2ZM6I

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
125
structure length
125
Chain Sequence
YYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
total genus 20
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2zm6I00
4X64E 2UUCE 4KHPE 1S16A 1XMOE 4DUYI 5GMEA 2E5LE 1IBLI 4DV3E 4DR3E 4JI0I 5IWAI 1XNRI 1N0VC 2F4VI 1FJGI 1RREA 4LF7E 4PU9A 4DR1I 3PYEA 1BKNA 5LMUI 5BR8I 1PVGA 5A2QQ 2HHHE 4DR7E 4X65I 1HNXI 1NHJA 3GONA 4HYMA 4HY1A 4YY3E 5LMNI 4JI7E 3J80Q 3ZM7A 2V2QA 4OX9I 4DR4I 4JI4I 3QT6A 1ZXNA 4DR5I 4URLA 1IBKE 2J7KA 2R42A 4B3TI 4LFCI 4DV7I 3OTOE 1Z0WA 1HNZI 1I94E 2UXBI 4DV4I 1PKPA 5LL6R 4DUYE 2DEJA 2V34A 2A2CA 1IBLE 4RPFA 1VISA 3H4LA 3J81Q 2UUBI 4DV6I 3PYGA 2HFSA 4LF4I 3PYFA 1XHKA 1OJ4A 1Z0TA 4DR1E 1KIJA 1K47A 4DU8A 5LMUE 4X66I 1N34I 5GMDA 4DPWA 2UXDI 3WU3A 4JI6I 3B8HA 2A2DA 5IT9Q 4YHHI 1N33I 5LMNE 4UTGA 2AJ4A 4DV0E 4XTJA 4FWGA 3ZZUA 4DV7E 4LF5I 1WUUA 1N36E 4JI8I 2EFGA 2VQFI 4DPTA 3D4JA 1HNZE 4GKKI 4FN5A 2V2VA 3ZKDA 4JI3I 4JYAI 2UXBE 4DV4E 4DR2I 4HACB 1ZM4A 1Z59A 3Q1QA 1Z0EA 1B63A 4LF9I 4DV5I 2UUBE 1XNQI 2DEIA 1H72C 1Z5CA 4DV6E 4LF4E 1NHHA 1Z5BA 4NXNI 1HR0E 1PIEA 4DR6I 4I3HA 4X66E 5FLXQ 3LPSA 3V2UC 2ZM6I 3J7AM 4JI2I 2CZ9A 1MU5A 4GKJI 1IBMI 1MG7A 2BV3A 4JI1I 1KVKA 1NZ0A 2BM0A 3WU5A 1N33E 3JAMC 4DU7A 4Z7CA 1H7UA 1D6TA 1A6FA 2HK3A 4WUDA 4DPXA 2UUAE 3J7AG 4LF8I 2HK2A 1XMQE 4LF5E 4JI8E 3LTOA 2HFUA 1ELOA 4USKA 4JI3E 4DXLA 2UXCI 4DR2E 3QT7A 4PRXA 1H74A 4DV5E 5IWAE 4JI0E 3V5RA 1XNQE 1XNRE 4B3RI 2F4VE 1FJGE 3B82A 4DV1I 2UU9I 1FWLA 4LF6I 3QT8A 4B3MI 4X64I 2BM1A 4WUBA 5BR8E 4ED4A 2E5LI 4JG4A 4HXZA 4JI2E 4X65E 4DR3I 4GKJE 1IBME 1HNXE 4JI1E 1ZM9A 3WU4A 2X7IA 4DR4E 4OX9E 2R3VA 4JI4E 4B3SI 4DR5E 2VF3A 3T1HI 4LF8E 3F0NA 2OI2A 4M1KA 2HHHI 4B3TE 4LFCE 4LFBI 1H73A 4JI7I 1FKAE 4DUZI 3T1YI 3QT5A 4JV5I 1IBKI 3M6AA 3K17A 3ZZTA 3B78A 2Q2EB 4FWDA 4DV2I 4P7AA 4B3RE 3HULA 2UU9E 1I94I 4LF6E 4K0KI 4B3ME 5A2QC 2V2ZA 1FNMA 1N34E 1ZM3A 3PYDA 2UXDE 1FI4A 3J80C 4JI6E 4ZVIA 1RR9A 1N32I 4HACA 4KQVA 4YHHE 4R1FA 2WW4A 4B3SE 3T1HE 4JI5I 2NPFA 1Z0VA 1ZM2A 3ZKBA 4EMDA 4LFBE 4AQYI 2X36A 2VQFE 1Z0GA 2GS8A 2ZITA 1HNWI 1Z0CA 4GKKE 4WUCA 4JYAE 4DUZE 3T1YE 2E1RA 3J81C 4JV5E 4FW9A 4DV0I 5L3JA 4DV2E 4UT4A 3JAMQ 1KKHA 2XEXA 4LF9E 1J5EI 4LFAI 4NXMI 1N36I 4Z7YA 1Z0BA 1H7SA 4MYUA 1MX0A 4USMA 4X62I 4K0KE 3WU6A 2V8PA 4NXNE 4MYTA 2VQEI 2UUCI 2LJPA 4KHPI 3ZZ0A 4DR6E 1Z5AA 1XMOI 2ZM6E 5IT9C 4DV3I 1N32E 4LF7I 1HR0I 1FWKA 1N0UA 1QZRA 1EI1A 4JI5E 1EA6A 3K1JA 2HKJA 4DR7I 1U2RA 1ZXMA 4FWHA 4AQYE 1KTVA 3CWVA 1S4EA 1NHIA 1HNWE 4P52A 4YY3I 1B62A 4PRVA 2HKEA 1DARA 2UXCE 2ZBKB 2UUAI 4DPUA 1XMQI 1J5EE 4LFAE 4NXME 3LNUA 3OTOI 5FLXC 4DV1E 4DPYA 1UEKA 4X62E 2VQEE
chains in the Genus database with same CATH superfamily
