3GMEA

Crystal structure of polynucleotide phosphorylase in complex with rnase e and manganese
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
545
structure length
482
Chain Sequence
MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFRPSEGETLIARLIDRPIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPVNEALNARVTDKQERYLHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTDTFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQAINAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyribonucleotide nucleotidyltransferase
publication title Crystal structure of Escherichia coli polynucleotide phosphorylase core bound to RNase E, RNA and manganese: implications for catalytic mechanism and RNA degradosome assembly.
pubmed doi rcsb
molecule tags Transferase / protein binding
total genus 128
structure length 482
sequence length 545
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 3gmeA02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gmeA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gmeA01
5C0XA 3M7NG 2JEAA 2BA0G 5K36A 1UDQA 2JE6B 2NN6D 2NN6B 1WHUA 4IFDF 3B4TA 2C37A 2C39B 2WP8B 1E3PA 2PO0A 5JEAF 5C0XD 5C0XB 2JEAB 4AM3A 5K36D 4IFDC 5K36B 4OO1F 5JEAA 3M85D 1E3HA 1OYPA 2C37B 3L7ZB 4OO1A 5K36F 4IFDD 4IFDB 5C0XC 3HKMA 5JEAD 5JEAB 5K36C 2PO1A 4NBQA 4OO1B 4OO1D 2JEBB 1R6MA 3U1KA 1OYRA 2WNRA 3CDIA 2PO1B 5JEAC 2BR2A 2PO0B 4OO1C 3DD6A 2WNRB 4IFDE 2PNZA 2NN6E 4BA2A 3M85G 3GLLA 2C38A 2PNZB 5C0XE 1UDSA 3GCMA 2BA1D 5K36E 2C39A 3GMEA 4AIDA 3CDJA 4BA1A 4BA2B 2PO2A 2C38B 3H1CA 3M7ND 3L7ZA 1R6LA 5JEAE 2BA0D 2BR2B 4BA1B 1OYSA 2PO2B 4IFDA 4OO1E 2NN6F 2BA1G 3KRNA 3H36A 2JE6A 4AIMA 5C0XF 2NN6A 2NN6C 1UDNA 1UDOA 2JEBA 2WP8A
chains in the Genus database with same CATH superfamily
4KFCA 2EZKA 1FYMA 4M1KA 1CF7B 1XSXA 1ZR4A 1VNDA 2GXBA 2VBXA 4ESFA 3J81Z 2VE8A 4H0EA 3A4CA 3P3CA 4O3MA 4MYTA 3FKJA 1POGA 1P9QC 1YO5C 4DU8A 2HS5A 2XSJC 3C1DA 3ZKDA 2VB6A 3JSPA 3LSTA 1JE8A 4Q5SF 3RI4A 1RR9A 1ZLKA 4P5OA 1BM9A 2MSYA 2IS6A 2OTJI 4JYAI 2ZMEC 3PNYA 2EFNA 1H7UA 2UUAI 1ACIA 3MVPA 4BU2A 4HOBA 1G6NA 1Z0BA 4HY1A 4GXOA 4BQQA 3DU6A 1IBKI 2UV1A 1X1DA 4YEJA 1XN7A 1AKHB 1LDJA 2CQ7A 4Z7YA 2UXDI 1IC8A 1RKTA 4XICA 1D3YA 1E2XA 1SD6A 3ONQA 1B72B 4UHTA 1O7LA 2IJLA 1RR8C 1HSJA 1TWAJ 1YW9A 4RM3A 4RB1A 4OAZA 4HV5A 2KIMA 2O5RA 3K4JA 2LC2A 3S1NJ 1BKNA 4X66E 4QPQA 2ECCA 2JEBB 4XN0A 4HF1A 3PM1A 1ON2A 3KEOA 3UKGA 3HOTA 3U9GA 3OIOA 1W5SA 4JI6E 2IOPA 2NNNA 4CYCA 4BJ6C 1I39A 4OMZA 2JJ7A 3BR1A 2V1DA 2L7KA 4XSZF 1GV2A 3BG9A 2M8EA 3CJNA 4RLFA 1IW7F 1K4SA 2HFSA 5FLXC 4A3GJ 1UELB 1ERDA 4KN7X 2HPIA 5HLHA 2ID6A 2WTEA 3LSKA 1B8IA 1W0UA 1MJ9A 1OCOH 2E5ZA 3TO9A 1R1VA 4XKWA 1D0XA 1ZAOA 4G12A 2JUGA 5KAIC 1A31A 2ZJPF 1WQ2A 4LJZF 3GLLA 2RGVA 3BDDA 3O3KA 4KIGA 1QPMA 3N97A 2FBKA 2VKEA 2X6OA 3LWFA 2L9SA 4KJZA 5BPDA 1N36I 2NAZA 2Y0MA 3GMEA 2VJIA 5FKMA 3HYIA 1JTXA 4DZPA 4MQ9F 2LSOA 2AO9A 4DZJA 4LG3A 4RBOA 1KYWA 3OYAA 1I27A 1S7AA 4HG2A 1SEUA 1Z0VA 2K7LA 3TO7A 1FJGI 2HVRA 4YELA 3MZHA 1WH5A 3GZ6A 2EQRA 4Z2YA 1IV8A 4UUTA 3OL3A 4A3MJ 1D1AA 1J59A 2WA0A 3HSEA 3OS2A 1FYKA 3A01B 1QVUA 2IRFG 3K9TA 3CCLI 3FXLA 2F5FA 5HOOA 2EIJH 1ITYA 1ZLJA 3K1MA 3RJPA 1HNXI 1FYLA 3V7CA 1I3AA 3K0LA 3KE2A 5TJJA 2CV1A 2YS9A 5DEQA 3ZGKA 2RNGA 1HBXG 2I10A 2H1LA 3QRFF 4BJTA 1Q1HA 3LSGA 3OOUA 4V19K 3CLOA 2DFHA 1UZCA 1XSDA 2KT0A 3A1YA 5L3JA 1HA8A 4CXFA 1X2NA 2K3PA 2V7FA 2R42A 3LSIA 3MCZA 4BYYA 4IF4A 1HNWI 3G1LA 4FISA 5K36D 4WX9A 4WWCA 3GFMA 1OPCA 4LF8E 3CO7C 1XMQI 2E1NA 3HUGB 2F4VE 2NVXJ 3DPUA 2HTSA 4XOPA 2EV0A 1FWZA 3EUKL 2HZDA 2KISA 4PU9A 2E71A 2LTPA 1T39A 3VYRB 4ABZA 3RZOJ 3BT9A 4UB6C 5EGOB 1YRNA 2COMA 2JK3A 3FKIJ 4IRIA 1DP3A 3MKYB 4A3FJ 3S1MJ 5FROA 4NBQA 2GQQA 2XAFA 4EVIA 1EH7A 3T1HE 2JRTA 4IHWA 4XLFA 4RAFA 4A3IJ 4JI5I 3BJOA 3K4MA 2PG4A 3V5RA 2L7ZA 1W4MA 3BG3A 3FBNB 1T95A 4CH7A 2JT1A 1H89C 5FWKA 1I1GA 3F21A 4MO7A 1JUSA 2HDWA 2E34A 4LF6E 2JUCA 2M0CA 3G2BA 2O6GE 2DA6A 5EZGA 2B0LA 1USUA 5LGTA 2ZKZA 4HSTA 2K27A 3VOEA 3BQYA 1R22A 3RKXA 2DEJA 3AFHA 2LKXA 4UV8A 3ZZTA 2RC4A 4JI3I 4FW4A 4LF9I 4L5IA 5B66C 3GLXA 5IT3A 3V42A 3QQAA 1Z0TA 5AIPA 4XRMA 2KRHA 1FMWA 1OCRH 3FXUA 3NWTA 4V2GA 4IZJB 2LY2A 3M07A 5JLXA 4XRSA 1WZ2A 2BZTA 4F3QA 2PJRB 5IWAI 3M85G 3HXLA 4UB8C 1DU0A 2MW8A 2LBFA 3OS0A 1BIAA 4G8XA 4I2OA 3K70C 1IO2A 2QUFA 3V7SA 2QENA 3W6JB 5IT9K 1XGSA 3J7AM 2RQPA 3CJTB 4B09A 2LRDA 1X2MA 2CUZA 1WSUA 3CDJA 4PUSA 2L2OA 2LG4A 5F1RA 3RSNA 1DQUA 4JI6I 1YG2A 4BJ5C 1BW6A 4FW9A 5F6FA 5GMEA 3T0YA 2KRFA 1MKMA 3KFWX 1N77A 1TNSA 4JV5I 5ICCA 4L5EA 5BNGA 4S0HB 4U3BA 3LNUA 2LNBA 4FQGA 3R0JA 1GXQA 5B1AH 2TCTA 4IFDA 2V4JC 4B43A 4KN4X 2DA4A 2VI6A 4XRSG 3MFKA 2GOMA 4Y13A 3CCQI 3PYDA 2IEKA 3SZTA 5HS8A 3I56I 3F0NA 2RNJA 4E7LA 2K3FA 4DR4I 1LB2A 3K4LA 1D8JA 5H2FC 1J0RA 1OJLA 2F5VA 2K9SA 5BQTA 3I3LA 4CCMA 5L3DA 4QLCU 2LY1A 2OTLI 1QQIA 5JHFA 3DCFA 2IPQX 1A36A 1LE8A 3HULA 2HQ5A 3RKYA 3M7NG 1YX5A 2I8DA 3FXKA 2BA0G 4KT6A 2R3VA 2NN6B 2PMUA 3L7WA 1HF0A 1EF4A 3WGGA 3RCOA 4UNOA 2AQFA 1P4AA 2DFFA 1Y1WJ 2KZGA 5FFZA 3AL0B 4OO1F 2MC3A 3H9JA 3DPLC 3HHHA 1WCMJ 5E8IA 2A6EF 2ZJ2A 4OO1A 5CVVA 4MYUA 2G0EA 2GS8A 3AG4H 1V5EA 3RKWA 1VQPI 3HRUA 3IHUA 1X4PA 3KP5A 2W84A 2PMZN 3ZR8X 5LHIA 4JI8E 2V34A 1MGTA 4KT5C 3TKYA 1JXSA 1P4XA 4KMFA 1BC7C 4J00A 4FWDA 1A35A 3CJRB 4NXME 4W1UA 5GTHC 2E7WA 3RPQA 3V4GA 4C3IJ 2ZFUA 2K4JA 2PO1B 3M1CA 1T98A 9ANTA 1S7OA 1N32E 1W7PD 2WAQA 4OIOF 3EUHC 1Z9CA 4HX4A 4B3TE 3I0TA 3KEYA 4ZJZA 2GLOA 5FD6A 1KU2A 4P7AA 4ZZDA 2W57A 3RQ4A 1QZZA 3QP6A 1HR0E 3HBLA 3W6VA 4WF2A 1SAUA 2CV0A 4JI4E 2VOPA 4HRIA 2W7NA 4KMUX 3GFIA 1Y4UA 1EV7A 4HEA2 1LQ1A 3DV8A 4DBRA 2X36A 2FE3A 5E18F 4HDVA 3HOXJ 3OYJA 4I76A 2QLZA 1G8XA 2C38A 5LMNI 1BI0A 1LFBA 2ZXJA 5M3MJ 5C44J 1RUOA 1MU5A 3OY9A 3J80Z 2NVQJ 1RUNA 2EZLA 3PNVA 4X64I 1F43A 1RI7A 4B3ME 3WHCA 1XMKA 2FA5A 1ZG1A 1JKQC 4Y17A 4A3KJ 4HX8A 1USVA 4B3SE 2HI3A 3H0GJ 2KP6A 3K1PA 4UV9A 1Z05A 3CZ6A 3N05A 2L7FP 4USMA 3F72A 2L54A 1I1SA 1X3UA 4NQWB 3LFUA 1ZELA 1D8KA 4IEJA 3CP2A 3H36A 5BS6A 1MMSA 3SHFA 1XXEA 4UUSA 4HNTA 1OYIA 5C0XF 2XROA 1YLFA 4P9UA 1U5TB 3L09A 4DPUA 2AE8A 3SFIA 3MEXA 1FP1D 3UNGC 4CGZA 4CZCA 5C0XA 4USKA 2LKPA 1UHWA 4AU7A 3FX3A 5DV5A 3T1YI 3OTOE 4DR1I 5M5WJ 2K9QA 4ENKA 2NPFA 2V6CA 1ETVA 2NVUB 2EK5A 5JEAF 1FOYA 2GIZA 3ASNH 3NZKA 3E5UA 5AONA 5K5QA 3G6EI 2WBMA 2E19A 4C3JJ 1MBGA 3K4NA 2EIKH 5JEAA 1R4NB 3CO6C 4ZDOA 3M6AA 3BR6A 2W48A 4LFBI 2EV5A 1VF9A 2XASA 2LR8A 4BE0A 5FRNA 4IFDB 2Z2SB 3JW4A 4HQEA 2BY1A 1ZM2A 5FO5A 2IS1A 2L9RA 3TMOA 2E60A 4FETA 4KICA 3CMAI 2DK5A 3MZ8A 3CC2I 3I4MJ 5D6EA 5J47A 5K36C 2HOAA 2FMYA 3Q0UA 4ZYDA 4JG4A 4I99C 2R92J 3FM3A 1V3FA 4BBSJ 1H88C 2HK2A 5LEKA 5J8FA 2M30A 1WFXA 2F4OB 1R6MA 4XLCA 1GT0C 4CCNA 1BN5A 2M87A 2CG4A 4EQQA 4MU3A 4C2TA 5J40A 2XGDA 3GZNB 2CUJA 2DMTA 1D0ZA 3FISA 1XSVA 3D5SC 2JVHA 4R8HA 2VKVA 3FMSA 2K9NA 1OR7C 1RC9A 1Y8QB 1IRXA 1MJBA 4PGHA 1H73A 2ZFWA 2F5DA 4JP0A 4BS9A 2R5YB 3H3VK 4CYDA 3BROA 4E7KA 3FXQA 1RRJA 1PKPA 1ONVA 4IHYA 1HW2A 1D6TA 1K6OA 1IRGA 2YX4A 1YX3A 3KLOA 1XCVA 4XKVA 4KYWA 1MBKA 4JI2I 4G94A 3CCVI 4DR6E 4BXFA 1KU7A 4IZKA 4FT8A 4BGDA 4IVNA 1Z5BA 3C2GA 5JFRA 2VQEI 1IBMI 3RYRA 1EA3A 3HOSA 1X1PA 1HDPA 2FU4A 3O2PE 4U7DA 4IO9F 2STWA 2BA1D 2KHMA 3VDXA 3TW6A 3IAS2 2DQLA 3J81Q 4FW3A 1ZARA 3FXMA 4LMYA 4XIDA 3WTTC 1QBJA 1ELOA 1Z5CA 3HIFA 2Z5BB 5LMUI 2O1VA 3OYLA 3OYEA 3OSFA 1VQLI 2KIQA 4XLEA 3H1CA 2OA4A 5KK1A 3OSGA 2BV3A 2L7MP 2L01A 3CUQA 3LL7A 4LPFA 2HKEA 2FQ3A 3B78A 5C4XJ 2FX0A 1SMTA 4ENMA 1ETKA 2IGOA 2CG9A 3ZM7A 1HR0I 1RNLA 2P8TA 4JI4I 1YQAA 3ZZUA 1CF7A 5LRSA 3TO6A 3JCUC 1RETA 3KP4A 4LFAE 2BOLA 4A0YA 5J3LA 3DEWA 3GTQJ 3ABLH 4EEFG 1E0EA 4BEHB 1S7EA 3S3NA 4YY3E 3G1OA 2O9LA 1Z77A 2EZIA 3VSKA 4IS9A 1Z0EA 1FKAE 3PIOF 