2C37A

Rnase ph core of the archaeal exosome in complex with u8 rna
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
260
Chain Sequence
b'MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 76
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c37A01
5C0XF 4NBQA 2WNRB 3CDJA 2PNZA 4IFDA 1UDOA 2C37A 4BA1A 4IFDE 5K36B 2PO0B 5C0XE 5C0XC 1OYRA 4AIMA 1E3PA 3GMEA 5JEAF 2WP8B 1OYPA 5C0XB 2WNRA 2C38B 4BA2B 4AM3A 1UDNA 2C39B 5JEAC 1R6MA 2JE6B 2PO0A 5K36A 3B4TA 5K36E 2PO1B 5K36C 3GCMA 5JEAB 3M85G 2WP8A 4BA2A 5C0XA 2C38A 3M85D 4OO1D 3KRNA 3U1KA 2C39A 2BA0G 2JE6A 2PO1A 2BA1G 3GLLA 2NN6D 5JEAA 5JEAE 1UDQA 3M7NG 4OO1F 4IFDD 2NN6F 3H1CA 2JEAB 2BA0D 1OYSA 2PO2B 3L7ZB 4OO1B 5K36D 2BA1D 4IFDF 1E3HA 3DD6A 2BR2B 3M7ND 5C0XD 2JEAA 1R6LA 2JEBB 2NN6B 4IFDC 2PO2A 3L7ZA 4OO1A 1UDSA 4OO1E 4OO1C 2PNZB 4IFDB 2C37B 4BA1B 5K36F 3HKMA 2BR2A 5JEAD 3CDIA 2JEBA 2NN6A 4AIDA 2NN6E 2NN6C
chains in the Genus database with same CATH superfamily
1IBKI 4GQUA 4MU0A 2WNRB 2IOPA 4DV4I 4XTJA 1UDOA 4MYUA 1IBKE 2VF3A 4WUBA 1D6TA 4IFDE 4B3MI 3ZKBA 4AIMA 3J81Q 2ZBKB 3GMEA 5LMUI 3OTOE 4B3ME 2CVEA 4LF6E 1FJGI 2UXBE 2C38B 5FLXQ 5LMUE 2Z5BA 3ZZTA 1FJGE 3J80Q 1UDNA 2JT2A 2JE6B 2PO0A 1YH8A 1Z5BA 2R3VA 2PO1B 3QT7A 3T1YI 1Y4UA 5JEAB 4FW9A 1HNXI 4WUCA 2O1VA 2HFUA 4DR2E 4X65E 4JI0I 1HNXE 2UUAE 3Q6MA 4K0KI 1HR0I 4LF9I 1H74A 2HKJA 4JI0E 3WU5A 4DR6I 4K0KE 4IS9A 1HR0E 1S16A 3GLLA 4UT4A 2E5LE 2J65A 5JEAE 4DR6E 3QT8A 3LNUA 4DV1E 1S4EA 1J5EI 2Q2EB 4OO1F 4IFDD 4LF8I 3H4LA 1OJ4A 1XXEA 2HK3A 4USMA 1IBMI 2V34A 3LPSA 4FN5A 4MU1A 2O1WA 3K17A 1YHCA 4MU3A 4P7AA 5BR8I 2BA0D 1OYSA 4DR4I 1RR9A 2VQFE 5BR8E 4QNJA 4DR7I 4DR4E 1U2RA 1MU5A 1VI7A 3DD6A 4DR7E 4X64I 1N33I 3M7ND 1WUUA 2JEAA 1QZRA 2JEBB 2NN6B 1XHKA 1USVA 3LTOA 3M6AA 2PO2A 1N33E 1HNWI 3L7ZA 4DPYA 1UDSA 1NHIA 4LFAI 2ZM6I 1N32I 1XMOI 4DPUA 5JEAD 3JAMQ 4RPFA 2NN6E 4NXMI 4UTGA 5C0XF 1A6FA 1ZM3A 4JI6I 5DRQA 4FWDA 1KIJA 1Y6ZA 3PYEA 2Z5BB 