4X64E 2UUCE 4KHPE 1S16A 3PS2A 5DNLA 1XMOE 4DUYI 3CDJA 5GMEA 2PO1A 2E5LE 1IBLI 4DV3E 4U3BA 1YHCA 4DR3E 4JI0I 5IWAI 1XNRI 1N0VC 2F4VI 1USUA 1RREA 1FJGI 4LF7E 4LPFA 4OO1F 4BA2A 4OKGA 4PU9A 2JEBB 2O1VA 4DR1I 2PO0B 3PYEA 1BKNA 4OO1A 5LMUI 5BR8I 1PVGA 5A2QQ 2HHHE 4DR7E 4X65I 1HNXI 1NHJA 3GONA 4HYMA 4HY1A 3PRYA 4YY3E 4OO1D 3P3EA 5LMNI 4JI7E 2C37A 3J80Q 3ZM7A 2V2QA 4OX9I 4DR4I 4IS9A 5DRPA 4JI4I 3QT6A 1ZXNA 4DR5I 4URLA 1IBKE 2J7KA 2F1DA 2R42A 3HKMA 4B3TI 4LFCI 2JEBA 4DV7I 5K36B 2WNRB 2PO0A 3OTOE 1Z0WA 1VI7A 1UDQA 1HNZI 1I94E 4OO1C 2UXBI 2C38A 4DV4I 1PKPA 5LL6R 1YH8A 2C39B 4DUYE 2DEJA 1HK7A 2V34A 2A2CA 1IBLE 4RPFA 1VISA 5ELWA 3H4LA 3J81Q 2BR2A 2UUBI 4DV6I 3PYGA 2HFSA 4OZEA 4LF4I 2PO2B 1R6LA 5K36F 1Y60A 3PYFA 1XHKA 1OJ4A 1Z0TA 4DR1E 3M7ND 1KIJA 1K47A 4DU8A 4MU1A 1UDOA 4X66I 5LMUE 1N34I 2WNRA 5K36A 5GMDA 4DPWA 2UXDI 4IZKB 2WP8B 3DD6A 3WU3A 4JI6I 3GLLA 3B8HA 1XXEA 2A2DA 5IT9Q 4YHHI 1N33I 5LMNE 5K36D 1P42A 4UTGA 3P3CA 3NZKA 1E3HA 2GO3A 2CG9A 3PS3A 1Y4UA 3M85D 2JT2A 2AJ4A 4DV0E 4XTJA 1UDNA 4FWGA 2AE8A 5DRRA 2PO2A 2CGEA 3ZZUA 4DV7E 5C0XB 4LF5I 1WUUA 1N36E 4JI8I 2EFGA 2VQFI 4QNJA 4DPTA 3D4JA 2O3ZA 3KRNA 1HNZE 4IZKA 3U1KA 4FN5A 4GKKI 2WP8A 4FW4A 2V2VA 3ZKDA 4JI3I 4JYAI 2UXBE 5K36C 4DV4E 4DR2I 4HACB 1ZM4A 1Z59A 3Q1QA 1Z0EA 2BA1D 1B63A 2GQ0A 1Y6ZA 4LF9I 5EL9A 4DV5I 2UUBE 1XNQI 2DEIA 1H72C 1Z5CA 2BA0G 4FW5A 4DV6E 3U1YA 4LF4E 1NHHA 1RHYA 5C0XF 1Z5BA 4NXNI 1HR0E 1UDSA 2JE6B 1PIEA 4DR6I 3P06A 4I3HA 4X66E 5C0XA 5FLXQ 3LPSA 3V2UC 2ZM6I 5K36E 3J7AM 4JI2I 2CZ9A 1MU5A 4GKJI 1IBMI 1MG7A 2BV3A 4JI1I 1KVKA 1NZ0A 2BM0A 3WU5A 1N33E 5C0XD 1OYRA 3JAMC 4DU7A 4Z7CA 1H7UA 1D6TA 1A6FA 2HK3A 4ISAA 4WUDA 4DPXA 2UUAE 3J7AG 4LF8I 2HK2A 2O1TA 1XMQE 4LF5E 5JEAB 4JI8E 3LTOA 2GO4A 2HFUA 2PNZB 2NN6B 1ELOA 4USKA 4IFDB 4JI3E 5C0XC 4DXLA 2UXCI 3Q6MA 3P3GA 3UHMA 4DR2E 3QT7A 3H1CA 1OYPA 5DRQA 4PRXA 1H74A 4DV5E 5IWAE 4JI0E 3V5RA 1XNQE 4AIDA 1XNRE 4B3RI 2F4VE 1FJGE 3B82A 4DV1I 2UU9I 1FWLA 4LF6I 3QT8A 4B3MI 5JEAF 4IZJB 4X64I 2BM1A 2NN6F 4WUBA 4IFDF 1E3PA 5BR8E 4ED4A 5C0XE 2E5LI 4JG4A 2PNZA 4HXZA 4JI2E 2NN6A 4IFDA 4X65E 4DR3I 4GKJE 1IBME 3K85A 4BA1B 1HNXE 4JI1E 1ZM9A 2C39A 2CVEA 3WU4A 2X7IA 1OYSA 4DR4E 4OX9E 2R3VA 4JI4E 4B3SI 4DR5E 2NN6D 2VF3A 3T1HI 5EKWA 4LF8E 3F0NA 3PS1A 2OI2A 4M1KA 5FWKA 2HHHI 4B3TE 4LFCE 4IZJA 4LFBI 1H73A 4FW3A 4JI7I 1FKAE 4DUZI 3T1YI 4MDTA 5JEAC 3QT5A 4JV5I 4BA1A 1IBKI 3M6AA 3K17A 3ZZTA 2NN6C 3B78A 2IERA 2Q2EB 4IZJD 4IFDC 4FWDA 4DV2I 4LCHA 4OO1B 4P7AA 4B3RE 3HULA 2UU9E 1I94I 4LF6E 4K0KI 5DROA 4B3ME 5A2QC 2V2ZA 1FNMA 2O1UA 1N34E 1ZM3A 3PYDA 3B4TA 1USVA 2UXDE 2JEAB 1FI4A 1Y5YA 2C37B 4FW7A 5JEAE 2IESA 3J80C 4JI6E 4ZVIA 1RR9A 2NN6E 1N32I 4IFDE 4HACA 4KQVA 4YHHE 3CDIA 4R1FA 2WW4A 4U3DA 4AIMA 4B3SE 3M7NG 5DNXA 3T1HE 4JI5I 2NPFA 1Z0VA 2VESA 2C38B 1ZM2A 4FW6A 3ZKBA 2JE6A 4EMDA 4LFBE 4AQYI 2X36A 2IOQA 2VQFE 1Z0GA 2GS8A 2ZITA 4MU0A 1HNWI 1Z0CA 4GKKE 2JEAA 