1MMAA 2Y31A 2O1TA 3H92A 4QSHA 2R7ZJ 1B62A 2DLLA 2TDXA 2CQKA 3R60A 4I0AA 1FSEA 2WAFA 3GTKJ 1JUPA 2UXBE 4XR6A 2W25A 2JEAB 1AKHA 1QGPA 3E7LA 2ACJA 3VYUB 2A5WA 3ROUA 2W1OA 3M85D 3R61A 3WG7H 3ZMDA 3P9IA 1O57A 1SVLA 2PN6A 3D5LA 5IP7J 4XLAA 3JAMK 3ZQHA 1I6HJ 3P76A 1U6GA 2IT0A 2VQCA 4DUZI 1Y0UA 3ABTA 2EFOA 4LG0B 1KQ8A 2R3SA 3FXRA 4UUSB 3D4JA 4L9TA 4LCGA 1VISA 2YSRA 2EV6A 1B59A 2Y9ZA 3HRTA 2A61A 2PMZA 3I5UA 2QWWA 3BR5A 3OV8A 3GTLJ 2LF8A 4BUPA 4UVBA 3WGHA 2H8RA 1H72C 3EUAA 1YJ9I 2Y0SA 2HYGD 3HGYA 3W6KB 4CZZA 4OMYA 3IRRA 1R1UA 4KISA 2H09A 4MFEA 3OYFA 2HVSA 4U0VA 3NQOA 2O3ZA 3ZQGA 1GUUA 4IKFA 1R7JA 4XSXF 4N9IA 2OCEA 4A0ZA 4F93B 5E1XA 4IFDE 2HHHE 2VT3A 4K2EA 4LCFA 4PJ0C 3PQKA 4NXNE 4I01A 3C3WA 5DUIA 3HOUJ 1PYVA 5E3LA 3FXOA 3NRVA 1ZYRF 3KEQA 1JJ8C 4R1HA 1G3YA 3BR3A 2E1CA 2AXTC 5F0HA 4JI1E 3CESA 5E1WA 5LGNA 2K5CA 2B7EA 1UG2A 4EV0A 1NK3P 2Y69H 3HOZJ 5EEHA 2X7IA 4U0WA 5IPAA 1ETOA 2J5PA 5FB2A 2UXCE 4AIDA 2DOFA 3CC7I 2L02A 2XPVA 4U88A 3A01A 2KL4A 1BC8C 2OJED 2B9SA 4HF0A 1RREA 5DD4A 3K1JA 5IT9Q 2DJNA 4XKBA 4O6JA 3P3EA 1ZG5A 1IGNA 4L0ZB 3E3VA 2VKHA 1ETXA 4WCGA 1SFXA 1MMDA 4OO1E 4EMDA 2DA5A 4I09A 5JHUA 4KHPI 1QZYA 2BY3A 1R1TA 3DQVC 2A5YB 2HOEA 1JT6A 4C30A 4IHSA 1OYWA 2R7SA 4FHTA 1DARA 4LOCA 2A3SA 3VB2A 1XB4A 3PO2J 1ZRDA 5J1RA 5A2QQ 3OYHA 5CVRA 1S3JA 2XPUA 4DV6E 3KYLA 4DV1I 3OIQA 3S2DJ 1OCTC 4BKXA 4HLYA 4Y3OA 1W7PA 3SEQA 3GW2A 1S72I 1IXRC 5GP9A 3ZRGA 4M71A 5K5RA 3K85A 1IG7A 1E3OC 3DPTA 4ESBA 2FOKA 3KYCB 1S16A 4RGRA 5K36B 2AHQA 2XGEA 2XV4S 5EGOA 3T1BA 4DR3E 4I6ZA 2K86A 4DV2E 3I59B 5D5UB 4ON0A 3KP6A 5JI6A 4WUCA 4HBLA 4E7SA 3JRCA 4B1RA 1XGOA 2XAGA 3HB9A 2VQLA 3H3UA 4RB0A 2HEOA 1ETWA 4LFAI 1FP2A 5ILUA 1O3TA 3ZN0A 2P7VB 4LF7E 1WI9A 3S1RJ 3HHGA 3T8RA 3IKTA 1FX7A 2FF4A 4AUXA 1DDNA 1XDSA 2FMLA 1LNWA 2X85A 2H8WA 1T38A 4IOAF 2XF5A 4ZH4F 2GO3A 4FWHA 2MGQA 3DLLF 1SC7A 5IT9C 3WTVC 4LB5A 2C6YA 1T0FA 4IPAA 1XMOE 1A5JA 3KCCA 2WAEA 1DGWY 3OYKA 4PRVA 4IZJA 1AOYA 4B44A 4M6YA 3SDBA 3MWMA 1STZA 4NC8A 4M9XA 1NK2P 2PJRA 2JZYA 4A5NA 4AC0A 4GYGA 1MH3A 3HOWJ 2R7DA 3NAUA 3TOAA 2HKOA 2V2VA 2K40A 3H3ZA 3L00A 4IHTA 2Z16A 2L4MA 2WAQN 3T8TA 2JT2A 5DROA 2DYSH 5BR8I 1BJAA 5C0XE 4IL6C 1IN5A 2FUG2 3KZZA 4AIJA 4RDUA 2Z99A 3VODA 1JUMA 1APLC 3QP5A 2R7VA 3ZOBA 3SJMA 1D5YA 1B9MA 4LF5E 1KU3A 1OISA 4BHBA 2BHYA 3OYDA 4MEXF 4BA2B 3CF2A 3RPUD 4GKKE 4JX4A 4R1FA 4ANJA 1HNZI 1OFCX 2MLGA 1P2FA 1AA7A 4OWRB 5ERIA 1BBYA 1IRFA 3KLNA 5JEAE 1BIBA 5K5OA 1MBJA 3K2AA 4II2A 4ETSA 4MTDA 1ON1A 3JRGA 4MEYF 2IERA 2ZMEA 2PJPA 3J81K 1LUJB 1H9TA 2NN6F 4P96A 2D2WA 2UUBI 1GHCA 4DR2E 4DV0I 1R5HA 2QYOA 1USSA 2PEXA 3S2HJ 2NN6A 4Z6YA 5J6XA 1Y60A 4LIVA 4OIQF 4B48A 1Z3YA 4DV4I 5GAEJ 2X4HA 2VQGA 1MX0A 1IXSB 2G7UA 1XMAA 4RGXA 1TWCJ 2R7QA 1B4AA 4ISAA 1IXCA 1VQ7I 2DQRA 2JE6B 5KHDA 2AJ4A 4DPYA 2ZNYA 4HW0A 3CCSI 1R71A 3SYTA 1FBSA 4A0XA 1MD0A 2OUMA 1J5EE 5GAGJ 3CJQB 4FWGA 2VLAA 1JHFA 2E5LE 5TGTA 1FIAA 5E3OA 4ESJA 3S14J 3ABUA 5H6QA 2XB0X 1SFUA 4HAMA 4B3RI 3LOCA 4JBAA 2ZJQF 2MYSA 3M8EA 4A6DA 1RZ4A 2CJJA 4DV5E 2LJPA 4LFUA 3FZVA 1Y1VJ 1X4OA 1RKWA 1BR2A 3TQNA 1ENHA 1T8IA 1MJAA 1TWGJ 2DPDA 4XKCA 2IS4A 2PO1A 5EYRA 3MN2A 2J65A 2FNAA 2DI3A 2OD5A 5CVIA 3FMRA 3WGIA 4GFBA 2E1MC 1PUEE 1Z59A 4DV6I 2I5UA 2DT7B 3MQ0A 2V9PA 3A03A 3QAHA 5DS9A 1XNQE 3WE2A 4D7NA 4DOZA 1MBEA 1HC8A 2NVYJ 2KRCA 1GVDA 1W7PB 3IWFA 5J1UA 2JN6A 5H20A 2DOAA 1TLHB 1QHGA 2PNMA 3BZKA 4ZYAA 1B1BA 1TZLA 1ZM9A 4MIMA 5CJ9A 2ESHA 4DR3I 4E6KG 4HYEA 4RAYA 4DPXA 1OCPA 1Z3XA 4DV2I 4N9HA 1WGXA 3LMMA 3A02A 1BI1A 5FLMJ 4WUBA 1OMIA 2DJIA 2ZM6E 5ICEA 4LK1F 5F64A 1VFCA 2DEIA 3KP2A 3Q0WA 4V2FA 1J5YA 1FI4A 3WTZA 1R23A 2QZ8A 1YW8A 4LF7I 2YUSA 5E1ZB 1JTYA 3KZYA 2R5ZB 1BA5A 3KPHA 4GKJE 2C39A 3BCBA 3COAC 4OAYA 4XN3A 3F6OA 3OL4A 2IA0A 1ETQA 3QPHA 2HOSA 4NQWA 1P92A 4PSXA 3PSFA 4YIFA 3PIPF 4P9FA 1XMOI 1UHSA 3K4KA 5F1JA 1N36E 2VT2A 5LLQA 1FZPB 2UXNA 1U5TA 4UT4A 3ZMTA 4BA1B 4ITVA 3J7YJ 3QT5A 1I5ZA 1OYSA 3FIWA 3PUFA 2PI0A 2ECBA 4HYMA 5FLXZ 1KZHA 2HGCA 1HSTA 4PK4A 2LD5A 4RLQA 2OU2A 3WHBA 4X66I 4BHCA 4PJLA 1WKMA 1BR1A 2VC1A 4WK8F 2R7XA 4QWQA 4NC7A 4MU4A 1MBFA 1IN7A 2Q1ZB 4EATA 2EFPA 4M74A 3BZ6A 2F2EA 4GGGA 3O8GA 1UDQA 2KJBA 1W5CC 2QM3A 3PQJA 3S93A 4G7ZF 1H8AC 2VL8A 5GADJ 4RPFA 4IFDF 2GO4A 2GZWA 3B4TA 3AG2H 2OQRA 5KAFC 1VI0A 2M4KA 5GMDA 4DR7E 5A2QK 5DCFA 4AQYE 3DEEA 3R0AA 1F9NA 2DMUA 4DBQA 3ASOH 1F1ZA 2OZ6A 1VQ6I 3HSRA 4EMSA 2CQQA 3B6AA 2V6EA 3P9KA 4FN5A 1HW1A 2Y48A 1N75A 2QSHX 2ZMEB 4JX6A 3PL8A 2DOEA 1RESA 5CYVA 1YHCA 6PAXA 4DR2I 5L3GA 3OR1C 3LQRA 4PJJA 4EGZA 4KNYA 5BOXA 2CW8A 1P6RA 3I55I 3JAMQ 5E3NA 1U0JA 2M2EA 4YRVA 3F9KA 1K4TA 3ZQ7A 3L9FA 1JJ6C 1R4MB 2R5YA 2Z5UA 2N8GA 4DYCA 2IGKA 3BP8A 2LH9A 3ULQB 3L2QA 2HQAA 3U1YA 2CV2A 1J5EI 1X3WB 5JVTA 1CQTA 1PP7U 1ZGAA 2IGNA 2RKHA 3GBGA 2IA1A 2Q2EB 2O1WA 3AAFA 1B6AA 3QOEA 5LD2C 1XNRE 3KZIC 4AVPA 4BQNA 2ME0A 2LF7A 4DV5I 5K7FA 1K47A 2VIXA 2Y0SN 4L9NA 2FBIA 2V9KA 4RM2A 1LPQA 1NTCA 3HPHA 1ZGWA 4L18B 2Z5BA 2BV6A 4EM1A 1FTTA 4BXUA 1TW3A 2F4IA 3DEUA 3S8PA 5CQGA 4PGGA 5FFXA 1AHDP 4GO1A 4BACA 4AIHA 2OAZA 1ZR2A 2VESA 4D5FA 3G3ZA 4FASD 3HGGA 1R5ID 2DA1A 1IV6A 1MNMC 2LOOA 2X6YA 4I98B 3H35A 3X2QH 3HOVJ 3GTOJ 3CWVA 4LF8I 3GUDA 3O8HA 2F4VI 2LFBA 1JHHA 1N25A 1Y39A 1MDMB 1VQKI 3M8FA 2JA5J 2RN7A 4X0GA 4IXAA 3K2ZA 2GM4A 2CW7A 2MG4A 4MGRA 4UVCA 4EGYA 4P1WA 4BEHA 1VQOI 5IP6A 4BY1J 3WTSC 2ZXIA 5LGUA 3CMMA 1REPC 2WWYA 2A07F 2ZM6I 3TBIA 4DR5E 2VBZA 3CCRI 3T1HI 2EJRA 4A3BJ 1LVKA 4BE1A 5TRDA 3DBRB 2E2HJ 2R7TA 2UUCE 4ASNA 3GTGJ 3SZPA 2BY0A 2WY7Q 2E1RA 2JEAA 2VQFE 4ZVIA 4D1QA 5DCMB 2OBPA 4LF6I 4L9JA 5DDGA 1PP8F 4BBRJ 3ISPA 2QQ8A 2ZSIB 2C39B 2WP8B 3S1QJ 2BW3B 2WV0A 4LGWA 1RR7A 3Q9SA 1OCZH 2P6SA 4HPQA 2M8GX 4E7ZA 1MG7A 1Z5AA 4LG0A 3FHZA 1XHKA 4H4KC 3EUHA 2NS0A 4JI0E 2HPMA 2E1MB 2MABA 4W97A 3I53A 1KGSA 4M6VA 1QHHD 5HVQC 1ZM4A 4FX0A 2QVOA 5DNXA 3L2CA 1X1BA 2JRMA 4DPWA 3HKMA 1F5TA 4HQMA 3OYNA 3PYEA 2V26A 1K78B 4I02A 3MMYB 4YFKF 2G7HA 4RAGA 5HS7A 4LITA 1U78A 3MKWB 2CRGA 2XEXA 2WY8Q 2VF3A 1BOAA 1NHIA 3CDIA 4U0YA 2ME6A 2VKDA 2DT5A 2JA8J 4L9VA 3TGNA 4RB2C 4DR7I 1IF1A 2BVLA 3KP3A 2IXSA 3K1NA 3GONA 1NHJA 5FJ8J 2NXNB 4LLNA 2ID3A 2A6HF 3B02A 2IBDA 3P06A 5FLVA 3FF5A 2XHKA 4DPTA 4DV7E 1I3QJ 3QU6A 3J80K 1X58A 3LSJA 1FC3A 4DU7A 2VQHA 1Z1DA 4B3TI 1Z0WA 2J5OA 5D5XB 1WJEA 2NN6E 3GYHX 5L3EA 3DU5A 5LRRA 3HZJA 2X48A 2ZXHA 3ABKH 1KTVA 2KPMA 1DUXC 2ZO4A 3RYPA 5E3MA 1G3SA 1W1WE 5M3FJ 4X1EA 2M7BA 2EA4A 2VJJA 1X19A 2DDAA 2QEXI 1LDDA 3M3YJ 2DDBA 3RDIA 1H0MA 2DTRA 3EETA 2V1UA 1LEBA 2A6TA 2GXGA 2QKLB 3CUQC 5L3FA 3L7ZA 1KA8A 4EM2A 4FTHA 1OLTA 3TL4X 1FTZA 2PFBA 5EF6A 4FE7A 1LFPA 3CCEI 2PO2B 3BTJA 2KKOA 2NOJB 1HOMA 2CS3A 3CF5F 4HXZA 4Y7NJ 3JRIA 4JI8I 1FLIA 4OX9E 4B4CA 1XNRI 2X51A 3NWSA 2R93J 4CCLA 4DGWB 3V2UC 5J4YA 3SEZA 1UDOA 1U9OA 4XL9A 4NXMI 4HA8A 1YYVA 2QBYB 5HODA 3ERED 3KYDB 2ESNA 5K7HA 5K36A 4LLLA 1ZREA 5HLTA 1N32I 3LA2A 2DA2A 3I59A 4DYRA 4BAYA 2DFEA 4XLHA 3GFLA 1ZM3A 1Y8RB 2XB5A 4HNUA 2V1XA 3DXJF 4NC6A 2UZKA 5DRRA 4YIIA 4BL0B 2XSDC 1FNNA 2HYFA 2XKPA 3K69A 3W2WA 4WXDA 3K17A 1MSEC 1OR7A 1V4RA 1NHAA 5D8KB 1Q1VA 5IYDJ 4KA4A 3EDPA 5JVGF 2P5LC 1FOWA 2KQRA 3OR2C 3HTSB 2JA2A 1OKRA 3B6CA 4NB5A 2HYJA 4A3EJ 2WC2A 1TWHJ 4E7IA 4DR5I 2XAUA 3GXOA 1PUFB 5D5WB 2X9DA 2VN2A 3F8NA 3F8BA 4ZYHA 4X62E 3H0DA 4X65E 4R79A 4B3MI 1T6SA 1P4WA 3ECOA 5F0FA 1I6XA 1U2WA 4AWXB 3L2UA 2VQFI 1DPRA 1QZEA 4PCQA 4RGUA 1IJWC 3P3GA 2IESA 4HACA 3BR0A 3ZPLA 4XORA 4B3SI 5CQEA 3C18A 3EQLF 3PRYA 4DNCA 1N0VC 4UXNA 2CGPA 2BR2A 2FOWA 5H6RA 4HLXA 2K9MA 1J75A 2K4BA 3P9CA 2D1VA 2X6WA 3CC4I 2XPWA 2WNRB 4JYAE 1XPXA 1WJ5A 1E17A 2UUAE 1S8NA 3LAPA 4M9SA 4MNUA 2BM0A 3HL2A 2HFUA 3FWEA 1HCRA 3PFYA 4BE2A 1O3RA 3VWBA 3A0BC 3ZCOA 3ZP5A 1S4EA 1XDUA 3J81C 1J7KA 2UXDE 1A6QA 4BA2A 1R36A 1LFUP 1TW2A 