4FWHA 4J3DA 4IZJA 4JI6E 2C37A 4BA1A 3HJCA 2F4VI 2CG9A 1Z5CA 2PO0B 5C0XC 2BV3A 1FKAE 1B62A 2GS8A 4DU7A 4DV6I 1FWLA 1PKPA 4AM3A 2PNMA 4AQYI 3V5RA 2F1DA 3K85A 4DV6E 4LF5E 4X65I 4LFCI 1Z59A 1N34E 4AQYE 5K36A 5IT9C 1USUA 3B4TA 1XNRE 5K36C 3ZZ0A 3GCMA 4LFCE 4MDTA 1I94E 1Y5YA 3P06A 4URLA 2J7KA 2UXDI 4LPFA 4BA2A 2V8PA 3M85D 4LF4I 4ZVIA 4NXNE 3OTOI 4LF6I 4DUYE 2UXDE 2UXBI 4LF4E 2BA0G 2HFSA 4MYTA 2NN6D 5DRPA 1RREA 1N0UA 4GKJE 2R42A 4OZEA 5A2QC 4FW5A 1Z0GA 3M7NG 4M1KA 5GMDA 1IBLI 4ED4A 3J7AG 4JI1I 4DR2I 4B3RE 4HY1A 4QNKA 3P3EA 3V2UC 1IBLE 2UUAI 3WU6A 1KKHA 4JI1E 4LCFA 1MX0A 3U1YA 4DUZE 4JYAE 1ZXNA 3H1CA 2E5LI 4IZKA 2JEAB 3J81C 4B3TE 4DV2I 2PO2B 4DR1I 1KTVA 2NPFA 3L7ZB 4DV5E 5FLXC 4DV1I 1MG7A 2V2QA 4DV2E 4IFDF 4DR1E 1E3HA 2HHHI 4ISAA 2HHHE 4IFDC 4Z7CA 4DPXA 4JI5I 4OO1A 4PU9A 5EKWA 3HULA 4OO1C 2WW4A 2VQFI 4JI5E 4IZJB 2C37B 4BA1B 4X62I 1XNQE 4Z7YA 3WU4A 2OI2A 2BR2A 3K1JA 4X62E 5LMNE 4DV7E 1P42A 1Y4SA 1Z0BA 2GO4A 3CDJA 1N0VC 2PNZA 1VISA 3P76A 4DPWA 5K36B 5C0XE 5EL9A 1Z0VA 4PRVA 3ZM7A 5JEAF 2A2DA 4JI8I 4X66E 2O1TA 2X7IA 1OYPA 4BA2B 5ELWA 4JI8E 4DXLA 2O1UA 5JEAC 1R6MA 4B3SI 2AJ4A 1B63A 5K36E 1BKNA 3P3CA 1H73A 4JI4E 4B3SE 2WP8A 4JI3E 4LCHA 5C0XA 2PNLA 2HK2A 3U1KA 4YHHI 4JI2E 2C39A 2E1RA 2IERA 1Z0TA 2VQEI 4YHHE 4LF5I 5IT9Q 2CZ9A 2XEXA 1N34I 1NHJA 4HACA 2UUBE 2VQEE 2A2CA 1XNRI 3F0NA 4IZKB 1I94I 4DV3E 3T1HE 1N36E 4IZJD 1DARA 4JG4A 4NXNI 2UUCI 4DUYI 1H7SA 4LFBI 4DR5I 5DNLA 3Q1QA 4KQVA 2UUCE 3PS2A 1FWKA 2HKEA 4LFBE 2NN6F 4YY3E 4DR5E 2V2ZA 2ZITA 1PVGA 3PYGA 1NZ0A 1UEKA 3P3GA 5IWAE 4GKJI 2Z5CA 3QT6A 1HK7A 4OO1B 2DEIA 3GONA 5K36D 2BA1D 1Z0WA 4WUDA 4FW4A 4JI7E 4B3RI 1Y60A 2BR2B 1NHHA 4LF7I 1H72C 3B82A 4I3HA 3PRYA 4DUZI 2GQ0A 4PRXA 4DV4E 4JYAI 4U3DA 4OKGA 4N3OA 4LF7E 2X36A 4DPTA 2UU9I 4B3TI 1EA6A 4OO1E 2GO3A 2PNZB 1ZM4A 3WU3A 2UU9E 4DV5I 4MU4A 1KVKA 2Z5EA 4R1FA 1Z0EA 4AIDA 2IOQA 4NBQA 3UHMA 3B78A 3J80C 2CGEA 4JV5I 4IFDA 3T1YE 1OYRA 1Z0CA 4JV5E 1E3PA 