR1C 4ABZA 4KITB 1W36C 3WU3A 4A0ZA 2R0QC 3MMYB 1H7UA 1QRYA 4DGWB 1NHAA 3C2HA 1H0MA 1LJ9A 2A61A 2HQAA 3DTKA 4UVBA 2HVQA 4QPOA 2Z2SB 4IHTA 1WWXA 2HDWA 1MU5A 1JHFA 2JUCA 4B3TI 5EEGA 4G94A 3DU5A 1HW5A 1NHIA 2NPFA 1TTYA 2UUZA 3EUHA 3FDYA 3KZIC 4M6VA 3U2RA 3J80Z 1YJNI 1EF4A 2BXYA 4BKXA 2K4BA 4CCKA 5EEAA 1I1SA 3QT6A 4JI4I 3B73A 2EV6A 4F3QA 3KP4A 4KN7X 1WZ2A 3S3OA 1UHSA 2O1TA 1BIBA 1TWAJ 3TEDA 3NZKA 3Q0UA 2NN6E 2BBYA 1XGMA 1FSHA 3BY6A 3MWMA 1K61A 4UXNA 2VQFE 4EJVA 1V5GA 2O3FA 4A3GJ 2HHHE 1VQ8I 2O8XA 4FW4A 2HOEA 1G3TA 4HBLA 1WQ2A 2DEJA 2GXGA 4I7HA 2DXIA 2A5YB 2DFHA 5GAEJ 1RR9A 3H5NA 4ZDPA 2BVLA 1NG6A 1HKTA 3FXOA 1R5GA 2L9VA 3DPTA 4RDUA 4XSZF 1DU0A 4UV8A 2F48A 1OPCA 1R1VA 3FMSA 1B9MA 2NVTJ 4XLAA 4M6YA 2O9LA 1X58A 3UR3C 2R93J 4CCMA 1U5TB 2Z16A 2ID6A 3S2HJ 1IBLI 3EUKL 4LG3A 2F4VI 5FLXK 4M3DA 2Q2EB 4CCLA 3M4OJ 2W85A 4CICA 3ZKDA 4YHHE 2PNZB 2NVUB 2JE6A 2ZCWA 5J8CA 4DPYA 1HNZE 1TWCJ 2ACJA 2MYSA 3ZCOA 2BY1A 2XKPA 2BV3A 1I94E 4XMYA 3OWTA 2PO0A 2FQ4A 3FXJA 3WU2C 3R4KA 1A36A 3EUAA 2ISYA 4X1EA 5L3GA 2PI0A 4M72A 1YS6A 2MLKA 2Y2ZA 5E79C 2XAHA 2O6GE 1OISA 4UY8I 1V54H 4G6DA 4EM2A 3OS0A 1VTNC 2DT6A 3L2CA 4ZZLA 1MMAA 2AS5F 4LFUA 3OYFA 2XF7A 2C38A 4B3AA 2QM3A 1SD7A 2GBYA 5LEKA 3VDXA 3E5QA 2X85A 3ZXSA 4A6DA 1F4KA 1P4AA 4FW6A 3K70D 4M6XA 2FMLA 5LRSA 2HEOA 4USKA 2IRFG 2JA5J 4BNCA 2WW4A 4M3BA 1XNQI 2JRMA 1N34E 4DR3I 3QQAA 3GFIA 4UUVA 2PO2A 2XASA 2K40A 4PGGA 4RGRA 3JRAA 1NH3A 1MBEA 4UB6C 5DUKA 3ZPLA 4BE2A 2NN6B 1ETOA 4F93B 1HBXG 2WP8B 4XTJA 4IKFA 3QPLA 3V5RA 1EH8A 2JT1A 1XHKA 1P42A 3OYJA 3DPUA 1FWKA 3S15J 5DCFA 1O3RA 1WPKA 1ZREA 1H9GA 3M8FA 2XVCA 2P4WA 3FK7A 2L0KA 3WODF 3M1EA 4XICA 2AO9A 2HDCA 4A0XA 4LG0B 4PZJA 4JQFA 2JRTA 2LTPA 5J8FA 2JVHA 3O8HA 2PJPA 2Z5BB 3QPTA 1IO2A 5HS7A 1VQ4I 1HOMA 5FLXZ 1IZ1A 4LB6B 2LH9A 5JVTA 3GTKJ 2A3SA 1LDKB 3EUHC 1OCTC 2ECBA 2DPUA 3CLQA 3LSRA 1N78A 2E1MB 2V1NA 3ELKA 3MQ0A 4U0VA 3U21A 4DU8A 1W5CC 1AOYA 2PO1A 2MC3A 2DQRA 2L5QA 3CUQC 3DKXA 3KCCA 2W82A 2HVSA 1TWHJ 1UDQA 4I0AA 2EZKA 1KKHA 3I59A 2W84A 4NHJA 1FJGI 4ANJA 4LG0A 3K6GA 2EV5A 1T2KA 4EQQA 3CQZJ 1T8IA 4GQUA 3W2AA 1FX7A 1IN8A 2M8GX 1XMAA 2R7FA 2CSOA 4DV2E 1MBJA 2ZNZA 2X9DA 3AG4H 1HSTA 2MC4A 5KCMA 1WH5A 3LMMA 1FJLA 4U0YA 1U0JA 4XRSG 5LLQA 1ZHFA 2YX4A 1OFCX 2STTA 5FROA 1Y5YA 3G6EI 2JT2A 2ESNA 2QVOA 4KICA 4AVZA 4ENMA 2QUFA 1WSUA 1JUMA 1XDSA 1OMIA 2DN0A 2OBPA 1XD7A 2PMHA 4FHTA 3OV8A 4FN5A 5DYMA 5K7ZA 1N33I 3QT8A 5GTHC 2ME0A 3FXUA 5KAFC 2HKOA 2HZDA 1K6OA 2HXOA 5H6QA 3SZTA 4PDKA 2FOWA 1FY7A 2WC2A 3L7WA 1ONVA 1OYWA 1T98A 5E8IA 2BZTA 4ZZDA 1Z7LA 4ZYHA 4S05A 4JI1E 2KIMA 1Y6IA 4DXLA 1GUUA 2Z3YA 4F92B 1ETXA 5D4RA 1JTYA 2VQEI 4GKKE 5ED4A 4BA2B 2MFZA 2STWA 4D5CA 2UXCE 3HTUA 3BR0A 2ZM6I 1R23A 5ILSA 1KQ9A 2VI6A 2R7WA 3FF5A 4NC8A 1FTZA 2OI2A 4LLLA 4BQOA 4IZZA 1LDDA 4OWRB 2R7QA 3SEQA 2RC4A 1VZ0A 3CDHA 3M9AA 4JBAA 4BQQA 4LB5A 2DA4A 2K02A 2X1DA 2A69F 3ESWB 4BE0A 4BXFA 4DPWA 2BM1A 1KGSA 1ORKA 2B0LA 3F8MA 3CO7C 2F5FA 4RAFA 5EG0A 2A05A 2ADUA 3LSHA 1HCRA 1PVEA 1J7KA 1USTA 3SEZA 2GM4A 4FE7A 3J7AM 2E35A 1WI9A 2UUBE 1YHQI 3M7NG 5FLVA 3F0CA 1TQMA 3R60A 1MBHA 2VQGA 3KPHA 5KAIC 1YO5C 2LY2A 3TO6A 3S16J 1ENHA 2EA2A 2P0WA 2W7NA 3PFYA 4N3OA 5D8LB 1TW2A 3GTLJ 4JI3E 3CJQB 4DR4I 1X4PA 4BEHB 3AL0B 1B63A 3JW4A 1OJ4A 1ELOA 4EGYA 2CJJA 2EFPA 4D1QA 3FXKA 3KYCB 3S2DJ 2NAZA 1KTVA 4RPFA 2LFBA 2E36A 4JI8E 4DV4E 2ECCA 2QBYB 3LOCA 3HKZN 2L7FP 2OZUA 5BS6A 5JEAE 4MIMA 1TLHB 2IGOA 3QU3A 5HODA 2UXBE 2DBBA 4BACA 3OMYA 2AJ4A 2X0LA 1UELB 3SZPA 4QIWN 2DK5A 4EJTA 3DF8A 5GPCA 2CW8A 1GT0C 1H73A 3PYDA 2AHQA 4X64E 1HNWE 2PMZA 4XBFA 1FNNA 3KEYA 3SFZA 3U1DA 4AU7A 4B09A 1BJZA 2V6CA 5EGOA 1N0UA 1AA7A 5LL6R 4XKCA 2RNGA 4IF4A 2L9NA 5A2QK 1HKSA 2LD5A 2ZC2A 4B3ME 3S1MJ 1YIOA 1ZXNA 4MYTA 4X62E 1VQOI 4XR6A 2A6TA 3LNUA 1XSXA 4LF9E 2KFDA 5DNXA 3HEFA 4XLCA 4R8HA 5IT3A 4RS8A 5FRMA 2DFFA 5EZHA 4MTEA 3ASOH 4X65I 2VKEA 3P5JA 4XONA 3T5XA 3W6VA 1D0XA 2XIGA 1DQUA 2DW4A 3HSEA 3GYHX 5DD8A 1OCZH 1ZTRA 2LF7A 2ZXIA 2W4SA 4HA8A 1HC8A 4LF5E 3K1NA 3IRRA 3BLYA 3ABMH 2Y0SN 3CZ6A 3CP2A 2RGVA 3PFIA 3ZMSA 5M3MJ 2KRCA 2HQNA 3LSIA 4L0YB 2IPQX 3WG9A 3GTMJ 4ZJZA 2WNRA 2Y31A 1OR7A 3PM1A 5DRRA 1SD4A 4L9TA 1UDOA 1REPC 1S5LC 4EJOA 2DA5A 2VE8A 4BEHA 2WY7Q 3QOPA 1A6FA 2O61A 5KHDA 1S7OA 4CHUA 2BW3B 1ZGJA 2V9KA 2Z5CA 3LPSA 1IF1A 2HVRA 1FI4A 3HM5A 3LA3A 2VPLA 1XMQE 1PJRA 4P55A 5E1XA 1ERDA 2IGMA 3JTGA 1IGNA 2JEBA 1P4WA 1JJ8C 2DMQA 2OF7A 3ISPA 3RIRA 3BWGA 5K36F 2JA7J 4B3SE 4G9YA 2LNBA 2QZ8A 4IHYA 1ODDA 2IGNA 2YU9J 3D0SA 4O3MA 4E7SA 1QZYA 4WXCA 4X6AJ 4JI4E 3S32A 1TL8A 1QPIA 3IP4B 3L7ZA 2GA2A 4JOMA 1Z0GA 4LF7I 1DGWY 3WU0A 1X3UA 4DNCA 5H2FC 5K7HA 5IP9J 5D5UB 2KRFA 5E17F 4CZCA 2M87A 1PIEA 5F1RA 3GMEA 2ZITA 4JI6E 4IFDD 3VEPA 1LPQA 2PJRB 2O1WA 3BJAA 5CVRA 3CCSI 3ZP5A 2OTLI 2QYOA 3DEEA 1W7PB 4DU7A 1FKAE 3N97A 3SZGA 1HR0I 3P3EA 1LEAA 3OYNA 4USMA 1TZLA 4PGHA 4IQ4A 2DT7B 3DKWA 1LEBA 2IT0A 1SVLA 1SC7A 3D5RC 2VESA 1SANA 3U1KA 2LG4A 4WF2A 2BEOA 1MIJA 1OQYA 2Y0MA 3NRVA 5C4XJ 4BDYA 1WGXA 4L5JA 4ZDOA 4FW3A 2IP2A 3TQNA 3T1YE 2C39B 3HRUA 3ABUA 4YY3E 2W00A 3DLLF 1N34I 4OO1F 2LKPA 1SVOA 4AD9A 2PEXA 4IRGA 1ZK8A 4LITA 1WFXA 3F3XA 2E19A 4E7LA 4HF1A 3WGIA 3FMQA 3GZNB 5F0CA 4BHCA 4YFKF 3J81Z 2KJCA 1MSFC 4D5FA 1SVMA 2WP8A 3N05A 4AIHA 4EJUA 3JRFA 3P7NA 1KA8A 3SJMA 3PO2J 1FEXA 2DAOA 3LSMA 2AQFA 4G6TB 2H1KA 3CDIA 1ZLKA 3I59B 3FBIB 1I39A 5E3LA 3I4NJ 3F22A 4XKWA 2EILH 4NB5A 4DYRA 1JKRC 2HU9A 1VQLI 2FX0A 3NAUA 1YJWI 4OIRF 2DA1A 1P2FA 2K9SA 4I99C 3WE2A 3HHHA 4R79A 3HKMA 4AQYI 3CCLI 5K36A 3K69A 3CC4I 3WU5A 2QSGX 1EKEA 2RVCA 2COBA 4BBRJ 3K85A 3HUGB 4OO1A 4OO1D 2WV0A 5EEHA 3KFWX 