2ZM6I

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
125
structure length
125
Chain Sequence
YYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 20
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2zm6I00
1XNQI 2UXCE 4FW9A 2LJPA 3QT7A 4JI0E 2AJ4A 4DV0E 1D6TA 4X62I 4LFCI 1FJGE 4AQYI 4JI6I 3ZZUA 4DR3E 4GKJI 4DV7I 1B62A 4LF7I 4DR2I 3J80Q 1XMQI 2VF3A 4B3RI 5LMNI 1XNRE 1VISA 4DV4E 4WUCA 4B3MI 3PYFA 4DR1I 1U2RA 5IT9Q 2BM0A 4FWHA 4DR6E 1BKNA 4DR7E 4PU9A 4DUYI 2NPFA 2V2QA 1H7SA 2X7IA 2UUAE 4JI2I 4LF8E 2HKJA 4DV5I 5LMNE 3CWVA 3ZZTA 1FI4A 1H72C 1PIEA 4LF5I 4JG4A 5A2QC 2Q2EB 1Z5AA 4DUYE 3LNUA 1FWLA 2UUBI 2HK2A 4WUBA 2UXBI 4K0KI 3B78A 1Z59A 4DR4I 4X66I 2VQFE 2BV3A 4UT4A 4DV1I 4GKKI 4NXMI 1FKAE 4FN5A 1XHKA 3ZZ0A 3T1HI 2HHHE 4NXNE 5LMUI 4XTJA 4MYUA 1HNWE 2UUCE 4KQVA 4M1KA 4LFAI 2ZM6I 4ZVIA 1KTVA 2XEXA 4USKA 3QT6A 2UU9I 4OX9E 1N36E 4DV2E 4P52A 2UXCI 4LF9E 2A2DA 4JI0I 4DPYA 4DV0I 3T1YE 1FJGI 1EI1A 4LF4E 4HYMA 4KHPE 4DU8A 2R42A 4PRXA 4DR3I 2X36A 3H4LA 1MG7A 3LTOA 4JV5E 3B8HA 4JI3E 5GMEA 2HFSA 3QT5A 3JAMC 1XNRI 4DV4I 1OJ4A 3QT8A 4DR6I 4DR7I 1S16A 2DEJA 3WU5A 4I3HA 2UUAI 4LF8I 3F0NA 2WW4A 1H7UA 1J5EE 1PVGA 2F4VE 3J81Q 4DR5E 1FWKA 5FLXC 4PRVA 2J7KA 4USMA 1Z0EA 1KKHA 1Z5BA 2VQFI 1A6FA 1B63A 1Z0TA 2GS8A 3ZKBA 2V2ZA 1ZM3A 1N34E 1Z0WA 3M6AA 1RREA 2HHHI 4NXNI 1HNWI 4B3TE 2UUCI 3PYEA 3J80C 4JI1I 1NZ0A 5BR8I 1I94E 5IT9C 1ELOA 4DPXA 3PYGA 4FWGA 4OX9I 4JI7I 1ZXMA 1N36I 4X65E 3K1JA 4DV2I 4URLA 4JI1E 4LF9I 4JI4E 4DV6E 2HK3A 2OI2A 4JYAE 5GMDA 3K17A 3T1YI 3B82A 3GONA 4LF4I 2ZBKB 1HNZE 2A2CA 4KHPI 4JI7E 4JV5I 4R1FA 2V8PA 1NHHA 4JI3I 1Z0VA 4JI8E 1MU5A 3LPSA 1MX0A 4HY1A 4X64E 1N32E 3WU4A 1HNXE 4DU7A 4YHHE 1ZXNA 2EFGA 1N33E 4LFBE 4LF6E 3V5RA 4WUDA 4Z7YA 1XMOE 1Z0BA 5IWAE 4HACA 3OTOE 1J5EI 2F4VI 4DPWA 4DR5I 3V2UC 4DUZE 2UXDE 2E5LE 1IBKI 1HR0E 4YY3E 1KVKA 3WU6A 1FNMA 1K47A 2VQEE 2BM1A 4P7AA 5A2QQ 4JI5E 1IBLI 5BR8E 1IBKE 1N34I 1XNQE 1IBMI 1ZM2A 1H73A 4B3TI 4X62E 4LFCE 1Z0CA 3WU3A 3D4JA 1PKPA 4AQYE 4JI6E 1KIJA 1I94I 3J7AM 1DARA 1IBLE 4GKJE 1IBME 4DV7E 2HFUA 4FWDA 3ZM7A 4ED4A 3Q1QA 4DPUA 4LF7E 4DR2E 4X65I 1XMQE 1EA6A 4B3RE 1H74A 4JI4I 4DV6I 4B3ME 3J81C 4JYAI 4DR1E 4EMDA 1HNZI 5LL6R 1N0UA 4DV3I 4JI2E 1NHJA 4DV5E 5L3JA 4JI8I 1N0VC 3HULA 4B3SI 4X64I 4LF5E 1N32I 4HXZA 1HNXI 4YHHI 2UUBE 1N33I 4DV3E 4LFBI 2UXBE 2V34A 4K0KE 4DXLA 3ZKDA 4LF6I 3PYDA 4DR4E 4X66E 4DV1E 4GKKE 1XMOI 4NXME 1S4EA 5IWAI 3JAMQ 4B3SE 1ZM9A 3OTOI 1NHIA 2CZ9A 3T1HE 2HKEA 4HACB 5LMUE 4DUZI 2V2VA 1Z0GA 2E1RA 2UXDI 2E5LI 2DEIA 1UEKA 4RPFA 1HR0I 4UTGA 1WUUA 1QZRA 4Z7CA 4YY3I 4LFAE 2ZM6E 2ZITA 2R3VA 3J7AG 2VQEI 4MYTA 5FLXQ 1ZM4A 2UU9E 1Z5CA 4JI5I 4DPTA 1RR9A
chains in the Genus database with same CATH superfamily
