4LF9E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf9E02
4X62E 2L3JA 4JYAE 4WFTA 2BM1A 3QT5A 1S16A 4LFBE 1T4OA 1XHKA 4HYMA 3WU5A 4WUCA 2HKJA 3M6AA 1WHQA 2EZ6A 2UXBE 3J80Q 4B3RI 3C4TA 4LF4I 2IHR1 2L2MA 4DV5I 4GKKE 2E5LI 4LFAE 4GKJE 4YY3I 4WUDA 4DR4I 4DUZE 2V2ZA 4JI7E 4NXME 1RC7A 2LTSA 1YYWA 4NXNE 3PYDA 5GMDA 4LF8I 4DUYE 4DV0I 4DR5E 4B3TE 3T1YI 1N0UA 1KVKA 2UXCI 3QT8A 1ZXNA 4DR7I 1UILA 2F4VI 4LF6I 4KHPE 1N32I 2UXDI 1PVGA 1D6TA 4B3SE 2R3VA 2AJ4A 3ZKDA 5LMUI 4X66I 2X7IA 1YYOA 1IBLE 4X8WA 3WU6A 3T1HE 3PYEA 3QT6A 5GMEA 1IBMI 1FJGI 2UUBE 4JG4A 1XNRE 1KIJA 1QZRA 2HHHE 3ZZUA 4MYTA 3VYXA 1ELOA 2MDRA 1XMOI 1I94I 3J7Yp 2DEJA 4X64E 2UU9E 4WUBA 1KTVA 3H4LA 4JI3E 4DV4E 4JI8I 1Z59A 2V34A 4JI5E 4DR1I 4DR3E 4DPXA 4DXLA 1HNZE 4AQYE 1N33I 1X47A 3VYYA 1J5EE 2DB2A 1RQ0A 3JAMQ 4DV1I 3F0NA 3LTOA 4DPUA 2GS8A 4P7AA 1HR0I 2A2DA 1ZM4A 4JI4E 2Q2EB 1EA6A 2CZ9A 5IWAI 4DV2I 1UHZA 3C4BA 1ZM2A 1XNQE 4JI6E 4LF9E 1B62A 4DPTA 2LUQA 2B3TB 2UUAE 2UUCI 1IBKE 1EKZA 1WUUA 4JV5E 1FWKA 2LJHA 1ZM3A 4OOGC 3J81C 4I3HA 4DU7A 4OX9E 4DV6I 4DR6I 2RTXA 1N36I 1FNMA 2JVAA 1X48A 4LF4E 2BM0A 4DPYA 1H7UA 5BR8E 1N34I 2E1RA 3HULA 4GKKI 1GQEA 4DR4E 2RS6A 4JI2E 2HK3A 4DV3I 4DUZI 1Z0TA 4JI7I 2RS7A 3ZM7A 3OTOE 5A2QQ 4LF8E 4X65I 4DUYI 1XMQI 3B78A 3T1YE 2HFUA 3PYGA 5FLXQ 1ZM9A 2UXCE 3B8HA 1H7SA 3ZZ0A 3ADJA 4RPFA 2ZM6I 4LF5I 4URLA 3GONA 4ED4A 2F4VE 4LF6E 1N32E 4HACB 1OJ4A 2UXDE 2A2CA 4JI1E 4B3MI 4KHPI 4Z7YA 5LMUE 4X66E 1Z0WA 4B3SI 2LTRA 4LF7E 4LFCE 1T4LB 2YT4A 1RR9A 4DKKA 3B82A 1HNXE 4Z7CA 2CPNA 3JAMC 2VQFI 5CFFE 3T1HI 1IBME 2LBSB 1FJGE 2ZITA 4JI0I 3ADLA 1YZ9A 1ZBTA 1NZ0A 2NPFA 1Z0BA 2WW4A 1MX0A 1XMOE 2VQEE 3LNUA 2JY9A 4P52A 5IT9Q 2RSMA 2NUGA 1NHHA 2UU9I 4K0KI 3QT7A 1H73A 4DR1E 3ZZTA 2BV3A 4YHHI 4JI5I 1WHNA 4DR3I 1N33E 4DR2I 3V2UC 4DV7I 3J80C 1H72C 1HNWI 3J7AM 5LMNI 2V2VA 2NUEA 1HR0E 1A6FA 2DMYA 3J7AG 1PIEA 1NHIA 1EI1A 1KKHA 2EFGA 3LLHA 1S4EA 3LPSA 4DU8A 4DV2E 1RREA 4HXZA 4DV1E 4LF9I 2X36A 1T4NA 2L2KB 4X62I 2OI2A 4JYAI 2R42A 1STUA 4HY1A 3ZKBA 2N3HA 4DPWA 2UUAI 3Q1QA 3CWVA 4LFBI 2HKEA 4B3RE 4DV6E 4PRXA 4MYUA 2UXBI 1MU5A 4DR6E 4DV5E 4OX9I 2L2NA 1N36E 2E5LE 5FLXC 3WU3A 4FWDA 1NHJA 4LFAI 2N3GA 4YY3E 4GKJI 1N34E 1O0WA 4M30A 5BR8I 1Z0VA 4NXMI 1DI2A 4DV0E 4NXNI 1Z0EA 4ZVIA 4DV3E 1U2RA 3V5RA 4JI2I 4M2ZA 4USKA 4DR5I 4B3TI 3HTXA 1Z5CA 4X65E 4EMDA 3OTOI 3J81Q 1H74A 1XMQE 4DR7E 1X49A 2HFSA 5LL6R 4FWGA 4M1KA 1Z5BA 2V8PA 2ZM6E 1UEKA 3D4JA 4WYQB 4LF5E 3ADGA 1Z0CA 4KQVA 4UTGA 5IT9C 1FKAE 4R1FA 4B3ME 2DEIA 1IBLI 2DIXA 4JI1I 1FWLA 3K1JA 2ZBKB 1PKPA 4FW9A 1VISA 3PYFA 4LFCI 4LF7I 2L3CA 2VQFE 2B7VA 2UUBI 1HNXI 3WU4A 1XNRI 1ZXMA 4JI0E 1I94E 2HHHI 1BKNA 5L3JA 4JI8E 4X64I 2LRSA 4JI3I 1FI4A 3K17A 4DV4I 2LJPA 1K47A 2XEXA 2VQEI 2NA2A 2B7TA 1HNZI 4K0KE 4AQYI 4FWHA 2J7KA 2LUPB 2NUFA 4YHHE 1J5EI 4XTJA 1N0VC 4DR2E 1J26A 4DV7E 4JV5I 4PRVA 4UT4A 1HNWE 5LMNE 3P1XA 1YYKA 4HACA 1Z5AA 5IWAE 4JI4I 2KHXA 1QU6A 3ADIA 2V2QA 1B63A 1Z0GA 4PU9A 2HK2A 1XNQI 4JI6I 1MG7A 4USMA 2VF3A 2UUCE 5A2QC 1IBKI 4FN5A 1DARA 2L33A
chains in the Genus database with same CATH superfamily
4X62E 2FV4B 2L3JA 2EMHA 2YTOA 4JYAE 3L00A 2YSPA 3EQ1A 4WFTA 2B9DA 1A1JA 2HC5A 4MQYA 5JEAC 1N3GA 2BM1A 1S16A 2Q8UA 2LJUA 5AE1A 4LFBE 1T4OA 2Z5BB 1XHKA 4HYMA 3WU5A 4WUCA 1Y5YA 2RQLA 2HKJA 3M6AA 1WHQA 4F9AB 2EZ6A 2UXBE 2J7JA 4U3DA 3J80Q 4B3RI 2YSOA 3C4TA 1BBGA 1UN6B 4MU4A 2RSIA 4O43A 1HK7A 3HJCA 2EMYA 3CDJA 4LF4I 2IHR1 2L2MA 4DV5I 1RMDA 1EH7A 2EL5A 4L8NA 2YTDA 1LLMC 4GKKE 4LFAE 1USUA 2E5LI 2EQ3A 5JEAE 4LTYA 5A6JA 4GKJE 3TQMA 2EM6A 1PDAA 1AH5A 1E3PA 4YY3I 2F8BA 2YZTA 2EPOA 2V88A 4WUDA 4DR4I 4DUZE 1DGCA 2ODRC 2V2ZA 2R1FA 4JI7E 4F9BB 2O1VA 2O1TA 2G7HA 4NXME 2EL6A 3K6QA 1RC7A 3IWBA 2I13A 2LTSA 2Z5CA 2JEBA 1YYWA 4NXNE 2EL4A 2J65A 2YTQA 2DSYA 3PYDA 2ENCA 5GMDA 2O3ZA 4LF8I 2EOQA 4DUYE 4DV0I 1A1GA 2I9IA 2C37A 4DR5E 3GMEA 3IWCA 2WBUA 4B3TE 5DROA 2JEAA 3IWDA 5DRPA 1AAYA 4F54A 3T1YI 3H1CA 3K85A 2EMGA 4GQUA 2E72A 2JE6A 1N0UA 2GQ0A 1KVKA 2UXCI 3QT8A 2EOFA 1ZXNA 4DR7I 1PJQA 2LCEA 2YTPA 2YU8A 1UILA 1Y6ZA 5A6AA 2F4VI 4LF6I 4WXDA 4KHPE 2PO2A 1N32I 1NEIA 2AE8A 2UXDI 3OMLA 3F6GA 1PVGA 1D6TA 3ZOQB 1TN9A 5FWKA 4B3SE 2R3VA 2AJ4A 3ZKDA 5LMUI 2CGEA 4X66I 2X7IA 2NN6D 1YYOA 2EQ1A 3GLLA 1IBLE 2O1WA 2JYAA 1UBDC 2WNRB 4U3BA 4X8WA 1B69A 2NN6F 3WU6A 4OO1A 