2ZM6I

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
125
structure length
125
Chain Sequence
YYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 20
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2zm6I00
4B3TE 2GS8A 2A2DA 2UUAE 4X64I 4JI1I 4DV3E 1DARA 2UXDI 4UTGA 2HKJA 1N34I 3WU3A 4FWHA 4DPUA 4DV1E 4JV5I 3QT7A 4KHPI 4USMA 4DR4E 2UUBI 4LF9E 1ZM3A 4DV3I 2ZM6I 1N0VC 1XHKA 4HACB 2UXBE 4LFCI 1N0UA 4X65I 4KHPE 1HNZE 1ZM2A 1H74A 4PRVA 4K0KE 4DPWA 4LFBE 4M1KA 4JI0E 2UUCE 1NHIA 5A2QC 1VISA 4JI1E 2E5LI 4JYAE 4DR2E 1I94I 4DR3E 3ZZUA 4RPFA 1J5EE 3M6AA 4K0KI 4ZVIA 1RR9A 3ZKDA 4AQYE 3LTOA 4URLA 4DV7I 4DV6E 3V2UC 3T1YE 1XMQI 4GKKE 1H7SA 2E5LE 2WW4A 4LF8E 1IBKI 1XMOE 2BM1A 3PYEA 4HXZA 1HNXI 3J80Q 4B3SE 2V2QA 5FLXQ 4NXMI 1D6TA 1XNRI 1KIJA 2EFGA 2V34A 4Z7CA 2UU9E 1NZ0A 2E1RA 2ZM6E 4DR1I 4JG4A 4USKA 4X62E 4DV2E 4PU9A 3CWVA 4DPXA 1KKHA 1FKAE 4JI3I 1H7UA 2BM0A 1S16A 3OTOE 3F0NA 4DV6I 3GONA 4YHHE 1Z0WA 3PYDA 5LMUI 1PVGA 3ZM7A 2ZITA 4JI7I 1KVKA 3K1JA 4LF8I 5IWAE 4MYTA 1PKPA 1MU5A 1Z5AA 3ZZTA 2HK3A 4P7AA 1IBLI 4P52A 2OI2A 4LFAE 1ZXMA 4OX9I 3HULA 4EMDA 1MX0A 3QT5A 1NHJA 2Q2EB 4DR3I 1N36E 4DR2I 4B3ME 4DV4E 5BR8E 4DR7I 4Z7YA 4DUYE 1BKNA 3J81Q 1Z59A 1Z0GA 4DV0I 2A2CA 4DR6I 4LFAI 1FWKA 1A6FA 1EI1A 1B62A 4FN5A 4B3TI 2VQEE 4YHHI 1IBLE 5LL6R 1FWLA 2UXBI 4WUCA 2LJPA 1I94E 1FI4A 1PIEA 5A2QQ 3J80C 3Q1QA 2UUCI 4DV5E 4LF4I 2HKEA 4FW9A 3T1HE 2AJ4A 5LMNE 2UXCI 1Z0TA 5BR8I 2XEXA 4JI6I 1Z5BA 4DU7A 4LF6I 2VF3A 4X65E 3ZZ0A 4GKJE 1H73A 2X7IA 4DPTA 4OX9E 2VQEI 4WUDA 3OTOI 4B3RI 4I3HA 1ELOA 1HR0I 3WU4A 3J81C 2HHHI 2HHHE 3V5RA 4LF5E 4B3SI 4DUYI 1QZRA 4LF7E 1N32E 1EA6A 1S4EA 3T1HI 4DV4I 4DR7E 4X66E 5LMUE 1N36I 1IBKE 4JI8E 4DR1E 1MG7A 2V8PA 3QT8A 4NXNI 2R42A 1B63A 3WU6A 4WUBA 4XTJA 1NHHA 1ZM4A 2J7KA 5LMNI 2UXCE 4GKJI 4JI4I 4FWGA 1OJ4A 1K47A 3J7AM 2HFSA 1FJGE 4DU8A 4JI2I 1H72C 4JI0I 4LF5I 3ZKBA 1HR0E 3T1YI 3B8HA 2F4VI 4FWDA 3H4LA 4HACA 4DV0E 4DV7E 4NXME 1Z0EA 3WU5A 1Z5CA 4DV5I 4LF4E 5IT9Q 5GMEA 4JI2E 2CZ9A 4JI6E 3LPSA 4DPYA 5FLXC 1XMQE 2X36A 4GKKI 2UXDE 1XNQE 4MYUA 3D4JA 2UUAI 4DR6E 2R3VA 2UUBE 4LF9I 1XNRE 1Z0VA 1Z0BA 4LF6E 1Z0CA 2HFUA 4JYAI 4DUZI 4JI8I 2V2VA 5IWAI 2F4VE 2VQFI 1ZM9A 2VQFE 1RREA 4LF7I 4KQVA 1N32I 3PYFA 4B3MI 5IT9C 1N34E 1WUUA 4ED4A 4PRXA 4YY3I 3JAMC 4X62I 4LFCE 3QT6A 4X64E 4R1FA 2NPFA 1IBME 1XNQI 3K17A 4DR4I 1J5EI 3PYGA 1FJGI 1UEKA 2V2ZA 3B82A 2BV3A 4LFBI 4JI7E 2ZBKB 4DXLA 1HNXE 3LNUA 1HNZI 1HNWI 4JI5E 5L3JA 4HY1A 1N33I 4DV2I 4DR5I 1KTVA 5GMDA 1IBMI 4AQYI 2DEJA 1FNMA 4YY3E 4DV1I 4JV5E 1HNWE 1XMOI 4X66I 3B78A 4JI3E 4JI4E 3JAMQ 2DEIA 4DUZE 4B3RE 1U2RA 3J7AG 1ZXNA 4HYMA 4DR5E 4NXNE 2UU9I 1N33E 4UT4A 4JI5I 2HK2A
chains in the Genus database with same CATH superfamily