1XNQI 2UXCE 1UDOA 4FW9A 2LJPA 3QT7A 3P76A 4JI0E 2AJ4A 4DV0E 4BA1B 1D6TA 4X62I 4LFCI 1FJGE 4AIDA 4GQUA 4AQYI 4JI6I 3ZZUA 4MU4A 4DR3E 4GKJI 4DV7I 2AE8A 4IZJD 1B62A 4OO1B 4OO1E 4MU3A 4LF7I 4DR2I 2O3ZA 2WP8A 3J80Q 1XMQI 2VF3A 2CVEA 5ELWA 4B3RI 5LMNI 4OO1F 1XNRE 1VISA 4DV4E 2PO0B 2C39A 4WUCA 4B3MI 2BA0G 3PYFA 4DR1I 1U2RA 5IT9Q 2BM0A 4FWHA 4DR6E 1BKNA 4DR7E 4U3BA 4PU9A 4DUYI 2NPFA 2NN6B 2NN6E 2V2QA 1H7SA 2X7IA 2UUAE 4JI2I 4LF8E 2HKJA 4DV5I 2J65A 5LMNE 2NN6F 3CWVA 3ZZTA 4IFDB 4IFDE 1FI4A 1H72C 2IERA 1OYSA 4ISAA 3HJCA 1PIEA 3B4TA 3NZKA 4LF5I 4JG4A 5A2QC 4QNJA 2Q2EB 1Z5AA 2Z5EA 3GLLA 5JEAA 4IZJA 4DUYE 2JEAA 3LNUA 4LCGA 1FWLA 2UUBI 4IFDF 2HK2A 4WUBA 2UXBI 4K0KI 3B78A 3GMEA 1Z59A 4AIMA 4DR4I 4X66I 2VQFE 2BV3A 4UT4A 4DV1I 4GKKI 4FW5A 4NXMI 1FKAE 4FN5A 1XHKA 4FW7A 3ZZ0A 4U3DA 3T1HI 3PRYA 2HHHE 5C0XA 4NXNE 5LMUI 5K36A 4XTJA 4MYUA 1HNWE 1XXEA 2UUCE 5DNXA 4KQVA 4M1KA 4LFAI 4MQYA 2ZM6I 4ZVIA 1KTVA 2O1VA 2XEXA 4USKA 3QT6A 2UU9I 4OX9E 4LCHA 1N36E 4J3DA 4DV2E 4P52A 5FWKA 2UXCI 1UDQA 4BA2A 4LF9E 1YHCA 2A2DA 4JI0I 4DPYA 4DV0I 2IOQA 3P3GA 2PNZB 4LPFA 3T1YE 1FJGI 1EI1A 4LF4E 2C38A 4HYMA 4KHPE 3Q6MA 3DD6A 4DU8A 2R42A 4PRXA 4DR3I 2X36A 4MDTA 3H4LA 1MG7A 3LTOA 4JV5E 3B8HA 1OYRA 4JI3E 5GMEA 2HFSA 3QT5A 3U1YA 3P3EA 3M85G 3JAMC 1Y5YA 5DRQA 1XNRI 4DV4I 1OJ4A 2WP8B 2IOPA 3PS1A 3QT8A 3H1CA 1R6LA 4DR6I 2C39B 3PS2A 4DR7I 4FW3A 5JEAD 1S16A 2DEJA 3CDIA 4IZKB 4I3HA 3WU5A 2UUAI 3U1KA 4LF8I 3F0NA 2F1DA 2WW4A 1H7UA 1J5EE 1PVGA 2F4VE 3J81Q 4DR5E 1FWKA 4FW6A 5FLXC 2Z5CA 1E3HA 2O1WA 4PRVA 2J7KA 5C0XD 4USMA 5K36D 1Z0EA 1KKHA 4IZJB 1Z5BA 2VQFI 1A6FA 1B63A 2C37A 1Z0TA 2GS8A 3ZKBA 3UHMA 2V2ZA 1USVA 2JEBA 1ZM3A 2BR2B 1N34E 1Z0WA 3GCMA 3L7ZA 3M6AA 4MU1A 1RREA 2HHHI 4NXNI 1Y4SA 1HNWI 4LOMA 4B3TE 2UUCI 3PYEA 3J80C 4JI1I 1NZ0A 5K36B 2JE6B 5BR8I 5JEAC 1I94E 5IT9C 1ELOA 4DPXA 3PYGA 2PO2B 2WNRB 4QNKA 4FWGA 4OX9I 4JI7I 1ZXMA 1N36I 4X65E 4IFDA 3K1JA 4DV2I 4URLA 4JI1E 4LF9I 2PNLA 4JI4E 4OKGA 4DV6E 2HK3A 2OI2A 4JYAE 5C0XC 5GMDA 4BA2B 3K17A 5K36C 3T1YI 3B82A 3GONA 4LF4I 2ZBKB 2BA1D 2A2CA 1HNZE 4KHPI 4JI7E 4FW4A 4JV5I 2C38B 4R1FA 2V8PA 1NHHA 4JI3I 1Z0VA 4JI8E 1MU5A 2GO4A 5DNLA 3P3CA 5EKWA 2PO1A 2Z5BA 4LCFA 1HK7A 1MX0A 3LPSA 4HY1A 4X64E 1N32E 3WU4A 2IESA 4DPTA 1Y4UA 1HNXE 4DU7A 1VI7A 1R6MA 4YHHE 1ZXNA 1RR9A 1N33E 4LFBE 3M7ND 4LF6E 4IS9A 3V5RA 4WUDA 4Z7YA 1XMOE 1Z0BA 2O1TA 5IWAE 4HACA 3OTOE 1J5EI 2CGEA 2F4VI 4DPWA 4DR5I 3V2UC 4DUZE 2UXDE 2E5LE 4OO1D 1IBKI 3KRNA 2Z5CB 1HR0E 2PNZA 4YY3E 1KVKA 3WU6A 3Q6NA 1FNMA 1K47A 2VQEE 3PS3A 4AM3A 2BM1A 4P7AA 5A2QQ 4JI5E 2C37B 1IBLI 5DRRA 2NN6D 1RHYA 5BR8E 1IBKE 2BA0D 1N34I 4N3OA 1IBMI 1XNQE 4BA1A 1ZM2A 3HKMA 2VESA 2JEBB 5JEAB 2JEAB 1H73A 5JEAE 3L7ZB 4B3TI 1UDSA 4IFDD 4X62E 4LFCE 1Z0CA 3WU3A 3D4JA 1P42A 1PKPA 4AQYE 5EL9A 5JEAF 4JI6E 1KIJA 1I94I 4OO1A 3J7AM 1DARA 1IBLE 4IZKA 4GKJE 1IBME 4DV7E 2HFUA 4FWDA 3ZM7A 4ED4A 3Q1QA 4DPUA 4LF7E 2PO0A 1UDNA 