3GMEA

Crystal structure of polynucleotide phosphorylase in complex with rnase e and manganese
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
545
structure length
482
Chain Sequence
MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFRPSEGETLIARLIDRPIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPVNEALNARVTDKQERYLHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTDTFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQAINAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli polynucleotide phosphorylase core bound to RNase E, RNA and manganese: implications for catalytic mechanism and RNA degradosome assembly.
pubmed doi rcsb
molecule tags Transferase / protein binding
molecule keywords Polyribonucleotide nucleotidyltransferase
total genus 128
structure length 482
sequence length 545
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 3gmeA02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gmeA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gmeA01
2BR2A 5K36C 2WNRB 2JEAB 5C0XE 3GMEA 5JEAF 2NN6B 5C0XD 5K36F 3L7ZA 2PNZA 4OO1F 4BA2B 4IFDC 4OO1A 4IFDF 3B4TA 5K36E 3CDIA 3M7NG 5JEAE 1UDSA 2NN6A 2JE6A 2JEBA 2WP8A 4AM3A 1R6MA 4AIMA 2WP8B 5K36B 2PO2A 3H1CA 2BR2B 4IFDA 2NN6C 1E3HA 1OYPA 2BA0G 5K36D 1UDQA 3U1KA 2C39B 5JEAB 3KRNA 2PNZB 4AIDA 2PO0B 5JEAD 4OO1C 4IFDD 5K36A 4BA2A 2BA1G 2NN6E 2JE6B 3CDJA 2NN6D 5C0XB 3HKMA 4BA1B 2C38B 1R6LA 4NBQA 2JEBB 1WHUA 4IFDE 3DD6A 4OO1E 2PO2B 4BA1A 3GCMA 2PO1B 3H36A 1OYSA 2WNRA 2JEAA 1UDNA 2C39A 5C0XF 5JEAA 2C38A 3M85G 3L7ZB 2C37B 1OYRA 3M85D 5C0XC 2NN6F 2C37A 2BA1D 5C0XA 2BA0D 1UDOA 1E3PA 5JEAC 4OO1D 4IFDB 2PO0A 3GLLA 3M7ND 2PO1A 4OO1B
chains in the Genus database with same CATH superfamily
2P7CB 2NVUB 2DMQA 1S16A 3DEWA 3HKZN 1MBHA 1HDDC 2ICWG 1QGPA 1LVKA 3HSEA 4LGWA 1T6SA 4OIOF 2ACJA 2VB6A 4UUVA 2GXBA 4EGZA 5DS9A 2MFZA 3I3LA 3LSJA 2OZ6A 2Y31A 4CYCA 3WTSC 1JI8A 1FWLA 1LNWA 1VQNI 1SD7A 3WU0A 1XB4A 3ZMTA 1K6OA 2WTEA 1MW7A 5FLXC 3H0DA 3G1MA 4LF6I 3DPLC 3K85A 1XGNA 2OA4A 5H20A 5J4VA 4JG4A 3IWZA 4IFDC 2DT6A 4OAZA 1BI3A 1USUA 2JK3A 3J80K 1JT6A 4IRHA 4JX4A 3W3CA 2PMUA 2GZWA 2VJJA 2YSRA 1MH4A 4I99C 5K36E 2P0WA 2RKHA 1N75A 4LK1F 4XLNF 4DV6I 2ZB9A 4FHTA 3H0GJ 3SXYA 4HQMA 1IUYA 4AM3A 4I02A 4LITA 1W5CC 1FOXA 1LE8B 4AIMA 4CCOA 1S72I 3JSPA 2EIMH 3KIOA 2M4GA 3LSRA 3HB9A 4M72A 4Z7YA 2ZBKA 1DGRM 3FM5A 2KMUA 1W7PA 3MKLA 4RLFA 5TISC 2ZMEB 4XMYA 4LB6B 2KIMA 2LYCA 3U1KA 1VQ5I 2ISYA 1FIPA 4AQYE 1EH8A 4KT5C 4CICA 3RKQA 2UUBI 4HF0A 4JBAA 4BHPA 1H72C 1E17A 2VT3A 3OYCA 4JI7I 1A5JA 4GKKI 4BJ5C 4ESBA 1ZQ3P 2HFHA 3E6MA 4PFOA 4V19K 3C2GA 3S14J 2EFNA 2RC4A 4DV0I 2JT2A 4WCGA 4LLNA 2FBKA 2IRFG 4LOCA 1XDUA 2LFBA 2WC2A 5CYVA 1R6LA 4M3DA 2YX7A 4EV0A 4B3AA 4JI7E 3KE2A 3PSFA 3S93A 5JHUA 1WJDA 3L2UA 4HOBA 1FKAE 2YX4A 1M1EB 1GV2A 2M9HA 2X6XA 3U1DA 1SVOA 1VZ0A 4I7HA 1DARA 5K7ZA 4O6JA 3IKVA 4NDLA 4RAYA 5IT3A 3FXRA 5B5EC 4CYCB 3NAUA 3OL3A 3DBRB 2C38A 3M8EA 2C37B 4AQYI 3DLLF 4M1KA 2D5VA 4KQVA 1A6QA 4J00A 1N33I 1MBGA 3S1NJ 5C0XA 2NVQJ 1T2KA 2A68F 4D5FA 3QT5A 2DI3A 4RDUA 4PUSA 2BY3A 3HOZJ 1U5TA 2HOTA 2BVLA 4ISAA 3SHFA 1QHHD 5HLGA 1H8AC 2LF7A 3PUFA 1X3UA 5EEHA 1IN4A 2W4SA 5BPDA 2IGMA 4IEJA 3IP4B 3R6SA 2QWWA 3GW2A 4NC6A 4KDPA 1IW7F 3GBGA 4LJZF 1HK7A 2ZJ2A 4JI5I 1USVA 1BOBA 4KN7X 2PBIA 2VQCA 3JR9A 2BXYA 2IBDA 1NHHA 2V2ZA 5J6XA 5E3NA 4DV7I 2KIFA 2IOPA 2P5LC 4LG0B 1WWXA 4M6YA 2HS5A 4JI1E 3NQOA 1Y6IA 1RI7A 4MTEA 2OJED 2V7FA 3ZQGA 3OSFA 4HNVA 2Z9OA 3HOVJ 1FWKA 2W7NA 2A5YB 3E6CC 1BW6A 1K61A 3OYKA 4BE2A 1FEXA 1Z0WA 3HM5A 2PQ8A 3DWLE 5IP7J 1F36A 4A69C 2VLAA 1A35A 3S15J 2PMHA 3D4JA 1FY7A 3TP3A 2F5EA 1VQPI 2OC6A 5FKLA 3A2KA 4UTGA 3G3ZA 1N32E 5IT9Q 2IP2A 3ERMA 2DU9A 4N0BA 4B3XA 3V5RA 2M1BA 3FDYA 3OR1C 3J7YJ 4IVNA 4MU4A 3FXQA 2PO2A 2LOOA 5ILSA 2E1NA 2R5ZB 2BR2B 4FW5A 2ZM6E 1RIOH 2RQPA 1OCPA 5KNLA 3V4GA 1FYMA 2FBHA 1B72A 2C39B 3BZKA 4BACA 2BE5F 5JLXA 4B3TE 2P6SA 2M3AA 1UHSA 4FQGA 2R3VA 1EV7A 1HSJA 4DV5I 2D1HA 5JEAD 1RHYA 4OO1C 3Q9SA 2QUFA 3SQNA 5ICFA 3L09A 4Q48A 1X2NA 1O57A 1RC9A 2BW3B 5J8CA 1TL8A 2PNLA 3LA3A 3AFHA 5TJJA 1YQAA 4HV5A 5C0XB 1J7KA 2ZCWA 4BDYA 4UVBA 3FMQA 3BR2A 1U8BA 1RZ4A 2BVMA 2XIGA 3BR1A 4HA8A 3E6BA 2F2EA 5IOZA 2QVOA 2DTRA 1VQ9I 1GV5A 3HPGA 1U5TC 2QYOA 5HDGA 4KNYA 3ABTA 3LWFA 5LMNE 3J7AO 1J5EE 3KZZA 2WWYA 4X6AJ 4DJAA 4DR4I 4AIKA 4LFBI 1STZA 2E5NA 4R79A 3ZRGA 2O9LA 2COBA 3F23A 5HS8A 3HRMA 1YITI 1LB2A 2VQEE 2RN7A 5J1UA 1OJLA 4KHPI 2L54A 3U9GA 3WU5A 3R0JA 5ELWA 2DDAA 3CCUI 4BQOA 3JAMQ 1D8KA 1EA3A 2HHHI 3R61A 4LIUA 2CG9A 1VQ4I 2NOJB 1ZXNA 5EEAA 1BI0A 1B59A 3CJQB 3CUOA 4IOAF 2IT0A 1REPC 1ZM2A 1QO0D 2OAZA 1LJ9A 4UV8A 3DU6A 1IDYA 4QPOA 5FJ8J 1IUFA 1SMTA 2O61A 1Z7UA 4HZFA 1HCRA 2VXZA 1LDJA 3ESWB 3DKYA 2H8RA 2NVTJ 4LF5I 3P3EA 2E19A 4KIGA 1USSA 2ZXIA 4I0BA 4KJZA 1TQMA 2ECBA 1MMSA 3KYCB 2JA2A 2JEAB 3K9TA 2VPRA 1IXRC 3L00A 2KJCA 2NN6B 5K36F 3B6CA 5EL9A 4ETSA 3GTMJ 1IBMI 3CCSI 2FOWA 2Y2ZA 1YYVA 3MVPA 4E4HA 4JI4I 2YUSA 1YJNI 3CF2A 3IKTA 2OPTA 1Z0VA 2Q2EB 2CO5A 2MH9A 3LQRA 3WTWC 1MNDA 4K0KI 4A5MA 3CDIA 1S6LA 3I5UA 3L7WA 1MH3A 3BCAA 3GZ6A 4PGGA 2JA7J 4XK4A 1ZR4A 2RQQA 3WTXC 2CQKA 1TNTA 2R92J 3ABLH 4LF4E 2D2WA 2M30A 1MBKA 4OKGA 5K1YA 4R1HA 5LL6R 4A5NA 3H9GA 2O5RA 1VQ7I 4ZVIA 1ERDA 4IFDA 1TNSA 2F6CA 2KP6A 4X0GA 1I94I 2ETHA 2IA2A 4P9UA 2V26A 2H6CA 3BG7A 2ZBKB 3KRNA 2DO7A 3J81Q 5DRPA 1XCBA 2RGVA 3CDLA 4EM2A 4J3DA 4YFKF 3F8MA 5EG0A 3WTYC 5D4SA 4JI8I 3I59A 2UXDE 1F43A 5IT9C 3H35A 5D4RA 4AIHA 2Z2SB 4RB2C 4I0AA 1MGTA 4HX7A 3E7LA 3QP5A 3AG1H 3SZGA 1D1AA 2LJPA 2VC0A 3U21A 1IG7A 1R49A 2MABA 3L2VA 2EFPA 1P7IA 3K4CA 1XSDA 2A69F 1P2FA 3E1SA 1WHUA 4D7NA 3GTOJ 2JEBB 3EYYA 1WVRA 3HGYA 2AXLA 2LG4A 2LY1A 2P6TA 1YHCA 1OR7C 2L7ZA 2P8TA 3S32A 3VOEA 3OS1A 1Z9CA 2Y0MA 4AC0A 1XX5A 3C3WA 1N77A 4IX7A 2V9KA 3MZHA 3OL4A 1KQ0A 3GCMA 1GVJA 5C3EJ 3CQZJ 2VKEA 3EUHA 4A0ZA 1Z0CA 1R6RA 2HGCA 3F8NA 4P96A 3O6BB 1LPQA 4E7JA 4GDFA 1SVLA 3J7AM 1G3TA 2E36A 4ZZLA 5CPRB 2DA3A 3ZMZA 2O1TA 5LHHA 2E7WA 4ENJA 1MMGA 1DUXC 3WTVC 2A6TA 4MHGA 4NQWB 4XLHA 3MMYB 1XSXA 3W6KB 2LKSA 1LDDA 3OYGA 5F1JA 1X4PA 1Z21A 2FX0A 1JKPC 2EFQA 4UY8I 3JAMC 1LE8A 3WE2A 4DZJA 1ZREA 4DR5I 3QAHA 1YW8A 2Q0OA 4M73A 1H74A 1WPKA 3DV8A 4IRIA 2R5YB 2DFEA 4LFCI 1VI0A 3IC7A 1B1BA 5DD4A 2Z5BB 2X1CA 2OUMA 3H5AA 3B82A 3KP4A 2K4JA 2R7DA 4CXFA 2DCEA 3JRDA 1FOYA 3AL0C 1NHJA 4QNKA 2KZVA 2L2OA 1BM9A 2IAIA 3SEQA 2VBYA 3P3GA 1Z0BA 4JYAI 3BT9A 3DPUA 2AE8A 1BC7C 1DQUA 3DTKA 4OZEA 3A1YA 4FW6A 3GX4X 1VQKI 5EGOB 5HS9A 4PRXA 3B4TA 3KP7A 4CSWA 4LF8I 4X66I 1IAWA 4IHTA 1Z6RA 2STTA 5LBQA 1A36A 2JE6A 1ZRDA 4EMSA 1X1DA 4E70A 1R22A 2W24A 3K4KA 4LG3A 4QPQA 1HC8A 1ZXMA 2NNNA 2O1UA 2WP8B 1HR0I 1O3SA 2GQ0A 1JJ8C 3LNQA 2XB5A 1FZPB 2IGKA 4WXCA 2OV7A 2YPRA 3ABKH 4M3EA 3HHGA 1HLVA 2PJPA 3VYTB 3AG4H 4HDVA 2KISA 2NAZA 3EETA 1RNLA 2NS0A 3BG9A 3GTGJ 2YS9A 2Q1ZB 2P81A 4ZJZA 2Z1DA 4DNCA 4R1FA 5FWKA 2VN2A 3MEXA 4AVPA 1WUUA 5E18F 4ZZDA 2WAEA 3WODF 2LC2A 3W6VA 1EH7A 1XNQE 1EA6A 1IV8A 1FMWA 1LEAA 4XKVA 2OD5A 2W25A 5A2QZ 4LF4I 4E7KA 3KCCA 5EYRA 4C30A 3WU3A 1TT5B 2XRLA 5BPIA 4HF1A 3CD6I 3G6EI 4YIFA 2ZFUA 1MDMA 1NTCA 3LTOA 2VQFI 2HQNA 3ZZTA 4R8HA 4BYYA 1T8IA 1HNXE 4IF4A 3I4PA 2M7AA 2P7VB 4DV7E 5J3LA 4XRFA 1Z3YA 1MJAA 4U0WA 3BG3A 4E7SA 2X4HA 1KVKA 4QSHA 2C39A 1V55H 2XAJA 1YW9A 1Y39A 1FJGE 1B8IA 3PYEA 2PMZA 4YEJA 2R5YA 1OYIA 4UT4A 5E3LA 3PQJA 5A2QK 1QPMA 4M3BA 3RQIA 3ZPLA 2VKHA 3FK6A 2BA0D 2L9SA 3ZQFA 1OMIA 2HU9A 1BIBA 1FBSA 2GIZA 5D6EA 3OYJA 1O3QA 3CUQC 2KZGA 1WJAA 5AONA 1G3YA 2DW4A 2M8GX 2QBYA 2R7WA 1J0RA 3DLAA 4H0EA 5ICCA 1HR0E 1H9GA 2BV3A 2EA2A 4LF7E 4WUCA 4C3HJ 4CCLA 4B3SE 1ZGJA 2QA4I 1V5FA 3K4MA 1AOYA 1UG2A 5D5UB 4WK8F 1MMAA 4IS9A 1RPWA 1S4EA 1R7JA 4GXOA 1MJ9A 