3JRDA 1HKQA 3KLOA 4HF2A 4A5NA 1I3AA 2EZIA 1HW2A 4PRVA 2DLLA 3L09A 3H5RA 4DR2E 2QQAA 3GXOA 4Z2YA 2L4AA 1RRJA 1H8AC 3JRIA 3SXYA 2MG4A 4HDVA 1N32I 2ISZA 3GX4X 1NK2P 4LCHA 1MKMA 2KKOA 4PJ0C 4QWQA 4JX4A 2OC6A 4XOTA 1OYPA 4B44A 5IPAA 2J7KA 1D6TA 1J09A 4CGZA 2G0EA 2IA0A 4HF0A 1IV8A 4MQYA 4HLXA 1Z0WA 3AFHA 3OTOE 3G1LA 2RDPA 1IRFA 3UHMA 3HGYA 4KFCA 3E6CC 1BW5A 1O57A 1OJLA 2O03A 4A3JJ 3K10A 2HFUA 3ZQCA 1W5SA 2FJ1A 3DV8A 1BM9A 4CSWA 4L9JA 5DNLA 2CGPA 1YYVA 1FIPA 2QKMB 5CVIA 3F0NA 4U3BA 3A02A 2OTJI 3CP8A 3Q1QA 5HNHA 1FSEA 2LY1A 3HPGA 1RREA 1LQ1A 2JPCA 2OD5A 2F6CA 1UMQA 2P8TA 2K7LA 5LFAA 3QRFF 2XAFA 2V1DA 2I8DA 4Y3OA 1XMKA 4I76A 2CO5A 2NVYJ 4HYEA 1ZXMA 4CA0A 1IRGA 4LFAE 4KHPE 3J7YJ 1MX0A 5B3SH 1NK3P 3QAHA 1XS9A 4WCGA 4HACA 2Q2EA 2PBIA 2LK2A 3OYMA 4GYIA 3LSGA 3OYHA 2RREA 3P3GA 4XN3A 3B02A 3LQQA 2QENA 4XM3A 3KE2A 1ZH5A 3FISA 2NN6C 3QYEA 2VJJA 1IBMI 3RCOA 4M9SA 1V4RA 3M8EA 4CO8A 5M5WJ 3DPLC 4LLGF 2P5LC 1B62A 2LVSA 2CW7A 2A07F 1O3QA 3DU6A 3KLNA 3H3VK 3V8JA 4IJAA 4JI5E 1OCCH 1U3EM 2R7UA 5F0HA 3BG3A 2Y75A 2VQLA 1B8IB 1F1ZA 1K7AA 3TDZC 2E1OA 1L0OC 2KIUA 1NTCA 2EQRA 1XNRE 4I01A 2M7BA 4WK8F 1T08B 4LF8I 4HNUA 1FP2A 1Z21A 2R7RA 2DK8A 4E6KG 3BT9A 1I3QJ 2Y30A 2HYJA 4FT8A 5LMNI 4FE4A 1UEKA 2E5NA 4DR7I 1IXRC 3C3WA 1W1WE 1ETWA 4BH9A 5DRQA 2ZXHA 3OYKA 2L7ZA 3QPSA 1QVUA 2WA0A 3E7LA 2P6SA 4XKVA 4DYCA 5J1RA 3GCMA 4KQVA 4B3RI 5GP9A 3BZ6A 3JREA 1J75A 5GMEA 4ZYEA 1RUOA 1OKRA 5LRRA 4E7IA 5GADJ 3WTXC 3FHZA 5EZGA 2GIVA 1LFPA 2ZSIB 4FISA 4R1FA 3GW2A 3J80C 3NARA 1LFBA 1R22A 1BR2A 1D8KA 3T1HE 3I53A 3CF5F 4NXNE 1UJ8A 3BR1A 1HXDA 1UB9A 2J65A 2LR8A 2CUFA 3ZQGA 3S1NJ 2LBFA 1FYMA 2CQ7A 2CUJA 3I9V2 4BYYA 3OY9A 3IKTA 5GTIC 3A01A 1BI1A 5TJJA 5LHGA 4JI7I 4AIJA 2BOLA 4AIMA 4MDTA 2FA5A 2ELJA 3R0AA 1HNXE 1XSVA 2LP0A 1UG0A 3BTLA 4KIFA 2E2IJ 1Z0TA 2LMDA 3OTOI 4OU0A 3CDLA 3J81K 2GO3A 3ZKBA 1B59A 4YFXF 2XV4S 1QO0D 2IERA 1QNTA 3CD6I 2XUBA 3NQOA 3TP0A 1WUUA 2Y9YA 3K4KA 5J6XA 1AU7A 1S7EA 2K9MA 3K4MA 5IP7J 1PYVA 4RA2A 2ETHA 5K36E 2PNZA 2HS5A 2ZM6E 3DBRB 4IS9A 2VBXA 5DRPA 1TNSA 1O3TA 4P7AA 1MBKA 3ABTA
chains in the Genus database with same CATH topology
1WHUA 2PO0B 4IFDE 4BA1A 3U1KA 2PO1A 4IFDA 5JEAB 5C0XB 2NN6E 1UDQA 4NBQA 2JEBB 2NN6C 2BR2A 2C39B 5C0XF 1OYSA 3GLLA 4OO1F 2BA1D 4IFDB 3M85D 2NN6A 1R6MA 2WP8A 3B4TA 1UDNA 3KRNA 2BR2B 2C39A 2C38B 3CDIA 5JEAA 4AIDA 3DD6A 2BA0G 3HKMA 4AM3A 2BA0D 5K36A 3H1CA 4OO1A 2PNZB 4OO1D 2JE6A 1OYRA 4IFDC 2NN6D 2NN6F 2WNRA 2PO0A 4BA1B 1UDOA 1E3HA 3CDJA 3GCMA 5C0XD 4BA2B 2JEAA 4IFDF 5K36D 3M7ND 1OYPA 1R6LA 5C0XC 5C0XE 3L7ZB 3M85G 2C38A 2C37A 2JEBA 4OO1E 5K36F 5C0XA 5JEAD 2PO2A 3H36A 5JEAF 2BA1G 3M7NG 4AIMA 4BA2A 2NN6B 3L7ZA 2WP8B 2WNRB 5JEAC 4OO1B 1UDSA 3GMEA 2JEAB 4IFDD 2PO1B 4OO1C 2C37B 5K36E 2PNZA 5K36C 2JE6B 1E3PA 2PO2B 5JEAE 5K36B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHU A;  2PO0 B;  4IFD E;  4BA1 A;  3U1K A;  2PO1 A;  4IFD A;  5JEA B;  5C0X B;  2NN6 E;  1UDQ A;  4NBQ A;  2JEB B;  2NN6 C;  2BR2 A;  2C39 B;  5C0X F;  1OYS A;  3GLL A;  4OO1 F;  2BA1 D;  4IFD B;  3M85 D;  2NN6 A;  1R6M A;  2WP8 A;  3B4T A;  1UDN A;  3KRN A;  2BR2 B;  2C39 A;  2C38 B;  3CDI A;  5JEA A;  4AID A;  3DD6 A;  2BA0 G;  3HKM A;  4AM3 A;  2BA0 D;  5K36 A;  3H1C A;  4OO1 A;  2PNZ B;  4OO1 D;  2JE6 A;  1OYR A;  4IFD C;  2NN6 D;  2NN6 F;  2WNR A;  2PO0 A;  4BA1 B;  1UDO A;  1E3H A;  3CDJ A;  3GCM A;  5C0X D;  4BA2 B;  2JEA A;  4IFD F;  5K36 D;  3M7N D;  1OYP A;  1R6L A;  5C0X C;  5C0X E;  3L7Z B;  3M85 G;  2C38 A;  2C37 A;  2JEB A;  4OO1 E;  5K36 F;  5C0X A;  5JEA D;  2PO2 A;  3H36 A;  5JEA F;  2BA1 G;  3M7N G;  4AIM A;  4BA2 A;  2NN6 B;  3L7Z A;  2WP8 B;  2WNR B;  5JEA C;  4OO1 B;  1UDS A;  3GME A;  2JEA B;  4IFD D;  2PO1 B;  4OO1 C;  2C37 B;  5K36 E;  2PNZ A;  5K36 C;  2JE6 B;  1E3P A;  2PO2 B;  5JEA E;  5K36 B; 
#chains in the Genus database with same CATH topology
 2NRA C;  1W4M A;  1AWC A;  4LGW A;  4IFD A;  1Z6T A;  3E6M A;  1I5Z A;  2JWT A;  4KYW A;  4HPQ A;  5CKT A;  4KT6 A;  5DS9 A;  3ZZT A;  4HV6 A;  3GTJ J;  3A2K A;  2MLG A;  4ZTJ A;  1SAU A;  4N4O B;  1KZH A;  3KP7 A;  1NG7 A;  4HNV A;  5FD5 A;  4PJL A;  3GLL A;  3E1S A;  1SD6 A;  5B66 C;  2CMP A;  3ZMV A;  3F23 A;  1Z05 A;  4PFO A;  4LMY A;  4BY1 J;  4P52 A;  2L7M P;  4RBO A;  2ZBK B;  2CZ9 A;  4AVP A;  3ZZ0 A;  3ROU A;  3O2P E;  1IW7 F;  2K3P A;  5CPR B;  1T0F A;  2EK5 A;  4U88 A;  2KLO A;  3DXJ F;  1KQ8 A;  2ZME A;  5HDK A;  5DEQ A;  4B1R A;  4KA4 A;  4UT4 A;  4KIS A;  4AID A;  4PJM A;  5LHI A;  4I02 A;  2B7E A;  3LNQ A;  1BIA A;  1USU A;  2L01 A;  1EJ9 A;  1Y4U A;  4LF4 E;  2DOE A;  2VN2 A;  3O8G A;  1WJE A;  4EAT A;  1HA8 A;  1R58 A;  1G3S A;  1BR4 A;  1LDJ A;  3DLA A;  3JAM K;  2CQQ A;  2PG4 A;  1R1T A;  2NOJ B;  3OL3 A;  1YIJ I;  3P9K A;  1RKT A;  3HHG A;  2V9P A;  3IH4 A;  3HRT A;  3LTO A;  1O7F A;  3KP6 A;  4KMF A;  4DPT A;  2YU3 A;  1X19 A;  3HB9 A;  4MQ9 F;  3C18 A;  4B4C A;  4FAS D;  1OCO H;  1POG A;  3BG5 A;  4A0Y A;  2GXA A;  2HPM A;  4DR5 E;  2VF3 A;  2RKH A;  4DV1 I;  1WJC A;  1BI0 A;  3RKY A;  4X62 I;  2AQE A;  4ZYA A;  2OA4 A;  4DBQ A;  1H9T A;  5LMN E;  2XSD C;  4A5M A;  5C0X C;  3PYF A;  4JYA I;  5J1U A;  1JTX A;  4BUP A;  4E7K A;  4DPX A;  2WTE A;  1BL0 A;  1DPR A;  5CVV A;  3V8K A;  4L9N A;  2R92 J;  3CCJ I;  1BI2 A;  2E60 A;  3PIO F;  1XNQ E;  3V7R A;  5D6F A;  4CCJ A;  5JEA D;  4XLF A;  4DV7 E;  4A3E J;  2VUM J;  1SFE A;  2EBI A;  2H27 A;  2GAU A;  2BA1 G;  1FOY A;  4JYK A;  2E7W A;  3JRB A;  5LBQ A;  5F64 A;  1LNW A;  4ED4 A;  2L9S A;  3CMY A;  