4DR2E 4X65I 1XMQE 1USUA 5C0XB 5C0XE 4OO1C 1EA6A 5DRPA 4B3RE 5K36E 2CG9A 1H74A 4JI4I 5DROA 4DV6I 3J81C 4B3ME 4JYAI 4DR1E 2NN6A 5C0XF 5K36F 4EMDA 1HNZI 5LL6R 1N0UA 4DV3I 4JI2E 1NHJA 1OYPA 1E3PA 2GO3A 4DV5E 5L3JA 2NN6C 4JI8I 2BR2A 1N0VC 3HULA 4B3SI 3CDJA 4X64I 4LF5E 1N32I 1Y60A 4HXZA 4IFDC 1HNXI 2PO1B 2Z5BB 3P06A 4YHHI 2UUBE 1N33I 4DV3E 4LFBI 2UXBE 2V34A 4K0KE 4DXLA 2JE6A 3ZKDA 4LF6I 3PYDA 3K85A 4DR4E 4X66E 4NBQA 2GQ0A 1YH8A 4DV1E 4GKKE 4MU0A 1XMOI 4NXME 1S4EA 5IWAI 3JAMQ 1Y6ZA 2BA1G 4B3SE 2PO2A 2WNRA 1ZM9A 3OTOI 4OZEA 1NHIA 2CZ9A 3T1HE 2HKEA 4HACB 5LMUE 2V2VA 1Z0GA 2E1RA 4DUZI 2UXDI 2E5LI 2DEIA 1UEKA 4RPFA 1HR0I 4UTGA 1WUUA 1QZRA 2O1UA 4Z7CA 4YY3I 4LFAE 2ZM6E 2ZITA 2R3VA 3J7AG 2VQEI 4MYTA 3M7NG 2PNMA 5FLXQ 3M85D 2UU9E 2JT2A 1Z5CA 4JI5I 1ZM4A 2EFGA
chains in the Genus database with same CATH topology
1XNQI 2UXCE 4FW9A 2LJPA 3QT7A 4JI0E 2AJ4A 4DV0E 1D6TA 4X62I 4LFCI 1FJGE 4AQYI 4JI6I 3ZZUA 4DR3E 4GKJI 4DV7I 4IZJD 1B62A 4LF7I 4DR2I 3J80Q 1XMQI 2VF3A 4B3RI 5LMNI 1XNRE 1VISA 4DV4E 4WUCA 4B3MI 3PYFA 4DR1I 1U2RA 5IT9Q 2BM0A 4FWHA 4DR6E 1BKNA 4DR7E 4PU9A 4DUYI 2NPFA 2V2QA 1H7SA 2X7IA 2UUAE 4JI2I 4LF8E 2HKJA 4DV5I 5LMNE 3CWVA 3ZZTA 1FI4A 1H72C 3HJCA 1PIEA 4LF5I 4JG4A 5A2QC 2Q2EB 1Z5AA 2Z5EA 4IZJA 4DUYE 3LNUA 1FWLA 2UUBI 2HK2A 4WUBA 2UXBI 4K0KI 3B78A 1Z59A 4DR4I 4X66I 2VQFE 2BV3A 4UT4A 4DV1I 4GKKI 4NXMI 1FKAE 4FN5A 1XHKA 3ZZ0A 3T1HI 3PRYA 2HHHE 4NXNE 5LMUI 4XTJA 4MYUA 1HNWE 2UUCE 4KQVA 4M1KA 4LFAI 2ZM6I 4ZVIA 1KTVA 2O1VA 2XEXA 4USKA 3QT6A 2UU9I 4OX9E 1N36E 4DV2E 4P52A 5FWKA 2UXCI 4LF9E 2A2DA 4JI0I 4DPYA 4DV0I 2IOQA 3T1YE 1FJGI 1EI1A 4LF4E 4HYMA 4KHPE 3Q6MA 4DU8A 2R42A 4PRXA 4DR3I 2X36A 3H4LA 1MG7A 3LTOA 4JV5E 3B8HA 4JI3E 5GMEA 2HFSA 3QT5A 3JAMC 1XNRI 4DV4I 1OJ4A 2IOPA 3QT8A 4DR6I 4DR7I 1S16A 2DEJA 4IZKB 4I3HA 3WU5A 2UUAI 4LF8I 3F0NA 2WW4A 1H7UA 1J5EE 1PVGA 2F4VE 3J81Q 4DR5E 1FWKA 5FLXC 2Z5CA 2O1WA 4PRVA 2J7KA 4USMA 1Z0EA 1KKHA 4IZJB 1Z5BA 2VQFI 1A6FA 1B63A 1Z0TA 2GS8A 3ZKBA 2V2ZA 1USVA 1ZM3A 1N34E 1Z0WA 3M6AA 1RREA 2HHHI 4NXNI 1Y4SA 1HNWI 4B3TE 2UUCI 3PYEA 3J80C 4JI1I 1NZ0A 5BR8I 1I94E 5IT9C 1ELOA 4DPXA 3PYGA 4FWGA 4OX9I 4JI7I 1ZXMA 1N36I 4X65E 3K1JA 4DV2I 4URLA 4JI1E 4LF9I 2PNLA 4JI4E 4DV6E 2HK3A 2OI2A 4JYAE 5GMDA 3K17A 3T1YI 3B82A 3GONA 4LF4I 2ZBKB 1HNZE 2A2CA 4KHPI 4JI7E 4JV5I 4R1FA 2V8PA 1NHHA 4JI3I 1Z0VA 4JI8E 1MU5A 2Z5BA 1HK7A 1MX0A 3LPSA 4HY1A 4X64E 1N32E 3WU4A 1Y4UA 1HNXE 4DU7A 4YHHE 1ZXNA 1RR9A 1N33E 4LFBE 4LF6E 3V5RA 4WUDA 4Z7YA 1XMOE 1Z0BA 2O1TA 5IWAE 4HACA 3OTOE 1J5EI 2CGEA 2F4VI 4DPWA 4DR5I 3V2UC 4DUZE 2UXDE 2E5LE 1IBKI 2Z5CB 1HR0E 4YY3E 1KVKA 3WU6A 3Q6NA 1FNMA 1K47A 2VQEE 2BM1A 4P7AA 5A2QQ 4JI5E 1IBLI 5BR8E 1IBKE 1N34I 1XNQE 4N3OA 1IBMI 1ZM2A 1H73A 4B3TI 4X62E 4LFCE 1Z0CA 3WU3A 3D4JA 1PKPA 4AQYE 4JI6E 1KIJA 1I94I 3J7AM 1DARA 1IBLE 