4LF9E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf9E02
2N3HA 1FI4A 3WU5A 4X66I 1YYWA 4KHPI 3J80C 1UILA 2R3VA 3CWVA 3M6AA 3P1XA 2HK2A 2EZ6A 4GKKE 4NXMI 4LFCI 4WUBA 2B7VA 1S16A 3ZZ0A 4DR6E 1KVKA 4B3MI 4JI4I 5IWAE 1I94I 1H73A 2B3TB 2XEXA 4HY1A 5IT9C 3T1HE 1B62A 3J80Q 2IHR1 3OTOI 2X7IA 4Z7YA 2JVAA 1Z0BA 5A2QC 4LF6I 1N34E 1Z5AA 4ZVIA 4DV0I 1Z5CA 4DR6I 4DV1I 1N33I 1BKNA 5IWAI 1Z0TA 4DUZI 1VISA 1ZXMA 4DPXA 2UXDE 4WFTA 1XNQE 4DR3E 4DU8A 3J7Yp 5IT9Q 1N36I 3LLHA 4HXZA 4X64I 1IBKE 2UUBI 1ZXNA 5A2QQ 1PIEA 2N3GA 4OX9E 3QT7A 1Z0VA 4OOGC 1WHNA 2RS6A 4M2ZA 2HHHI 4DPTA 2RSMA 2WW4A 1XNQI 4LF5I 3VYXA 2HFSA 2RS7A 4JI1E 4DV7I 1RR9A 2BM0A 3ADLA 2BM1A 1MG7A 4JYAE 5FLXC 4OX9I 2UUCI 1N32E 2CZ9A 2E1RA 3HULA 4DV6I 2NPFA 2F4VE 4YHHE 4JV5I 4B3RI 4LF9E 2NUGA 2ZITA 4JI8I 4Z7CA 4RPFA 1H72C 1EKZA 4UTGA 1D6TA 1WHQA 1X49A 3ADIA 1RC7A 1OJ4A 4X66E 3V5RA 3JAMC 4K0KI 4KHPE 1QZRA 2F4VI 2UXBI 1RQ0A 3GONA 5LMUI 2UXCI 4DU7A 2V8PA 4NXME 4LFCE 4DR4I 4FWHA 4X8WA 3ADJA 1ZM9A 4B3ME 4JI4E 4DR2E 2BV3A 4WUCA 1ELOA 1I94E 1IBME 1XHKA 2HKEA 1WUUA 2A2CA 1Z0GA 4URLA 4M30A 3JAMQ 4USMA 1FJGI 1PVGA 2L33A 3OTOE 4JI6I 2RTXA 1NZ0A 3B82A 4DPYA 4LF6E 2R42A 4PU9A 4JI0I 4DV0E 4XTJA 4FN5A 1H7UA 4DV1E 1N33E 4DR2I 1HNXI 2A2DA 4DUZE 1IBMI 3VYYA 1B63A 1EA6A 4P7AA 4EMDA 4LF8E 1MU5A 4X62I 1ZM4A 1N36E 1UHZA 4LF4E 4X64E 2UUBE 1ZM2A 1X48A 2LTRA 1XNRI 1U2RA 1XMQE 3WU6A 2DEIA 2HHHE 3J81C 5GMEA 4LF5E 4LF8I 1S4EA 3ZKDA 4LF4I 4DV7E 4JI3E 2UUCE 1KIJA 2HFUA 3PYFA 4HACA 4X65E 4DV6E 1XMQI 5LL6R 4AQYI 1H7SA 4B3RE 4JV5E 4JI8E 4NXNE 1KTVA 3J81Q 2LBSB 4JI3I 1T4LB 1EI1A 2ZM6I 5GMDA 4DKKA 2V34A 4LFAI 3T1YI 1FWKA 4X65I 1DARA 1A6FA 4K0KE 2LJHA 1IBLI 2UUAI 2UXBE 2VQFI 4LF7E 1N0VC 1HNWI 2V2ZA 1T4OA 4NXNI 2L3CA 1RREA 2AJ4A 5LMUE 2UXCE 4B3TI 1NHIA 3B8HA 1DI2A 3QT6A 5LMNE 1FKAE 4WYQB 1J26A 3PYEA 4DR4E 2LJPA 1Z0EA 1QU6A 1XMOE 5BR8I 2DIXA 2B7TA 5FLXQ 4LF7I 4JI5E 4HACB 1PKPA 2V2VA 1YYOA 4MYUA 1FJGE 4DXLA 2HKJA 4GKJI 5LMNI 4JI6E 5L3JA 2OI2A 4DV2I 4B3SI 1YZ9A 4JI0E 1YYKA 4DR1I 4DUYI 4JG4A 4LFBI 1XMOI 2NUFA 3WU4A 4FW9A 1HNXE 2E5LE 4YY3I 4JI5I 1STUA 3J7AM 1HR0E 2VQEE 1ZM3A 4JI7I 4FWGA 4FWDA 1J5EI 4X62E 3LTOA 4DR5E 3Q1QA 1FWLA 4DR7E 2DEJA 3D4JA 2E5LI 1XNRE 4UT4A 4JI2I 1HR0I 2VQEI 2DMYA 1GQEA 3C4TA 3LNUA 3B78A 4DV5I 3ZZUA 4DR5I 1KKHA 4DV4I 4DR7I 3H4LA 3PYGA 1O0WA 4DPWA 1MX0A 3WU3A 3ZKBA 1Z5BA 3HTXA 2MDRA 1NHHA 4AQYE 1Z0WA 4MYTA 1Z59A 2GS8A 1T4NA 1H74A 1Z0CA 4GKKI 3K1JA 2Q2EB 3QT5A 2ZM6E 4LFAE 2KHXA 2YT4A 3T1YE 1ZBTA 2LUPB 1IBLE 2UUAE 3T1HI 2VQFE 1HNWE 2VF3A 2UU9E 4B3TE 3K17A 4DPUA 1N34I 4PRXA 2LTSA 2LUQA 4KQVA 4WUDA 2EFGA 4DV3E 1X47A 2JY9A 5BR8E 2UXDI 4ED4A 2L2NA 2HK3A 2UU9I 4DR3I 4USKA 2X36A 2L2MA 4GKJE 2V2QA 1IBKI 1K47A 4I3HA 4DV2E 3PYDA 4B3SE 4DR1E 4DUYE 3V2UC 4LFBE 4DV3I 3C4BA 4YY3E 1HNZE 4PRVA 1N0UA 4R1FA 5CFFE 2ZBKB 3ZZTA 4JI7E 4JI1I 1FNMA 1J5EE 2LRSA 2CPNA 3F0NA 3J7AG 4P52A 2L2KB 4JYAI 4HYMA 4M1KA 1N32I 1NHJA 2J7KA 4YHHI 1HNZI 3ZM7A 4LF9I 3LPSA 4JI2E 1UEKA 2NUEA 3ADGA 3QT8A 2DB2A 2L3JA 4DV5E 2NA2A 4DV4E
chains in the Genus database with same CATH superfamily
2C37A 3OMLA 2N3HA 5DNXA 2EOIA 1FI4A 3WU5A 2GQ0A 3LMLA 4X66I 1YYWA 2EQ0A 4KHPI 3J80C 1UILA 2EORA 2NABA 1T38A 2E72A 2IESA 1DGCA 2PO2A 5AE1A 2R3VA 3CWVA 3EPKA 3M6AA 2J7JA 2GHFA 3P1XA 1YSAC 1PJSA 4Q28A 2WP8A 3L00A 2BA0D 2HK2A 2JYAA 2EZ6A 2NN6E 2NN6F 4MQYA 4GKKE 4NXMI 4LFCI 3UHMA 4WUBA 1WXRA 2B7VA 2EOXA 1S16A 4N3OA 4IZJD 1N3GA 2EM9A 3ZZ0A 4DR6E 5A6JA 1KVKA 4M9VC 4B3MI 4JI4I 2RPCA 5A6BA 4PU9A 5IWAE 5A6BD 5KL2A 4BA2A 1E3PA 2EE8A 1I94I 4I8OA 1H73A 5AC5A 3H1CA 2B3TB 4R2DA 2XEXA 4HY1A 5IT9C 3T1HE 1B62A 2WNRA 4BBYA 3J80Q 2IHR1 4P7DA 4RHBB 4GQUA 4U3BA 2C39B 3OTOI 3C6MA 2EMAA 2X7IA 4Z7YA 1P47A 2JVAA 1Z0BA 5A2QC 1R6LA 4AIDA 2PO0A 4LF6I 1N34E 1Z5AA 4ZVIA 4DV0I 1Z5CA 2DLQA 2YPNA 4DR6I 4DV1I 1IQOA 1BKNA 4L8NA 1N33I 2EM2A 5IWAI 4IFDD 2EPMX 1Z0TA 4DUZI 4LOMA 1IQSA 3THNA 1JK1A 2DMIA 1VISA 1ZXMA 1Y4UA 2BA1D 4DPXA 5AE3A 1UDSA 4X62I 5DRRA 2UXDE 1EH8A 4WFTA 2CTDA 2PO2B 1XNQE 4DR3E 4DU8A 3J7Yp 5IT9Q 2JPAA 4WPYA 2JEBA 1N36I 3LLHA 4HXZA 4X64I 1IBKE 1EH6A 2UUBI 3K85A 5DNLA 3IWCA 2V8QB 4WX9A 2I9IA 2JEAA 1ZXNA 1A1JA 2GPIA 5A2QQ 1PIEA 2N3GA 4OX9E 2IOPA 3QT7A 2JT2A 1Z0VA 4MDTA 4BA2B 5C0XE 4OOGC 1WHNA 5C0XF 3PRYA 3AV0A 2RS6A 3VHTB 1LLMC 2EMYA 4M2ZA 5C0XB 