4R2RA 2PO1B 2ADRA 4OO1D 3T1HE 3PYEA 3QT6A 5K36E 2EPKX 3HPZA 2M4IA 3UK3C 3C6MA 2PNLA 4AIDA 5GMEA 4NBQA 1IBMI 3DF6A 1FJGI 2EMAA 3HQ1A 4Q28A 1JK2A 2BBGA 2UUBE 4JG4A 2BA1G 1XNRE 4R03A 4BA2B 4F6NA 1KIJA 4R2EA 2C39A 3U1YA 2EPRA 1QZRA 4GEQB 2HHHE 3ZZUA 4MYTA 5KL7A 3PS3A 2MKNA 3VYXA 4N3OA 1ELOA 2MDRA 1XMOI 2CSHA 3J7Yp 2BA0D 2DEJA 1I94I 4IFDA 4X64E 2UU9E 3VK6A 4WUBA 1X6FA 2BA1D 1KTVA 3F6HA 4JI3E 3H4LA 2JR1A 3AUZA 4DV4E 4JI8I 4F2JC 1Z59A 2V34A 4WSPA 3L7ZB 1GTKA 1YHCA 5KL6A 4JI5E 4DR1I 4DR3E 4R2DA 4DPXA 4DXLA 1HNZE 4M9VC 4AQYE 2BB8A 3PRYA 2RPCA 1N33I 2L8TA 4FW4A 1IQSA 1X47A 2JPAA 4OKGA 4J8ZA 3VYYA 1J5EE 2DB2A 1RQ0A 2L6MA 5EL9A 3JAMQ 4DV1I 3F0NA 2EMCA 2EN1A 3LTOA 4DPUA 2EMLA 2GS8A 4P7AA 1HR0I 4AM3A 2EMKA 2A2DA 1YUJA 3EPKA 1ZM4A 4JI4E 2EN6A 3M85G 2JT2A 2Q2EB 1JK1A 1EA6A 2Z5CB 4QNKA 2MKDA 2WZOA 2CZ9A 4IZJA 4MU0A 2DMIA 1UHZA 5IWAI 4DV2I 2LE2A 5K36B 3C4BA 2EM3A 4BC9A 1ZM2A 3P3EA 4MDTA 1XNQE 4JI6E 4LF9E 2YTEA 1YH8A 2EMWA 2EWLA 4O24A 5DNXA 1B62A 2MDGA 2LUQA 2F1DA 4DPTA 1PJSA 4LPFA 2B3TB 5JEAA 2UUAE 2UUCI 1IBKE 1EKZA 1WUUA 2WP8A 2PO0B 5JEAD 3JTZA 4JV5E 1FWKA 3FIGA 2LJHA 4BMJA 1ZM3A 4OOGC 2EN8A 3J81C 2PO2B 1Y4SA 1PJTA 4R2AA 1G2FC 1P47A 4I3HA 4DU7A 2YTGA 4OX9E 4DV6I 5JEAF 2M7QA 1EH6A 4DR6I 2EM9A 2RTXA 5EKWA 5C0XE 1N36I 1A1HA 2C38A 1FNMA 1QNTA 4FW5A 4BS9A 1SFEA 1UDNA 1X48A 2JVAA 5KL5A 4LF4E 2BM0A 4MU1A 2EN4A 3BF2A 4BHBA 4ZYEA 1H7UA 5BR8E 4DPYA 1N34I 2E1RA 2PNZB 4R2PA 3HULA 4IZKA 3MHHC 2EMXA 4GKKI 2ODRD 2EN7A 2EP3A 1GQEA 4BHCA 4DR4E 2EOYA 5AC4A 2RS6A 4I8OA 1X5WA 2V83A 4JI2E 2HK3A 2WBSA 4DV3I 4RH8A 4DUZI 1TF6A 1Z0TA 3EPJA 1P42A 4JI7I 2RS7A 3ZM7A 3OTOE 5A2QQ 4FW6A 2V86A 1A1FA 4LF8E 4IFDB 3CDIA 4LCHA 1T39A 4X65I 2GO4A 2O1UA 4DUYI 3P06A 1XMQI 3M7NG 2GLIA 2ENHA 3BGHA 4KWYA 4TUIA 2V85A 3B78A 2LVHA 3PS1A 4LCFA 3T1YE 2HFUA 5K36C 3PYGA 4BA1B 2YTFA 1WJPA 1ZBQA 3QG5C 1ZM9A 3P76A 4WSGA 2UXCE 1UDOA 3B8HA 3KWRA 1H7SA 3ZZ0A 3ADJA 4RPFA 2ZM6I 2NN6A 4LF5I 4URLA 3C6KA 1TF3A 1ZR9A 3GONA 2F4VE 4LF6E 1N32E 4HACB 4ED4A 3M7ND 1OJ4A 2HGHA 2UXDE 2GPIA 2A2CA 2LT7A 4JI1E 5C0XB 4B3MI 1GZ6A 1OYPA 4Z7YA 2EORA 4KHPI 1ZU1A 4Q35B 3U1KA 5LMUE 4X66E 5TSEA 2PNMA 2Z5BA 1Z0WA 4B3SI 4O5GA 1A1KA 2LTRA 4BCAA 5ELWA 4LF7E 4LFCE 1T4LB 4IZJB 4P7DA 2DLQA 2YT4A 1RR9A 4DKKA 3B82A 4M0VA 4X9JA 1HNXE 4Z7CA 2CPNA 3JAMC 2VQFI 1USVA 1G2DC 5CFFE 1T38A 1YPNA 3T1HI 1IBME 4O4KA 2LBSB 1FJGE 2ZITA 4JI0I 3ADLA 1YZ9A 2E1MA 4N4RB 2CG9A 5A6BA 4OO1C 1ZBTA 5A6BD 1NZ0A 2NPFA 1X6EA 2WP8B 1L4SA 1KJKA 3PS2A 4LCGA 4QNJA 1Z0BA 2WW4A 1MX0A 4R2CA 1XMOE 2VQEE 5A6KA 2V87A 2CVEA 3LNUA 2JY9A 4IJDA 4P52A 5IT9Q 2RSMA 1X6HA 2NUGA 2M9AA 1NHHA 1Y4UA 2EMBA 2UU9I 1EH8A 4NZVA 4K0KI 4IS1C 3QT7A 1H73A 4IS9A 2EQ0A 4DR1E 3KRNA 3ZZTA 2JXPA 1IQOA 4IFDC 3THOB 3Q6NA 4OO1E 4WXCA 2BV3A 4YHHI 4JI5I 1WHNA 1UDQA 4DR3I 1N33E 2ELYA 2L92A 4DR2I 2YTNA 3V2UC 2EPPA 2WBTA 4DV7I 3J80C 1BBOA 1H72C 2EN2A 3J7AM 2EMIA 2EM7A 5LMNI 1HNWI 3P3CA 2JEBB 2V2VA 2NUEA 5AC5A 1HR0E 1A6FA 2JP9A 4BC7A 2DMYA 3EPHA 3UHMA 3EPLA 3J7AG 1PIEA 3DJWA 3KZYA 1NHIA 2C37B 2EPUA 1EI1A 4J3DA 1KKHA 2EFGA 2K4VA 1VI7A 2IERA 3LLHA 3M85D 2JEAB 4IFDE 5C0XC 1S4EA 1BB8A 3LPSA 4DU8A 4DV2E 2EPMX 1RREA 2WNRA 3B4TA 1MEYC 2JE6B 2PO1A 2FTXB 2MC5A 4HXZA 4MLQA 4DV1E 2YTIA 1KYQA 3H09A 5LLQA 4F6MA 2EOSA 4LF9I 1WRJA 2X36A 1T4NA 2FGGA 2L2KB 4ZYGA 4X62I 2OI2A 4JYAI 1DQ3A 2R42A 5FLXQ 1STUA 4HY1A 2EPNA 5IV8B 1Z1BA 4FW3A 3ZKBA 2EM5A 4BA2A 2M1SA 2JOXA 4GZNC 2N3HA 2VF1A 1IMUA 2DGCA 2NN6B 3CWVA 4DPWA 1XXEA 2UUAI 2MC6A 3Q1QA 4LFBI 2HKEA 2BR2A 4B3RE 4DV6E 4PRXA 2EPAA 5KL3A 4MYUA 2UXBI 1MU5A 3QT5A 2EOOA 4DV5E 4DR6E 4OX9I 2KOUA 2L2NA 1N36E 2IESA 4OO1B 2E5LE 5DRRA 2YRHA 2EPXA 2VRDA 5FLXC 3WU3A 4FWDA 2ELZA 1NHJA 2YTJA 3L7ZA 2LV2A 2GO3A 4BBYA 4LFAI 2EPCA 4FK5C 2N3GA 4YY3E 4GKJI 1N34E 1X3CA 2C39B 1O0WA 4M30A 5BR8I 2EPLX 4MU3A 4R2SA 1Z0VA 1SR9A 3BIDA 4NXMI 1DI2A 4DV0E 1YFHA 4NXNI 3THNA 1Z0EA 4L5NC 4DV3E 2EOEA 3GCMA 4ZVIA 4TUGA 4AIMA 1U2RA 3V5RA 4JI2I 2JOBA 4M2ZA 2CTDA 4USKA 4DR5I 5AASA 4ZYDA 1OYRA 4B3TI 2EOHA 3HTXA 3JU0A 1Z5CA 3NZKA 5K36A 4X65E 2KONA 4EMDA 3OTOI 1NCSA 5K36D 3J81Q 1H74A 1XMQE 4DR7E 2EJ4A 1X49A 2HFSA 5LL6R 3P3GA 2LO3A 4FWGA 4LU9A 4M1KA 5A2QC 1Z5BA 2N8XA 4F9CB 2V8PA 5K36F 2EM0A 1YSAC 1OYSA 2H36X 2YPNA 2ZM6E 1UEKA 3HKMA 2EPZA 3D4JA 4WYQB 3VHTB 4LF5E 5DNLA 2YWQA 