4IZKA 4GKJE 1IBME 4DV7E 2HFUA 4FWDA 3ZM7A 4ED4A 3Q1QA 4DPUA 4LF7E 4DR2E 4X65I 1XMQE 1USUA 1EA6A 4B3RE 2CG9A 1H74A 4JI4I 4DV6I 4B3ME 3J81C 4JYAI 4DR1E 4EMDA 1HNZI 5LL6R 1N0UA 4DV3I 4JI2E 1NHJA 4DV5E 5L3JA 4JI8I 1N0VC 3HULA 4B3SI 4X64I 4LF5E 1N32I 4HXZA 1HNXI 2Z5BB 3P06A 4YHHI 2UUBE 1N33I 4DV3E 4LFBI 2UXBE 2V34A 4K0KE 4DXLA 3ZKDA 4LF6I 3PYDA 3K85A 4DR4E 4X66E 2GQ0A 4DV1E 4GKKE 1XMOI 4NXME 1S4EA 5IWAI 3JAMQ 1Y6ZA 4B3SE 1ZM9A 3OTOI 1NHIA 2CZ9A 3T1HE 2HKEA 4HACB 5LMUE 4DUZI 2V2VA 1Z0GA 2E1RA 2UXDI 2E5LI 2DEIA 1UEKA 4RPFA 1HR0I 4UTGA 1WUUA 1QZRA 2O1UA 4Z7CA 4YY3I 4LFAE 2ZM6E 2ZITA 2R3VA 3J7AG 2VQEI 4MYTA 2PNMA 5FLXQ 1ZM4A 2UU9E 1Z5CA 4JI5I 4DPTA 2EFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ I;  2UXC E;  4FW9 A;  2LJP A;  3QT7 A;  4JI0 E;  2AJ4 A;  4DV0 E;  1D6T A;  4X62 I;  4LFC I;  1FJG E;  4AQY I;  4JI6 I;  3ZZU A;  4DR3 E;  4GKJ I;  4DV7 I;  1B62 A;  4LF7 I;  4DR2 I;  3J80 Q;  1XMQ I;  2VF3 A;  4B3R I;  5LMN I;  1XNR E;  1VIS A;  4DV4 E;  4WUC A;  4B3M I;  3PYF A;  4DR1 I;  1U2R A;  5IT9 Q;  2BM0 A;  4FWH A;  4DR6 E;  1BKN A;  4DR7 E;  4PU9 A;  4DUY I;  2NPF A;  2V2Q A;  1H7S A;  2X7I A;  2UUA E;  4JI2 I;  4LF8 E;  2HKJ A;  4DV5 I;  5LMN E;  3CWV A;  3ZZT A;  1FI4 A;  1H72 C;  1PIE A;  4LF5 I;  4JG4 A;  5A2Q C;  2Q2E B;  1Z5A A;  4DUY E;  3LNU A;  1FWL A;  2UUB I;  2HK2 A;  4WUB A;  2UXB I;  4K0K I;  3B78 A;  1Z59 A;  4DR4 I;  4X66 I;  2VQF E;  2BV3 A;  4UT4 A;  4DV1 I;  4GKK I;  4NXM I;  1FKA E;  4FN5 A;  1XHK A;  3ZZ0 A;  3T1H I;  2HHH E;  4NXN E;  5LMU I;  4XTJ A;  4MYU A;  1HNW E;  2UUC E;  4KQV A;  4M1K A;  4LFA I;  2ZM6 I;  4ZVI A;  1KTV A;  2XEX A;  4USK A;  3QT6 A;  2UU9 I;  4OX9 E;  1N36 E;  4DV2 E;  4P52 A;  2UXC I;  4LF9 E;  2A2D A;  4JI0 I;  4DPY A;  4DV0 I;  3T1Y E;  1FJG I;  1EI1 A;  4LF4 E;  4HYM A;  4KHP E;  4DU8 A;  2R42 A;  4PRX A;  4DR3 I;  2X36 A;  3H4L A;  1MG7 A;  3LTO A;  4JV5 E;  3B8H A;  4JI3 E;  5GME A;  2HFS A;  3QT5 A;  3JAM C;  1XNR I;  4DV4 I;  1OJ4 A;  3QT8 A;  4DR6 I;  4DR7 I;  1S16 A;  2DEJ A;  3WU5 A;  4I3H A;  2UUA I;  4LF8 I;  3F0N A;  2WW4 A;  1H7U A;  1J5E E;  1PVG A;  2F4V E;  3J81 Q;  4DR5 E;  1FWK A;  5FLX C;  4PRV A;  2J7K A;  4USM A;  1Z0E A;  1KKH A;  1Z5B A;  2VQF I;  1A6F A;  1B63 A;  1Z0T A;  2GS8 A;  3ZKB A;  2V2Z A;  1ZM3 A;  1N34 E;  1Z0W A;  3M6A A;  1RRE A;  2HHH I;  4NXN I;  1HNW I;  4B3T E;  2UUC I;  3PYE A;  3J80 C;  4JI1 I;  1NZ0 A;  5BR8 I;  1I94 E;  5IT9 C;  1ELO A;  4DPX A;  3PYG A;  4FWG A;  4OX9 I;  4JI7 I;  1ZXM A;  1N36 I;  4X65 E;  3K1J A;  4DV2 I;  4URL A;  4JI1 E;  4LF9 I;  4JI4 E;  4DV6 E;  2HK3 A;  2OI2 A;  4JYA E;  5GMD A;  3K17 A;  3T1Y I;  3B82 A;  3GON A;  4LF4 I;  2ZBK B;  1HNZ E;  2A2C A;  4KHP I;  4JI7 E;  4JV5 I;  4R1F A;  2V8P A;  1NHH A;  4JI3 I;  1Z0V