4WUCA 1Y4SA 4JYAE 4DUZE 3T1YE 2BR2B 2E1RA 3J81C 4JV5E 4FW9A 4DV0I 1R6MA 4LOMA 5L3JA 4DV2E 4UT4A 3JAMQ 1KKHA 4LCGA 2XEXA 3M85G 4LF9E 1J5EI 4LFAI 2BA0D 4NXMI 1N36I 4Z7YA 1Z0BA 4MU3A 4QNKA 1H7SA 2Z5BB 4MYUA 3Q6NA 1MX0A 4USMA 4X62I 4K0KE 3WU6A 2V8PA 2Z5EA 3HJCA 4MYTA 2VQEI 4NXNE 3GCMA 2UUCI 2LJPA 4KHPI 3ZZ0A 4DR6E 4LCFA 1Z5AA 1XMOI 5JEAA 3L7ZB 2ZM6E 5IT9C 4GQUA 4DV3I 2BA1G 1N32E 4LF7I 4NBQA 4MU4A 2PNMA 2IOPA 1HR0I 5JEAD 3P76A 4AM3A 1FWKA 2Z5CB 1N0UA 1QZRA 1EI1A 3GMEA 4IFDD 4OO1E 4JI5E 1EA6A 2Z5BA 2PNLA 3K1JA 2HKJA 4DR7I 1U2RA 2O1WA 1ZXMA 4FWHA 4AQYE 1KTVA 3CWVA 2PO1B 1S4EA 1NHIA 3L7ZA 1HNWE 4P52A 4YY3I 1B62A 4PRVA 2HKEA 1DARA 2UXCE 4MQYA 2ZBKB 2UUAI 4BA2B 4DPUA 1XMQI 2J65A 1J5EE 4LFAE 4NXME 3LNUA 3OTOI 5FLXC 4DV1E 2Z5CA 4DPYA 1UEKA 4J3DA 4X62E 2VQEE 4N3OA
chains in the Genus database with same CATH topology
4X64E 2UUCE 4KHPE 1S16A 1XMOE 4DUYI 5GMEA 2E5LE 1IBLI 4DV3E 4DR3E 4JI0I 5IWAI 1XNRI 1N0VC 2F4VI 1USUA 1RREA 1FJGI 4LF7E 4PU9A 2O1VA 4DR1I 3PYEA 1BKNA 5LMUI 5BR8I 1PVGA 5A2QQ 2HHHE 4DR7E 4X65I 1HNXI 1NHJA 3GONA 4HYMA 4HY1A 3PRYA 4YY3E 5LMNI 4JI7E 3J80Q 3ZM7A 2V2QA 4OX9I 4DR4I 4JI4I 3QT6A 1ZXNA 4DR5I 4URLA 1IBKE 2J7KA 2R42A 4B3TI 4LFCI 4DV7I 3OTOE 1Z0WA 1HNZI 1I94E 2UXBI 4DV4I 1PKPA 5LL6R 4DUYE 2DEJA 1HK7A 2V34A 2A2CA 1IBLE 4RPFA 1VISA 3H4LA 3J81Q 2UUBI 4DV6I 3PYGA 2HFSA 4LF4I 3PYFA 1XHKA 1OJ4A 1Z0TA 4DR1E 1KIJA 1K47A 4DU8A 5LMUE 4X66I 1N34I 5GMDA 4DPWA 2UXDI 4IZKB 3WU3A 4JI6I 3B8HA 2A2DA 5IT9Q 4YHHI 1N33I 5LMNE 4UTGA 2CG9A 1Y4UA 2AJ4A 4DV0E 4XTJA 4FWGA 2CGEA 3ZZUA 4DV7E 4LF5I 1WUUA 1N36E 4JI8I 2EFGA 2VQFI 4DPTA 3D4JA 1HNZE 4IZKA 4GKKI 4FN5A 2V2VA 3ZKDA 4JI3I 4JYAI 2UXBE 4DV4E 4DR2I 4HACB 1ZM4A 1Z59A 3Q1QA 1Z0EA 1B63A 2GQ0A 1Y6ZA 4LF9I 4DV5I 2UUBE 1XNQI 2DEIA 1H72C 1Z5CA 4DV6E 4LF4E 1NHHA 1Z5BA 4NXNI 1HR0E 1PIEA 4DR6I 3P06A 4I3HA 4X66E 5FLXQ 3LPSA 3V2UC 2ZM6I 3J7AM 4JI2I 2CZ9A 1MU5A 4GKJI 1IBMI 1MG7A 2BV3A 4JI1I 1KVKA 1NZ0A 2BM0A 3WU5A 1N33E 3JAMC 4DU7A 4Z7CA 1H7UA 1D6TA 1A6FA 2HK3A 4WUDA 4DPXA 2UUAE 3J7AG 4LF8I 2HK2A 2O1TA 1XMQE 4LF5E 4JI8E 3LTOA 2HFUA 1ELOA 4USKA 4JI3E 4DXLA 2UXCI 3Q6MA 4DR2E 3QT7A 4PRXA 1H74A 4DV5E 5IWAE 4JI0E 3V5RA 1XNQE 1XNRE 4B3RI 2F4VE 1FJGE 3B82A 4DV1I 2UU9I 1FWLA 4LF6I 3QT8A 4B3MI 4IZJB 4X64I 2BM1A 4WUBA 5BR8E 4ED4A 2E5LI 4JG4A 4HXZA 4JI2E 4X65E 4DR3I 4GKJE 1IBME 3K85A 1HNXE 4JI1E 1ZM9A 3WU4A 2X7IA 4DR4E 4OX9E 2R3VA 4JI4E 4B3SI 4DR5E 2VF3A 3T1HI 4LF8E 3F0NA 2OI2A 4M1KA 5FWKA 2HHHI 4B3TE 4LFCE 4IZJA 4LFBI 1H73A 4JI7I 1FKAE 4DUZI 3T1YI 3QT5A 4JV5I 1IBKI 3M6AA 3K17A 3ZZTA 3B78A 2Q2EB 4IZJD 4FWDA 4DV2I 4P7AA 4B3RE 3HULA 2UU9E 1I94I 4LF6E 4K0KI 4B3ME 5A2QC 2V2ZA 1FNMA 2O1UA 1N34E 1ZM3A 3PYDA 1USVA 2UXDE 1FI4A 3J80C 4JI6E 4ZVIA 1RR9A 1N32I 4HACA 4KQVA 4YHHE 4R1FA 2WW4A 4B3SE 3T1HE 4JI5I 2NPFA 1Z0VA 1ZM2A 3ZKBA 4EMDA 