2DT7B 2RDPA 2AQFA 2ELJA 4IKFA 1ZYRF 4DPYA 1BR2A 3RKYA 4E7IA 1ETQA 4LMYA 1WH7A 4HV6A 4L9NA 2ZXHA 1DU6A 3CC4I 2VL8A 4OO1A 1MMDA 1JKOC 4BJTA 1C0WA 4DV0E 4IFDF 4IL6C 1ZRCA 4OU0A 4XQFA 4WX9A 1L0OC 2CRGA 2HDCA 1ZHFA 1ETKA 3F21A 3ZQIA 2R0QC 3MD2A 1DP3A 2WP8A 3WTTC 4D0PA 4XLAA 2DODA 2CUFA 4DV5E 3DF8A 5D5XB 4MU0A 3HZJA 1R5GA 2FU4A 4HBLA 4KIFA 1NK3P 5LMUI 4B3RE 2EZLA 4LLGF 1YW7A 3CLQA 2CUJA 2PI0A 2DBBA 3J80Q 3CCJI 3SZTA 5DDGA 1W7PB 5H6QA 2WW4A 1RR7A 1ZG3A 2CWEA 2LY2A 5D8KB 1P4WA 4U7DA 1Q1HA 1B63A 2F4IA 2NVYJ 1VNDA 4L18B 1BJZA 9ANTA 3BLYA 3J81Z 2R7VA 2LP0A 1I50J 2WAFA 4A2UA 1UJ8A 1KA8A 1NHAA 4XLFA 2PJRB 1FI4A 5DM7F 3F9KA 1YS7A 4O3MA 2W84A 3FK7A 2UV1A 5K5OA 3ZN0A 4KYWA 2QSFX 1BOAA 3HKZA 3GTQJ 1H9TA 4DYCA 3BJ6A 3E3VA 2H8WA 3PFIA 2M8EA 4NC8A 2KPMA 4DUZE 1YG2A 1Z91A 1HKQA 3FMRA 2JUCA 1SD5A 4ASNA 3BG6A 4UB6C 3T1HE 3WU4A 2UU9E 4XKBA 2ESHA 4USKA 3CLOA 5D8LB 2UXDI 2P4WA 2QSHX 2R7UA 4PJLA 4BXFA 3KEYA 2VASA 2A61A 5GMDA 1WJ5A 1RREA 2CQNA 5C0XC 4IJAA 4HQEA 3DP7A 1HNZI 2HR3A 3RTRA 2DEJA 4XRMA 4OOIA 3TO7A 4NXME 3EUAA 2HQAA 2R7SA 3D5SC 3HC7A 4CO8A 4IFDB 2DYSH 1Y6ZA 1N32I 3FHNA 4X1EA 1LVAA 1JT0A 1TC3C 2HVQA 3ZCOA 3BY6A 1IV6A 4FW4A 5B1AH 2V1NA 2COMA 3ML6A 3GWZA 3JRGA 2C6YA 1N78A 2NXNB 3ZGKA 2ZJRF 2G7HA 3OIOA 4ZYDA 4F55A 4LFAI 1PVGA 3CC7I 1XN7A 2VE9A 3A0HC 2F5DA 4C2MJ 1PUFB 2KJBA 2Y30A 4XN0A 1SFXA 5K7FA 3LSHA 3RSNA 3ZQHA 1KZHA 5FO5A 4WWCA 3KP5A 3OS0A 3DBHB 1YJ9I 1U9NA 2F48A 4E6KG 1XSVA 1VTNC 2OTLI 4ABZA 2LMDA 3P7NA 4W1UA 2XV4S 5GAGJ 3M7NG 3LL7A 4E7ZA 3OV8A 3IH3A 3ISPA 1SFUA 3GVAA 4BQQA 4UUSA 4XBFA 3DFGA 4BQNA 4XRSG 3OYDA 4HDUA 1G8XA 4BE0A 3CJRB 3HSFA 3IH2A 4BBRJ 4LPFA 4L5JA 3ZOBA 4HW0A 4UNOA 4A0XA 2IVMA 1ON2A 3TDZC 4DR2E 2FF4A 4OMYA 1IBLE 2Y9ZA 2GOMA 4G6DA 3V8JA 4AIDA 5BR8I 1N34E 3CCQI 4XKCA 2DOEA 3BOQA 2HYGD 4NXNI 4BS9A 3PO3J 2Z5EA 4DBRA 1Y1VJ 2EWNA 1VF9A 2F4OB 3WU1B 3K4NA 2BA1G 2QSGX 1HW1A 2UXCI 5E1ZB 3N4MA 2L7KA 4DOZA 1J59A 4KISA 2V9PA 4DV1I 3HPHA 4DZPA 2FNAA 3ZQLA 1Z5BA 3BTIA 2EB7A 2R7RA 5DYMA 5JFRA 4ESJA 2VQHA 3PNTA 2BY1A 2HZDA 3ZQ7A 3DTEA 2CJJA 1OLTA 2K9QA 2Y9YA 1W36D 1XHKA 2BBYA 3GZ5A 3HJCA 1N36E 3TKYA 3OY9A 3OYIA 5CVUA 3M6AA 3CDHA 1DGWY 2K9MA 3IRRA 3GF2A 3H36A 3M07A 4LG0A 1K79A 3FXLA 5EZHA 1VQMI 3O3KA 1BKNA 2M2EA 4KFCA 5C0XF 3W2VA 3I56I 5K7HA 4A3BJ 1U0JA 1YE9A 1FBUA 1OCRH 3KZYA 4XRSA 2BA1D 1YIOA 2HTSA 4V2GA 1F4KA 4G7OF 4H4KC 1N33E 4RM3A 1R1VA 4ITVA 1XMAA 5FRNA 1E3PA 2DDBA 4GO1A 1PDNC 4WUBA 3SFZA 1IZ1A 4M9ZA 1JHFA 2VJ4A 4A3FJ 1SD6A 3CMMA 1YIJI 1RETA 2KQRA 2XKPA 4MEXF 2Z3YA 3PL8A 2LKPA 4HG2A 1F1ZA 4WXDA 5IP6A 2F4VI 3M7GA 5BS6A 3PS3A 4OIQF 3P76A 4JI0E 4Q4ZF 1I1SA 1T56A 1OJ4A 4QLCU 3CMAI 2QF7A 2JA8J 4A3JJ 2BY0A 4X62E 3QPTA 1ZKGA 4DR7I 2OQRA 2BZTA 3H9JA 5F64A 2ME6A 1Y4UA 5FLXQ 3RJPA 3K17A 4XSXF 2V1UA 2PNZA 1OYWA 4I3HA 3COAC 3J80C 2HKOA 2Z5CA 3TEDA 2R4GA 2VC1A 3DU5A 4B3MI 2CU7A 3KEQA 2RV8A 3DCFA 1TQPA 3ABMH 4O5VA 5M3FJ 1MKMA 4X65E 1HNWI 2V2QA 1V5GA 2O8XA 4GGGA 3FIWA 3K4LA 1R6MA 3S1QJ 4BHCA 1JKQC 4JOMA 4IZJB 2OCEA 2VF3A 3VPRA 1W1WE 5K36B 3JRFA 1WJFA 2W82A 1BI2A 3IAM2 4KT6A 3SDBA 4BE1A 1H0MA 1ZM4A 3BDDA 2B63J 2FA5A 5K5RA 3BCBA 1B6AA 3BJAA 4XORA 4YELA 2JTVA 4U3BA 1FJLA 1R4NB 4OAYA 4MQVA 4XL9A 4F7ZA 3PS1A 1R58A 3LSTA 1S7AA 5DNLA 4X64E 1W4MA 5FROA 1D0ZA 4DXLA 3B73A 3CESA 2IERA 1FNNA 2G7UA 1I6HJ 2HQRA 1BIAA 2NPFA 3IRQA 3BTJA 2UWMA 2DN0A 4DUZI 3I58A 2HFUA 1R71A 1IBLI 1HXDA 2PG4A 2ZNZA 3BR6A 2ZJQF 3S1RJ 3HOYJ 4A3CJ 1YH8A 2VQEI 2WADA 5GTHC 4LLLA 3OYHA 2O8KA 2VODA 5A2QC 3T1YE 2L0KA 1QA6A 4EQQA 3L7ZB 3A01B 3B8HA 1WJCA 2L4MA 3M85D 2G0EA 1WKMA 2DQLA 4OIPF 4G94A 2H27A 1UDOA 3VWBA 2FOKA 1Y60A 1MJBA 2CMPA 1HA8A 1TT0A 1HBXG 1AA7A 4XSZF 4CUGA 1RR9A 3K1PA 3TBIA 1IBME 4OO1B 2QKMB 4XNFA 3F0CA 6PAXA 4I09A 1O3TA 5CVJA 3LOCA 3FXUA 1ETVA 3E6DA 3L2RA 1JKRC 1GT0C 4GKJI 1P4XA 1U2RA 3VYUB 3D5LA 1D1BA 3R4KA 1OFCX 4LB5A 5HLIA 4LCGA 4LFAE 3GFJA 4TV7A 4ZYGA 3ECOA 3S2DJ 3ZR8X 2FSWA 2CQXA 5JVTA 1NZ0A 3MFKA 2PJRA 2VPLA 1IN7A 2FUG2 3R0AA 3DPTA 2BY2A 1IN5A 2QQBA 1XDSA 4PSXA 1JUSA 3FZVA 3WGHA 1O3RA 4JI6E 4YHHI 2JPBA 4ENMA 3IUOA 5LEKA 3A0BC 1LKXA 4DV2E 4FWDA 2FD5A 2L5QA 2BW3A 3I54A 2KLOA 2K40A 2X51A 4E7LA 1JXSA 3TL4X 1FOKA 1O7LA 4PJNA 4II2A 1HNWE 4WUDA 4BQAA 2WB1N 1HDPA 3GYHX 3QQAA 5IWAE 2DK8A 4LF6E 2CUZA 3P9CA 1ENHA 4HF2A 5EF6A 2JT1A 1A6FA 2LREA 1PP8F 2IJLA 2ZNYA 3REOA 2M5WA 1SEUA 3H5NA 1KIJA 1TWGJ 3JTGA 2IS4A 4UB8C 2E71A 2GBYA 4AUXA 2R7OA 4OINF 1TWAJ 2M4KA 1G3WA 4JI5E 3LQQA 4M71A 3FXMA 2HPMA 2ESNA 2W00A 4B1RA 3OYNA 2E35A 1ZTRA 2O3FA 1ONVA 1ON1A 5JLWA 2PNZB 4DR2I 1S7OA 1QZYA 2LH9A 4L9TA 4P5OA 3PYFA 1HW5A 2NOGA 3ZMSA 4YY3I 4JI2I 4DBQA 5HOOA 1D0YA 3D1NI 2IW5A 1R4MB 1TWFJ 3HRUA 3R60A 3GO5A 1IBKI 3Q3SA 2NN6D 2O6GE 5HVQC 2XAQA 3QYBA 2HKJA 3G4SI 2M7BA 3CCEI 1Z67A 1T08B 3HEFA 4BAYA 5DCFA 3I53A 4XLPF 2GO4A 4DU8A 3CUQB 1R1TA 2J5OA 2V79A 1B62A 1H73A 4U3DA 5LGTA 3F6VA 2XEXA 2FNPA 2LLKA 1JGSA 3G2BA 1XMXA 2A2CA 3K70C 1X1BA 3WU2C 1TWCJ 1ELOA 4CH7A 4OO1E 4I76A 3K70D 2H09A 1IN6A 2LVSA 1BN5A 5LRRA 3QPSA 1OYSA 4B43A 1WH5A 3LMMA 3HUGB 2F1DA 2RNGA 2CW0F 1K4TA 5KVRA 2EQRA 2XAFA 4JI8E 3RPUD 2VONA 1XNQI 4DV2I 1Y0NA 4AD9A 1WCMJ 4Z6YA 3P3CA 1K83J 4HX8A 4JQFA 2L7MP 2HTJA 3TO6A 3FBIB 5E17F 2X7IA 1YO5C 4XICA 5EDNA 1OR7A 2K3PA 1CQTA 1YLFA 3QOPA 3VB2A 1H7UA 2PO0A 1D3YA 3IL2A 4M74A 3ZXSA 5M5YJ 3N97A 4DUYI 2DMTA 3CMEI 1OQYA 1UHWA 3H5RA 2NRAC 1TW3A 4U87A 4L9JA 4USMA 1OKRA 5K5QA 1YRNB 2XSDC 2DMNA 4JI3I 1Z0TA 3OMYA 4NC7A 4DUYE 2K02A 3OYMA 2O1WA 3KP3A 4MQ9F 5D6FA 1FSEA 2VJIA 3FM3A 3G1LA 1XG1A 4FETA 2KRCA 3SEZA 5IP9J 2XAUA 3EYIA 1V5EA 2PMZN 4P1WA 5L3EA 3C2HA 3QT8A 2K5CA 5F1RA 2GO3A 2B9SA 3Q0UA 5H6RA 1RUOA 4IHXA 3GTKJ 1TWHJ 3V42A 2MSYA 1HQCA 1PIEA 4XTJA 1XD7A 2XASA 4DPTA 2EJRA 1VQ6I 3AAFA 3OIQA 4DPUA 1WFXA 1HKSA 3Q6NA 4L0ZB 2CW8A 4Y17A 1XMQI 2X9DA 3LFUA 2P5VA 2L3DA 3DKXA 5E1WA 1QZEA 3W6JB 4AYBA 4A3EJ 5FLMJ 3B02A 4KA4A 4Y3OA 1OYPA 2BA0G 4OMZA 1X3ZB 4D5CA 4IHVA 3KETA 5FRMA 3IH4A 4ESFA 5JEAB 1FC3A 4G7ZF 1HNXI 3GONA 1JUPA 2WA0A 3GEZA 2EA4A 4YIRX 1I1GA 4X64I 3PQKA 4EM0B 4IO9F 3TQNA 1IF1A 3TOAA 2XPUA 1IBKE 4J19A 3S3OA 3PS2A 4DR1E 2WY7Q 2ZXWH 4Q47A 2H6BA 3O8HA 4PRVA 2IA1A 4BA1B 1DU0A 4HRIA 1A04A 2EINH 2MLKA 1QVUA 2XPWA 4RMNA 1R00A 2XAGA 1FYKA 4PCQA 1J9IA 1NK2P 3UHMA 2CQQA 2H1LA 4BNCA 1USTA 2E5ZA 2QKLB 3BZ6A 4JV5E 2R7XA 5IYBJ 4W97A 1T33A 2V9VA 1KONA 2XHKA 2FXAA 1Y8RB 5EGOA 1JGGA 1ITYA 4JP0A 5BR8E 4BU2A 1SANA 1KTVA 4DV4E 1N34I 3CCRI 3D0SA 4ENKA 2NN6F 1ZG1A 4NHJA 2NVXJ 2DOFA 2IGNA 1U6GA 2GA1A 3KLNA 1T0FA 4C9YA 2HVRA 3S3MA 4DR1I 2VI6A 2QCOA 3W2AA 2BV6A 1KYWA 1Y1WJ 2DEIA 2UXNA 3HOTA 1B4AA 2EBIA 2CQ7A 3OYFA 1HNZE 1RESA 5DCMB 1EH6A 1TTYA 4DV6E 2GAUA 4YRVA 4MLOA 1PUEE 2EFGA 4NXMI 1P9QC 1K6YA 3MZ8A 3NEUA 2CUEA 3K69A 4XN3A 5FLVA 3U1YA 3E5QA 4MYUA 4GKJE 2CYYA 2ZO4A 5JHFA 1N0UA 4Y33A 3OR2C 4BY7J 5J47A 3CCLI 1MG7A 5HS7A 5IT9K 5JEAF 1Y0UA 4FASD 2DMPA 4F92B 5HODA 3A01A 5GPAA 1YJWI 1OPCA 4DR6E 5HDNA 3BZCA 1W0UA 2JQ7A 4HNUA 3L2WA 4HSRA 3A4CA 4II3A 3QRFF 4MDTA 1Y56A 3BR5A 2MGQA 3LAPA 2VUMJ 2FRHA 2DFFA 3KP2A 2QENA 3BPVA 3G1OA 3T5XA 5JEAE 1FT9A 1WQ2A 3FX3A 2DA1A 3NWSA 4CGZA 1K78A 3E5XA 4LIVA 5AIPA 1JTYA 3HJEA 1XGMA 3OYBA 1DPRA 2B0LA 4MNUA 3JSOA 1G6NA 3IWFA 3P5JA 2Z16A 4G9YA 1Z0XA 2ADUA 2KIQA 4BDZA 4S04A 5IT9Z 2WB1A 3CP8A 3CF5F 1RRJA 3VDXA 1TW2A 1TBXA 2NN6C 1E3HA 3K7AJ 1BJAA 4IZKB 2V1XA 4RM2A 3QYFA 4B3RI 1XMOI 1IRGA 4LD5A 4M3GA 5JVGF 4A6EA 2AO9A 5ILUA 3T8TA 1CF7B 1YX5A 3IHUA 3ZZ0A 3HGGA 2KL4A 4DR7E 1ZR2A 3DKWA 3HOUJ 1Z77A 3JRBA 2OCCH 3H3ZA 5B1BH 5DD8A 2UU9I 4GRIA 4GYGA 4MTDA 4PK4A 3ZKDA 2BGCA 3CP2A 1UCRA 3OYAA 1X3WB 1ZK8A 2E7XA 5CQGA 1D5VA 3PO2J 3Q6MA 3LSIA 3L2QA 1ZG5A 1BBYA 1GXQA 4LF8E 4NBQA 2CZ9A 4K2EA 2P5KA 1T38A 1ETXA 4FCYA 2OQGA 1LDKB 2L01A 2XF7A 4CDGA 5KK1A 