4DPTA 2RSMA 2HHHI 1G2DC 2WW4A 4BA1A 2EL5A 2EMHA 4P78A 1USVA 2WNRB 4LF5I 1XNQI 3VYXA 2V86A 4LTYA 2RS7A 2HFSA 2EMLA 4JI1E 2EP3A 3HQ1A 1A1HA 2EWLA 4DV7I 2GO4A 1RR9A 2BM0A 3ADLA 3HXLA 2PO0B 2MKDA 1UDQA 2BM1A 2ENAA 1ZU1A 4BC9A 1MG7A 5FLXC 4JYAE 4OX9I 1VI7A 2UUCI 5KL7A 1N32E 2CZ9A 2E1RA 1GTKA 3HULA 4DV6I 2NPFA 3U1KA 2V83A 2F4VE 3THOB 4YHHE 3EPLA 4F9CB 4LF9E 4JV5I 4B3RI 2NUGA 2ZITA 2EOZA 2EPPA 2PNZA 4JI8I 4Z7CA 2MC6A 5A6KA 4RPFA 1H72C 2M7QA 1SR9A 5C0XC 2FTXB 1A1GA 2EM4A 1EKZA 2RQLA 4O43A 2NN6A 4UTGA 5EL9A 1D6TA 2JE6A 3L7ZA 2EL4A 1WHQA 3F6HA 4R2AA 2JEBB 1Y5YA 4WXCA 1QNTA 1X49A 2DRPA 2JEAB 2R1FA 3ADIA 1RC7A 1OJ4A 2EMZA 2EPRA 4FW6A 4X66E 3V5RA 3JAMC 4K0KI 4KHPE 1RMDA 3UK3C 1QZRA 2F4VI 3MHSC 3VK6A 2UXBI 2IOQA 2GLIA 1RQ0A 2EN8A 5DNYA 3GONA 4TUIA 5LMUI 2UXCI 4R2RA 1T39A 4LCGA 4DU7A 2V8PA 4NXME 2EMWA 4LFCE 2K4VA 2VE7C 4DR4I 2YTJA 5DRPA 4FWHA 4X8WA 2EMIA 1NEIA 2JWOA 2AE8A 2EN6A 3ADJA 2PRTA 1ZM9A 4B3ME 4GEQB 4DR2E 1TF3A 1SFEA 4JI4E 2YTIA 1ELOA 2BV3A 4WUCA 1I94E 1IBME 1XHKA 2HKEA 1WUUA 3P3GA 2A2CA 3CDJA 4OKGA 4R2QA 3AUZA 1Z0GA 4URLA 4M30A 3JAMQ 4USMA 2EOQA 1FJGI 2GO3A 2PNZB 1PVGA 2L33A 3OTOE 4JI6I 2RTXA 1NZ0A 3B82A 1IMUA 4WSGA 2NN6B 2LMZA 4LF6E 2EOHA 2YTNA 5LLQA 2YTEA 4X9JA 1RHYA 4DV0E 5KL4A 5IXMB 4R2PA 3EPJA 2JE6B 4XTJA 4JI0I 4IJDA 1H7UA 4FN5A 3U1YA 4DV1E 1N33E 4DR2I 5AE2A 2MKNA 3DF6A 4F9BB 1HNXI 2A2DA 4DUZE 4IS1C 1IBMI 4OO1E 4HEIA 4OO1F 5K36E 2YTQA 5C0XA 5K36F 4FW5A 5C0XD 2G7HA 4MU1A 3VYYA 1B63A 1EA6A 4MU3A 4NBQA 4P7AA 2EPAA 1X6FA 2EJ4A 2WBSA 4EMDA 4U3DA 2EPOA 5JEAE 5JEAF 4QNJA 2EOOA 2L92A 2EN2A 2LVHA 2LT7A 1UBDC 4LF8E 1MU5A 3F6GA 1ZM4A 1N36E 2BR2A 1UHZA 3KZYA 1MEYC 4X64E 4LF4E 4BC7A 2YTDA 2JOXA 2UUBE 1ZM2A 1X48A 2EOEA 2NN6C 1YHCA 2LTRA 4F6NA 3CDIA 3M85D 1A1FA 2ADRA 1XNRI 1U2RA 1PJQA 4MU4A 1XMQE 4L5NC 3WU6A 2DEIA 2D9HA 2LV2A 2EM7A 4KZSA 2HHHE 3J81C 1KYQA 3FIGA 5GMEA 3M7NG 2V89A 1HK7A 4LF5E 4LF8I 1S4EA 4LCHA 3ZKDA 2B9DA 2VF1A 4LF4I 4DV7E 4JI3E 4F6MA 1X3CA 5KL5A 2BB8A 3JTZA 2YZTA 2YRHA 2JXPA 5AASA 4KWYA 2EPXA 3BBGA 2Z5EA 4AM3A 2YTFA 4RH8A 1ZAAC 1WRJA 2EM6A 1TN9A 2UUCE 1KIJA 2EN4A 1UDNA 2HFUA 3PYFA 4HACA 4X65E 4DV6E 1XMQI 5LL6R 4AQYI 1H7SA 2M9AA 4F54A 4B3RE 2EQ1A 4JV5E 1BB8A 1AAYA 4OZEA 2YTPA 4JI8E 2YTOA 3DJWA 4NXNE 1KTVA 4J8ZA 2EPCA 1YPNA 2YSOA 4ZYGA 3J81Q 1PDAA 3M99B 2LBSB 4JI3I 1OYSA 2BR2B 1T4LB 1EI1A 5EKWA 3NZKA 2WBUA 3EQ1A 5ADZA 2ZM6I 2V85A 4DKKA 2V34A 5GMDA 4LFAI 3T1YI 2EOMA 1FWKA 2C38A 4AIMA 4X65I 1DARA 1A6FA 4K0KE 2LJHA 1KJKA 1IBLI 2YRMA 2UUAI 1A1IA 2UXBE 2EPZA 3K6QA 4LF7E 1N0VC 2VQFI 1HNWI 2Q8UA 2V2ZA 1T4OA 4NXNI 4DV4E 2LO3A 1RREA 2AJ4A 5LMUE 2EOFA 2UXCE 4B3TI 2ODRC 4Q35B 1DI2A 1NHIA 3B8HA 3Q6MA 2HGHA 3QT6A 5LMNE 2NN6D 4NHRA 1FKAE 4WYQB 1J26A 3PYEA 4FW4A 2EOJA 4DR4E 2ENHA 2O1VA 3QG5C 2LJPA 2EN3A 2M1SA 1QU6A 1Z0EA 2PNMA 3GLLA 2YSPA 2BA0G 4R8OA 1P42A 1XMOE 3P76A 5BR8I 2WCC3 5K36A 4OO1A 2DIXA 2B7TA 2JOBA 1B69A 5FLXQ 4LF7I 4OO1D 4JI5E 4HACB 5K36D 1PKPA 2V2VA 3PS2A 4MU0A 1YYOA 4MYUA 5IV8B 1FJGE 4DXLA 5JEAA 2HKJA 3B4TA 2ELZA 5AC4A 3GCMA 4GKJI 5LMNI 4LU9A 2KOUA 4JI6E 2EMCA 2LCEA 4ZYEA 1TF6A 1Z1BA 2Z5BA 5L3JA 2OI2A 4DV2I 1R6MA 4B3SI 1YZ9A 4MLVA 4JI0E 1YYKA 1UDOA 3MHHC 2O3ZA 4DUYI 4DR1I 4JG4A 3P3EA 4QNKA 4LFBI 2L6MA 2NUFA 1Y60A 1XMOI 1XXEA 3RMPA 3WU4A 2V87A 4FW9A 1HNXE 2E5LE 4YY3I 2O1TA 4F9AB 4M0VA 2C38B 4JI5I 1STUA 3J7AM 4ISAA 3KRNA 1HR0E 2VQEE 4F2JC 4R2CA 4ZYHA 1ZM3A 3M85G 4JI7I 4FWGA 2BA1G 4FWDA 3TQMA 1J5EI 4NZVA 2L8TA 4X62E 3LTOA 4DR5E 3Q1QA 1FWLA 4BHBA 4R2EA 4DR7E 3BF2A 2DEJA 5T6JA 2Z5CA 1OYRA 4O24A 1Y6ZA 3D4JA 3BGHA 4IS9A 1ZBQA 5A6AA 4WSPA 5DRQA 2E5LI 2EN7A 1A1KA 4N4RB 1XNRE 5DROA 1A1LA 4UT4A 3HKMA 4JI2I 1HR0I 2VQEI 2DMYA 4OO1B 5K36B 1GQEA 2ODRD 2MDGA 3C4TA 2A25A 2FV4B 5ELWA 2M4IA 4ZYDA 2DLKA 3B78A 3LNUA 5KL6A 4DV5I 1WJPA 4R2SA 2E1MA 1BBOA 5JEAB 3ZZUA 2CSHA 1GZ6A 4DR5I 1KKHA 2O1WA 2EQ3A 2CT1A 4DV4I 4R03A 2Z5BB 4IZJA 5F3WA 4DR7I 4BS9A 3P3CA 1JK2A 3C6KA 3H4LA 3PYGA 1O0WA 4DPWA 3ECRA 1MX0A 3WU3A 2LJUA 2WBTA 3ZKBA 2BBGA 4BCAA 1Z5BA 3HTXA 2MDRA 1NHHA 4O4KA 4WXDA 4AQYE 2EMXA 2VESA 1Z0WA 2EM5A 1Z59A 4MYTA 2PO1A 2GS8A 5K36C 4OO1C 1T4NA 4HTGA 1H74A 1Z0CA 2R42A 4GKKI 1MGTA 5KL3A 2K7IA 5JEAC 3K1JA 1Y4SA 4O5GA 4MLQA 2Q2EB 3HPSA 2C37B 3KZZA 3QT5A 4IFDA 2ZM6E 2EMKA 4LFAE 1YUJA 2KHXA 2YT4A 3T1YE 2EM8A 2Z5CB 