5J1YA 2VPLA 3LPSA 3A0HC 2PNZB 4M3BA 4NHJA 3WTYC 3LSPA 1Y56A 2D45A 3OTOI 3Q1QA 2L0KA 3HC7A 4D5CA 1S29A 2JTVA 2L9VA 3GWZA 1ZQ3P 5IP9J 2ISZA 4B8XA 1IAWA 1NHHA 2O8KA 2CU7A 3LA7A 3ZQLA 2DODA 1EH8A 3A2KA 1K61A 1Y6ZA 2L4AA 4RMNA 2GIVA 5IY5H 5ICFA 3M7ND 2BA0D 5ELWA 5DD8A 2DU9A 1KKHA 4NNJA 1Z0CA 2DBBA 1WJBA 1VI7A 4HDUA 4URLA 1MSFC 3R4KA 4DV7I 2P7CB 2BE5F 2K02A 3SXYA 3RKQA 2JE6A 4AIMA 3J7AG 1LKXA 1XCBA 2RAEA 3ZMUA 1UDNA 3Q9VA 2IP2A 4A12A 2E2IJ 3ZMVA 1GLNA 5B3SH 1Z21A 3WTUC 3ZQCA 2OCCH 4FE4A 2VODA 3WU4A 1PJRA 1OQYA 1N0UA 4G7OF 1RIOH 3UHMA 2DK8A 3DBLB 3E6MA 4C9YA 1WHUA 4WUDA 1MMNA 1XMXA 1XGNA 4KITB 3HRMA 4OKGA 2XRNA 1E3PA 3S3MA 5DNLA 3D1NI 1SFEA 2EB7A 1ZG3A 2RVCA 5LHHA 2HZTA 1TT0A 1G3TA 3KETA 3IH4A 1Y4SA 2H6CA 3ERMA 3QOPA 4BQOA 3WU3A 1MW7A 2HU9A 1E3HA 1S5LC 3L7ZB 3G73A 2P81A 5F08A 1G2HA 1KYZA 4HZFA 2FRHA 4M9ZA 2Z5EA 3M8JA 1KQ9A 1V55H 3WU0A 1LJ9A 3VEPA 5E79C 4FW7A 4UUVA 3JREA 5B5EC 4DR6I 3JRBA 3JRDA 5HDKA 3IH2A 2JA6J 1O3QA 1HNXE 4II3A 1KQ0A 4AD9A 3B82A 1YIJI 3F8CA 3OIPA 4YIRX 1VQ5I 4OO1D 4E7JA 4XLPF 2ZNZA 4PZJA 4M3FA 2D5VA 2LVSA 4MU1A 3CLQA 1IDZA 2E5NA 1GV5A 4PFOA 2H27A 1J9IA 4HF2A 2O8XA 4IRHA 3HJEA 4IQ4A 1FJLA 3I4PA 3TEDA 3LSMA 4CCJA 1TP4A 4YG2F 2ELJA 3T5XA 1QNTA 3QT6A 1K6YA 3K4BA 2HNHA 3QU3A 1YHQI 1HNWE 3BG5A 5IYBJ 1CGPA 2V2QA 2MH9A 4JX5A 4C2MJ 5DRQA 2FQ4A 3ELKA 5FKOA 4PJNA 2R5ZA 4JK1X 1WJAA 1QPIA 3ZKBA 4DW6A 5IOYA 4YY3I 2FNPA 4J19A 2JPBA 1YFHA 3QPTA 1YIOA 1VQ9I 1YW7A 1R5GA 2AQEA 5LFAA 4Y52J 2ISYA 3PS1A 2Y30A 2M34A 2XDVA 4G6QA 3IRQA 2JSPA 1JI8A 5HNFA 5KNLA 2XF7A 2P4WA 4X62I 4PJMA 4X65I 1U8RA 2KJCA 3WE3A 1DGRM 4GDFA 1RHYA 2UXBI 4BA1A 1GDTA 2OC6A 4JI5E 1PVEA 4CA0A 2DN0A 4BNCA 1D0YA 4HACB 3BG6A 2HXIA 4XTJA 4FW5A 1YJWI 3E0JB 2BR2B 5A2QC 2BHZA 4ED4A 3J7ZI 4JI3E 2QKMB 3HSFA 4LF9E 2BGCA 2EZHA 1V5FA 2EWNA 1HW5A 3IH3A 1FSHA 3FHNA 5JR3A 2KDOA 1OYYA 3V7RA 2NVTJ 3HTUA 2W85A 2NN6C 2CYYA 3DBHB 4M72A 3KX2A 1XC5A 2E36A 1VQ4I 2X1EA 2EINH 1W36D 4BY7J 4KDPA 1EI1A 5IWAE 1JGSA 4Y33A 3ZQFA 2ZB9A 3H5NA 4G6TB 3AL0C 3BTIA 1FWKA 1Z0GA 1ZXMA 5DM6F 2XUBA 3EYYA 4GQUA 4FX4A 5D8LB 5C0XD 2DYRH 3CDLA 4G9YA 1FMVA 3BG7A 5FKLA 3F6VA 2PNLA 2HHHI 3TDUC 2JMWA 2XRLA 1R00A 4G7HF 2ZBKB 3B73A 2WADA 2CW0F 2DA3A 2C37B 3D5RC 5LBQA 1UEKA 4NXNI 2DT6A 3HOYJ 5BMZA 3VPRA 4JV5E 3DKYA 3OWTA 2IVMA 2DA7A 2PBIA 1IDYA 1T33A 4UVAA 1BR4A 1HXDA 1QO0D 2IS2A 4JI1I 5JEAD 1YH8A 2F6CA 1UG0A 2X6XA 2Y75A 4ZZLA 3OS1A 3G71I 1B63A 4DR4E 2UXCI 3ZN1A 3M4OJ 2L9NA 4HSRA 1UHMA 4JQFA 4ZTJA 3V8KA 4Q48A 3E6BA 1OYRA 2XAJA 2K85A 2D1HA 2Q2EA 3BR2A 4I7HA 3JTHA 3IC7A 1HQCA 3GZ5A 3HDDA 3DD6A 1Z7UA 2M7AA 3F0CA 2MD0A 2R7OA 5EEAA 4ENNA 1OJ4A 4A3JJ 3W2VA 1JKPC 2LLKA 3BPXA 3SQNA 5LHGA 1IN6A 3QPLA 4KUMA 1ZGJA 2IAIA 2GXAA 1KONA 2OV7A 2EIMH 3OOPA 1GXPA 3E5QA 3BLYA 4Q47A 3F22A 4WXCA 3EYIA 2CO5A 2GAUA 5EG0B 4YHHE 3J80Q 5K36E 1MDMA 2VPRA 2CSOA 3Q0VA 2A2DA 2HQRA 2IA2A 3K10A 3R6SA 4M73A 5HLGA 1P7IA 5CVUA 3FXJA 1WRJA 2DO7A 3IWZA 1BL0A 1YOVB 1SMYF 2H1KA 3U1DA 3QPSA 3JSOA 4AYBN 5F27A 2BBYA 2JSCA 2NS7A 2PMHA 1F4KA 2DW4A 5IT9Z 1A6IA 1U5TC 4LFCE 1FEXA 3ZMSA 3Q3SA 1PDNC 3RIRA 2BA1G 2GQ0A 2KIUA 1P7JA 1XTAA 3AG3H 5GAHJ 3I71A 2H94A 2EH3A 4U87A 5ICGA 1OCCH 2LYCA 4L0YB 1XX5A 2KIFA 2KFDA 2L3DA 3MZYA 2LKSA 2MC4A 2GA1A 5DCMA 4IZZA 1IBLE 4CDGA 1J2XA 2WP8A 2BW3A 2VOOA 3QYBA 3PFIA 5A2QZ 4DJAA 4LK0F 5K7ZA 2M0MA 5L3BA 2Z5CA 3E1SA 2GBYA 1IRZA 5LMNE 4MQYA 4NUBA 1Y6IA 4Y15A 3GF2A 1MBHA 4MU0A 2M45A 4F52A 4B3AA 4LLGF 4X64E 4QTRA 4IHXA 2HXOA 4XBFA 2BYVE 2FD5A 3GTPJ 2BVMA 1SFKA 4IFDC 2RDPA 3RZDJ 4AVZA 4YFNF 3FBIB 3G1MA 3D0SA 3OMYA 4L5JA 3C7JA 1VTNC 3S3OA 4M3GA 2R7FA 4LIUA 1K78A 2X1DA 3ZQQA 1Z67A 3F23A 1D1CA 1N33E 1D5VA 2EFWA 3GFJA 4OU0A 2V9VA 2QSGX 4A69C 1H7SA 3SZGA 5KCMA 3J80C 3OYBA 1TWFJ 1UCRA 3FK6A 2XVCA 3U21A 5L3CA 2AS5F 2UWMA 4LF5I 4XOTA 3FK7A 1TBXA 1R9TJ 3EPZA 3HPGA 1VZ0A 4RS8A 3BPVA 1UMQA 4XLNF 2BEOA 4FW6A 1BW5A 3UR3C 3FDYA 4GKKI 2M4GA 5BPIA 3TOBA 4XMYA 3T1YE 2KLOA 1WUUA 1ULYA 5EL9A 4DR1E 2Q8KA 1Y5YA 3PS3A 1BOBA 5DYMA 2KZVA 3RQIA 1V54H 4XQFA 1N34E 4OO1C 5FD5A 1WVRA 5HNHA 4CYCB 3OYGA 3QYFA 2MBFA 4P55A 2XGXA 3JTGA 3W2AA 3FMQA 1G59A 2O1UA 1MNDA 3PUBA 5D5VB 4E4HA 3CCMI 1ZKGA 2HK3A 1KU9A 1T56A 4QNJA 2ADUA 4LFBE 1MIJA 3HKZN 1IUYA 4X6AJ 3M1EA 4CCOA 2NRAC 3ZZ0A 1B8IB 1QU3A 3H5RA 4KIBA 4ZTFA 2FBHA 1YE9A 4YFXF 3JR9A 2BXZA 1H9GA 2J7KA 1Y0NA 1ZN2A 2XKOA 1TT5B 1O3SA 3HRSA 5FLXK 3WTXC 1SAXA 3Q6MA 2UXXA 3GEZA 2A69F 3F3XA 3OYMA 4DUYE 3U2RA 2GA2A 2PO2A 3H4LA 2E5LI 1RPWA 1FIPA 1WJFA 3DWLE 3IV5A 3K4CA 2P6TA 1ORKA 2LP0A 2MFZA 2QF7A 2R7UA 2HKJA 1YTYA 1P42A 5KVRA 1SD4A 3TW7A 1DP7P 1NH3A 2EFGA 2YU3A 4A3LJ 3PS2A 3KIOA 2NYXA 3I54A 5FGMA 4DV3E 1SD5A 1WJCA 2VBWA 3QT8A 2WV1A 1TC3C 1UB9A 4LD5A 2HKXA 3BJAA 2OI2A 2QBYA 3BCAA 1YI2I 1TQIA 5LL6R 4OOIA 2WB1N 2VXDA 3E6DA 2V79A 3MKZA 1IZ1A 2CUFA 1Z6TA 4CO8A 2DMNA 1SFOJ 2HR3A 2QQBA 2OF7A 1KVKA 2DFIA 1R6LA 1S9HA 4RAZA 2HTJA 2BY2A 4JI2E 1WI3A 3OYCA 4OZEA 3LFKA 4DQ2A 1BI3A 4HV6A 4TV7A 2RV8A 2XIGA 5FKNA 1XNQI 1ZK8A 3O6BB 4YHHI 2MA3A 3VSLA 1IBME 2HDCA 2VQEE 3WU5A 1FY7A 2NOGA 1G3WA 2Z3YA 2GOXB 3BTLA 2PO0A 4UTGA 1VQ8I 1K7AA 3BZCA 2VUMJ 2R7RA 5EDNA 3V8JA 5LMUE 2ETHA 3LQQA 1S6LA 2F4MB 3HEFA 1L0OC 3IUOA 3M7GA 4BDZA 1W36C 3PYFA 4P52A 1USTA 2E7XA 2RREA 4FCYA 2DMPA 3CUOA 4JYKA 5E8GA 3JAMC 4LFCI 1PUFA 1IN4A 1FOXA 3F8FA 2JVGA 5C0XC 2FXAA 2ZC2A 3PSIA 2JWTA 2W00A 3IP4B 4E70A 3G4SI 3VYTB 1JGGA 1IBLI 4GKJI 2R4GA 4I0BA 1QVTA 5E17F 1BI2A 2E35A 3I58A 3MD2A 4RB3C 2A05A 2LMDA 4C3HJ 1YRNB 4D9JA 1T08B 4XRFA 2M1BA 2WNRA 1J09A 2Z5CB 5F0CA 2COBA 3DKWA 4D0PA 3DKXA 5JEAC 2V1NA 1U9NA 5LEJA 5FKKA 2RQQA 3S2WA 1ZH5A 3SFZA 2OPTA 1YJNI 4F92B 1I94E 1HKSA 4KIFA 3PO3J 4IQJA 1A04A 4DIQA 4ZDPA 4IJAA 2CVEA 2UU9E 5EZHA 2PNZA 1HDDC 2O3FA 2ZSHB 2XAQA 4BQAA 1WWXA 1LDKB 5C4JJ 4IZJD 3LA3A 5M5YJ 1AWCA 1N33I 2FEZA 3H9GA 5HS9A 4LOMA 4DUZE 1LEAA 3DFGA 2LDUA 2VJ4A 3RPUA 1DPUA 5FRMA 5M5XJ 1V5GA 4GRIA 4ZC3A 5D4SA 1FWLA 1TNTA 2Z33A 2CMPA 4G6DA 3TP3A 2XAHA 3WODF 1TTYA 2HVQA 2QSFX 4M3EA 1YITI 2W4SA 5ILSA 2KDZA 2X0LA 2HWVA 2JPCA 2YPRA 3MKLA 4K0KE 3BJ6A 4AQYI 4AIKA 3IL2A 2LBFB 1C0WA 1G4DA 1WPKA 2QQAA 4HX7A 4IOCF 2Z9OA 3I9V2 2O61A 2EPFA 1H74A 3OYIA 1JKRC 1ETYA 5IOZA 2BM1A 3C2BA 5ED4A 2FJ1A 2F48A 4WXHA 1N34I 4N3OA 2O03A 4IRGA 1XG1A 4CUGA 3CTAA 2QQ9A 3P5JA 4OIRF 2CUEA 3JRHA 4LF4E 2ZJRF 4AYBA 4F55A 2W24A 1TQPA 2DTZA 2CQNA 3BQZA 2VASA 3C2HA 3S32A 1UAAA 1SVOA 4OINF 2X1CA 2NS8A 4F91B 2ELKA 1JKOC 1YS7A 4HNVA 3LAJA 3K6GA 4JI7E 2NN6D 1K79A 3GO5A 1U2RA 3PYGA 1EKEA 5AIQA 5DTDA 3CCJI 3NARA 3LSRA 1LE8B 4DUYI 5GPAA 2QGUA 3QYEA 4J3DA 2JA7J 1M1EB 2LK2A 5EJCA 2W82A 4N4OB 4EJTA 4E7HA 4DV3I 2P5KA 2UUZA 3E97A 5HDNA 1K83J 4BXXJ 3DTIA 1WH7A 2HFHA 1AU7A 5K36F 2DAOA 4S04A 1I50J 1R6RA 2M3AA 3AG1H 4MTEA 1Z0XA 3ABMH 3GTJJ 2ICWG 2M9HA 1EA6A 3S16J 1PVGA 4KHPE 4A93J 4UY8I 2FSWA 3DP7A 1ZTRA 4OO1B 3GTMJ 2XGCA 2MD5A 4GCVA 3JAMZ 3Q5FA 2F5CA 5E20A 3CDHA 4U3DA 3F8MA 4DXLA 1UJ8A 3TDZC 3U1KA 4DV1E 2CGEA 3CP8A 3QODA 4KQVA 1TQMA 3BOQA 1SANA 4ZDLA 3J7AO 3RTRA 3S17J 4ZYGA 5DUKA 1FT9A 2Z1DA 4XK4A 2LY9A 3ZQIA 3KP7A 5CKTA 5F04A 2IOQA 2CQXA 3DLAA 2PO0B 3ZMZA 5K1YA 3L2VA 3M9AA 4QPOA 2VBYA 4B47A 2KMUA 4M6XA 4DYQA 3N4MA 1UFMA 3LTOA 1Z6RA 1EJ9A 2WW4A 3WU1B 2EBIA 4I3HA 1NG6A 1FBUA 1FNMA 2E1OA 2PX9A 2XF6A 1N78A 1Z7LA 2VONA 1R49A 1R58A 2YX7A 5GTIC 3GVAA 4PFPA 2HDDA 4XONA 4Z7CA 2MLKA 2UUCI 3MAJA 2CFOA 1ZHFA 3GCMA 2A68F 2ELHA 3I4NJ 1U8BA 4N4NB 3VFZA 3BC8A 5CPRB 3PJRA 3HKZA 2G9WA 1QZRA 1QA6A 1X1AA 2H6BA 5C3EJ 1MH4A 2C38B 1B9NA 2IW5A 2DCEA 2P5VA 4O5VA 1XGMA 4RGSA 4Y4RA 5EEGA 5TISC 4CCKA 3I64A 2HOTA 5HLIA 4JI0I 1DU6A 4MDTA 2VC0A 4ENJA 1I94I 1FOKA 1IBKE 3J7AY 3HM5A 3CQZJ 1B72A 3KRNA 5HDGA 4BH9A 4QNKA 2UU9I 3CCUI 1FPQA 4MQVA 3CMYA 1XS9A 3CCYA 2OQGA 3CMEI 4ZYEA 2B63J 1ZRCA 