A;  4JI8 E;  1MU5 A;  3LPS A;  1MX0 A;  4HY1 A;  4X64 E;  1N32 E;  3WU4 A;  1HNX E;  4DU7 A;  4YHH E;  1ZXN A;  2EFG A;  1N33 E;  4LFB E;  4LF6 E;  3V5R A;  4WUD A;  4Z7Y A;  1XMO E;  1Z0B A;  5IWA E;  4HAC A;  3OTO E;  1J5E I;  2F4V I;  4DPW A;  4DR5 I;  3V2U C;  4DUZ E;  2UXD E;  2E5L E;  1IBK I;  1HR0 E;  4YY3 E;  1KVK A;  3WU6 A;  1FNM A;  1K47 A;  2VQE E;  2BM1 A;  4P7A A;  5A2Q Q;  4JI5 E;  1IBL I;  5BR8 E;  1IBK E;  1N34 I;  1XNQ E;  1IBM I;  1ZM2 A;  1H73 A;  4B3T I;  4X62 E;  4LFC E;  1Z0C A;  3WU3 A;  3D4J A;  1PKP A;  4AQY E;  4JI6 E;  1KIJ A;  1I94 I;  3J7A M;  1DAR A;  1IBL E;  4GKJ E;  1IBM E;  4DV7 E;  2HFU A;  4FWD A;  3ZM7 A;  4ED4 A;  3Q1Q A;  4DPU A;  4LF7 E;  4DR2 E;  4X65 I;  1XMQ E;  1EA6 A;  4B3R E;  1H74 A;  4JI4 I;  4DV6 I;  4B3M E;  3J81 C;  4JYA I;  4DR1 E;  4EMD A;  1HNZ I;  5LL6 R;  1N0U A;  4DV3 I;  4JI2 E;  1NHJ A;  4DV5 E;  5L3J A;  4JI8 I;  1N0V C;  3HUL A;  4B3S I;  4X64 I;  4LF5 E;  1N32 I;  4HXZ A;  1HNX I;  4YHH I;  2UUB E;  1N33 I;  4DV3 E;  4LFB I;  2UXB E;  2V34 A;  4K0K E;  4DXL A;  3ZKD A;  4LF6 I;  3PYD A;  4DR4 E;  4X66 E;  4DV1 E;  4GKK E;  1XMO I;  4NXM E;  1S4E A;  5IWA I;  3JAM Q;  4B3S E;  1ZM9 A;  3OTO I;  1NHI A;  2CZ9 A;  3T1H E;  2HKE A;  4HAC B;  5LMU E;  4DUZ I;  2V2V A;  1Z0G A;  2E1R A;  2UXD I;  2E5L I;  2DEI A;  1UEK A;  4RPF A;  1HR0 I;  4UTG A;  1WUU A;  1QZR A;  4Z7C A;  4YY3 I;  4LFA E;  2ZM6 E;  2ZIT A;  2R3V A;  3J7A G;  2VQE I;  4MYT A;  5FLX Q;  1ZM4 A;  2UU9 E;  1Z5C A;  4JI5 I;  4DPT A;  1RR9 A; 
#chains in the Genus database with same CATH topology
 1XNQ I;  2UXC E;  1UDO A;  4FW9 A;  2LJP A;  3QT7 A;  3P76 A;  4JI0 E;  2AJ4 A;  4DV0 E;  4BA1 B;  1D6T A;  4X62 I;  4LFC I;  1FJG E;  4AID A;  4GQU A;  4AQY I;  4JI6 I;  3ZZU A;  4MU4 A;  4DR3 E;  4GKJ I;  4DV7 I;  2AE8 A;  4IZJ D;  1B62 A;  4OO1 B;  4OO1 E;  4MU3 A;  4LF7 I;  4DR2 I;  2O3Z A;  2WP8 A;  3J80 Q;  1XMQ I;  2VF3 A;  2CVE A;  5ELW A;  4B3R I;  5LMN I;  4OO1 F;  1XNR E;  1VIS A;  4DV4 E;  2PO0 B;  2C39 A;  4WUC A;  4B3M I;  2BA0 G;  3PYF A;  4DR1 I;  1U2R A;  5IT9 Q;  2BM0 A;  4FWH A;  4DR6 E;  1BKN A;  4DR7 E;  4U3B A;  4PU9 A;  4DUY I;  2NPF A;  2NN6 B;  2NN6 E;  2V2Q A;  1H7S A;  2X7I A;  2UUA E;  4JI2 I;  4LF8 E;  2HKJ A;  4DV5 I;  2J65 A;  5LMN E;  2NN6 F;  3CWV A;  3ZZT A;  4IFD B;  4IFD E;  1FI4 A;  1H72 C;  2IER A;  1OYS A;  4ISA A;  3HJC A;  1PIE A;  3B4T A;  3NZK A;  4LF5 I;  4JG4 A;  5A2Q C;  4QNJ A;  2Q2E B;  1Z5A A;  2Z5E A;  3GLL A;  5JEA A;  4IZJ A;  4DUY E;  2JEA A;  3LNU A;  4LCG A;  1FWL A;  2UUB I;  4IFD F;  2HK2 A;  4WUB A;  2UXB I;  4K0K I;  3B78 A;  3GME A;  1Z59 A;  4AIM A;  4DR4 I;  4X66 I;  2VQF E;  2BV3 A;  4UT4 A;  4DV1 I;  4GKK I;  4FW5 A;  4NXM I;  1FKA E;  4FN5 A;  1XHK A;  