4LFBE 4AQYI 2X36A 2IOQA 2VQFE 1Z0GA 2GS8A 2ZITA 1HNWI 1Z0CA 4GKKE 4WUCA 1Y4SA 4JYAE 4DUZE 3T1YE 2E1RA 3J81C 4JV5E 4FW9A 4DV0I 5L3JA 4DV2E 4UT4A 3JAMQ 1KKHA 2XEXA 4LF9E 1J5EI 4LFAI 4NXMI 1N36I 4Z7YA 1Z0BA 1H7SA 2Z5BB 4MYUA 3Q6NA 1MX0A 4USMA 4X62I 4K0KE 3WU6A 2V8PA 2Z5EA 3HJCA 4MYTA 2VQEI 4NXNE 2UUCI 2LJPA 4KHPI 3ZZ0A 4DR6E 1Z5AA 1XMOI 2ZM6E 5IT9C 4DV3I 1N32E 4LF7I 2PNMA 2IOPA 1HR0I 1FWKA 2Z5CB 1N0UA 1QZRA 1EI1A 4JI5E 1EA6A 2Z5BA 2PNLA 3K1JA 2HKJA 4DR7I 1U2RA 2O1WA 1ZXMA 4FWHA 4AQYE 1KTVA 3CWVA 1S4EA 1NHIA 1HNWE 4P52A 4YY3I 1B62A 4PRVA 2HKEA 1DARA 2UXCE 2ZBKB 2UUAI 4DPUA 1XMQI 1J5EE 4LFAE 4NXME 3LNUA 3OTOI 5FLXC 4DV1E 2Z5CA 4DPYA 1UEKA 4X62E 2VQEE 4N3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 E;  2UUC E;  4KHP E;  1S16 A;  1XMO E;  4DUY I;  5GME A;  2E5L E;  1IBL I;  4DV3 E;  4DR3 E;  4JI0 I;  5IWA I;  1XNR I;  1N0V C;  2F4V I;  1FJG I;  1RRE A;  4LF7 E;  4PU9 A;  4DR1 I;  3PYE A;  1BKN A;  5LMU I;  5BR8 I;  1PVG A;  5A2Q Q;  2HHH E;  4DR7 E;  4X65 I;  1HNX I;  1NHJ A;  3GON A;  4HYM A;  4HY1 A;  4YY3 E;  5LMN I;  4JI7 E;  3J80 Q;  3ZM7 A;  2V2Q A;  4OX9 I;  4DR4 I;  4JI4 I;  3QT6 A;  1ZXN A;  4DR5 I;  4URL A;  1IBK E;  2J7K A;  2R42 A;  4B3T I;  4LFC I;  4DV7 I;  3OTO E;  1Z0W A;  1HNZ I;  1I94 E;  2UXB I;  4DV4 I;  1PKP A;  5LL6 R;  4DUY E;  2DEJ A;  2V34 A;  2A2C A;  1IBL E;  4RPF A;  1VIS A;  3H4L A;  3J81 Q;  2UUB I;  4DV6 I;  3PYG A;  2HFS A;  4LF4 I;  3PYF A;  1XHK A;  1OJ4 A;  1Z0T A;  4DR1 E;  1KIJ A;  1K47 A;  4DU8 A;  5LMU E;  4X66 I;  1N34 I;  5GMD A;  4DPW A;  2UXD I;  3WU3 A;  4JI6 I;  3B8H A;  2A2D A;  5IT9 Q;  4YHH I;  1N33 I;  5LMN E;  4UTG A;  2AJ4 A;  4DV0 E;  4XTJ A;  4FWG A;  3ZZU A;  4DV7 E;  4LF5 I;  1WUU A;  1N36 E;  4JI8 I;  2EFG A;  2VQF I;  4DPT A;  3D4J A;  1HNZ E;  4GKK I;  4FN5 A;  2V2V A;  3ZKD A;  4JI3 I;  4JYA I;  2UXB E;  4DV4 E;  4DR2 I;  4HAC B;  1ZM4 A;  1Z59 A;  3Q1Q A;  1Z0E A;  1B63 A;  4LF9 I;  4DV5 I;  2UUB E;  1XNQ I;  2DEI A;  1H72 C;  1Z5C A;  4DV6 E;  4LF4 E;  1NHH A;  1Z5B A;  4NXN I;  1HR0 E;  1PIE A;  4DR6 I;  4I3H A;  4X66 E;  5FLX Q;  3LPS A;  3V2U C;  2ZM6 I;  3J7A M;  4JI2 I;  2CZ9 A;  1MU5 A;  4GKJ I;  1IBM I;  1MG7 A;  2BV3 A;  4JI1 I;  1KVK A;  1NZ0 A;  2BM0 A;  3WU5 A;  1N33 E;  3JAM C;  4DU7 A;  4Z7C A;  1H7U A;  1D6T A;  1A6F A;  2HK3 A;  4WUD A;  4DPX A;  2UUA E;  3J7A G;  4LF8 I;  2HK2 A;  1XMQ E;  4LF5 E;  4JI8 E;  3LTO A;  2HFU A;  1ELO A;  4USK A;  4JI3 E;  4DXL A;  2UXC I;  4DR2 E;  3QT7 A;  4PRX A;  1H74 A;  4DV5 E;  5IWA E;  4JI0 E;  3V5R A;  1XNQ E;  1XNR E;  4B3R I;  2F4V E;  1FJG E;  3B82 A;  4DV1 I;  2UU9 I;  1FWL A;  4LF6 I;  3QT8 A;  4B3M I;  4X64 I;  2BM1 A;  4WUB A;  5BR8 E;  4ED4 A;  2E5L I;  4JG4 A;  4HXZ A;  4JI2 E;  4X65 E;  4DR3 I;  4GKJ E;  1IBM