2JEBA 2VJ5A 3ECHA 4C2UA 1HKTA 3IAM2 4M3DA 4GYIA 1F36A 2WB1A 5BR8E 5D6FA 2YR2A 3LSHA 3L1PA 2ZCWA 3DTEA 3DF8A 2ZBKA 4A3DJ 2ZITA 4F7ZA 2NNYA 4PRXA 2ZXWH 3IKVA 2C37A 2BXYA 2XC7A 3ZXSA 3W3CA 2QA4I 2PLYA 4K0KI 4LCHA 5C0XB 1U3EM 2LREA 1A6FA 4AM3A 2O0YA 4PSWA 2DXIA 4EJUA 2R0QC 3B8HA 1FBQA 1WJDA 5J8CA 3LNQA 2JQ7A 4A6EA 3AKZA 1ZXNA 1HNZE 1OYPA 4XM3A 5B1BH 3HG9A 3HJCA 2TRTA 2EFQA 4XNFA 4BDYA 2QCOA 5CVJA 4IX7A 1W5TA 5J4VA 2F5EA 2DMQA 4LF4I 3QWLA 4IFDD 1Z91A 2UUBE 3WG9A 5JEAB 1O4XA 1IUFA 5DM7F 3REOA 1ZRFA 2OZUA 4DV0E 4U7BA 3E6CC 3S15J 1IN8A 1MNEA 2O7OA 4MFDA 2E2JJ 5JLWA 4EJVA 1MMGA 4DV4E 2Y2ZA 1EH6A 3FM5A 4CSWA 2MH2A 4JI7I 5D4RA 4J01A 2AXLA 3K7AJ 3DTKA 4JOMA 3BY6A 2STTA 3H9QA 1MZBA 3H5AA 2CH0A 3ML6A 1HKQA 5ILVA 2A2CA 4MLOA 4A2UA 1FJGE 3VYSB 2K9LA 3ESWB 4NDLA 1JT0A 2CWEA 3WU6A 1LVAA 2CZ9A 4OX9I 3K70D 1NG7A 2EA2A 1D1BA 2VXZA 4PDKA 4LB6B 4IHVA 2Y9YA 1HK7A 5EG0A 4B3RE 4EJOA 3L2WA 2P0WA 1TL8A 2HQNA 2IGMA 5CLSA 2GWRA 1VQNI 1X1CA 4Q4ZF 2V2ZA 2V8PA 4CICA 2L5QA 3E5XA 2PQ8A 5GPCA 1T2KA 1UDSA 3SDGA 1QRYA 1VQMI 4MHGA 3JRAA 5IYCJ 1NZ0A 2R7WA 1KIJA 1T0FC 4S05A 3NEUA 3WU2C 1ODDA 2F1DA 4IZKB 2CFXA 4OIPF 4A3CJ 4B3XA 4D7MA 3BTCA 3JRFA 4EM0B 4A5MA 3HUGA 3BWGA 1XMQE 5DRPA 1X3ZB 3QT7A 4RA2A 4BHPA 3WTWC 5FLXQ 1HLVA 3TP0A 1GVJA 1O7FA 1W0TA 3V8LA 2VE9A 3PNTA 4N0BA 2Q0OA 1SD7A 5EKWA 3CD6I 2DPUA 3CUQB 1SVMA 1XD7A 4CHUA 2EILH 4QIWN 3L2RA 1YS6A 3GX4X 2YU9J 1BJZA 2M5WA 1L3LA 3P7NA 3Q6NA 1PIEA 4EJWA
chains in the Genus database with same CATH topology
5C0XA 3M7NG 2JEAA 2BA0G 5K36A 1UDQA 2JE6B 2NN6D 2NN6B 1WHUA 4IFDF 3B4TA 2C37A 2C39B 2WP8B 1E3PA 2PO0A 5JEAF 5C0XD 5C0XB 2JEAB 4AM3A 5K36D 4IFDC 5K36B 4OO1F 5JEAA 3M85D 1E3HA 1OYPA 2C37B 3L7ZB 4OO1A 5K36F 4IFDD 4IFDB 5C0XC 3HKMA 5JEAD 5JEAB 5K36C 2PO1A 4NBQA 4OO1B 4OO1D 2JEBB 1R6MA 3U1KA 1OYRA 2WNRA 3CDIA 2PO1B 5JEAC 2BR2A 2PO0B 4OO1C 3DD6A 2WNRB 4IFDE 2PNZA 2NN6E 4BA2A 3M85G 3GLLA 2C38A 2PNZB 5C0XE 1UDSA 3GCMA 2BA1D 5K36E 2C39A 3GMEA 4AIDA 3CDJA 4BA1A 4BA2B 2PO2A 2C38B 3H1CA 3M7ND 3L7ZA 1R6LA 5JEAE 2BA0D 2BR2B 4BA1B 1OYSA 2PO2B 4IFDA 4OO1E 2NN6F 2BA1G 3KRNA 3H36A 2JE6A 4AIMA 5C0XF 2NN6A 2NN6C 1UDNA 1UDOA 2JEBA 2WP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X A;  3M7N G;  2JEA A;  2BA0 G;  5K36 A;  1UDQ A;  2JE6 B;  2NN6 D;  2NN6 B;  1WHU A;  4IFD F;  3B4T A;  2C37 A;  2C39 B;  2WP8 B;  1E3P A;  2PO0 A;  5JEA F;  5C0X D;  5C0X B;  2JEA B;  4AM3 A;  5K36 D;  4IFD C;  5K36 B;  4OO1 F;  5JEA A;  3M85 D;  1E3H A;  1OYP A;  2C37 B;  3L7Z B;  4OO1 A;  5K36 F;  4IFD D;  4IFD B;  5C0X C;  3HKM A;  5JEA D;  5JEA B;  5K36 C;  2PO1 A;  4NBQ A;  4OO1 B;  4OO1 D;  2JEB B;  1R6M A;  3U1K A;  1OYR A;  2WNR A;  3CDI A;  2PO1 B;  5JEA C;  2BR2 A;  2PO0 B;  4OO1 C;  3DD6 A;  2WNR B;  4IFD E;  2PNZ A;  2NN6 E;  4BA2 A;  3M85 G;  3GLL A;  2C38 A;  2PNZ B;  5C0X E;  1UDS A;  3GCM A;  2BA1 D;  5K36 E;  2C39 A;  3GME A;  4AID A;  3CDJ A;  4BA1 A;  4BA2 B;  2PO2 A;  2C38 B;  3H1C A;  3M7N D;  3L7Z A;  1R6L A;  5JEA E;  2BA0 D;  2BR2 B;  4BA1 B;  1OYS A;  2PO2 B;  4IFD A;  4OO1 E;  2NN6 F;  2BA1 G;  3KRN A;  3H36 A;  2JE6 A;  4AIM A;  5C0X F;  2NN6 A;  2NN6 C;  1UDN A;  1UDO A;  2JEB A;  2WP8 A; 
#chains in the Genus database with same CATH topology
 4KFC A;  2EZK A;  1FYM A;  4M1K A;  1CF7 B;  1XSX A;  1ZR4 A;  1VND A;  2GXB A;  2VBX A;  4ESF A;  3J81 Z;  2VE8 A;  4H0E A;  3A4C A;  3P3C A;  4O3M A;  4MYT A;  3FKJ A;  1POG A;  1P9Q C;  1YO5 C;  4DU8 A;  2HS5 A;  2XSJ C;  3C1D A;  3ZKD A;  2VB6 A;  3JSP A;  3LST A;  1JE8 A;  4Q5S F;  3RI4 A;  1RR9 A;  1ZLK A;  4P5O A;  1BM9 A;  2MSY A;  2IS6 A;  2OTJ I;  4JYA I;  2ZME C;  3PNY A;  2EFN A;  1H7U A;  2UUA I;  1ACI A;  3MVP A;  4BU2 A;  4HOB A;  1G6N A;  1Z0B A;  4HY1 A;  4GXO A;  4BQQ A;  3DU6 A;  1IBK I;  2UV1 A;  1X1D A;  4YEJ A;  1XN7 A;  1AKH B;  1LDJ A;  2CQ7 A;  4Z7Y A;  2UXD I;  1IC8 A;  1RKT A;  4XIC A;  1D3Y A;  1E2X A;  1SD6 A;  3ONQ A;  1B72 B;  4UHT A;  1O7L A;  2IJL A;  1RR8 C;  1HSJ A;  1TWA J;  1YW9 A;  4RM3 A;  4RB1 A;  4OAZ A;  4HV5 A;  2KIM A;  2O5R A;  3K4J A;  2LC2 A;  3S1N J;  1BKN A;  4X66 E;  4QPQ A;  2ECC A;  2JEB B;  4XN0 A;  4HF1 A;  3PM1 A;  1ON2 A;  3KEO A;  3UKG A;  3HOT A;  3U9G A;  3OIO A;  1W5S A;  4JI6 E;  2IOP A;  2NNN A;  4CYC A;  4BJ6 C;  1I39 A;  4OMZ A;  2JJ7 A;  3BR1 A;  2V1D A;  2L7K A;  4XSZ F;  1GV2 A;  3BG9 A;  2M8E A;  3CJN A;  4RLF A;  1IW7 F;  1K4S A;  2HFS A;  5FLX C;  4A3G J;  1UEL B;  1ERD A;  4KN7 X;  2HPI A;  5HLH A;  2ID6 A;  2WTE A;  3LSK A;  1B8I A;  1W0U A;  1MJ9 A;  1OCO H;  2E5Z A;  3TO9 A;  1R1V A;  4XKW A;  1D0X A;  1ZAO A;  4G12 A;  2JUG A;  5KAI C;  1A31 A;  2ZJP F;  1WQ2 A;  4LJZ F;  3GLL A;  2RGV A;  3BDD A;  3O3K A;  4KIG A;  1QPM A;  3N97 A;  2FBK A;  2VKE A;  2X6O A;  3LWF A;  2L9S A;  4KJZ A;  5BPD A;  1N36 I;  2NAZ A;  2Y0M A;  3GME A;  2VJI A;  5FKM A;  3HYI A;  1JTX A;  4DZP A;  4MQ9 F;  2LSO A;  2AO9 A;  4DZJ A;  4LG3 A;  4RBO A;  1KYW A;  3OYA A;  1I27 A;  1S7A A;  4HG2 A;  1SEU A;  1Z0V A;  2K7L A;  3TO7 A;  1FJG I;  2HVR A;  4YEL A;  3MZH A;  1WH5 A;  3GZ6 A;  2EQR A;  4Z2Y A;  1IV8 A;  4UUT A;  3OL3 A;  4A3M J;  1D1A A;  1J59 A;  2WA0 A;  3HSE A;  3OS2 A;  1FYK A;  3A01 B;  1QVU A;  2IRF G;  3K9T A;  3CCL I;  3FXL A;  2F5F A;  5HOO A;  2EIJ H;  1ITY A;  1ZLJ A;  3K1M A;  3RJP A;  1HNX I;  1FYL A;  3V7C A;  1I3A A;  3K0L A;  3KE2 A;  5TJJ A;  2CV1 A;  2YS9 A;  5DEQ A;  3ZGK A;  2RNG A;  1HBX G;  2I10 A;  2H1L A;  3QRF F;  4BJT A;  1Q1H A;  3LSG A;  3OOU A;  4V19 K;  3CLO A;  2DFH A;  1UZC A;  1XSD A;  2KT0 A;  3A1Y A;  5L3J A;  1HA8 A;  4CXF A;  1X2N A;  2K3P A;  2V7F A;  2R42 A;  3LSI A;  3MCZ A;  4BYY A;  4IF4 A;  1HNW I;  3G1L A;  4FIS A;  5K36 D;  4WX9 A;  4WWC A;  3GFM A;  1OPC A;  4LF8 E;  3CO7 C;  1XMQ I;  2E1N A;  3HUG B;  2F4V E;  2NVX J;  3DPU A;  2HTS A;  4XOP A;  2EV0 A;  1FWZ A;  3EUK L;  2HZD A;  2KIS A;  4PU9 A;  2E71 A;  2LTP A;  1T39 A;  3VYR B;  4ABZ A;  3RZO J;  3BT9 A;  4UB6 C;  5EGO B;  1YRN A;  2COM A;  2JK3 A;  3FKI J;  4IRI A;  1DP3 A;  3MKY B;  4A3F J;  3S1M J;  5FRO A;  4NBQ A;  2GQQ A;  2XAF A;  4EVI A;  1EH7 A;  3T1H E;  2JRT A;  4IHW A;  4XLF A;  4RAF A;  4A3I J;  4JI5 I;  3BJO A;  3K4M A;  2PG4 A;  3V5R A;  2L7Z A;  1W4M A;  3BG3 A;  3FBN B;  1T95 A;  4CH7 A;  2JT1 A;  1H89 C;  5FWK A;  1I1G A;  3F21 A;  4MO7 A;  1JUS A;  2HDW A;  2E34 A;  4LF6 E;  2JUC A;  2M0C A;  3G2B A;  2O6G E;  2DA6 A;  5EZG A;  2B0L A;  1USU A;  5LGT A;  2ZKZ A;  4HST A;  2K27 A;  3VOE A;  3BQY A;  1R22 A;  3RKX A;  2DEJ A;  3AFH A;  2LKX A;  4UV8 A;  3ZZT A;  2RC4 A;  4JI3 I;  4FW4 A;  4LF9 I;  4L5I A;  5B66 C;  3GLX A;  5IT3 A;  3V42 A;  3QQA A;  1Z0T A;  5AIP A;  4XRM A;  2KRH A;  1FMW A;  1OCR H;  3FXU A;  3NWT A;  4V2G A;  4IZJ B;  2LY2 A;  3M07 A;  5JLX A;  4XRS A;  1WZ2 A;  2BZT A;  4F3Q A;  2PJR B;  5IWA I;  3M85 G;  3HXL A;  4UB8 C;  1DU0 A;  2MW8 A;  2LBF A;  3OS0 A;  1BIA A;  4G8X A;  4I2O A;  3K70 C;  1IO2 A;  2QUF A;  3V7S A;  2QEN A;  3W6J B;  5IT9 K;  1XGS A;  3J7A M;  2RQP A;  3CJT B;  4B09 A;  2LRD A;  1X2M A;  2CUZ A;  1WSU A;  3CDJ A;  4PUS A;  2L2O A;  2LG4 A;  5F1R A;  3RSN A;  1DQU A;  4JI6 I;  1YG2 A;  4BJ5 C;  1BW6 A;  4FW9 A;  5F6F A;  5GME A;  3T0Y A;  2KRF A;  1MKM A;  3KFW X;  1N77 A;  1TNS A;  4JV5 I;  5ICC A;  4L5E A;  5BNG A;  4S0H B;  4U3B A;  3LNU A;  2LNB A;  4FQG A;  3R0J A;  1GXQ A;  5B1A H;  2TCT A;  4IFD A;  2V4J C;  4B43 A;  4KN4 X;  2DA4 A;  2VI6 A;  4XRS G;  3MFK A;  2GOM A;  4Y13 A;  3CCQ I;  3PYD A;  2IEK A;  3SZT A;  5HS8 A;  3I56 I;  3F0N A;  2RNJ A;  4E7L A;  2K3F A;  4DR4 I;  1LB2 A;  