4FW7 A;  3ZZ0 A;  4U3D A;  3T1H I;  3PRY A;  2HHH E;  5C0X A;  4NXN E;  5LMU I;  5K36 A;  4XTJ A;  4MYU A;  1HNW E;  1XXE A;  2UUC E;  5DNX A;  4KQV A;  4M1K A;  4LFA I;  4MQY A;  2ZM6 I;  4ZVI A;  1KTV A;  2O1V A;  2XEX A;  4USK A;  3QT6 A;  2UU9 I;  4OX9 E;  4LCH A;  1N36 E;  4J3D A;  4DV2 E;  4P52 A;  5FWK A;  2UXC I;  1UDQ A;  4BA2 A;  4LF9 E;  1YHC A;  2A2D A;  4JI0 I;  4DPY A;  4DV0 I;  2IOQ A;  3P3G A;  2PNZ B;  4LPF A;  3T1Y E;  1FJG I;  1EI1 A;  4LF4 E;  2C38 A;  4HYM A;  4KHP E;  3Q6M A;  3DD6 A;  4DU8 A;  2R42 A;  4PRX A;  4DR3 I;  2X36 A;  4MDT A;  3H4L A;  1MG7 A;  3LTO A;  4JV5 E;  3B8H A;  1OYR A;  4JI3 E;  5GME A;  2HFS A;  3QT5 A;  3U1Y A;  3P3E A;  3M85 G;  3JAM C;  1Y5Y A;  5DRQ A;  1XNR I;  4DV4 I;  1OJ4 A;  2WP8 B;  2IOP A;  3PS1 A;  3QT8 A;  3H1C A;  1R6L A;  4DR6 I;  2C39 B;  3PS2 A;  4DR7 I;  4FW3 A;  5JEA D;  1S16 A;  2DEJ A;  3CDI A;  4IZK B;  4I3H A;  3WU5 A;  2UUA I;  3U1K A;  4LF8 I;  3F0N A;  2F1D A;  2WW4 A;  1H7U A;  1J5E E;  1PVG A;  2F4V E;  3J81 Q;  4DR5 E;  1FWK A;  4FW6 A;  5FLX C;  2Z5C A;  1E3H A;  2O1W A;  4PRV A;  2J7K A;  5C0X D;  4USM A;  5K36 D;  1Z0E A;  1KKH A;  4IZJ B;  1Z5B A;  2VQF I;  1A6F A;  1B63 A;  2C37 A;  1Z0T A;  2GS8 A;  3ZKB A;  3UHM A;  2V2Z A;  1USV A;  2JEB A;  1ZM3 A;  2BR2 B;  1N34 E;  1Z0W A;  3GCM A;  3L7Z A;  3M6A A;  4MU1 A;  1RRE A;  2HHH I;  4NXN I;  1Y4S A;  1HNW I;  4LOM A;  4B3T E;  2UUC I;  3PYE A;  3J80 C;  4JI1 I;  1NZ0 A;  5K36 B;  2JE6 B;  5BR8 I;  5JEA C;  1I94 E;  5IT9 C;  1ELO A;  4DPX A;  3PYG A;  2PO2 B;  2WNR B;  4QNK A;  4FWG A;  4OX9 I;  4JI7 I;  1ZXM A;  1N36 I;  4X65 E;  4IFD A;  3K1J A;  4DV2 I;  4URL A;  4JI1 E;  4LF9 I;  2PNL A;  4JI4 E;  4OKG A;  4DV6 E;  2HK3 A;  2OI2 A;  4JYA E;  5C0X C;  5GMD A;  4BA2 B;  3K17 A;  5K36 C;  3T1Y I;  3B82 A;  3GON A;  4LF4 I;  2ZBK B;  2BA1 D;  2A2C A;  1HNZ E;  4KHP I;  4JI7 E;  4FW4 A;  4JV5 I;  2C38 B;  4R1F A;  2V8P A;  1NHH A;  4JI3 I;  1Z0V A;  4JI8 E;  1MU5 A;  2GO4 A;  5DNL A;  3P3C A;  5EKW A;  2PO1 A;  2Z5B A;  4LCF A;  1HK7 A;  1MX0 A;  3LPS A;  4HY1 A;  4X64 E;  1N32 E;  3WU4 A;  2IES A;  4DPT A;  1Y4U A;  1HNX E;  4DU7 A;  1VI7 A;  1R6M A;  4YHH E;  1ZXN A;  1RR9 A;  1N33 E;  4LFB E;  3M7N D;  4LF6 E;  4IS9 A;  3V5R A;  4WUD A;  4Z7Y A;  1XMO E;  1Z0B A;  2O1T A;  5IWA E;  4HAC A;  3OTO E;  1J5E I;  2CGE A;  2F4V I;  4DPW A;  4DR5 I;  3V2U C;  4DUZ E;  2UXD E;  2E5L E;  4OO1 D;  1IBK I;  3KRN A;  2Z5C B;  1HR0 E;  2PNZ A;  4YY3 E;  1KVK A;  3WU6 A;  3Q6N A;  1FNM A;  1K47 A;  2VQE E;  3PS3 A;  4AM3 A;  2BM1 A;  4P7A A;  5A2Q Q;  4JI5 E;  2C37 B;  1IBL I;  5DRR A;  2NN6 D;  1RHY A;  5BR8 E;  1IBK E;  2BA0 D;  1N34 I;  4N3O A;  1IBM I;  1XNQ E;  4BA1 A;  1ZM2 A;  3HKM A;  2VES A;  2JEB B;  5JEA B;  