2R7ZJ 5L3FA 3TOBA 3ZP5A 2FQ3A 3S16J 2MYSA 2WNRA 5LFAA 1P6RA 3FXKA 1SFEA 4M6XA 2DTZA 2HOEA 4ZDPA 5HDKA 3S3NA 1VFCA 1UDNA 1Z5CA 2V8PA 3ASOH 4DR6I 2FQ4A 3BG5A 5LLQA 2X1DA 4IQ4A 3FISA 3NARA 4IQJA 4DV1E 2X6WA 3P9IA 2L02A 3WU6A 3HRTA 1UAAA 2NYXA 1NH3A 3K4BA 1QVTA 2QM3A 2WBMA 4BEHB 2ID3A 2Y69H 3M7ND 1IJWC 4JYKA 1ZN2A 2M87A 2VXDA 3WGIA 4FWHA 4PSWA 5DEQA 4DR3E 3CZ6A 5GADJ 2BHYA 2MH2A 3CJTB 1V54H 1XNRI 4JX6A 1SVMA 4YHHE 2CFXA 3U2RA 3KLOA 2HPIA 3PM1A 5E8GA 2MBFA 1R5HA 2IA0A 5GAEJ 4HNTA 4MO7A 5ED4A 2HWVA 2I10A 5ICGA 1RR8C 2LDUA 2KHMA 1S3JA 1BR1A 1MBJA 1I6XA 5J40A 4F3QA 1E2XA 2AJ4A 5GMEA 4AIJA 1FTZA 2O1VA 2QBYB 2V6EA 2KIUA 2DFIA 4IXAA 1OISA 3I64A 3Q0VA 3PIPF 2J65A 2MLGA 2LY9A 4CCNA 1XGOA 3OIPA 4FISA 2WAQA 3M3YJ 5ICEA 2MW8A 5FLXZ 1SFKA 4ZYAA 1UG0A 2IXSA 3WTZA 3DQVC 1L3LA 2FMLA 4A3DJ 3S17J 2CVEA 2IOQA 4FWGA 3LSKA 5LHGA 5CVVA 2DPDA 1QZZA 3LPSA 4LF9I 4YFXF 4C3IJ 5DCMA 2DFHA 3PNYA 1T39A 3C1DA 3ULQB 1APLC 2IEKA 1WGXA 3QU6A 1Z05A 4UV9A 2QLZA 4Y7NJ 4PFPA 1I39A 1ZGAA 2ZM6I 2PEXA 5LMNI 4B09A 4EATA 4DPXA 4LF9E 5FLXK 1SMYF 2HEOA 2TCTA 3HTSB 1YX3A 1LFBA 3PUBA 2PO0B 4UXNA 4OX9I 4FW7A 1VISA 1HW2A 2J5PA 4F91B 2RAEA 4F52A 3RZOJ 3UKGA 3BTLA 2UXCE 1GUUA 2K27A 2JMWA 4BA2A 4IZZA 4UVCA 4G12A 1ETOA 3GFLA 2Z5BA 2Z5UA 2Z33A 4J01A 2W57A 4KMUX 2LD5A 3LNUA 3A02A 1XMQE 5CQEA 4ED4A 3QP6A 3RKWA 5KHDA 1UZCA 1VQ8I 5A2QQ 5KCMA 2VT2A 1OCOH 3NRVA 5BQTA 2R7FA 3RZDJ 5FD5A 2OBPA 3IV5A 3JRHA 5IPAA 2DJNA 4LK0F 3FBNB 4NQWA 2GLOA 2X6YA 2HK3A 2PO2B 3GZNB 2R93J 1IXSB 4XIDA 3HSRA 2PN6A 4ZDOA 4BA1A 3DTIA 1OCZH 1D0XA 4JI6I 1HF0A 5E3MA 1ZRFA 1FNMA 5L3JA 1MIJA 4A6DA 4RGRA 2HDDA 3K4JA 5LEJA 3LAJA 1XC5A 1ZELA 1H7SA 2UUAE 3CWVA 1D6TA 4HSTA 4ZTFA 2C37A 3J7ZI 3RI4A 3AG3H 1HSTA 3DEUA 2BYVE 2M0CA 3DBLB 3JAMZ 2DA2A 1MBEA 3RPUA 4BJ6C 2GS8A 1B9MA 1KU7A 4HY1A 5E1XA 3FMSA 2X85A 2M34A 1WRJA 2XPVA 4C2UA 3B78A 2XGCA 4BHBA 4X66E 1J5YA 1MNEA 3JRIA 2QEXI 4JX5A 1UMQA 3UR3C 1VQOI 1WI9A 3PJRA 2YR2A 3H9QA 3RQ4A 4CCKA 1FOWA 2AQEA 5K36C 3HYIA 1H88C 3GTLJ 2B7EA 2KKOA 1SFOJ 3I4MJ 4F93B 4UHTA 1OCTC 2CV0A 5M3MJ 5FKKA 3L7ZA 4CA0A 1WJBA 1A31A 3ZQCA 4OO1F 5FGMA 3HRSA 2JJ7A 3LFKA 2GM4A 4Y4RA 3G73A 5AIQA 3V7RA 4DR3I 3KEOA 1FP2A 3F72A 4DR5E 3RKXA 3SDGA 3V8LA 1W36C 2F5VA 4X65I 4WXHA 5F0HA 1IRFA 5E79C 2JRMA 3SYTA 2PFBA 3ONQA 2E1MC 1ZGWA 5DTDA 4MEYF 1YI2I 4EM1A 3HOWJ 4RB1A 3JREA 1Z3XA 2M45A 3C7JA 4A3KJ 4PU9A 2H1KA 3E97A 4L9VA 2ZC2A 3RYPA 1BR4A 4LFUA 3JTHA 3KX2A 3OYLA 4GFBA 4RS8A 1U9OA 5CKTA 2JSPA 3MKWB 3RIRA 4HLXA 2X36A 2CGPA 1KQ9A 2A5WA 1FJGI 2EIKH 2EFOA 1S8NA 1N36I 3I59B 2VIXA 3WGGA 2R7TA 1S29A 2AHQA 1X4OA 1HKTA 3HXLA 1QHGA 2F4MB 2H94A 1BI1A 2JSCA 5E8IA 1J2XA 3OOUA 2RVCA 1RKWA 1LFUP 2LF8A 1ZLJA 5DM6F 2MG4A 3J7AY 3MCZA 3JRCA 5FFZA 1ACIA 4RGXA 1IGNA 3QT6A 3KYDB 1Q1VA 1I27A 1MNMC 1G3SA 1MMNA 4A93J 2ELHA 3M4OJ 1QU3A 4CZZA 5C4XJ 3FXJA 2A6EF 4HX4A 2KRHA 4IZJD 1Z59A 4ZC3A 5GP9A 5DV5A 5HLTA 2V4JC 3TW6A 1CF7A 2JA6J 2OU2A 5HNHA 4G6TB 3FWEA 4A3GJ 4PGHA 1AWCA 4M3FA 2VQGA 3ZQQA 4M9XA 2CFOA 3OOPA 3VSKA 5HNFA 2JN6A 2W48A 4PJ0C 1T95A 3EDPA 1IRXA 1CGPA 2CG4A 2MC4A 2JRTA 2R3SA 4BUPA 4D7MA 2K9SA 4BGDA 4ENNA 1JJ6C 4EJTA 1AU7A 3BWGA 2HKEA 4I98B 3EQLF 4XOTA 2VQLA 1MZBA 2PO1A 3L9FA 3HIFA 2W1OA 2I5UA 3F22A 3J81K 4XONA 2CV2A 2VOOA 1EJ9A 4C3JJ 4AU7A 1DDNA 3OYEA 4LOMA 1I3QJ 3JW4A 1KU3A 1YS6A 2EILH 2PNMA 4IHSA 1GXPA 5IYCJ 5FB2A 4BL0B 1S5LC 1FIAA 2PLYA 2E2HJ 4ON0A 4B3ME 5L3CA 4N4NB 3FF5A 1AHDP 4IHYA 2NS7A 3I71A 3E0JB 1RUNA 5C0XD 2HOSA 4RB0A 3IAS2 3CC2I 1KU9A 2RREA 2A2DA 3S2WA 2X0LA 2XAHA 2A07F 2K9LA 4MGRA 3G71I 3K10A 4GCVA 1QBJA 4GKKE 4C2TA 3TW7A 3FKIJ 3MAJA 2JPCA 3F3XA 2MC3A 4AWXB 5TRDA 2OF7A 2NN6A 2LNBA 1ZAOA 4Z7CA 3BQYA 5CVRA 3H92A 5KAFC 4RGSA 4S05A 2VBXA 2DJIA 5JI6A 1BL0A 2O0YA 4A3MJ 2KRFA 2DQRA 3HG9A 4CCMA 2E1CA 3CCYA 2WV1A 2ZITA 1AKHA 4N4OB 1KQ8A 3K6GA 2BEOA 2E60A 4UVAA 2VKVA 3WG9A 4AVZA 5J4YA 3KPHA 4QTRA 3MKYB 4RGUA 3F8CA 3I0TA 2M0MA 5K36A 5CJ9A 2OZUA 4OX9E 5BOXA 2E34A 2D1VA 4YIIA 4RA2A 2GWRA 2NN6E 2IS2A 1EF4A 2Y0SN 4HEA2 2GA2A 3BTCA 4KMFA 3HTUA 1U2WA 2E1RA 4P9FA 1IN8A 4FW9A 3JAMK 1Z7LA 3ZMVA 3ZMUA 5L3DA 4FN5A 1FMVA 5HLHA 3ECHA 3VODA 4Z2YA 4P52A 2XUBA 4B44A 2E2IJ 3F8FA 3GTJJ 1F5TA 1T0FC 2DOAA 2K85A 2VE8A 2Y0SA 2ZJPF 2DPUA 2GQQA 1LQ1A 4MQYA 5F0FA 2FMYA 4DV3I 2UXBE 3PYDA 5IOYA 2PO1B 2HZTA 2HOAA 3QPLA 2DMUA 4RAFA 3NZKA 5LD2C 2CGEA 3CUQA 5JEAA 4KHPE 3T8RA 4DQ2A 1KKHA 3M85G 4JI3E 3EUHC 3VYRB 1OYRA 1O7FA 2ISZA 4D1QA 4S0HB 4ZYHA 1SD4A 2XC7A 2JVHA 1NG7A 3PIOF 2WAQN 2EFWA 4FX4A 3ZM7A 5B3SH 1A6IA 3WHCA 2ZMEC 4HYMA 1D5YA 4G8XA 5GTIC 3ZN1A 1E3OC 5M5XJ 2JWTA 1K4SA 5FKOA 1P7JA 1QPIA 1S9HA 1O4XA 1UELB 4YG2F 2VKDA 1PKPA 2EZKA 5FKNA 3TDUC 1X2MA 2R5ZA 4U7BA 2BR2A 4FW3A 4Y15A 1Z0GA 4EMDA 3Q1QA 2Z99A 2ZFWA 1F9NA 1W5SA 2WNRB 2JUGA 3K2ZA 4UUSB 4DW6A 4DYRA 5BMZA 5EJCA 5C0XE 2Q8KA 5H2FC 1ZARA 1NG6A 3MN2A 2GXGA 1ORKA 4LF7I 1KGSA 3OTOI 4BXUA 2Y75A 4NUBA 3WE3A 4JI1I 1X1AA 3EUKL 5FD6A 2E1OA 4U0VA 3H3UA 4KIBA 2XVCA 1U5TB 2DA6A 1UHMA 1AKHB 4MU1A 4HACB 4P55A 1P4AA 2HNHA 2BHZA 2L9NA 2UXXA 3GXOA 2XB0X 3PNVA 2J7KA 3H3VK 2XDVA 3LA2A 4B4CA 5DROA 1JHHA 2IPQX 2HYJA 2EPFA 4RB3C 1PJRA 5LGNA 4BY1J 1X19A 3ROUA 1FPQA 3CTAA 4I6ZA 3L1PA 2VBWA 1FP1D 2UUBE 2LTPA 3AL0B 3P06A 3I55I 1JE8A 4FE4A 3KFWX 4FTHA 1V3FA 1P92A 4PJMA 4XR6A 2ZXJA 3ZZUA 1Z0EA 5F6FA 2DA7A 5F27A 2LR8A 4GQUA 4BKXA 2I8DA 2YU9J 1YTYA 4CYDA 1MSFC 1UB9A 1GDTA 3KYLA 1UEKA 3E5UA 4K0KE 4Q5SF 1OCCH 1W7PD 2ZSHB 1YHQI 4Y52J 2XGXA 4HXZA 3HUGA 3S8PA 2EV0A 1Y4SA 3QPHA 2A3SA 3SZPA 2OI2A 1XMOE 1RKTA 3S2HJ 1I3AA 4M6VA 1S7EA 3DXJF 4EEFG 4XM3A 3CO7C 1IO2A 5ERIA 2XROA 3Q5FA 1FLIA 1MSEC 4LFBE 1Z5AA 4RLQA 1V4RA 1JUMA 2NNYA 4UUTA 3HL2A 4V2FA 3O2PE 3JRAA 2FEZA 3AKZA 3Q0WA 4PJJA 4U88A 1I94E 2ZKZA 3K1MA 2X6OA 1XMKA 1X58A 2HXIA 4ZDLA 4ZTJA 1FYLA 3ZMDA 5CLSA 3CCMI 1MU5A 2DT5A 3BP8A 1FX7A 1POGA 2QGUA 4KICA 4PZJA 3V2UC 2AS5F 2MD0A 2XKOA 3K0LA 5B66C 4IZKA 4MU3A 2XF6A 3I4NJ 2L4AA 2UUCE 3F8BA 4N9HA 5DRRA 3H4LA 4LCHA 3M8JA 3K1JA 4L5EA 4DIQA 2EIJH 5KAIC 2KDZA 2Q2EA 4QNJA 5EZGA 2KT0A 4X62I 5EEGA 5JEAC 4RPFA 2LBFA 1QZRA 1IXCA 4OO1D 1KU2A 3X2QH 2K86A 2W85A 2WV0A 3HDDA 4HACA 3LSMA 3PSIA 3NWTA 2GIVA 2E5LE 5F08A 1TQIA 3BJOA 3W2WA 2K7LA 2F4VE 3SFIA 1QNTA 3LSGA 4WF2A 2E2JJ 2D45A 2Y48A 2LKXA 4B47A 3RDIA 4JI0I 2AXTC 5FFXA 1KYZA 1T98A 4XKWA 3BROA 2WY8Q 2ELKA 1B9NA 1LUJB 2K4BA 3TO9A 4ZH4F 4JYAE 3HOXJ 2YU3A 5ILVA 1ZM9A 2F5CA 3C2BA 3HHHA 1E0EA 4YY3E 4EJUA 3WTUC 1B8IB 3QT7A 1N25A 1ETWA 4HYEA 4B3SI 3MKZA 2FJ1A 2KFDA 2QQ9A 4BA2B 4B48A 1G59A 1TZLA 2HHHE 2BM0A 2HDWA 2A6HF 2O7OA 2MD5A 3T0YA 2XRNA 5JR3A 2ME0A 3K1NA 1J09A 1WSUA 1BW5A 1VI7A 5GPCA 3GUDA 1UDSA 2A05A 4HPQA 1I5ZA 4KUMA 3MWMA 4G7HF 4EGYA 3A03A 2LK2A 4B3TI 3QU3A 1EKEA 3V8KA 2DYRH 2HVSA 5EKWA 3I9V2 3LA7A 5EG0B 1IRZA 4A3IJ 4I2OA 4LF5E 2V1DA 2TDXA 1J75A 1FSHA 4YFNF 2V2VA 2RNJA 3BR0A 4IOCF 4HAMA 2XGDA 4MIMA 2DXIA 2R7QA 3MQ0A 5LRSA 4XLCA 1G4DA 2GOXB 4ANJA 1R36A 1PP7U 3J80Z 5DUKA 3VYSB 3VEPA 3BPXA 3FXOA 5D5WB 1W0TA 1TLHB 2EZIA 3CDJA 3MZYA 1UFMA 2CS3A 2X48A 4MFDA 3GFIA 3BC8A 3F6OA 3P9KA 3ZKBA 2CSOA 2IS6A 2ECCA 3L2CA 3T1HI 4NXNE 1JTXA 1DPUA 4BBSJ 2LBFB 3HOSA 1GLNA 1GHCA 1Y5YA 4LCFA 4IFDE 2UUZA 2Z5CB 1PVEA 2IGOA 1X1CA 2CH0A 1K7AA 1BA5A 1ULYA 1GVDA 5GAHJ 2DK5A 1VQLI 5CVIA 2OTJI 4AYBN 4A0YA 1MBFA 2HXOA 3GTPJ 2DA5A 4XLEA 4QIWN 2DA4A 3M9AA 2JEAA 3QYEA 1R23A 4N9IA 1MD0A 4MFEA 2NS8A 4DYQA 3TP0A 5IY5H 2O3ZA 4I01A 4FE7A 3WG7H 4CHUA 3K2AA 1XTAA 4IZJA 1WI3A 2JA5J 2BOLA 3OTOE 2XF5A 2VESA 4MYTA 2F5FA 4DGWB 2IS1A 3PYGA 1N0VC 5F0CA 3RCOA 2BXZA 5M5WJ 5D5VB 1QRYA 3BR3A 4IPAA 3B6AA 3QOEA 1XS9A 2QQAA 1K47A 3ABUA 3GLLA 1QQIA 2L7FP 3ASNH 3M1CA 4RAGA 4ZYEA 2CV1A 2HQ5A 4RAZA 1IDZA 5F04A 1WZ2A 3N05A 4DU7A 3TMOA 5C44J 4BH9A 1SAXA 1D8JA 2JVGA 3T1BA 4FT8A 2X1EA 2R42A 