4B3TE 2IESA 4J3DA 2GS8A 2A2DA 2JT2A 2UUAE 4X64I 4JI1I 4DV3E 2Z5EA 2PNZB 1DARA 2UXDI 2J65A 2CGEA 4UTGA 2HKJA 3H1CA 3WU3A 4FWHA 4DPUA 1N34I 4AM3A 3PS1A 4DV1E 4JV5I 3UHMA 4OO1C 3QT7A 3P3EA 4MDTA 4KHPI 4USMA 4DR4E 2UUBI 4LF9E 1ZM3A 4DV3I 2ZM6I 5JEAB 1N0VC 1XHKA 4HACB 2UXBE 4LFCI 2BA1D 1N0UA 5EL9A 4IZJD 4OO1E 5ELWA 5FWKA 4X65I 4KHPE 1HNZE 1ZM2A 1YHCA 3CDJA 1H74A 4PRVA 5C0XB 4K0KE 2WP8A 4DPWA 4LFBE 4M1KA 4JI0E 5JEAD 2UUCE 1HK7A 1NHIA 5A2QC 4OKGA 1VISA 4JI1E 2C39B 2E5LI 4JYAE 4DR2E 1I94I 4DR3E 3ZZUA 4RPFA 2Z5CA 1J5EE 2GO3A 4LCGA 3M6AA 4K0KI 4ZVIA 1RR9A 3ZKDA 4AQYE 3LTOA 4URLA 4DV7I 1RHYA 4DV6E 2O1VA 4IFDD 3V2UC 4QNJA 3T1YE 1XMQI 4GKKE 4FW4A 4OO1B 1H7SA 2E5LE 2WW4A 5JEAE 4LF8E 1IBKI 1XMOE 2BM1A 3PYEA 4HXZA 1HNXI 3J80Q 2PO1A 4BA2A 4B3SE 2V2QA 5FLXQ 4NXMI 1D6TA 1XNRI 1KIJA 2EFGA 2V34A 4Z7CA 2UU9E 1NZ0A 2E1RA 2ZM6E 4DR1I 4IS9A 3DD6A 3Q6NA 2NN6C 4JG4A 4USKA 4X62E 4DV2E 4PU9A 1USUA 3CWVA 4GQUA 4DPXA 1KKHA 1FKAE 2NN6E 4JI3I 1H7UA 2BM0A 1S16A 3NZKA 3OTOE 3F0NA 2CG9A 4DV6I 3GONA 4YHHE 1UDNA 1Z0WA 4IZKA 5DRRA 3PYDA 5LMUI 4LPFA 4IFDE 2C38A 1E3HA 1Y60A 2IOPA 1PVGA 3ZM7A 2ZITA 4JI7I 3M85D 1KVKA 3K1JA 4LF8I 5IWAE 4MYTA 1PKPA 1MU5A 1Z5AA 3ZZTA 1OYSA 4IFDB 2HK3A 4OO1D 3Q6MA 4P7AA 1IBLI 4P52A 3P3GA 4FW6A 4IZJA 2Z5BA 2OI2A 2C39A 2BA1G 4LFAE 4U3DA 1ZXMA 4IZKB 2GQ0A 3HULA 4OX9I 2GO4A 5K36F 1UDOA 5C0XA 4EMDA 1MX0A 3QT5A 1NHJA 2CVEA 2Q2EB 4DR3I 1N36E 4DR2I 4B3ME 4DV4E 5BR8E 5C0XE 4DR7I 3HKMA 1VI7A 4Z7YA 4DUYE 1BKNA 2JE6A 2JEBA 3J81Q 4LCHA 5K36C 1Z59A 1Z0GA 4DV0I 2A2CA 4DR6I 4LFAI 1FWKA 2WNRA 1A6FA 1EI1A 1B62A 4FN5A 4B3TI 2PO0A 4LOMA 2VQEE 4YHHI 4MU3A 1IBLE 1YH8A 5LL6R 1FWLA 2UXBI 4WUCA 4IFDC 2LJPA 1I94E 1FI4A 1PIEA 2C38B 4N3OA 1P42A 3GMEA 5A2QQ 3P3CA 3J80C 3Q1QA 2UUCI 4DV5E 4LF4I 2HKEA 4FW9A 3T1HE 2AJ4A 5LMNE 2UXCI 3U1KA 1Z0TA 5BR8I 2XEXA 4DU7A 1Z5BA 4JI6I 4LF6I 4IZJB 2WP8B 2VF3A 2O1TA 4X65E 3ZZ0A 5C0XF 4GKJE 1H73A 2X7IA 4DPTA 4OX9E 2VQEI 2O3ZA 4WUDA 3OTOI 4B3RI 4I3HA 3L7ZA 2PO0B 1ELOA 3HJCA 1HR0I 2NN6D 3WU4A 5C0XC 3J81C 2HHHI 2HHHE 2PO1B 3V5RA 4LF5E 4B3SI 4DUYI 1QZRA 4LF7E 1N32E 1EA6A 1S4EA 3T1HI 4DV4I 4DR7E 4X66E 5LMUE 1N36I 1IBKE 4JI8E 4DR1E 1MG7A 2V8PA 2C37A 3QT8A 4NXNI 2R42A 2WNRB 1B63A 2PO2B 4FW5A 2PNMA 3WU6A 4WUBA 1R6MA 4XTJA 1NHHA 5K36D 2Z5BB 1ZM4A 2J7KA 4AIMA 1Y5YA 3GLLA 5LMNI 2AE8A 3KRNA 2UXCE 4GKJI 4JI4I 4FWGA 1OJ4A 1K47A 3M85G 4MU1A 4LCFA 3J7AM 2HFSA 1FJGE 5EKWA 4DU8A 4JI2I 1H72C 4JI0I 4LF5I 3B4TA 3ZKBA 1HR0E 3T1YI 3B8HA 2F4VI 3M7ND 1R6LA 4FWDA 1UDSA 5C0XD 3CDIA 3M7NG 1UDQA 3H4LA 4HACA 4DV0E 5JEAF 4OO1F 2JEAB 4DV7E 3P06A 2BR2A 4NXME 4U3BA 3PS2A 1Z0EA 2NN6A 3PRYA 5DRPA 3WU5A 1Z5CA 4DV5I 4LF4E 5IT9Q 5GMEA 3U1YA 4JI2E 3K85A 2CZ9A 4JI6E 1Y6ZA 3LPSA 4DPYA 1OYRA 1Y4UA 5FLXC 1XMQE 2X36A 4GKKI 2UXDE 1XNQE 4MYUA 3D4JA 2UUAI 5DROA 4DR6E 2R3VA 2UUBE 4LF9I 1XNRE 1Z0VA 1Z0BA 4LF6E 1Z0CA 2HFUA 4JYAI 4DUZI 4JI8I 2V2VA 5IWAI 2F4VE 2O1WA 5JEAC 2BR2B 4MU4A 2VQFI 1ZM9A 2VQFE 1RREA 4LF7I 4KQVA 1N32I 4BA2B 3PS3A 3PYFA 4B3MI 5IT9C 1E3PA 1N34E 1WUUA 5K36B 4ED4A 4MQYA 4PRXA 4YY3I 3JAMC 4X62I 4LFCE 3L7ZB 3QT6A 4X64E 4QNKA 4R1FA 2NPFA 1IBME 1XNQI 3K17A 2O1UA 4AIDA 4DR4I 2PNZA 1J5EI 3PYGA 4FW3A 1XXEA 1FJGI 2Z5CB 1UEKA 3GCMA 2V2ZA 2JEBB 2BV3A 3B82A 4LFBI 4JI7E 2NN6F 4BA1A 2ZBKB 2C37B 4DXLA 1HNXE 3LNUA 4FW7A 1HNZI 1HNWI 4JI5E 5DNLA 5L3JA 4OO1A 4HY1A 1N33I 4DV2I 4DR5I 1KTVA 5GMDA 1IBMI 4AQYI 2F1DA 1Y4SA 2DEJA 1FNMA 4YY3E 4IFDA 5DRQA 4DV1I 4JV5E 1HNWE 1XMOI 4X66I 3B78A 2JE6B 4ISAA 2IERA 4IFDF 4JI3E 2PNLA 1USVA 3JAMQ 4JI4E 2NN6B 3P76A 4OZEA 1OYPA 2VESA 4MU0A 4BA1B 5DNXA 2DEIA 4DUZE 4B3RE 5K36A 1U2RA 3J7AG 2BA0G 1ZXNA 4HYMA 4DR5E 4NXNE 2UU9I 2JEAA 2BA0D 1N33E 5K36E 2IOQA 2PO2A 4UT4A 5JEAA 4JI5I 2HK2A 4NBQA
chains in the Genus database with same CATH topology
4B3TE 2GS8A 2A2DA 2UUAE 4X64I 4JI1I 4DV3E 2Z5EA 1DARA 2UXDI 2CGEA 4UTGA 2HKJA 1N34I 3WU3A 4FWHA 4DPUA 4DV1E 4JV5I 3QT7A 4KHPI 4USMA 4DR4E 2UUBI 4LF9E 1ZM3A 4DV3I 2ZM6I 1N0VC 1XHKA 4HACB 2UXBE 4LFCI 1N0UA 4IZJD 5FWKA 4X65I 4KHPE 1HNZE 1ZM2A 1H74A 4PRVA 4K0KE 4DPWA 4LFBE 4M1KA 4JI0E 2UUCE 1HK7A 1NHIA 5A2QC 1VISA 4JI1E 2E5LI 4JYAE 4DR2E 1I94I 4DR3E 3ZZUA 4RPFA 2Z5CA 1J5EE 3M6AA 4K0KI 4ZVIA 1RR9A 3ZKDA 4AQYE 3LTOA 4URLA 4DV7I 4DV6E 2O1VA 3V2UC 3T1YE 1XMQI 4GKKE 1H7SA 2E5LE 2WW4A 4LF8E 1IBKI 1XMOE 2BM1A 3PYEA 4HXZA 1HNXI 3J80Q 4B3SE 2V2QA 5FLXQ 4NXMI 1D6TA 1XNRI 1KIJA 2EFGA 2V34A 4Z7CA 2UU9E 1NZ0A 2E1RA 2ZM6E 4DR1I 3Q6NA 4JG4A 4USKA 4X62E 4DV2E 4PU9A 1USUA 3CWVA 4DPXA 1KKHA 1FKAE 4JI3I 1H7UA 2BM0A 1S16A 3OTOE 3F0NA 2CG9A 4DV6I 3GONA 4YHHE 4IZKA 1Z0WA 3PYDA 5LMUI 2IOPA 1PVGA 3ZM7A 2ZITA 4JI7I 1KVKA 3K1JA 4LF8I 5IWAE 4MYTA 1PKPA 1MU5A 1Z5AA 3ZZTA 2HK3A 3Q6MA 4P7AA 1IBLI 4P52A 4IZJA 2Z5BA 2OI2A 4LFAE 1ZXMA 4IZKB 2GQ0A 3HULA 4OX9I 4EMDA 1MX0A 3QT5A 1NHJA 2Q2EB 4DR3I 1N36E 4DR2I 4B3ME 4DV4E 5BR8E 4DR7I 4Z7YA 4DUYE 1BKNA 3J81Q 1Z59A 1Z0GA 4DV0I 2A2CA 4DR6I 4LFAI 1FWKA 1A6FA 1EI1A 1B62A 4FN5A 4B3TI 2VQEE 4YHHI 1IBLE 5LL6R 1FWLA 2UXBI 4WUCA 2LJPA 1I94E 1FI4A 1PIEA 4N3OA 5A2QQ 3J80C 3Q1QA 2UUCI 4DV5E 4LF4I 2HKEA 4FW9A 3T1HE 2AJ4A 5LMNE 2UXCI 1Z0TA 5BR8I 2XEXA 4DU7A 1Z5BA 4JI6I 4LF6I 4IZJB 2VF3A 2O1TA 4X65E 3ZZ0A 4GKJE 1H73A 2X7IA 4DPTA 4OX9E 2VQEI 4WUDA 3OTOI 4B3RI 4I3HA 1ELOA 3HJCA 1HR0I 3WU4A 3J81C 2HHHI 2HHHE 3V5RA 4LF5E 4B3SI 4DUYI 1QZRA 4LF7E 1N32E 1EA6A 1S4EA 3T1HI 4DV4I 4DR7E 4X66E 5LMUE 1N36I 1IBKE 4JI8E 4DR1E 1MG7A 2V8PA 3QT8A 4NXNI 2R42A 1B63A 2PNMA 3WU6A 4WUBA 4XTJA 1NHHA 2Z5BB 1ZM4A 2J7KA 5LMNI 2UXCE 4GKJI 4JI4I 4FWGA 1OJ4A 1K47A 3J7AM 2HFSA 1FJGE 4DU8A 4JI2I 1H72C 4JI0I 4LF5I 3ZKBA 1HR0E 3T1YI 3B8HA 2F4VI 4FWDA 3H4LA 4HACA 4DV0E 4DV7E 3P06A 4NXME 1Z0EA 3PRYA 3WU5A 1Z5CA 4DV5I 4LF4E 5IT9Q 5GMEA 4JI2E 3K85A 2CZ9A 4JI6E 1Y6ZA 3LPSA 4DPYA 1Y4UA 