5DNXA 4DU8A 1XNQI 4EMDA 2WP8B 3Q6NA 3NZKA 5C0XB 2WNRA 5LMNI 4LF9E 4DV7I 2C39B 3ZKDA 2O3ZA 1ELOA 4P52A 1ZM9A 4LOMA 5DRRA 4HYMA 4HACB 4KHPI 3M85G 1J5EE 2UXCI 2C38A 4LF8E 4OO1D 3KRNA 3J7AM 4KHPE 4X66I 1IBME 2UXCE 2JE6A 1EI1A 2BM1A 4FW3A 2PO1A 3ZZUA 2BA1G 2BM0A 5JEAA 5GMEA 4USKA 2EFGA 4MQYA 1UDQA 4JI4I 2IESA 5L3JA 3B8HA 2Z5CB 4JI3I 5DROA 1HNZI 4X64E 4JI2I 1HNZE 2AE8A 1HNWE 4OX9I 4LFAE 1K47A 2ZM6E 2UUBI 3CWVA 4OX9E 4FW7A 1N32E 1XMOE 4LCGA 1XMQI 1RHYA 2DEJA 3QT5A 1ZM2A 5FWKA 4DV3I 3T1HI 1N36I 1XMQE 3JAMC 1Z5AA 4DR3I 4NXME 2V2VA 3PS1A 2LJPA 3PYFA 5C0XD 1R6LA 4DR3E 4GKKI 2F4VE 1H7UA 4YY3I 4HXZA 1FNMA 5IWAI 4GKKE 4DV0I 5LL6R 4IFDB 3D4JA 5K36F 4U3BA 3HKMA 4FWGA 5A2QQ 1PIEA 3PYDA 3CDIA 4DV0E 2VESA 4JI7I 3PS3A 1ZXMA 1FI4A 2JEBA 2NN6A 4FW6A 2NN6C
chains in the Genus database with same CATH topology
5C0XF 4NBQA 2WNRB 3CDJA 2PNZA 4IFDA 1UDOA 2C37A 4BA1A 4IFDE 5K36B 2PO0B 5C0XE 5C0XC 1OYRA 4AIMA 1E3PA 3GMEA 5JEAF 2WP8B 1OYPA 5C0XB 2WNRA 2C38B 4BA2B 4AM3A 1UDNA 2C39B 5JEAC 1R6MA 2JE6B 2PO0A 5K36A 3B4TA 5K36E 2PO1B 5K36C 3GCMA 5JEAB 3M85G 2WP8A 4BA2A 5C0XA 2C38A 3M85D 4OO1D 3KRNA 3U1KA 2C39A 2BA0G 2JE6A 2PO1A 2BA1G 3GLLA 2NN6D 5JEAA 5JEAE 1UDQA 3M7NG 4OO1F 4IFDD 2NN6F 3H1CA 2JEAB 2BA0D 1OYSA 2PO2B 3L7ZB 4OO1B 5K36D 2BA1D 4IFDF 1E3HA 3DD6A 2BR2B 3M7ND 5C0XD 2JEAA 1R6LA 2JEBB 2NN6B 4IFDC 2PO2A 3L7ZA 4OO1A 1UDSA 4OO1E 4OO1C 2PNZB 4IFDB 2C37B 4BA1B 5K36F 3HKMA 2BR2A 5JEAD 3CDIA 2JEBA 2NN6A 4AIDA 2NN6E 2NN6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X F;  4NBQ A;  2WNR B;  3CDJ A;  2PNZ A;  4IFD A;  1UDO A;  2C37 A;  4BA1 A;  4IFD E;  5K36 B;  2PO0 B;  5C0X E;  5C0X C;  1OYR A;  4AIM A;  1E3P A;  3GME A;  5JEA F;  2WP8 B;  1OYP A;  5C0X B;  2WNR A;  2C38 B;  4BA2 B;  4AM3 A;  1UDN A;  2C39 B;  5JEA C;  1R6M A;  2JE6 B;  2PO0 A;  5K36 A;  3B4T A;  5K36 E;  2PO1 B;  5K36 C;  3GCM A;  5JEA B;  3M85 G;  2WP8 A;  4BA2 A;  5C0X A;  2C38 A;  