4URLA 2UUAI 2O03A 4OWRB 3FKJA 2L9VA 4HLYA 5BNGA 3GMEA 4G6QA 2G9WA 5L3BA 4A12A 2CW7A 1FTTA 2K3FA 2PX9A 1B72B 3HBLA 5J8FA 5J1RA 3LSPA 1DP7P 3F0NA 2FBIA 5FKMA 2XGEA 1XGSA 3AG2H 2E5LI 1R5ID 1G2HA 2HI3A 1XNRE 4QWQA 1P42A 1SAUA 3M8FA 2HKXA 4NB5A 2HK2A 4JI4E 1ODDA 2JEBA 5IWAI 4IHWA 2IESA 4XOPA 4U0YA 3FHZA 2DAOA 1ZM3A 2BM1A 2QQ8A 4A3LJ 2V34A 3M1EA 1IC8A 3O8GA 1X1PA 2EZHA 3H1CA 2QZ8A 3ERED 2EH3A 4DV3E 3VFZA 2UXBI 2HFSA 2VQFE 5K36D 5J1YA 1UDQA 2DLLA 2XSJC 5LMUE 3UNGC 4KN4X 1U3EM 1ZH5A 3CO6C 4RBOA 1K78B 1FWZA 1J5EI 1LFPA 1SC7A 3TGNA 1YOVB 1W5TA 3KZIC 3WHBA 2V6CA 2UZKA 4L0YB 4EJOA 5E3OA 3EPZA 4L5IA 4IFDD 2LRDA 2VOPA 1FBQA 3QWLA 4JI2E 2STWA 5L3GA 1H89C 5TGTA 3CCVI 1R9TJ 3S1MJ 2FE3A 1YFHA 5IYDJ 3J7AG 3RPQA 2JE6B 3HULA 3PRYA 1Z1DA 3SJMA 4P7AA 3V7CA 5LHIA 2GXAA 3HKMA 1PUFA 1YRNA 4DPWA 2K9NA 2C38B 3OWTA 1EI1A 3OS2A 2VBZA 1OYYA 1XCVA 3JCUC 4IRGA 4CCJA 2ZMEA 2E1MB 4E7HA 1NHIA 1Y8QB 1HOMA 4NNJA 3RYRA 1Z6TA 4Y13A 1MDMB 2N8GA 3QODA 3CJNA 3DD6A 4DV4I 4KITB 2HYFA 2EV6A 4BEHA 4BXXJ 3D5RC 2KDOA 3ELKA 3VSLA 4N3OA 2UUCI 4D9JA 4DR4E 2EV5A 1LEBA 1R1UA 2LSOA 1TP4A 5DNXA 1ETYA 4EJWA 1BC8C 2VJ5A 4PDKA 1U78A 1MX0A 1ZLKA 1XXEA 3V7SA 2MA3A 4EVIA 4OIRF 4JV5I 3GLXA 1XPXA 3C18A 4M9SA 3GFMA 5C4JJ 2L9RA 3J81C 4B8XA 3DEEA 5DUIA 5LGUA 3Q9VA 4CZCA 4EJVA 2ID6A 3OSGA 2TRTA 5DRQA 1WJEA 4FX0A 3T1YI 4LFCE 1U8RA 3CMYA 2ZSIB 4JK1X 3KP6A 1D1CA 3PFYA 3BQZA 4GYIA 5E20A 2EK5A 2JZYA 1PYVA
chains in the Genus database with same CATH topology
2BR2A 5K36C 2WNRB 2JEAB 5C0XE 3GMEA 5JEAF 2NN6B 5C0XD 5K36F 3L7ZA 2PNZA 4OO1F 4BA2B 4IFDC 4OO1A 4IFDF 3B4TA 5K36E 3CDIA 3M7NG 5JEAE 1UDSA 2NN6A 2JE6A 2JEBA 2WP8A 4AM3A 1R6MA 4AIMA 2WP8B 5K36B 2PO2A 3H1CA 2BR2B 4IFDA 2NN6C 1E3HA 1OYPA 2BA0G 5K36D 1UDQA 3U1KA 2C39B 5JEAB 3KRNA 2PNZB 4AIDA 2PO0B 5JEAD 4OO1C 4IFDD 5K36A 4BA2A 2BA1G 2NN6E 2JE6B 3CDJA 2NN6D 5C0XB 3HKMA 4BA1B 2C38B 1R6LA 4NBQA 2JEBB 1WHUA 4IFDE 3DD6A 4OO1E 2PO2B 4BA1A 3GCMA 2PO1B 3H36A 1OYSA 2WNRA 2JEAA 1UDNA 2C39A 5C0XF 5JEAA 2C38A 3M85G 3L7ZB 2C37B 1OYRA 3M85D 5C0XC 2NN6F 2C37A 2BA1D 5C0XA 2BA0D 1UDOA 1E3PA 5JEAC 4OO1D 4IFDB 2PO0A 3GLLA 3M7ND 2PO1A 4OO1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BR2 A;  5K36 C;  2WNR B;  2JEA B;  5C0X E;  3GME A;  5JEA F;  2NN6 B;  5C0X D;  5K36 F;  3L7Z A;  2PNZ A;  4OO1 F;  4BA2 B;  4IFD C;  4OO1 A;  4IFD F;  3B4T A;  5K36 E;  3CDI A;  3M7N G;  5JEA E;  1UDS A;  2NN6 A;  2JE6 A;  2JEB A;  2WP8 A;  4AM3 A;  1R6M A;  4AIM A;  2WP8 B;  5K36 B;  2PO2 A;  3H1C A;  2BR2 B;  4IFD A;  2NN6 C;  1E3H A;  1OYP A;  2BA0 G;  5K36 D;  1UDQ A;  3U1K A;  2C39 B;  5JEA B;  3KRN A;  2PNZ B;  4AID A;  2PO0 B;  5JEA D;  4OO1 C;  4IFD D;  5K36 A;  4BA2 A;  2BA1 G;  2NN6 E;  2JE6 B;  3CDJ A;  2NN6 D;  5C0X B;  3HKM A;  4BA1 B;  2C38 B;  1R6L A;  4NBQ A;  2JEB B;  1WHU A;  4IFD E;  3DD6 A;  4OO1 E;  2PO2 B;  4BA1 A;  3GCM A;  2PO1 B;  3H36 A;  1OYS A;  2WNR A;  2JEA A;  1UDN A;  2C39 A;  5C0X F;  5JEA A;  2C38 A;  3M85 G;  3L7Z B;  2C37 B;  1OYR A;  3M85 D;  5C0X C;  2NN6 F;  2C37 A;  2BA1 D;  5C0X A;  2BA0 D;  1UDO A;  1E3P A;  5JEA C;  4OO1 D;  4IFD B;  2PO0 A;  3GLL A;  3M7N D;  2PO1 A;  4OO1 B; 
#chains in the Genus database with same CATH topology
 2P7C B;  2NVU B;  2DMQ A;  1S16 A;  3DEW A;  3HKZ N;  1MBH A;  1HDD C;  2ICW G;  1QGP A;  1LVK A;  3HSE A;  4LGW A;  1T6S A;  4OIO F;  2ACJ A;  2VB6 A;  4UUV A;  2GXB A;  4EGZ A;  5DS9 A;  2MFZ A;  3I3L A;  3LSJ A;  2OZ6 A;  2Y31 A;  4CYC A;  3WTS C;  1JI8 A;  1FWL A;  1LNW A;  1VQN I;  1SD7 A;  3WU0 A;  1XB4 A;  3ZMT A;  1K6O A;  2WTE A;  1MW7 A;  5FLX C;  3H0D A;  3G1M A;  4LF6 I;  3DPL C;  3K85 A;  1XGN A;  2OA4 A;  5H20 A;  5J4V A;  4JG4 A;  3IWZ A;  4IFD C;  2DT6 A;  4OAZ A;  1BI3 A;  1USU A;  2JK3 A;  3J80 K;  1JT6 A;  4IRH A;  4JX4 A;  3W3C A;  2PMU A;  2GZW A;  2VJJ A;  2YSR A;  1MH4 A;  4I99 C;  5K36 E;  2P0W A;  2RKH A;  1N75 A;  4LK1 F;  4XLN F;  4DV6 I;  2ZB9 A;  4FHT A;  3H0G J;  3SXY A;  4HQM A;  1IUY A;  4AM3 A;  4I02 A;  4LIT A;  1W5C C;  1FOX A;  1LE8 B;  4AIM A;  4CCO A;  1S72 I;  3JSP A;  2EIM H;  3KIO A;  2M4G A;  3LSR A;  3HB9 A;  4M72 A;  4Z7Y A;  2ZBK A;  1DGR M;  3FM5 A;  2KMU A;  1W7P A;  3MKL A;  4RLF A;  5TIS C;  2ZME B;  4XMY A;  4LB6 B;  2KIM A;  2LYC A;  3U1K A;  1VQ5 I;  2ISY A;  1FIP A;  4AQY E;  1EH8 A;  4KT5 C;  4CIC A;  3RKQ A;  2UUB I;  4HF0 A;  4JBA A;  4BHP A;  1H72 C;  1E17 A;  2VT3 A;  3OYC A;  4JI7 I;  1A5J A;  4GKK I;  4BJ5 C;  4ESB A;  1ZQ3 P;  2HFH A;  3E6M A;  4PFO A;  4V19 K;  3C2G A;  3S14 J;  2EFN A;  2RC4 A;  4DV0 I;  2JT2 A;  4WCG A;  4LLN A;  2FBK A;  2IRF G;  4LOC A;  1XDU A;  2LFB A;  2WC2 A;  5CYV A;  1R6L A;  4M3D A;  2YX7 A;  4EV0 A;  4B3A A;  4JI7 E;  3KE2 A;  3PSF A;  3S93 A;  5JHU A;  1WJD A;  3L2U A;  4HOB A;  1FKA E;  2YX4 A;  1M1E B;  1GV2 A;  2M9H A;  2X6X A;  3U1D A;  1SVO A;  1VZ0 A;  4I7H A;  1DAR A;  5K7Z A;  4O6J A;  3IKV A;  4NDL A;  4RAY A;  5IT3 A;  3FXR A;  5B5E C;  4CYC B;  3NAU A;  3OL3 A;  3DBR B;  2C38 A;  3M8E A;  2C37 B;  4AQY I;  3DLL F;  4M1K A;  2D5V A;  4KQV A;  1A6Q A;  4J00 A;  1N33 I;  1MBG A;  3S1N J;  5C0X A;  2NVQ J;  1T2K A;  2A68 F;  4D5F A;  3QT5 A;  2DI3 A;  4RDU A;  4PUS A;  2BY3 A;  3HOZ J;  1U5T A;  2HOT A;  2BVL A;  4ISA A;  3SHF A;  1QHH D;  5HLG A;  1H8A C;  2LF7 A;  3PUF A;  1X3U A;  5EEH A;  1IN4 A;  2W4S A;  5BPD A;  2IGM A;  4IEJ A;  3IP4 B;  3R6S A;  2QWW A;  3GW2 A;  4NC6 A;  4KDP A;  1IW7 F;  3GBG A;  4LJZ F;  1HK7 A;  2ZJ2 A;  4JI5 I;  1USV A;  1BOB A;  4KN7 X;  2PBI A;  2VQC A;  3JR9 A;  2BXY A;  2IBD A;  1NHH A;  2V2Z A;  5J6X A;  5E3N A;  4DV7 I;  2KIF A;  2IOP A;  2P5L C;  4LG0 B;  1WWX A;  4M6Y A;  2HS5 A;  4JI1 E;  3NQO A;  1Y6I A;  1RI7 A;  4MTE A;  2OJE D;  2V7F A;  3ZQG A;  3OSF A;  4HNV A;  2Z9O A;  3HOV J;  1FWK A;  2W7N A;  2A5Y B;  3E6C C;  1BW6 A;  1K61 A;  3OYK A;  4BE2 A;  1FEX A;  1Z0W A;  3HM5 A;  2PQ8 A;  3DWL E;  5IP7 J;  1F36 A;  4A69 C;  2VLA A;  1A35 A;  3S15 J;  2PMH A;  3D4J A;  1FY7 A;  3TP3 A;  2F5E A;  1VQP I;  2OC6 A;  5FKL A;  3A2K A;  4UTG A;  3G3Z A;  1N32 E;  5IT9 Q;  2IP2 A;  3ERM A;  2DU9 A;  4N0B A;  4B3X A;  3V5R A;  2M1B A;  3FDY A;  3OR1 C;  3J7Y J;  4IVN A;  4MU4 A;  3FXQ A;  2PO2 A;  2LOO A;  5ILS A;  2E1N A;  2R5Z B;  2BR2 B;  4FW5 A;  2ZM6 E;  1RIO H;  2RQP A;  1OCP A;  5KNL A;  3V4G A;  1FYM A;  2FBH A;  1B72 A;  2C39 B;  3BZK A;  4BAC A;  2BE5 F;  5JLX A;  4B3T E;  2P6S A;  2M3A A;  1UHS A;  4FQG A;  2R3V A;  1EV7 A;  1HSJ A;  4DV5 I;  2D1H A;  5JEA D;  1RHY A;  4OO1 C;  3Q9S A;  2QUF A;  3SQN A;  5ICF A;  3L09 A;  4Q48 A;  1X2N A;  1O57 A;  1RC9 A;  2BW3 B;  5J8C A;  1TL8 A;  2PNL A;  3LA3 A;  3AFH A;  5TJJ A;  1YQA A;  4HV5 A;  5C0X B;  1J7K A;  2ZCW A;  4BDY A;  4UVB A;  3FMQ A;  3BR2 A;  1U8B A;  1RZ4 A;  2BVM A;  2XIG A;  3BR1 A;  4HA8 A;  3E6B A;  2F2E A;  5IOZ A;  2QVO A;  2DTR A;  1VQ9 I;  1GV5 A;  3HPG A;  1U5T C;  2QYO A;  5HDG A;  4KNY A;  3ABT A;  3LWF A;  5LMN E;  3J7A O;  1J5E E;  3KZZ A;  2WWY A;  4X6A J;  4DJA A;  4DR4 I;  4AIK A;  4LFB I;  1STZ A;  2E5N A;  4R79 A;  3ZRG A;  2O9L A;  2COB A;  3F23 A;  5HS8 A;  3HRM A;  1YIT I;  1LB2 A;  2VQE E;  2RN7 A;  5J1U A;  1OJL A;  4KHP I;  2L54 A;  3U9G A;  3WU5 A;  3R0J A;  5ELW A;  2DDA A;  3CCU I;  4BQO A;  3JAM Q;  1D8K A;  1EA3 A;  2HHH I;  3R61 A;  4LIU A;  2CG9 A;  1VQ4 I;  2NOJ B;  1ZXN A;  5EEA A;  1BI0 A;  1B59 A;  3CJQ B;  3CUO A;  4IOA F;  2IT0 A;  1REP C;  1ZM2 A;  1QO0 D;  2OAZ A;  1LJ9 A;  4UV8 A;  3DU6 A;  1IDY A;  4QPO A;  5FJ8 J;  1IUF A;  1SMT A;  2O61 A;  1Z7U A;  4HZF A;  1HCR A;  2VXZ A;  1LDJ A;  3ESW B;  3DKY A;  2H8R A;  2NVT J;  4LF5 I;  3P3E A;  2E19 A;  4KIG A;  1USS A;  2ZXI A;  4I0B A;  4KJZ A;  1TQM A;  2ECB A;  1MMS A;  3KYC B;  2JA2 A;  2JEA B;  3K9T A;  2VPR A;  1IXR C;  3L00 A;  2KJC A;  2NN6 B;  5K36 F;  3B6C A;  5EL9 A;  4ETS A;  3GTM J;  1IBM I;  3CCS I;  2FOW A;  2Y2Z A;  1YYV A;  3MVP A;  4E4H A;  4JI4 I;  2YUS A;  1YJN I;  3CF2 A;  3IKT A;  2OPT A;  1Z0V A;  2Q2E B;  2CO5 A;  2MH9 A;  3LQR A;  3WTW C;  1MND A;  4K0K I;  4A5M A;  3CDI A;  1S6L A;  3I5U A;  3L7W A;  1MH3 A;  3BCA A;  3GZ6 A;  4PGG A;  2JA7 J;  4XK4 A;  1ZR4 A;  2RQQ A;  3WTX C;  2CQK A;  1TNT A;  2R92 J;  3ABL H;  4LF4 E;  2D2W A;  2M30 A;  1MBK A;  4OKG A;  5K1Y A;  4R1H A;  5LL6 R;  4A5N A;  3H9G A;  2O5R A;  1VQ7 I;  4ZVI A;  1ERD A;  4IFD A;  1TNS A;  2F6C A;  2KP6 A;  4X0G A;  1I94 I;  2ETH A;  2IA2 A;  4P9U A;  2V26 A;  2H6C A;  3BG7 A;  2ZBK B;  3KRN A;  2DO7 A;  3J81 Q;  5DRP A;  1XCB A;  2RGV A;  3CDL A;  4EM2 A;  4J3D A;  4YFK F;  3F8M A;  5EG0 A;  3WTY C;  5D4S A;  4JI8 I;  3I59 A;  2UXD E;  1F43 A;  5IT9 C;  3H35 A;  5D4R A;  4AIH A;  2Z2S B;  4RB2 C;  4I0A A;  1MGT A;  4HX7 A;  3E7L A;  3QP5 A;  3AG1 H;  3SZG A;  1D1A A;  2LJP A;  2VC0 A;  3U21 A;  1IG7 A;  1R49 A;  2MAB A;  3L2V A;  2EFP A;  1P7I A;  3K4C A;  1XSD A;  2A69 F;  1P2F A;  3E1S A;  1WHU A;  4D7N A;  3GTO J;  2JEB B;  3EYY A;  1WVR A;  3HGY A;  2AXL A;  2LG4 A;  2LY1 A;  2P6T A;  1YHC A;  1OR7 C;  2L7Z A;  2P8T A;  3S32 A;  3VOE A;  3OS1 A;  1Z9C A;  2Y0M A;  4AC0 A;  1XX5 A;  3C3W A;  1N77 A;  4IX7 A;  2V9K A;  3MZH A;  3OL4 A;  1KQ0 A;  3GCM A;  1GVJ A;  5C3E J;  3CQZ J;  2VKE A;  3EUH A;  4A0Z A;  1Z0C A;  1R6R A;  2HGC A;  3F8N A;  4P96 A;  3O6B B;  1LPQ A;  4E7J A;  4GDF A;  1SVL A;  3J7A M;  1G3T A;  2E36 A;  4ZZL A;  5CPR B;  2DA3 A;  3ZMZ A;  2O1T A;  5LHH A;  2E7W A;  4ENJ A;  1MMG A;  1DUX C;  3WTV C;  2A6T A;  4MHG A;  4NQW B;  4XLH A;  3MMY B;  1XSX A;  3W6K B;  2LKS A;  1LDD A;  3OYG A;  5F1J A;  1X4P A;  1Z21 A;  2FX0 A;  1JKP C;  2EFQ A;  4UY8 I;  3JAM C;  1LE8 A;  3WE2 A;  4DZJ A;  1ZRE A;  4DR5 I;  3QAH A;  1YW8 A;  2Q0O A;  4M73 A;  1H74 A;  1WPK A;  3DV8 A;  4IRI A;  2R5Y B;  2DFE A;  4LFC I;  1VI0 A;  3IC7 A;  1B1B A;  5DD4 A;  2Z5B B;  2X1C A;  2OUM A;  3H5A A;  3B82 A;  3KP4 A;  2K4J A;  2R7D A;  4CXF A;  2DCE A;  3JRD A;  1FOY A;  3AL0 C;  1NHJ A;  4QNK A;  2KZV A;  2L2O A;  1BM9 A;  2IAI A;  3SEQ A;  2VBY A;  3P3G A;  1Z0B A;  4JYA I;  3BT9 A;  3DPU A;  2AE8 A;  1BC7 C;  1DQU A;  3DTK A;  4OZE A;  3A1Y A;  4FW6 A;  3GX4 X;  1VQK I;  5EGO B;  5HS9 A;  4PRX A;  3B4T A;  3KP7 A;  4CSW A;  4LF8 I;  4X66 I;  1IAW A;  4IHT A;  1Z6R A;  2STT A;  5LBQ A;  1A36 A;  2JE6 A;  1ZRD A;  4EMS A;  1X1D A;  4E70 A;  1R22 A;  2W24 A;  3K4K A;  4LG3 A;  4QPQ A;  1HC8 A;  1ZXM A;  2NNN A;  2O1U A;  2WP8 B;  1HR0 I;  1O3S A;  2GQ0 A;  1JJ8 C;  3LNQ A;  2XB5 A;  1FZP B;  2IGK A;  4WXC A;  2OV7 A;  2YPR A;  3ABK H;  4M3E A;  3HHG A;  1HLV A;  2PJP A;  3VYT B;  3AG4 H;  4HDV A;  2KIS A;  2NAZ A;  3EET A;  1RNL A;  2NS0 A;  3BG9 A;  3GTG J;  2YS9 A;  2Q1Z B;  2P81 A;  4ZJZ A;  2Z1D A;  4DNC A;  4R1F A;  5FWK A;  2VN2 A;  3MEX A;  4AVP A;  1WUU A;  5E18 F;  4ZZD A;  2WAE A;  3WOD F;  2LC2 A;  3W6V A;  1EH7 A;  1XNQ E;  1EA6 A;  1IV8 A;  1FMW A;  1LEA A;  4XKV A;  2OD5 A;  2W25 A;  5A2Q Z;  4LF4 I;  4E7K A;  3KCC A;  5EYR A;  4C30 A;  3WU3 A;  1TT5 B;  2XRL A;  5BPI A;  4HF1 A;  3CD6 I;  3G6E I;  4YIF A;  2ZFU A;  1MDM A;  1NTC A;  3LTO A;  2VQF I;  2HQN A;  3ZZT A;  4R8H A;  4BYY A;  1T8I A;  1HNX E;  4IF4 A;  3I4P A;  2M7A A;  2P7V B;  4DV7 E;  5J3L A;  4XRF A;  1Z3Y A;  1MJA A;  4U0W A;  3BG3 A;  4E7S A;  2X4H A;  1KVK A;  4QSH A;  2C39 A;  1V55 H;  2XAJ A;  1YW9 A;  1Y39 A;  1FJG E;  1B8I A;  3PYE A;  2PMZ A;  4YEJ A;  2R5Y A;  1OYI A;  4UT4 A;  5E3L A;  3PQJ A;  5A2Q K;  1QPM A;  4M3B A;  3RQI A;  3ZPL A;  2VKH A;  3FK6 A;  2BA0 D;  2L9S A;  3ZQF A;  1OMI A;  2HU9 A;  1BIB A;  1FBS A;  2GIZ A;  5D6E A;  3OYJ A;  1O3Q A;  3CUQ C;  2KZG A;  1WJA A;  5AON A;  1G3Y A;  2DW4 A;  2M8G X;  2QBY A;  2R7W A;  1J0R A;  3DLA A;  4H0E A;  5ICC A;  1HR0 E;  1H9G A;  2BV3 A;  2EA2 A;  4LF7 E;  4WUC A;  4C3H J;  4CCL A;  4B3S E;  1ZGJ A;  2QA4 I;  1V5F A;  3K4M A;  1AOY A;  1UG2 A;  5D5U B;  4WK8 F;  1MMA A;  4IS9 A;  1RPW A;  1S4E A;  1R7J A;  4GXO A;  1MJ9 A;  2DT7 B;  2RDP A;  2AQF A;  2ELJ A;  4IKF A;  1ZYR F;  4DPY A;  1BR2 A;  3RKY A;  4E7I A;  1ETQ A;  4LMY A;  1WH7 A;  4HV6 A;  4L9N A;  2ZXH A;  1DU6 A;  3CC4 I;  2VL8 A;  4OO1 A;  1MMD A;  1JKO C;  4BJT A;  1C0W A;  4DV0 E;  4IFD F;  4IL6 C;  1ZRC A;  4OU0 A;  4XQF A;  4WX9 A;  1L0O C;  2CRG A;  2HDC A;  1ZHF A;  1ETK A;  3F21 A;  3ZQI A;  2R0Q C;  3MD2 A;  1DP3 A;  2WP8 A;  3WTT C;  4D0P A;  4XLA A;  2DOD A;  2CUF A;  4DV5 E;  3DF8 A;  5D5X B;  4MU0 A;  3HZJ A;  1R5G A;  2FU4 A;  4HBL A;  4KIF A;  1NK3 P;  5LMU I;  4B3R E;  2EZL A;  4LLG F;  1YW7 A;  3CLQ A;  2CUJ A;  2PI0 A;  2DBB A;  3J80 Q;  3CCJ I;  3SZT A;  5DDG A;  1W7P B;  5H6Q A;  2WW4 A;  1RR7 A;  1ZG3 A;  2CWE A;  2LY2 A;  5D8K B;  1P4W A;  4U7D A;  1Q1H A;  1B63 A;  2F4I A;  2NVY J;  1VND A;  4L18 B;  1BJZ A;  9ANT A;  3BLY A;  3J81 Z;  2R7V A;  2LP0 A;  1I50 J;  2WAF A;  4A2U A;  1UJ8 A;  1KA8 A;  1NHA A;  4XLF A;  2PJR B;  1FI4 A;  5DM7 F;  3F9K A;  1YS7 A;  4O3M A;  2W84 A;  3FK7 A;  2UV1 A;  5K5O A;  3ZN0 A;  4KYW A;  2QSF X;  1BOA A;  3HKZ A;  3GTQ J;  1H9T A;  4DYC A;  3BJ6 A;  3E3V A;  2H8W A;  3PFI A;  2M8E A;  4NC8 A;  2KPM A;  4DUZ E;  1YG2 A;  1Z91 A;  1HKQ A;  3FMR A;  2JUC A;  1SD5 A;  4ASN A;  3BG6 A;  4UB6 C;  3T1H E;  3WU4 A;  2UU9 E;  4XKB A;  2ESH A;  4USK A;  3CLO A;  5D8L B;  2UXD I;  2P4W A;  2QSH X;  2R7U A;  4PJL A;  4BXF A;  3KEY A;  2VAS A;  2A61 A;  5GMD A;  1WJ5 A;  1RRE A;  2CQN A;  5C0X C;  4IJA A;  4HQE A;  3DP7 A;  1HNZ I;  2HR3 A;  3RTR A;  2DEJ A;  4XRM A;  4OOI A;  3TO7 A;  4NXM E;  3EUA A;  2HQA A;  2R7S A;  3D5S C;  3HC7 A;  4CO8 A;  4IFD B;  2DYS H;  1Y6Z A;  1N32 I;  3FHN A;  4X1E A;  1LVA A;  1JT0 A;  1TC3 C;  2HVQ A;  3ZCO A;  3BY6 A;  1IV6 A;  4FW4 A;  5B1A H;  2V1N A;  2COM A;  3ML6 A;  3GWZ A;  3JRG A;  2C6Y A;  1N78 A;  2NXN B;  3ZGK A;  2ZJR F;  2G7H A;  3OIO A;  4ZYD A;  4F55 A;  4LFA I;  1PVG A;  3CC7 I;  1XN7 A;  2VE9 A;  3A0H C;  2F5D A;  4C2M J;  1PUF B;  2KJB A;  2Y30 A;  4XN0 A;  1SFX A;  5K7F A;  3LSH A;  3RSN A;  3ZQH A;  1KZH A;  5FO5 A;  4WWC A;  3KP5 A;  3OS0 A;  3DBH B;  1YJ9 I;  1U9N A;  2F48 A;  4E6K G;  1XSV A;  1VTN C;  2OTL I;  4ABZ A;  2LMD A;  3P7N A;  4W1U A;  2XV4 S;  5GAG J;  3M7N G;  3LL7 A;  4E7Z A;  3OV8 A;  3IH3 A;  3ISP A;  1SFU A;  3GVA A;  4BQQ A;  4UUS A;  4XBF A;  3DFG A;  4BQN A;  4XRS G;  3OYD A;  4HDU A;  1G8X A;  4BE0 A;  3CJR B;  3HSF A;  3IH2 A;  4BBR J;  4LPF A;  4L5J A;  3ZOB A;  4HW0 A;  4UNO A;  4A0X A;  2IVM A;  1ON2 A;  3TDZ C;  4DR2 E;  2FF4 A;  4OMY A;  1IBL E;  2Y9Z A;  2GOM A;  4G6D A;  3V8J A;  4AID A;  5BR8 I;  1N34 E;  3CCQ I;  4XKC A;  2DOE A;  3BOQ A;  2HYG D;  4NXN I;  4BS9 A;  3PO3 J;  2Z5E A;  4DBR A;  1Y1V J;  2EWN A;  1VF9 A;  2F4O B;  3WU1 B;  3K4N A;  2BA1 G;  2QSG X;  1HW1 A;  2UXC I;  5E1Z B;  3N4M A;  2L7K A;  4DOZ A;  1J59 A;  4KIS A;  2V9P A;  4DV1 I;  3HPH A;  4DZP A;  2FNA A;  3ZQL A;  1Z5B A;  3BTI A;  2EB7 A;  2R7R A;  5DYM A;  5JFR A;  4ESJ A;  2VQH A;  3PNT A;  2BY1 A;  2HZD A;  3ZQ7 A;  3DTE A;  2CJJ A;  1OLT A;  2K9Q A;  2Y9Y A;  1W36 D;  1XHK A;  2BBY A;  3GZ5 A;  3HJC A;  1N36 E;  3TKY A;  3OY9 A;  3OYI A;  5CVU A;  3M6A A;  3CDH A;  1DGW Y;  