3PS1A 1X6HA 1ZBTA 2KONA 1UN6B 2LUPB 2ENCA 1IBLE 3L7ZB 2UUAE 3T1HI 2VQFE 1HNWE 4DMIA 2VF3A 2UU9E 2EOSA 2H36X 2CG9A 2EPNA 3Q6NA 3HPZA 4B3TE 2VRDA 4DPYA 1AH5A 2WP8B 2IERA 3K17A 4IZKA 4DPUA 1N34I 2EOYA 2O1UA 4PRXA 2YWQA 3KWRA 2YRKA 2HJJA 2DSYA 2LTSA 1EH7A 4IZJB 2LUQA 4KQVA 4WUDA 3ZOQB 5A69A 2EFGA 2PNLA 4DV3E 1X47A 2JY9A 2EPUA 2WZOA 5BR8E 3PS3A 2UXDI 3H09A 3IWDA 3P06A 2ELYA 4ED4A 2L2NA 2HK3A 2UU9I 4DR3I 2PO1B 4USKA 4BHCA 2X36A 2EM0A 2RSIA 2L2MA 4LPFA 4GKJE 2V2QA 1IBKI 2MC5A 3GMEA 2N8XA 2EM3A 1K47A 1ZR9A 4I3HA 2CVEA 4DV2E 3PYDA 2YU5A 4B3SE 4IFDE 3JU0A 4DR1E 4IFDF 4DUYE 1F2IG 4LFBE 3V2UC 3M7ND 2FGGA 4IFDB 4DV3I 2EMFA 3C4BA 4YY3E 2V88A 3BIDA 1HNZE 4FW3A 1YH8A 1N0UA 1OYPA 4PRVA 4R1FA 5CFFE 2F8BA 1X5WA 2ZBKB 3DD6A 3ZZTA 1G2FC 5JEAD 2I13A 4JI7E 4JI1I 2DGCA 1FNMA 1J5EE 2YU8A 2LRSA 1NCSA 2CPNA 3J7AG 2CGEA 3F0NA 2EPLX 4J3DA 3HJCA 2EMGA 4TUGA 3EPHA 4IZKB 4P52A 4FW7A 4FK5C 2L2KB 4JYAI 2EN1A 1DQ3A 1PJTA 4HYMA 4M1KA 1YUIA 2R76A 3IWBA 2J65A 1BBGA 1N32I 2EPKX 2JR1A 4GZNC 1NHJA 2J7KA 4BMJA 2JP9A 5FWKA 2EL6A 5TSEA 2F1DA 4YHHI 1HNZI 3ZM7A 4LF9I 4IFDC 3LPSA 2EMBA 4JI2E 1UEKA 2NUEA 1YFHA 3ADGA 2C39A 1USUA 3MSWA 3QT8A 1E3HA 2DB2A 2YTGA 2L3JA 4BA1B 4DV5E 1L4SA 1X6EA 4LCFA 2NA2A 2HC5A 2L3CA 2LE2A
chains in the Genus database with same CATH topology
3OMLA 2N3HA 1FI4A 3WU5A 2GQ0A 3LMLA 4X66I 1YYWA 4KHPI 3J80C 1UILA 5AE1A 2R3VA 3CWVA 3M6AA 3P1XA 4Q28A 2HK2A 2EZ6A 4GKKE 4NXMI 4LFCI 4WUBA 1WXRA 2B7VA 1S16A 4N3OA 4IZJD 3ZZ0A 4DR6E 1KVKA 4B3MI 4JI4I 5IWAE 1I94I 4I8OA 1H73A 2B3TB 2XEXA 4HY1A 5IT9C 3T1HE 1B62A 4BBYA 3J80Q 2IHR1 4P7DA 3OTOI 2X7IA 4Z7YA 2JVAA 1Z0BA 5A2QC 4LF6I 1N34E 1Z5AA 4ZVIA 4DV0I 1Z5CA 4DR6I 4DV1I 1N33I 1BKNA 4L8NA 5IWAI 1Z0TA 4DUZI 1VISA 1ZXMA 1Y4UA 4DPXA 5AE3A 2UXDE 4WFTA 1XNQE 4DR3E 4DU8A 3J7Yp 5IT9Q 4WPYA 1N36I 3LLHA 4HXZA 4X64I 1IBKE 2UUBI 3K85A 3IWCA 2V8QB 1ZXNA 5A2QQ 1PIEA 2N3GA 4OX9E 2IOPA 3QT7A 1Z0VA 4OOGC 1WHNA 3PRYA 3AV0A 2RS6A 4M2ZA 2HHHI 4DPTA 2RSMA 2WW4A 4P78A 1USVA 4LF5I 1XNQI 3VYXA 2V86A 4LTYA 2RS7A 2HFSA 4JI1E 3HQ1A 2EWLA 4DV7I 1RR9A 2BM0A 3ADLA 3HXLA 2BM1A 4BC9A 1MG7A 5FLXC 4JYAE 4OX9I 2UUCI 1N32E 2CZ9A 2E1RA 3HULA 4DV6I 2NPFA 2V83A 2F4VE 4YHHE 4JV5I 4B3RI 4F9CB 4LF9E 2NUGA 2ZITA 4JI8I 4Z7CA 2MC6A 4RPFA 1H72C 2M7QA 1SR9A 2FTXB 1EKZA 4UTGA 1D6TA 1WHQA 3F6HA 1X49A 3ADIA 1RC7A 1OJ4A 4X66E 3V5RA 3JAMC 4K0KI 4KHPE 1QZRA 2F4VI 3VK6A 2UXBI 2IOQA 1RQ0A 5DNYA 3GONA 4TUIA 5LMUI 2UXCI 4DU7A 2V8PA 4NXME 4LFCE 4DR4I 2K4VA 2VE7C 4FWHA 4X8WA 2JWOA 3ADJA 1ZM9A 4B3ME 4GEQB 4DR2E 4JI4E 2BV3A 4WUCA 1ELOA 1I94E 1IBME 1XHKA 2HKEA 1WUUA 2A2CA 3AUZA 1Z0GA 4URLA 4M30A 3JAMQ 4USMA 1FJGI 1PVGA 2L33A 3OTOE 4JI6I 2RTXA 1NZ0A 3B82A 4DPYA 2LMZA 4LF6E 2R42A 4PU9A 4JI0I 4DV0E 4XTJA 4FN5A 1H7UA 4DV1E 1N33E 4DR2I 5AE2A 3DF6A 4F9BB 1HNXI 2A2DA 4DUZE 1IBMI 2G7HA 3VYYA 1B63A 1EA6A 4P7AA 4EMDA 2L92A 4LF8E 1MU5A 4X62I 3F6GA 1ZM4A 1N36E 1UHZA 4LF4E 4X64E 4BC7A 2UUBE 2JOXA 1ZM2A 1X48A 2LTRA 1XNRI 1U2RA 1XMQE 4L5NC 3WU6A 2DEIA 4KZSA 2HHHE 3J81C 3FIGA 5GMEA 2V89A 1HK7A 4LF5E 4LF8I 1S4EA 3ZKDA 2B9DA 2VF1A 4LF4I 4DV7E 4JI3E 3JTZA 2YZTA 5AASA 2Z5EA 2UUCE 1KIJA 2HFUA 3PYFA 4HACA 4X65E 4DV6E 1XMQI 5LL6R 4AQYI 1H7SA 4F54A 4B3RE 4JV5E 4JI8E 3DJWA 4NXNE 1KTVA 4J8ZA 3J81Q 2LBSB 4JI3I 1T4LB 1EI1A 5ADZA 2ZM6I 2V85A 4DKKA 2V34A 5GMDA 4LFAI 3T1YI 1FWKA 4X65I 1DARA 1A6FA 4K0KE 2LJHA 1IBLI 2UUAI 2UXBE 3K6QA 4LF7E 1N0VC 2VQFI 1HNWI 2V2ZA 1T4OA 4NXNI 2L3CA 1RREA 2AJ4A 5LMUE 2UXCE 4B3TI 2ODRC 1NHIA 1DI2A 3B8HA 3Q6MA 3QT6A 5LMNE 1FKAE 4WYQB 1J26A 3PYEA 4DR4E 2O1VA 2LJPA 2PNMA 2M1SA 1Z0EA 1QU6A 4R8OA 1XMOE 5BR8I 2DIXA 2B7TA 2JOBA 5FLXQ 4LF7I 4JI5E 4HACB 1PKPA 2V2VA 1YYOA 4MYUA 1FJGE 4DXLA 2HKJA 4GKJI 5LMNI 4LU9A 2KOUA 4JI6E 2Z5BA 5L3JA 2OI2A 4DV2I 4B3SI 1YZ9A 4JI0E 1YYKA 4DR1I 4DUYI 4JG4A 4LFBI 2L6MA 2NUFA 1XMOI 3RMPA 3WU4A 2V87A 4FW9A 1HNXE 2E5LE 4YY3I 2O1TA 4F9AB 4M0VA 4JI5I 1STUA 3J7AM 1HR0E 2VQEE 1ZM3A 4JI7I 4FWGA 4FWDA 1J5EI 2L8TA 4X62E 3LTOA 4DR5E 3Q1QA 1FWLA 4DR7E 2DEJA 5T6JA 2Z5CA 1Y6ZA 3D4JA 1ZBQA 2E5LI 4WSPA 1XNRE 4UT4A 4JI2I 1HR0I 2VQEI 2DMYA 1GQEA 2ODRD 3C4TA 2FV4B 2M4IA 3B78A 3LNUA 4DV5I 2E1MA 3ZZUA 4DR5I 1GZ6A 1KKHA 2O1WA 4DV4I 4R03A 2Z5BB 4IZJA 5F3WA 4DR7I 4BS9A 3H4LA 3PYGA 1O0WA 4DPWA 1MX0A 3WU3A 3ZKBA 4BCAA 1Z5BA 3HTXA 2MDRA 1NHHA 