E;  1HNX E;  4JI1 E;  1ZM9 A;  3WU4 A;  2X7I A;  4DR4 E;  4OX9 E;  2R3V A;  4JI4 E;  4B3S I;  4DR5 E;  2VF3 A;  3T1H I;  4LF8 E;  3F0N A;  2OI2 A;  4M1K A;  2HHH I;  4B3T E;  4LFC E;  4LFB I;  1H73 A;  4JI7 I;  1FKA E;  4DUZ I;  3T1Y I;  3QT5 A;  4JV5 I;  1IBK I;  3M6A A;  3K17 A;  3ZZT A;  3B78 A;  2Q2E B;  4FWD A;  4DV2 I;  4P7A A;  4B3R E;  3HUL A;  2UU9 E;  1I94 I;  4LF6 E;  4K0K I;  4B3M E;  5A2Q C;  2V2Z A;  1FNM A;  1N34 E;  1ZM3 A;  3PYD A;  2UXD E;  1FI4 A;  3J80 C;  4JI6 E;  4ZVI A;  1RR9 A;  1N32 I;  4HAC A;  4KQV A;  4YHH E;  4R1F A;  2WW4 A;  4B3S E;  3T1H E;  4JI5 I;  2NPF A;  1Z0V A;  1ZM2 A;  3ZKB A;  4EMD A;  4LFB E;  4AQY I;  2X36 A;  2VQF E;  1Z0G A;  2GS8 A;  2ZIT A;  1HNW I;  1Z0C A;  4GKK E;  4WUC A;  4JYA E;  4DUZ E;  3T1Y E;  2E1R A;  3J81 C;  4JV5 E;  4FW9 A;  4DV0 I;  5L3J A;  4DV2 E;  4UT4 A;  3JAM Q;  1KKH A;  2XEX A;  4LF9 E;  1J5E I;  4LFA I;  4NXM I;  1N36 I;  4Z7Y A;  1Z0B A;  1H7S A;  4MYU A;  1MX0 A;  4USM A;  4X62 I;  4K0K E;  3WU6 A;  2V8P A;  4NXN E;  4MYT A;  2VQE I;  2UUC I;  2LJP A;  4KHP I;  3ZZ0 A;  4DR6 E;  1Z5A A;  1XMO I;  2ZM6 E;  5IT9 C;  4DV3 I;  1N32 E;  4LF7 I;  1HR0 I;  1FWK A;  1N0U A;  1QZR A;  1EI1 A;  4JI5 E;  1EA6 A;  3K1J A;  2HKJ A;  4DR7 I;  1U2R A;  1ZXM A;  4FWH A;  4AQY E;  1KTV A;  3CWV A;  1S4E A;  1NHI A;  1HNW E;  4P52 A;  4YY3 I;  1B62 A;  4PRV A;  2HKE A;  1DAR A;  2UXC E;  2ZBK B;  2UUA I;  4DPU A;  1XMQ I;  1J5E E;  4LFA E;  4NXM E;  3LNU A;  3OTO I;  5FLX C;  4DV1 E;  4DPY A;  1UEK A;  4X62 E;  2VQE E; 
#chains in the Genus database with same CATH topology
 4X64 E;  2UUC E;  4KHP E;  1S16 A;  3PS2 A;  5DNL A;  1XMO E;  4DUY I;  3CDJ A;  5GME A;  2PO1 A;  2E5L E;  1IBL I;  4DV3 E;  4U3B A;  1YHC A;  4DR3 E;  4JI0 I;  5IWA I;  1XNR I;  1N0V C;  2F4V I;  1USU A;  1RRE A;  1FJG I;  4LF7 E;  4LPF A;  4OO1 F;  4BA2 A;  4OKG A;  4PU9 A;  2JEB B;  2O1V A;  4DR1 I;  2PO0 B;  3PYE A;  1BKN A;  4OO1 A;  5LMU I;  5BR8 I;  1PVG A;  5A2Q Q;  2HHH E;  4DR7 E;  4X65 I;  1HNX I;  1NHJ A;  3GON A;  4HYM A;  4HY1 A;  3PRY A;  4YY3 E;  4OO1 D;  3P3E A;  5LMN I;  4JI7 E;  2C37 A;  3J80 Q;  3ZM7 A;  2V2Q A;  4OX9 I;  4DR4 I;  4IS9 A;  5DRP A;  4JI4 I;  3QT6 A;  1ZXN A;  4DR5 I;  4URL A;  1IBK E;  2J7K A;  2F1D A;  2R42 A;  3HKM A;  4B3T I;  4LFC I;  2JEB A;  4DV7 I;  5K36 B;  2WNR B;  2PO0 A;  3OTO E;  1Z0W A;  1VI7 A;  1UDQ A;  1HNZ I;  1I94 E;  4OO1 C;  2UXB I;  2C38 A;  4DV4 I;  1PKP A;  5LL6 R;  1YH8 A;  2C39 B;  4DUY E;  2DEJ A;  1HK7 A;  2V34 A;  2A2C A;  1IBL E;  4RPF A;  1VIS A;  5ELW A;  3H4L A;  3J81 Q;  2BR2 A;  2UUB I;  4DV6 I;  3PYG A;  2HFS A;  4OZE A;  4LF4 I;  2PO2 B;  1R6L A;  5K36 F;  1Y60 A;  3PYF A;  1XHK A;  1OJ4 A;  1Z0T A;  4DR1 E;  3M7N D;  1KIJ A;  1K47 A;  4DU8 