4LF9E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf9E02
3GONA 4YY3I 2OI2A 4X65I 1OJ4A 1HR0I 4JV5E 1S16A 4NXME 4X64E 4JI1I 4ED4A 4YHHE 1VISA 1XNRI 4EMDA 4I3HA 4P52A 3J80Q 1Z5AA 5LMNI 1XHKA 4ZVIA 3J7AG 4DV6E 3OTOI 3J7AM 5FLXQ 1BKNA 4B3MI 3T1YE 1UEKA 1FI4A 3JAMQ 2L33A 4LF8I 3B82A 2L2MA 4JI5E 4R1FA 3ADLA 3ZZ0A 2UXBI 3J7Yp 4DV2E 4JI0I 2DMYA 3ZM7A 2KHXA 1PIEA 1HNZE 5BR8I 3P1XA 4JI3E 1QU6A 2LJHA 2EZ6A 4FW9A 2JY9A 2EFGA 3K17A 4JYAI 1IBLE 2DB2A 1YYWA 2R42A 2V34A 1DARA 2BV3A 2ZM6I 2UUCI 3T1HI 1N0VC 1B62A 1H73A 1NZ0A 5A2QC 3VYXA 4LF7I 2RSMA 1Z59A 5L3JA 2LBSB 1XMQE 4P7AA 1HNWE 3K1JA 4PRVA 4DUYI 1IBMI 4WUCA 1RREA 1N0UA 2V8PA 3PYGA 2LTSA 4JI7I 4DV3I 2E5LE 4DV5E 3J80C 4LF5E 4NXNE 2HK3A 1X47A 4DU7A 2JVAA 4KQVA 2LRSA 4DV1I 4PU9A 4JI2E 1I94E 4JI6E 2VQEI 4DR4I 1MX0A 2UU9I 1T4OA 1N36E 4DUZE 4X66I 4DPWA 3JAMC 1WHQA 5IWAI 4GKKE 4B3SI 4B3TE 4DR2E 4AQYE 1N32I 2HFSA 4DR1I 1ZXNA 4JG4A 4LF4I 3QT6A 1K47A 2N3HA 3ADJA 4DR5E 1T4NA 1KKHA 3ADGA 4DKKA 4GKJE 1U2RA 2UUAE 4LF6I 2BM0A 2B7VA 1N34E 2UUBE 4MYTA 3ZKBA 3J81Q 4HXZA 1Z0GA 4K0KE 2L3CA 2NUFA 4Z7YA 4LF9E 1UHZA 1ZBTA 5GMEA 2VQFE 1Z0CA 4JI4E 2NUGA 2LJPA 1HNXI 3WU5A 4X62E 2MDRA 5LMUE 2E1RA 4KHPE 3WU6A 2RS7A 3VYYA 4DV7I 2IHR1 2CPNA 3T1YI 3HULA 1J5EE 1FNMA 1YYKA 1RQ0A 4LFAI 4DPXA 1EI1A 1H7SA 1FJGI 1NHIA 1Z0TA 4YY3E 2V2ZA 2VF3A 2L2NA 4DU8A 1HR0E 2HHHE 3H4LA 4DR6I 4JI1E 2NA2A 2F4VE 1XNRE 1ZXMA 4UTGA 5LMNE 1NHJA 4LFBI 4XTJA 2AJ4A 3OTOE 4LFCI 4URLA 1X48A 4OOGC 1ZM3A 3Q1QA 1S4EA 2R3VA 2A2CA 4JI8I 4USMA 1RC7A 4LF8E 4WUBA 2B7TA 1Z0WA 2J7KA 1N33I 3J81C 4JI0E 1IBKE 2X36A 5BR8E 2CZ9A 3PYFA 4DV5I 4OX9I 1FWLA 4DV0I 1WHNA 2BM1A 4JYAE 2HKEA 1XNQI 4WFTA 4JI6I 4B3RI 4DR3E 3B78A 2ZM6E 2UUCE 3T1HE 2L3JA 4DR7I 4LF7E 1UILA 2HK2A 1GQEA 1STUA 2WW4A 3C4TA 2LUPB 1PVGA 2X7IA 2NPFA 2UXDI 2UXCE 3WU3A 1XMOI 5GMDA 4DV3E 3B8HA 3ZZTA 1EA6A 4JV5I 1ELOA 4NXMI 4HACA 3C4BA 4X64I 3QT7A 1D6TA 4DV1E 4YHHI 2VQFI 4DR4E 1DI2A 4JI4I 3CWVA 4PRXA 1QZRA 4DV4E 2UU9E 1O0WA 2L2KB 1WUUA 4X66E 4DV6I 2LUQA 4M30A 3ADIA 5IWAE 4USKA 1KTVA 1N32E 5IT9Q 3QT5A 4DXLA 2Q2EB 4LF4E 1X49A 2YT4A 2GS8A 2HHHI 2DEJA 4JI5I 4LF6E 2F4VI 4DV2I 4X65E 3ZZUA 1NHHA 1FWKA 1HNZI 3LPSA 2DIXA 4JI3I 1MG7A 1A6FA 3M6AA 3LLHA 1HNXE 4WYQB 4RPFA 3ZKDA 1IBLI 2ZBKB 4UT4A 2RTXA 1Z0EA 1Z5BA 1MU5A 2HKJA 4MYUA 4DV7E 2XEXA 3D4JA 4LFAE 1FJGE 4B3ME 3PYEA 1XMQI 1J26A 2V2QA 4FWHA 1HNWI 4DR6E 1IBKI 4HYMA 1KVKA 4DPUA 4DPTA 4M2ZA 2UXBE 3F0NA 2E5LI 4FWDA 1ZM2A 4HACB 4LF5I 4NXNI 1T4LB 4FN5A 4LFBE 1FKAE 4DR3I 4LFCE 4DPYA 1H72C 3QT8A 1B63A 1ZM4A 1KIJA 1Z0VA 1ZM9A 4JI2I 4Z7CA 1I94I 5IT9C 2LTRA 1H74A 4JI8E 1N36I 3LTOA 1RR9A 4DUZI 2UXCI 2RS6A 2NUEA 4GKKI 1Z0BA 4B3TI 4DR2I 4AQYI 1N33E 4OX9E 4DUYE 1IBME 1YZ9A 4DR5I 2V2VA 4DV0E 4JI7E 2N3GA 1Z5CA 5CFFE 4GKJI 1XNQE 1H7UA 2UUAI 4HY1A 4X8WA 3HTXA 1N34I 2UUBI 5FLXC 4WUDA 4M1KA 4K0KI 4B3RE 1PKPA 1YYOA 4DV4I 4LF9I 2B3TB 4DR7E 2HFUA 2VQEE 3V2UC 3LNUA 4X62I 2UXDE 5LMUI 1EKZA 4FWGA 4KHPI 2DEIA 3PYDA 2ZITA 5A2QQ 3V5RA 3WU4A 4B3SE 1J5EI 2A2DA 1XMOE 5LL6R 4DR1E
chains in the Genus database with same CATH superfamily
3EPJA 5FWKA 2LJUA 5JEAF 2YRKA 3GONA 4WXCA 4BMJA 4YY3I 1ZBQA 2OI2A 4O5GA 4X65I 1OJ4A 1HR0I 4JV5E 1TN9A 4L8NA 1TF3A 4NXME 5A6AA 1S16A 1USVA 4MU3A 5C0XC 4X64E 2V83A 4JI1I 2DLQA 2HJJA 4ED4A 2BA0G 1OYRA 5C0XB 4YHHE 1VISA 1AAYA 1XNRI 4EMDA 1UDNA 2YTDA 4I3HA 4BA2B 2PO2B 4P52A 3J80Q 2EMHA 2VE7C 1Z5AA 5LMNI 5AC4A 2ADRA 2ENHA 1XHKA 2F1DA 3J7AG 4ZVIA 1P42A 2YU5A 1OYPA 2EQ3A 4DV6E 2PO0A 2O3ZA 3OTOI 3J7AM 5DROA 4ISAA 3L7ZB 2EPMX 3KRNA 3BIDA 5FLXQ 5IXMB 4IS1C 2EPLX 5DNXA 4ZYDA 1N34I 2N8XA 3P3CA 1YSAC 1BKNA 4B3MI 2JE6B 2EPUA 2NN6A 2WNRB 1GTKA 3T1YE 2WZOA 5JEAE 1UEKA 4LOMA 3FIGA 1EH8A 1FI4A 2YTQA 2L33A 2LT7A 3B82A 3JAMQ 4LF8I 2L2MA 4P7DA 4OO1F 2C38B 1T38A 4JI5E 3CDJA 2EOYA 4R1FA 2O1TA 1A1JA 3ADLA 5K36C 2WBUA 2GO4A 3ZZ0A 2UXBI 5K36B 3J7Yp 2RSIA 4DV2E 3EPLA 4JI0I 2DMYA 3ZM7A 2KHXA 1PIEA 1HNZE 5BR8I 3P1XA 4JI3E 1QU6A 2LJHA 2EM4A 2EZ6A 4FW9A 2JY9A 2EFGA 1A1HA 3K17A 4JYAI 1SFEA 3KZYA 1Y60A 1X5WA 1IBLE 4M9VC 2DB2A 2EMCA 1YYWA 2R42A 2L92A 1NCSA 2V34A 1DARA 3U1YA 2BV3A 2EM2A 2ZM6I 2UUCI 3T1HI 3JTZA 1B62A 1H73A 1N0VC 5A2QC 1NZ0A 1YH8A 3VYXA 3GMEA 4QNKA 5DNLA 4LF7I 2RSMA 2EMZA 4IJDA 1Z59A 5L3JA 3DF6A 2BB8A 4MU4A 2YTIA 3K85A 2EL4A 2LBSB 1XMQE 2EWLA 