2JEA B;  1H73 A;  5JEA E;  3L7Z B;  4B3T I;  1UDS A;  4IFD D;  4X62 E;  4LFC E;  1Z0C A;  3WU3 A;  3D4J A;  1P42 A;  1PKP A;  4AQY E;  5EL9 A;  5JEA F;  4JI6 E;  1KIJ A;  1I94 I;  4OO1 A;  3J7A M;  1DAR A;  1IBL E;  4IZK A;  4GKJ E;  1IBM E;  4DV7 E;  2HFU A;  4FWD A;  3ZM7 A;  4ED4 A;  3Q1Q A;  4DPU A;  4LF7 E;  2PO0 A;  1UDN A;  4DR2 E;  4X65 I;  1XMQ E;  1USU A;  5C0X B;  5C0X E;  4OO1 C;  1EA6 A;  5DRP A;  4B3R E;  5K36 E;  2CG9 A;  1H74 A;  4JI4 I;  5DRO A;  4DV6 I;  3J81 C;  4B3M E;  4JYA I;  4DR1 E;  2NN6 A;  5C0X F;  5K36 F;  4EMD A;  1HNZ I;  5LL6 R;  1N0U A;  4DV3 I;  4JI2 E;  1NHJ A;  1OYP A;  1E3P A;  2GO3 A;  4DV5 E;  5L3J A;  2NN6 C;  4JI8 I;  2BR2 A;  1N0V C;  3HUL A;  4B3S I;  3CDJ A;  4X64 I;  4LF5 E;  1N32 I;  1Y60 A;  4HXZ A;  4IFD C;  1HNX I;  2PO1 B;  2Z5B B;  3P06 A;  4YHH I;  2UUB E;  1N33 I;  4DV3 E;  4LFB I;  2UXB E;  2V34 A;  4K0K E;  4DXL A;  2JE6 A;  3ZKD A;  4LF6 I;  3PYD A;  3K85 A;  4DR4 E;  4X66 E;  4NBQ A;  2GQ0 A;  1YH8 A;  4DV1 E;  4GKK E;  4MU0 A;  1XMO I;  4NXM E;  1S4E A;  5IWA I;  3JAM Q;  1Y6Z A;  2BA1 G;  4B3S E;  2PO2 A;  2WNR A;  1ZM9 A;  3OTO I;  4OZE A;  1NHI A;  2CZ9 A;  3T1H E;  2HKE A;  4HAC B;  5LMU E;  2V2V A;  1Z0G A;  2E1R A;  4DUZ I;  2UXD I;  2E5L I;  2DEI A;  1UEK A;  4RPF A;  1HR0 I;  4UTG A;  1WUU A;  1QZR A;  2O1U A;  4Z7C A;  4YY3 I;  4LFA E;  2ZM6 E;  2ZIT A;  2R3V A;  3J7A G;  2VQE I;  4MYT A;  3M7N G;  2PNM A;  5FLX Q;  3M85 D;  2UU9 E;  2JT2 A;  1Z5C A;  4JI5 I;  1ZM4 A;  2EFG A; 
#chains in the Genus database with same CATH homology
 1XNQ I;  2UXC E;  4FW9 A;  2LJP A;  3QT7 A;  4JI0 E;  2AJ4 A;  4DV0 E;  1D6T A;  4X62 I;  4LFC I;  1FJG E;  4AQY I;  4JI6 I;  3ZZU A;  4DR3 E;  4GKJ I;  4DV7 I;  4IZJ D;  1B62 A;  4LF7 I;  4DR2 I;  3J80 Q;  1XMQ I;  2VF3 A;  4B3R I;  5LMN I;  1XNR E;  1VIS A;  4DV4 E;  4WUC A;  4B3M I;  3PYF A;  4DR1 I;  1U2R A;  5IT9 Q;  2BM0 A;  4FWH A;  4DR6 E;  1BKN A;  4DR7 E;  4PU9 A;  4DUY I;  2NPF A;  2V2Q A;  1H7S A;  2X7I A;  2UUA E;  4JI2 I;  4LF8 E;  2HKJ A;  4DV5 I;  5LMN E;  3CWV A;  3ZZT A;  1FI4 A;  1H72 C;  3HJC A;  1PIE A;  4LF5 I;  4JG4 A;  5A2Q C;  2Q2E B;  1Z5A A;  2Z5E A;  4IZJ A;  4DUY E;  3LNU A;  1FWL A;  2UUB I;  2HK2 A;  4WUB A;  2UXB I;  4K0K I;  3B78 A;  1Z59 A;  4DR4 I;  4X66 I;  2VQF E;  2BV3 A;  4UT4 A;  4DV1 I;  4GKK I;  4NXM I;  1FKA E;  4FN5 A;  1XHK A;  3ZZ0 A;  3T1H I;  3PRY A;  2HHH E;  4NXN E;  5LMU I;  4XTJ A;  4MYU A;  1HNW E;  2UUC E;  4KQV A;  4M1K A;  4LFA I;  2ZM6 I;  4ZVI A;  1KTV A;  2O1V A;  2XEX A;  4USK A;  3QT6 A;  2UU9 I;  4OX9 E;  1N36 E;  4DV2 E;  4P52 A;  5FWK A;  2UXC I;  4LF9 E;  2A2D A;  4JI0 I;  4DPY A;  4DV0 I;  2IOQ A;  3T1Y E;  1FJG I;  1EI1 A;  4LF4 E;  4HYM A;  4KHP E;  3Q6M A;  4DU8 A;  2R42 