4GO1 A;  3FMR A;  1T39 A;  4G7O F;  4DR4 E;  1QHH D;  1E0E A;  1UDS A;  3CCY A;  5IT9 Q;  3J80 Q;  3T1Y I;  3AAF A;  1TW3 A;  2HQ5 A;  2MW8 A;  3Q9S A;  4HG2 A;  4MEY F;  4G6Q A;  1N36 E;  3GBG A;  2F2E A;  4PUS A;  2EPF A;  2O3Z A;  4NC7 A;  3RDI A;  2K5C A;  4ENJ A;  2R7V A;  3I0T A;  2XGC A;  3IUO A;  4E7H A;  2JE6 B;  3RKX A;  2R5Y A;  1Z6R A;  3MZH A;  2JUG A;  3ASN H;  2EH3 A;  2XPW A;  4UVA A;  4BA1 A;  3LFU A;  2VPR A;  5HVQ C;  2IA2 A;  4CXF A;  1R4M B;  5M3F J;  2VOO A;  5J1Y A;  1XN7 A;  3HSR A;  5HLT A;  2F4O B;  3OYD A;  2D45 A;  4NBQ A;  4A2U A;  4LFB I;  2UZK A;  3AG2 H;  5AIP A;  1Z0V A;  4MU0 A;  1AKH A;  1GV2 A;  1LE8 B;  5L3J A;  4DR1 I;  3HIF A;  4LIV A;  2TRT A;  4QSH A;  4URL A;  1G8X A;  3V4G A;  1ETK A;  1IXC A;  5D4S A;  1Z5C A;  1E2X A;  5A2Q Q;  3AG1 H;  1N33 E;  1K47 A;  4A3C J;  1UHW A;  4WXH A;  3DBH B;  1PUF B;  1Z3Y A;  5JEA A;  4A12 A;  3QWL A;  2JK3 A;  1NHH A;  2LSO A;  4B43 A;  3S2W A;  1FTT A;  1XPX A;  3WU4 A;  2VQE E;  2UXC I;  4BY7 J;  2CQK A;  4HAM A;  4NQW B;  2H1L A;  3FX3 A;  4NC6 A;  4KHP I;  2XAG A;  4BA2 A;  3E6B A;  2EFW A;  2VOP A;  5FKN A;  4D7N A;  3ULQ B;  1Z1D A;  3HOT A;  3QYF A;  3RPU D;  3S1R J;  4Y17 A;  9ANT A;  3V42 A;  3HBL A;  3ERE D;  5GMD A;  3KZZ A;  4M3F A;  3PIP F;  5TRD A;  2UXD E;  4JP0 A;  4DR1 E;  2GOM A;  3GFL A;  2HPI A;  2DYR H;  1RKW A;  1BI3 A;  3E5X A;  4PSW A;  4JK1 X;  1VQP I;  4XLH A;  1ZR4 A;  4PJN A;  3GON A;  3P3C A;  5F0F A;  4DIQ A;  1UCR A;  2FMY A;  2AXT C;  1BBY A;  3I4P A;  4IX7 A;  3ERM A;  3ZMD A;  3QP5 A;  3RJP A;  1LFU P;  5DV5 A;  1FWZ A;  2IEK A;  3BRO A;  4XN0 A;  3K1J A;  2GQ0 A;  1YOV B;  4M9Z A;  4LJZ F;  3CCU I;  4DV6 I;  3FHN A;  3M1C A;  1R5I D;  3T1B A;  3HDD A;  4LFA I;  1YX5 A;  3J7A Y;  4DYQ A;  3G73 A;  2JMW A;  5HLG A;  3I56 I;  3JRC A;  1IC8 A;  2RV8 A;  1I6X A;  4ON0 A;  1VQ5 I;  2KRH A;  2CGE A;  3PS3 A;  1JJ6 C;  1WI3 A;  2W24 A;  5EG0 B;  4UNO A;  4XK4 A;  4OAZ A;  1R9T J;  3ML6 A;  4KT5 C;  4UUT A;  1FP1 D;  4OO1 C;  1YW7 A;  2PMZ N;  3ECO A;  4HV5 A;  2GXB A;  2BGC A;  4JI8 I;  1STZ A;  2M8E A;  2CVE A;  3FXR A;  3IWZ A;  1G2H A;  4MU4 A;  3V8L A;  3H35 A;  2MH9 A;  1MW7 A;  1E3O C;  3FWE A;  3HG9 A;  3G3Z A;  2K9Q A;  3KZY A;  4A3B J;  4GKJ I;  4MNU A;  4BJ5 C;  2YR2 A;  5D6E A;  2NNY A;  4A3L J;  3PYG A;  2V1X A;  2E34 A;  4L0Z B;  2KZV A;  2NXN B;  2RQQ A;  3K2A A;  3TW7 A;  3JR9 A;  1O4X A;  1RR8 C;  4D9J A;  2QQ8 A;  1MNE A;  2V9V A;  1J5E I;  2WB1 N;  3DEW A;  3B82 A;  3Q0V A;  2GLO A;  2KDZ A;  3FKI J;  1GVD A;  4XL9 A;  2ME6 A;  4KJZ A;  1B72 B;  3K7A J;  3EQL F;  2V79 A;  3B78 A;  4BGD A;  1D0Z A;  2PJR A;  2DDA A;  1XMO E;  3BZC A;  3B4T A;  2KJB A;  2X1E A;  3CTA A;  2DTZ A;  1DP7 P;  4LF5 I;  3OS2 A;  4FQG A;  2LRE A;  2IOQ A;  2CWE A;  2IW5 A;  4LFC I;  3TL4 X;  2EIJ H;  2Q1Z B;  4B47 A;  4FWG A;  3KP2 A;  4RM3 A;  2R7S A;  3DD6 A;  4BDZ A;  3CJT B;  2VIX A;  4CH7 A;  3H0D A;  3BTI A;  3WHB A;  1FWL A;  5M5Y J;  2DFI A;  3LL7 A;  2IXS A;  3JRG A;  4ESJ A;  1IBL E;  2DCE A;  2M7A A;  5LHH A;  3FXM A;  2F4V E;  3RYR A;  5GAH J;  5FJ8 J;  2QSH X;  4IFD C;  1X1A A;  3Q9V A;  1TT0 A;  1ZG1 A;  3PO3 J;  2NN6 F;  3EPZ A;  5FO5 A;  1D5Y A;  1Y1V J;  4LF6 E;  2BHZ A;  1GXQ A;  4I6Z A;  3E0J B;  4D0P A;  5EDN A;  2HFH A;  2ZO4 A;  3CCR I;  4IFD F;  2MBF A;  1Z91 A;  4P9F A;  2D1V A;  5LEJ A;  4YIR X;  5F27 A;  2ZJR F;  1W0U A;  2IOP A;  2QCO A;  1IBM E;  3A4C A;  1Y39 A;  1V5F A;  2DA2 A;  1H89 C;  4BXX J;  1VQK I;  5FWK A;  1MMG A;  1ZQ3 P;  3RKW A;  2NVX J;  2FNA A;  4M74 A;  2M4G A;  1X1B A;  4WUB A;  2O8K A;  4NXM E;  4MTD A;  4Y15 A;  5F6F A;  3V7C A;  2IGK A;  4Q48 A;  5EGO B;  2WAF A;  4LOC A;  1BC8 C;  2VC1 A;  2UUA E;  4HNT A;  2DO7 A;  3NWT A;  2B9S A;  1EV7 A;  1J5Y A;  3IRQ A;  4RB2 C;  2PX9 A;  2KIS A;  1Y56 A;  2LF8 A;  4N9H A;  4A69 C;  2OZ6 A;  4FTH A;  1Z5B A;  2JA2 A;  2BV6 A;  2I10 A;  5C44 J;  4DR3 E;  2UU9 I;  3W3C A;  4H4K C;  4JI6 I;  4XLE A;  1WKM A;  2PNM A;  2MAB A;  2VC0 A;  3BG9 A;  4A3K J;  4KN4 X;  1IRX A;  4GFB A;  1WCM J;  4GCV A;  3WTW C;  5DTD A;  3PNV A;  4BAY A;  5EF6 A;  3IAM 2;  2M45 A;  3HOZ J;  3H9Q A;  4B3R E;  5DM7 F;  1IV6 A;  4HDU A;  4DV2 I;  1UZC A;  2R3S A;  2R4G A;  1RUN A;  5FKM A;  2LOO A;  1USS A;  2EFN A;  5HS9 A;  5IT9 C;  4RB1 A;  2CG4 A;  1K79 A;  4A3M J;  1DAR A;  1HK7 A;  4BJ6 C;  2R7T A;  1TQI A;  4FWD A;  2ZXJ A;  1KU3 A;  2DOF A;  3C7J A;  2E71 A;  3LAP A;  1PP8 F;  1R7J A;  1XCV A;  3E3V A;  4HX4 A;  2D5V A;  1E17 A;  3QP6 A;  1N25 A;  3R0J A;  4CCN A;  2JA6 J;  1D8J A;  2BR2 A;  2ZJ2 A;  2X6X A;  3OIP A;  4CYD A;  5JFR A;  1GLN A;  4P5O A;  2R5Y B;  3KX2 A;  5L3D A;  1A6I A;  1JT0 A;  1VQN I;  2MA3 A;  4DV7 I;  1K6Y A;  2EJR A;  2NS7 A;  3A01 B;  2BA1 D;  4YFN F;  2Z5E A;  4NUB A;  3VSK A;  4Z6Y A;  2NN6 A;  2M5W A;  4IO9 F;  2V2V A;  5EKW A;  4XSX F;  1UDN A;  3F6V A;  2Q0O A;  2VON A;  3AG3 H;  4WWC A;  2ESH A;  4J19 A;  1LUJ B;  1D1A A;  3ZMZ A;  3S3N A;  2DMP A;  3F9K A;  2DQL A;  2IA1 A;  2FQ3 A;  2E1C A;  4Q5S F;  2NNN A;  2XEX A;  2K9N A;  4AQY E;  1S4E A;  4DR6 I;  3CC2 I;  3IC7 A;  5IYB J;  2RQP A;  2DOD A;  5FKK A;  3LQR A;  1FOK A;  4IRH A;  1IDZ A;  3CLO A;  4CYC B;  3SHF A;  1YW8 A;  5IYD J;  1JHH A;  2PQ8 A;  1ZG3 A;  3GTP J;  2HYF A;  2O1U A;  2NS0 A;  2EIK H;  3IWF A;  4DZJ A;  3IAS 2;  1R49 A;  4AUX A;  1MGT A;  2UXN A;  1B4A A;  3AL0 C;  3HTS B;  2P5K A;  4OOI A;  5FRN A;  1RET A;  4XRF A;  