3K4L A;  1D8J A;  5H2F C;  1J0R A;  1OJL A;  2F5V A;  2K9S A;  5BQT A;  3I3L A;  4CCM A;  5L3D A;  4QLC U;  2LY1 A;  2OTL I;  1QQI A;  5JHF A;  3DCF A;  2IPQ X;  1A36 A;  1LE8 A;  3HUL A;  2HQ5 A;  3RKY A;  3M7N G;  1YX5 A;  2I8D A;  3FXK A;  2BA0 G;  4KT6 A;  2R3V A;  2NN6 B;  2PMU A;  3L7W A;  1HF0 A;  1EF4 A;  3WGG A;  3RCO A;  4UNO A;  2AQF A;  1P4A A;  2DFF A;  1Y1W J;  2KZG A;  5FFZ A;  3AL0 B;  4OO1 F;  2MC3 A;  3H9J A;  3DPL C;  3HHH A;  1WCM J;  5E8I A;  2A6E F;  2ZJ2 A;  4OO1 A;  5CVV A;  4MYU A;  2G0E A;  2GS8 A;  3AG4 H;  1V5E A;  3RKW A;  1VQP I;  3HRU A;  3IHU A;  1X4P A;  3KP5 A;  2W84 A;  2PMZ N;  3ZR8 X;  5LHI A;  4JI8 E;  2V34 A;  1MGT A;  4KT5 C;  3TKY A;  1JXS A;  1P4X A;  4KMF A;  1BC7 C;  4J00 A;  4FWD A;  1A35 A;  3CJR B;  4NXM E;  4W1U A;  5GTH C;  2E7W A;  3RPQ A;  3V4G A;  4C3I J;  2ZFU A;  2K4J A;  2PO1 B;  3M1C A;  1T98 A;  9ANT A;  1S7O A;  1N32 E;  1W7P D;  2WAQ A;  4OIO F;  3EUH C;  1Z9C A;  4HX4 A;  4B3T E;  3I0T A;  3KEY A;  4ZJZ A;  2GLO A;  5FD6 A;  1KU2 A;  4P7A A;  4ZZD A;  2W57 A;  3RQ4 A;  1QZZ A;  3QP6 A;  1HR0 E;  3HBL A;  3W6V A;  4WF2 A;  1SAU A;  2CV0 A;  4JI4 E;  2VOP A;  4HRI A;  2W7N A;  4KMU X;  3GFI A;  1Y4U A;  1EV7 A;  4HEA 2;  1LQ1 A;  3DV8 A;  4DBR A;  2X36 A;  2FE3 A;  5E18 F;  4HDV A;  3HOX J;  3OYJ A;  4I76 A;  2QLZ A;  1G8X A;  2C38 A;  5LMN I;  1BI0 A;  1LFB A;  2ZXJ A;  5M3M J;  5C44 J;  1RUO A;  1MU5 A;  3OY9 A;  3J80 Z;  2NVQ J;  1RUN A;  2EZL A;  3PNV A;  4X64 I;  1F43 A;  1RI7 A;  4B3M E;  3WHC A;  1XMK A;  2FA5 A;  1ZG1 A;  1JKQ C;  4Y17 A;  4A3K J;  4HX8 A;  1USV A;  4B3S E;  2HI3 A;  3H0G J;  2KP6 A;  3K1P A;  4UV9 A;  1Z05 A;  3CZ6 A;  3N05 A;  2L7F P;  4USM A;  3F72 A;  2L54 A;  1I1S A;  1X3U A;  4NQW B;  3LFU A;  1ZEL A;  1D8K A;  4IEJ A;  3CP2 A;  3H36 A;  5BS6 A;  1MMS A;  3SHF A;  1XXE A;  4UUS A;  4HNT A;  1OYI A;  5C0X F;  2XRO A;  1YLF A;  4P9U A;  1U5T B;  3L09 A;  4DPU A;  2AE8 A;  3SFI A;  3MEX A;  1FP1 D;  3UNG C;  4CGZ A;  4CZC A;  5C0X A;  4USK A;  2LKP A;  1UHW A;  4AU7 A;  3FX3 A;  5DV5 A;  3T1Y I;  3OTO E;  4DR1 I;  5M5W J;  2K9Q A;  4ENK A;  2NPF A;  2V6C A;  1ETV A;  2NVU B;  2EK5 A;  5JEA F;  1FOY A;  2GIZ A;  3ASN H;  3NZK A;  3E5U A;  5AON A;  5K5Q A;  3G6E I;  2WBM A;  2E19 A;  4C3J J;  1MBG A;  3K4N A;  2EIK H;  5JEA A;  1R4N B;  3CO6 C;  4ZDO A;  3M6A A;  3BR6 A;  2W48 A;  4LFB I;  2EV5 A;  1VF9 A;  2XAS A;  2LR8 A;  4BE0 A;  5FRN A;  4IFD B;  2Z2S B;  3JW4 A;  4HQE A;  2BY1 A;  1ZM2 A;  5FO5 A;  2IS1 A;  2L9R A;  3TMO A;  2E60 A;  4FET A;  4KIC A;  3CMA I;  2DK5 A;  3MZ8 A;  3CC2 I;  3I4M J;  5D6E A;  5J47 A;  5K36 C;  2HOA A;  2FMY A;  3Q0U A;  4ZYD A;  4JG4 A;  4I99 C;  2R92 J;  3FM3 A;  1V3F A;  4BBS J;  1H88 C;  2HK2 A;  5LEK A;  5J8F A;  2M30 A;  1WFX A;  2F4O B;  1R6M A;  4XLC A;  1GT0 C;  4CCN A;  1BN5 A;  2M87 A;  2CG4 A;  4EQQ A;  4MU3 A;  4C2T A;  5J40 A;  2XGD A;  3GZN B;  2CUJ A;  2DMT A;  1D0Z A;  3FIS A;  1XSV A;  3D5S C;  2JVH A;  4R8H A;  2VKV A;  3FMS A;  2K9N A;  1OR7 C;  1RC9 A;  1Y8Q B;  1IRX A;  1MJB A;  4PGH A;  1H73 A;  2ZFW A;  2F5D A;  4JP0 A;  4BS9 A;  2R5Y B;  3H3V K;  4CYD A;  3BRO A;  4E7K A;  3FXQ A;  1RRJ A;  1PKP A;  1ONV A;  4IHY A;  1HW2 A;  1D6T A;  1K6O A;  1IRG A;  2YX4 A;  1YX3 A;  3KLO A;  1XCV A;  4XKV A;  4KYW A;  1MBK A;  4JI2 I;  4G94 A;  3CCV I;  4DR6 E;  4BXF A;  1KU7 A;  4IZK A;  4FT8 A;  4BGD A;  4IVN A;  1Z5B A;  3C2G A;  5JFR A;  2VQE I;  1IBM I;  3RYR A;  1EA3 A;  3HOS A;  1X1P A;  1HDP A;  2FU4 A;  3O2P E;  4U7D A;  4IO9 F;  2STW A;  2BA1 D;  2KHM A;  3VDX A;  3TW6 A;  3IAS 2;  2DQL A;  3J81 Q;  4FW3 A;  1ZAR A;  3FXM A;  4LMY A;  4XID A;  3WTT C;  1QBJ A;  1ELO A;  1Z5C A;  3HIF A;  2Z5B B;  5LMU I;  2O1V A;  3OYL A;  3OYE A;  3OSF A;  1VQL I;  2KIQ A;  4XLE A;  3H1C A;  2OA4 A;  5KK1 A;  3OSG A;  2BV3 A;  2L7M P;  2L01 A;  3CUQ A;  3LL7 A;  4LPF A;  2HKE A;  2FQ3 A;  3B78 A;  5C4X J;  2FX0 A;  1SMT A;  4ENM A;  1ETK A;  2IGO A;  2CG9 A;  3ZM7 A;  1HR0 I;  1RNL A;  2P8T A;  4JI4 I;  1YQA A;  3ZZU A;  1CF7 A;  5LRS A;  3TO6 A;  3JCU C;  1RET A;  3KP4 A;  4LFA E;  2BOL A;  4A0Y A;  5J3L A;  3DEW A;  3GTQ J;  3ABL H;  4EEF G;  1E0E A;  4BEH B;  1S7E A;  3S3N A;  4YY3 E;  3G1O A;  2O9L A;  1Z77 A;  2EZI A;  3VSK A;  4IS9 A;  1Z0E A;  1FKA E;  3PIO F;  1MMA A;  2Y31 A;  2O1T A;  3H92 A;  4QSH A;  2R7Z J;  1B62 A;  2DLL A;  2TDX A;  2CQK A;  3R60 A;  4I0A A;  1FSE A;  2WAF A;  3GTK J;  1JUP A;  2UXB E;  4XR6 A;  2W25 A;  2JEA B;  1AKH A;  1QGP A;  3E7L A;  2ACJ A;  3VYU B;  2A5W A;  3ROU A;  2W1O A;  3M85 D;  3R61 A;  3WG7 H;  3ZMD A;  3P9I A;  1O57 A;  1SVL A;  2PN6 A;  3D5L A;  5IP7 J;  4XLA A;  3JAM K;  3ZQH A;  1I6H J;  3P76 A;  1U6G A;  2IT0 A;  2VQC A;  4DUZ I;  1Y0U A;  3ABT A;  2EFO A;  4LG0 B;  1KQ8 A;  2R3S A;  3FXR A;  4UUS B;  3D4J A;  4L9T A;  4LCG A;  1VIS A;  2YSR A;  2EV6 A;  1B59 A;  2Y9Z A;  3HRT A;  2A61 A;  2PMZ A;  3I5U A;  2QWW A;  3BR5 A;  3OV8 A;  3GTL J;  2LF8 A;  4BUP A;  4UVB A;  3WGH A;  2H8R A;  1H72 C;  3EUA A;  1YJ9 I;  2Y0S A;  2HYG D;  3HGY A;  3W6K B;  4CZZ A;  4OMY A;  3IRR A;  1R1U A;  4KIS A;  2H09 A;  4MFE A;  3OYF A;  2HVS A;  4U0V A;  3NQO A;  2O3Z A;  3ZQG A;  1GUU A;  4IKF A;  1R7J A;  4XSX F;  4N9I A;  2OCE A;  4A0Z A;  4F93 B;  5E1X A;  4IFD E;  2HHH E;  2VT3 A;  4K2E A;  4LCF A;  4PJ0 C;  3PQK A;  4NXN E;  4I01 A;  3C3W A;  5DUI A;  3HOU J;  1PYV A;  5E3L A;  3FXO A;  3NRV A;  1ZYR F;  3KEQ A;  1JJ8 C;  4R1H A;  1G3Y A;  3BR3 A;  2E1C A;  2AXT C;  5F0H A;  4JI1 E;  3CES A;  5E1W A;  5LGN A;  2K5C A;  2B7E A;  1UG2 A;  4EV0 A;  1NK3 P;  2Y69 H;  3HOZ J;  5EEH A;  2X7I A;  4U0W A;  5IPA A;  1ETO A;  2J5P A;  5FB2 A;  2UXC E;  4AID A;  2DOF A;  3CC7 I;  2L02 A;  2XPV A;  4U88 A;  3A01 A;  2KL4 A;  1BC8 C;  2OJE D;  2B9S A;  4HF0 A;  1RRE A;  5DD4 A;  3K1J A;  5IT9 Q;  2DJN A;  4XKB A;  4O6J A;  3P3E A;  1ZG5 A;  1IGN A;  4L0Z B;  3E3V A;  2VKH A;  1ETX A;  4WCG A;  1SFX A;  1MMD A;  4OO1 E;  4EMD A;  2DA5 A;  4I09 A;  5JHU A;  4KHP I;  1QZY A;  2BY3 A;  1R1T A;  3DQV C;  2A5Y B;  2HOE A;  1JT6 A;  4C30 A;  4IHS A;  1OYW A;  2R7S A;  4FHT A;  1DAR A;  4LOC A;  2A3S A;  3VB2 A;  1XB4 A;  3PO2 J;  1ZRD A;  5J1R A;  5A2Q Q;  3OYH A;  5CVR A;  1S3J A;  2XPU A;  4DV6 E;  3KYL A;  4DV1 I;  3OIQ A;  3S2D J;  1OCT C;  4BKX A;  4HLY A;  4Y3O A;  1W7P A;  3SEQ A;  3GW2 A;  1S72 I;  1IXR C;  5GP9 A;  3ZRG A;  4M71 A;  5K5R A;  3K85 A;  1IG7 A;  1E3O C;  3DPT A;  4ESB A;  2FOK A;  3KYC B;  1S16 A;  4RGR A;  5K36 B;  2AHQ A;  2XGE A;  2XV4 S;  5EGO A;  3T1B A;  4DR3 E;  4I6Z A;  2K86 A;  4DV2 E;  3I59 B;  5D5U B;  4ON0 A;  3KP6 A;  5JI6 A;  4WUC A;  4HBL A;  4E7S A;  3JRC A;  4B1R A;  1XGO A;  2XAG A;  3HB9 A;  2VQL A;  3H3U A;  4RB0 A;  2HEO A;  1ETW A;  4LFA I;  1FP2 A;  5ILU A;  1O3T A;  3ZN0 A;  2P7V B;  4LF7 E;  1WI9 A;  3S1R J;  3HHG A;  3T8R A;  3IKT A;  1FX7 A;  2FF4 A;  4AUX A;  1DDN A;  1XDS A;  2FML A;  1LNW A;  2X85 A;  2H8W A;  1T38 A;  4IOA F;  2XF5 A;  4ZH4 F;  2GO3 A;  4FWH A;  2MGQ A;  3DLL F;  1SC7 A;  5IT9 C;  3WTV C;  4LB5 A;  2C6Y A;  1T0F A;  4IPA A;  1XMO E;  1A5J A;  3KCC A;  2WAE A;  1DGW Y;  3OYK A;  4PRV A;  4IZJ A;  1AOY A;  4B44 A;  4M6Y A;  3SDB A;  3MWM A;  1STZ A;  4NC8 A;  4M9X A;  1NK2 P;  2PJR A;  2JZY A;  4A5N A;  4AC0 A;  4GYG A;  1MH3 A;  3HOW J;  2R7D A;  3NAU A;  3TOA A;  2HKO A;  2V2V A;  2K40 A;  3H3Z A;  3L00 A;  4IHT A;  2Z16 A;  2L4M A;  2WAQ N;  3T8T A;  2JT2 A;  5DRO A;  2DYS H;  5BR8 I;  1BJA A;  5C0X E;  4IL6 C;  1IN5 A;  2FUG 