4AQYE 1Z0WA 4MYTA 1Z59A 2GS8A 1T4NA 1H74A 1Z0CA 4GKKI 3K1JA 1Y4SA 2Q2EB 3HPSA 3QT5A 2ZM6E 4LFAE 2KHXA 2YT4A 3T1YE 2Z5CB 1ZBTA 2KONA 2LUPB 1IBLE 2UUAE 3T1HI 2VQFE 1HNWE 4DMIA 2VF3A 2UU9E 2CG9A 2H36X 3Q6NA 3HPZA 4B3TE 3K17A 4IZKA 4DPUA 1N34I 2O1UA 4PRXA 3KWRA 2DSYA 2LTSA 4IZJB 2LUQA 4KQVA 4WUDA 3ZOQB 2EFGA 2PNLA 4DV3E 1X47A 2JY9A 2WZOA 5BR8E 2UXDI 3H09A 3IWDA 3P06A 4ED4A 2L2NA 2HK3A 2UU9I 4DR3I 4USKA 2X36A 2L2MA 4GKJE 2V2QA 1IBKI 2MC5A 1K47A 4I3HA 4DV2E 3PYDA 4B3SE 3JU0A 4DR1E 4DUYE 3V2UC 4LFBE 2FGGA 4DV3I 3C4BA 4YY3E 2V88A 1HNZE 4PRVA 1N0UA 4R1FA 5CFFE 2F8BA 2ZBKB 3ZZTA 4JI7E 4JI1I 1FNMA 1J5EE 2LRSA 2CPNA 3J7AG 2CGEA 3F0NA 3HJCA 4TUGA 4IZKB 4P52A 2L2KB 4JYAI 1DQ3A 4HYMA 4M1KA 3IWBA 1N32I 2JR1A 1NHJA 2J7KA 4BMJA 5FWKA 4YHHI 1HNZI 3ZM7A 4LF9I 3LPSA 4JI2E 1UEKA 2NUEA 3ADGA 1USUA 3MSWA 3QT8A 2DB2A 2L3JA 4DV5E 2NA2A 4DV4E 2LE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3H A;  1FI4 A;  3WU5 A;  4X66 I;  1YYW A;  4KHP I;  3J80 C;  1UIL A;  2R3V A;  3CWV A;  3M6A A;  3P1X A;  2HK2 A;  2EZ6 A;  4GKK E;  4NXM I;  4LFC I;  4WUB A;  2B7V A;  1S16 A;  3ZZ0 A;  4DR6 E;  1KVK A;  4B3M I;  4JI4 I;  5IWA E;  1I94 I;  1H73 A;  2B3T B;  2XEX A;  4HY1 A;  5IT9 C;  3T1H E;  1B62 A;  3J80 Q;  2IHR 1;  3OTO I;  2X7I A;  4Z7Y A;  2JVA A;  1Z0B A;  5A2Q C;  4LF6 I;  1N34 E;  1Z5A A;  4ZVI A;  4DV0 I;  1Z5C A;  4DR6 I;  4DV1 I;  1N33 I;  1BKN A;  5IWA I;  1Z0T A;  4DUZ I;  1VIS A;  1ZXM A;  4DPX A;  2UXD E;  4WFT A;  1XNQ E;  4DR3 E;  4DU8 A;  3J7Y p;  5IT9 Q;  1N36 I;  3LLH A;  4HXZ A;  4X64 I;  1IBK E;  2UUB I;  1ZXN A;  5A2Q Q;  1PIE A;  2N3G A;  4OX9 E;  3QT7 A;  1Z0V A;  4OOG C;  1WHN A;  2RS6 A;  4M2Z A;  2HHH I;  4DPT A;  2RSM A;  2WW4 A;  1XNQ I;  4LF5 I;  3VYX A;  2HFS A;  2RS7 A;  4JI1 E;  4DV7 I;  1RR9 A;  2BM0 A;  3ADL A;  2BM1 A;  1MG7 A;  4JYA E;  5FLX C;  4OX9 I;  2UUC I;  1N32 E;  2CZ9 A;  2E1R A;  3HUL A;  4DV6 I;  2NPF A;  2F4V E;  4YHH E;  4JV5 I;  4B3R I;  4LF9 E;  2NUG A;  2ZIT A;  4JI8 I;  4Z7C A;  4RPF A;  1H72 C;  1EKZ A;  4UTG A;  1D6T A;  1WHQ A;  1X49 A;  3ADI A;  1RC7 A;  1OJ4 A;  4X66 E;  3V5R A;  3JAM C;  4K0K I;  4KHP E;  1QZR A;  2F4V I;  2UXB I;  1RQ0 A;  3GON A;  5LMU I;  2UXC I;  4DU7 A;  2V8P A;  4NXM E;  4LFC E;  4DR4 I;  4FWH A;  4X8W A;  3ADJ A;  1ZM9 A;  4B3M E;  4JI4 E;  4DR2 E;  2BV3 A;  4WUC A;  1ELO A;  1I94 E;  1IBM E;  1XHK A;  2HKE A;  1WUU A;  2A2C A;  1Z0G A;  4URL A;  4M30 A;  3JAM Q;  4USM A;  1FJG I;  1PVG A;  2L33 A;  3OTO E;  4JI6 I;  2RTX A;  1NZ0 A;  3B82 A;  4DPY A;  4LF6 E;  2R42 A;  4PU9 A;  4JI0 I;  4DV0 E;  4XTJ A;  4FN5 A;  1H7U A;  4DV1 E;  1N33 E;  4DR2 I;  1HNX I;  2A2D A;  4DUZ E;  1IBM I;  3VYY A;  1B63 A;  1EA6 A;  4P7A A;  4EMD A;  4LF8 E;  1MU5 A;  4X62 I;  1ZM4 A;  1N36 E;  1UHZ A;  4LF4 E;  4X64 E;  2UUB E;  1ZM2 A;  1X48 A;  2LTR A;  1XNR I;  1U2R A;  1XMQ E;  3WU6 A;  2DEI A;  2HHH E;  3J81 C;  5GME A;  4LF5 E;  4LF8 I;  1S4E A;  3ZKD A;  4LF4 I;  4DV7 E;  4JI3 E;  2UUC E;  1KIJ A;  2HFU A;  3PYF A;  4HAC A;  4X65 E;  4DV6 E;  1XMQ I;  5LL6 R;  4AQY I;  1H7S A;  4B3R E;  4JV5 E;  4JI8 E;  4NXN E;  1KTV A;  3J81 Q;  2LBS B;  4JI3 I;  1T4L B;  1EI1 A;  2ZM6 I;  5GMD A;  4DKK A;  2V34 A;  4LFA I;  3T1Y I;  1FWK A;  4X65 I;  1DAR A;  1A6F A;  4K0K E;  2LJH A;  1IBL I;  2UUA I;  2UXB E;  2VQF I;  4LF7 E;  1N0V C;  1HNW I;  2V2Z A;  1T4O A;  4NXN I;  2L3C A;  1RRE A;  2AJ4 A;  5LMU E;  2UXC E;  4B3T I;  1NHI A;  3B8H A;  1DI2 A;  3QT6 A;  5LMN E;  1FKA E;  4WYQ B;  1J26 A;  3PYE A;  4DR4 E;  2LJP A;  1Z0E A;  1QU6 A;  1XMO E;  5BR8 I;  2DIX A;  2B7T A;  5FLX Q;  4LF7 I;  4JI5 E;  4HAC B;  1PKP A;  2V2V A;  1YYO A;  4MYU A;  1FJG E;  4DXL A;  2HKJ A;  4GKJ I;  5LMN I;  4JI6 E;  5L3J A;  2OI2 A;  4DV2 I;  4B3S I;  1YZ9 A;  4JI0 E;  1YYK A;  4DR1 I;  4DUY I;  4JG4 A;  4LFB I;  1XMO I;  2NUF A;  3WU4 A;  4FW9 A;  1HNX E;  2E5L E;  4YY3 I;  4JI5 I;  1STU A;  3J7A M;  1HR0 E;  2VQE E;  1ZM3 A;  4JI7 I;  4FWG A;  4FWD A;  1J5E I;  4X62 E;  3LTO A;  4DR5 E;  3Q1Q A;  1FWL A;  4DR7 E;  2DEJ A;  3D4J A;  2E5L I;  1XNR E;  4UT4 A;  4JI2 I;  1HR0 I;  2VQE I;  2DMY A;  1GQE A;  3C4T A;  3LNU A;  3B78 A;  4DV5 I;  3ZZU A;  4DR5 I;  1KKH A;  4DV4 I;  