1VI7 A;  1X3W B;  1Z7U A;  1USV A;  3J7A O;  5K36 D;  1JGG A;  1R6L A;  1ZG5 A;  2AE8 A;  2JA8 J;  1EA6 A;  3M85 G;  3HL2 A;  1QA6 A;  5IYC J;  2D1H A;  3DTE A;  1QPM A;  4YRV A;  1QQI A;  3OIQ A;  3PL8 A;  2FXA A;  3HGG A;  3S93 A;  1XGN A;  1ZEL A;  4EEF G;  4ZYG A;  3EET A;  4BQN A;  4IZK A;  4A6E A;  4LPF A;  4MU3 A;  4X0G A;  4U87 A;  3JCU C;  2W25 A;  2JTV A;  4WUC A;  5E18 F;  2IVM A;  4JX5 A;  2XF6 A;  4I0B A;  1MDM A;  5FGM A;  1K78 B;  1KU9 A;  4JV5 E;  3O3K A;  4ZTF A;  2OJE D;  4RGU A;  5B1A H;  1S8N A;  2EZH A;  2RAE A;  3CMA I;  2R5Z B;  4RGX A;  2O1V A;  3CUQ B;  4M3E A;  4Y13 A;  2IS4 A;  3HRM A;  4ESB A;  5J4Y A;  3LAJ A;  2HFS A;  1GVJ A;  5C4J J;  1BJA A;  4C9Y A;  2A2D A;  4ASN A;  1LVA A;  3F72 A;  1U5T A;  3D5L A;  5K36 C;  2VOD A;  3DWL E;  2EA4 A;  2TCT A;  2Q8K A;  4BJT A;  1Z5A A;  1D1C A;  4JYA E;  3RQ4 A;  1O7L A;  2LBF B;  4LCF A;  3FZV A;  3MKZ A;  3A03 A;  4C2U A;  4IXA A;  4IHS A;  5JEA B;  3BDD A;  1IDY A;  4UB8 C;  4RGS A;  4KNY A;  1Y6Z A;  4HQE A;  1Y8Q B;  2UV1 A;  2MD5 A;  3CUO A;  3GTQ J;  2Z9O A;  4WXD A;  3DBL B;  4MHG A;  2HNH A;  2VBZ A;  3SFI A;  4F7Z A;  2QGU A;  3BOQ A;  3HKZ A;  3HJE A;  1ON2 A;  3VFZ A;  1VIS A;  3ZQH A;  2Z5B A;  1XDU A;  2OQG A;  2HXI A;  3ZM7 A;  3HOU J;  2IBD A;  1DGR M;  2HZT A;  1T0F C;  2FD5 A;  1WJF A;  1FBU A;  2FF4 A;  2OCE A;  3K9T A;  4LK1 F;  1K83 J;  2LKX A;  1YJ9 I;  1SMY F;  3MCZ A;  4HYM A;  1V5E A;  4IRI A;  3B6A A;  4DZP A;  1YTY A;  1A35 A;  1P92 A;  1U2R A;  1VQ7 I;  2M2E A;  4DR7 E;  3ZMT A;  3IKV A;  1F9N A;  2GIZ A;  2WAD A;  2P7C B;  1VND A;  4PK4 A;  4IVN A;  3LST A;  1YRN A;  1S16 A;  3HUL A;  5KK1 A;  1MJ9 A;  1VQM I;  4C3I J;  1T33 A;  4XRM A;  1SFO J;  4IZJ D;  5JI6 A;  1HSJ A;  3I55 I;  1CF7 A;  2HOS A;  1OYR A;  3Q6N A;  4RMN A;  5K5Q A;  2V8P A;  2VXD A;  2YX7 A;  4PRX A;  3RYP A;  2UXB I;  4OX9 E;  5GPA A;  5C0X D;  3EDP A;  1Y0N A;  1RHY A;  1SFX A;  4DW6 A;  2ELH A;  1KYZ A;  2FSW A;  5JHF A;  4OZE A;  2HKX A;  1YS7 A;  2FOK A;  3CCE I;  2VL8 A;  2H94 A;  3WGG A;  6PAX A;  1IUF A;  2HR3 A;  4BXU A;  4PFP A;  2HTS A;  3GEZ A;  1R71 A;  3K70 C;  5C0X E;  4U3D A;  4X65 E;  3OYB A;  1YLF A;  2XSJ C;  3D5S C;  2OUM A;  2V2Q A;  1JT6 A;  2BHY A;  4BBS J;  2QBY A;  1UAA A;  2X1C A;  1HNX I;  3T0Y A;  3PNY A;  4M3G A;  3H36 A;  3S1Q J;  4Y52 J;  5H6R A;  3DQV C;  3OR2 C;  1FJG E;  1EH7 A;  1RPW A;  1ZGA A;  2L54 A;  5AIQ A;  5B5E C;  4ITV A;  1Z9C A;  1Y1W J;  2X6O A;  2A2C A;  4E70 A;  1MZB A;  3H3U A;  2ZME C;  3I4M J;  4RAY A;  3CCQ I;  3TO9 A;  1ZRD A;  3Q0W A;  2XB5 A;  5DCM A;  3G71 I;  3L00 A;  2V7F A;  1YX3 A;  1QGP A;  3MZY A;  4OO1 B;  4IL6 C;  2H6C A;  1ZN2 A;  4EMS A;  3HJC A;  4DQ2 A;  3S8P A;  3OYG A;  1U8R A;  1J2X A;  5IP6 A;  1ZM4 A;  2VQH A;  3DCF A;  2C37 B;  2DYS H;  5FD6 A;  3WTV C;  3COA C;  4Y33 A;  2DFE A;  1T95 A;  1E3P A;  1B6A A;  1OR7 C;  1ZM9 A;  5HS8 A;  1X3Z B;  4II2 A;  3G2B A;  3B8H A;  1FC3 A;  4I98 B;  4HX8 A;  2PO0 B;  3VOE A;  4UUS A;  5EL9 A;  2R5Z A;  1BW6 A;  4DUY E;  2XGX A;  5K7F A;  5HDG A;  2G7U A;  1IJW C;  5ILV A;  3MFK A;  3LWF A;  1JI8 A;  2KMU A;  2R7O A;  1EA3 A;  2XAQ A;  5K1Y A;  3P06 A;  1R4N B;  1WVR A;  4CZZ A;  4DBR A;  1MNM C;  3NEU A;  3BTC A;  3GZ6 A;  1QU3 A;  4DV6 E;  1T6S A;  1S7A A;  1C0W A;  5CYV A;  1S9H A;  4ESF A;  4LF7 E;  4E7J A;  2GO4 A;  5HLI A;  5HOO A;  5J4V A;  3OSF A;  1YHC A;  3HXL A;  3ABL H;  1QVT A;  1BOA A;  3HUG A;  4GRI A;  4QPQ A;  4C2T A;  1H88 C;  4IZK B;  2KHM A;  3GLX A;  2F1D A;  4I3H A;  1Z3X A;  2Z5C B;  4L18 B;  1QZZ A;  1W7P A;  5CLS A;  2QSF X;  3BR2 A;  4AM3 A;  4DUZ E;  4N9I A;  4LK0 F;  1KQ0 A;  2E5L I;  5ILU A;  3GO5 A;  2A6E F;  3K4B A;  1BA5 A;  4OIO F;  4K2E A;  4ENK A;  4NNJ A;  1S72 I;  2CQX A;  2LKS A;  4F52 A;  1FIA A;  1TWF J;  3L9F A;  3P9I A;  5CVJ A;  1X4O A;  3RPU A;  1ETY A;  2CYY A;  2M34 A;  4GGG A;  5E20 A;  4XRS A;  1W36 D;  2UUC I;  3WG7 H;  2XGE A;  4Q4Z F;  2JEA A;  3I5U A;  3QOD A;  5ICC A;  3VOD A;  2KIF A;  1ZRC A;  3LA7 A;  1B72 A;  2E2H J;  1KIJ A;  3TO7 A;  1I6H J;  5IOZ A;  2Z99 A;  3CES A;  1BOB A;  2A5W A;  1OLT A;  1ZM3 A;  3BJO A;  3HYI A;  2CFO A;  3C2G A;  4P1W A;  5K5O A;  4HY1 A;  5ICE A;  2ICW G;  1KU7 A;  1NZ0 A;  3I71 A;  4MQV A;  1I27 A;  3W6J B;  5JR3 A;  1DP3 A;  1TP4 A;  1X1D A;  2DOA A;  1Y0U A;  1YIT I;  2VT3 A;  1MD0 A;  2BVM A;  1ZR2 A;  1PP7 U;  2WWY A;  2KPM A;  4A3F J;  1MJA A;  4PJJ A;  4V2F A;  4G7H F;  4A93 J;  2B63 J;  2XGD A;  1X1C A;  4JI3 I;  2COM A;  4EVI A;  3G4S I;  2M9H A;  4RB0 A;  3F8N A;  4DV0 I;  2M1B A;  1U5T C;  4G8X A;  2JEA B;  2UXX A;  2EB7 A;  1Z67 A;  3F21 A;  2CV1 A;  4FX0 A;  1TBX A;  2Z1D A;  1P7J A;  4G7Z F;  4BE1 A;  2BYV E;  4DR2 I;  1XMX A;  3P76 A;  2QWW A;  1JKQ C;  2XC7 A;  4JX6 A;  4Y4R A;  4BL0 B;  5A2Q C;  3F8F A;  2P5V A;  2M0M A;  3BTJ A;  4MFE A;  4HLY A;  4QTR A;  3FKJ A;  1N32 E;  4FCY A;  1XGS A;  4LCG A;  1DU6 A;  1JE8 A;  2OV7 A;  4GKK I;  3R61 A;  1TT5 B;  2MGQ A;  3VYU B;  2XDV A;  3M07 A;  5IOY A;  1D5V A;  1G3W A;  4KDP A;  2CQN A;  2EFQ A;  2LYC A;  4J3D A;  4ZH4 F;  3I64 A;  5C0X B;  3BQY A;  4M73 A;  3V2U C;  5F1J A;  1W5T A;  1QZE A;  2MSY A;  2QQ9 A;  3T1H I;  1IBK E;  3FXL A;  4K0K I;  3C2B A;  2JSP A;  5L3B A;  4RB3 C;  2P6T A;  3MKL A;  3RZO J;  5M5X J;  4XLP F;  1HQC A;  2A6H F;  2KQR A;  3WHC A;  5HNF A;  2JSC A;  4OIN F;  2BE5 F;  1A6Q A;  3LFK A;  1N0V C;  2MH2 A;  4I2O A;  1QZR A;  3PRY A;  