5FLXC 1XMQE 2X36A 4GKKI 2UXDE 1XNQE 4MYUA 3D4JA 2UUAI 4DR6E 2R3VA 2UUBE 4LF9I 1XNRE 1Z0VA 1Z0BA 4LF6E 1Z0CA 2HFUA 4JYAI 4DUZI 4JI8I 2V2VA 5IWAI 2F4VE 2O1WA 2VQFI 1ZM9A 2VQFE 1RREA 4LF7I 4KQVA 1N32I 3PYFA 4B3MI 5IT9C 1N34E 1WUUA 4ED4A 4PRXA 4YY3I 3JAMC 4X62I 4LFCE 3QT6A 4X64E 4R1FA 2NPFA 1IBME 1XNQI 3K17A 2O1UA 4DR4I 1J5EI 3PYGA 1FJGI 2Z5CB 1UEKA 2V2ZA 3B82A 2BV3A 4LFBI 4JI7E 2ZBKB 4DXLA 1HNXE 3LNUA 1HNZI 1HNWI 4JI5E 5L3JA 4HY1A 1N33I 4DV2I 4DR5I 1KTVA 5GMDA 1IBMI 4AQYI 1Y4SA 2DEJA 1FNMA 4YY3E 4DV1I 4JV5E 1HNWE 1XMOI 4X66I 3B78A 4JI3E 2PNLA 1USVA 3JAMQ 4JI4E 2DEIA 4DUZE 4B3RE 1U2RA 3J7AG 1ZXNA 4HYMA 4DR5E 4NXNE 2UU9I 1N33E 2IOQA 4UT4A 4JI5I 2HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T E;  2GS8 A;  2A2D A;  2UUA E;  4X64 I;  4JI1 I;  4DV3 E;  1DAR A;  2UXD I;  4UTG A;  2HKJ A;  1N34 I;  3WU3 A;  4FWH A;  4DPU A;  4DV1 E;  4JV5 I;  3QT7 A;  4KHP I;  4USM A;  4DR4 E;  2UUB I;  4LF9 E;  1ZM3 A;  4DV3 I;  2ZM6 I;  1N0V C;  1XHK A;  4HAC B;  2UXB E;  4LFC I;  1N0U A;  4X65 I;  4KHP E;  1HNZ E;  1ZM2 A;  1H74 A;  4PRV A;  4K0K E;  4DPW A;  4LFB E;  4M1K A;  4JI0 E;  2UUC E;  1NHI A;  5A2Q C;  1VIS A;  4JI1 E;  2E5L I;  4JYA E;  4DR2 E;  1I94 I;  4DR3 E;  3ZZU A;  4RPF A;  1J5E E;  3M6A A;  4K0K I;  4ZVI A;  1RR9 A;  3ZKD A;  4AQY E;  3LTO A;  4URL A;  4DV7 I;  4DV6 E;  3V2U C;  3T1Y E;  1XMQ I;  4GKK E;  1H7S A;  2E5L E;  2WW4 A;  4LF8 E;  1IBK I;  1XMO E;  2BM1 A;  3PYE A;  4HXZ A;  1HNX I;  3J80 Q;  4B3S E;  2V2Q A;  5FLX Q;  4NXM I;  1D6T A;  1XNR I;  1KIJ A;  2EFG A;  2V34 A;  4Z7C A;  2UU9 E;  1NZ0 A;  2E1R A;  2ZM6 E;  4DR1 I;  4JG4 A;  4USK A;  4X62 E;  4DV2 E;  4PU9 A;  3CWV A;  4DPX A;  1KKH A;  1FKA E;  4JI3 I;  1H7U A;  2BM0 A;  1S16 A;  3OTO E;  3F0N A;  4DV6 I;  3GON A;  4YHH E;  1Z0W A;  3PYD A;  5LMU I;  1PVG A;  3ZM7 A;  2ZIT A;  4JI7 I;  1KVK A;  3K1J A;  4LF8 I;  5IWA E;  4MYT A;  1PKP A;  1MU5 A;  1Z5A A;  3ZZT A;  2HK3 A;  4P7A A;  1IBL I;  4P52 A;  2OI2 A;  4LFA E;  1ZXM A;  4OX9 I;  3HUL A;  4EMD A;  1MX0 A;  3QT5 A;  1NHJ A;  2Q2E B;  4DR3 I;  1N36 E;  4DR2 I;  4B3M E;  4DV4 E;  5BR8 E;  4DR7 I;  4Z7Y A;  4DUY E;  1BKN A;  3J81 Q;  1Z59 A;  1Z0G A;  4DV0 I;  2A2C A;  4DR6 I;  4LFA I;  1FWK A;  1A6F A;  1EI1 A;  1B62 A;  4FN5 A;  4B3T I;  2VQE E;  4YHH I;  1IBL E;  5LL6 R;  1FWL A;  2UXB I;  4WUC A;  2LJP A;  1I94 E;  1FI4 A;  1PIE A;  5A2Q Q;  3J80 C;  3Q1Q A;  2UUC I;  4DV5 E;  4LF4 I;  2HKE A;  4FW9 A;  3T1H E;  2AJ4 A;  5LMN E;  2UXC I;  1Z0T A;  5BR8 I;  2XEX A;  4JI6 I;  1Z5B A;  4DU7 A;  4LF6 I;  2VF3 A;  4X65 E;  3ZZ0 A;  4GKJ E;  1H73 A;  2X7I A;  4DPT A;  4OX9 E;  2VQE I;  4WUD A;  3OTO I;  4B3R I;  4I3H A;  1ELO A;  1HR0 I;  3WU4 A;  3J81 C;  2HHH I;  2HHH E;  3V5R A;  4LF5 E;  4B3S I;  4DUY I;  1QZR