2K9M A;  3IRR A;  3GF2 A;  3H36 A;  3M07 A;  4LG0 A;  1K79 A;  3FXL A;  5EZH A;  1VQM I;  3O3K A;  1BKN A;  2M2E A;  4KFC A;  5C0X F;  3W2V A;  3I56 I;  5K7H A;  4A3B J;  1U0J A;  1YE9 A;  1FBU A;  1OCR H;  3KZY A;  4XRS A;  2BA1 D;  1YIO A;  2HTS A;  4V2G A;  1F4K A;  4G7O F;  4H4K C;  1N33 E;  4RM3 A;  1R1V A;  4ITV A;  1XMA A;  5FRN A;  1E3P A;  2DDB A;  4GO1 A;  1PDN C;  4WUB A;  3SFZ A;  1IZ1 A;  4M9Z A;  1JHF A;  2VJ4 A;  4A3F J;  1SD6 A;  3CMM A;  1YIJ I;  1RET A;  2KQR A;  2XKP A;  4MEX F;  2Z3Y A;  3PL8 A;  2LKP A;  4HG2 A;  1F1Z A;  4WXD A;  5IP6 A;  2F4V I;  3M7G A;  5BS6 A;  3PS3 A;  4OIQ F;  3P76 A;  4JI0 E;  4Q4Z F;  1I1S A;  1T56 A;  1OJ4 A;  4QLC U;  3CMA I;  2QF7 A;  2JA8 J;  4A3J J;  2BY0 A;  4X62 E;  3QPT A;  1ZKG A;  4DR7 I;  2OQR A;  2BZT A;  3H9J A;  5F64 A;  2ME6 A;  1Y4U A;  5FLX Q;  3RJP A;  3K17 A;  4XSX F;  2V1U A;  2PNZ A;  1OYW A;  4I3H A;  3COA C;  3J80 C;  2HKO A;  2Z5C A;  3TED A;  2R4G A;  2VC1 A;  3DU5 A;  4B3M I;  2CU7 A;  3KEQ A;  2RV8 A;  3DCF A;  1TQP A;  3ABM H;  4O5V A;  5M3F J;  1MKM A;  4X65 E;  1HNW I;  2V2Q A;  1V5G A;  2O8X A;  4GGG A;  3FIW A;  3K4L A;  1R6M A;  3S1Q J;  4BHC A;  1JKQ C;  4JOM A;  4IZJ B;  2OCE A;  2VF3 A;  3VPR A;  1W1W E;  5K36 B;  3JRF A;  1WJF A;  2W82 A;  1BI2 A;  3IAM 2;  4KT6 A;  3SDB A;  4BE1 A;  1H0M A;  1ZM4 A;  3BDD A;  2B63 J;  2FA5 A;  5K5R A;  3BCB A;  1B6A A;  3BJA A;  4XOR A;  4YEL A;  2JTV A;  4U3B A;  1FJL A;  1R4N B;  4OAY A;  4MQV A;  4XL9 A;  4F7Z A;  3PS1 A;  1R58 A;  3LST A;  1S7A A;  5DNL A;  4X64 E;  1W4M A;  5FRO A;  1D0Z A;  4DXL A;  3B73 A;  3CES A;  2IER A;  1FNN A;  2G7U A;  1I6H J;  2HQR A;  1BIA A;  2NPF A;  3IRQ A;  3BTJ A;  2UWM A;  2DN0 A;  4DUZ I;  3I58 A;  2HFU A;  1R71 A;  1IBL I;  1HXD A;  2PG4 A;  2ZNZ A;  3BR6 A;  2ZJQ F;  3S1R J;  3HOY J;  4A3C J;  1YH8 A;  2VQE I;  2WAD A;  5GTH C;  4LLL A;  3OYH A;  2O8K A;  2VOD A;  5A2Q C;  3T1Y E;  2L0K A;  1QA6 A;  4EQQ A;  3L7Z B;  3A01 B;  3B8H A;  1WJC A;  2L4M A;  3M85 D;  2G0E A;  1WKM A;  2DQL A;  4OIP F;  4G94 A;  2H27 A;  1UDO A;  3VWB A;  2FOK A;  1Y60 A;  1MJB A;  2CMP A;  1HA8 A;  1TT0 A;  1HBX G;  1AA7 A;  4XSZ F;  4CUG A;  1RR9 A;  3K1P A;  3TBI A;  1IBM E;  4OO1 B;  2QKM B;  4XNF A;  3F0C A;  6PAX A;  4I09 A;  1O3T A;  5CVJ A;  3LOC A;  3FXU A;  1ETV A;  3E6D A;  3L2R A;  1JKR C;  1GT0 C;  4GKJ I;  1P4X A;  1U2R A;  3VYU B;  3D5L A;  1D1B A;  3R4K A;  1OFC X;  4LB5 A;  5HLI A;  4LCG A;  4LFA E;  3GFJ A;  4TV7 A;  4ZYG A;  3ECO A;  3S2D J;  3ZR8 X;  2FSW A;  2CQX A;  5JVT A;  1NZ0 A;  3MFK A;  2PJR A;  2VPL A;  1IN7 A;  2FUG 2;  3R0A A;  3DPT A;  2BY2 A;  1IN5 A;  2QQB A;  1XDS A;  4PSX A;  1JUS A;  3FZV A;  3WGH A;  1O3R A;  4JI6 E;  4YHH I;  2JPB A;  4ENM A;  3IUO A;  5LEK A;  3A0B C;  1LKX A;  4DV2 E;  4FWD A;  2FD5 A;  2L5Q A;  2BW3 A;  3I54 A;  2KLO A;  2K40 A;  2X51 A;  4E7L A;  1JXS A;  3TL4 X;  1FOK A;  1O7L A;  4PJN A;  4II2 A;  1HNW E;  4WUD A;  4BQA A;  2WB1 N;  1HDP A;  3GYH X;  3QQA A;  5IWA E;  2DK8 A;  4LF6 E;  2CUZ A;  3P9C A;  1ENH A;  4HF2 A;  5EF6 A;  2JT1 A;  1A6F A;  2LRE A;  1PP8 F;  2IJL A;  2ZNY A;  3REO A;  2M5W A;  1SEU A;  3H5N A;  1KIJ A;  1TWG J;  3JTG A;  2IS4 A;  4UB8 C;  2E71 A;  2GBY A;  4AUX A;  2R7O A;  4OIN F;  1TWA J;  2M4K A;  1G3W A;  4JI5 E;  3LQQ A;  4M71 A;  3FXM A;  2HPM A;  2ESN A;  2W00 A;  4B1R A;  3OYN A;  2E35 A;  1ZTR A;  2O3F A;  1ONV A;  1ON1 A;  5JLW A;  2PNZ B;  4DR2 I;  1S7O A;  1QZY A;  2LH9 A;  4L9T A;  4P5O A;  3PYF A;  1HW5 A;  2NOG A;  3ZMS A;  4YY3 I;  4JI2 I;  4DBQ A;  5HOO A;  1D0Y A;  3D1N I;  2IW5 A;  1R4M B;  1TWF J;  3HRU A;  3R60 A;  3GO5 A;  1IBK I;  3Q3S A;  2NN6 D;  2O6G E;  5HVQ C;  2XAQ A;  3QYB A;  2HKJ A;  3G4S I;  2M7B A;  3CCE I;  1Z67 A;  1T08 B;  3HEF A;  4BAY A;  5DCF A;  3I53 A;  4XLP F;  2GO4 A;  4DU8 A;  3CUQ B;  1R1T A;  2J5O A;  2V79 A;  1B62 A;  1H73 A;  4U3D A;  5LGT A;  3F6V A;  2XEX A;  2FNP A;  2LLK A;  1JGS A;  3G2B A;  1XMX A;  2A2C A;  3K70 C;  1X1B A;  3WU2 C;  1TWC J;  1ELO A;  4CH7 A;  4OO1 E;  4I76 A;  3K70 D;  2H09 A;  1IN6 A;  2LVS A;  1BN5 A;  5LRR A;  3QPS A;  1OYS A;  4B43 A;  1WH5 A;  3LMM A;  3HUG B;  2F1D A;  2RNG A;  2CW0 F;  1K4T A;  5KVR A;  2EQR A;  2XAF A;  4JI8 E;  3RPU D;  2VON A;  1XNQ I;  4DV2 I;  1Y0N A;  4AD9 A;  1WCM J;  4Z6Y A;  3P3C A;  1K83 J;  4HX8 A;  4JQF A;  2L7M P;  2HTJ A;  3TO6 A;  3FBI B;  5E17 F;  2X7I A;  1YO5 C;  4XIC A;  5EDN A;  1OR7 A;  2K3P A;  1CQT A;  1YLF A;  3QOP A;  3VB2 A;  1H7U A;  2PO0 A;  1D3Y A;  3IL2 A;  4M74 A;  3ZXS A;  5M5Y J;  3N97 A;  4DUY I;  2DMT A;  3CME I;  1OQY A;  1UHW A;  3H5R A;  2NRA C;  1TW3 A;  4U87 A;  4L9J A;  4USM A;  1OKR A;  5K5Q A;  1YRN B;  2XSD C;  2DMN A;  4JI3 I;  1Z0T A;  3OMY A;  4NC7 A;  4DUY E;  2K02 A;  3OYM A;  2O1W A;  3KP3 A;  4MQ9 F;  5D6F A;  1FSE A;  2VJI A;  3FM3 A;  3G1L A;  1XG1 A;  4FET A;  2KRC A;  3SEZ A;  5IP9 J;  2XAU A;  3EYI A;  1V5E A;  2PMZ N;  4P1W A;  5L3E A;  3C2H A;  3QT8 A;  2K5C A;  5F1R A;  2GO3 A;  2B9S A;  3Q0U A;  5H6R A;  1RUO A;  4IHX A;  3GTK J;  1TWH J;  3V42 A;  2MSY A;  1HQC A;  1PIE A;  4XTJ A;  1XD7 A;  2XAS A;  4DPT A;  2EJR A;  1VQ6 I;  3AAF A;  3OIQ A;  4DPU A;  1WFX A;  1HKS A;  3Q6N A;  4L0Z B;  2CW8 A;  4Y17 A;  1XMQ I;  2X9D A;  3LFU A;  2P5V A;  2L3D A;  3DKX A;  5E1W A;  1QZE A;  3W6J B;  4AYB A;  4A3E J;  5FLM J;  3B02 A;  4KA4 A;  4Y3O A;  1OYP A;  2BA0 G;  4OMZ A;  1X3Z B;  4D5C A;  4IHV A;  3KET A;  5FRM A;  3IH4 A;  4ESF A;  5JEA B;  1FC3 A;  4G7Z F;  1HNX I;  3GON A;  1JUP A;  2WA0 A;  3GEZ A;  2EA4 A;  4YIR X;  1I1G A;  4X64 I;  3PQK A;  4EM0 B;  4IO9 F;  3TQN A;  1IF1 A;  3TOA A;  2XPU A;  1IBK E;  4J19 A;  3S3O A;  3PS2 A;  4DR1 E;  2WY7 Q;  2ZXW H;  4Q47 A;  2H6B A;  3O8H A;  4PRV A;  2IA1 A;  4BA1 B;  1DU0 A;  4HRI A;  1A04 A;  2EIN H;  2MLK A;  1QVU A;  2XPW A;  4RMN A;  1R00 A;  2XAG A;  1FYK A;  4PCQ A;  1J9I A;  1NK2 P;  3UHM A;  2CQQ A;  2H1L A;  4BNC A;  1UST A;  2E5Z A;  2QKL B;  3BZ6 A;  4JV5 E;  2R7X A;  5IYB J;  4W97 A;  1T33 A;  2V9V A;  1KON A;  2XHK A;  2FXA A;  1Y8R B;  5EGO A;  1JGG A;  1ITY A;  4JP0 A;  5BR8 E;  4BU2 A;  1SAN A;  1KTV A;  4DV4 E;  1N34 I;  3CCR I;  3D0S A;  4ENK A;  2NN6 F;  1ZG1 A;  4NHJ A;  2NVX J;  2DOF A;  2IGN A;  1U6G A;  2GA1 A;  3KLN A;  1T0F A;  4C9Y A;  2HVR A;  3S3M A;  4DR1 I;  2VI6 A;  2QCO A;  3W2A A;  2BV6 A;  1KYW A;  1Y1W J;  2DEI A;  2UXN A;  3HOT A;  1B4A A;  2EBI A;  2CQ7 A;  3OYF A;  1HNZ E;  1RES A;  5DCM B;  1EH6 A;  1TTY A;  4DV6 E;  2GAU A;  4YRV A;  4MLO A;  1PUE E;  2EFG A;  4NXM I;  1P9Q C;  1K6Y A;  3MZ8 A;  3NEU A;  2CUE A;  3K69 A;  4XN3 A;  5FLV A;  3U1Y A;  3E5Q A;  4MYU A;  4GKJ E;  2CYY A;  2ZO4 A;  5JHF A;  1N0U A;  4Y33 A;  3OR2 C;  4BY7 J;  5J47 A;  3CCL I;  1MG7 A;  5HS7 A;  5IT9 K;  5JEA F;  1Y0U A;  4FAS D;  2DMP A;  4F92 B;  5HOD A;  3A01 A;  5GPA A;  1YJW I;  1OPC A;  4DR6 E;  5HDN A;  3BZC A;  1W0U A;  2JQ7 A;  4HNU A;  3L2W A;  4HSR A;  3A4C A;  4II3 A;  3QRF F;  4MDT A;  1Y56 A;  3BR5 A;  2MGQ A;  3LAP A;  2VUM J;  2FRH A;  2DFF A;  3KP2 A;  2QEN A;  3BPV A;  3G1O A;  3T5X A;  5JEA E;  1FT9 A;  1WQ2 A;  3FX3 A;  2DA1 A;  3NWS A;  4CGZ A;  1K78 A;  3E5X A;  4LIV A;  5AIP A;  1JTY A;  3HJE A;  1XGM A;  3OYB A;  1DPR A;  2B0L A;  4MNU A;  3JSO A;  1G6N A;  3IWF A;  3P5J A;  2Z16 A;  4G9Y A;  1Z0X A;  2ADU A;  2KIQ A;  4BDZ A;  4S04 A;  5IT9 Z;  2WB1 A;  3CP8 A;  3CF5 F;  1RRJ A;  3VDX A;  1TW2 A;  1TBX A;  2NN6 C;  1E3H A;  3K7A J;  1BJA A;  4IZK B;  2V1X A;  4RM2 A;  3QYF A;  