2KDO A;  1AHD P;  2E2J J;  3VYR B;  1R6M A;  3JTH A;  2H09 A;  1U6G A;  4FX4 A;  4JI7 E;  4RLF A;  3MN2 A;  1JXS A;  4GYG A;  1XMQ I;  3E6D A;  2OAZ A;  1SFK A;  4CYC A;  2LLK A;  3ZN0 A;  1VQ6 I;  1A31 A;  1TWG J;  3IH3 A;  3A1Y A;  2LJP A;  3CJN A;  4N0B A;  1YI2 I;  5BPI A;  1S6L A;  4YIF A;  2XRL A;  4OAY A;  2BA0 G;  3DFG A;  4Z7C A;  2ZXW H;  3N4M A;  3LSJ A;  3NWS A;  4MU1 A;  1JUP A;  1BKN A;  2HOA A;  5FLM J;  3M6A A;  1R00 A;  1D0Y A;  3C1D A;  3KEO A;  1XG1 A;  2J5O A;  2I5U A;  2JVG A;  1IRZ A;  2VXZ A;  4P9U A;  1PUF A;  4XKB A;  4YHH I;  1E3H A;  4BHP A;  2CRG A;  4EJW A;  3D1N I;  2GA1 A;  3QT5 A;  4B48 A;  1X2N A;  3ECH A;  2KL4 A;  1B1B A;  1SEU A;  4LLN A;  3W2V A;  2YPR A;  3ZQL A;  3Q5F A;  3BR5 A;  5CQE A;  5CVU A;  4X64 I;  2E5L E;  3PUB A;  1ACI A;  2GZW A;  1OYI A;  1TQP A;  5DRO A;  4IOC F;  3M8J A;  4ETS A;  4MO7 A;  2F5E A;  2K4J A;  2N8G A;  5L3E A;  3JAM C;  5F08 A;  2ELK A;  3RKQ A;  4O6J A;  3MZ8 A;  2Y9Z A;  1FOX A;  3WTS C;  4U0W A;  4RAG A;  4CDG A;  5IT9 K;  3KYD B;  5ERI A;  5IY5 H;  3J80 K;  4UVC A;  1GV5 A;  3GF2 A;  3RI4 A;  3HOS A;  2G7H A;  1OYY A;  3GUD A;  2DPD A;  5IWA I;  3MEX A;  3K4C A;  2O7O A;  5BOX A;  3A0B C;  4O5V A;  3QT7 A;  2BY2 A;  3OYA A;  1IG7 A;  4V19 K;  5JEA C;  3FM3 A;  3UNG C;  1KON A;  1P4X A;  2BW3 A;  4Q47 A;  5TGT A;  4WX9 A;  1ON1 A;  3SDG A;  3OS1 A;  3IL2 A;  1RNL A;  3Q6M A;  2PO1 B;  4XOR A;  1I50 J;  4H0E A;  1P6R A;  5J40 A;  5HDN A;  2ZFW A;  1J59 A;  3CJR B;  1R6R A;  1FYL A;  4LD5 A;  4OX9 I;  3MD2 A;  4I09 A;  3BCA A;  4DV1 E;  1RC9 A;  4JI0 I;  2CFX A;  2K9L A;  4B3X A;  2EFG A;  2H6B A;  3OL4 A;  4IEJ A;  4AC0 A;  1G4D A;  1FBQ A;  2NYX A;  5K36 B;  3F8C A;  3GZ5 A;  3MAJ A;  5AON A;  4IFD E;  2DJN A;  1H74 A;  1MG7 A;  2F5C A;  1Y4S A;  4DV0 E;  1EH6 A;  2ZBK A;  4IPA A;  3DKY A;  2V4J C;  2W57 A;  2QEX I;  2PMU A;  2CW0 F;  3R6S A;  4M1K A;  2XRN A;  3H3Z A;  5ELW A;  3DP7 A;  2XPV A;  3CC7 I;  2F5V A;  1IN4 A;  4RLQ A;  4EMD A;  2XHK A;  1Q1H A;  3RZD J;  3CMM A;  1XMO I;  4V2G A;  5LGT A;  5FKO A;  1X1P A;  1ULY A;  2M30 A;  3GVA A;  2E5Z A;  4RAZ A;  3K1M A;  3BR3 A;  2V26 A;  1Y60 A;  1Z59 A;  4FW5 A;  4B3M I;  1ZRF A;  2IS1 A;  2C38 B;  4HRI A;  1DPU A;  1OCR H;  1MMS A;  2VBW A;  4YEL A;  2O5R A;  1FBS A;  2R7X A;  1IN6 A;  1TC3 C;  5B1B H;  2DU9 A;  3KYL A;  3HOV J;  4UV9 A;  4DV5 I;  5EYR A;  3VSL A;  5J3L A;  2UXD I;  2EWN A;  2R3V A;  2EFO A;  2WAQ N;  4J00 A;  4LF6 I;  4MLO A;  3HOX J;  2HK2 A;  2PFB A;  2OQR A;  1HDP A;  4JI1 I;  3W2W A;  3P9C A;  2ZJP F;  1K4S A;  2HOT A;  3ZGK A;  3FIW A;  4DPU A;  3SYT A;  4XNF A;  4BA1 B;  3PQJ A;  2M0C A;  3LSP A;  1FPQ A;  1W0T A;  3QOE A;  2K86 A;  2FBK A;  4FET A;  3IHU A;  1F43 A;  4DOZ A;  3E97 A;  1MBF A;  1ZKG A;  1L3L A;  2ZKZ A;  1HW1 A;  5TIS C;  1R5H A;  5DCM B;  2W1O A;  5IT9 Z;  3JRH A;  2ZNY A;  4CCO A;  3BG6 A;  3J7Z I;  4BHB A;  1Z0E A;  2DDB A;  1XTA A;  4HEA 2;  1WJD A;  3BCB A;  2VJ4 A;  2C37 A;  1V3F A;  2CUE A;  4L5I A;  2XAJ A;  2FRH A;  2L3D A;  2VJ5 A;  3L2V A;  1MH4 A;  1JKP C;  1J9I A;  3BR6 A;  4LIU A;  4GDF A;  1H72 C;  3L2U A;  5JLW A;  2LY9 A;  1SMT A;  2UU9 E;  1MND A;  5FFX A;  4CUG A;  2DEI A;  2HHH I;  3WTZ A;  1M1E B;  2RNJ A;  2UUB I;  1FMW A;  2DA7 A;  4MFD A;  4UHT A;  3VWB A;  4BQA A;  1N77 A;  4IZJ B;  5E1Z B;  4F91 B;  2H8W A;  2WAE A;  1IAW A;  4KUM A;  5ICG A;  2Z33 A;  2P7V B;  4HQM A;  2HQR A;  3SDB A;  4EM1 A;  3QU6 A;  1LB2 A;  3H4L A;  4UTG A;  2CUZ A;  5FKL A;  5E3N A;  3WTU C;  2E1R A;  4M71 A;  3JSP A;  1VI0 A;  1J0R A;  2XF5 A;  2R7D A;  3REO A;  1GDT A;  3PS1 A;  1VQ9 I;  2FBI A;  5BPD A;  1OCP A;  2XB0 X;  1VF9 A;  1RZ4 A;  1KU2 A;  2VE9 A;  3BQZ A;  3PS2 A;  5IWA E;  1R1U A;  1ZAO A;  2DMU A;  4D7M A;  2V34 A;  3LSK A;  3HRS A;  3MKW B;  4IHW A;  2PO2 B;  4W97 A;  1YE9 A;  1WHU A;  3T8T A;  1RIO H;  5GAG J;  5HLH A;  1YRN B;  3GTO J;  3ZQQ A;  1F5T A;  2UWM A;  4NDL A;  1HR0 E;  1KYW A;  3K0L A;  1RR7 A;  1XSD A;  1D3Y A;  2VB6 A;  4G12 A;  3KIO A;  1ZM2 A;  2JEB B;  3BZK A;  2GOX B;  5C0X F;  1T56 A;  2GQQ A;  1PDN C;  3PJR A;  2OU2 A;  2HKJ A;  3OOU A;  1P9Q C;  2EIM H;  3JAM Z;  2VKV A;  4XOP A;  5L3F A;  4LF9 I;  2CV0 A;  3H5A A;  3M85 D;  2YUS A;  1IUY A;  1T38 A;  3KET A;  4XID A;  1FT9 A;  1GHC A;  2V2Z A;  3I3L A;  2FEZ A;  2JPB A;  3FK6 A;  4ZVI A;  3HPH A;  4YY3 I;  4DR6 E;  2GWR A;  3B6C A;  2C39 A;  3TDU C;  1U78 A;  1LKX A;  4LF8 E;  2MD0 A;  1ZAR A;  4OIP F;  3V7S A;  4BU2 A;  3MKY B;  5E3O A;  2OCC H;  3H0G J;  4N4N B;  2XKO A;  4PSX A;  4XLN F;  2A68 F;  2X48 A;  2DMT A;  4KIB A;  2HGC A;  3DTI A;  3H1C A;  2VQC A;  1S29 A;  1F36 A;  2XAU A;  3HSF A;  4B8X A;  2EV0 A;  1Z0B A;  2M4K A;  2KP6 A;  2VT2 A;  5E3M A;  4WUD A;  2JJ7 A;  2NN6 D;  5LGU A;  4DUY I;  3LA2 A;  4HST A;  4HZF A;  4FW9 A;  4FWH A;  3IH2 A;  3ZR8 X;  2XRO A;  5FLX Q;  4B3T E;  1NHJ A;  5FB2 A;  3VYS B;  2IES A;  1MBG A;  3BP8 A;  3QPH A;  3BJ6 A;  3A0H C;  5JHU A;  3SQN A;  1G6N A;  2X51 A;  2VBY A;  1U9N A;  2H8R A;  2Y0S A;  1WJA A;  3ZQI A;  2WAQ A;  3W6K B;  4LFB E;  4RM2 A;  1UFM A;  4M9X A;  5JVG F;  3GFJ A;  3L7Z B;  2BY0 A;  4DV5 E;  4HW0 A;  1Z77 A;  2ZME B;  5KVR A;  3S14 J;  5JLX A;  1LVK A;  4OO1 E;  3D4J A;  2G9W A;  1DUX C;  2PNL A;  3CWV A;  3J81 C;  2DT5 A;  1HDD C;  4OMY A;  5BNG A;  3WU6 A;  2KZG A;  3OOP A;  2VJI A;  2DI3 A;  2L4M A;  5DM6 F;  3L2R A;  2VLA A;  2BM0 A;  3ZZU A;  5CQG A;  5LMU E;  3HOW