4P7AA 2BA0D 4OO1E 1HNWE 3K1JA 2EPAA 5JEAD 4PRVA 2MC6A 2CTDA 3M99B 2JWOA 2LMZA 4NZVA 5KL2A 4R2EA 5DRQA 3BBGA 2EQ0A 2WNRA 4DUYI 1ZU1A 2NPFA 4WUCA 1IBMI 2EE8A 1RREA 2KOUA 2YTOA 1N0UA 2V8PA 2YWQA 2EPRA 3ECRA 2GLIA 2LTSA 1RHYA 4F6NA 3PYGA 4JI7I 2C38A 4L5NC 4F2JC 4DV3I 2E5LE 1UDQA 4DV5E 3J80C 4LF5E 4WSPA 4NXNE 2HK3A 2EPOA 4HEIA 5JEAA 1X47A 3P76A 4DU7A 1A1LA 2JVAA 5KL5A 1HK7A 4KQVA 4QNJA 2VRDA 2JOXA 4LTYA 2LVHA 2LRSA 2G7HA 3MHHC 4PU9A 4JI2E 2JXPA 1I94E 4JI6E 2V86A 2VQEI 4DV1I 4DR4I 4F9AB 4MU1A 4N3OA 1MX0A 2PO0B 1Y4UA 3GLLA 2UU9I 2UUBI 2CVEA 1T4OA 2D9HA 1N36E 4DUZE 4X66I 2A25A 1IQOA 4DPWA 2O1VA 3Q6MA 2NN6C 3JAMC 1WHQA 5IWAI 2YTFA 4ZYGA 5ADZA 2Z5CA 4GKKE 3CDIA 4MQYA 4B3SI 4B3TE 4OO1D 4DR2E 4AQYE 1N32I 2BR2A 2HFSA 3H1CA 4DR1I 5ELWA 3U1KA 3EQ1A 5KL3A 4BA1A 2JEAA 1ZXNA 2Z5BA 4JG4A 4LF4I 3C6MA 2MKDA 4O4KA 3DJWA 2DLKA 1K47A 3QT6A 2N3HA 2KONA 3ADJA 4DR5E 1T4NA 1G2FC 2JPAA 1KKHA 2C37A 3ADGA 2EM3A 2JR1A 4HTGA 2EL5A 4BHCA 4DKKA 1UBDC 1B69A 2I13A 4GKJE 4IFDE 1U2RA 2UUAE 4LF6I 2BM0A 2JEBA 2B7VA 2V89A 1N34E 2UUBE 1E3HA 4MYTA 3ZKBA 4HXZA 3J81Q 1Z0GA 4LPFA 1T39A 2WBSA 4K0KE 2GHFA 2L3CA 1R6MA 3IWDA 2NUFA 2ODRD 4O24A 4Z7YA 4LF9E 3LMLA 1UHZA 2VF1A 1ZBTA 5TSEA 5GMEA 2IESA 2VQFE 1Z0CA 5LLQA 1KJKA 4JI4E 2NUGA 2LJPA 1HNXI 2PNZA 2M9AA 3WU5A 2B9DA 2VESA 2EMGA 4X62E 4R2RA 2YRHA 2MDRA 2EN2A 2J7JA 5K36F 5LMUE 2V87A 2E1RA 4KHPE 3EPKA 3F6HA 3WU6A 2RS7A 3VYYA 1A1KA 4DV7I 2IHR1 2CPNA 3T1YI 3HXLA 3HULA 2EMIA 1YUIA 1J5EE 4LCHA 1FNMA 2IERA 1QNTA 1YYKA 1RQ0A 2EN1A 4DPXA 1BB8A 4LFAI 2EMBA 1EI1A 1H7SA 1FJGI 2EN3A 1NHIA 2YRMA 1IQSA 4YY3E 1OYSA 1USUA 1Z0TA 2V2ZA 2VF3A 2L2NA 4MU0A 2R76A 3HKMA 3Q6NA 4M0VA 3PS2A 2EM7A 4DU8A 1Y6ZA 1HR0E 2HHHE 3H4LA 4DR6I 1WJPA 3B4TA 1PJSA 2RQLA 3MHSC 4BS9A 4JI1E 4IS9A 2YPNA 1DGCA 4AIDA 2NA2A 4F9BB 5AE2A 2F4VE 5JEAC 2EOXA 1XNRE 1ZXMA 2EORA 2PO1B 2J65A 4UTGA 5JEAB 1VI7A 5LMNE 4DMIA 5KL6A 1NHJA 2YSPA 4R03A 4LFBI 2EOSA 3TQMA 4XTJA 2AJ4A 1EH6A 3OTOE 4LFCI 4J3DA 4AIMA 4URLA 5K36E 1UDSA 3AV0A 1X48A 4OOGC 3OMLA 1EH7A 2EPZA 3QG5C 1ZM3A 3Q1QA 1S4EA 2R3VA 2A2CA 1YHCA 4RH8A 4P78A 5A6BD 2IOPA 4FW5A 5EL9A 2YTPA 4FK5C 4JI8I 2Z5CB 3NZKA 4USMA 2EN6A 1RC7A 4LF8E 2BR2B 2DRPA 4WUBA 2B7TA 4R2AA 4F9CB 1ZR9A 4BA1B 4GEQB 1Z0WA 2JEAB 2Z5BB 3ZOQB 2YU8A 2PRTA 4WX9A 1YPNA 4O43A 1X6HA 2CG9A 2J7KA 2EMWA 3M7NG 1AH5A 1N33I 1YUJA 3J81C 3L00A 4JI0E 4GQUA 2HC5A 2C37B 1IBKE 2X36A 4OKGA 5BR8E 1BBOA 2CZ9A 3PYFA 4DV5I 4J8ZA 4OX9I 2JEBB 2YTNA 1FWLA 4DV0I 1WHNA 1PJTA 2EOJA 3MSWA 2M7QA 2BM1A 4JYAE 2HKEA 2EL6A 1XNQI 2GQ0A 1N3GA 1WRJA 4WFTA 2NN6F 4BC9A 4IFDF 4JI6I 3AUZA 4IZJD 2PO1A 4B3RI 3H09A 3UHMA 4DR3E 3PRYA 4BC7A 2V88A 2Q8UA 3B78A 2MC5A 2ZM6E 2UUCE 3P3GA 3T1HE 2PNZB 5K36D 2K7IA 2L3JA 1WXRA 3C6KA 2FTXB 1IMUA 4LF7E 4DR7I 1UILA 2HK2A 1JK1A 5DRRA 2ODRC 3PS3A 1GQEA 1STUA 2LCEA 1R6LA 2WW4A 4TUGA 3C4TA 2LUPB 4GZNC 1PVGA 1NEIA 5AASA 2X7IA 3JU0A 2JT2A 2FV4B 2UXDI 4IZJA 2DGCA 2UXCE 2ELZA 2E1MA 3HQ1A 3WU3A 4IZKA 1PDAA 3K6QA 2EOZA 3UK3C 1XMOI 5C0XF 5GMDA 3KWRA 4DV3E 2EOOA 3HPZA 3B8HA 3ZZTA 2AE8A 1EA6A 4JV5I 2C39B 1ELOA 2NN6E 1PJQA 2V85A 4Q35B 3C4BA 2EMLA 4WXDA 4HACA 4NXMI 4X64I 1XXEA 2EM8A 3QT7A 4ZYHA 1D6TA 2FGGA 5T6JA 4DV1E 4OO1A 4YHHI 2VQFI 4DR4E 1DI2A 4JI4I 2EJ4A 3CWVA 4LCFA 4PRXA 1QZRA 4R2QA 1BBGA 4DV4E 2UU9E 1O0WA 2L2KB 2EMFA 2EOFA 1WUUA 2L8TA 4X66E 4DV6I 3HPSA 2LUQA 4M30A 3ADIA 5IWAE 4R2PA 1UDOA 2MDGA 1A1IA 4MLVA 4I8OA 1KTVA 1N32E 4USKA 2LO3A 2EMXA 5IT9Q 2EPKX 3QT5A 4DXLA 2L6MA 2IOQA 2CSHA 2Q2EB 4LF4E 1X49A 1RMDA 4U3DA 5C0XE 3P3EA 2YT4A 3M85G 4AM3A 3EPHA 2GS8A 2HHHI 3BGHA 1KYQA 2DEJA 5EKWA 1Y5YA 3THNA 4JI5I 2EOMA 2M1SA 2ELYA 2YTJA 2ENCA 4LF6E 5A69A 5KL7A 2F4VI 2E72A 4F6MA 2EM0A 4DV2I 4X65E 2EMKA 1NHHA 3ZZUA 2NN6D 2EM5A 1FWKA 1HNZI 3LPSA 4IFDD 1SR9A 1X3CA 2DIXA 5A6JA 1MG7A 4JI3I 2PNLA 4Q28A 3RMPA 4RHBB 2C39A 1A6FA 3M6AA 1LLMC 3LLHA 4WYQB 1HNXE 4RPFA 1JK2A 2EM9A 3ZKDA 1IBLI 5IV8B 4F54A 2ZBKB 4UT4A 2RTXA 1Z0EA 5KL4A 1F2IG 3HJCA 2WP8A 1Z5BA 1MU5A 2GO3A 4MDTA 2HKJA 1L4SA 2EPCA 4DV7E 4MYUA 4IFDA 2XEXA 4FW6A 2LE2A 3KZZA 1TF6A 4FW7A 3PS1A 2EOHA 3D4JA 1G2DC 4R2SA 2YZTA 3THOB 1P47A 4LFAE 1Z1BA 3P06A 4IZJB 1FJGE 4B3ME 3PYEA 1XMQI 1J26A 3DD6A 2V2QA 5C0XD 4IZKB 4FWHA 1HNWI 4N4RB 4DR6E 2DMIA 1A1FA 2EPXA 4R8OA 1IBKI 4HYMA 4BCAA 2K4VA 1KVKA 4DPUA 1YFHA 4DPTA 