2;  3KZZ A;  4AIJ A;  4RDU A;  2Z99 A;  3VOD A;  1JUM A;  1APL C;  3QP5 A;  2R7V A;  3ZOB A;  3SJM A;  1D5Y A;  1B9M A;  4LF5 E;  1KU3 A;  1OIS A;  4BHB A;  2BHY A;  3OYD A;  4MEX F;  4BA2 B;  3CF2 A;  3RPU D;  4GKK E;  4JX4 A;  4R1F A;  4ANJ A;  1HNZ I;  1OFC X;  2MLG A;  1P2F A;  1AA7 A;  4OWR B;  5ERI A;  1BBY A;  1IRF A;  3KLN A;  5JEA E;  1BIB A;  5K5O A;  1MBJ A;  3K2A A;  4II2 A;  4ETS A;  4MTD A;  1ON1 A;  3JRG A;  4MEY F;  2IER A;  2ZME A;  2PJP A;  3J81 K;  1LUJ B;  1H9T A;  2NN6 F;  4P96 A;  2D2W A;  2UUB I;  1GHC A;  4DR2 E;  4DV0 I;  1R5H A;  2QYO A;  1USS A;  2PEX A;  3S2H J;  2NN6 A;  4Z6Y A;  5J6X A;  1Y60 A;  4LIV A;  4OIQ F;  4B48 A;  1Z3Y A;  4DV4 I;  5GAE J;  2X4H A;  2VQG A;  1MX0 A;  1IXS B;  2G7U A;  1XMA A;  4RGX A;  1TWC J;  2R7Q A;  1B4A A;  4ISA A;  1IXC A;  1VQ7 I;  2DQR A;  2JE6 B;  5KHD A;  2AJ4 A;  4DPY A;  2ZNY A;  4HW0 A;  3CCS I;  1R71 A;  3SYT A;  1FBS A;  4A0X A;  1MD0 A;  2OUM A;  1J5E E;  5GAG J;  3CJQ B;  4FWG A;  2VLA A;  1JHF A;  2E5L E;  5TGT A;  1FIA A;  5E3O A;  4ESJ A;  3S14 J;  3ABU A;  5H6Q A;  2XB0 X;  1SFU A;  4HAM A;  4B3R I;  3LOC A;  4JBA A;  2ZJQ F;  2MYS A;  3M8E A;  4A6D A;  1RZ4 A;  2CJJ A;  4DV5 E;  2LJP A;  4LFU A;  3FZV A;  1Y1V J;  1X4O A;  1RKW A;  1BR2 A;  3TQN A;  1ENH A;  1T8I A;  1MJA A;  1TWG J;  2DPD A;  4XKC A;  2IS4 A;  2PO1 A;  5EYR A;  3MN2 A;  2J65 A;  2FNA A;  2DI3 A;  2OD5 A;  5CVI A;  3FMR A;  3WGI A;  4GFB A;  2E1M C;  1PUE E;  1Z59 A;  4DV6 I;  2I5U A;  2DT7 B;  3MQ0 A;  2V9P A;  3A03 A;  3QAH A;  5DS9 A;  1XNQ E;  3WE2 A;  4D7N A;  4DOZ A;  1MBE A;  1HC8 A;  2NVY J;  2KRC A;  1GVD A;  1W7P B;  3IWF A;  5J1U A;  2JN6 A;  5H20 A;  2DOA A;  1TLH B;  1QHG A;  2PNM A;  3BZK A;  4ZYA A;  1B1B A;  1TZL A;  1ZM9 A;  4MIM A;  5CJ9 A;  2ESH A;  4DR3 I;  4E6K G;  4HYE A;  4RAY A;  4DPX A;  1OCP A;  1Z3X A;  4DV2 I;  4N9H A;  1WGX A;  3LMM A;  3A02 A;  1BI1 A;  5FLM J;  4WUB A;  1OMI A;  2DJI A;  2ZM6 E;  5ICE A;  4LK1 F;  5F64 A;  1VFC A;  2DEI A;  3KP2 A;  3Q0W A;  4V2F A;  1J5Y A;  1FI4 A;  3WTZ A;  1R23 A;  2QZ8 A;  1YW8 A;  4LF7 I;  2YUS A;  5E1Z B;  1JTY A;  3KZY A;  2R5Z B;  1BA5 A;  3KPH A;  4GKJ E;  2C39 A;  3BCB A;  3COA C;  4OAY A;  4XN3 A;  3F6O A;  3OL4 A;  2IA0 A;  1ETQ A;  3QPH A;  2HOS A;  4NQW A;  1P92 A;  4PSX A;  3PSF A;  4YIF A;  3PIP F;  4P9F A;  1XMO I;  1UHS A;  3K4K A;  5F1J A;  1N36 E;  2VT2 A;  5LLQ A;  1FZP B;  2UXN A;  1U5T A;  4UT4 A;  3ZMT A;  4BA1 B;  4ITV A;  3J7Y J;  3QT5 A;  1I5Z A;  1OYS A;  3FIW A;  3PUF A;  2PI0 A;  2ECB A;  4HYM A;  5FLX Z;  1KZH A;  2HGC A;  1HST A;  4PK4 A;  2LD5 A;  4RLQ A;  2OU2 A;  3WHB A;  4X66 I;  4BHC A;  4PJL A;  1WKM A;  1BR1 A;  2VC1 A;  4WK8 F;  2R7X A;  4QWQ A;  4NC7 A;  4MU4 A;  1MBF A;  1IN7 A;  2Q1Z B;  4EAT A;  2EFP A;  4M74 A;  3BZ6 A;  2F2E A;  4GGG A;  3O8G A;  1UDQ A;  2KJB A;  1W5C C;  2QM3 A;  3PQJ A;  3S93 A;  4G7Z F;  1H8A C;  2VL8 A;  5GAD J;  4RPF A;  4IFD F;  2GO4 A;  2GZW A;  3B4T A;  3AG2 H;  2OQR A;  5KAF C;  1VI0 A;  2M4K A;  5GMD A;  4DR7 E;  5A2Q K;  5DCF A;  4AQY E;  3DEE A;  3R0A A;  1F9N A;  2DMU A;  4DBQ A;  3ASO H;  1F1Z A;  2OZ6 A;  1VQ6 I;  3HSR A;  4EMS A;  2CQQ A;  3B6A A;  2V6E A;  3P9K A;  4FN5 A;  1HW1 A;  2Y48 A;  1N75 A;  2QSH X;  2ZME B;  4JX6 A;  3PL8 A;  2DOE A;  1RES A;  5CYV A;  1YHC A;  6PAX A;  4DR2 I;  5L3G A;  3OR1 C;  3LQR A;  4PJJ A;  4EGZ A;  4KNY A;  5BOX A;  2CW8 A;  1P6R A;  3I55 I;  3JAM Q;  5E3N A;  1U0J A;  2M2E A;  4YRV A;  3F9K A;  1K4T A;  3ZQ7 A;  3L9F A;  1JJ6 C;  1R4M B;  2R5Y A;  2Z5U A;  2N8G A;  4DYC A;  2IGK A;  3BP8 A;  2LH9 A;  3ULQ B;  3L2Q A;  2HQA A;  3U1Y A;  2CV2 A;  1J5E I;  1X3W B;  5JVT A;  1CQT A;  1PP7 U;  1ZGA A;  2IGN A;  2RKH A;  3GBG A;  2IA1 A;  2Q2E B;  2O1W A;  3AAF A;  1B6A A;  3QOE A;  5LD2 C;  1XNR E;  3KZI C;  4AVP A;  4BQN A;  2ME0 A;  2LF7 A;  4DV5 I;  5K7F A;  1K47 A;  2VIX A;  2Y0S N;  4L9N A;  2FBI A;  2V9K A;  4RM2 A;  1LPQ A;  1NTC A;  3HPH A;  1ZGW A;  4L18 B;  2Z5B A;  2BV6 A;  4EM1 A;  1FTT A;  4BXU A;  1TW3 A;  2F4I A;  3DEU A;  3S8P A;  5CQG A;  4PGG A;  5FFX A;  1AHD P;  4GO1 A;  4BAC A;  4AIH A;  2OAZ A;  1ZR2 A;  2VES A;  4D5F A;  3G3Z A;  4FAS D;  3HGG A;  1R5I D;  2DA1 A;  1IV6 A;  1MNM C;  2LOO A;  2X6Y A;  4I98 B;  3H35 A;  3X2Q H;  3HOV J;  3GTO J;  3CWV A;  4LF8 I;  3GUD A;  3O8H A;  2F4V I;  2LFB A;  1JHH A;  1N25 A;  1Y39 A;  1MDM B;  1VQK I;  3M8F A;  2JA5 J;  2RN7 A;  4X0G A;  4IXA A;  3K2Z A;  2GM4 A;  2CW7 A;  2MG4 A;  4MGR A;  4UVC A;  4EGY A;  4P1W A;  4BEH A;  1VQO I;  5IP6 A;  4BY1 J;  3WTS C;  2ZXI A;  5LGU A;  3CMM A;  1REP C;  2WWY A;  2A07 F;  2ZM6 I;  3TBI A;  4DR5 E;  2VBZ A;  3CCR I;  3T1H I;  2EJR A;  4A3B J;  1LVK A;  4BE1 A;  5TRD A;  3DBR B;  2E2H J;  2R7T A;  2UUC E;  4ASN A;  3GTG J;  3SZP A;  2BY0 A;  2WY7 Q;  2E1R A;  2JEA A;  2VQF E;  4ZVI A;  4D1Q A;  5DCM B;  2OBP A;  4LF6 I;  4L9J A;  5DDG A;  1PP8 F;  4BBR J;  3ISP A;  2QQ8 A;  2ZSI B;  2C39 B;  2WP8 B;  3S1Q J;  2BW3 B;  2WV0 A;  4LGW A;  1RR7 A;  3Q9S A;  1OCZ H;  2P6S A;  4HPQ A;  2M8G X;  4E7Z A;  1MG7 A;  1Z5A A;  4LG0 A;  3FHZ A;  1XHK A;  4H4K C;  3EUH A;  2NS0 A;  4JI0 E;  2HPM A;  2E1M B;  2MAB A;  4W97 A;  3I53 A;  1KGS A;  4M6V A;  1QHH D;  5HVQ C;  1ZM4 A;  4FX0 A;  2QVO A;  5DNX A;  3L2C A;  1X1B A;  2JRM A;  4DPW A;  3HKM A;  1F5T A;  4HQM A;  3OYN A;  3PYE A;  2V26 A;  1K78 B;  4I02 A;  3MMY B;  4YFK F;  2G7H A;  4RAG A;  5HS7 A;  4LIT A;  1U78 A;  3MKW B;  2CRG A;  2XEX A;  2WY8 Q;  2VF3 A;  1BOA A;  1NHI A;  3CDI A;  4U0Y A;  2ME6 A;  2VKD A;  2DT5 A;  2JA8 J;  4L9V A;  3TGN A;  4RB2 C;  4DR7 I;  1IF1 A;  2BVL A;  3KP3 A;  2IXS A;  3K1N A;  3GON A;  1NHJ A;  5FJ8 J;  2NXN B;  4LLN A;  2ID3 A;  2A6H F;  3B02 A;  2IBD A;  3P06 A;  5FLV A;  3FF5 A;  2XHK A;  4DPT A;  4DV7 E;  1I3Q J;  3QU6 A;  3J80 K;  1X58 A;  3LSJ A;  1FC3 A;  4DU7 A;  2VQH A;  1Z1D A;  4B3T I;  1Z0W A;  2J5O A;  5D5X B;  1WJE A;  2NN6 E;  3GYH X;  5L3E A;  3DU5 A;  5LRR A;  3HZJ A;  2X48 A;  2ZXH A;  3ABK H;  1KTV A;  2KPM A;  1DUX C;  2ZO4 A;  3RYP A;  5E3M A;  1G3S A;  1W1W E;  5M3F J;  4X1E A;  2M7B A;  2EA4 A;  2VJJ A;  1X19 A;  2DDA A;  2QEX I;  1LDD A;  3M3Y J;  2DDB A;  3RDI A;  1H0M A;  2DTR A;  3EET A;  2V1U A;  1LEB A;  2A6T A;  2GXG A;  2QKL B;  3CUQ C;  5L3F A;  3L7Z A;  1KA8 A;  4EM2 A;  4FTH A;  1OLT A;  3TL4 X;  1FTZ A;  2PFB A;  5EF6 A;  4FE7 A;  1LFP A;  3CCE I;  2PO2 B;  3BTJ A;  2KKO A;  2NOJ B;  1HOM A;  2CS3 A;  3CF5 F;  4HXZ A;  4Y7N J;  3JRI A;  4JI8 I;  1FLI A;  4OX9 E;  4B4C A;  1XNR I;  2X51 A;  3NWS A;  2R93 J;  4CCL A;  4DGW B;  3V2U C;  5J4Y A;  3SEZ A;  1UDO A;  1U9O A;  4XL9 A;  4NXM I;  4HA8 A;  1YYV A;  2QBY B;  5HOD A;  3ERE D;  3KYD B;  2ESN A;  5K7H A;  5K36 A;  4LLL A;  1ZRE A;  5HLT A;  1N32 I;  3LA2 A;  2DA2 A;  3I59 A;  4DYR A;  4BAY A;  2DFE A;  4XLH A;  3GFL A;  1ZM3 A;  1Y8R B;  2XB5 A;  4HNU A;  2V1X A;  3DXJ F;  4NC6 A;  2UZK A;  5DRR A;  4YII A;  4BL0 B;  2XSD C;  1FNN A;  2HYF A;  2XKP A;  3K69 A;  3W2W A;  4WXD A;  3K17 A;  1MSE C;  1OR7 A;  1V4R A;  1NHA A;  5D8K B;  1Q1V A;  5IYD J;  4KA4 A;  3EDP A;  5JVG F;  2P5L C;  1FOW A;  2KQR A;  3OR2 C;  3HTS B;  2JA2 A;  1OKR A;  3B6C A;  4NB5 A;  2HYJ A;  4A3E J;  2WC2 A;  1TWH J;  4E7I A;  4DR5 I;  2XAU A;  3GXO A;  1PUF B;  5D5W B;  2X9D A;  2VN2 A;  3F8N A;  3F8B A;  4ZYH A;  4X62 E;  3H0D A;  4X65 E;  4R79 A;  4B3M I;  1T6S A;  1P4W A;  3ECO A;  5F0F A;  1I6X A;  1U2W A;  4AWX B;  3L2U A;  2VQF I;  1DPR A;  1QZE A;  4PCQ A;  4RGU A;  1IJW C;  3P3G