J;  1X2M A;  2IAI A;  1IN5 A;  4TV7 A;  3K2Z A;  3F8B A;  3QYB A;  4AYB A;  2FU4 A;  4IHX A;  3RQI A;  4A3D J;  2VKD A;  1RI7 A;  3PUF A;  3TBI A;  1BN5 A;  4JV5 I;  4MGR A;  4ZDL A;  1R36 A;  1VFC A;  1JGS A;  1JUS A;  2V6E A;  1ITY A;  3AKZ A;  1G59 A;  1FYK A;  2IS2 A;  3ONQ A;  4S0H B;  1YH8 A;  1HF0 A;  3PQK A;  2ZJQ F;  2UUC E;  1U9O A;  3S17 J;  4A3I J;  3TMO A;  2IS6 A;  4IHV A;  2IJL A;  4ENN A;  3OYC A;  1XB4 A;  1HNZ I;  2P81 A;  3EYY A;  2L7K A;  3X2Q H;  3PNT A;  4DV4 I;  4IZJ A;  1UHM A;  3WGH A;  2CV2 A;  4XQF A;  2UUA I;  1K78 A;  2K27 A;  4DV3 E;  4EGZ A;  3KP5 A;  1FLI A;  3RPQ A;  3CME I;  2FE3 A;  1A04 A;  3OYI A;  3HOY J;  1CGP A;  2HKE A;  4NXN I;  1IXS B;  3HC7 A;  2HYG D;  3MVP A;  1ZGW A;  4EM0 B;  2JN6 A;  2HDD A;  4QNK A;  4JI2 E;  4OKG A;  2W48 A;  1B9N A;  3WTT C;  3BG7 A;  4HAC B;  1RES A;  4IFD B;  2PN6 A;  4BS9 A;  4Y7N J;  3T8R A;  1Z0C A;  5BR8 I;  3FM5 A;  2CS3 A;  2BY3 A;  3L2W A;  5EJC A;  3GFM A;  1MMN A;  3ZMU A;  1GXP A;  2BR2 B;  3J7A G;  2TDX A;  1APL C;  2R7Z J;  4LF4 I;  5H20 A;  4X66 I;  3E5U A;  3FXQ A;  5DDG A;  2Y69 H;  3CO6 C;  2WB1 A;  1XCB A;  4PCQ A;  4LFC E;  2HTJ A;  3L1P A;  2EIN H;  2FBH A;  1U2W A;  2JQ7 A;  3HZJ A;  4YEJ A;  4LOM A;  2WY8 Q;  1MH3 A;  1BR1 A;  1D1B A;  1QHG A;  2QF7 A;  2KIQ A;  2Y48 A;  4F55 A;  1DDN A;  2X7I A;  2ID3 A;  3CUQ A;  3H92 A;  4HOB A;  2EZL A;  2K85 A;  2C6Y A;  4JI2 I;  2QQB A;  4JG4 A;  5KNL A;  3CDJ A;  4HX7 A;  3RTR A;  3CCM I;  4ZC3 A;  3OSG A;  1N36 I;  4MYU A;  1XX5 A;  5BQT A;  4AWX B;  5BR8 E;  3BPX A;  1IBK I;  3G1O A;  4K0K E;  3ABK H;  3WE3 A;  3U1Y A;  1XGO A;  5D5V B;  1ZYR F;  3JSO A;  4ISA A;  3ZOB A;  5J47 A;  1SD5 A;  5E8G A;  3BPV A;  4S04 A;  1O3S A;  1MSE C;  2DTR A;  4L9V A;  2QA4 I;  4OMZ A;  4MEX F;  1CF7 B;  1WH7 A;  3TP3 A;  1MMD A;  5DD4 A;  1PVG A;  1CQT A;  3PYE A;  3I54 A;  2X36 A;  5C0X A;  4JI0 E;  4W1U A;  1AKH B;  4AIK A;  4II3 A;  1Q1V A;  3L2Q A;  1I1G A;  2KT0 A;  2XPU A;  4GXO A;  5FLX C;  2PLY A;  2WNR B;  1IN7 A;  2X6W A;  3O6B B;  1FZP B;  5LD2 C;  1SFU A;  4C3H J;  1QBJ A;  3CCV I;  3ZN1 A;  2NVQ J;  5C3E J;  2VQF I;  2BXZ A;  5D5X B;  4L5E A;  1HLV A;  3F6O A;  2ZB9 A;  3K17 A;  5K5R A;  1U8B A;  2CH0 A;  3H9J A;  2V1U A;  4U7D A;  2X4H A;  3EYI A;  4NQW A;  2NOG A;  2LC2 A;  4AYB N;  3J81 Q;  1ETQ A;  3GWZ A;  3K4N A;  5D8K B;  1B8I A;  2VKH A;  4NXM I;  5LMU I;  2WBM A;  5ICF A;  2HWV A;  2L02 A;  3UKG A;  3GTG J;  2OPT A;  3RSN A;  1ZLJ A;  1WJB A;  1H7S A;  1UG2 A;  1P7I A;  4DJA A;  1Z0X A;  3KP3 A;  1ETV A;  1YG2 A;  2F4M B;  2LRD A;  2ZSH B;  2DJI A;  2E7X A;  3S3M A;  1OYS A;  3OYL A;  4DR5 I;  2M3A A;  2L2O A;  4C3J J;  4J01 A;  3K1P A;  2HK3 A;  1XC5 A;  4IOA F;  2YSR A;  1PUE E;  5DUI A;  2E1M C;  4QLC U;  5D5W B;  3TOA A;  2WV1 A;  4YII A;  2LDU A;  1I94 I;  1WJ5 A;  2X6Y A;  2JZY A;  2ZFU A;  2E1N A;  2DA6 A;  4E4H A;  4P96 A;  3I58 A;  1MDM B;  1S3J A;  3TGN A;  2DMN A;  4DUZ I;  2YS9 A;  4OIQ F;  4HSR A;  1A5J A;  3KRN A;  3JAM Q;  4B3S I;  3ZQF A;  4JI5 I;  2RN7 A;  1FNM A;  3OIO A;  3K4L A;  3M3Y J;  1N75 A;  4DV3 I;  2CG9 A;  4C30 A;  2BA0 D;  4QNJ A;  1BC7 C;  1Y8R B;  4KMU X;  1K4T A;  3BC8 A;  1PKP A;  3PSI A;  2K3F A;  3VPR A;  1MJB A;  4FW7 A;  5F04 A;  1XNR I;  1V55 H;  3TW6 A;  2CU7 A;  2L9R A;  1G3Y A;  3G1M A;  4E7Z A;  1LE8 A;  2O0Y A;  4U7B A;  1TNT A;  2F4I A;  4YG2 F;  2Z5U A;  5FFZ A;  3CF2 A;  3FBN B;  4C2M J;  3U9G A;  2FNP A;  3Q3S A;  3PSF A;  2F5D A;  3TOB A;  4ZYD A;  3KEQ A;  5LGN A;  1W7P D;  4KIG A;  2FUG 2;  4R1H A;  4X66 E;  5A2Q Z;  3IV5 A;  3M7N D;  4UUS B;  2R42 A;  1FMV A;  4GKJ E;  3ZRG A;  4Z7Y A;  2NS8 A;  1SAX A;  3DEU A;  5BMZ A;  1YFH A;  2QLZ A;  3M7G A;  2GS8 A;  1HNW I;  5CJ9 A;  3K4J A;  1JKO C;  3WU1 B;  2D2W A;  2J5P A;  3VB2 A;  3H9G A;  1FOW A;  2AXL A;  2HI3 A;  3TKY A;  1YQA A;  1XXE A;  5L3C A;  3VYT B;  2VAS A;  1WRJ A;  4PU9 A;  3WTY C;  4HXZ A;  5JEA F;  1J5E E;  2QKL B;  1KVK A;  2DA3 A;  3OYE A;  1EI1 A;  1YW9 A;  5E1W A;  4IQJ A;  4EV0 A;  3ZQ7 A;  3OR1 C;  4ABZ A;  4KIT B;  1W36 C;  3WU3 A;  4A0Z A;  2R0Q C;  3MMY B;  1H7U A;  1QRY A;  4DGW B;  1NHA A;  3C2H A;  1H0M A;  1LJ9 A;  2A61 A;  2HQA A;  3DTK A;  4UVB A;  2HVQ A;  4QPO A;  2Z2S B;  4IHT A;  1WWX A;  2HDW A;  1MU5 A;  1JHF A;  2JUC A;  4B3T I;  5EEG A;  4G94 A;  3DU5 A;  1HW5 A;  1NHI A;  2NPF A;  1TTY A;  2UUZ A;  3EUH A;  3FDY A;  3KZI C;  4M6V A;  3U2R A;  3J80 Z;  1YJN I;  1EF4 A;  2BXY A;  4BKX A;  2K4B A;  4CCK A;  5EEA A;  1I1S A;  3QT6 A;  4JI4 I;  3B73 A;  2EV6 A;  4F3Q A;  3KP4 A;  4KN7 X;  1WZ2 A;  3S3O A;  1UHS A;  2O1T A;  1BIB A;  1TWA J;  3TED A;  3NZK A;  3Q0U A;  2NN6 E;  2BBY A;  1XGM A;  1FSH A;  3BY6 A;  3MWM A;  1K61 A;  4UXN A;  2VQF E;  4EJV A;  1V5G A;  2O3F A;  4A3G J;  2HHH E;  1VQ8 I;  2O8X A;  4FW4 A;  2HOE A;  1G3T A;  4HBL A;  1WQ2 A;  2DEJ A;  2GXG A;  4I7H A;  2DXI A;  2A5Y B;  2DFH A;  5GAE J;  1RR9 A;  3H5N A;  4ZDP A;  2BVL A;  1NG6 A;  1HKT A;  3FXO A;  1R5G A;  2L9V A;  3DPT A;  4RDU A;  4XSZ F;  1DU0 A;  4UV8 A;  2F48 A;  1OPC A;  1R1V A;  3FMS A;  1B9M A;  2NVT J;  4XLA A;  4M6Y A;  2O9L A;  1X58 A;  3UR3 C;  2R93 J;  4CCM A;  1U5T B;  2Z16 A;  2ID6 A;  3S2H J;  1IBL I;  3EUK L;  4LG3 A;  2F4V I;  5FLX K;  4M3D A;  2Q2E B;  4CCL A;  3M4O J;  2W85 A;  4CIC A;  3ZKD A;  4YHH E;  2PNZ B;  2NVU B;  2JE6 A;  2ZCW A;  5J8C A;  4DPY A;  1HNZ E;  1TWC J;  2ACJ A;  2MYS A;  3ZCO A;  2BY1 A;  2XKP