3GCMA 4M2ZA 4BBYA 2UXBE 2R1FA 4NBQA 5DNYA 1X6EA 3F0NA 2E5LI 2EOIA 5A6BA 4FWDA 1ZM2A 4HACB 5C0XA 4LF5I 2BA1G 4OO1C 4NXNI 1T4LB 4BA2A 1DQ3A 4FN5A 4LCGA 4LFBE 2PO2A 1FKAE 4OO1B 2YTEA 4DR3I 4LFCE 4DPYA 1H72C 3QT8A 1B63A 1ZM4A 3M85D 3F6GA 1KIJA 1Z0VA 1ZM9A 4JI2I 4Z7CA 1I94I 5F3WA 2M4IA 2WCC3 5IT9C 3L7ZA 2LTRA 2NABA 2EMAA 1H74A 4JI8E 2GPIA 1X6FA 4BHBA 2RPCA 2JE6A 3LTOA 3BF2A 1RR9A 4DUZI 1N36I 2UXCI 2RS6A 4X9JA 4R2DA 2CT1A 1A1GA 2NUEA 2Z5EA 4OZEA 4GKKI 1Z0BA 2EP3A 4B3TI 4DR2I 4AQYI 2JP9A 2I9IA 1N33E 4FW3A 5AC5A 2YTGA 2MKNA 5DRPA 3VHTB 4OX9E 2V8QB 4DUYE 2EPPA 1IBME 5K36A 2EQ1A 4R2CA 2BBGA 1ZAAC 4WSGA 1YZ9A 4DR5I 2O1UA 4DV0E 2V2VA 4JI7E 2DSYA 2N3GA 2YSOA 2EPNA 1Z5CA 5CFFE 4GKJI 2EOEA 2F8BA 1XNQE 1H7UA 5AE3A 2UUAI 4MLQA 4HY1A 4X8WA 1MEYC 2EMYA 2JYAA 3VK6A 4TUIA 3HTXA 2EN7A 5FLXC 2LV2A 2PNMA 4M1KA 4WUDA 4K0KI 4B3RE 1PKPA 1Y4SA 1YYOA 4DV4I 2EOQA 4KWYA 1MGTA 2EN4A 4LF9I 5A6KA 3IWBA 2CGEA 2B3TB 1E3PA 2H36X 2ENAA 4DR7E 2HFUA 4FW4A 2VQEE 4U3BA 4ZYEA 3V2UC 1UN6B 2WP8B 4IFDC 3LNUA 4LU9A 2O1WA 2NN6B 4X62I 4IFDB 2EM6A 2UXDE 5AE1A 3M7ND 5LMUI 1EKZA 1GZ6A 4FWGA 4KHPI 2EN8A 2WBTA 2HGHA 2DEIA 3PYDA 4NHRA 2ZITA 3IWCA 4KZSA 5A2QQ 4WPYA 2JOBA 2BA1D 3V5RA 3WU4A 4B3SE 1J5EI 2A2DA 1XMOE 5LL6R 4DR1E
chains in the Genus database with same CATH topology
5FWKA 3GONA 4YY3I 4BMJA 1ZBQA 2OI2A 4X65I 1OJ4A 1HR0I 4JV5E 4L8NA 1S16A 4NXME 1USVA 4X64E 2V83A 4JI1I 4ED4A 4YHHE 1VISA 1XNRI 4EMDA 4I3HA 4P52A 3J80Q 2VE7C 1Z5AA 5LMNI 1XHKA 4ZVIA 3J7AG 4DV6E 3OTOI 3J7AM 5FLXQ 1BKNA 4B3MI 3T1YE 2WZOA 1UEKA 3FIGA 1FI4A 3JAMQ 2L33A 4LF8I 3B82A 2L2MA 4P7DA 4JI5E 4R1FA 2O1TA 3ADLA 3ZZ0A 2UXBI 3J7Yp 4DV2E 4JI0I 2DMYA 3ZM7A 2KHXA 1PIEA 1HNZE 5BR8I 3P1XA 4JI3E 1QU6A 2LJHA 2EZ6A 4FW9A 2JY9A 2EFGA 3K17A 4JYAI 1IBLE 2DB2A 1YYWA 2R42A 2L92A 2V34A 1DARA 2BV3A 2ZM6I 2UUCI 3T1HI 1H73A 3JTZA 1B62A 1N0VC 5A2QC 1NZ0A 3VYXA 4LF7I 2RSMA 1Z59A 5L3JA 3DF6A 3K85A 2LBSB 1XMQE 2EWLA 4P7AA 1HNWE 3K1JA 4PRVA 2MC6A 2JWOA 2LMZA 4DUYI 1IBMI 4WUCA 1RREA 2KOUA 1N0UA 2V8PA 3PYGA 2LTSA 4JI7I 4L5NC 4DV3I 2E5LE 4DV5E 3J80C 4LF5E 4WSPA 4NXNE 2HK3A 1X47A 4DU7A 2JVAA 1HK7A 4KQVA 2JOXA 4LTYA 2LRSA 2G7HA 4DV1I 4PU9A 4JI2E 1I94E 4JI6E 2V86A 2VQEI 4DR4I 4F9AB 4N3OA 1MX0A 2UU9I 1Y4UA 1T4OA 1N36E 4DUZE 4X66I 4DPWA 2O1VA 3Q6MA 3JAMC 1WHQA 5IWAI 5ADZA 2Z5CA 4GKKE 4B3SI 4B3TE 4DR2E 4AQYE 1N32I 2HFSA 4DR1I 1ZXNA 2Z5BA 4JG4A 4LF4I 3DJWA 3QT6A 1K47A 2N3HA 2KONA 3ADJA 4DR5E 1T4NA 1KKHA 3ADGA 2JR1A 4DKKA 4GKJE 1U2RA 2UUAE 4LF6I 2BM0A 2B7VA 2V89A 1N34E 2UUBE 4MYTA 3ZKBA 3J81Q 4HXZA 1Z0GA 4K0KE 2L3CA 3IWDA 2NUFA 2ODRD 4Z7YA 4LF9E 3LMLA 1UHZA 2VF1A 1ZBTA 5GMEA 2VQFE 1Z0CA 4JI4E 2NUGA 2LJPA 1HNXI 3WU5A 2B9DA 4X62E 2MDRA 5LMUE 2V87A 2E1RA 4KHPE 3F6HA 3WU6A 2RS7A 3VYYA 4DV7I 2IHR1 2CPNA 3T1YI 3HXLA 3HULA 1J5EE 1FNMA 1YYKA 1RQ0A 4LFAI 4DPXA 1EI1A 1H7SA 1FJGI 1USUA 1NHIA 1Z0TA 4YY3E 2V2ZA 2VF3A 2L2NA 3Q6NA 4M0VA 4DU8A 1Y6ZA 1HR0E 2HHHE 3H4LA 4DR6I 4BS9A 4JI1E 2NA2A 4F9BB 5AE2A 2F4VE 1XNRE 1ZXMA 4UTGA 5LMNE 4DMIA 1NHJA 4R03A 4LFBI 4XTJA 2AJ4A 3OTOE 4LFCI 4URLA 3AV0A 1X48A 4OOGC 3OMLA 1ZM3A 3Q1QA 1S4EA 2R3VA 2A2CA 4P78A 2IOPA 4JI8I 2Z5CB 4USMA 1RC7A 4LF8E 4WUBA 2B7TA 4F9CB 4GEQB 1Z0WA 2Z5BB 3ZOQB 2CG9A 2J7KA 1N33I 3J81C 4JI0E 1IBKE 2X36A 5BR8E 2CZ9A 3PYFA 4DV5I 4OX9I 4J8ZA 1FWLA 4DV0I 1WHNA 3MSWA 2M7QA 2BM1A 4JYAE 2HKEA 1XNQI 2GQ0A 4WFTA 4BC9A 4JI6I 3AUZA 4IZJD 4B3RI 3H09A 4DR3E 3PRYA 4BC7A 2V88A 3B78A 2MC5A 2ZM6E 2UUCE 3T1HE 2L3JA 1WXRA 2FTXB 4DR7I 4LF7E 1UILA 2HK2A 2ODRC 1GQEA 1STUA 2WW4A 4TUGA 3C4TA 2LUPB 1PVGA 2X7IA 5AASA 2NPFA 2UXDI 3JU0A 2FV4B 4IZJA 2UXCE 2E1MA 3HQ1A 3WU3A 4IZKA 3K6QA 1XMOI 5GMDA 3KWRA 4DV3E 3HPZA 3B8HA 3ZZTA 1EA6A 4JV5I 1ELOA 4NXMI 2V85A 4HACA 3C4BA 4X64I 3QT7A 1D6TA 2FGGA 5T6JA 4DV1E 4YHHI 2VQFI 4DR4E 1DI2A 4JI4I 3CWVA 4PRXA 1QZRA 4DV4E 2UU9E 1O0WA 2L2KB 1WUUA 2L8TA 4X66E 4DV6I 3HPSA 2LUQA 4M30A 3ADIA 5IWAE 4USKA 4I8OA 1KTVA 1N32E 5IT9Q 3QT5A 4DXLA 2L6MA 2IOQA 2Q2EB 4LF4E 1X49A 2YT4A 2GS8A 2HHHI 2DEJA 4JI5I 2M1SA 4LF6E 2F4VI 4DV2I 4X65E 3ZZUA 1NHHA 1FWKA 1HNZI 3LPSA 1SR9A 2DIXA 4JI3I 1MG7A 2PNLA 4Q28A 3RMPA 1A6FA 3M6AA 3LLHA 1HNXE 4WYQB 4RPFA 3ZKDA 1IBLI 4F54A 2ZBKB 4UT4A 2RTXA 1Z0EA 3HJCA 1Z5BA 1MU5A 2HKJA 4MYUA 4DV7E 2XEXA 2LE2A 3D4JA 2YZTA 4LFAE 3P06A 4IZJB 1FJGE 4B3ME 