A;  2IES A;  4HAC A;  3BR0 A;  3ZPL A;  4XOR A;  4B3S I;  5CQE A;  3C18 A;  3EQL F;  3PRY A;  4DNC A;  1N0V C;  4UXN A;  2CGP A;  2BR2 A;  2FOW A;  5H6R A;  4HLX A;  2K9M A;  1J75 A;  2K4B A;  3P9C A;  2D1V A;  2X6W A;  3CC4 I;  2XPW A;  2WNR B;  4JYA E;  1XPX A;  1WJ5 A;  1E17 A;  2UUA E;  1S8N A;  3LAP A;  4M9S A;  4MNU A;  2BM0 A;  3HL2 A;  2HFU A;  3FWE A;  1HCR A;  3PFY A;  4BE2 A;  1O3R A;  3VWB A;  3A0B C;  3ZCO A;  3ZP5 A;  1S4E A;  1XDU A;  3J81 C;  1J7K A;  2UXD E;  1A6Q A;  4BA2 A;  1R36 A;  1LFU P;  1TW2 A;  5J1Y A;  2VPL A;  3LPS A;  3A0H C;  2PNZ B;  4M3B A;  4NHJ A;  3WTY C;  3LSP A;  1Y56 A;  2D45 A;  3OTO I;  3Q1Q A;  2L0K A;  3HC7 A;  4D5C A;  1S29 A;  2JTV A;  2L9V A;  3GWZ A;  1ZQ3 P;  5IP9 J;  2ISZ A;  4B8X A;  1IAW A;  1NHH A;  2O8K A;  2CU7 A;  3LA7 A;  3ZQL A;  2DOD A;  1EH8 A;  3A2K A;  1K61 A;  1Y6Z A;  2L4A A;  4RMN A;  2GIV A;  5IY5 H;  5ICF A;  3M7N D;  2BA0 D;  5ELW A;  5DD8 A;  2DU9 A;  1KKH A;  4NNJ A;  1Z0C A;  2DBB A;  1WJB A;  1VI7 A;  4HDU A;  4URL A;  1MSF C;  3R4K A;  4DV7 I;  2P7C B;  2BE5 F;  2K02 A;  3SXY A;  3RKQ A;  2JE6 A;  4AIM A;  3J7A G;  1LKX A;  1XCB A;  2RAE A;  3ZMU A;  1UDN A;  3Q9V A;  2IP2 A;  4A12 A;  2E2I J;  3ZMV A;  1GLN A;  5B3S H;  1Z21 A;  3WTU C;  3ZQC A;  2OCC H;  4FE4 A;  2VOD A;  3WU4 A;  1PJR A;  1OQY A;  1N0U A;  4G7O F;  1RIO H;  3UHM A;  2DK8 A;  3DBL B;  3E6M A;  4C9Y A;  1WHU A;  4WUD A;  1MMN A;  1XMX A;  1XGN A;  4KIT B;  3HRM A;  4OKG A;  2XRN A;  1E3P A;  3S3M A;  5DNL A;  3D1N I;  1SFE A;  2EB7 A;  1ZG3 A;  2RVC A;  5LHH A;  2HZT A;  1TT0 A;  1G3T A;  3KET A;  3IH4 A;  1Y4S A;  2H6C A;  3ERM A;  3QOP A;  4BQO A;  3WU3 A;  1MW7 A;  2HU9 A;  1E3H A;  1S5L C;  3L7Z B;  3G73 A;  2P81 A;  5F08 A;  1G2H A;  1KYZ A;  4HZF A;  2FRH A;  4M9Z A;  2Z5E A;  3M8J A;  1KQ9 A;  1V55 H;  3WU0 A;  1LJ9 A;  3VEP A;  5E79 C;  4FW7 A;  4UUV A;  3JRE A;  5B5E C;  4DR6 I;  3JRB A;  3JRD A;  5HDK A;  3IH2 A;  2JA6 J;  1O3Q A;  1HNX E;  4II3 A;  1KQ0 A;  4AD9 A;  3B82 A;  1YIJ I;  3F8C A;  3OIP A;  4YIR X;  1VQ5 I;  4OO1 D;  4E7J A;  4XLP F;  2ZNZ A;  4PZJ A;  4M3F A;  2D5V A;  2LVS A;  4MU1 A;  3CLQ A;  1IDZ A;  2E5N A;  1GV5 A;  4PFO A;  2H27 A;  1J9I A;  4HF2 A;  2O8X A;  4IRH A;  3HJE A;  4IQ4 A;  1FJL A;  3I4P A;  3TED A;  3LSM A;  4CCJ A;  1TP4 A;  4YG2 F;  2ELJ A;  3T5X A;  1QNT A;  3QT6 A;  1K6Y A;  3K4B A;  2HNH A;  3QU3 A;  1YHQ I;  1HNW E;  3BG5 A;  5IYB J;  1CGP A;  2V2Q A;  2MH9 A;  4JX5 A;  4C2M J;  5DRQ A;  2FQ4 A;  3ELK A;  5FKO A;  4PJN A;  2R5Z A;  4JK1 X;  1WJA A;  1QPI A;  3ZKB A;  4DW6 A;  5IOY A;  4YY3 I;  2FNP A;  4J19 A;  2JPB A;  1YFH A;  3QPT A;  1YIO A;  1VQ9 I;  1YW7 A;  1R5G A;  2AQE A;  5LFA A;  4Y52 J;  2ISY A;  3PS1 A;  2Y30 A;  2M34 A;  2XDV A;  4G6Q A;  3IRQ A;  2JSP A;  1JI8 A;  5HNF A;  5KNL A;  2XF7 A;  2P4W A;  4X62 I;  4PJM A;  4X65 I;  1U8R A;  2KJC A;  3WE3 A;  1DGR M;  4GDF A;  1RHY A;  2UXB I;  4BA1 A;  1GDT A;  2OC6 A;  4JI5 E;  1PVE A;  4CA0 A;  2DN0 A;  4BNC A;  1D0Y A;  4HAC B;  3BG6 A;  2HXI A;  4XTJ A;  4FW5 A;  1YJW I;  3E0J B;  2BR2 B;  5A2Q C;  2BHZ A;  4ED4 A;  3J7Z I;  4JI3 E;  2QKM B;  3HSF A;  4LF9 E;  2BGC A;  2EZH A;  1V5F A;  2EWN A;  1HW5 A;  3IH3 A;  1FSH A;  3FHN A;  5JR3 A;  2KDO A;  1OYY A;  3V7R A;  2NVT J;  3HTU A;  2W85 A;  2NN6 C;  2CYY A;  3DBH B;  4M72 A;  3KX2 A;  1XC5 A;  2E36 A;  1VQ4 I;  2X1E A;  2EIN H;  1W36 D;  4BY7 J;  4KDP A;  1EI1 A;  5IWA E;  1JGS A;  4Y33 A;  3ZQF A;  2ZB9 A;  3H5N A;  4G6T B;  3AL0 C;  3BTI A;  1FWK A;  1Z0G A;  1ZXM A;  5DM6 F;  2XUB A;  3EYY A;  4GQU A;  4FX4 A;  5D8L B;  5C0X D;  2DYR H;  3CDL A;  4G9Y A;  1FMV A;  3BG7 A;  5FKL A;  3F6V A;  2PNL A;  2HHH I;  3TDU C;  2JMW A;  2XRL A;  1R00 A;  4G7H F;  2ZBK B;  3B73 A;  2WAD A;  2CW0 F;  2DA3 A;  2C37 B;  3D5R C;  5LBQ A;  1UEK A;  4NXN I;  2DT6 A;  3HOY J;  5BMZ A;  3VPR A;  4JV5 E;  3DKY A;  3OWT A;  2IVM A;  2DA7 A;  2PBI A;  1IDY A;  1T33 A;  4UVA A;  1BR4 A;  1HXD A;  1QO0 D;  2IS2 A;  4JI1 I;  5JEA D;  1YH8 A;  2F6C A;  1UG0 A;  2X6X A;  2Y75 A;  4ZZL A;  3OS1 A;  3G71 I;  1B63 A;  4DR4 E;  2UXC I;  3ZN1 A;  3M4O J;  2L9N A;  4HSR A;  1UHM A;  4JQF A;  4ZTJ A;  3V8K A;  4Q48 A;  3E6B A;  1OYR A;  2XAJ A;  2K85 A;  2D1H A;  2Q2E A;  3BR2 A;  4I7H A;  3JTH A;  3IC7 A;  1HQC A;  3GZ5 A;  3HDD A;  3DD6 A;  1Z7U A;  2M7A A;  3F0C A;  2MD0 A;  2R7O A;  5EEA A;  4ENN A;  1OJ4 A;  4A3J J;  3W2V A;  1JKP C;  2LLK A;  3BPX A;  3SQN A;  5LHG A;  1IN6 A;  3QPL A;  4KUM A;  1ZGJ A;  2IAI A;  2GXA A;  1KON A;  2OV7 A;  2EIM H;  3OOP A;  1GXP A;  3E5Q A;  3BLY A;  4Q47 A;  3F22 A;  4WXC A;  3EYI A;  2CO5 A;  2GAU A;  5EG0 B;  4YHH E;  3J80 Q;  5K36 E;  1MDM A;  2VPR A;  2CSO A;  3Q0V A;  2A2D A;  2HQR A;  2IA2 A;  3K10 A;  3R6S A;  4M73 A;  5HLG A;  1P7I A;  5CVU A;  3FXJ A;  1WRJ A;  2DO7 A;  3IWZ A;  1BL0 A;  1YOV B;  1SMY F;  2H1K A;  3U1D A;  3QPS A;  3JSO A;  4AYB N;  5F27 A;  2BBY A;  2JSC A;  2NS7 A;  2PMH A;  1F4K A;  2DW4 A;  5IT9 Z;  1A6I A;  1U5T C;  4LFC E;  1FEX A;  3ZMS A;  3Q3S A;  1PDN C;  3RIR A;  2BA1 G;  2GQ0 A;  2KIU A;  1P7J A;  1XTA A;  3AG3 H;  5GAH J;  3I71 A;  2H94 A;  2EH3 A;  4U87 A;  5ICG A;  1OCC H;  2LYC A;  4L0Y B;  1XX5 A;  2KIF A;  2KFD A;  2L3D A;  3MZY A;  2LKS A;  2MC4 A;  2GA1 A;  5DCM A;  4IZZ A;  1IBL E;  4CDG A;  1J2X A;  2WP8 A;  2BW3 A;  2VOO A;  3QYB A;  3PFI A;  5A2Q Z;  4DJA A;  4LK0 F;  5K7Z A;  2M0M A;  5L3B A;  2Z5C A;  3E1S A;  2GBY A;  1IRZ A;  5LMN E;  4MQY A;  4NUB A;  1Y6I A;  4Y15 A;  3GF2 A;  1MBH A;  4MU0 A;  2M45 A;  4F52 A;  4B3A A;  4LLG F;  4X64 E;  4QTR A;  4IHX A;  2HXO A;  4XBF A;  2BYV E;  2FD5 A;  3GTP J;  2BVM A;  1SFK A;  4IFD C;  2RDP A;  3RZD J;  4AVZ A;  4YFN F;  3FBI B;  3G1M A;  3D0S A;  3OMY A;  4L5J A;  3C7J A;  1VTN C;  3S3O A;  4M3G A;  2R7F A;  4LIU A;  1K78 A;  2X1D A;  3ZQQ A;  1Z67 A;  3F23 A;  1D1C A;  1N33 E;  1D5V A;  2EFW A;  3GFJ A;  4OU0 A;  2V9V A;  2QSG X;  4A69 C;  1H7S A;  3SZG A;  5KCM A;  3J80 C;  3OYB A;  1TWF J;  1UCR A;  3FK6 A;  2XVC A;  3U21 A;  5L3C A;  2AS5 F;  2UWM A;  4LF5 I;  4XOT A;  3FK7 A;  1TBX A;  1R9T J;  3EPZ A;  3HPG A;  1VZ0 A;  4RS8 A;  3BPV A;  1UMQ A;  4XLN F;  2BEO A;  4FW6 A;  1BW5 A;  3UR3 C;  3FDY A;  4GKK I;  2M4G A;  5BPI A;  3TOB A;  4XMY A;  3T1Y E;  2KLO A;  1WUU A;  1ULY A;  5EL9 A;  4DR1 E;  2Q8K A;  1Y5Y A;  3PS3 A;  1BOB A;  5DYM A;  2KZV A;  3RQI A;  1V54 H;  4XQF A;  1N34 E;  4OO1 C;  5FD5 A;  1WVR A;  5HNH A;  4CYC B;  3OYG A;  3QYF A;  2MBF A;  4P55 A;  2XGX A;  3JTG A;  3W2A A;  3FMQ A;  1G59 A;  2O1U A;  1MND A;  3PUB A;  5D5V B;  4E4H A;  3CCM I;  1ZKG A;  2HK3 A;  1KU9 A;  1T56 A;  4QNJ A;  2ADU A;  4LFB E;  1MIJ A;  3HKZ N;  1IUY A;  4X6A J;  3M1E A;  4CCO A;  2NRA C;  3ZZ0 A;  1B8I B;  1QU3 A;  3H5R A;  4KIB A;  4ZTF A;  2FBH A;  1YE9 A;  4YFX F;  3JR9 A;  2BXZ A;  1H9G A;  2J7K A;  1Y0N A;  1ZN2 A;  2XKO A;  1TT5 B;  1O3S A;  3HRS A;  5FLX K;  3WTX C;  1SAX A;  3Q6M A;  2UXX A;  3GEZ A;  2A69 F;  3F3X A;  3OYM A;  4DUY E;  3U2R A;  2GA2 A;  2PO2 A;  3H4L A;  2E5L I;  1RPW A;  1FIP A;  1WJF A;  3DWL E;  3IV5 A;  3K4C A;  2P6T A;  1ORK A;  2LP0 A;  2MFZ A;  2QF7 A;  2R7U A;  2HKJ A;  1YTY A;  1P42 A;  5KVR A;  1SD4 A;  3TW7 A;  1DP7 P;  1NH3 A;  2EFG A;  2YU3 A;  4A3L J;  3PS2 A;  3KIO A;  2NYX A;  3I54 A;  5FGM A;  4DV3 E;  1SD5 A;  1WJC A;  2VBW A;  3QT8 A;  2WV1 A;  1TC3 C;  1UB9 A;  4LD5 A;  2HKX A;  3BJA A;  2OI2 A;  2QBY A;  3BCA A;  1YI2 I;  1TQI A;  5LL6 R;  4OOI A;  2WB1 N;  2VXD A;  3E6D A;  2V79 A;  