3M85 D;  4OO1 D;  3KRN A;  3U1K A;  2C39 A;  2BA0 G;  2JE6 A;  2PO1 A;  2BA1 G;  3GLL A;  2NN6 D;  5JEA A;  5JEA E;  1UDQ A;  3M7N G;  4OO1 F;  4IFD D;  2NN6 F;  3H1C A;  2JEA B;  2BA0 D;  1OYS A;  2PO2 B;  3L7Z B;  4OO1 B;  5K36 D;  2BA1 D;  4IFD F;  1E3H A;  3DD6 A;  2BR2 B;  3M7N D;  5C0X D;  2JEA A;  1R6L A;  2JEB B;  2NN6 B;  4IFD C;  2PO2 A;  3L7Z A;  4OO1 A;  1UDS A;  4OO1 E;  4OO1 C;  2PNZ B;  4IFD B;  2C37 B;  4BA1 B;  5K36 F;  3HKM A;  2BR2 A;  5JEA D;  3CDI A;  2JEB A;  2NN6 A;  4AID A;  2NN6 E;  2NN6 C; 
#chains in the Genus database with same CATH topology
 1IBK I;  4GQU A;  4MU0 A;  2WNR B;  2IOP A;  4DV4 I;  4XTJ A;  1UDO A;  4MYU A;  1IBK E;  2VF3 A;  4WUB A;  1D6T A;  4IFD E;  4B3M I;  3ZKB A;  4AIM A;  3J81 Q;  2ZBK B;  3GME A;  5LMU I;  3OTO E;  4B3M E;  2CVE A;  4LF6 E;  1FJG I;  2UXB E;  2C38 B;  5FLX Q;  5LMU E;  2Z5B A;  3ZZT A;  1FJG E;  3J80 Q;  1UDN A;  2JT2 A;  2JE6 B;  2PO0 A;  1YH8 A;  1Z5B A;  2R3V A;  2PO1 B;  3QT7 A;  3T1Y I;  1Y4U A;  5JEA B;  4FW9 A;  1HNX I;  4WUC A;  2O1V A;  2HFU A;  4DR2 E;  4X65 E;  4JI0 I;  1HNX E;  2UUA E;  3Q6M A;  4K0K I;  1HR0 I;  4LF9 I;  1H74 A;  2HKJ A;  4JI0 E;  3WU5 A;  4DR6 I;  4K0K E;  4IS9 A;  1HR0 E;  1S16 A;  3GLL A;  4UT4 A;  2E5L E;  2J65 A;  5JEA E;  4DR6 E;  3QT8 A;  3LNU A;  4DV1 E;  1S4E A;  1J5E I;  2Q2E B;  4OO1 F;  4IFD D;  4LF8 I;  3H4L A;  1OJ4 A;  1XXE A;  2HK3 A;  4USM A;  1IBM I;  2V34 A;  3LPS A;  4FN5 A;  4MU1 A;  2O1W A;  3K17 A;  1YHC A;  4MU3 A;  4P7A A;  5BR8 I;  2BA0 D;  1OYS A;  4DR4 I;  1RR9 A;  2VQF E;  5BR8 E;  4QNJ A;  4DR7 I;  4DR4 E;  1U2R A;  1MU5 A;  1VI7 A;  3DD6 A;  4DR7 E;  4X64 I;  1N33 I;  3M7N D;  1WUU A;  2JEA A;  1QZR A;  2JEB B;  2NN6 B;  1XHK A;  1USV A;  3LTO A;  3M6A A;  2PO2 A;  1N33 E;  1HNW I;  3L7Z A;  4DPY A;  1UDS A;  1NHI A;  4LFA I;  2ZM6 I;  1N32 I;  1XMO I;  4DPU A;  5JEA D;  3JAM Q;  4RPF A;  2NN6 E;  