3PYEA 1XMQI 1J26A 2V2QA 4IZKB 4FWHA 1HNWI 4DR6E 4R8OA 1IBKI 4HYMA 4BCAA 2K4VA 1KVKA 4DPUA 4DPTA 4M2ZA 4BBYA 2UXBE 5DNYA 3F0NA 2E5LI 4FWDA 1ZM2A 4HACB 4LF5I 4NXNI 1T4LB 1DQ3A 4FN5A 4LFBE 1FKAE 4DR3I 4LFCE 4DPYA 1H72C 3QT8A 1B63A 1ZM4A 3F6GA 1KIJA 1Z0VA 1ZM9A 4JI2I 4Z7CA 1I94I 5F3WA 2M4IA 5IT9C 2LTRA 1H74A 4JI8E 1N36I 3LTOA 1RR9A 4DUZI 2UXCI 2RS6A 2NUEA 2Z5EA 4GKKI 1Z0BA 4B3TI 4DR2I 4AQYI 1N33E 4OX9E 2V8QB 4DUYE 1IBME 1YZ9A 4DR5I 2O1UA 4DV0E 2V2VA 4JI7E 2DSYA 2N3GA 1Z5CA 5CFFE 4GKJI 2F8BA 1XNQE 1H7UA 5AE3A 2UUAI 4HY1A 4X8WA 3HTXA 3VK6A 4TUIA 1N34I 2UUBI 5FLXC 2PNMA 4WUDA 4M1KA 4K0KI 4B3RE 1PKPA 1Y4SA 1YYOA 4DV4I 4LF9I 3IWBA 2CGEA 2B3TB 2H36X 4DR7E 2HFUA 2VQEE 3V2UC 3LNUA 4LU9A 2O1WA 4X62I 2UXDE 5AE1A 5LMUI 1EKZA 1GZ6A 4FWGA 4KHPI 2DEIA 3PYDA 2ZITA 3IWCA 4KZSA 5A2QQ 4WPYA 2JOBA 3V5RA 3WU4A 4B3SE 1J5EI 2A2DA 1XMOE 5LL6R 4DR1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GON A;  4YY3 I;  2OI2 A;  4X65 I;  1OJ4 A;  1HR0 I;  4JV5 E;  1S16 A;  4NXM E;  4X64 E;  4JI1 I;  4ED4 A;  4YHH E;  1VIS A;  1XNR I;  4EMD A;  4I3H A;  4P52 A;  3J80 Q;  1Z5A A;  5LMN I;  1XHK A;  4ZVI A;  3J7A G;  4DV6 E;  3OTO I;  3J7A M;  5FLX Q;  1BKN A;  4B3M I;  3T1Y E;  1UEK A;  1FI4 A;  3JAM Q;  2L33 A;  4LF8 I;  3B82 A;  2L2M A;  4JI5 E;  4R1F A;  3ADL A;  3ZZ0 A;  2UXB I;  3J7Y p;  4DV2 E;  4JI0 I;  2DMY A;  3ZM7 A;  2KHX A;  1PIE A;  1HNZ E;  5BR8 I;  3P1X A;  4JI3 E;  1QU6 A;  2LJH A;  2EZ6 A;  4FW9 A;  2JY9 A;  2EFG A;  3K17 A;  4JYA I;  1IBL E;  2DB2 A;  1YYW A;  2R42 A;  2V34 A;  1DAR A;  2BV3 A;  2ZM6 I;  2UUC I;  3T1H I;  1N0V C;  1B62 A;  1H73 A;  1NZ0 A;  5A2Q C;  3VYX A;  4LF7 I;  2RSM A;  1Z59 A;  5L3J A;  2LBS B;  1XMQ E;  4P7A A;  1HNW E;  3K1J A;  4PRV A;  4DUY I;  1IBM I;  4WUC A;  1RRE A;  1N0U A;  2V8P A;  3PYG A;  2LTS A;  4JI7 I;  4DV3 I;  2E5L E;  4DV5 E;  3J80 C;  4LF5 E;  4NXN E;  2HK3 A;  1X47 A;  4DU7 A;  2JVA A;  4KQV A;  2LRS A;  4DV1 I;  4PU9 A;  4JI2 E;  1I94 E;  4JI6 E;  2VQE I;  4DR4 I;  1MX0 A;  2UU9 I;  1T4O A;  1N36 E;  4DUZ E;  4X66 I;  4DPW A;  3JAM C;  1WHQ A;  5IWA I;  4GKK E;  4B3S I;  4B3T E;  4DR2 E;  4AQY E;  1N32 I;  2HFS A;  4DR1 I;  1ZXN A;  4JG4 A;  4LF4 I;  3QT6 A;  1K47 A;  2N3H A;  3ADJ A;  4DR5 E;  1T4N A;  1KKH A;  3ADG A;  4DKK A;  4GKJ E;  1U2R A;  2UUA E;  4LF6 I;  2BM0 A;  2B7V A;  1N34 E;  2UUB E;  4MYT A;  3ZKB A;  3J81 Q;  4HXZ A;  1Z0G A;  4K0K E;  2L3C A;  2NUF A;  4Z7Y A;  4LF9 E;  1UHZ A;  1ZBT A;  5GME A;  2VQF E;  1Z0C A;  4JI4 E;  2NUG A;  2LJP A;  1HNX I;  3WU5 A;  4X62 E;  2MDR A;  5LMU E;  2E1R A;  4KHP E;  3WU6 A;  2RS7 A;  3VYY A;  4DV7 I;  2IHR 1;  2CPN A;  3T1Y I;  3HUL A;  1J5E E;  1FNM A;  1YYK A;  1RQ0 A;  4LFA I;  4DPX A;  1EI1 A;  1H7S A;  1FJG I;  1NHI A;  1Z0T A;  4YY3 E;  2V2Z A;  2VF3 A;  2L2N A;  4DU8 A;  1HR0 E;  2HHH E;  3H4L A;  4DR6 I;  4JI1 E;  2NA2 A;  2F4V E;  1XNR E;  1ZXM A;  4UTG A;  5LMN E;  1NHJ A;  4LFB I;  4XTJ A;  2AJ4 A;  3OTO E;  4LFC I;  4URL A;  1X48 A;  4OOG C;  1ZM3 A;  3Q1Q A;  1S4E A;  2R3V A;  2A2C A;  4JI8 I;  4USM A;  1RC7 A;  4LF8 E;  4WUB A;  2B7T A;  1Z0W A;  2J7K A;  1N33 I;  3J81 C;  4JI0 E;  1IBK E;  2X36 A;  5BR8 E;  2CZ9 A;  3PYF A;  4DV5 I;  4OX9 I;  1FWL A;  4DV0 I;  1WHN A;  2BM1 A;  4JYA E;  2HKE A;  1XNQ I;  4WFT A;  4JI6 I;  4B3R I;  4DR3 E;  3B78 A;  2ZM6 E;  2UUC E;  3T1H E;  2L3J A;  4DR7 I;  4LF7 E;  1UIL A;  2HK2 A;  1GQE A;  1STU A;  2WW4 A;  3C4T A;  2LUP B;  1PVG A;  2X7I A;  2NPF A;  2UXD I;  2UXC E;  3WU3 A;  1XMO I;  5GMD A;  4DV3 E;  3B8H A;  3ZZT A;  1EA6 A;  4JV5 I;  1ELO A;  4NXM I;  4HAC A;  3C4B A;  4X64 I;  3QT7 A;  1D6T A;  4DV1 E;  4YHH I;  2VQF I;  4DR4 E;  1DI2 A;  4JI4 I;  3CWV A;  4PRX A;  1QZR A;  4DV4 E;  2UU9 E;  1O0W A;  2L2K B;  1WUU A;  4X66 E;  4DV6 I;  2LUQ A;  4M30 A;  3ADI A;  5IWA E;  4USK A;  1KTV A;  1N32 E;  5IT9 Q;  3QT5 A;  4DXL A;  2Q2E B;  4LF4 E;  1X49 A;  2YT4 A;  2GS8 A;  2HHH I;  2DEJ A;  4JI5 I;  4LF6 E;  2F4V I;  4DV2 I;  4X65 E;  3ZZU A;  1NHH A;  1FWK A;  1HNZ I;  3LPS A;  2DIX A;  4JI3 I;  1MG7 A;  1A6F A;  3M6A A;  3LLH A;  1HNX E;  4WYQ B;  4RPF A;  3ZKD A;  1IBL I;  2ZBK B;  4UT4 A;  2RTX A;  1Z0E A;  1Z5B A;  1MU5 A;  2HKJ A;  4MYU A;  