A;  2BV3 A;  1I94 E;  4XMY A;  3OWT A;  2PO0 A;  2FQ4 A;  3FXJ A;  3WU2 C;  3R4K A;  1A36 A;  3EUA A;  2ISY A;  4X1E A;  5L3G A;  2PI0 A;  4M72 A;  1YS6 A;  2MLK A;  2Y2Z A;  5E79 C;  2XAH A;  2O6G E;  1OIS A;  4UY8 I;  1V54 H;  4G6D A;  4EM2 A;  3OS0 A;  1VTN C;  2DT6 A;  3L2C A;  4ZZL A;  1MMA A;  2AS5 F;  4LFU A;  3OYF A;  2XF7 A;  2C38 A;  4B3A A;  2QM3 A;  1SD7 A;  2GBY A;  5LEK A;  3VDX A;  3E5Q A;  2X85 A;  3ZXS A;  4A6D A;  1F4K A;  1P4A A;  4FW6 A;  3K70 D;  4M6X A;  2FML A;  5LRS A;  2HEO A;  4USK A;  2IRF G;  2JA5 J;  4BNC A;  2WW4 A;  4M3B A;  1XNQ I;  2JRM A;  1N34 E;  4DR3 I;  3QQA A;  3GFI A;  4UUV A;  2PO2 A;  2XAS A;  2K40 A;  4PGG A;  4RGR A;  3JRA A;  1NH3 A;  1MBE A;  4UB6 C;  5DUK A;  3ZPL A;  4BE2 A;  2NN6 B;  1ETO A;  4F93 B;  1HBX G;  2WP8 B;  4XTJ A;  4IKF A;  3QPL A;  3V5R A;  1EH8 A;  2JT1 A;  1XHK A;  1P42 A;  3OYJ A;  3DPU A;  1FWK A;  3S15 J;  5DCF A;  1O3R A;  1WPK A;  1ZRE A;  1H9G A;  3M8F A;  2XVC A;  2P4W A;  3FK7 A;  2L0K A;  3WOD F;  3M1E A;  4XIC A;  2AO9 A;  2HDC A;  4A0X A;  4LG0 B;  4PZJ A;  4JQF A;  2JRT A;  2LTP A;  5J8F A;  2JVH A;  3O8H A;  2PJP A;  2Z5B B;  3QPT A;  1IO2 A;  5HS7 A;  1VQ4 I;  1HOM A;  5FLX Z;  1IZ1 A;  4LB6 B;  2LH9 A;  5JVT A;  3GTK J;  2A3S A;  1LDK B;  3EUH C;  1OCT C;  2ECB A;  2DPU A;  3CLQ A;  3LSR A;  1N78 A;  2E1M B;  2V1N A;  3ELK A;  3MQ0 A;  4U0V A;  3U21 A;  4DU8 A;  1W5C C;  1AOY A;  2PO1 A;  2MC3 A;  2DQR A;  2L5Q A;  3CUQ C;  3DKX A;  3KCC A;  2W82 A;  2HVS A;  1TWH J;  1UDQ A;  4I0A A;  2EZK A;  1KKH A;  3I59 A;  2W84 A;  4NHJ A;  1FJG I;  4ANJ A;  4LG0 A;  3K6G A;  2EV5 A;  1T2K A;  4EQQ A;  3CQZ J;  1T8I A;  4GQU A;  3W2A A;  1FX7 A;  1IN8 A;  2M8G X;  1XMA A;  2R7F A;  2CSO A;  4DV2 E;  1MBJ A;  2ZNZ A;  2X9D A;  3AG4 H;  1HST A;  2MC4 A;  5KCM A;  1WH5 A;  3LMM A;  1FJL A;  4U0Y A;  1U0J A;  4XRS G;  5LLQ A;  1ZHF A;  2YX4 A;  1OFC X;  2STT A;  5FRO A;  1Y5Y A;  3G6E I;  2JT2 A;  2ESN A;  2QVO A;  4KIC A;  4AVZ A;  4ENM A;  2QUF A;  1WSU A;  1JUM A;  1XDS A;  1OMI A;  2DN0 A;  2OBP A;  1XD7 A;  2PMH A;  4FHT A;  3OV8 A;  4FN5 A;  5DYM A;  5K7Z A;  1N33 I;  3QT8 A;  5GTH C;  2ME0 A;  3FXU A;  5KAF C;  2HKO A;  2HZD A;  1K6O A;  2HXO A;  5H6Q A;  3SZT A;  4PDK A;  2FOW A;  1FY7 A;  2WC2 A;  3L7W A;  1ONV A;  1OYW A;  1T98 A;  5E8I A;  2BZT A;  4ZZD A;  1Z7L A;  4ZYH A;  4S05 A;  4JI1 E;  2KIM A;  1Y6I A;  4DXL A;  1GUU A;  2Z3Y A;  4F92 B;  1ETX A;  5D4R A;  1JTY A;  2VQE I;  4GKK E;  5ED4 A;  4BA2 B;  2MFZ A;  2STW A;  4D5C A;  2UXC E;  3HTU A;  3BR0 A;  2ZM6 I;  1R23 A;  5ILS A;  1KQ9 A;  2VI6 A;  2R7W A;  3FF5 A;  4NC8 A;  1FTZ A;  2OI2 A;  4LLL A;  4BQO A;  4IZZ A;  1LDD A;  4OWR B;  2R7Q A;  3SEQ A;  2RC4 A;  1VZ0 A;  3CDH A;  3M9A A;  4JBA A;  4BQQ A;  4LB5 A;  2DA4 A;  2K02 A;  2X1D A;  2A69 F;  3ESW B;  4BE0 A;  4BXF A;  4DPW A;  2BM1 A;  1KGS A;  1ORK A;  2B0L A;  3F8M A;  3CO7 C;  2F5F A;  4RAF A;  5EG0 A;  2A05 A;  2ADU A;  3LSH A;  1HCR A;  1PVE A;  1J7K A;  1UST A;  3SEZ A;  2GM4 A;  4FE7 A;  3J7A M;  2E35 A;  1WI9 A;  2UUB E;  1YHQ I;  3M7N G;  5FLV A;  3F0C A;  1TQM A;  3R60 A;  1MBH A;  2VQG A;  3KPH A;  5KAI C;  1YO5 C;  2LY2 A;  3TO6 A;  3S16 J;  1ENH A;  2EA2 A;  2P0W A;  2W7N A;  3PFY A;  4N3O A;  5D8L B;  1TW2 A;  3GTL J;  4JI3 E;  3CJQ B;  4DR4 I;  1X4P A;  4BEH B;  3AL0 B;  1B63 A;  3JW4 A;  1OJ4 A;  1ELO A;  4EGY A;  2CJJ A;  2EFP A;  4D1Q A;  3FXK A;  3KYC B;  3S2D J;  2NAZ A;  1KTV A;  4RPF A;  2LFB A;  2E36 A;  4JI8 E;  4DV4 E;  2ECC A;  2QBY B;  3LOC A;  3HKZ N;  2L7F P;  2OZU A;  5BS6 A;  5JEA E;  4MIM A;  1TLH B;  2IGO A;  3QU3 A;  5HOD A;  2UXB E;  2DBB A;  4BAC A;  3OMY A;  2AJ4 A;  2X0L A;  1UEL B;  3SZP A;  4QIW N;  2DK5 A;  4EJT A;  3DF8 A;  5GPC A;  2CW8 A;  1GT0 C;  1H73 A;  3PYD A;  2AHQ A;  4X64 E;  1HNW E;  2PMZ A;  4XBF A;  1FNN A;  3KEY A;  3SFZ A;  3U1D A;  4AU7 A;  4B09 A;  1BJZ A;  2V6C A;  5EGO A;  1N0U A;  1AA7 A;  5LL6 R;  4XKC A;  2RNG A;  4IF4 A;  2L9N A;  5A2Q K;  1HKS A;  2LD5 A;  2ZC2 A;  4B3M E;  3S1M J;  1YIO A;  1ZXN A;  4MYT A;  4X62 E;  1VQO I;  4XR6 A;  2A6T A;  3LNU A;  1XSX A;  4LF9 E;  2KFD A;  5DNX A;  3HEF A;  4XLC A;  4R8H A;  5IT3 A;  4RS8 A;  5FRM A;  2DFF A;  5EZH A;  4MTE A;  3ASO H;  4X65 I;  2VKE A;  3P5J A;  4XON A;  3T5X A;  3W6V A;  1D0X A;  2XIG A;  1DQU A;  2DW4 A;  3HSE A;  3GYH X;  5DD8 A;  1OCZ H;  1ZTR A;  2LF7 A;  2ZXI A;  2W4S A;  4HA8 A;  1HC8 A;  4LF5 E;  3K1N A;  3IRR A;  3BLY A;  3ABM H;  2Y0S N;  3CZ6 A;  3CP2 A;  2RGV A;  3PFI A;  3ZMS A;  5M3M J;  2KRC A;  2HQN A;  3LSI A;  4L0Y B;  2IPQ X;  3WG9 A;  3GTM J;  4ZJZ A;  2WNR A;  2Y31 A;  1OR7 A;  3PM1 A;  5DRR A;  1SD4 A;  4L9T A;  1UDO A;  1REP C;  1S5L C;  4EJO A;  2DA5 A;  2VE8 A;  4BEH A;  2WY7 Q;  3QOP A;  1A6F A;  2O61 A;  5KHD A;  1S7O A;  4CHU A;  2BW3 B;  1ZGJ A;  2V9K A;  2Z5C A;  3LPS A;  1IF1 A;  2HVR A;  1FI4 A;  3HM5 A;  3LA3 A;  2VPL A;  1XMQ E;  1PJR A;  4P55 A;  5E1X A;  1ERD A;  2IGM A;  3JTG A;  1IGN A;  2JEB A;  1P4W A;  1JJ8 C;  2DMQ A;  2OF7 A;  3ISP A;  3RIR A;  3BWG A;  5K36 F;  2JA7 J;  4B3S E;  4G9Y A;  2LNB A;  2QZ8 A;  4IHY A;  1ODD A;  2IGN A;  2YU9 J;  3D0S A;  4O3M A;  4E7S A;  1QZY A;  4WXC A;  4X6A J;  4JI4 E;  3S32 A;  1TL8 A;  1QPI A;  3IP4 B;  3L7Z A;  2GA2 A;  4JOM A;  1Z0G A;  4LF7 I;  1DGW Y;  3WU0 A;  1X3U A;  4DNC A;  5H2F C;  5K7H A;  5IP9 J;  5D5U B;  2KRF A;  5E17 F;  4CZC A;  2M87 A;  1PIE A;  5F1R A;  3GME A;  2ZIT A;  4JI6 