4DR7 I;  3H4L A;  3PYG A;  1O0W A;  4DPW A;  1MX0 A;  3WU3 A;  3ZKB A;  1Z5B A;  3HTX A;  2MDR A;  1NHH A;  4AQY E;  1Z0W A;  4MYT A;  1Z59 A;  2GS8 A;  1T4N A;  1H74 A;  1Z0C A;  4GKK I;  3K1J A;  2Q2E B;  3QT5 A;  2ZM6 E;  4LFA E;  2KHX A;  2YT4 A;  3T1Y E;  1ZBT A;  2LUP B;  1IBL E;  2UUA E;  3T1H I;  2VQF E;  1HNW E;  2VF3 A;  2UU9 E;  4B3T E;  3K17 A;  4DPU A;  1N34 I;  4PRX A;  2LTS A;  2LUQ A;  4KQV A;  4WUD A;  2EFG A;  4DV3 E;  1X47 A;  2JY9 A;  5BR8 E;  2UXD I;  4ED4 A;  2L2N A;  2HK3 A;  2UU9 I;  4DR3 I;  4USK A;  2X36 A;  2L2M A;  4GKJ E;  2V2Q A;  1IBK I;  1K47 A;  4I3H A;  4DV2 E;  3PYD A;  4B3S E;  4DR1 E;  4DUY E;  3V2U C;  4LFB E;  4DV3 I;  3C4B A;  4YY3 E;  1HNZ E;  4PRV A;  1N0U A;  4R1F A;  5CFF E;  2ZBK B;  3ZZT A;  4JI7 E;  4JI1 I;  1FNM A;  1J5E E;  2LRS A;  2CPN A;  3F0N A;  3J7A G;  4P52 A;  2L2K B;  4JYA I;  4HYM A;  4M1K A;  1N32 I;  1NHJ A;  2J7K A;  4YHH I;  1HNZ I;  3ZM7 A;  4LF9 I;  3LPS A;  4JI2 E;  1UEK A;  2NUE A;  3ADG A;  3QT8 A;  2DB2 A;  2L3J A;  4DV5 E;  2NA2 A;  4DV4 E; 
#chains in the Genus database with same CATH topology
 2C37 A;  3OML A;  2N3H A;  5DNX A;  2EOI A;  1FI4 A;  3WU5 A;  2GQ0 A;  3LML A;  4X66 I;  1YYW A;  2EQ0 A;  4KHP I;  3J80 C;  1UIL A;  2EOR A;  2NAB A;  1T38 A;  2E72 A;  2IES A;  1DGC A;  2PO2 A;  5AE1 A;  2R3V A;  3CWV A;  3EPK A;  3M6A A;  2J7J A;  2GHF A;  3P1X A;  1YSA C;  1PJS A;  4Q28 A;  2WP8 A;  3L00 A;  2BA0 D;  2HK2 A;  2JYA A;  2EZ6 A;  2NN6 E;  2NN6 F;  4MQY A;  4GKK E;  4NXM I;  4LFC I;  3UHM A;  4WUB A;  1WXR A;  2B7V A;  2EOX A;  1S16 A;  4N3O A;  4IZJ D;  1N3G A;  2EM9 A;  3ZZ0 A;  4DR6 E;  5A6J A;  1KVK A;  4M9V C;  4B3M I;  4JI4 I;  2RPC A;  5A6B A;  4PU9 A;  5IWA E;  5A6B D;  5KL2 A;  4BA2 A;  1E3P A;  2EE8 A;  1I94 I;  4I8O A;  1H73 A;  5AC5 A;  3H1C A;  2B3T B;  4R2D A;  2XEX A;  4HY1 A;  5IT9 C;  3T1H E;  1B62 A;  2WNR A;  4BBY A;  3J80 Q;  2IHR 1;  4P7D A;  4RHB B;  4GQU A;  4U3B A;  2C39 B;  3OTO I;  3C6M A;  2EMA A;  2X7I A;  4Z7Y A;  1P47 A;  2JVA A;  1Z0B A;  5A2Q C;  1R6L A;  4AID A;  2PO0 A;  4LF6 I;  1N34 E;  1Z5A A;  4ZVI A;  4DV0 I;  1Z5C A;  2DLQ A;  2YPN A;  4DR6 I;  4DV1 I;  1IQO A;  1BKN A;  4L8N A;  1N33 I;  2EM2 A;  5IWA I;  4IFD D;  2EPM X;  1Z0T A;  4DUZ I;  4LOM A;  1IQS A;  3THN A;  1JK1 A;  2DMI A;  1VIS A;  1ZXM A;  1Y4U A;  2BA1 D;  4DPX A;  5AE3 A;  1UDS A;  4X62 I;  5DRR A;  2UXD E;  1EH8 A;  4WFT A;  2CTD A;  2PO2 B;  1XNQ E;  4DR3 E;  4DU8 A;  3J7Y p;  5IT9 Q;  2JPA A;  4WPY A;  2JEB A;  1N36 I;  3LLH A;  4HXZ A;  4X64 I;  1IBK E;  1EH6 A;  2UUB I;  3K85 A;  5DNL A;  3IWC A;  2V8Q B;  4WX9 A;  2I9I A;  2JEA A;  1ZXN A;  1A1J A;  2GPI A;  5A2Q Q;  1PIE A;  2N3G A;  4OX9 E;  2IOP A;  3QT7 A;  2JT2 A;  1Z0V A;  4MDT A;  4BA2 B;  5C0X E;  4OOG C;  1WHN A;  5C0X F;  3PRY A;  3AV0 A;  2RS6 A;  3VHT B;  1LLM C;  2EMY A;  4M2Z A;  5C0X B;  4DPT A;  2RSM A;  2HHH I;  1G2D C;  2WW4 A;  4BA1 A;  2EL5 A;  2EMH A;  4P78 A;  1USV A;  2WNR B;  4LF5 I;  1XNQ I;  3VYX A;  2V86 A;  4LTY A;  2RS7 A;  2HFS A;  2EML A;  4JI1 E;  2EP3 A;  3HQ1 A;  1A1H A;  2EWL A;  4DV7 I;  2GO4 A;  1RR9 A;  2BM0 A;  3ADL A;  3HXL A;  2PO0 B;  2MKD A;  1UDQ A;  2BM1 A;  2ENA A;  1ZU1 A;  4BC9 A;  1MG7 A;  5FLX C;  4JYA E;  4OX9 I;  1VI7 A;  2UUC I;  5KL7 A;  1N32 E;  2CZ9 A;  2E1R A;  1GTK A;  3HUL A;  4DV6 I;  2NPF A;  3U1K A;  2V83 A;  2F4V E;  3THO B;  4YHH E;  3EPL A;  4F9C B;  4LF9 E;  4JV5 I;  4B3R I;  2NUG A;  2ZIT A;  2EOZ A;  2EPP A;  2PNZ A;  4JI8 I;  4Z7C A;  2MC6 A;  5A6K A;  4RPF A;  1H72 C;  2M7Q A;  1SR9 A;  5C0X C;  2FTX B;  1A1G A;  2EM4 A;  1EKZ A;  2RQL A;  4O43 A;  2NN6 A;  4UTG A;  5EL9 A;  1D6T A;  2JE6 A;  3L7Z A;  2EL4 A;  1WHQ A;  3F6H A;  4R2A A;  2JEB B;  1Y5Y A;  4WXC A;  1QNT A;  1X49 A;  2DRP A;  2JEA B;  2R1F A;  3ADI A;  1RC7 A;  1OJ4 A;  2EMZ A;  2EPR A;  4FW6 A;  4X66 E;  3V5R A;  3JAM C;  4K0K I;  4KHP E;  1RMD A;  3UK3 C;  1QZR A;  2F4V I;  3MHS C;  3VK6 A;  2UXB I;  2IOQ A;  2GLI A;  1RQ0 A;  2EN8 A;  5DNY A;  3GON A;  4TUI A;  5LMU I;  2UXC I;  4R2R A;  1T39 A;  4LCG A;  4DU7 A;  2V8P A;  4NXM E;  2EMW A;  4LFC E;  2K4V A;  2VE7 C;  4DR4 I;  2YTJ A;  5DRP A;  4FWH A;  4X8W A;  2EMI