A;  4LF7 E;  1N32 E;  1EA6 A;  1S4E A;  3T1H I;  4DV4 I;  4DR7 E;  4X66 E;  5LMU E;  1N36 I;  1IBK E;  4JI8 E;  4DR1 E;  1MG7 A;  2V8P A;  3QT8 A;  4NXN I;  2R42 A;  1B63 A;  3WU6 A;  4WUB A;  4XTJ A;  1NHH A;  1ZM4 A;  2J7K A;  5LMN I;  2UXC E;  4GKJ I;  4JI4 I;  4FWG A;  1OJ4 A;  1K47 A;  3J7A M;  2HFS A;  1FJG E;  4DU8 A;  4JI2 I;  1H72 C;  4JI0 I;  4LF5 I;  3ZKB A;  1HR0 E;  3T1Y I;  3B8H A;  2F4V I;  4FWD A;  3H4L A;  4HAC A;  4DV0 E;  4DV7 E;  4NXM E;  1Z0E A;  3WU5 A;  1Z5C A;  4DV5 I;  4LF4 E;  5IT9 Q;  5GME A;  4JI2 E;  2CZ9 A;  4JI6 E;  3LPS A;  4DPY A;  5FLX C;  1XMQ E;  2X36 A;  4GKK I;  2UXD E;  1XNQ E;  4MYU A;  3D4J A;  2UUA I;  4DR6 E;  2R3V A;  2UUB E;  4LF9 I;  1XNR E;  1Z0V A;  1Z0B A;  4LF6 E;  1Z0C A;  2HFU A;  4JYA I;  4DUZ I;  4JI8 I;  2V2V A;  5IWA I;  2F4V E;  2VQF I;  1ZM9 A;  2VQF E;  1RRE A;  4LF7 I;  4KQV A;  1N32 I;  3PYF A;  4B3M I;  5IT9 C;  1N34 E;  1WUU A;  4ED4 A;  4PRX A;  4YY3 I;  3JAM C;  4X62 I;  4LFC E;  3QT6 A;  4X64 E;  4R1F A;  2NPF A;  1IBM E;  1XNQ I;  3K17 A;  4DR4 I;  1J5E I;  3PYG A;  1FJG I;  1UEK A;  2V2Z A;  3B82 A;  2BV3 A;  4LFB I;  4JI7 E;  2ZBK B;  4DXL A;  1HNX E;  3LNU A;  1HNZ I;  1HNW I;  4JI5 E;  5L3J A;  4HY1 A;  1N33 I;  4DV2 I;  4DR5 I;  1KTV A;  5GMD A;  1IBM I;  4AQY I;  2DEJ A;  1FNM A;  4YY3 E;  4DV1 I;  4JV5 E;  1HNW E;  1XMO I;  4X66 I;  3B78 A;  4JI3 E;  4JI4 E;  3JAM Q;  2DEI A;  4DUZ E;  4B3R E;  1U2R A;  3J7A G;  1ZXN A;  4HYM A;  4DR5 E;  4NXN E;  2UU9 I;  1N33 E;  4UT4 A;  4JI5 I;  2HK2 A; 
#chains in the Genus database with same CATH topology
 4B3T E;  2IES A;  4J3D A;  2GS8 A;  2A2D A;  2JT2 A;  2UUA E;  4X64 I;  4JI1 I;  4DV3 E;  2Z5E A;  2PNZ B;  1DAR A;  2UXD I;  2J65 A;  2CGE A;  4UTG A;  2HKJ A;  3H1C A;  3WU3 A;  4FWH A;  4DPU A;  1N34 I;  4AM3 A;  3PS1 A;  4DV1 E;  4JV5 I;  3UHM A;  4OO1 C;  3QT7 A;  3P3E A;  4MDT A;  4KHP I;  4USM A;  4DR4 E;  2UUB I;  4LF9 E;  1ZM3 A;  4DV3 I;  2ZM6 I;  5JEA B;  1N0V C;  1XHK A;  4HAC B;  2UXB E;  4LFC I;  2BA1 D;  1N0U A;  5EL9 A;  4IZJ D;  4OO1 E;  5ELW A;  5FWK A;  4X65 I;  4KHP E;  1HNZ E;  1ZM2 A;  1YHC A;  3CDJ A;  1H74 A;  4PRV A;  5C0X B;  4K0K E;  2WP8 A;  4DPW A;  4LFB E;  4M1K A;  4JI0 E;  5JEA D;  2UUC E;  1HK7 A;  1NHI A;  5A2Q C;  4OKG A;  1VIS A;  4JI1 E;  2C39 B;  2E5L I;  4JYA E;  4DR2 E;  1I94 I;  4DR3 E;  3ZZU A;  4RPF A;  2Z5C A;  1J5E E;  2GO3 A;  4LCG A;  3M6A A;  4K0K I;  4ZVI A;  1RR9 A;  3ZKD A;  4AQY E;  3LTO A;  4URL A;  4DV7 I;  1RHY A;  4DV6 E;  2O1V A;  4IFD D;  3V2U C;  4QNJ A;  3T1Y E;  1XMQ I;  4GKK E;  4FW4 A;  4OO1 B;  1H7S A;  2E5L E;  2WW4 A;  5JEA E;  4LF8 E;  1IBK I;  1XMO E;  2BM1 A;  3PYE A;  4HXZ A;  1HNX I;  3J80 Q;  2PO1 A;  4BA2 A;  4B3S E;  2V2Q A;  5FLX Q;  4NXM I;  