E;  4IFD D;  3VEP A;  1LPQ A;  2PJR B;  2O1W A;  3BJA A;  5CVR A;  3CCS I;  3ZP5 A;  2OTL I;  2QYO A;  3DEE A;  1W7P B;  4DU7 A;  1FKA E;  3N97 A;  3SZG A;  1HR0 I;  3P3E A;  1LEA A;  3OYN A;  4USM A;  1TZL A;  4PGH A;  4IQ4 A;  2DT7 B;  3DKW A;  1LEB A;  2IT0 A;  1SVL A;  1SC7 A;  3D5R C;  2VES A;  1SAN A;  3U1K A;  2LG4 A;  4WF2 A;  2BEO A;  1MIJ A;  1OQY A;  2Y0M A;  3NRV A;  5C4X J;  4BDY A;  1WGX A;  4L5J A;  4ZDO A;  4FW3 A;  2IP2 A;  3TQN A;  3T1Y E;  2C39 B;  3HRU A;  3ABU A;  4YY3 E;  2W00 A;  3DLL F;  1N34 I;  4OO1 F;  2LKP A;  1SVO A;  4AD9 A;  2PEX A;  4IRG A;  1ZK8 A;  4LIT A;  1WFX A;  3F3X A;  2E19 A;  4E7L A;  4HF1 A;  3WGI A;  3FMQ A;  3GZN B;  5F0C A;  4BHC A;  4YFK F;  3J81 Z;  2KJC A;  1MSF C;  4D5F A;  1SVM A;  2WP8 A;  3N05 A;  4AIH A;  4EJU A;  3JRF A;  3P7N A;  1KA8 A;  3SJM A;  3PO2 J;  1FEX A;  2DAO A;  3LSM A;  2AQF A;  4G6T B;  2H1K A;  3CDI A;  1ZLK A;  3I59 B;  3FBI B;  1I39 A;  5E3L A;  3I4N J;  3F22 A;  4XKW A;  2EIL H;  4NB5 A;  4DYR A;  1JKR C;  2HU9 A;  1VQL I;  2FX0 A;  3NAU A;  1YJW I;  4OIR F;  2DA1 A;  1P2F A;  2K9S A;  4I99 C;  3WE2 A;  3HHH A;  4R79 A;  3HKM A;  4AQY I;  3CCL I;  5K36 A;  3K69 A;  3CC4 I;  3WU5 A;  2QSG X;  1EKE A;  2RVC A;  2COB A;  4BBR J;  3K85 A;  3HUG B;  4OO1 A;  4OO1 D;  2WV0 A;  5EEH A;  3KFW X;  3JRD A;  1HKQ A;  3KLO A;  4HF2 A;  4A5N A;  1I3A A;  2EZI A;  1HW2 A;  4PRV A;  2DLL A;  3L09 A;  3H5R A;  4DR2 E;  2QQA A;  3GXO A;  4Z2Y A;  2L4A A;  1RRJ A;  1H8A C;  3JRI A;  3SXY A;  2MG4 A;  4HDV A;  1N32 I;  2ISZ A;  3GX4 X;  1NK2 P;  4LCH A;  1MKM A;  2KKO A;  4PJ0 C;  4QWQ A;  4JX4 A;  2OC6 A;  4XOT A;  1OYP A;  4B44 A;  5IPA A;  2J7K A;  1D6T A;  1J09 A;  4CGZ A;  2G0E A;  2IA0 A;  4HF0 A;  1IV8 A;  4MQY A;  4HLX A;  1Z0W A;  3AFH A;  3OTO E;  3G1L A;  2RDP A;  1IRF A;  3UHM A;  3HGY A;  4KFC A;  3E6C C;  1BW5 A;  1O57 A;  1OJL A;  2O03 A;  4A3J J;  3K10 A;  2HFU A;  3ZQC A;  1W5S A;  2FJ1 A;  3DV8 A;  1BM9 A;  4CSW A;  4L9J A;  5DNL A;  2CGP A;  1YYV A;  1FIP A;  2QKM B;  5CVI A;  3F0N A;  4U3B A;  3A02 A;  2OTJ I;  3CP8 A;  3Q1Q A;  5HNH A;  1FSE A;  2LY1 A;  3HPG A;  1RRE A;  1LQ1 A;  2JPC A;  2OD5 A;  2F6C A;  1UMQ A;  2P8T A;  2K7L A;  5LFA A;  3QRF F;  2XAF A;  2V1D A;  2I8D A;  4Y3O A;  1XMK A;  4I76 A;  2CO5 A;  2NVY J;  4HYE A;  1ZXM A;  4CA0 A;  1IRG A;  4LFA E;  4KHP E;  3J7Y J;  1MX0 A;  5B3S H;  1NK3 P;  3QAH A;  1XS9 A;  4WCG A;  4HAC A;  2Q2E A;  2PBI A;  2LK2 A;  3OYM A;  4GYI A;  3LSG A;  3OYH A;  2RRE A;  3P3G A;  4XN3 A;  3B02 A;  3LQQ A;  2QEN A;  4XM3 A;  3KE2 A;  1ZH5 A;  3FIS A;  2NN6 C;  3QYE A;  2VJJ A;  1IBM I;  3RCO A;  4M9S A;  1V4R A;  3M8E A;  4CO8 A;  5M5W J;  3DPL C;  4LLG F;  2P5L C;  1B62 A;  2LVS A;  2CW7 A;  2A07 F;  1O3Q A;  3DU6 A;  3KLN A;  3H3V K;  3V8J A;  4IJA A;  4JI5 E;  1OCC H;  1U3E M;  2R7U A;  5F0H A;  3BG3 A;  2Y75 A;  2VQL A;  1B8I B;  1F1Z A;  1K7A A;  3TDZ C;  2E1O A;  1L0O C;  2KIU A;  1NTC A;  2EQR A;  1XNR E;  4I01 A;  2M7B A;  4WK8 F;  1T08 B;  4LF8 I;  4HNU A;  1FP2 A;  1Z21 A;  2R7R A;  2DK8 A;  4E6K G;  3BT9 A;  1I3Q J;  2Y30 A;  2HYJ A;  4FT8 A;  5LMN I;  4FE4 A;  1UEK A;  2E5N A;  4DR7 I;  1IXR C;  3C3W A;  1W1W E;  1ETW A;  4BH9 A;  5DRQ A;  2ZXH A;  3OYK A;  2L7Z A;  3QPS A;  1QVU A;  2WA0 A;  3E7L A;  2P6S A;  4XKV A;  4DYC A;  5J1R A;  3GCM A;  4KQV A;  4B3R I;  5GP9 A;  3BZ6 A;  3JRE A;  1J75 A;  5GME A;  4ZYE A;  1RUO A;  1OKR A;  5LRR A;  4E7I A;  5GAD J;  3WTX C;  3FHZ A;  5EZG A;  2GIV A;  1LFP A;  2ZSI B;  4FIS A;  4R1F A;  3GW2 A;  3J80 C;  3NAR A;  1LFB A;  1R22 A;  1BR2 A;  1D8K A;  3T1H E;  3I53 A;  3CF5 F;  4NXN E;  1UJ8 A;  3BR1 A;  1HXD A;  1UB9 A;  2J65 A;  2LR8 A;  2CUF A;  3ZQG A;  3S1N J;  2LBF A;  1FYM A;  2CQ7 A;  2CUJ A;  3I9V 2;  4BYY A;  3OY9 A;  3IKT A;  5GTI C;  3A01 A;  1BI1 A;  5TJJ A;  5LHG A;  4JI7 I;  4AIJ A;  2BOL A;  4AIM A;  4MDT A;  2FA5 A;  2ELJ A;  3R0A A;  1HNX E;  1XSV A;  2LP0 A;  1UG0 A;  3BTL A;  4KIF A;  2E2I J;  1Z0T A;  2LMD A;  3OTO I;  4OU0 A;  3CDL A;  3J81 K;  2GO3 A;  3ZKB A;  1B59 A;  4YFX F;  2XV4 S;  1QO0 D;  2IER A;  1QNT A;  3CD6 I;  2XUB A;  3NQO A;  3TP0 A;  1WUU A;  2Y9Y A;  3K4K A;  5J6X A;  1AU7 A;  1S7E A;  2K9M A;  3K4M A;  5IP7 J;  1PYV A;  4RA2 A;  2ETH A;  5K36 E;  2PNZ A;  2HS5 A;  2ZM6 E;  3DBR B;  4IS9 A;  2VBX A;  5DRP A;  1TNS A;  1O3T A;  4P7A A;  1MBK A;  3ABT A; 
#chains in the Genus database with same CATH homology
 1WHU A;  2PO0 B;  4IFD E;  4BA1 A;  3U1K A;  2PO1 A;  4IFD A;  5JEA B;  5C0X B;  2NN6 E;  1UDQ A;  4NBQ A;  2JEB B;  2NN6 C;  2BR2 A;  2C39 B;  5C0X F;  1OYS A;  3GLL A;  4OO1 F;  2BA1 D;  4IFD B;  3M85 D;  2NN6 A;  1R6M A;  2WP8 A;  3B4T A;  1UDN A;  3KRN A;  2BR2 B;  2C39 A;  2C38 B;  3CDI A;  5JEA A;  4AID A;  3DD6 A;  2BA0 G;  3HKM A;  4AM3 A;  2BA0 D;  5K36 A;  3H1C A;  4OO1 A;  2PNZ B;  4OO1 D;  2JE6 A;  1OYR A;  4IFD C;  2NN6 D;  2NN6 F;  2WNR A;  2PO0 A;  4BA1 B;  1UDO A;  1E3H A;  3CDJ A;  3GCM A;  5C0X D;  4BA2 B;  2JEA A;  4IFD F;  5K36 D;  3M7N D;  1OYP A;  1R6L A;  5C0X C;  5C0X E;  3L7Z B;  3M85 G;  2C38 A;  2C37 A;  2JEB A;  4OO1 E;  5K36 F;  5C0X A;  5JEA D;  2PO2 A;  3H36 A;  5JEA F;  2BA1 G;  3M7N G;  4AIM A;  4BA2 A;  2NN6 B;  3L7Z A;  2WP8 B;  2WNR B;  5JEA C;  4OO1 B;  1UDS A;  3GME A;  2JEA B;  4IFD D;  2PO1 B;  4OO1 C;  2C37 B;  5K36 E;  2PNZ A;  5K36 C;  2JE6 B;  1E3P A;  2PO2 B;  5JEA E;  5K36 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...