3ADGA 4RHBB 2EOMA 3RMPA 2PO0A 4KZSA 1Z0CA 2Z5EA 4KQVA 2IOQA 4WX9A 4UTGA 5IT9C 1FKAE 4R1FA 4B3ME 2EM4A 2K7IA 2DEIA 1IBLI 2EM2A 3HPSA 2DIXA 4JI1I 2NN6C 1FWLA 4ZYHA 2WCC3 5KL2A 2EN3A 2ZBKB 3K1JA 1PKPA 2JWOA 4OZEA 4FW9A 4R2QA 5F3WA 1VISA 4FW7A 3PYFA 2YU5A 4LFCI 5AE3A 4LF7I 2YRKA 2L3CA 3ECRA 4NHRA 2VQFE 5JEAB 2B7VA 2UUBI 4LOMA 1HNXI 1RHYA 3WU4A 2GHFA 1ZXMA 1XNRI 2PNZA 4JI0E 2EE8A 5ADZA 4P78A 1I94E 3BBGA 4HEIA 1E3HA 2HHHI 2NN6E 2CT1A 2BA0G 2EMFA 1BKNA 5DRQA 5L3JA 4OO1F 2HJJA 1A1LA 2R76A 2DRPA 4JI8E 4X64I 2C38B 2LRSA 4JI3I 1YUIA 1A1IA 1FI4A 3K17A 5KL4A 4DV4I 2BR2B 4HTGA 2YRMA 2LJPA 2EOJA 3MHSC 1K47A 4WPYA 2ENAA 5T6JA 2XEXA 5AE2A 2NA2A 2VQEI 2B7TA 1HNZI 4IFDD 2EOXA 2EOIA 2V8QB 4K0KE 2EOZA 4AQYI 4FWHA 1R6MA 2V89A 2LUPB 2NUFA 2J7KA 2PRTA 1MGTA 3LMLA 3DD6A 2A25A 4IZKB 4YHHE 1J5EI 4IFDF 1F2IG 4BA1A 5IXMB 1DARA 2EMZA 1N0VC 2VESA 4XTJA 4DMIA 4DR2E 2DLKA 1J26A 4DV7E 4JV5I 4PRVA 4UT4A 1HNWE 5LMNE 3MSWA 3KZZA 3P1XA 1YYKA 4HACA 1Z5AA 5IWAE 4JI4I 2KHXA 5C0XA 2D9HA 5C0XD 3Q6MA 5A69A 1QU6A 3ADIA 2V2QA 2EM8A 1B63A 1ZAAC 1Z0GA 4PU9A 5DNYA 2VE7C 3M99B 2HK2A 2LMZA 3HXLA 4JI6I 1MG7A 1XNQI 1R6LA 5C0XF 1UDSA 2IOPA 4USMA 2NABA 4MLVA 2VF3A 4IZJD 1WXRA 2UUCE 1Y60A 4ISAA 4R8OA 1IBKI 4FN5A 3AV0A 2L33A
chains in the Genus database with same CATH topology
4X62E 2FV4B 2L3JA 4JYAE 4WFTA 2B9DA 2BM1A 3QT5A 1S16A 5AE1A 4LFBE 2Z5BB 1T4OA 1XHKA 4HYMA 3WU5A 4WUCA 2HKJA 3M6AA 1WHQA 4F9AB 2EZ6A 2UXBE 3J80Q 4B3RI 3C4TA 1HK7A 3HJCA 4LF4I 2IHR1 2L2MA 4DV5I 1USUA 4L8NA 4GKKE 2E5LI 4LFAE 4LTYA 4GKJE 4YY3I 2F8BA 2YZTA 2V88A 4WUDA 4DR4I 4DUZE 2ODRC 2V2ZA 4JI7E 2O1VA 4F9BB 2O1TA 2G7HA 4NXME 3K6QA 1RC7A 3IWBA 2Z5CA 2LTSA 1YYWA 4NXNE 2DSYA 3PYDA 5GMDA 4LF8I 4DUYE 4DV0I 4DR5E 3IWCA 4B3TE 3IWDA 4F54A 3T1YI 3K85A 1N0UA 2GQ0A 1KVKA 2UXCI 3QT8A 1ZXNA 4DR7I 1UILA 1Y6ZA 2F4VI 4LF6I 4KHPE 1N32I 2UXDI 3OMLA 3F6GA 1PVGA 1D6TA 3ZOQB 5FWKA 4B3SE 2R3VA 2AJ4A 3ZKDA 5LMUI 2CGEA 4X66I 2X7IA 1YYOA 1IBLE 2O1WA 4X8WA 3WU6A 3T1HE 3PYEA 3QT6A 3HPZA 2M4IA 2PNLA 5GMEA 1IBMI 3DF6A 1FJGI 4Q28A 3HQ1A 2UUBE 4R8OA 4JG4A 1XNRE 4R03A 1KIJA 1QZRA 4GEQB 2HHHE 3ZZUA 4MYTA 3VYXA 4N3OA 1ELOA 2MDRA 1XMOI 1I94I 3J7Yp 2DEJA 4X64E 2UU9E 3VK6A 4WUBA 1KTVA 3F6HA 4JI3E 3H4LA 2JR1A 3AUZA 4DV4E 4JI8I 1Z59A 2V34A 4WSPA 4JI5E 4DR1I 4DR3E 4DPXA 4DXLA 1HNZE 4AQYE 3PRYA 1N33I 2L8TA 1X47A 4J8ZA 3VYYA 1J5EE 2DB2A 1RQ0A 2L6MA 3JAMQ 4DV1I 3F0NA 3LTOA 4DPUA 2GS8A 4P7AA 1HR0I 2A2DA 1ZM4A 4JI4E 2Q2EB 1EA6A 2Z5CB 2WZOA 2CZ9A 4IZJA 5IWAI 4DV2I 1UHZA 2LE2A 3C4BA 1ZM2A 4BC9A 1XNQE 4JI6E 4LF9E 2EWLA 1B62A 4DPTA 2LUQA 2B3TB 2UUAE 2UUCI 1IBKE 1EKZA 1WUUA 3JTZA 4JV5E 1FWKA 3FIGA 2LJHA 4BMJA 1ZM3A 4OOGC 3J81C 1Y4SA 4I3HA 4DU7A 4OX9E 4DV6I 2M7QA 4DR6I 2RTXA 1N36I 1FNMA 4BS9A 2JVAA 1X48A 4LF4E 2BM0A 4DPYA 1H7UA 5BR8E 1N34I 2E1RA 3HULA 4IZKA 4GKKI 2ODRD 1GQEA 4DR4E 2RS6A 4I8OA 2V83A 4JI2E 2HK3A 4DV3I 4DUZI 1Z0TA 4JI7I 2RS7A 3ZM7A 3OTOE 5A2QQ 2V86A 4LF8E 4X65I 2O1UA 4DUYI 3P06A 1XMQI 3B78A 4TUIA 2V85A 3T1YE 2HFUA 3PYGA 1ZBQA 1ZM9A 5FLXQ 2UXCE 3B8HA 3KWRA 1H7SA 3ZZ0A 3ADJA 4RPFA 2ZM6I 4LF5I 4URLA 3GONA 4ED4A 2F4VE 4LF6E 1N32E 4HACB 1OJ4A 2UXDE 2A2CA 4JI1E 4B3MI 1GZ6A 4KHPI 4Z7YA 5LMUE 4X66E 2PNMA 2Z5BA 1Z0WA 4B3SI 2LTRA 4BCAA 4LF7E 4LFCE 1T4LB 4IZJB 4P7DA 2YT4A 1RR9A 4DKKA 3B82A 4M0VA 1HNXE 4Z7CA 2CPNA 3JAMC 2VQFI 1USVA 5CFFE 3T1HI 1IBME 2LBSB 1FJGE 2ZITA 4JI0I 3ADLA 1YZ9A 2E1MA 2CG9A 1ZBTA 1NZ0A 2NPFA 1Z0BA 2WW4A 1MX0A 1XMOE 2VQEE 2V87A 3LNUA 2JY9A 4P52A 5IT9Q 2RSMA 2NUGA 1NHHA 1Y4UA 2UU9I 4K0KI 3QT7A 1H73A 4DR1E 3ZZTA 3Q6NA 2BV3A 4YHHI 4JI5I 1WHNA 4DR3I 1N33E 2L92A 4DR2I 3V2UC 4DV7I 3J80C 1H72C 1HNWI 3J7AM 5LMNI 2V2VA 2NUEA 1HR0E 1A6FA 4BC7A 2DMYA 3J7AG 1PIEA 3DJWA 1NHIA 1EI1A 1KKHA 2EFGA 2K4VA 3LLHA 1S4EA 3LPSA 4DU8A 4DV2E 1RREA 2FTXB 2MC5A 4HXZA 4DV1E 3H09A 4LF9I 2X36A 1T4NA 2FGGA 2L2KB 4X62I 2OI2A 4JYAI 1DQ3A 2R42A 1STUA 4HY1A 3ZKBA 2M1SA 2JOXA 2N3HA 2VF1A 4DPWA 2UUAI 3Q1QA 3CWVA 4LFBI 2MC6A 2HKEA 4B3RE 4DV6E 4PRXA 4MYUA 2UXBI 1MU5A 4DR6E 4DV5E 4OX9I 2KOUA 2L2NA 1N36E 2E5LE 5FLXC 3WU3A 4FWDA 1NHJA 4BBYA 4LFAI 2N3GA 4YY3E 4GKJI 1N34E 1O0WA 4M30A 5BR8I 1Z0VA 1SR9A 4NXMI 1DI2A 4DV0E 4NXNI 1Z0EA 4L5NC 4DV3E 4ZVIA 4TUGA 1U2RA 3V5RA 4JI2I 2JOBA 4M2ZA 4USKA 4DR5I 5AASA 4B3TI 3HTXA 3JU0A 1Z5CA 4X65E 2KONA 4EMDA 