1D6T A;  1XNR I;  1KIJ A;  2EFG A;  2V34 A;  4Z7C A;  2UU9 E;  1NZ0 A;  2E1R A;  2ZM6 E;  4DR1 I;  4IS9 A;  3DD6 A;  3Q6N A;  2NN6 C;  4JG4 A;  4USK A;  4X62 E;  4DV2 E;  4PU9 A;  1USU A;  3CWV A;  4GQU A;  4DPX A;  1KKH A;  1FKA E;  2NN6 E;  4JI3 I;  1H7U A;  2BM0 A;  1S16 A;  3NZK A;  3OTO E;  3F0N A;  2CG9 A;  4DV6 I;  3GON A;  4YHH E;  1UDN A;  1Z0W A;  4IZK A;  5DRR A;  3PYD A;  5LMU I;  4LPF A;  4IFD E;  2C38 A;  1E3H A;  1Y60 A;  2IOP A;  1PVG A;  3ZM7 A;  2ZIT A;  4JI7 I;  3M85 D;  1KVK A;  3K1J A;  4LF8 I;  5IWA E;  4MYT A;  1PKP A;  1MU5 A;  1Z5A A;  3ZZT A;  1OYS A;  4IFD B;  2HK3 A;  4OO1 D;  3Q6M A;  4P7A A;  1IBL I;  4P52 A;  3P3G A;  4FW6 A;  4IZJ A;  2Z5B A;  2OI2 A;  2C39 A;  2BA1 G;  4LFA E;  4U3D A;  1ZXM A;  4IZK B;  2GQ0 A;  3HUL A;  4OX9 I;  2GO4 A;  5K36 F;  1UDO A;  5C0X A;  4EMD A;  1MX0 A;  3QT5 A;  1NHJ A;  2CVE A;  2Q2E B;  4DR3 I;  1N36 E;  4DR2 I;  4B3M E;  4DV4 E;  5BR8 E;  5C0X E;  4DR7 I;  3HKM A;  1VI7 A;  4Z7Y A;  4DUY E;  1BKN A;  2JE6 A;  2JEB A;  3J81 Q;  4LCH A;  5K36 C;  1Z59 A;  1Z0G A;  4DV0 I;  2A2C A;  4DR6 I;  4LFA I;  1FWK A;  2WNR A;  1A6F A;  1EI1 A;  1B62 A;  4FN5 A;  4B3T I;  2PO0 A;  4LOM A;  2VQE E;  4YHH I;  4MU3 A;  1IBL E;  1YH8 A;  5LL6 R;  1FWL A;  2UXB I;  4WUC A;  4IFD C;  2LJP A;  1I94 E;  1FI4 A;  1PIE A;  2C38 B;  4N3O A;  1P42 A;  3GME A;  5A2Q Q;  3P3C A;  3J80 C;  3Q1Q A;  2UUC I;  4DV5 E;  4LF4 I;  2HKE A;  4FW9 A;  3T1H E;  2AJ4 A;  5LMN E;  2UXC I;  3U1K A;  1Z0T A;  5BR8 I;  2XEX A;  4DU7 A;  1Z5B A;  4JI6 I;  4LF6 I;  4IZJ B;  2WP8 B;  2VF3 A;  2O1T A;  4X65 E;  3ZZ0 A;  5C0X F;  4GKJ E;  1H73 A;  2X7I A;  4DPT A;  4OX9 E;  2VQE I;  2O3Z A;  4WUD A;  3OTO I;  4B3R I;  4I3H A;  3L7Z A;  2PO0 B;  1ELO A;  3HJC A;  1HR0 I;  2NN6 D;  3WU4 A;  5C0X C;  3J81 C;  2HHH I;  2HHH E;  2PO1 B;  3V5R A;  4LF5 E;  4B3S I;  4DUY I;  1QZR A;  4LF7 E;  1N32 E;  1EA6 A;  1S4E A;  3T1H I;  4DV4 I;  4DR7 E;  4X66 E;  5LMU E;  1N36 I;  1IBK E;  4JI8 E;  4DR1 E;  1MG7 A;  2V8P A;  2C37 A;  3QT8 A;  4NXN I;  2R42 A;  2WNR B;  1B63 A;  2PO2 B;  4FW5 A;  2PNM A;  3WU6 A;  4WUB A;  1R6M A;  4XTJ A;  1NHH A;  5K36 D;  2Z5B B;  1ZM4 A;  2J7K A;  4AIM A;  1Y5Y A;  3GLL A;  5LMN I;  2AE8 A;  3KRN A;  2UXC E;  4GKJ I;  4JI4 I;  4FWG A;  1OJ4 A;  1K47 A;  3M85 G;  4MU1 A;  4LCF A;  3J7A M;  2HFS A;  1FJG E;  5EKW A;  4DU8 A;  4JI2 I;  1H72 C;  4JI0 I;  4LF5 I;  3B4T A;  3ZKB A;  1HR0 E;  3T1Y I;  3B8H A;  2F4V I;  3M7N D;  1R6L A;  4FWD A;  1UDS A;  5C0X D;  3CDI A;  3M7N G;  1UDQ A;  3H4L A;  4HAC A;  4DV0 E;  5JEA F;  4OO1 F;  2JEA B;  4DV7 E;  3P06 A;  2BR2 A;  4NXM E;  4U3B A;  3PS2 A;  1Z0E A;  2NN6 A;  3PRY A;  5DRP A;  3WU5 A;  1Z5C A;  4DV5 I;  4LF4 E;  5IT9 Q;  5GME A;  3U1Y A;  4JI2 E;  