A;  1NEI A;  2JWO A;  2AE8 A;  2EN6 A;  3ADJ A;  2PRT A;  1ZM9 A;  4B3M E;  4GEQ B;  4DR2 E;  1TF3 A;  1SFE A;  4JI4 E;  2YTI A;  1ELO A;  2BV3 A;  4WUC A;  1I94 E;  1IBM E;  1XHK A;  2HKE A;  1WUU A;  3P3G A;  2A2C A;  3CDJ A;  4OKG A;  4R2Q A;  3AUZ A;  1Z0G A;  4URL A;  4M30 A;  3JAM Q;  4USM A;  2EOQ A;  1FJG I;  2GO3 A;  2PNZ B;  1PVG A;  2L33 A;  3OTO E;  4JI6 I;  2RTX A;  1NZ0 A;  3B82 A;  1IMU A;  4WSG A;  2NN6 B;  2LMZ A;  4LF6 E;  2EOH A;  2YTN A;  5LLQ A;  2YTE A;  4X9J A;  1RHY A;  4DV0 E;  5KL4 A;  5IXM B;  4R2P A;  3EPJ A;  2JE6 B;  4XTJ A;  4JI0 I;  4IJD A;  1H7U A;  4FN5 A;  3U1Y A;  4DV1 E;  1N33 E;  4DR2 I;  5AE2 A;  2MKN A;  3DF6 A;  4F9B B;  1HNX I;  2A2D A;  4DUZ E;  4IS1 C;  1IBM I;  4OO1 E;  4HEI A;  4OO1 F;  5K36 E;  2YTQ A;  5C0X A;  5K36 F;  4FW5 A;  5C0X D;  2G7H A;  4MU1 A;  3VYY A;  1B63 A;  1EA6 A;  4MU3 A;  4NBQ A;  4P7A A;  2EPA A;  1X6F A;  2EJ4 A;  2WBS A;  4EMD A;  4U3D A;  2EPO A;  5JEA E;  5JEA F;  4QNJ A;  2EOO A;  2L92 A;  2EN2 A;  2LVH A;  2LT7 A;  1UBD C;  4LF8 E;  1MU5 A;  3F6G A;  1ZM4 A;  1N36 E;  2BR2 A;  1UHZ A;  3KZY A;  1MEY C;  4X64 E;  4LF4 E;  4BC7 A;  2YTD A;  2JOX A;  2UUB E;  1ZM2 A;  1X48 A;  2EOE A;  2NN6 C;  1YHC A;  2LTR A;  4F6N A;  3CDI A;  3M85 D;  1A1F A;  2ADR A;  1XNR I;  1U2R A;  1PJQ A;  4MU4 A;  1XMQ E;  4L5N C;  3WU6 A;  2DEI A;  2D9H A;  2LV2 A;  2EM7 A;  4KZS A;  2HHH E;  3J81 C;  1KYQ A;  3FIG A;  5GME A;  3M7N G;  2V89 A;  1HK7 A;  4LF5 E;  4LF8 I;  1S4E A;  4LCH A;  3ZKD A;  2B9D A;  2VF1 A;  4LF4 I;  4DV7 E;  4JI3 E;  4F6M A;  1X3C A;  5KL5 A;  2BB8 A;  3JTZ A;  2YZT A;  2YRH A;  2JXP A;  5AAS A;  4KWY A;  2EPX A;  3BBG A;  2Z5E A;  4AM3 A;  2YTF A;  4RH8 A;  1ZAA C;  1WRJ A;  2EM6 A;  1TN9 A;  2UUC E;  1KIJ A;  2EN4 A;  1UDN A;  2HFU A;  3PYF A;  4HAC A;  4X65 E;  4DV6 E;  1XMQ I;  5LL6 R;  4AQY I;  1H7S A;  2M9A A;  4F54 A;  4B3R E;  2EQ1 A;  4JV5 E;  1BB8 A;  1AAY A;  4OZE A;  2YTP A;  4JI8 E;  2YTO A;  3DJW A;  4NXN E;  1KTV A;  4J8Z A;  2EPC A;  1YPN A;  2YSO A;  4ZYG A;  3J81 Q;  1PDA A;  3M99 B;  2LBS B;  4JI3 I;  1OYS A;  2BR2 B;  1T4L B;  1EI1 A;  5EKW A;  3NZK A;  2WBU A;  3EQ1 A;  5ADZ A;  2ZM6 I;  2V85 A;  4DKK A;  2V34 A;  5GMD A;  4LFA I;  3T1Y I;  2EOM A;  1FWK A;  2C38 A;  4AIM A;  4X65 I;  1DAR A;  1A6F A;  4K0K E;  2LJH A;  1KJK A;  1IBL I;  2YRM A;  2UUA I;  1A1I A;  2UXB E;  2EPZ A;  3K6Q A;  4LF7 E;  1N0V C;  2VQF I;  1HNW I;  2Q8U A;  2V2Z A;  1T4O A;  4NXN I;  4DV4 E;  2LO3 A;  1RRE A;  2AJ4 A;  5LMU E;  2EOF A;  2UXC E;  4B3T I;  2ODR C;  4Q35 B;  1DI2 A;  1NHI A;  3B8H A;  3Q6M A;  2HGH A;  3QT6 A;  5LMN E;  2NN6 D;  4NHR A;  1FKA E;  4WYQ B;  1J26 A;  3PYE A;  4FW4 A;  2EOJ A;  4DR4 E;  2ENH A;  2O1V A;  3QG5 C;  2LJP A;  2EN3 A;  2M1S A;  1QU6 A;  1Z0E A;  2PNM A;  3GLL A;  2YSP A;  2BA0 G;  4R8O A;  1P42 A;  1XMO E;  3P76 A;  5BR8 I;  2WCC 3;  5K36 A;  4OO1 A;  2DIX A;  2B7T A;  2JOB A;  1B69 A;  5FLX Q;  4LF7 I;  4OO1 D;  4JI5 E;  4HAC B;  5K36 D;  1PKP A;  2V2V A;  3PS2 A;  4MU0 A;  1YYO A;  4MYU A;  5IV8 B;  1FJG E;  4DXL A;  5JEA A;  2HKJ A;  3B4T A;  2ELZ A;  5AC4 A;  3GCM A;  4GKJ I;  5LMN I;  4LU9 A;  2KOU A;  4JI6 E;  2EMC A;  2LCE A;  4ZYE A;  1TF6 A;  1Z1B A;  2Z5B A;  5L3J A;  2OI2 A;  4DV2 I;  1R6M A;  4B3S I;  1YZ9 A;  4MLV A;  4JI0 E;  1YYK A;  1UDO A;  3MHH C;  2O3Z A;  4DUY I;  4DR1 I;  4JG4 A;  3P3E A;  4QNK A;  4LFB I;  2L6M A;  2NUF A;  1Y60 A;  1XMO I;  1XXE A;  3RMP A;  3WU4 A;  2V87 A;  4FW9 A;  1HNX E;  2E5L E;  4YY3 I;  2O1T A;  4F9A B;  4M0V A;  2C38 B;  4JI5 I;  1STU A;  3J7A M;  4ISA A;  3KRN A;  1HR0 E;  2VQE E;  4F2J C;  4R2C A;  4ZYH A;  1ZM3 A;  3M85 G;  4JI7 I;  4FWG A;  2BA1 G;  4FWD A;  3TQM A;  1J5E I;  4NZV A;  2L8T A;  4X62 E;  3LTO A;  4DR5 E;  3Q1Q A;  1FWL A;  4BHB A;  4R2E A;  4DR7 E;  3BF2 A;  2DEJ A;  5T6J A;  2Z5C A;  1OYR A;  4O24 A;  1Y6Z A;  3D4J A;  3BGH A;  4IS9 A;  1ZBQ A;  5A6A A;  4WSP A;  5DRQ A;  2E5L I;  2EN7 A;  1A1K A;  4N4R B;  1XNR E;  5DRO A;  1A1L A;  4UT4 A;  3HKM A;  4JI2 I;  1HR0 I;  2VQE I;  2DMY A;  4OO1 B;  5K36 B;  1GQE A;  2ODR D;  2MDG A;  3C4T A;  2A25 A;  2FV4 B;  5ELW A;  2M4I A;  4ZYD A;  2DLK A;  3B78 A;  3LNU