3OTOI 3J81Q 1H74A 1XMQE 4DR7E 1X49A 2HFSA 5LL6R 4FWGA 4M1KA 4LU9A 1Z5BA 4F9CB 2V8PA 2H36X 2ZM6E 1UEKA 3D4JA 4WYQB 4LF5E 3ADGA 3RMPA 4KZSA 1Z0CA 2Z5EA 4KQVA 2IOQA 4UTGA 5IT9C 1FKAE 4R1FA 4B3ME 2DEIA 1IBLI 3HPSA 2DIXA 4JI1I 1FWLA 3K1JA 2ZBKB 1PKPA 2JWOA 4FW9A 5F3WA 1VISA 3PYFA 4LFCI 5AE3A 4LF7I 2L3CA 2VQFE 2B7VA 2UUBI 1HNXI 3WU4A 1XNRI 1ZXMA 4JI0E 5ADZA 4P78A 1I94E 2HHHI 1BKNA 5L3JA 4JI8E 4X64I 2LRSA 4JI3I 1FI4A 3K17A 4DV4I 2LJPA 1K47A 4WPYA 5T6JA 2XEXA 2VQEI 5AE2A 2NA2A 2B7TA 1HNZI 2V8QB 4K0KE 4AQYI 4FWHA 2J7KA 2V89A 2LUPB 2NUFA 3LMLA 4IZKB 4YHHE 1J5EI 4XTJA 1N0VC 4DMIA 4DR2E 1J26A 4DV7E 4JV5I 4PRVA 4UT4A 1HNWE 5LMNE 3MSWA 3P1XA 1YYKA 4HACA 1Z5AA 5IWAE 4JI4I 2KHXA 3Q6MA 1QU6A 3ADIA 2V2QA 3AV0A 1B63A 1Z0GA 4PU9A 5DNYA 2VE7C 2HK2A 2LMZA 3HXLA 4JI6I 1MG7A 1XNQI 2IOPA 4USMA 2VF3A 4IZJD 1WXRA 2UUCE 5A2QC 1IBKI 4FN5A 1DARA 2L33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 E;  2L3J A;  4JYA E;  4WFT A;  2BM1 A;  3QT5 A;  1S16 A;  4LFB E;  1T4O A;  1XHK A;  4HYM A;  3WU5 A;  4WUC A;  2HKJ A;  3M6A A;  1WHQ A;  2EZ6 A;  2UXB E;  3J80 Q;  4B3R I;  3C4T A;  4LF4 I;  2IHR 1;  2L2M A;  4DV5 I;  4GKK E;  2E5L I;  4LFA E;  4GKJ E;  4YY3 I;  4WUD A;  4DR4 I;  4DUZ E;  2V2Z A;  4JI7 E;  4NXM E;  1RC7 A;  2LTS A;  1YYW A;  4NXN E;  3PYD A;  5GMD A;  4LF8 I;  4DUY E;  4DV0 I;  4DR5 E;  4B3T E;  3T1Y I;  1N0U A;  1KVK A;  2UXC I;  3QT8 A;  1ZXN A;  4DR7 I;  1UIL A;  2F4V I;  4LF6 I;  4KHP E;  1N32 I;  2UXD I;  1PVG A;  1D6T A;  4B3S E;  2R3V A;  2AJ4 A;  3ZKD A;  5LMU I;  4X66 I;  2X7I A;  1YYO A;  1IBL E;  4X8W A;  3WU6 A;  3T1H E;  3PYE A;  3QT6 A;  5GME A;  1IBM I;  1FJG I;  2UUB E;  4JG4 A;  1XNR E;  1KIJ A;  1QZR A;  2HHH E;  3ZZU A;  4MYT A;  3VYX A;  1ELO A;  2MDR A;  1XMO I;  1I94 I;  3J7Y p;  2DEJ A;  4X64 E;  2UU9 E;  4WUB A;  1KTV A;  3H4L A;  4JI3 E;  4DV4 E;  4JI8 I;  1Z59 A;  2V34 A;  4JI5 E;  4DR1 I;  4DR3 E;  4DPX A;  4DXL A;  1HNZ E;  4AQY E;  1N33 I;  1X47 A;  3VYY A;  1J5E E;  2DB2 A;  1RQ0 A;  3JAM Q;  4DV1 I;  3F0N A;  3LTO A;  4DPU A;  2GS8 A;  4P7A A;  1HR0 I;  2A2D A;  1ZM4 A;  4JI4 E;  2Q2E B;  1EA6 A;  2CZ9 A;  5IWA I;  4DV2 I;  1UHZ A;  3C4B A;  1ZM2 A;  1XNQ E;  4JI6 E;  4LF9 E;  1B62 A;  4DPT A;  2LUQ A;  2B3T B;  2UUA E;  2UUC I;  1IBK E;  1EKZ A;  1WUU A;  4JV5 E;  1FWK A;  2LJH A;  1ZM3 A;  4OOG C;  3J81 C;  4I3H A;  4DU7 A;  4OX9 E;  4DV6 I;  4DR6 I;  2RTX A;  1N36 I;  1FNM A;  2JVA A;  1X48 A;  4LF4 E;  2BM0 A;  4DPY A;  1H7U A;  5BR8 E;  1N34 I;  2E1R A;  3HUL A;  4GKK I;  1GQE A;  4DR4 E;  2RS6 A;  4JI2 E;  2HK3 A;  4DV3 I;  4DUZ I;  1Z0T A;  4JI7 I;  2RS7 A;  3ZM7 A;  3OTO E;  5A2Q Q;  4LF8 E;  4X65 I;  4DUY I;  1XMQ I;  3B78 A;  3T1Y E;  2HFU A;  3PYG A;  5FLX Q;  1ZM9 A;  2UXC E;  3B8H A;  1H7S A;  3ZZ0 A;  3ADJ A;  4RPF A;  2ZM6 I;  4LF5 I;  4URL A;  3GON A;  4ED4 A;  2F4V E;  4LF6 E;  1N32 E;  4HAC B;  1OJ4 A;  2UXD E;  2A2C A;  4JI1 E;  4B3M I;  4KHP I;  4Z7Y A;  5LMU E;  4X66 E;  1Z0W A;  4B3S I;  2LTR A;  4LF7 E;  4LFC E;  1T4L B;  2YT4 A;  1RR9 A;  4DKK A;  3B82 A;  1HNX E;  4Z7C A;  2CPN A;  3JAM C;  2VQF I;  5CFF E;  3T1H I;  1IBM E;  2LBS B;  1FJG E;  2ZIT A;  4JI0 I;  3ADL A;  1YZ9 A;  1ZBT A;  1NZ0 A;  2NPF A;  1Z0B A;  2WW4 A;  1MX0 A;  1XMO E;  2VQE E;  3LNU A;  2JY9 A;  4P52 A;  5IT9 Q;  2RSM A;  2NUG A;  1NHH A;  2UU9 I;  4K0K I;  3QT7 A;  1H73 A;  4DR1 E;  3ZZT A;  2BV3 A;  4YHH I;  4JI5 I;  1WHN A;  4DR3 I;  1N33 E;  4DR2 I;  3V2U C;  4DV7 I;  3J80 C;  1H72 C;  1HNW I;  3J7A M;  5LMN I;  2V2V A;  2NUE A;  1HR0 E;  1A6F A;  2DMY A;  3J7A G;  1PIE A;  1NHI A;  1EI1 A;  1KKH A;  2EFG A;  3LLH A;  1S4E A;  3LPS A;  4DU8 A;  4DV2 E;  1RRE A;  4HXZ A;  4DV1 E;  4LF9 I;  2X36 A;  1T4N A;  2L2K B;  4X62 I;  2OI2 A;  4JYA I;  2R42 A;  1STU A;  4HY1 A;  3ZKB A;  2N3H A;  4DPW A;  2UUA I;  3Q1Q A;  3CWV A;  4LFB I;  2HKE A;  4B3R E;  4DV6 E;  4PRX A;  4MYU A;  2UXB I;  1MU5 A;  4DR6 E;  4DV5 E;  4OX9 I;  2L2N A;  1N36 E;  2E5L E;  5FLX C;  3WU3 A;  4FWD A;  1NHJ A;  4LFA I;  2N3G A;  4YY3 E;  4GKJ I;  1N34 E;  1O0W A;  4M30 A;  5BR8 I;  1Z0V A;  4NXM I;  1DI2 A;  4DV0 E;  4NXN I;  1Z0E A;  4ZVI A;  4DV3 E;  1U2R A;  3V5R A;  4JI2 I;  4M2Z A;  4USK A;  4DR5 