4DV7 E;  2XEX A;  3D4J A;  4LFA E;  1FJG E;  4B3M E;  3PYE A;  1XMQ I;  1J26 A;  2V2Q A;  4FWH A;  1HNW I;  4DR6 E;  1IBK I;  4HYM A;  1KVK A;  4DPU A;  4DPT A;  4M2Z A;  2UXB E;  3F0N A;  2E5L I;  4FWD A;  1ZM2 A;  4HAC B;  4LF5 I;  4NXN I;  1T4L B;  4FN5 A;  4LFB E;  1FKA E;  4DR3 I;  4LFC E;  4DPY A;  1H72 C;  3QT8 A;  1B63 A;  1ZM4 A;  1KIJ A;  1Z0V A;  1ZM9 A;  4JI2 I;  4Z7C A;  1I94 I;  5IT9 C;  2LTR A;  1H74 A;  4JI8 E;  1N36 I;  3LTO A;  1RR9 A;  4DUZ I;  2UXC I;  2RS6 A;  2NUE A;  4GKK I;  1Z0B A;  4B3T I;  4DR2 I;  4AQY I;  1N33 E;  4OX9 E;  4DUY E;  1IBM E;  1YZ9 A;  4DR5 I;  2V2V A;  4DV0 E;  4JI7 E;  2N3G A;  1Z5C A;  5CFF E;  4GKJ I;  1XNQ E;  1H7U A;  2UUA I;  4HY1 A;  4X8W A;  3HTX A;  1N34 I;  2UUB I;  5FLX C;  4WUD A;  4M1K A;  4K0K I;  4B3R E;  1PKP A;  1YYO A;  4DV4 I;  4LF9 I;  2B3T B;  4DR7 E;  2HFU A;  2VQE E;  3V2U C;  3LNU A;  4X62 I;  2UXD E;  5LMU I;  1EKZ A;  4FWG A;  4KHP I;  2DEI A;  3PYD A;  2ZIT A;  5A2Q Q;  3V5R A;  3WU4 A;  4B3S E;  1J5E I;  2A2D A;  1XMO E;  5LL6 R;  4DR1 E; 
#chains in the Genus database with same CATH topology
 3EPJ A;  5FWK A;  2LJU A;  5JEA F;  2YRK A;  3GON A;  4WXC A;  4BMJ A;  4YY3 I;  1ZBQ A;  2OI2 A;  4O5G A;  4X65 I;  1OJ4 A;  1HR0 I;  4JV5 E;  1TN9 A;  4L8N A;  1TF3 A;  4NXM E;  5A6A A;  1S16 A;  1USV A;  4MU3 A;  5C0X C;  4X64 E;  2V83 A;  4JI1 I;  2DLQ A;  2HJJ A;  4ED4 A;  2BA0 G;  1OYR A;  5C0X B;  4YHH E;  1VIS A;  1AAY A;  1XNR I;  4EMD A;  1UDN A;  2YTD A;  4I3H A;  4BA2 B;  2PO2 B;  4P52 A;  3J80 Q;  2EMH A;  2VE7 C;  1Z5A A;  5LMN I;  5AC4 A;  2ADR A;  2ENH A;  1XHK A;  2F1D A;  3J7A G;  4ZVI A;  1P42 A;  2YU5 A;  1OYP A;  2EQ3 A;  4DV6 E;  2PO0 A;  2O3Z A;  3OTO I;  3J7A M;  5DRO A;  4ISA A;  3L7Z B;  2EPM X;  3KRN A;  3BID A;  5FLX Q;  5IXM B;  4IS1 C;  2EPL X;  5DNX A;  4ZYD A;  1N34 I;  2N8X A;  3P3C A;  1YSA C;  1BKN A;  4B3M I;  2JE6 B;  2EPU A;  2NN6 A;  2WNR B;  1GTK A;  3T1Y E;  2WZO A;  5JEA E;  1UEK A;  4LOM A;  3FIG A;  1EH8 A;  1FI4 A;  2YTQ A;  2L33 A;  2LT7 A;  3B82 A;  3JAM Q;  4LF8 I;  2L2M A;  4P7D A;  4OO1 F;  2C38 B;  1T38 A;  4JI5 E;  3CDJ A;  2EOY A;  4R1F A;  2O1T A;  1A1J A;  3ADL A;  5K36 C;  2WBU A;  2GO4 A;  3ZZ0 A;  2UXB I;  5K36 B;  3J7Y p;  2RSI A;  4DV2 E;  3EPL A;  4JI0 I;  2DMY A;  3ZM7 A;  2KHX A;  1PIE A;  1HNZ E;  5BR8 I;  3P1X A;  4JI3 E;  1QU6 A;  2LJH A;  2EM4 A;  2EZ6 A;  4FW9 A;  2JY9 A;  2EFG A;  1A1H A;  3K17 A;  4JYA I;  1SFE A;  3KZY A;  1Y60 A;  1X5W A;  1IBL E;  4M9V C;  2DB2 A;  2EMC A;  1YYW A;  2R42 A;  2L92 A;  1NCS A;  2V34 A;  1DAR A;  3U1Y A;  2BV3 A;  2EM2 A;  2ZM6 I;  2UUC I;  3T1H I;  3JTZ A;  1B62 A;  1H73 A;  1N0V C;  5A2Q C;  1NZ0 A;  1YH8 A;  3VYX A;  3GME A;  4QNK A;  5DNL A;  4LF7 I;  2RSM A;  2EMZ A;  4IJD A;  1Z59 A;  5L3J A;  3DF6 A;  2BB8 A;  4MU4 A;  2YTI A;  3K85 A;  2EL4 A;  2LBS B;  1XMQ E;  2EWL A;  4P7A A;  2BA0 D;  4OO1 E;  1HNW E;  3K1J A;  2EPA A;  5JEA D;  4PRV A;  2MC6 A;  2CTD A;  3M99 B;  2JWO A;  2LMZ A;  4NZV A;  5KL2 A;  4R2E A;  5DRQ A;  3BBG A;  2EQ0 A;  2WNR A;  4DUY I;  1ZU1 A;  2NPF A;  4WUC A;  1IBM I;  2EE8 A;  1RRE A;  2KOU A;  2YTO A;  1N0U A;  2V8P A;  2YWQ A;  2EPR A;  3ECR A;  2GLI A;  2LTS A;  1RHY A;  4F6N A;  3PYG A;  4JI7 I;  2C38 A;  4L5N C;  4F2J C;  4DV3 I;  2E5L E;  1UDQ A;  4DV5 E;  3J80 C;  4LF5 E;  4WSP A;  4NXN E;  2HK3 A;  2EPO A;  4HEI A;  5JEA A;  1X47 A;  3P76 A;  4DU7 A;  1A1L A;  2JVA A;  5KL5 A;  1HK7 A;  4KQV A;  4QNJ A;  2VRD A;  2JOX A;  4LTY A;  2LVH A;  2LRS A;  2G7H A;  3MHH C;  4PU9 A;  4JI2 E;  2JXP A;  1I94 E;  4JI6 E;  2V86 A;  2VQE I;  4DV1 I;  4DR4 I;  4F9A B;  4MU1 A;  4N3O A;  1MX0 A;  2PO0 B;  1Y4U A;  3GLL A;  2UU9 I;  2UUB I;  2CVE A;  1T4O A;  2D9H A;  1N36 E;  4DUZ E;  4X66 I;  2A25 A;  1IQO A;  4DPW A;  2O1V A;  3Q6M A;  2NN6 C;  3JAM C;  1WHQ A;  5IWA I;  2YTF A;  4ZYG A;  5ADZ A;  2Z5C A;  4GKK E;  3CDI A;  4MQY A;  4B3S I;  4B3T E;  4OO1 D;  4DR2 E;  4AQY E;  1N32 I;  2BR2 A;  2HFS A;  3H1C A;  4DR1 I;  5ELW A;  3U1K A;  3EQ1 A;  5KL3 A;  4BA1 A;  2JEA A;  1ZXN A;  2Z5B A;  4JG4 A;  4LF4 I;  3C6M A;  2MKD A;  4O4K A;  3DJW A;  2DLK A;  1K47 A;  3QT6 A;  2N3H A;  2KON A;  3ADJ A;  