A;  4MU1 A;  1UDO A;  4X66 I;  5LMU E;  1N34 I;  2WNR A;  5K36 A;  5GMD A;  4DPW A;  2UXD I;  4IZK B;  2WP8 B;  3DD6 A;  3WU3 A;  4JI6 I;  3GLL A;  3B8H A;  1XXE A;  2A2D A;  5IT9 Q;  4YHH I;  1N33 I;  5LMN E;  5K36 D;  1P42 A;  4UTG A;  3P3C A;  3NZK A;  1E3H A;  2GO3 A;  2CG9 A;  3PS3 A;  1Y4U A;  3M85 D;  2JT2 A;  2AJ4 A;  4DV0 E;  4XTJ A;  1UDN A;  4FWG A;  2AE8 A;  5DRR A;  2PO2 A;  2CGE A;  3ZZU A;  4DV7 E;  5C0X B;  4LF5 I;  1WUU A;  1N36 E;  4JI8 I;  2EFG A;  2VQF I;  4QNJ A;  4DPT A;  3D4J A;  2O3Z A;  3KRN A;  1HNZ E;  4IZK A;  3U1K A;  4FN5 A;  4GKK I;  2WP8 A;  4FW4 A;  2V2V A;  3ZKD A;  4JI3 I;  4JYA I;  2UXB E;  5K36 C;  4DV4 E;  4DR2 I;  4HAC B;  1ZM4 A;  1Z59 A;  3Q1Q A;  1Z0E A;  2BA1 D;  1B63 A;  2GQ0 A;  1Y6Z A;  4LF9 I;  5EL9 A;  4DV5 I;  2UUB E;  1XNQ I;  2DEI A;  1H72 C;  1Z5C A;  2BA0 G;  4FW5 A;  4DV6 E;  3U1Y A;  4LF4 E;  1NHH A;  1RHY A;  5C0X F;  1Z5B A;  4NXN I;  1HR0 E;  1UDS A;  2JE6 B;  1PIE A;  4DR6 I;  3P06 A;  4I3H A;  4X66 E;  5C0X A;  5FLX Q;  3LPS A;  3V2U C;  2ZM6 I;  5K36 E;  3J7A M;  4JI2 I;  2CZ9 A;  1MU5 A;  4GKJ I;  1IBM I;  1MG7 A;  2BV3 A;  4JI1 I;  1KVK A;  1NZ0 A;  2BM0 A;  3WU5 A;  1N33 E;  5C0X D;  1OYR A;  3JAM C;  4DU7 A;  4Z7C A;  1H7U A;  1D6T A;  1A6F A;  2HK3 A;  4ISA A;  4WUD A;  4DPX A;  2UUA E;  3J7A G;  4LF8 I;  2HK2 A;  2O1T A;  1XMQ E;  4LF5 E;  5JEA B;  4JI8 E;  3LTO A;  2GO4 A;  2HFU A;  2PNZ B;  2NN6 B;  1ELO A;  4USK A;  4IFD B;  4JI3 E;  5C0X C;  4DXL A;  2UXC I;  3Q6M A;  3P3G A;  3UHM A;  4DR2 E;  3QT7 A;  3H1C A;  1OYP A;  5DRQ A;  4PRX A;  1H74 A;  4DV5 E;  5IWA E;  4JI0 E;  3V5R A;  1XNQ E;  4AID A;  1XNR E;  4B3R I;  2F4V E;  1FJG E;  3B82 A;  4DV1 I;  2UU9 I;  1FWL A;  4LF6 I;  3QT8 A;  4B3M I;  5JEA F;  4IZJ B;  4X64 I;  2BM1 A;  2NN6 F;  4WUB A;  4IFD F;  1E3P A;  5BR8 E;  4ED4 A;  5C0X E;  2E5L I;  4JG4 A;  2PNZ A;  4HXZ A;  4JI2 E;  2NN6 A;  4IFD A;  4X65 E;  4DR3 I;  4GKJ E;  1IBM E;  3K85 A;  4BA1 B;  1HNX E;  4JI1 E;  1ZM9 A;  2C39 A;  2CVE A;  3WU4 A;  2X7I A;  1OYS A;  4DR4 E;  4OX9 E;  2R3V A;  4JI4 E;  4B3S I;  4DR5 E;  2NN6 D;  2VF3 A;  3T1H I;  5EKW A;  4LF8 E;  3F0N A;  3PS1 A;  2OI2 A;  4M1K A;  5FWK A;  2HHH I;  4B3T E;  4LFC E;  4IZJ A;  4LFB I;  1H73 A;  4FW3 A;  4JI7 I;  1FKA E;  4DUZ I;  3T1Y I;  4MDT A;  5JEA C;  3QT5 A;  4JV5 I;  4BA1 A;  1IBK I;  3M6A A;  3K17 A;  3ZZT A;  2NN6 C;  3B78 A;  2IER A;  2Q2E B;  4IZJ D;  4IFD C;  4FWD A;  4DV2 I;  4LCH A;  4OO1 B;  4P7A A;  4B3R E;  3HUL A;  2UU9 E;  1I94 I;  4LF6 E;  4K0K I;  5DRO A;  4B3M E;  5A2Q C;  2V2Z A;  1FNM A;  2O1U A;  1N34 E;  1ZM3 A;  3PYD A;  3B4T A;  1USV A;  2UXD E;  2JEA B;  1FI4 A;  1Y5Y A;  2C37 B;  4FW7 A;  5JEA E;  2IES A;  3J80 C;  4JI6 E;  4ZVI A;  1RR9 A;  2NN6 E;  1N32 