4B3R I;  1XMO I;  1IRG A;  4LD5 A;  4M3G A;  5JVG F;  4A6E A;  2AO9 A;  5ILU A;  3T8T A;  1CF7 B;  1YX5 A;  3IHU A;  3ZZ0 A;  3HGG A;  2KL4 A;  4DR7 E;  1ZR2 A;  3DKW A;  3HOU J;  1Z77 A;  3JRB A;  2OCC H;  3H3Z A;  5B1B H;  5DD8 A;  2UU9 I;  4GRI A;  4GYG A;  4MTD A;  4PK4 A;  3ZKD A;  2BGC A;  3CP2 A;  1UCR A;  3OYA A;  1X3W B;  1ZK8 A;  2E7X A;  5CQG A;  1D5V A;  3PO2 J;  3Q6M A;  3LSI A;  3L2Q A;  1ZG5 A;  1BBY A;  1GXQ A;  4LF8 E;  4NBQ A;  2CZ9 A;  4K2E A;  2P5K A;  1T38 A;  1ETX A;  4FCY A;  2OQG A;  1LDK B;  2L01 A;  2XF7 A;  4CDG A;  5KK1 A;  2R7Z J;  5L3F A;  3TOB A;  3ZP5 A;  2FQ3 A;  3S16 J;  2MYS A;  2WNR A;  5LFA A;  1P6R A;  3FXK A;  1SFE A;  4M6X A;  2DTZ A;  2HOE A;  4ZDP A;  5HDK A;  3S3N A;  1VFC A;  1UDN A;  1Z5C A;  2V8P A;  3ASO H;  4DR6 I;  2FQ4 A;  3BG5 A;  5LLQ A;  2X1D A;  4IQ4 A;  3FIS A;  3NAR A;  4IQJ A;  4DV1 E;  2X6W A;  3P9I A;  2L02 A;  3WU6 A;  3HRT A;  1UAA A;  2NYX A;  1NH3 A;  3K4B A;  1QVT A;  2QM3 A;  2WBM A;  4BEH B;  2ID3 A;  2Y69 H;  3M7N D;  1IJW C;  4JYK A;  1ZN2 A;  2M87 A;  2VXD A;  3WGI A;  4FWH A;  4PSW A;  5DEQ A;  4DR3 E;  3CZ6 A;  5GAD J;  2BHY A;  2MH2 A;  3CJT B;  1V54 H;  1XNR I;  4JX6 A;  1SVM A;  4YHH E;  2CFX A;  3U2R A;  3KLO A;  2HPI A;  3PM1 A;  5E8G A;  2MBF A;  1R5H A;  2IA0 A;  5GAE J;  4HNT A;  4MO7 A;  5ED4 A;  2HWV A;  2I10 A;  5ICG A;  1RR8 C;  2LDU A;  2KHM A;  1S3J A;  1BR1 A;  1MBJ A;  1I6X A;  5J40 A;  4F3Q A;  1E2X A;  2AJ4 A;  5GME A;  4AIJ A;  1FTZ A;  2O1V A;  2QBY B;  2V6E A;  2KIU A;  2DFI A;  4IXA A;  1OIS A;  3I64 A;  3Q0V A;  3PIP F;  2J65 A;  2MLG A;  2LY9 A;  4CCN A;  1XGO A;  3OIP A;  4FIS A;  2WAQ A;  3M3Y J;  5ICE A;  2MW8 A;  5FLX Z;  1SFK A;  4ZYA A;  1UG0 A;  2IXS A;  3WTZ A;  3DQV C;  1L3L A;  2FML A;  4A3D J;  3S17 J;  2CVE A;  2IOQ A;  4FWG A;  3LSK A;  5LHG A;  5CVV A;  2DPD A;  1QZZ A;  3LPS A;  4LF9 I;  4YFX F;  4C3I J;  5DCM A;  2DFH A;  3PNY A;  1T39 A;  3C1D A;  3ULQ B;  1APL C;  2IEK A;  1WGX A;  3QU6 A;  1Z05 A;  4UV9 A;  2QLZ A;  4Y7N J;  4PFP A;  1I39 A;  1ZGA A;  2ZM6 I;  2PEX A;  5LMN I;  4B09 A;  4EAT A;  4DPX A;  4LF9 E;  5FLX K;  1SMY F;  2HEO A;  2TCT A;  3HTS B;  1YX3 A;  1LFB A;  3PUB A;  2PO0 B;  4UXN A;  4OX9 I;  4FW7 A;  1VIS A;  1HW2 A;  2J5P A;  4F91 B;  2RAE A;  4F52 A;  3RZO J;  3UKG A;  3BTL A;  2UXC E;  1GUU A;  2K27 A;  2JMW A;  4BA2 A;  4IZZ A;  4UVC A;  4G12 A;  1ETO A;  3GFL A;  2Z5B A;  2Z5U A;  2Z33 A;  4J01 A;  2W57 A;  4KMU X;  2LD5 A;  3LNU A;  3A02 A;  1XMQ E;  5CQE A;  4ED4 A;  3QP6 A;  3RKW A;  5KHD A;  1UZC A;  1VQ8 I;  5A2Q Q;  5KCM A;  2VT2 A;  1OCO H;  3NRV A;  5BQT A;  2R7F A;  3RZD J;  5FD5 A;  2OBP A;  3IV5 A;  3JRH A;  5IPA A;  2DJN A;  4LK0 F;  3FBN B;  4NQW A;  2GLO A;  2X6Y A;  2HK3 A;  2PO2 B;  3GZN B;  2R93 J;  1IXS B;  4XID A;  3HSR A;  2PN6 A;  4ZDO A;  4BA1 A;  3DTI A;  1OCZ H;  1D0X A;  4JI6 I;  1HF0 A;  5E3M A;  1ZRF A;  1FNM A;  5L3J A;  1MIJ A;  4A6D A;  4RGR A;  2HDD A;  3K4J A;  5LEJ A;  3LAJ A;  1XC5 A;  1ZEL A;  1H7S A;  2UUA E;  3CWV A;  1D6T A;  4HST A;  4ZTF A;  2C37 A;  3J7Z I;  3RI4 A;  3AG3 H;  1HST A;  3DEU A;  2BYV E;  2M0C A;  3DBL B;  3JAM Z;  2DA2 A;  1MBE A;  3RPU A;  4BJ6 C;  2GS8 A;  1B9M A;  1KU7 A;  4HY1 A;  5E1X A;  3FMS A;  2X85 A;  2M34 A;  1WRJ A;  2XPV A;  4C2U A;  3B78 A;  2XGC A;  4BHB A;  4X66 E;  1J5Y A;  1MNE A;  3JRI A;  2QEX I;  4JX5 A;  1UMQ A;  3UR3 C;  1VQO I;  1WI9 A;  3PJR A;  2YR2 A;  3H9Q A;  3RQ4 A;  4CCK A;  1FOW A;  2AQE A;  5K36 C;  3HYI A;  1H88 C;  3GTL J;  2B7E A;  2KKO A;  1SFO J;  3I4M J;  4F93 B;  4UHT A;  1OCT C;  2CV0 A;  5M3M J;  5FKK A;  3L7Z A;  4CA0 A;  1WJB A;  1A31 A;  3ZQC A;  4OO1 F;  5FGM A;  3HRS A;  2JJ7 A;  3LFK A;  2GM4 A;  4Y4R A;  3G73 A;  5AIQ A;  3V7R A;  4DR3 I;  3KEO A;  1FP2 A;  3F72 A;  4DR5 E;  3RKX A;  3SDG A;  3V8L A;  1W36 C;  2F5V A;  4X65 I;  4WXH A;  5F0H A;  1IRF A;  5E79 C;  2JRM A;  3SYT A;  2PFB A;  3ONQ A;  2E1M C;  1ZGW A;  5DTD A;  4MEY F;  1YI2 I;  4EM1 A;  3HOW J;  4RB1 A;  3JRE A;  1Z3X A;  2M45 A;  3C7J A;  4A3K J;  4PU9 A;  2H1K A;  3E97 A;  4L9V A;  2ZC2 A;  3RYP A;  1BR4 A;  4LFU A;  3JTH A;  3KX2 A;  3OYL A;  4GFB A;  4RS8 A;  1U9O A;  5CKT A;  2JSP A;  3MKW B;  3RIR A;  4HLX A;  2X36 A;  2CGP A;  1KQ9 A;  2A5W A;  1FJG I;  2EIK H;  2EFO A;  1S8N A;  1N36 I;  3I59 B;  2VIX A;  3WGG A;  2R7T A;  1S29 A;  2AHQ A;  1X4O A;  1HKT A;  3HXL A;  1QHG A;  2F4M B;  2H94 A;  1BI1 A;  2JSC A;  5E8I A;  1J2X A;  3OOU A;  2RVC A;  1RKW A;  1LFU P;  2LF8 A;  1ZLJ A;  5DM6 F;  2MG4 A;  3J7A Y;  3MCZ A;  3JRC A;  5FFZ A;  1ACI A;  4RGX A;  1IGN A;  3QT6 A;  3KYD B;  1Q1V A;  1I27 A;  1MNM C;  1G3S A;  1MMN A;  4A93 J;  2ELH A;  3M4O J;  1QU3 A;  4CZZ A;  5C4X J;  3FXJ A;  2A6E F;  4HX4 A;  2KRH A;  4IZJ D;  1Z59 A;  4ZC3 A;  5GP9 A;  5DV5 A;  5HLT A;  2V4J C;  3TW6 A;  1CF7 A;  2JA6 J;  2OU2 A;  5HNH A;  4G6T B;  3FWE A;  4A3G J;  4PGH A;  1AWC A;  4M3F A;  2VQG A;  3ZQQ A;  4M9X A;  2CFO A;  3OOP A;  3VSK A;  5HNF A;  2JN6 A;  2W48 A;  4PJ0 C;  1T95 A;  3EDP A;  1IRX A;  1CGP A;  2CG4 A;  2MC4 A;  2JRT A;  2R3S A;  4BUP A;  4D7M A;  2K9S A;  4BGD A;  4ENN A;  1JJ6 C;  4EJT A;  1AU7 A;  3BWG A;  2HKE A;  4I98 B;  3EQL F;  4XOT A;  2VQL A;  1MZB A;  2PO1 A;  3L9F A;  3HIF A;  2W1O A;  2I5U A;  3F22 A;  3J81 K;  4XON A;  2CV2 A;  2VOO A;  1EJ9 A;  4C3J J;  4AU7 A;  1DDN A;  3OYE A;  4LOM A;  1I3Q J;  3JW4 A;  1KU3 A;  1YS6 A;  2EIL H;  2PNM A;  4IHS A;  1GXP A;  5IYC J;  5FB2 A;  4BL0 B;  1S5L C;  1FIA A;  2PLY A;  2E2H J;  4ON0 A;  4B3M E;  5L3C A;  4N4N B;  3FF5 A;  1AHD P;  4IHY A;  2NS7 A;  3I71 A;  3E0J B;  1RUN A;  5C0X D;  2HOS A;  4RB0 A;  3IAS 2;  3CC2 I;  1KU9 A;  2RRE A;  2A2D A;  3S2W A;  2X0L A;  2XAH A;  2A07 F;  2K9L A;  4MGR A;  3G71 I;  3K10 A;  4GCV A;  1QBJ A;  4GKK E;  4C2T A;  3TW7 A;  3FKI J;  3MAJ A;  2JPC A;  3F3X A;  2MC3 A;  4AWX B;  5TRD A;  2OF7 A;  2NN6 A;  2LNB A;  1ZAO A;  4Z7C A;  3BQY A;  5CVR A;  3H92 A;  5KAF C;  4RGS A;  4S05 A;  2VBX A;  2DJI A;  5JI6 A;  1BL0 A;  2O0Y A;  4A3M J;  2KRF A;  2DQR A;  3HG9 A;  4CCM A;  2E1C A;  3CCY A;  2WV1 A;  2ZIT A;  1AKH A;  4N4O B;  1KQ8 A;  3K6G A;  2BEO A;  2E60 A;  4UVA A;  2VKV A;  3WG9 A;  4AVZ A;  5J4Y A;  3KPH A;  4QTR A;  3MKY B;  4RGU A;  3F8C A;  3I0T A;  2M0M A;  5K36 A;  5CJ9 A;  2OZU A;  4OX9 E;  5BOX A;  2E34 A;  2D1V A;  4YII A;  4RA2 A;  2GWR A;  2NN6 E;  2IS2 A;  1EF4 A;  2Y0S N;  4HEA 2;  2GA2 A;  3BTC A;  4KMF A;  3HTU A;  1U2W A;  2E1R A;  4P9F A;  1IN8 A;  4FW9 A;  3JAM K;  1Z7L A;  3ZMV A;  3ZMU A;  5L3D A;  4FN5 A;  1FMV A;  5HLH A;  3ECH A;  3VOD A;  4Z2Y A;  4P52 A;  2XUB A;  4B44 A;  2E2I J;  3F8F A;  3GTJ J;  1F5T A;  1T0F C;  2DOA A;  2K85 A;  2VE8 A;  2Y0S A;  2ZJP F;  2DPU A;  2GQQ A;  1LQ1 A;  4MQY A;  5F0F A;  2FMY A;  4DV3 I;  2UXB E;  3PYD A;  5IOY A;  2PO1 B;  2HZT A;  2HOA A;  3QPL A;  2DMU A;  4RAF A;  3NZK A;  5LD2 C;  2CGE A;  3CUQ A;  5JEA A;  4KHP E;  3T8R A;  4DQ2 A;  1KKH A;  3M85 G;  4JI3 E;  3EUH C;  3VYR B;  1OYR A;  1O7F A;  2ISZ A;  4D1Q A;  4S0H B;  4ZYH A;  1SD4 A;  2XC7 A;  2JVH A;  1NG7 A;  3PIO F;  2WAQ N;  2EFW A;  4FX4 A;  3ZM7 A;  5B3S H;  1A6I A;  3WHC A;  2ZME C;  4HYM A;  1D5Y A;  4G8X A;  5GTI C;  3ZN1 A;  1E3O C;  5M5X J;  2JWT A;  1K4S A;  5FKO A;  1P7J A;  1QPI A;  1S9H A;  1O4X A;  1UEL B;  4YG2 F;  2VKD A;  1PKP A;  2EZK A;  5FKN A;  3TDU C;  1X2M A;  2R5Z A;  4U7B A;  2BR2 A;  4FW3 A;  4Y15 A;  1Z0G A;  4EMD A;  3Q1Q A;  2Z99 A;  2ZFW A;  1F9N A;  1W5S A;  2WNR B;  2JUG A;  3K2Z