I;  4B3T I;  3HTX A;  1Z5C A;  4X65 E;  4EMD A;  3OTO I;  3J81 Q;  1H74 A;  1XMQ E;  4DR7 E;  1X49 A;  2HFS A;  5LL6 R;  4FWG A;  4M1K A;  1Z5B A;  2V8P A;  2ZM6 E;  1UEK A;  3D4J A;  4WYQ B;  4LF5 E;  3ADG A;  1Z0C A;  4KQV A;  4UTG A;  5IT9 C;  1FKA E;  4R1F A;  4B3M E;  2DEI A;  1IBL I;  2DIX A;  4JI1 I;  1FWL A;  3K1J A;  2ZBK B;  1PKP A;  4FW9 A;  1VIS A;  3PYF A;  4LFC I;  4LF7 I;  2L3C A;  2VQF E;  2B7V A;  2UUB I;  1HNX I;  3WU4 A;  1XNR I;  1ZXM A;  4JI0 E;  1I94 E;  2HHH I;  1BKN A;  5L3J A;  4JI8 E;  4X64 I;  2LRS A;  4JI3 I;  1FI4 A;  3K17 A;  4DV4 I;  2LJP A;  1K47 A;  2XEX A;  2VQE I;  2NA2 A;  2B7T A;  1HNZ I;  4K0K E;  4AQY I;  4FWH A;  2J7K A;  2LUP B;  2NUF A;  4YHH E;  1J5E I;  4XTJ A;  1N0V C;  4DR2 E;  1J26 A;  4DV7 E;  4JV5 I;  4PRV A;  4UT4 A;  1HNW E;  5LMN E;  3P1X A;  1YYK A;  4HAC A;  1Z5A A;  5IWA E;  4JI4 I;  2KHX A;  1QU6 A;  3ADI A;  2V2Q A;  1B63 A;  1Z0G A;  4PU9 A;  2HK2 A;  1XNQ I;  4JI6 I;  1MG7 A;  4USM A;  2VF3 A;  2UUC E;  5A2Q C;  1IBK I;  4FN5 A;  1DAR A;  2L33 A; 
#chains in the Genus database with same CATH topology
 4X62 E;  2FV4 B;  2L3J A;  2EMH A;  2YTO A;  4JYA E;  3L00 A;  2YSP A;  3EQ1 A;  4WFT A;  2B9D A;  1A1J A;  2HC5 A;  4MQY A;  5JEA C;  1N3G A;  2BM1 A;  1S16 A;  2Q8U A;  2LJU A;  5AE1 A;  4LFB E;  1T4O A;  2Z5B B;  1XHK A;  4HYM A;  3WU5 A;  4WUC A;  1Y5Y A;  2RQL A;  2HKJ A;  3M6A A;  1WHQ A;  4F9A B;  2EZ6 A;  2UXB E;  2J7J A;  4U3D A;  3J80 Q;  4B3R I;  2YSO A;  3C4T A;  1BBG A;  1UN6 B;  4MU4 A;  2RSI A;  4O43 A;  1HK7 A;  3HJC A;  2EMY A;  3CDJ A;  4LF4 I;  2IHR 1;  2L2M A;  4DV5 I;  1RMD A;  1EH7 A;  2EL5 A;  4L8N A;  2YTD A;  1LLM C;  4GKK E;  4LFA E;  1USU A;  2E5L I;  2EQ3 A;  5JEA E;  4LTY A;  5A6J A;  4GKJ E;  3TQM A;  2EM6 A;  1PDA A;  1AH5 A;  1E3P A;  4YY3 I;  2F8B A;  2YZT A;  2EPO A;  2V88 A;  4WUD A;  4DR4 I;  4DUZ E;  1DGC A;  2ODR C;  2V2Z A;  2R1F A;  4JI7 E;  4F9B B;  2O1V A;  2O1T A;  2G7H A;  4NXM E;  2EL6 A;  3K6Q A;  1RC7 A;  3IWB A;  2I13 A;  2LTS A;  2Z5C A;  2JEB A;  1YYW A;  4NXN E;  2EL4 A;  2J65 A;  2YTQ A;  2DSY A;  3PYD A;  2ENC A;  5GMD A;  2O3Z A;  4LF8 I;  2EOQ A;  4DUY E;  4DV0 I;  1A1G A;  2I9I A;  2C37 A;  4DR5 E;  3GME A;  3IWC A;  2WBU A;  4B3T E;  5DRO A;  2JEA A;  3IWD A;  5DRP A;  1AAY A;  4F54 A;  3T1Y I;  3H1C A;  3K85 A;  2EMG A;  4GQU A;  2E72 A;  2JE6 A;  1N0U A;  2GQ0 A;  1KVK A;  2UXC I;  3QT8 A;  2EOF A;  1ZXN A;  4DR7 I;  1PJQ A;  2LCE A;  2YTP A;  2YU8 A;  1UIL A;  1Y6Z A;  5A6A A;  2F4V I;  4LF6 I;  4WXD A;  4KHP E;  2PO2 A;  1N32 I;  1NEI A;  2AE8 A;  2UXD I;  3OML A;  3F6G A;  1PVG A;  1D6T A;  3ZOQ B;  1TN9 A;  5FWK A;  4B3S E;  2R3V A;  2AJ4 A;  3ZKD A;  5LMU I;  2CGE A;  4X66 I;  2X7I A;  2NN6 D;  1YYO A;  2EQ1 A;  3GLL A;  1IBL E;  2O1W A;  2JYA A;  1UBD C;  2WNR B;  4U3B A;  4X8W A;  1B69 A;  2NN6 F;  3WU6 A;  4OO1 A;  4R2R A;  2PO1 B;  2ADR A;  4OO1 D;  3T1H E;  3PYE A;  3QT6 A;  5K36 E;  2EPK X;  3HPZ A;  2M4I A;  3UK3 C;  3C6M A;  2PNL A;  4AID A;  5GME A;  4NBQ A;  1IBM I;  3DF6 A;  1FJG I;  2EMA A;  3HQ1 A;  4Q28 A;  1JK2 A;  2BBG A;  2UUB E;  4JG4 A;  2BA1 G;  1XNR E;  4R03 A;  4BA2 B;  4F6N A;  1KIJ A;  4R2E A;  2C39 A;  3U1Y A;  2EPR A;  1QZR A;  4GEQ B;  2HHH E;  3ZZU A;  4MYT A;  5KL7 A;  3PS3 A;  2MKN A;  3VYX A;  4N3O A;  1ELO A;  2MDR A;  1XMO I;  2CSH A;  3J7Y p;  2BA0 D;  2DEJ A;  1I94 I;  4IFD A;  4X64 E;  2UU9 E;  3VK6 A;  4WUB A;  1X6F A;  2BA1 D;  1KTV A;  3F6H A;  4JI3 E;  3H4L A;  2JR1 A;  3AUZ A;  4DV4 E;  4JI8 I;  4F2J C;  1Z59 A;  2V34 A;  4WSP A;  3L7Z B;  1GTK A;  1YHC A;  5KL6 A;  4JI5 E;  4DR1 I;  4DR3 E;  4R2D A;  4DPX A;  4DXL A;  1HNZ E;  4M9V C;  4AQY E;  2BB8 A;  3PRY A;  2RPC A;  1N33 I;  2L8T A;  4FW4 A;  1IQS A;  1X47 A;  2JPA A;  4OKG A;  4J8Z A;  3VYY A;  1J5E E;  2DB2 A;  1RQ0 A;  2L6M A;  5EL9 A;  3JAM Q;  4DV1 I;  3F0N A;  2EMC A;  2EN1 A;  3LTO A;  4DPU A;  2EML A;  2GS8 A;  4P7A A;  1HR0 I;  4AM3 A;  2EMK A;  2A2D A;  1YUJ A;  3EPK A;  1ZM4 A;  4JI4 E;  2EN6 A;  3M85 G;  2JT2 A;  2Q2E B;  1JK1 A;  1EA6 A;  2Z5C B;  4QNK A;  2MKD A;  2WZO A;  2CZ9 A;  4IZJ A;  4MU0 A;  2DMI A;  1UHZ A;  5IWA I;  4DV2 I;  2LE2 A;  5K36 B;  3C4B