4DR5 E;  1T4N A;  1G2F C;  2JPA A;  1KKH A;  2C37 A;  3ADG A;  2EM3 A;  2JR1 A;  4HTG A;  2EL5 A;  4BHC A;  4DKK A;  1UBD C;  1B69 A;  2I13 A;  4GKJ E;  4IFD E;  1U2R A;  2UUA E;  4LF6 I;  2BM0 A;  2JEB A;  2B7V A;  2V89 A;  1N34 E;  2UUB E;  1E3H A;  4MYT A;  3ZKB A;  4HXZ A;  3J81 Q;  1Z0G A;  4LPF A;  1T39 A;  2WBS A;  4K0K E;  2GHF A;  2L3C A;  1R6M A;  3IWD A;  2NUF A;  2ODR D;  4O24 A;  4Z7Y A;  4LF9 E;  3LML A;  1UHZ A;  2VF1 A;  1ZBT A;  5TSE A;  5GME A;  2IES A;  2VQF E;  1Z0C A;  5LLQ A;  1KJK A;  4JI4 E;  2NUG A;  2LJP A;  1HNX I;  2PNZ A;  2M9A A;  3WU5 A;  2B9D A;  2VES A;  2EMG A;  4X62 E;  4R2R A;  2YRH A;  2MDR A;  2EN2 A;  2J7J A;  5K36 F;  5LMU E;  2V87 A;  2E1R A;  4KHP E;  3EPK A;  3F6H A;  3WU6 A;  2RS7 A;  3VYY A;  1A1K A;  4DV7 I;  2IHR 1;  2CPN A;  3T1Y I;  3HXL A;  3HUL A;  2EMI A;  1YUI A;  1J5E E;  4LCH A;  1FNM A;  2IER A;  1QNT A;  1YYK A;  1RQ0 A;  2EN1 A;  4DPX A;  1BB8 A;  4LFA I;  2EMB A;  1EI1 A;  1H7S A;  1FJG I;  2EN3 A;  1NHI A;  2YRM A;  1IQS A;  4YY3 E;  1OYS A;  1USU A;  1Z0T A;  2V2Z A;  2VF3 A;  2L2N A;  4MU0 A;  2R76 A;  3HKM A;  3Q6N A;  4M0V A;  3PS2 A;  2EM7 A;  4DU8 A;  1Y6Z A;  1HR0 E;  2HHH E;  3H4L A;  4DR6 I;  1WJP A;  3B4T A;  1PJS A;  2RQL A;  3MHS C;  4BS9 A;  4JI1 E;  4IS9 A;  2YPN A;  1DGC A;  4AID A;  2NA2 A;  4F9B B;  5AE2 A;  2F4V E;  5JEA C;  2EOX A;  1XNR E;  1ZXM A;  2EOR A;  2PO1 B;  2J65 A;  4UTG A;  5JEA B;  1VI7 A;  5LMN E;  4DMI A;  5KL6 A;  1NHJ A;  2YSP A;  4R03 A;  4LFB I;  2EOS A;  3TQM A;  4XTJ A;  2AJ4 A;  1EH6 A;  3OTO E;  4LFC I;  4J3D A;  4AIM A;  4URL A;  5K36 E;  1UDS A;  3AV0 A;  1X48 A;  4OOG C;  3OML A;  1EH7 A;  2EPZ A;  3QG5 C;  1ZM3 A;  3Q1Q A;  1S4E A;  2R3V A;  2A2C A;  1YHC A;  4RH8 A;  4P78 A;  5A6B D;  2IOP A;  4FW5 A;  5EL9 A;  2YTP A;  4FK5 C;  4JI8 I;  2Z5C B;  3NZK A;  4USM A;  2EN6 A;  1RC7 A;  4LF8 E;  2BR2 B;  2DRP A;  4WUB A;  2B7T A;  4R2A A;  4F9C B;  1ZR9 A;  4BA1 B;  4GEQ B;  1Z0W A;  2JEA B;  2Z5B B;  3ZOQ B;  2YU8 A;  2PRT A;  4WX9 A;  1YPN A;  4O43 A;  1X6H A;  2CG9 A;  2J7K A;  2EMW A;  3M7N G;  1AH5 A;  1N33 I;  1YUJ A;  3J81 C;  3L00 A;  4JI0 E;  4GQU A;  2HC5 A;  2C37 B;  1IBK E;  2X36 A;  4OKG A;  5BR8 E;  1BBO A;  2CZ9 A;  3PYF A;  4DV5 I;  4J8Z A;  4OX9 I;  2JEB B;  2YTN A;  1FWL A;  4DV0 I;  1WHN A;  1PJT A;  2EOJ A;  3MSW A;  2M7Q A;  2BM1 A;  4JYA E;  2HKE A;  2EL6 A;  1XNQ I;  2GQ0 A;  1N3G A;  1WRJ A;  4WFT A;  2NN6 F;  4BC9 A;  4IFD F;  4JI6 I;  3AUZ A;  4IZJ D;  2PO1 A;  4B3R I;  3H09 A;  3UHM A;  4DR3 E;  3PRY A;  4BC7 A;  2V88 A;  2Q8U A;  3B78 A;  2MC5 A;  2ZM6 E;  2UUC E;  3P3G A;  3T1H E;  2PNZ B;  5K36 D;  2K7I A;  2L3J A;  1WXR A;  3C6K A;  2FTX B;  1IMU A;  4LF7 E;  4DR7 I;  1UIL A;  2HK2 A;  1JK1 A;  5DRR A;  2ODR C;  3PS3 A;  1GQE A;  1STU A;  2LCE A;  1R6L A;  2WW4 A;  4TUG A;  3C4T A;  2LUP B;  4GZN C;  1PVG A;  1NEI A;  5AAS A;  2X7I A;  3JU0 A;  2JT2 A;  2FV4 B;  2UXD I;  4IZJ A;  2DGC A;  2UXC E;  2ELZ A;  2E1M A;  3HQ1 A;  3WU3 A;  4IZK A;  1PDA A;  3K6Q A;  2EOZ A;  3UK3 C;  1XMO I;  5C0X F;  5GMD A;  3KWR A;  4DV3 E;  2EOO A;  3HPZ A;  3B8H A;  3ZZT A;  2AE8 A;  1EA6 A;  4JV5 I;  2C39 B;  1ELO A;  2NN6 E;  1PJQ A;  2V85 A;  4Q35 B;  3C4B A;  2EML A;  4WXD A;  4HAC A;  4NXM I;  4X64 I;  1XXE A;  2EM8 A;  3QT7 A;  4ZYH A;  1D6T A;  2FGG A;  5T6J A;  4DV1 E;  4OO1 A;  4YHH I;  2VQF I;  4DR4 E;  1DI2 A;  4JI4 I;  2EJ4 A;  3CWV A;  4LCF A;  4PRX A;  1QZR A;  4R2Q A;  1BBG A;  4DV4 E;  2UU9 E;  1O0W A;  2L2K B;  2EMF A;  2EOF A;  1WUU A;  2L8T A;  4X66 E;  4DV6 I;  3HPS A;  2LUQ A;  4M30 A;  3ADI A;  5IWA E;  4R2P A;  1UDO A;  2MDG A;  1A1I A;  4MLV A;  4I8O A;  1KTV A;  1N32 E;  4USK A;  2LO3 A;  2EMX A;  5IT9 Q;  2EPK X;  3QT5 A;  4DXL A;  2L6M A;  2IOQ A;  2CSH A;  2Q2E B;  4LF4 E;  1X49 A;  1RMD A;  4U3D A;  5C0X E;  3P3E A;  2YT4 A;  3M85 G;  4AM3 A;  3EPH A;  2GS8 A;  2HHH I;  3BGH A;  1KYQ A;  2DEJ A;  5EKW A;  1Y5Y A;  3THN A;  4JI5 I;  2EOM A;  2M1S A;  2ELY A;  2YTJ A;  2ENC A;  4LF6 E;  5A69 A;  5KL7 A;  2F4V I;  2E72 A;  4F6M A;  2EM0 A;  4DV2 I;  4X65 E;  2EMK A;  1NHH A;  3ZZU A;  2NN6 D;  2EM5 A;  1FWK A;  1HNZ I;  3LPS A;  4IFD D;  1SR9 A;  1X3C