3MKZ A;  1IZ1 A;  2CUF A;  1Z6T A;  4CO8 A;  2DMN A;  1SFO J;  2HR3 A;  2QQB A;  2OF7 A;  1KVK A;  2DFI A;  1R6L A;  1S9H A;  4RAZ A;  2HTJ A;  2BY2 A;  4JI2 E;  1WI3 A;  3OYC A;  4OZE A;  3LFK A;  4DQ2 A;  1BI3 A;  4HV6 A;  4TV7 A;  2RV8 A;  2XIG A;  5FKN A;  1XNQ I;  1ZK8 A;  3O6B B;  4YHH I;  2MA3 A;  3VSL A;  1IBM E;  2HDC A;  2VQE E;  3WU5 A;  1FY7 A;  2NOG A;  1G3W A;  2Z3Y A;  2GOX B;  3BTL A;  2PO0 A;  4UTG A;  1VQ8 I;  1K7A A;  3BZC A;  2VUM J;  2R7R A;  5EDN A;  3V8J A;  5LMU E;  2ETH A;  3LQQ A;  1S6L A;  2F4M B;  3HEF A;  1L0O C;  3IUO A;  3M7G A;  4BDZ A;  1W36 C;  3PYF A;  4P52 A;  1UST A;  2E7X A;  2RRE A;  4FCY A;  2DMP A;  3CUO A;  4JYK A;  5E8G A;  3JAM C;  4LFC I;  1PUF A;  1IN4 A;  1FOX A;  3F8F A;  2JVG A;  5C0X C;  2FXA A;  2ZC2 A;  3PSI A;  2JWT A;  2W00 A;  3IP4 B;  4E70 A;  3G4S I;  3VYT B;  1JGG A;  1IBL I;  4GKJ I;  2R4G A;  4I0B A;  1QVT A;  5E17 F;  1BI2 A;  2E35 A;  3I58 A;  3MD2 A;  4RB3 C;  2A05 A;  2LMD A;  4C3H J;  1YRN B;  4D9J A;  1T08 B;  4XRF A;  2M1B A;  2WNR A;  1J09 A;  2Z5C B;  5F0C A;  2COB A;  3DKW A;  4D0P A;  3DKX A;  5JEA C;  2V1N A;  1U9N A;  5LEJ A;  5FKK A;  2RQQ A;  3S2W A;  1ZH5 A;  3SFZ A;  2OPT A;  1YJN I;  4F92 B;  1I94 E;  1HKS A;  4KIF A;  3PO3 J;  4IQJ A;  1A04 A;  4DIQ A;  4ZDP A;  4IJA A;  2CVE A;  2UU9 E;  5EZH A;  2PNZ A;  1HDD C;  2O3F A;  2ZSH B;  2XAQ A;  4BQA A;  1WWX A;  1LDK B;  5C4J J;  4IZJ D;  3LA3 A;  5M5Y J;  1AWC A;  1N33 I;  2FEZ A;  3H9G A;  5HS9 A;  4LOM A;  4DUZ E;  1LEA A;  3DFG A;  2LDU A;  2VJ4 A;  3RPU A;  1DPU A;  5FRM A;  5M5X J;  1V5G A;  4GRI A;  4ZC3 A;  5D4S A;  1FWL A;  1TNT A;  2Z33 A;  2CMP A;  4G6D A;  3TP3 A;  2XAH A;  3WOD F;  1TTY A;  2HVQ A;  2QSF X;  4M3E A;  1YIT I;  2W4S A;  5ILS A;  2KDZ A;  2X0L A;  2HWV A;  2JPC A;  2YPR A;  3MKL A;  4K0K E;  3BJ6 A;  4AQY I;  4AIK A;  3IL2 A;  2LBF B;  1C0W A;  1G4D A;  1WPK A;  2QQA A;  4HX7 A;  4IOC F;  2Z9O A;  3I9V 2;  2O61 A;  2EPF A;  1H74 A;  3OYI A;  1JKR C;  1ETY A;  5IOZ A;  2BM1 A;  3C2B A;  5ED4 A;  2FJ1 A;  2F48 A;  4WXH A;  1N34 I;  4N3O A;  2O03 A;  4IRG A;  1XG1 A;  4CUG A;  3CTA A;  2QQ9 A;  3P5J A;  4OIR F;  2CUE A;  3JRH A;  4LF4 E;  2ZJR F;  4AYB A;  4F55 A;  2W24 A;  1TQP A;  2DTZ A;  2CQN A;  3BQZ A;  2VAS A;  3C2H A;  3S32 A;  1UAA A;  1SVO A;  4OIN F;  2X1C A;  2NS8 A;  4F91 B;  2ELK A;  1JKO C;  1YS7 A;  4HNV A;  3LAJ A;  3K6G A;  4JI7 E;  2NN6 D;  1K79 A;  3GO5 A;  1U2R A;  3PYG A;  1EKE A;  5AIQ A;  5DTD A;  3CCJ I;  3NAR A;  3LSR A;  1LE8 B;  4DUY I;  5GPA A;  2QGU A;  3QYE A;  4J3D A;  2JA7 J;  1M1E B;  2LK2 A;  5EJC A;  2W82 A;  4N4O B;  4EJT A;  4E7H A;  4DV3 I;  2P5K A;  2UUZ A;  3E97 A;  5HDN A;  1K83 J;  4BXX J;  3DTI A;  1WH7 A;  2HFH A;  1AU7 A;  5K36 F;  2DAO A;  4S04 A;  1I50 J;  1R6R A;  2M3A A;  3AG1 H;  4MTE A;  1Z0X A;  3ABM H;  3GTJ J;  2ICW G;  2M9H A;  1EA6 A;  3S16 J;  1PVG A;  4KHP E;  4A93 J;  4UY8 I;  2FSW A;  3DP7 A;  1ZTR A;  4OO1 B;  3GTM J;  2XGC A;  2MD5 A;  4GCV A;  3JAM Z;  3Q5F A;  2F5C A;  5E20 A;  3CDH A;  4U3D A;  3F8M A;  4DXL A;  1UJ8 A;  3TDZ C;  3U1K A;  4DV1 E;  2CGE A;  3CP8 A;  3QOD A;  4KQV A;  1TQM A;  3BOQ A;  1SAN A;  4ZDL A;  3J7A O;  3RTR A;  3S17 J;  4ZYG A;  5DUK A;  1FT9 A;  2Z1D A;  4XK4 A;  2LY9 A;  3ZQI A;  3KP7 A;  5CKT A;  5F04 A;  2IOQ A;  2CQX A;  3DLA A;  2PO0 B;  3ZMZ A;  5K1Y A;  3L2V A;  3M9A A;  4QPO A;  2VBY A;  4B47 A;  2KMU A;  4M6X A;  4DYQ A;  3N4M A;  1UFM A;  3LTO A;  1Z6R A;  1EJ9 A;  2WW4 A;  3WU1 B;  2EBI A;  4I3H A;  1NG6 A;  1FBU A;  1FNM A;  2E1O A;  2PX9 A;  2XF6 A;  1N78 A;  1Z7L A;  2VON A;  1R49 A;  1R58 A;  2YX7 A;  5GTI C;  3GVA A;  4PFP A;  2HDD A;  4XON A;  4Z7C A;  2MLK A;  2UUC I;  3MAJ A;  2CFO A;  1ZHF A;  3GCM A;  2A68 F;  2ELH A;  3I4N J;  1U8B A;  4N4N B;  3VFZ A;  3BC8 A;  5CPR B;  3PJR A;  3HKZ A;  2G9W A;  1QZR A;  1QA6 A;  1X1A A;  2H6B A;  5C3E J;  1MH4 A;  2C38 B;  1B9N A;  2IW5 A;  2DCE A;  2P5V A;  4O5V A;  1XGM A;  4RGS A;  4Y4R A;  5EEG A;  5TIS C;  4CCK A;  3I64 A;  2HOT A;  5HLI A;  4JI0 I;  1DU6 A;  4MDT A;  2VC0 A;  4ENJ A;  1I94 I;  1FOK A;  1IBK E;  3J7A Y;  3HM5 A;  3CQZ J;  1B72 A;  3KRN A;  5HDG A;  4BH9 A;  4QNK A;  2UU9 I;  3CCU I;  1FPQ A;  4MQV A;  3CMY A;  1XS9 A;  3CCY A;  2OQG A;  3CME I;  4ZYE A;  2B63 J;  1ZRC A;  2JEB A;  2VJ5 A;  3ECH A;  4C2U A;  1HKT A;  3IAM 2;  4M3D A;  4GYI A;  1F36 A;  2WB1 A;  5BR8 E;  5D6F A;  2YR2 A;  3LSH A;  3L1P A;  2ZCW A;  3DTE A;  3DF8 A;  2ZBK A;  4A3D J;  2ZIT A;  4F7Z A;  2NNY A;  4PRX A;  2ZXW H;  3IKV A;  2C37 A;  2BXY A;  2XC7 A;  3ZXS A;  3W3C A;  2QA4 I;  2PLY A;  4K0K I;  4LCH A;  5C0X B;  1U3E M;  2LRE A;  1A6F A;  4AM3 A;  2O0Y A;  4PSW A;  2DXI A;  4EJU A;  2R0Q C;  3B8H A;  1FBQ A;  1WJD A;  5J8C A;  3LNQ A;  2JQ7 A;  4A6E A;  3AKZ A;  1ZXN A;  1HNZ E;  1OYP A;  4XM3 A;  5B1B H;  3HG9 A;  3HJC A;  2TRT A;  2EFQ A;  4XNF A;  4BDY A;  2QCO A;  5CVJ A;  4IX7 A;  1W5T A;  5J4V A;  2F5E A;  2DMQ A;  4LF4 I;  3QWL A;  4IFD D;  1Z91 A;  2UUB E;  3WG9 A;  5JEA B;  1O4X A;  1IUF A;  5DM7 F;  3REO A;  1ZRF A;  2OZU A;  4DV0 E;  4U7B A;  3E6C C;  3S15 J;  1IN8 A;  1MNE A;  2O7O A;  4MFD A;  2E2J J;  5JLW A;  4EJV A;  1MMG A;  4DV4 E;  2Y2Z A;  1EH6 A;  3FM5 A;  4CSW A;  2MH2 A;  4JI7 I;  5D4R A;  4J01 A;  2AXL A;  3K7A J;  3DTK A;  4JOM A;  3BY6 A;  2STT A;  3H9Q A;  1MZB A;  3H5A A;  2CH0 A;  3ML6 A;  1HKQ A;  5ILV A;  2A2C A;  4MLO A;  4A2U A;  1FJG E;  3VYS B;  2K9L A;  3ESW B;  4NDL A;  1JT0 A;  2CWE A;  3WU6 A;  1LVA A;  2CZ9 A;  4OX9 I;  3K70 D;  1NG7 A;  2EA2 A;  1D1B A;  2VXZ A;  4PDK A;  4LB6 B;  4IHV A;  2Y9Y A;  1HK7 A;  5EG0 A;  4B3R E;  4EJO A;  3L2W A;  2P0W A;  1TL8 A;  2HQN A;  2IGM A;  5CLS A;  2GWR A;  1VQN I;  1X1C A;  4Q4Z F;  2V2Z A;  2V8P A;  4CIC A;  2L5Q A;  3E5X A;  2PQ8 A;  5GPC A;  1T2K A;  1UDS A;  3SDG A;  1QRY A;  1VQM I;  4MHG A;  3JRA A;  5IYC J;  1NZ0 A;  2R7W A;  1KIJ A;  1T0F C;  4S05 A;  3NEU A;  3WU2 C;  1ODD A;  2F1D A;  4IZK B;  2CFX A;  4OIP F;  4A3C J;  4B3X A;  4D7M A;  3BTC A;  3JRF A;  4EM0 B;  4A5M A;  3HUG A;  3BWG A;  1XMQ E;  5DRP A;  1X3Z B;  3QT7 A;  4RA2 A;  4BHP A;  3WTW C;  5FLX Q;  1HLV A;  3TP0 A;  1GVJ A;  1O7F A;  1W0T A;  3V8L A;  2VE9 A;  3PNT A;  4N0B A;  2Q0O A;  1SD7 A;  5EKW A;  3CD6 I;  2DPU A;  3CUQ B;  1SVM A;  1XD7 A;  4CHU A;  2EIL H;  4QIW N;  3L2R A;  1YS6 A;  3GX4 X;  2YU9 J;  1BJZ A;  2M5W A;  1L3L A;  3P7N A;  3Q6N A;  1PIE A;  4EJW A; 
#chains in the Genus database with same CATH homology
 5C0X A;  3M7N G;  2JEA A;  2BA0 G;  5K36 A;  1UDQ A;  2JE6 B;  2NN6 D;  2NN6 B;  1WHU A;  4IFD F;  3B4T A;  2C37 A;  2C39 B;  2WP8 B;  1E3P A;  2PO0 A;  5JEA F;  5C0X D;  5C0X B;  2JEA B;  4AM3 A;  5K36 D;  4IFD C;  5K36 B;  4OO1 F;  5JEA A;  3M85 D;  1E3H A;  1OYP A;  2C37 B;  3L7Z B;  4OO1 A;  5K36 F;  4IFD D;  4IFD B;  5C0X C;  3HKM A;  5JEA D;  5JEA B;  5K36 C;  2PO1 A;  4NBQ A;  4OO1 B;  4OO1 D;  2JEB B;  1R6M A;  3U1K A;  1OYR A;  2WNR A;  3CDI A;  2PO1 B;  5JEA C;  2BR2 A;  2PO0 B;  4OO1 C;  3DD6 A;  2WNR B;  4IFD E;  2PNZ A;  2NN6 E;  4BA2 A;  3M85 G;  3GLL A;  2C38 A;  2PNZ B;  5C0X E;  1UDS A;  3GCM A;  2BA1 D;  5K36 E;  2C39 A;  3GME A;  4AID A;  3CDJ A;  4BA1 A;  4BA2 B;  2PO2 A;  2C38 B;  3H1C A;  3M7N D;  3L7Z A;  1R6L A;  5JEA E;  2BA0 D;  2BR2 B;  4BA1 B;  1OYS A;  2PO2 B;  4IFD A;  4OO1 E;  2NN6 F;  2BA1 G;  3KRN A;  3H36 A;  2JE6 A;  4AIM A;  5C0X F;  2NN6 A;  2NN6 C;  1UDN A;  1UDO A;  2JEB A;  2WP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...