A;  2EM3 A;  4BC9 A;  1ZM2 A;  3P3E A;  4MDT A;  1XNQ E;  4JI6 E;  4LF9 E;  2YTE A;  1YH8 A;  2EMW A;  2EWL A;  4O24 A;  5DNX A;  1B62 A;  2MDG A;  2LUQ A;  2F1D A;  4DPT A;  1PJS A;  4LPF A;  2B3T B;  5JEA A;  2UUA E;  2UUC I;  1IBK E;  1EKZ A;  1WUU A;  2WP8 A;  2PO0 B;  5JEA D;  3JTZ A;  4JV5 E;  1FWK A;  3FIG A;  2LJH A;  4BMJ A;  1ZM3 A;  4OOG C;  2EN8 A;  3J81 C;  2PO2 B;  1Y4S A;  1PJT A;  4R2A A;  1G2F C;  1P47 A;  4I3H A;  4DU7 A;  2YTG A;  4OX9 E;  4DV6 I;  5JEA F;  2M7Q A;  1EH6 A;  4DR6 I;  2EM9 A;  2RTX A;  5EKW A;  5C0X E;  1N36 I;  1A1H A;  2C38 A;  1FNM A;  1QNT A;  4FW5 A;  4BS9 A;  1SFE A;  1UDN A;  1X48 A;  2JVA A;  5KL5 A;  4LF4 E;  2BM0 A;  4MU1 A;  2EN4 A;  3BF2 A;  4BHB A;  4ZYE A;  1H7U A;  5BR8 E;  4DPY A;  1N34 I;  2E1R A;  2PNZ B;  4R2P A;  3HUL A;  4IZK A;  3MHH C;  2EMX A;  4GKK I;  2ODR D;  2EN7 A;  2EP3 A;  1GQE A;  4BHC A;  4DR4 E;  2EOY A;  5AC4 A;  2RS6 A;  4I8O A;  1X5W A;  2V83 A;  4JI2 E;  2HK3 A;  2WBS A;  4DV3 I;  4RH8 A;  4DUZ I;  1TF6 A;  1Z0T A;  3EPJ A;  1P42 A;  4JI7 I;  2RS7 A;  3ZM7 A;  3OTO E;  5A2Q Q;  4FW6 A;  2V86 A;  1A1F A;  4LF8 E;  4IFD B;  3CDI A;  4LCH A;  1T39 A;  4X65 I;  2GO4 A;  2O1U A;  4DUY I;  3P06 A;  1XMQ I;  3M7N G;  2GLI A;  2ENH A;  3BGH A;  4KWY A;  4TUI A;  2V85 A;  3B78 A;  2LVH A;  3PS1 A;  4LCF A;  3T1Y E;  2HFU A;  5K36 C;  3PYG A;  4BA1 B;  2YTF A;  1WJP A;  1ZBQ A;  3QG5 C;  1ZM9 A;  3P76 A;  4WSG A;  2UXC E;  1UDO A;  3B8H A;  3KWR A;  1H7S A;  3ZZ0 A;  3ADJ A;  4RPF A;  2ZM6 I;  2NN6 A;  4LF5 I;  4URL A;  3C6K A;  1TF3 A;  1ZR9 A;  3GON A;  2F4V E;  4LF6 E;  1N32 E;  4HAC B;  4ED4 A;  3M7N D;  1OJ4 A;  2HGH A;  2UXD E;  2GPI A;  2A2C A;  2LT7 A;  4JI1 E;  5C0X B;  4B3M I;  1GZ6 A;  1OYP A;  4Z7Y A;  2EOR A;  4KHP I;  1ZU1 A;  4Q35 B;  3U1K A;  5LMU E;  4X66 E;  5TSE A;  2PNM A;  2Z5B A;  1Z0W A;  4B3S I;  4O5G A;  1A1K A;  2LTR A;  4BCA A;  5ELW A;  4LF7 E;  4LFC E;  1T4L B;  4IZJ B;  4P7D A;  2DLQ A;  2YT4 A;  1RR9 A;  4DKK A;  3B82 A;  4M0V A;  4X9J A;  1HNX E;  4Z7C A;  2CPN A;  3JAM C;  2VQF I;  1USV A;  1G2D C;  5CFF E;  1T38 A;  1YPN A;  3T1H I;  1IBM E;  4O4K A;  2LBS B;  1FJG E;  2ZIT A;  4JI0 I;  3ADL A;  1YZ9 A;  2E1M A;  4N4R B;  2CG9 A;  5A6B A;  4OO1 C;  1ZBT A;  5A6B D;  1NZ0 A;  2NPF A;  1X6E A;  2WP8 B;  1L4S A;  1KJK A;  3PS2 A;  4LCG A;  4QNJ A;  1Z0B A;  2WW4 A;  1MX0 A;  4R2C A;  1XMO E;  2VQE E;  5A6K A;  2V87 A;  2CVE A;  3LNU A;  2JY9 A;  4IJD A;  4P52 A;  5IT9 Q;  2RSM A;  1X6H A;  2NUG A;  2M9A A;  1NHH A;  1Y4U A;  2EMB A;  2UU9 I;  1EH8 A;  4NZV A;  4K0K I;  4IS1 C;  3QT7 A;  1H73 A;  4IS9 A;  2EQ0 A;  4DR1 E;  3KRN A;  3ZZT A;  2JXP A;  1IQO A;  4IFD C;  3THO B;  3Q6N A;  4OO1 E;  4WXC A;  2BV3 A;  4YHH I;  4JI5 I;  1WHN A;  1UDQ A;  4DR3 I;  1N33 E;  2ELY A;  2L92 A;  4DR2 I;  2YTN A;  3V2U C;  2EPP A;  2WBT A;  4DV7 I;  3J80 C;  1BBO A;  1H72 C;  2EN2 A;  3J7A M;  2EMI A;  2EM7 A;  5LMN I;  1HNW I;  3P3C A;  2JEB B;  2V2V A;  2NUE A;  5AC5 A;  1HR0 E;  1A6F A;  2JP9 A;  4BC7 A;  2DMY A;  3EPH A;  3UHM A;  3EPL A;  3J7A G;  1PIE A;  3DJW A;  3KZY A;  1NHI A;  2C37 B;  2EPU A;  1EI1 A;  4J3D A;  1KKH A;  2EFG A;  2K4V A;  1VI7 A;  2IER A;  3LLH A;  3M85 D;  2JEA B;  4IFD E;  5C0X C;  1S4E A;  1BB8 A;  3LPS A;  4DU8 A;  4DV2 E;  2EPM X;  1RRE A;  2WNR A;  3B4T A;  1MEY C;  2JE6 B;  2PO1 A;  2FTX B;  2MC5 A;  4HXZ A;  4MLQ A;  4DV1 E;  2YTI A;  1KYQ A;  3H09 A;  5LLQ A;  4F6M A;  2EOS A;  4LF9 I;  1WRJ A;  2X36 A;  1T4N A;  2FGG A;  2L2K B;  4ZYG A;  4X62 I;  2OI2 A;  4JYA I;  1DQ3 A;  2R42 A;  5FLX Q;  1STU A;  4HY1 A;  2EPN A;  5IV8 B;  1Z1B A;  4FW3 A;  3ZKB A;  2EM5 A;  4BA2 A;  2M1S A;  2JOX A;  4GZN C;  2N3H A;  2VF1 A;  1IMU A;  2DGC A;  2NN6 B;  3CWV A;  4DPW A;  1XXE A;  2UUA I;  2MC6 A;  3Q1Q A;  4LFB I;  2HKE A;  2BR2 A;  4B3R E;  4DV6 E;  4PRX A;  2EPA A;  5KL3 A;  4MYU A;  2UXB I;  1MU5 A;  3QT5 A;  2EOO A;  4DV5 E;  4DR6 E;  4OX9 I;  2KOU A;  2L2N A;  1N36 E;  2IES A;  4OO1 B;  2E5L E;  5DRR A;  2YRH A;  2EPX A;  2VRD A;  5FLX C;  3WU3 A;  4FWD A;  2ELZ A;  1NHJ A;  2YTJ A;  3L7Z A;  2LV2 A;  2GO3 A;  4BBY A;  4LFA I;  2EPC A;  4FK5 C;  2N3G A;  4YY3 E;  4GKJ I;  1N34 