3K85 A;  2CZ9 A;  4JI6 E;  1Y6Z A;  3LPS A;  4DPY A;  1OYR A;  1Y4U A;  5FLX C;  1XMQ E;  2X36 A;  4GKK I;  2UXD E;  1XNQ E;  4MYU A;  3D4J A;  2UUA I;  5DRO A;  4DR6 E;  2R3V A;  2UUB E;  4LF9 I;  1XNR E;  1Z0V A;  1Z0B A;  4LF6 E;  1Z0C A;  2HFU A;  4JYA I;  4DUZ I;  4JI8 I;  2V2V A;  5IWA I;  2F4V E;  2O1W A;  5JEA C;  2BR2 B;  4MU4 A;  2VQF I;  1ZM9 A;  2VQF E;  1RRE A;  4LF7 I;  4KQV A;  1N32 I;  4BA2 B;  3PS3 A;  3PYF A;  4B3M I;  5IT9 C;  1E3P A;  1N34 E;  1WUU A;  5K36 B;  4ED4 A;  4MQY A;  4PRX A;  4YY3 I;  3JAM C;  4X62 I;  4LFC E;  3L7Z B;  3QT6 A;  4X64 E;  4QNK A;  4R1F A;  2NPF A;  1IBM E;  1XNQ I;  3K17 A;  2O1U A;  4AID A;  4DR4 I;  2PNZ A;  1J5E I;  3PYG A;  4FW3 A;  1XXE A;  1FJG I;  2Z5C B;  1UEK A;  3GCM A;  2V2Z A;  2JEB B;  2BV3 A;  3B82 A;  4LFB I;  4JI7 E;  2NN6 F;  4BA1 A;  2ZBK B;  2C37 B;  4DXL A;  1HNX E;  3LNU A;  4FW7 A;  1HNZ I;  1HNW I;  4JI5 E;  5DNL A;  5L3J A;  4OO1 A;  4HY1 A;  1N33 I;  4DV2 I;  4DR5 I;  1KTV A;  5GMD A;  1IBM I;  4AQY I;  2F1D A;  1Y4S A;  2DEJ A;  1FNM A;  4YY3 E;  4IFD A;  5DRQ A;  4DV1 I;  4JV5 E;  1HNW E;  1XMO I;  4X66 I;  3B78 A;  2JE6 B;  4ISA A;  2IER A;  4IFD F;  4JI3 E;  2PNL A;  1USV A;  3JAM Q;  4JI4 E;  2NN6 B;  3P76 A;  4OZE A;  1OYP A;  2VES A;  4MU0 A;  4BA1 B;  5DNX A;  2DEI A;  4DUZ E;  4B3R E;  5K36 A;  1U2R A;  3J7A G;  2BA0 G;  1ZXN A;  4HYM A;  4DR5 E;  4NXN E;  2UU9 I;  2JEA A;  2BA0 D;  1N33 E;  5K36 E;  2IOQ A;  2PO2 A;  4UT4 A;  5JEA A;  4JI5 I;  2HK2 A;  4NBQ A; 
#chains in the Genus database with same CATH homology
 4B3T E;  2GS8 A;  2A2D A;  2UUA E;  4X64 I;  4JI1 I;  4DV3 E;  2Z5E A;  1DAR A;  2UXD I;  2CGE A;  4UTG A;  2HKJ A;  1N34 I;  3WU3 A;  4FWH A;  4DPU A;  4DV1 E;  4JV5 I;  3QT7 A;  4KHP I;  4USM A;  4DR4 E;  2UUB I;  4LF9 E;  1ZM3 A;  4DV3 I;  2ZM6 I;  1N0V C;  1XHK A;  4HAC B;  2UXB E;  4LFC I;  1N0U A;  4IZJ D;  5FWK A;  4X65 I;  4KHP E;  1HNZ E;  1ZM2 A;  1H74 A;  4PRV A;  4K0K E;  4DPW A;  4LFB E;  4M1K A;  4JI0 E;  2UUC E;  1HK7 A;  1NHI A;  5A2Q C;  1VIS A;  4JI1 E;  2E5L I;  4JYA E;  4DR2 E;  1I94 I;  4DR3 E;  3ZZU A;  4RPF A;  2Z5C A;  1J5E E;  3M6A A;  4K0K I;  4ZVI A;  1RR9 A;  3ZKD A;  4AQY E;  3LTO A;  4URL A;  4DV7 I;  4DV6 E;  2O1V A;  3V2U C;  3T1Y E;  1XMQ I;  4GKK E;  1H7S A;  2E5L E;  2WW4 A;  4LF8 E;  1IBK I;  1XMO E;  2BM1 A;  3PYE A;  4HXZ A;  1HNX I;  3J80 Q;  4B3S E;  2V2Q A;  5FLX Q;  4NXM I;  1D6T A;  1XNR I;  1KIJ A;  2EFG A;  2V34 A;  4Z7C A;  2UU9 E;  1NZ0 A;  2E1R A;  2ZM6 E;  4DR1 I;  3Q6N A;  4JG4 A;  4USK A;  4X62 E;  4DV2 E;  4PU9 A;  1USU A;  3CWV A;  4DPX A;  1KKH A;  1FKA E;  4JI3 I;  1H7U A;  2BM0 A;  1S16 A;  3OTO E;  3F0N A;  2CG9 A;  4DV6 I;  3GON A;  4YHH E;  4IZK A;  1Z0W A;  3PYD A;  5LMU I;  2IOP