A;  4PRX A;  4DR3 I;  2X36 A;  3H4L A;  1MG7 A;  3LTO A;  4JV5 E;  3B8H A;  4JI3 E;  5GME A;  2HFS A;  3QT5 A;  3JAM C;  1XNR I;  4DV4 I;  1OJ4 A;  2IOP A;  3QT8 A;  4DR6 I;  4DR7 I;  1S16 A;  2DEJ A;  4IZK B;  4I3H A;  3WU5 A;  2UUA I;  4LF8 I;  3F0N A;  2WW4 A;  1H7U A;  1J5E E;  1PVG A;  2F4V E;  3J81 Q;  4DR5 E;  1FWK A;  5FLX C;  2Z5C A;  2O1W A;  4PRV A;  2J7K A;  4USM A;  1Z0E A;  1KKH A;  4IZJ B;  1Z5B A;  2VQF I;  1A6F A;  1B63 A;  1Z0T A;  2GS8 A;  3ZKB A;  2V2Z A;  1USV A;  1ZM3 A;  1N34 E;  1Z0W A;  3M6A A;  1RRE A;  2HHH I;  4NXN I;  1Y4S A;  1HNW I;  4B3T E;  2UUC I;  3PYE A;  3J80 C;  4JI1 I;  1NZ0 A;  5BR8 I;  1I94 E;  5IT9 C;  1ELO A;  4DPX A;  3PYG A;  4FWG A;  4OX9 I;  4JI7 I;  1ZXM A;  1N36 I;  4X65 E;  3K1J A;  4DV2 I;  4URL A;  4JI1 E;  4LF9 I;  2PNL A;  4JI4 E;  4DV6 E;  2HK3 A;  2OI2 A;  4JYA E;  5GMD A;  3K17 A;  3T1Y I;  3B82 A;  3GON A;  4LF4 I;  2ZBK B;  1HNZ E;  2A2C A;  4KHP I;  4JI7 E;  4JV5 I;  4R1F A;  2V8P A;  1NHH A;  4JI3 I;  1Z0V A;  4JI8 E;  1MU5 A;  2Z5B A;  1HK7 A;  1MX0 A;  3LPS A;  4HY1 A;  4X64 E;  1N32 E;  3WU4 A;  1Y4U A;  1HNX E;  4DU7 A;  4YHH E;  1ZXN A;  1RR9 A;  1N33 E;  4LFB E;  4LF6 E;  3V5R A;  4WUD A;  4Z7Y A;  1XMO E;  1Z0B A;  2O1T A;  5IWA E;  4HAC A;  3OTO E;  1J5E I;  2CGE A;  2F4V I;  4DPW A;  4DR5 I;  3V2U C;  4DUZ E;  2UXD E;  2E5L E;  1IBK I;  2Z5C B;  1HR0 E;  4YY3 E;  1KVK A;  3WU6 A;  3Q6N A;  1FNM A;  1K47 A;  2VQE E;  2BM1 A;  4P7A A;  5A2Q Q;  4JI5 E;  1IBL I;  5BR8 E;  1IBK E;  1N34 I;  1XNQ E;  4N3O A;  1IBM I;  1ZM2 A;  1H73 A;  4B3T I;  4X62 E;  4LFC E;  1Z0C A;  3WU3 A;  3D4J A;  1PKP A;  4AQY E;  4JI6 E;  1KIJ A;  1I94 I;  3J7A M;  1DAR A;  1IBL E;  4IZK A;  4GKJ E;  1IBM E;  4DV7 E;  2HFU A;  4FWD A;  3ZM7 A;  4ED4 A;  3Q1Q A;  4DPU A;  4LF7 E;  4DR2 E;  4X65 I;  1XMQ E;  1USU A;  1EA6 A;  4B3R E;  2CG9 A;  1H74 A;  4JI4 I;  4DV6 I;  4B3M E;  3J81 C;  4JYA I;  4DR1 E;  4EMD A;  1HNZ I;  5LL6 R;  1N0U A;  4DV3 I;  4JI2 E;  1NHJ A;  4DV5 E;  5L3J A;  4JI8 I;  1N0V C;  3HUL A;  4B3S I;  4X64 I;  4LF5 E;  1N32 I;  4HXZ A;  1HNX I;  2Z5B B;  3P06 A;  4YHH I;  2UUB E;  1N33 I;  4DV3 E;  4LFB I;  2UXB E;  2V34 A;  4K0K E;  4DXL A;  3ZKD A;  4LF6 I;  3PYD A;  3K85 A;  4DR4 E;  4X66 E;  2GQ0 A;  4DV1 E;  4GKK E;  1XMO I;  4NXM E;  1S4E A;  5IWA I;  3JAM Q;  1Y6Z A;  4B3S E;  1ZM9 A;  3OTO I;  1NHI A;  2CZ9 A;  3T1H E;  2HKE A;  4HAC B;  5LMU E;  4DUZ I;  2V2V A;  1Z0G A;  2E1R A;  2UXD I;  2E5L I;  2DEI A;  1UEK A;  4RPF A;  1HR0 I;  4UTG A;  1WUU A;  1QZR A;  2O1U A;  4Z7C A;  4YY3 I;  4LFA E;  2ZM6 E;  2ZIT A;  2R3V A;  3J7A G;  2VQE I;  4MYT A;  2PNM A;  5FLX Q;  1ZM4 A;  2UU9 E;  1Z5C A;  4JI5 I;  4DPT A;  2EFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...