E;  1X3C A;  2C39 B;  1O0W A;  4M30 A;  5BR8 I;  2EPL X;  4MU3 A;  4R2S A;  1Z0V A;  1SR9 A;  3BID A;  4NXM I;  1DI2 A;  4DV0 E;  1YFH A;  4NXN I;  3THN A;  1Z0E A;  4L5N C;  4DV3 E;  2EOE A;  3GCM A;  4ZVI A;  4TUG A;  4AIM A;  1U2R A;  3V5R A;  4JI2 I;  2JOB A;  4M2Z A;  2CTD A;  4USK A;  4DR5 I;  5AAS A;  4ZYD A;  1OYR A;  4B3T I;  2EOH A;  3HTX A;  3JU0 A;  1Z5C A;  3NZK A;  5K36 A;  4X65 E;  2KON A;  4EMD A;  3OTO I;  1NCS A;  5K36 D;  3J81 Q;  1H74 A;  1XMQ E;  4DR7 E;  2EJ4 A;  1X49 A;  2HFS A;  5LL6 R;  3P3G A;  2LO3 A;  4FWG A;  4LU9 A;  4M1K A;  5A2Q C;  1Z5B A;  2N8X A;  4F9C B;  2V8P A;  5K36 F;  2EM0 A;  1YSA C;  1OYS A;  2H36 X;  2YPN A;  2ZM6 E;  1UEK A;  3HKM A;  2EPZ A;  3D4J A;  4WYQ B;  3VHT B;  4LF5 E;  5DNL A;  2YWQ A;  3ADG A;  4RHB B;  2EOM A;  3RMP A;  2PO0 A;  4KZS A;  1Z0C A;  2Z5E A;  4KQV A;  2IOQ A;  4WX9 A;  4UTG A;  5IT9 C;  1FKA E;  4R1F A;  4B3M E;  2EM4 A;  2K7I A;  2DEI A;  1IBL I;  2EM2 A;  3HPS A;  2DIX A;  4JI1 I;  2NN6 C;  1FWL A;  4ZYH A;  2WCC 3;  5KL2 A;  2EN3 A;  2ZBK B;  3K1J A;  1PKP A;  2JWO A;  4OZE A;  4FW9 A;  4R2Q A;  5F3W A;  1VIS A;  4FW7 A;  3PYF A;  2YU5 A;  4LFC I;  5AE3 A;  4LF7 I;  2YRK A;  2L3C A;  3ECR A;  4NHR A;  2VQF E;  5JEA B;  2B7V A;  2UUB I;  4LOM A;  1HNX I;  1RHY A;  3WU4 A;  2GHF A;  1ZXM A;  1XNR I;  2PNZ A;  4JI0 E;  2EE8 A;  5ADZ A;  4P78 A;  1I94 E;  3BBG A;  4HEI A;  1E3H A;  2HHH I;  2NN6 E;  2CT1 A;  2BA0 G;  2EMF A;  1BKN A;  5DRQ A;  5L3J A;  4OO1 F;  2HJJ A;  1A1L A;  2R76 A;  2DRP A;  4JI8 E;  4X64 I;  2C38 B;  2LRS A;  4JI3 I;  1YUI A;  1A1I A;  1FI4 A;  3K17 A;  5KL4 A;  4DV4 I;  2BR2 B;  4HTG A;  2YRM A;  2LJP A;  2EOJ A;  3MHS C;  1K47 A;  4WPY A;  2ENA A;  5T6J A;  2XEX A;  5AE2 A;  2NA2 A;  2VQE I;  2B7T A;  1HNZ I;  4IFD D;  2EOX A;  2EOI A;  2V8Q B;  4K0K E;  2EOZ A;  4AQY I;  4FWH A;  1R6M A;  2V89 A;  2LUP B;  2NUF A;  2J7K A;  2PRT A;  1MGT A;  3LML A;  3DD6 A;  2A25 A;  4IZK B;  4YHH E;  1J5E I;  4IFD F;  1F2I G;  4BA1 A;  5IXM B;  1DAR A;  2EMZ A;  1N0V C;  2VES A;  4XTJ A;  4DMI A;  4DR2 E;  2DLK A;  1J26 A;  4DV7 E;  4JV5 I;  4PRV A;  4UT4 A;  1HNW E;  5LMN E;  3MSW A;  3KZZ A;  3P1X A;  1YYK A;  4HAC A;  1Z5A A;  5IWA E;  4JI4 I;  2KHX A;  5C0X A;  2D9H A;  5C0X D;  3Q6M A;  5A69 A;  1QU6 A;  3ADI A;  2V2Q A;  2EM8 A;  1B63 A;  1ZAA C;  1Z0G A;  4PU9 A;  5DNY A;  2VE7 C;  3M99 B;  2HK2 A;  2LMZ A;  3HXL A;  4JI6 I;  1MG7 A;  1XNQ I;  1R6L A;  5C0X F;  1UDS A;  2IOP A;  4USM A;  2NAB A;  4MLV A;  2VF3 A;  4IZJ D;  1WXR A;  2UUC E;  1Y60 A;  4ISA A;  4R8O A;  1IBK I;  4FN5 A;  3AV0 A;  2L33 A; 
#chains in the Genus database with same CATH homology
 4X62 E;  2FV4 B;  2L3J A;  4JYA E;  4WFT A;  2B9D A;  2BM1 A;  3QT5 A;  1S16 A;  5AE1 A;  4LFB E;  2Z5B B;  1T4O A;  1XHK A;  4HYM A;  3WU5 A;  4WUC A;  2HKJ A;  3M6A A;  1WHQ A;  4F9A B;  2EZ6 A;  2UXB E;  3J80 Q;  4B3R I;  3C4T A;  1HK7 A;  3HJC A;  4LF4 I;  2IHR 1;  2L2M A;  4DV5 I;  1USU A;  4L8N A;  4GKK E;  2E5L I;  4LFA E;  4LTY A;  4GKJ E;  4YY3 I;  2F8B A;  2YZT A;  2V88 A;  4WUD A;  4DR4 I;  4DUZ E;  2ODR C;  2V2Z A;  4JI7 E;  2O1V A;  4F9B B;  2O1T A;  2G7H A;  4NXM E;  3K6Q A;  1RC7 A;  3IWB A;  2Z5C A;  2LTS A;  1YYW A;  4NXN E;  2DSY A;  3PYD A;  5GMD A;  4LF8 I;  4DUY E;  4DV0 I;  4DR5 E;  3IWC A;  4B3T E;  3IWD A;  4F54 A;  3T1Y I;  3K85 A;  1N0U A;  2GQ0 A;  1KVK A;  2UXC I;  3QT8 A;  1ZXN A;  4DR7 I;  1UIL A;  1Y6Z A;  2F4V I;  4LF6 I;  4KHP E;  1N32 I;  2UXD I;  3OML A;  3F6G A;  1PVG A;  1D6T A;  3ZOQ B;  5FWK A;  4B3S E;  2R3V A;  2AJ4 A;  3ZKD A;  5LMU I;  2CGE A;  4X66 I;  2X7I A;  1YYO A;  1IBL E;  2O1W A;  4X8W A;  3WU6 A;  3T1H E;  3PYE A;  3QT6 A;  3HPZ A;  2M4I A;  2PNL A;  5GME A;  1IBM I;  3DF6 A;  1FJG I;  4Q28 A;  3HQ1 A;  2UUB E;  4R8O A;  4JG4 A;  1XNR E;  4R03 A;  1KIJ A;  1QZR A;  4GEQ B;  2HHH E;  3ZZU A;  4MYT A;  3VYX A;  4N3O A;  1ELO A;  2MDR A;  1XMO I;  1I94 I;  3J7Y p;  2DEJ A;  4X64 E;  2UU9 E;  3VK6 A;  4WUB A;  1KTV A;  3F6H A;  4JI3 E;  3H4L A;  2JR1 A;  3AUZ A;  4DV4 E;  4JI8 I;  1Z59 A;  2V34 A;  4WSP A;  4JI5 E;  4DR1 I;  4DR3 E;  4DPX A;  4DXL A;  1HNZ E;  4AQY E;  3PRY A;  1N33 I;  2L8T A;  1X47 