A;  5KL6 A;  4DV5 I;  1WJP A;  4R2S A;  2E1M A;  1BBO A;  5JEA B;  3ZZU A;  2CSH A;  1GZ6 A;  4DR5 I;  1KKH A;  2O1W A;  2EQ3 A;  2CT1 A;  4DV4 I;  4R03 A;  2Z5B B;  4IZJ A;  5F3W A;  4DR7 I;  4BS9 A;  3P3C A;  1JK2 A;  3C6K A;  3H4L A;  3PYG A;  1O0W A;  4DPW A;  3ECR A;  1MX0 A;  3WU3 A;  2LJU A;  2WBT A;  3ZKB A;  2BBG A;  4BCA A;  1Z5B A;  3HTX A;  2MDR A;  1NHH A;  4O4K A;  4WXD A;  4AQY E;  2EMX A;  2VES A;  1Z0W A;  2EM5 A;  1Z59 A;  4MYT A;  2PO1 A;  2GS8 A;  5K36 C;  4OO1 C;  1T4N A;  4HTG A;  1H74 A;  1Z0C A;  2R42 A;  4GKK I;  1MGT A;  5KL3 A;  2K7I A;  5JEA C;  3K1J A;  1Y4S A;  4O5G A;  4MLQ A;  2Q2E B;  3HPS A;  2C37 B;  3KZZ A;  3QT5 A;  4IFD A;  2ZM6 E;  2EMK A;  4LFA E;  1YUJ A;  2KHX A;  2YT4 A;  3T1Y E;  2EM8 A;  2Z5C B;  3PS1 A;  1X6H A;  1ZBT A;  2KON A;  1UN6 B;  2LUP B;  2ENC A;  1IBL E;  3L7Z B;  2UUA E;  3T1H I;  2VQF E;  1HNW E;  4DMI A;  2VF3 A;  2UU9 E;  2EOS A;  2H36 X;  2CG9 A;  2EPN A;  3Q6N A;  3HPZ A;  4B3T E;  2VRD A;  4DPY A;  1AH5 A;  2WP8 B;  2IER A;  3K17 A;  4IZK A;  4DPU A;  1N34 I;  2EOY A;  2O1U A;  4PRX A;  2YWQ A;  3KWR A;  2YRK A;  2HJJ A;  2DSY A;  2LTS A;  1EH7 A;  4IZJ B;  2LUQ A;  4KQV A;  4WUD A;  3ZOQ B;  5A69 A;  2EFG A;  2PNL A;  4DV3 E;  1X47 A;  2JY9 A;  2EPU A;  2WZO A;  5BR8 E;  3PS3 A;  2UXD I;  3H09 A;  3IWD A;  3P06 A;  2ELY A;  4ED4 A;  2L2N A;  2HK3 A;  2UU9 I;  4DR3 I;  2PO1 B;  4USK A;  4BHC A;  2X36 A;  2EM0 A;  2RSI A;  2L2M A;  4LPF A;  4GKJ E;  2V2Q A;  1IBK I;  2MC5 A;  3GME A;  2N8X A;  2EM3 A;  1K47 A;  1ZR9 A;  4I3H A;  2CVE A;  4DV2 E;  3PYD A;  2YU5 A;  4B3S E;  4IFD E;  3JU0 A;  4DR1 E;  4IFD F;  4DUY E;  1F2I G;  4LFB E;  3V2U C;  3M7N D;  2FGG A;  4IFD B;  4DV3 I;  2EMF A;  3C4B A;  4YY3 E;  2V88 A;  3BID A;  1HNZ E;  4FW3 A;  1YH8 A;  1N0U A;  1OYP A;  4PRV A;  4R1F A;  5CFF E;  2F8B A;  1X5W A;  2ZBK B;  3DD6 A;  3ZZT A;  1G2F C;  5JEA D;  2I13 A;  4JI7 E;  4JI1 I;  2DGC A;  1FNM A;  1J5E E;  2YU8 A;  2LRS A;  1NCS A;  2CPN A;  3J7A G;  2CGE A;  3F0N A;  2EPL X;  4J3D A;  3HJC A;  2EMG A;  4TUG A;  3EPH A;  4IZK B;  4P52 A;  4FW7 A;  4FK5 C;  2L2K B;  4JYA I;  2EN1 A;  1DQ3 A;  1PJT A;  4HYM A;  4M1K A;  1YUI A;  2R76 A;  3IWB A;  2J65 A;  1BBG A;  1N32 I;  2EPK X;  2JR1 A;  4GZN C;  1NHJ A;  2J7K A;  4BMJ A;  2JP9 A;  5FWK A;  2EL6 A;  5TSE A;  2F1D A;  4YHH I;  1HNZ I;  3ZM7 A;  4LF9 I;  4IFD C;  3LPS A;  2EMB A;  4JI2 E;  1UEK A;  2NUE A;  1YFH A;  3ADG A;  2C39 A;  1USU A;  3MSW A;  3QT8 A;  1E3H A;  2DB2 A;  2YTG A;  2L3J A;  4BA1 B;  4DV5 E;  1L4S A;  1X6E A;  4LCF A;  2NA2 A;  2HC5 A;  2L3C A;  2LE2 A; 
#chains in the Genus database with same CATH homology
 3OML A;  2N3H A;  1FI4 A;  3WU5 A;  2GQ0 A;  3LML A;  4X66 I;  1YYW A;  4KHP I;  3J80 C;  1UIL A;  5AE1 A;  2R3V A;  3CWV A;  3M6A A;  3P1X A;  4Q28 A;  2HK2 A;  2EZ6 A;  4GKK E;  4NXM I;  4LFC I;  4WUB A;  1WXR A;  2B7V A;  1S16 A;  4N3O A;  4IZJ D;  3ZZ0 A;  4DR6 E;  1KVK A;  4B3M I;  4JI4 I;  5IWA E;  1I94 I;  4I8O A;  1H73 A;  2B3T B;  2XEX A;  4HY1 A;  5IT9 C;  3T1H E;  1B62 A;  4BBY A;  3J80 Q;  2IHR 1;  4P7D A;  3OTO I;  2X7I A;  4Z7Y A;  2JVA A;  1Z0B A;  5A2Q C;  4LF6 I;  1N34 E;  1Z5A A;  4ZVI A;  4DV0 I;  1Z5C A;  4DR6 I;  4DV1 I;  1N33 I;  1BKN A;  4L8N A;  5IWA I;  1Z0T A;  4DUZ I;  1VIS A;  1ZXM A;  1Y4U A;  4DPX A;  5AE3 A;  2UXD E;  4WFT A;  1XNQ E;  4DR3 E;  4DU8 A;  3J7Y p;  5IT9 Q;  4WPY A;  1N36 I;  3LLH A;  4HXZ A;  4X64 I;  1IBK E;  2UUB I;  3K85 A;  3IWC A;  2V8Q B;  1ZXN A;  5A2Q Q;  1PIE A;  2N3G A;  4OX9 E;  2IOP A;  3QT7 A;  1Z0V A;  4OOG C;  1WHN A;  3PRY A;  3AV0 A;  2RS6 A;  4M2Z A;  2HHH I;  4DPT A;  2RSM A;  2WW4 A;  4P78 A;  1USV A;  4LF5 I;  1XNQ I;  3VYX A;  2V86 A;  4LTY A;  2RS7 A;  2HFS A;  4JI1 E;  3HQ1 A;  2EWL A;  4DV7 I;  1RR9 A;  2BM0 A;  3ADL A;  3HXL A;  2BM1 A;  4BC9 A;  1MG7 A;  5FLX C;  4JYA E;  4OX9 I;  2UUC I;  1N32 E;  2CZ9 A;  2E1R A;  3HUL A;  4DV6 I;  2NPF A;  2V83 A;  2F4V E;  4YHH E;  4JV5 I;  4B3R I;  4F9C B;  4LF9 E;  2NUG A;  2ZIT A;  4JI8 I;  4Z7C A;  2MC6 A;  4RPF A;  1H72 C;  2M7Q A;  1SR9 A;  2FTX B;  1EKZ A;  4UTG A;  1D6T A;  1WHQ A;  3F6H A;  1X49 A;  3ADI A;  1RC7 A;  1OJ4 A;  4X66 