A;  2DIX A;  5A6J A;  1MG7 A;  4JI3 I;  2PNL A;  4Q28 A;  3RMP A;  4RHB B;  2C39 A;  1A6F A;  3M6A A;  1LLM C;  3LLH A;  4WYQ B;  1HNX E;  4RPF A;  1JK2 A;  2EM9 A;  3ZKD A;  1IBL I;  5IV8 B;  4F54 A;  2ZBK B;  4UT4 A;  2RTX A;  1Z0E A;  5KL4 A;  1F2I G;  3HJC A;  2WP8 A;  1Z5B A;  1MU5 A;  2GO3 A;  4MDT A;  2HKJ A;  1L4S A;  2EPC A;  4DV7 E;  4MYU A;  4IFD A;  2XEX A;  4FW6 A;  2LE2 A;  3KZZ A;  1TF6 A;  4FW7 A;  3PS1 A;  2EOH A;  3D4J A;  1G2D C;  4R2S A;  2YZT A;  3THO B;  1P47 A;  4LFA E;  1Z1B A;  3P06 A;  4IZJ B;  1FJG E;  4B3M E;  3PYE A;  1XMQ I;  1J26 A;  3DD6 A;  2V2Q A;  5C0X D;  4IZK B;  4FWH A;  1HNW I;  4N4R B;  4DR6 E;  2DMI A;  1A1F A;  2EPX A;  4R8O A;  1IBK I;  4HYM A;  4BCA A;  2K4V A;  1KVK A;  4DPU A;  1YFH A;  4DPT A;  3GCM A;  4M2Z A;  4BBY A;  2UXB E;  2R1F A;  4NBQ A;  5DNY A;  1X6E A;  3F0N A;  2E5L I;  2EOI A;  5A6B A;  4FWD A;  1ZM2 A;  4HAC B;  5C0X A;  4LF5 I;  2BA1 G;  4OO1 C;  4NXN I;  1T4L B;  4BA2 A;  1DQ3 A;  4FN5 A;  4LCG A;  4LFB E;  2PO2 A;  1FKA E;  4OO1 B;  2YTE A;  4DR3 I;  4LFC E;  4DPY A;  1H72 C;  3QT8 A;  1B63 A;  1ZM4 A;  3M85 D;  3F6G A;  1KIJ A;  1Z0V A;  1ZM9 A;  4JI2 I;  4Z7C A;  1I94 I;  5F3W A;  2M4I A;  2WCC 3;  5IT9 C;  3L7Z A;  2LTR A;  2NAB A;  2EMA A;  1H74 A;  4JI8 E;  2GPI A;  1X6F A;  4BHB A;  2RPC A;  2JE6 A;  3LTO A;  3BF2 A;  1RR9 A;  4DUZ I;  1N36 I;  2UXC I;  2RS6 A;  4X9J A;  4R2D A;  2CT1 A;  1A1G A;  2NUE A;  2Z5E A;  4OZE A;  4GKK I;  1Z0B A;  2EP3 A;  4B3T I;  4DR2 I;  4AQY I;  2JP9 A;  2I9I A;  1N33 E;  4FW3 A;  5AC5 A;  2YTG A;  2MKN A;  5DRP A;  3VHT B;  4OX9 E;  2V8Q B;  4DUY E;  2EPP A;  1IBM E;  5K36 A;  2EQ1 A;  4R2C A;  2BBG A;  1ZAA C;  4WSG A;  1YZ9 A;  4DR5 I;  2O1U A;  4DV0 E;  2V2V A;  4JI7 E;  2DSY A;  2N3G A;  2YSO A;  2EPN A;  1Z5C A;  5CFF E;  4GKJ I;  2EOE A;  2F8B A;  1XNQ E;  1H7U A;  5AE3 A;  2UUA I;  4MLQ A;  4HY1 A;  4X8W A;  1MEY C;  2EMY A;  2JYA A;  3VK6 A;  4TUI A;  3HTX A;  2EN7 A;  5FLX C;  2LV2 A;  2PNM A;  4M1K A;  4WUD A;  4K0K I;  4B3R E;  1PKP A;  1Y4S A;  1YYO A;  4DV4 I;  2EOQ A;  4KWY A;  1MGT A;  2EN4 A;  4LF9 I;  5A6K A;  3IWB A;  2CGE A;  2B3T B;  1E3P A;  2H36 X;  2ENA A;  4DR7 E;  2HFU A;  4FW4 A;  2VQE E;  4U3B A;  4ZYE A;  3V2U C;  1UN6 B;  2WP8 B;  4IFD C;  3LNU A;  4LU9 A;  2O1W A;  2NN6 B;  4X62 I;  4IFD B;  2EM6 A;  2UXD E;  5AE1 A;  3M7N D;  5LMU I;  1EKZ A;  1GZ6 A;  4FWG A;  4KHP I;  2EN8 A;  2WBT A;  2HGH A;  2DEI A;  3PYD A;  4NHR A;  2ZIT A;  3IWC A;  4KZS A;  5A2Q Q;  4WPY A;  2JOB A;  2BA1 D;  3V5R A;  3WU4 A;  4B3S E;  1J5E I;  2A2D A;  1XMO E;  5LL6 R;  4DR1 E; 
#chains in the Genus database with same CATH homology
 5FWK A;  3GON A;  4YY3 I;  4BMJ A;  1ZBQ A;  2OI2 A;  4X65 I;  1OJ4 A;  1HR0 I;  4JV5 E;  4L8N A;  1S16 A;  4NXM E;  1USV A;  4X64 E;  2V83 A;  4JI1 I;  4ED4 A;  4YHH E;  1VIS A;  1XNR I;  4EMD A;  4I3H A;  4P52 A;  3J80 Q;  2VE7 C;  1Z5A A;  5LMN I;  1XHK A;  4ZVI A;  3J7A G;  4DV6 E;  3OTO I;  3J7A M;  5FLX Q;  1BKN A;  4B3M I;  3T1Y E;  2WZO A;  1UEK A;  3FIG A;  1FI4 A;  3JAM Q;  2L33 A;  4LF8 I;  3B82 A;  2L2M A;  4P7D A;  4JI5 E;  4R1F A;  2O1T A;  3ADL A;  3ZZ0 A;  2UXB I;  3J7Y p;  4DV2 E;  4JI0 I;  2DMY A;  3ZM7 A;  2KHX A;  1PIE A;  1HNZ E;  5BR8 I;  3P1X A;  4JI3 E;  1QU6 A;  2LJH A;  2EZ6 A;  4FW9 A;  2JY9 A;  2EFG A;  3K17 A;  4JYA I;  1IBL E;  2DB2 A;  1YYW A;  2R42 A;  2L92 A;  2V34 A;  1DAR A;  2BV3 A;  2ZM6 I;  2UUC I;  3T1H I;  1H73 A;  3JTZ A;  1B62 A;  1N0V C;  5A2Q C;  1NZ0 A;  3VYX A;  4LF7 I;  2RSM A;  1Z59 A;  5L3J A;  3DF6 A;  3K85 A;  2LBS B;  1XMQ E;  2EWL A;  4P7A A;  1HNW E;  3K1J A;  4PRV A;  2MC6 A;  2JWO A;  2LMZ A;  4DUY I;  1IBM I;  4WUC A;  1RRE A;  2KOU A;  1N0U A;  2V8P A;  3PYG A;  2LTS A;  4JI7 I;  4L5N C;  4DV3 I;  2E5L E;  4DV5 E;  3J80 C;  4LF5 E;  4WSP A;  4NXN E;  2HK3 A;  1X47 A;  4DU7 A;  2JVA A;  1HK7 A;  4KQV A;  2JOX A;  4LTY A;  2LRS A;  2G7H A;  4DV1 I;  4PU9 A;  4JI2 E;  1I94 E;  4JI6 E;  2V86 A;  2VQE I;  4DR4 I;  4F9A B;  4N3O A;  1MX0 A;  2UU9 I;  1Y4U A;  1T4O A;  1N36 E;  4DUZ E;  4X66 I;  4DPW A;  2O1V A;  3Q6M A;  3JAM C;  1WHQ A;  5IWA I;  5ADZ A;  2Z5C A;  4GKK E;  4B3S I;  4B3T E;  4DR2 