A;  1PVG A;  3ZM7 A;  2ZIT A;  4JI7 I;  1KVK A;  3K1J A;  4LF8 I;  5IWA E;  4MYT A;  1PKP A;  1MU5 A;  1Z5A A;  3ZZT A;  2HK3 A;  3Q6M A;  4P7A A;  1IBL I;  4P52 A;  4IZJ A;  2Z5B A;  2OI2 A;  4LFA E;  1ZXM A;  4IZK B;  2GQ0 A;  3HUL A;  4OX9 I;  4EMD A;  1MX0 A;  3QT5 A;  1NHJ A;  2Q2E B;  4DR3 I;  1N36 E;  4DR2 I;  4B3M E;  4DV4 E;  5BR8 E;  4DR7 I;  4Z7Y A;  4DUY E;  1BKN A;  3J81 Q;  1Z59 A;  1Z0G A;  4DV0 I;  2A2C A;  4DR6 I;  4LFA I;  1FWK A;  1A6F A;  1EI1 A;  1B62 A;  4FN5 A;  4B3T I;  2VQE E;  4YHH I;  1IBL E;  5LL6 R;  1FWL A;  2UXB I;  4WUC A;  2LJP A;  1I94 E;  1FI4 A;  1PIE A;  4N3O A;  5A2Q Q;  3J80 C;  3Q1Q A;  2UUC I;  4DV5 E;  4LF4 I;  2HKE A;  4FW9 A;  3T1H E;  2AJ4 A;  5LMN E;  2UXC I;  1Z0T A;  5BR8 I;  2XEX A;  4DU7 A;  1Z5B A;  4JI6 I;  4LF6 I;  4IZJ B;  2VF3 A;  2O1T A;  4X65 E;  3ZZ0 A;  4GKJ E;  1H73 A;  2X7I A;  4DPT A;  4OX9 E;  2VQE I;  4WUD A;  3OTO I;  4B3R I;  4I3H A;  1ELO A;  3HJC A;  1HR0 I;  3WU4 A;  3J81 C;  2HHH I;  2HHH E;  3V5R A;  4LF5 E;  4B3S I;  4DUY I;  1QZR A;  4LF7 E;  1N32 E;  1EA6 A;  1S4E A;  3T1H I;  4DV4 I;  4DR7 E;  4X66 E;  5LMU E;  1N36 I;  1IBK E;  4JI8 E;  4DR1 E;  1MG7 A;  2V8P A;  3QT8 A;  4NXN I;  2R42 A;  1B63 A;  2PNM A;  3WU6 A;  4WUB A;  4XTJ A;  1NHH A;  2Z5B B;  1ZM4 A;  2J7K A;  5LMN I;  2UXC E;  4GKJ I;  4JI4 I;  4FWG A;  1OJ4 A;  1K47 A;  3J7A M;  2HFS A;  1FJG E;  4DU8 A;  4JI2 I;  1H72 C;  4JI0 I;  4LF5 I;  3ZKB A;  1HR0 E;  3T1Y I;  3B8H A;  2F4V I;  4FWD A;  3H4L A;  4HAC A;  4DV0 E;  4DV7 E;  3P06 A;  4NXM E;  1Z0E A;  3PRY A;  3WU5 A;  1Z5C A;  4DV5 I;  4LF4 E;  5IT9 Q;  5GME A;  4JI2 E;  3K85 A;  2CZ9 A;  4JI6 E;  1Y6Z A;  3LPS A;  4DPY A;  1Y4U A;  5FLX C;  1XMQ E;  2X36 A;  4GKK I;  2UXD E;  1XNQ E;  4MYU A;  3D4J A;  2UUA I;  4DR6 E;  2R3V A;  2UUB E;  4LF9 I;  1XNR E;  1Z0V A;  1Z0B A;  4LF6 E;  1Z0C A;  2HFU A;  4JYA I;  4DUZ I;  4JI8 I;  2V2V A;  5IWA I;  2F4V E;  2O1W A;  2VQF I;  1ZM9 A;  2VQF E;  1RRE A;  4LF7 I;  4KQV A;  1N32 I;  3PYF A;  4B3M I;  5IT9 C;  1N34 E;  1WUU A;  4ED4 A;  4PRX A;  4YY3 I;  3JAM C;  4X62 I;  4LFC E;  3QT6 A;  4X64 E;  4R1F A;  2NPF A;  1IBM E;  1XNQ I;  3K17 A;  2O1U A;  4DR4 I;  1J5E I;  3PYG A;  1FJG I;  2Z5C B;  1UEK A;  2V2Z A;  3B82 A;  2BV3 A;  4LFB I;  4JI7 E;  2ZBK B;  4DXL A;  1HNX E;  3LNU A;  1HNZ I;  1HNW I;  4JI5 E;  5L3J A;  4HY1 A;  1N33 I;  4DV2 I;  4DR5 I;  1KTV A;  5GMD A;  1IBM I;  4AQY I;  1Y4S A;  2DEJ A;  1FNM A;  4YY3 E;  4DV1 I;  4JV5 E;  1HNW E;  1XMO I;  4X66 I;  3B78 A;  4JI3 E;  2PNL A;  1USV A;  3JAM Q;  4JI4 E;  2DEI A;  4DUZ E;  4B3R E;  1U2R A;  3J7A G;  1ZXN A;  4HYM A;  4DR5 E;  4NXN E;  2UU9 I;  1N33 E;  2IOQ A;  4UT4 A;  4JI5 I;  2HK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...