A;  4J8Z A;  3VYY A;  1J5E E;  2DB2 A;  1RQ0 A;  2L6M A;  3JAM Q;  4DV1 I;  3F0N A;  3LTO A;  4DPU A;  2GS8 A;  4P7A A;  1HR0 I;  2A2D A;  1ZM4 A;  4JI4 E;  2Q2E B;  1EA6 A;  2Z5C B;  2WZO A;  2CZ9 A;  4IZJ A;  5IWA I;  4DV2 I;  1UHZ A;  2LE2 A;  3C4B A;  1ZM2 A;  4BC9 A;  1XNQ E;  4JI6 E;  4LF9 E;  2EWL A;  1B62 A;  4DPT A;  2LUQ A;  2B3T B;  2UUA E;  2UUC I;  1IBK E;  1EKZ A;  1WUU A;  3JTZ A;  4JV5 E;  1FWK A;  3FIG A;  2LJH A;  4BMJ A;  1ZM3 A;  4OOG C;  3J81 C;  1Y4S A;  4I3H A;  4DU7 A;  4OX9 E;  4DV6 I;  2M7Q A;  4DR6 I;  2RTX A;  1N36 I;  1FNM A;  4BS9 A;  2JVA A;  1X48 A;  4LF4 E;  2BM0 A;  4DPY A;  1H7U A;  5BR8 E;  1N34 I;  2E1R A;  3HUL A;  4IZK A;  4GKK I;  2ODR D;  1GQE A;  4DR4 E;  2RS6 A;  4I8O A;  2V83 A;  4JI2 E;  2HK3 A;  4DV3 I;  4DUZ I;  1Z0T A;  4JI7 I;  2RS7 A;  3ZM7 A;  3OTO E;  5A2Q Q;  2V86 A;  4LF8 E;  4X65 I;  2O1U A;  4DUY I;  3P06 A;  1XMQ I;  3B78 A;  4TUI A;  2V85 A;  3T1Y E;  2HFU A;  3PYG A;  1ZBQ A;  1ZM9 A;  5FLX Q;  2UXC E;  3B8H A;  3KWR A;  1H7S A;  3ZZ0 A;  3ADJ A;  4RPF A;  2ZM6 I;  4LF5 I;  4URL A;  3GON A;  4ED4 A;  2F4V E;  4LF6 E;  1N32 E;  4HAC B;  1OJ4 A;  2UXD E;  2A2C A;  4JI1 E;  4B3M I;  1GZ6 A;  4KHP I;  4Z7Y A;  5LMU E;  4X66 E;  2PNM A;  2Z5B A;  1Z0W A;  4B3S I;  2LTR A;  4BCA A;  4LF7 E;  4LFC E;  1T4L B;  4IZJ B;  4P7D A;  2YT4 A;  1RR9 A;  4DKK A;  3B82 A;  4M0V A;  1HNX E;  4Z7C A;  2CPN A;  3JAM C;  2VQF I;  1USV A;  5CFF E;  3T1H I;  1IBM E;  2LBS B;  1FJG E;  2ZIT A;  4JI0 I;  3ADL A;  1YZ9 A;  2E1M A;  2CG9 A;  1ZBT A;  1NZ0 A;  2NPF A;  1Z0B A;  2WW4 A;  1MX0 A;  1XMO E;  2VQE E;  2V87 A;  3LNU A;  2JY9 A;  4P52 A;  5IT9 Q;  2RSM A;  2NUG A;  1NHH A;  1Y4U A;  2UU9 I;  4K0K I;  3QT7 A;  1H73 A;  4DR1 E;  3ZZT A;  3Q6N A;  2BV3 A;  4YHH I;  4JI5 I;  1WHN A;  4DR3 I;  1N33 E;  2L92 A;  4DR2 I;  3V2U C;  4DV7 I;  3J80 C;  1H72 C;  1HNW I;  3J7A M;  5LMN I;  2V2V A;  2NUE A;  1HR0 E;  1A6F A;  4BC7 A;  2DMY A;  3J7A G;  1PIE A;  3DJW A;  1NHI A;  1EI1 A;  1KKH A;  2EFG A;  2K4V A;  3LLH A;  1S4E A;  3LPS A;  4DU8 A;  4DV2 E;  1RRE A;  2FTX B;  2MC5 A;  4HXZ A;  4DV1 E;  3H09 A;  4LF9 I;  2X36 A;  1T4N A;  2FGG A;  2L2K B;  4X62 I;  2OI2 A;  4JYA I;  1DQ3 A;  2R42 A;  1STU A;  4HY1 A;  3ZKB A;  2M1S A;  2JOX A;  2N3H A;  2VF1 A;  4DPW A;  2UUA I;  3Q1Q A;  3CWV A;  4LFB I;  2MC6 A;  2HKE A;  4B3R E;  4DV6 E;  4PRX A;  4MYU A;  2UXB I;  1MU5 A;  4DR6 E;  4DV5 E;  4OX9 I;  2KOU A;  2L2N A;  1N36 E;  2E5L E;  5FLX C;  3WU3 A;  4FWD A;  1NHJ A;  4BBY A;  4LFA I;  2N3G A;  4YY3 E;  4GKJ I;  1N34 E;  1O0W A;  4M30 A;  5BR8 I;  1Z0V A;  1SR9 A;  4NXM I;  1DI2 A;  4DV0 E;  4NXN I;  1Z0E A;  4L5N C;  4DV3 E;  4ZVI A;  4TUG A;  1U2R A;  3V5R A;  4JI2 I;  2JOB A;  4M2Z A;  4USK A;  4DR5 I;  5AAS A;  4B3T I;  3HTX A;  3JU0 A;  1Z5C A;  4X65 E;  2KON A;  4EMD A;  3OTO I;  3J81 Q;  1H74 A;  1XMQ E;  4DR7 E;  1X49 A;  2HFS A;  5LL6 R;  4FWG A;  4M1K A;  4LU9 A;  1Z5B A;  4F9C B;  2V8P A;  2H36 X;  2ZM6 E;  1UEK A;  3D4J A;  4WYQ B;  4LF5 E;  3ADG A;  3RMP A;  4KZS A;  1Z0C A;  2Z5E A;  4KQV A;  2IOQ A;  4UTG A;  5IT9 C;  1FKA E;  4R1F A;  4B3M E;  2DEI A;  1IBL I;  3HPS A;  2DIX A;  4JI1 I;  1FWL A;  3K1J A;  2ZBK B;  1PKP A;  2JWO A;  4FW9 A;  5F3W A;  1VIS A;  3PYF A;  4LFC I;  5AE3 A;  4LF7 I;  2L3C A;  2VQF E;  2B7V A;  2UUB I;  1HNX I;  3WU4 A;  1XNR I;  1ZXM A;  4JI0 E;  5ADZ A;  4P78 A;  1I94 E;  2HHH I;  1BKN A;  5L3J A;  4JI8 E;  4X64 I;  2LRS A;  4JI3 I;  1FI4 A;  3K17 A;  4DV4 I;  2LJP A;  1K47 A;  4WPY A;  5T6J A;  2XEX A;  2VQE I;  5AE2 A;  2NA2 A;  2B7T A;  1HNZ I;  2V8Q B;  4K0K E;  4AQY I;  4FWH A;  2J7K A;  2V89 A;  2LUP B;  2NUF A;  3LML A;  4IZK B;  4YHH E;  1J5E I;  4XTJ A;  1N0V C;  4DMI A;  4DR2 E;  1J26 A;  4DV7 E;  4JV5 I;  4PRV A;  4UT4 A;  1HNW E;  5LMN E;  3MSW A;  3P1X A;  1YYK A;  4HAC A;  1Z5A A;  5IWA E;  4JI4 I;  2KHX A;  3Q6M A;  1QU6 A;  3ADI A;  2V2Q A;  3AV0 A;  1B63 A;  1Z0G A;  4PU9 A;  5DNY A;  2VE7 C;  2HK2 A;  2LMZ A;  3HXL A;  4JI6 I;  1MG7 A;  1XNQ I;  2IOP A;  4USM A;  2VF3 A;  4IZJ D;  1WXR A;  2UUC E;  5A2Q C;  1IBK I;  4FN5 A;  1DAR A;  2L33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...