I;  4IFD E;  4HAC A;  4KQV A;  4YHH E;  3CDI A;  4R1F A;  2WW4 A;  4U3D A;  4AIM A;  4B3S E;  3M7N G;  5DNX A;  3T1H E;  4JI5 I;  2NPF A;  1Z0V A;  2VES A;  2C38 B;  1ZM2 A;  4FW6 A;  3ZKB A;  2JE6 A;  4EMD A;  4LFB E;  4AQY I;  2X36 A;  2IOQ A;  2VQF E;  1Z0G A;  2GS8 A;  2ZIT A;  4MU0 A;  1HNW I;  1Z0C A;  4GKK E;  2JEA A;  4WUC A;  1Y4S A;  4JYA E;  4DUZ E;  3T1Y E;  2BR2 B;  2E1R A;  3J81 C;  4JV5 E;  4FW9 A;  4DV0 I;  1R6M A;  4LOM A;  5L3J A;  4DV2 E;  4UT4 A;  3JAM Q;  1KKH A;  4LCG A;  2XEX A;  3M85 G;  4LF9 E;  1J5E I;  4LFA I;  2BA0 D;  4NXM I;  1N36 I;  4Z7Y A;  1Z0B A;  4MU3 A;  4QNK A;  1H7S A;  2Z5B B;  4MYU A;  3Q6N A;  1MX0 A;  4USM A;  4X62 I;  4K0K E;  3WU6 A;  2V8P A;  2Z5E A;  3HJC A;  4MYT A;  2VQE I;  4NXN E;  3GCM A;  2UUC I;  2LJP A;  4KHP I;  3ZZ0 A;  4DR6 E;  4LCF A;  1Z5A A;  1XMO I;  5JEA A;  3L7Z B;  2ZM6 E;  5IT9 C;  4GQU A;  4DV3 I;  2BA1 G;  1N32 E;  4LF7 I;  4NBQ A;  4MU4 A;  2PNM A;  2IOP A;  1HR0 I;  5JEA D;  3P76 A;  4AM3 A;  1FWK A;  2Z5C B;  1N0U A;  1QZR A;  1EI1 A;  3GME A;  4IFD D;  4OO1 E;  4JI5 E;  1EA6 A;  2Z5B A;  2PNL A;  3K1J A;  2HKJ A;  4DR7 I;  1U2R A;  2O1W A;  1ZXM A;  4FWH A;  4AQY E;  1KTV A;  3CWV A;  2PO1 B;  1S4E A;  1NHI A;  3L7Z A;  1HNW E;  4P52 A;  4YY3 I;  1B62 A;  4PRV A;  2HKE A;  1DAR A;  2UXC E;  4MQY A;  2ZBK B;  2UUA I;  4BA2 B;  4DPU A;  1XMQ I;  2J65 A;  1J5E E;  4LFA E;  4NXM E;  3LNU A;  3OTO I;  5FLX C;  4DV1 E;  2Z5C A;  4DPY A;  1UEK A;  4J3D A;  4X62 E;  2VQE E;  4N3O A; 
#chains in the Genus database with same CATH homology
 4X64 E;  2UUC E;  4KHP E;  1S16 A;  1XMO E;  4DUY I;  5GME A;  2E5L E;  1IBL I;  4DV3 E;  4DR3 E;  4JI0 I;  5IWA I;  1XNR I;  1N0V C;  2F4V I;  1USU A;  1RRE A;  1FJG I;  4LF7 E;  4PU9 A;  2O1V A;  4DR1 I;  3PYE A;  1BKN A;  5LMU I;  5BR8 I;  1PVG A;  5A2Q Q;  2HHH E;  4DR7 E;  4X65 I;  1HNX I;  1NHJ A;  3GON A;  4HYM A;  4HY1 A;  3PRY A;  4YY3 E;  5LMN I;  4JI7 E;  3J80 Q;  3ZM7 A;  2V2Q A;  4OX9 I;  4DR4 I;  4JI4 I;  3QT6 A;  1ZXN A;  4DR5 I;  4URL A;  1IBK E;  2J7K A;  2R42 A;  4B3T I;  4LFC I;  4DV7 I;  3OTO E;  1Z0W A;  1HNZ I;  1I94 E;  2UXB I;  4DV4 I;  1PKP A;  5LL6 R;  4DUY E;  2DEJ A;  1HK7 A;  2V34 A;  2A2C A;  1IBL E;  4RPF A;  1VIS A;  3H4L A;  3J81 Q;  2UUB I;  4DV6 I;  3PYG A;  2HFS A;  4LF4 I;  3PYF A;  1XHK A;  1OJ4 A;  1Z0T A;  4DR1 E;  1KIJ A;  1K47 A;  4DU8 A;  5LMU E;  4X66 I;  1N34 I;  5GMD A;  4DPW A;  2UXD I;  4IZK B;  3WU3 A;  4JI6 I;  3B8H A;  2A2D A;  5IT9 Q;  4YHH I;  1N33 I;  5LMN E;  4UTG A;  2CG9 A;  1Y4U A;  2AJ4 A;  4DV0 E;  4XTJ A;  4FWG A;  2CGE A;  3ZZU A;  4DV7 E;  4LF5 I;  1WUU A;  1N36 E;  4JI8 I;  2EFG A;  2VQF I;  4DPT A;  3D4J A;  1HNZ E;  4IZK A;  4GKK I;  4FN5 A;  2V2V A;  3ZKD A;  4JI3 I;  4JYA