E;  3V5R A;  3JAM C;  4K0K I;  4KHP E;  1QZR A;  2F4V I;  3VK6 A;  2UXB I;  2IOQ A;  1RQ0 A;  5DNY A;  3GON A;  4TUI A;  5LMU I;  2UXC I;  4DU7 A;  2V8P A;  4NXM E;  4LFC E;  4DR4 I;  2K4V A;  2VE7 C;  4FWH A;  4X8W A;  2JWO A;  3ADJ A;  1ZM9 A;  4B3M E;  4GEQ B;  4DR2 E;  4JI4 E;  2BV3 A;  4WUC A;  1ELO A;  1I94 E;  1IBM E;  1XHK A;  2HKE A;  1WUU A;  2A2C A;  3AUZ A;  1Z0G A;  4URL A;  4M30 A;  3JAM Q;  4USM A;  1FJG I;  1PVG A;  2L33 A;  3OTO E;  4JI6 I;  2RTX A;  1NZ0 A;  3B82 A;  4DPY A;  2LMZ A;  4LF6 E;  2R42 A;  4PU9 A;  4JI0 I;  4DV0 E;  4XTJ A;  4FN5 A;  1H7U A;  4DV1 E;  1N33 E;  4DR2 I;  5AE2 A;  3DF6 A;  4F9B B;  1HNX I;  2A2D A;  4DUZ E;  1IBM I;  2G7H A;  3VYY A;  1B63 A;  1EA6 A;  4P7A A;  4EMD A;  2L92 A;  4LF8 E;  1MU5 A;  4X62 I;  3F6G A;  1ZM4 A;  1N36 E;  1UHZ A;  4LF4 E;  4X64 E;  4BC7 A;  2UUB E;  2JOX A;  1ZM2 A;  1X48 A;  2LTR A;  1XNR I;  1U2R A;  1XMQ E;  4L5N C;  3WU6 A;  2DEI A;  4KZS A;  2HHH E;  3J81 C;  3FIG A;  5GME A;  2V89 A;  1HK7 A;  4LF5 E;  4LF8 I;  1S4E A;  3ZKD A;  2B9D A;  2VF1 A;  4LF4 I;  4DV7 E;  4JI3 E;  3JTZ A;  2YZT A;  5AAS A;  2Z5E A;  2UUC E;  1KIJ A;  2HFU A;  3PYF A;  4HAC A;  4X65 E;  4DV6 E;  1XMQ I;  5LL6 R;  4AQY I;  1H7S A;  4F54 A;  4B3R E;  4JV5 E;  4JI8 E;  3DJW A;  4NXN E;  1KTV A;  4J8Z A;  3J81 Q;  2LBS B;  4JI3 I;  1T4L B;  1EI1 A;  5ADZ A;  2ZM6 I;  2V85 A;  4DKK A;  2V34 A;  5GMD A;  4LFA I;  3T1Y I;  1FWK A;  4X65 I;  1DAR A;  1A6F A;  4K0K E;  2LJH A;  1IBL I;  2UUA I;  2UXB E;  3K6Q A;  4LF7 E;  1N0V C;  2VQF I;  1HNW I;  2V2Z A;  1T4O A;  4NXN I;  2L3C A;  1RRE A;  2AJ4 A;  5LMU E;  2UXC E;  4B3T I;  2ODR C;  1NHI A;  1DI2 A;  3B8H A;  3Q6M A;  3QT6 A;  5LMN E;  1FKA E;  4WYQ B;  1J26 A;  3PYE A;  4DR4 E;  2O1V A;  2LJP A;  2PNM A;  2M1S A;  1Z0E A;  1QU6 A;  4R8O A;  1XMO E;  5BR8 I;  2DIX A;  2B7T A;  2JOB A;  5FLX Q;  4LF7 I;  4JI5 E;  4HAC B;  1PKP A;  2V2V A;  1YYO A;  4MYU A;  1FJG E;  4DXL A;  2HKJ A;  4GKJ I;  5LMN I;  4LU9 A;  2KOU A;  4JI6 E;  2Z5B A;  5L3J A;  2OI2 A;  4DV2 I;  4B3S I;  1YZ9 A;  4JI0 E;  1YYK A;  4DR1 I;  4DUY I;  4JG4 A;  4LFB I;  2L6M A;  2NUF A;  1XMO I;  3RMP A;  3WU4 A;  2V87 A;  4FW9 A;  1HNX E;  2E5L E;  4YY3 I;  2O1T A;  4F9A B;  4M0V A;  4JI5 I;  1STU A;  3J7A M;  1HR0 E;  2VQE E;  1ZM3 A;  4JI7 I;  4FWG A;  4FWD A;  1J5E I;  2L8T A;  4X62 E;  3LTO A;  4DR5 E;  3Q1Q A;  1FWL A;  4DR7 E;  2DEJ A;  5T6J A;  2Z5C A;  1Y6Z A;  3D4J A;  1ZBQ A;  2E5L I;  4WSP A;  1XNR E;  4UT4 A;  4JI2 I;  1HR0 I;  2VQE I;  2DMY A;  1GQE A;  2ODR D;  3C4T A;  2FV4 B;  2M4I A;  3B78 A;  3LNU A;  4DV5 I;  2E1M A;  3ZZU A;  4DR5 I;  1GZ6 A;  1KKH A;  2O1W A;  4DV4 I;  4R03 A;  2Z5B B;  4IZJ A;  5F3W A;  4DR7 I;  4BS9 A;  3H4L A;  3PYG A;  1O0W A;  4DPW A;  1MX0 A;  3WU3 A;  3ZKB A;  4BCA A;  1Z5B A;  3HTX A;  2MDR A;  1NHH A;  4AQY E;  1Z0W A;  4MYT A;  1Z59 A;  2GS8 A;  1T4N A;  1H74 A;  1Z0C A;  4GKK I;  3K1J A;  1Y4S A;  2Q2E B;  3HPS A;  3QT5 A;  2ZM6 E;  4LFA E;  2KHX A;  2YT4 A;  3T1Y E;  2Z5C B;  1ZBT A;  2KON A;  2LUP B;  1IBL E;  2UUA E;  3T1H I;  2VQF E;  1HNW E;  4DMI A;  2VF3 A;  2UU9 E;  2CG9 A;  2H36 X;  3Q6N A;  3HPZ A;  4B3T E;  3K17 A;  4IZK A;  4DPU A;  1N34 I;  2O1U A;  4PRX A;  3KWR A;  2DSY A;  2LTS A;  4IZJ B;  2LUQ A;  4KQV A;  4WUD A;  3ZOQ B;  2EFG A;  2PNL A;  4DV3 E;  1X47 A;  2JY9 A;  2WZO A;  5BR8 E;  2UXD I;  3H09 A;  3IWD A;  3P06 A;  4ED4 A;  2L2N A;  2HK3 A;  2UU9 I;  4DR3 I;  4USK A;  2X36 A;  2L2M A;  4GKJ E;  2V2Q A;  1IBK I;  2MC5 A;  1K47 A;  4I3H A;  4DV2 E;  3PYD A;  4B3S E;  3JU0 A;  4DR1 E;  4DUY E;  3V2U C;  4LFB E;  2FGG A;  4DV3 I;  3C4B A;  4YY3 E;  2V88 A;  1HNZ E;  4PRV A;  1N0U A;  4R1F A;  5CFF E;  2F8B A;  2ZBK B;  3ZZT A;  4JI7 E;  4JI1 I;  1FNM A;  1J5E E;  2LRS A;  2CPN A;  3J7A G;  2CGE A;  3F0N A;  3HJC A;  4TUG A;  4IZK B;  4P52 A;  2L2K B;  4JYA I;  1DQ3 A;  4HYM A;  4M1K A;  3IWB A;  1N32 I;  2JR1 A;  1NHJ A;  2J7K A;  4BMJ A;  5FWK A;  4YHH I;  1HNZ I;  3ZM7 A;  4LF9 I;  3LPS A;  4JI2 E;  1UEK A;  2NUE A;  3ADG A;  1USU A;  3MSW A;  3QT8 A;  2DB2 A;  2L3J A;  4DV5 E;  2NA2 A;  4DV4 E;  2LE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...