E;  4AQY E;  1N32 I;  2HFS A;  4DR1 I;  1ZXN A;  2Z5B A;  4JG4 A;  4LF4 I;  3DJW A;  3QT6 A;  1K47 A;  2N3H A;  2KON A;  3ADJ A;  4DR5 E;  1T4N A;  1KKH A;  3ADG A;  2JR1 A;  4DKK A;  4GKJ E;  1U2R A;  2UUA E;  4LF6 I;  2BM0 A;  2B7V A;  2V89 A;  1N34 E;  2UUB E;  4MYT A;  3ZKB A;  3J81 Q;  4HXZ A;  1Z0G A;  4K0K E;  2L3C A;  3IWD A;  2NUF A;  2ODR D;  4Z7Y A;  4LF9 E;  3LML A;  1UHZ A;  2VF1 A;  1ZBT A;  5GME A;  2VQF E;  1Z0C A;  4JI4 E;  2NUG A;  2LJP A;  1HNX I;  3WU5 A;  2B9D A;  4X62 E;  2MDR A;  5LMU E;  2V87 A;  2E1R A;  4KHP E;  3F6H A;  3WU6 A;  2RS7 A;  3VYY A;  4DV7 I;  2IHR 1;  2CPN A;  3T1Y I;  3HXL A;  3HUL A;  1J5E E;  1FNM A;  1YYK A;  1RQ0 A;  4LFA I;  4DPX A;  1EI1 A;  1H7S A;  1FJG I;  1USU A;  1NHI A;  1Z0T A;  4YY3 E;  2V2Z A;  2VF3 A;  2L2N A;  3Q6N A;  4M0V A;  4DU8 A;  1Y6Z A;  1HR0 E;  2HHH E;  3H4L A;  4DR6 I;  4BS9 A;  4JI1 E;  2NA2 A;  4F9B B;  5AE2 A;  2F4V E;  1XNR E;  1ZXM A;  4UTG A;  5LMN E;  4DMI A;  1NHJ A;  4R03 A;  4LFB I;  4XTJ A;  2AJ4 A;  3OTO E;  4LFC I;  4URL A;  3AV0 A;  1X48 A;  4OOG C;  3OML A;  1ZM3 A;  3Q1Q A;  1S4E A;  2R3V A;  2A2C A;  4P78 A;  2IOP A;  4JI8 I;  2Z5C B;  4USM A;  1RC7 A;  4LF8 E;  4WUB A;  2B7T A;  4F9C B;  4GEQ B;  1Z0W A;  2Z5B B;  3ZOQ B;  2CG9 A;  2J7K A;  1N33 I;  3J81 C;  4JI0 E;  1IBK E;  2X36 A;  5BR8 E;  2CZ9 A;  3PYF A;  4DV5 I;  4OX9 I;  4J8Z A;  1FWL A;  4DV0 I;  1WHN A;  3MSW A;  2M7Q A;  2BM1 A;  4JYA E;  2HKE A;  1XNQ I;  2GQ0 A;  4WFT A;  4BC9 A;  4JI6 I;  3AUZ A;  4IZJ D;  4B3R I;  3H09 A;  4DR3 E;  3PRY A;  4BC7 A;  2V88 A;  3B78 A;  2MC5 A;  2ZM6 E;  2UUC E;  3T1H E;  2L3J A;  1WXR A;  2FTX B;  4DR7 I;  4LF7 E;  1UIL A;  2HK2 A;  2ODR C;  1GQE A;  1STU A;  2WW4 A;  4TUG A;  3C4T A;  2LUP B;  1PVG A;  2X7I A;  5AAS A;  2NPF A;  2UXD I;  3JU0 A;  2FV4 B;  4IZJ A;  2UXC E;  2E1M A;  3HQ1 A;  3WU3 A;  4IZK A;  3K6Q A;  1XMO I;  5GMD A;  3KWR A;  4DV3 E;  3HPZ A;  3B8H A;  3ZZT A;  1EA6 A;  4JV5 I;  1ELO A;  4NXM I;  2V85 A;  4HAC A;  3C4B A;  4X64 I;  3QT7 A;  1D6T A;  2FGG A;  5T6J A;  4DV1 E;  4YHH I;  2VQF I;  4DR4 E;  1DI2 A;  4JI4 I;  3CWV A;  4PRX A;  1QZR A;  4DV4 E;  2UU9 E;  1O0W A;  2L2K B;  1WUU A;  2L8T A;  4X66 E;  4DV6 I;  3HPS A;  2LUQ A;  4M30 A;  3ADI A;  5IWA E;  4USK A;  4I8O A;  1KTV A;  1N32 E;  5IT9 Q;  3QT5 A;  4DXL A;  2L6M A;  2IOQ A;  2Q2E B;  4LF4 E;  1X49 A;  2YT4 A;  2GS8 A;  2HHH I;  2DEJ A;  4JI5 I;  2M1S A;  4LF6 E;  2F4V I;  4DV2 I;  4X65 E;  3ZZU A;  1NHH A;  1FWK A;  1HNZ I;  3LPS A;  1SR9 A;  2DIX A;  4JI3 I;  1MG7 A;  2PNL A;  4Q28 A;  3RMP A;  1A6F A;  3M6A A;  3LLH A;  1HNX E;  4WYQ B;  4RPF A;  3ZKD A;  1IBL I;  4F54 A;  2ZBK B;  4UT4 A;  2RTX A;  1Z0E A;  3HJC A;  1Z5B A;  1MU5 A;  2HKJ A;  4MYU A;  4DV7 E;  2XEX A;  2LE2 A;  3D4J A;  2YZT A;  4LFA E;  3P06 A;  4IZJ B;  1FJG E;  4B3M E;  3PYE A;  1XMQ I;  1J26 A;  2V2Q A;  4IZK B;  4FWH A;  1HNW I;  4DR6 E;  4R8O A;  1IBK I;  4HYM A;  4BCA A;  2K4V A;  1KVK A;  4DPU A;  4DPT A;  4M2Z A;  4BBY A;  2UXB E;  5DNY A;  3F0N A;  2E5L I;  4FWD A;  1ZM2 A;  4HAC B;  4LF5 I;  4NXN I;  1T4L B;  1DQ3 A;  4FN5 A;  4LFB E;  1FKA E;  4DR3 I;  4LFC E;  4DPY A;  1H72 C;  3QT8 A;  1B63 A;  1ZM4 A;  3F6G A;  1KIJ A;  1Z0V A;  1ZM9 A;  4JI2 I;  4Z7C A;  1I94 I;  5F3W A;  2M4I A;  5IT9 C;  2LTR A;  1H74 A;  4JI8 E;  1N36 I;  3LTO A;  1RR9 A;  4DUZ I;  2UXC I;  2RS6 A;  2NUE A;  2Z5E A;  4GKK I;  1Z0B A;  4B3T I;  4DR2 I;  4AQY I;  1N33 E;  4OX9 E;  2V8Q B;  4DUY E;  1IBM E;  1YZ9 A;  4DR5 I;  2O1U A;  4DV0 E;  2V2V A;  4JI7 E;  2DSY A;  2N3G A;  1Z5C A;  5CFF E;  4GKJ I;  2F8B A;  1XNQ E;  1H7U A;  5AE3 A;  2UUA I;  4HY1 A;  4X8W A;  3HTX A;  3VK6 A;  4TUI A;  1N34 I;  2UUB I;  5FLX C;  2PNM A;  4WUD A;  4M1K A;  4K0K I;  4B3R E;  1PKP A;  1Y4S A;  1YYO A;  4DV4 I;  4LF9 I;  3IWB A;  2CGE A;  2B3T B;  2H36 X;  4DR7 E;  2HFU A;  2VQE E;  3V2U C;  3LNU A;  4LU9 A;  2O1W A;  4X62 I;  2UXD E;  5AE1 A;  5LMU I;  1EKZ A;  1GZ6 A;  4FWG A;  4KHP I;  2DEI A;  3PYD A;  2ZIT A;  3IWC A;  4KZS A;  5A2Q Q;  4WPY A;  2JOB A;  3V5R A;  3WU4 A;  4B3S E;  1J5E I;  2A2D A;  1XMO E;  5LL6 R;  4DR1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...