I;  2UXB E;  4DV4 E;  4DR2 I;  4HAC B;  1ZM4 A;  1Z59 A;  3Q1Q A;  1Z0E A;  1B63 A;  2GQ0 A;  1Y6Z A;  4LF9 I;  4DV5 I;  2UUB E;  1XNQ I;  2DEI A;  1H72 C;  1Z5C A;  4DV6 E;  4LF4 E;  1NHH A;  1Z5B A;  4NXN I;  1HR0 E;  1PIE A;  4DR6 I;  3P06 A;  4I3H A;  4X66 E;  5FLX Q;  3LPS A;  3V2U C;  2ZM6 I;  3J7A M;  4JI2 I;  2CZ9 A;  1MU5 A;  4GKJ I;  1IBM I;  1MG7 A;  2BV3 A;  4JI1 I;  1KVK A;  1NZ0 A;  2BM0 A;  3WU5 A;  1N33 E;  3JAM C;  4DU7 A;  4Z7C A;  1H7U A;  1D6T A;  1A6F A;  2HK3 A;  4WUD A;  4DPX A;  2UUA E;  3J7A G;  4LF8 I;  2HK2 A;  2O1T A;  1XMQ E;  4LF5 E;  4JI8 E;  3LTO A;  2HFU A;  1ELO A;  4USK A;  4JI3 E;  4DXL A;  2UXC I;  3Q6M A;  4DR2 E;  3QT7 A;  4PRX A;  1H74 A;  4DV5 E;  5IWA E;  4JI0 E;  3V5R A;  1XNQ E;  1XNR E;  4B3R I;  2F4V E;  1FJG E;  3B82 A;  4DV1 I;  2UU9 I;  1FWL A;  4LF6 I;  3QT8 A;  4B3M I;  4IZJ B;  4X64 I;  2BM1 A;  4WUB A;  5BR8 E;  4ED4 A;  2E5L I;  4JG4 A;  4HXZ A;  4JI2 E;  4X65 E;  4DR3 I;  4GKJ E;  1IBM E;  3K85 A;  1HNX E;  4JI1 E;  1ZM9 A;  3WU4 A;  2X7I A;  4DR4 E;  4OX9 E;  2R3V A;  4JI4 E;  4B3S I;  4DR5 E;  2VF3 A;  3T1H I;  4LF8 E;  3F0N A;  2OI2 A;  4M1K A;  5FWK A;  2HHH I;  4B3T E;  4LFC E;  4IZJ A;  4LFB I;  1H73 A;  4JI7 I;  1FKA E;  4DUZ I;  3T1Y I;  3QT5 A;  4JV5 I;  1IBK I;  3M6A A;  3K17 A;  3ZZT A;  3B78 A;  2Q2E B;  4IZJ D;  4FWD A;  4DV2 I;  4P7A A;  4B3R E;  3HUL A;  2UU9 E;  1I94 I;  4LF6 E;  4K0K I;  4B3M E;  5A2Q C;  2V2Z A;  1FNM A;  2O1U A;  1N34 E;  1ZM3 A;  3PYD A;  1USV A;  2UXD E;  1FI4 A;  3J80 C;  4JI6 E;  4ZVI A;  1RR9 A;  1N32 I;  4HAC A;  4KQV A;  4YHH E;  4R1F A;  2WW4 A;  4B3S E;  3T1H E;  4JI5 I;  2NPF A;  1Z0V A;  1ZM2 A;  3ZKB A;  4EMD A;  4LFB E;  4AQY I;  2X36 A;  2IOQ A;  2VQF E;  1Z0G A;  2GS8 A;  2ZIT A;  1HNW I;  1Z0C A;  4GKK E;  4WUC A;  1Y4S A;  4JYA E;  4DUZ E;  3T1Y E;  2E1R A;  3J81 C;  4JV5 E;  4FW9 A;  4DV0 I;  5L3J A;  4DV2 E;  4UT4 A;  3JAM Q;  1KKH A;  2XEX A;  4LF9 E;  1J5E I;  4LFA I;  4NXM I;  1N36 I;  4Z7Y A;  1Z0B A;  1H7S A;  2Z5B B;  4MYU A;  3Q6N A;  1MX0 A;  4USM A;  4X62 I;  4K0K E;  3WU6 A;  2V8P A;  2Z5E A;  3HJC A;  4MYT A;  2VQE I;  4NXN E;  2UUC I;  2LJP A;  4KHP I;  3ZZ0 A;  4DR6 E;  1Z5A A;  1XMO I;  2ZM6 E;  5IT9 C;  4DV3 I;  1N32 E;  4LF7 I;  2PNM A;  2IOP A;  1HR0 I;  1FWK A;  2Z5C B;  1N0U A;  1QZR A;  1EI1 A;  4JI5 E;  1EA6 A;  2Z5B A;  2PNL A;  3K1J A;  2HKJ A;  4DR7 I;  1U2R A;  2O1W A;  1ZXM A;  4FWH A;  4AQY E;  1KTV A;  3CWV A;  1S4E A;  1NHI A;  1HNW E;  4P52 A;  4YY3 I;  1B62 A;  4PRV A;  2HKE A;  1DAR A;  2UXC E;  2ZBK B;  2UUA I;  4DPU A;  1XMQ I;  1J5E E;  4LFA E;  4NXM E;  3LNU A;  3OTO I;  5FLX C;  4DV1 E;  2Z5C A;  4DPY A;  1UEK A;  4X62 E;  2VQE E;  4N3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...