A;  4UUS B;  4DW6 A;  4DYR A;  5BMZ A;  5EJC A;  5C0X E;  2Q8K A;  5H2F C;  1ZAR A;  1NG6 A;  3MN2 A;  2GXG A;  1ORK A;  4LF7 I;  1KGS A;  3OTO I;  4BXU A;  2Y75 A;  4NUB A;  3WE3 A;  4JI1 I;  1X1A A;  3EUK L;  5FD6 A;  2E1O A;  4U0V A;  3H3U A;  4KIB A;  2XVC A;  1U5T B;  2DA6 A;  1UHM A;  1AKH B;  4MU1 A;  4HAC B;  4P55 A;  1P4A A;  2HNH A;  2BHZ A;  2L9N A;  2UXX A;  3GXO A;  2XB0 X;  3PNV A;  2J7K A;  3H3V K;  2XDV A;  3LA2 A;  4B4C A;  5DRO A;  1JHH A;  2IPQ X;  2HYJ A;  2EPF A;  4RB3 C;  1PJR A;  5LGN A;  4BY1 J;  1X19 A;  3ROU A;  1FPQ A;  3CTA A;  4I6Z A;  3L1P A;  2VBW A;  1FP1 D;  2UUB E;  2LTP A;  3AL0 B;  3P06 A;  3I55 I;  1JE8 A;  4FE4 A;  3KFW X;  4FTH A;  1V3F A;  1P92 A;  4PJM A;  4XR6 A;  2ZXJ A;  3ZZU A;  1Z0E A;  5F6F A;  2DA7 A;  5F27 A;  2LR8 A;  4GQU A;  4BKX A;  2I8D A;  2YU9 J;  1YTY A;  4CYD A;  1MSF C;  1UB9 A;  1GDT A;  3KYL A;  1UEK A;  3E5U A;  4K0K E;  4Q5S F;  1OCC H;  1W7P D;  2ZSH B;  1YHQ I;  4Y52 J;  2XGX A;  4HXZ A;  3HUG A;  3S8P A;  2EV0 A;  1Y4S A;  3QPH A;  2A3S A;  3SZP A;  2OI2 A;  1XMO E;  1RKT A;  3S2H J;  1I3A A;  4M6V A;  1S7E A;  3DXJ F;  4EEF G;  4XM3 A;  3CO7 C;  1IO2 A;  5ERI A;  2XRO A;  3Q5F A;  1FLI A;  1MSE C;  4LFB E;  1Z5A A;  4RLQ A;  1V4R A;  1JUM A;  2NNY A;  4UUT A;  3HL2 A;  4V2F A;  3O2P E;  3JRA A;  2FEZ A;  3AKZ A;  3Q0W A;  4PJJ A;  4U88 A;  1I94 E;  2ZKZ A;  3K1M A;  2X6O A;  1XMK A;  1X58 A;  2HXI A;  4ZDL A;  4ZTJ A;  1FYL A;  3ZMD A;  5CLS A;  3CCM I;  1MU5 A;  2DT5 A;  3BP8 A;  1FX7 A;  1POG A;  2QGU A;  4KIC A;  4PZJ A;  3V2U C;  2AS5 F;  2MD0 A;  2XKO A;  3K0L A;  5B66 C;  4IZK A;  4MU3 A;  2XF6 A;  3I4N J;  2L4A A;  2UUC E;  3F8B A;  4N9H A;  5DRR A;  3H4L A;  4LCH A;  3M8J A;  3K1J A;  4L5E A;  4DIQ A;  2EIJ H;  5KAI C;  2KDZ A;  2Q2E A;  4QNJ A;  5EZG A;  2KT0 A;  4X62 I;  5EEG A;  5JEA C;  4RPF A;  2LBF A;  1QZR A;  1IXC A;  4OO1 D;  1KU2 A;  3X2Q H;  2K86 A;  2W85 A;  2WV0 A;  3HDD A;  4HAC A;  3LSM A;  3PSI A;  3NWT A;  2GIV A;  2E5L E;  5F08 A;  1TQI A;  3BJO A;  3W2W A;  2K7L A;  2F4V E;  3SFI A;  1QNT A;  3LSG A;  4WF2 A;  2E2J J;  2D45 A;  2Y48 A;  2LKX A;  4B47 A;  3RDI A;  4JI0 I;  2AXT C;  5FFX A;  1KYZ A;  1T98 A;  4XKW A;  3BRO A;  2WY8 Q;  2ELK A;  1B9N A;  1LUJ B;  2K4B A;  3TO9 A;  4ZH4 F;  4JYA E;  3HOX J;  2YU3 A;  5ILV A;  1ZM9 A;  2F5C A;  3C2B A;  3HHH A;  1E0E A;  4YY3 E;  4EJU A;  3WTU C;  1B8I B;  3QT7 A;  1N25 A;  1ETW A;  4HYE A;  4B3S I;  3MKZ A;  2FJ1 A;  2KFD A;  2QQ9 A;  4BA2 B;  4B48 A;  1G59 A;  1TZL A;  2HHH E;  2BM0 A;  2HDW A;  2A6H F;  2O7O A;  2MD5 A;  3T0Y A;  2XRN A;  5JR3 A;  2ME0 A;  3K1N A;  1J09 A;  1WSU A;  1BW5 A;  1VI7 A;  5GPC A;  3GUD A;  1UDS A;  2A05 A;  4HPQ A;  1I5Z A;  4KUM A;  3MWM A;  4G7H F;  4EGY A;  3A03 A;  2LK2 A;  4B3T I;  3QU3 A;  1EKE A;  3V8K A;  2DYR H;  2HVS A;  5EKW A;  3I9V 2;  3LA7 A;  5EG0 B;  1IRZ A;  4A3I J;  4I2O A;  4LF5 E;  2V1D A;  2TDX A;  1J75 A;  1FSH A;  4YFN F;  2V2V A;  2RNJ A;  3BR0 A;  4IOC F;  4HAM A;  2XGD A;  4MIM A;  2DXI A;  2R7Q A;  3MQ0 A;  5LRS A;  4XLC A;  1G4D A;  2GOX B;  4ANJ A;  1R36 A;  1PP7 U;  3J80 Z;  5DUK A;  3VYS B;  3VEP A;  3BPX A;  3FXO A;  5D5W B;  1W0T A;  1TLH B;  2EZI A;  3CDJ A;  3MZY A;  1UFM A;  2CS3 A;  2X48 A;  4MFD A;  3GFI A;  3BC8 A;  3F6O A;  3P9K A;  3ZKB A;  2CSO A;  2IS6 A;  2ECC A;  3L2C A;  3T1H I;  4NXN E;  1JTX A;  1DPU A;  4BBS J;  2LBF B;  3HOS A;  1GLN A;  1GHC A;  1Y5Y A;  4LCF A;  4IFD E;  2UUZ A;  2Z5C B;  1PVE A;  2IGO A;  1X1C A;  2CH0 A;  1K7A A;  1BA5 A;  1ULY A;  1GVD A;  5GAH J;  2DK5 A;  1VQL I;  5CVI A;  2OTJ I;  4AYB N;  4A0Y A;  1MBF A;  2HXO A;  3GTP J;  2DA5 A;  4XLE A;  4QIW N;  2DA4 A;  3M9A A;  2JEA A;  3QYE A;  1R23 A;  4N9I A;  1MD0 A;  4MFE A;  2NS8 A;  4DYQ A;  3TP0 A;  5IY5 H;  2O3Z A;  4I01 A;  4FE7 A;  3WG7 H;  4CHU A;  3K2A A;  1XTA A;  4IZJ A;  1WI3 A;  2JA5 J;  2BOL A;  3OTO E;  2XF5 A;  2VES A;  4MYT A;  2F5F A;  4DGW B;  2IS1 A;  3PYG A;  1N0V C;  5F0C A;  3RCO A;  2BXZ A;  5M5W J;  5D5V B;  1QRY A;  3BR3 A;  4IPA A;  3B6A A;  3QOE A;  1XS9 A;  2QQA A;  1K47 A;  3ABU A;  3GLL A;  1QQI A;  2L7F P;  3ASN H;  3M1C A;  4RAG A;  4ZYE A;  2CV1 A;  2HQ5 A;  4RAZ A;  1IDZ A;  5F04 A;  1WZ2 A;  3N05 A;  4DU7 A;  3TMO A;  5C44 J;  4BH9 A;  1SAX A;  1D8J A;  2JVG A;  3T1B A;  4FT8 A;  2X1E A;  2R42 A;  4URL A;  2UUA I;  2O03 A;  4OWR B;  3FKJ A;  2L9V A;  4HLY A;  5BNG A;  3GME A;  4G6Q A;  2G9W A;  5L3B A;  4A12 A;  2CW7 A;  1FTT A;  2K3F A;  2PX9 A;  1B72 B;  3HBL A;  5J8F A;  5J1R A;  3LSP A;  1DP7 P;  3F0N A;  2FBI A;  5FKM A;  2XGE A;  1XGS A;  3AG2 H;  2E5L I;  1R5I D;  1G2H A;  2HI3 A;  1XNR E;  4QWQ A;  1P42 A;  1SAU A;  3M8F A;  2HKX A;  4NB5 A;  2HK2 A;  4JI4 E;  1ODD A;  2JEB A;  5IWA I;  4IHW A;  2IES A;  4XOP A;  4U0Y A;  3FHZ A;  2DAO A;  1ZM3 A;  2BM1 A;  2QQ8 A;  4A3L J;  2V34 A;  3M1E A;  1IC8 A;  3O8G A;  1X1P A;  2EZH A;  3H1C A;  2QZ8 A;  3ERE D;  2EH3 A;  4DV3 E;  3VFZ A;  2UXB I;  2HFS A;  2VQF E;  5K36 D;  5J1Y A;  1UDQ A;  2DLL A;  2XSJ C;  5LMU E;  3UNG C;  4KN4 X;  1U3E M;  1ZH5 A;  3CO6 C;  4RBO A;  1K78 B;  1FWZ A;  1J5E I;  1LFP A;  1SC7 A;  3TGN A;  1YOV B;  1W5T A;  3KZI C;  3WHB A;  2V6C A;  2UZK A;  4L0Y B;  4EJO A;  5E3O A;  3EPZ A;  4L5I A;  4IFD D;  2LRD A;  2VOP A;  1FBQ A;  3QWL A;  4JI2 E;  2STW A;  5L3G A;  1H89 C;  5TGT A;  3CCV I;  1R9T J;  3S1M J;  2FE3 A;  1YFH A;  5IYD J;  3J7A G;  3RPQ A;  2JE6 B;  3HUL A;  3PRY A;  1Z1D A;  3SJM A;  4P7A A;  3V7C A;  5LHI A;  2GXA A;  3HKM A;  1PUF A;  1YRN A;  4DPW A;  2K9N A;  2C38 B;  3OWT A;  1EI1 A;  3OS2 A;  2VBZ A;  1OYY A;  1XCV A;  3JCU C;  4IRG A;  4CCJ A;  2ZME A;  2E1M B;  4E7H A;  1NHI A;  1Y8Q B;  1HOM A;  4NNJ A;  3RYR A;  1Z6T A;  4Y13 A;  1MDM B;  2N8G A;  3QOD A;  3CJN A;  3DD6 A;  4DV4 I;  4KIT B;  2HYF A;  2EV6 A;  4BEH A;  4BXX J;  3D5R C;  2KDO A;  3ELK A;  3VSL A;  4N3O A;  2UUC I;  4D9J A;  4DR4 E;  2EV5 A;  1LEB A;  1R1U A;  2LSO A;  1TP4 A;  5DNX A;  1ETY A;  4EJW A;  1BC8 C;  2VJ5 A;  4PDK A;  1U78 A;  1MX0 A;  1ZLK A;  1XXE A;  3V7S A;  2MA3 A;  4EVI A;  4OIR F;  4JV5 I;  3GLX A;  1XPX A;  3C18 A;  4M9S A;  3GFM A;  5C4J J;  2L9R A;  3J81 C;  4B8X A;  3DEE A;  5DUI A;  5LGU A;  3Q9V A;  4CZC A;  4EJV A;  2ID6 A;  3OSG A;  2TRT A;  5DRQ A;  1WJE A;  4FX0 A;  3T1Y I;  4LFC E;  1U8R A;  3CMY A;  2ZSI B;  4JK1 X;  3KP6 A;  1D1C A;  3PFY A;  3BQZ A;  4GYI A;  5E20 A;  2EK5 A;  2JZY A;  1PYV A; 
#chains in the Genus database with same CATH homology
 2BR2 A;  5K36 C;  2WNR B;  2JEA B;  5C0X E;  3GME A;  5JEA F;  2NN6 B;  5C0X D;  5K36 F;  3L7Z A;  2PNZ A;  4OO1 F;  4BA2 B;  4IFD C;  4OO1 A;  4IFD F;  3B4T A;  5K36 E;  3CDI A;  3M7N G;  5JEA E;  1UDS A;  2NN6 A;  2JE6 A;  2JEB A;  2WP8 A;  4AM3 A;  1R6M A;  4AIM A;  2WP8 B;  5K36 B;  2PO2 A;  3H1C A;  2BR2 B;  4IFD A;  2NN6 C;  1E3H A;  1OYP A;  2BA0 G;  5K36 D;  1UDQ A;  3U1K A;  2C39 B;  5JEA B;  3KRN A;  2PNZ B;  4AID A;  2PO0 B;  5JEA D;  4OO1 C;  4IFD D;  5K36 A;  4BA2 A;  2BA1 G;  2NN6 E;  2JE6 B;  3CDJ A;  2NN6 D;  5C0X B;  3HKM A;  4BA1 B;  2C38 B;  1R6L A;  4NBQ A;  2JEB B;  1WHU A;  4IFD E;  3DD6 A;  4OO1 E;  2PO2 B;  4BA1 A;  3GCM A;  2PO1 B;  3H36 A;  1OYS A;  2WNR A;  2JEA A;  1UDN A;  2C39 A;  5C0X F;  5JEA A;  2C38 A;  3M85 G;  3L7Z B;  2C37 B;  1OYR A;  3M85 D;  5C0X C;  2NN6 F;  2C37 A;  2BA1 D;  5C0X A;  2BA0 D;  1UDO A;  1E3P A;  5JEA C;  4OO1 D;  4IFD B;  2PO0 A;  3GLL A;  3M7N D;  2PO1 A;  4OO1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...