4NXM I;  4UTG A;  5C0X F;  1A6F A;  1ZM3 A;  4JI6 I;  5DRQ A;  4FWD A;  1KIJ A;  1Y6Z A;  3PYE A;  2Z5B B;  4FWH A;  4J3D A;  4IZJ A;  4JI6 E;  2C37 A;  4BA1 A;  3HJC A;  2F4V I;  2CG9 A;  1Z5C A;  2PO0 B;  5C0X C;  2BV3 A;  1FKA E;  1B62 A;  2GS8 A;  4DU7 A;  4DV6 I;  1FWL A;  1PKP A;  4AM3 A;  2PNM A;  4AQY I;  3V5R A;  2F1D A;  3K85 A;  4DV6 E;  4LF5 E;  4X65 I;  4LFC I;  1Z59 A;  1N34 E;  4AQY E;  5K36 A;  5IT9 C;  1USU A;  3B4T A;  1XNR E;  5K36 C;  3ZZ0 A;  3GCM A;  4LFC E;  4MDT A;  1I94 E;  1Y5Y A;  3P06 A;  4URL A;  2J7K A;  2UXD I;  4LPF A;  4BA2 A;  2V8P A;  3M85 D;  4LF4 I;  4ZVI A;  4NXN E;  3OTO I;  4LF6 I;  4DUY E;  2UXD E;  2UXB I;  4LF4 E;  2BA0 G;  2HFS A;  4MYT A;  2NN6 D;  5DRP A;  1RRE A;  1N0U A;  4GKJ E;  2R42 A;  4OZE A;  5A2Q C;  4FW5 A;  1Z0G A;  3M7N G;  4M1K A;  5GMD A;  1IBL I;  4ED4 A;  3J7A G;  4JI1 I;  4DR2 I;  4B3R E;  4HY1 A;  4QNK A;  3P3E A;  3V2U C;  1IBL E;  2UUA I;  3WU6 A;  1KKH A;  4JI1 E;  4LCF A;  1MX0 A;  3U1Y A;  4DUZ E;  4JYA E;  1ZXN A;  3H1C A;  2E5L I;  4IZK A;  2JEA B;  3J81 C;  4B3T E;  4DV2 I;  2PO2 B;  4DR1 I;  1KTV A;  2NPF A;  3L7Z B;  4DV5 E;  5FLX C;  4DV1 I;  1MG7 A;  2V2Q A;  4DV2 E;  4IFD F;  4DR1 E;  1E3H A;  2HHH I;  4ISA A;  2HHH E;  4IFD C;  4Z7C A;  4DPX A;  4JI5 I;  4OO1 A;  4PU9 A;  5EKW A;  3HUL A;  4OO1 C;  2WW4 A;  2VQF I;  4JI5 E;  4IZJ B;  2C37 B;  4BA1 B;  4X62 I;  1XNQ E;  4Z7Y A;  3WU4 A;  2OI2 A;  2BR2 A;  3K1J A;  4X62 E;  5LMN E;  4DV7 E;  1P42 A;  1Y4S A;  1Z0B A;  2GO4 A;  3CDJ A;  1N0V C;  2PNZ A;  1VIS A;  3P76 A;  4DPW A;  5K36 B;  5C0X E;  5EL9 A;  1Z0V A;  4PRV A;  3ZM7 A;  5JEA F;  2A2D A;  4JI8 I;  4X66 E;  2O1T A;  2X7I A;  1OYP A;  4BA2 B;  5ELW A;  4JI8 E;  4DXL A;  2O1U A;  5JEA C;  1R6M A;  4B3S I;  2AJ4 A;  1B63 A;  5K36 E;  1BKN A;  3P3C A;  1H73 A;  4JI4 E;  4B3S E;  2WP8 A;  4JI3 E;  4LCH A;  5C0X A;  2PNL A;  2HK2 A;  3U1K A;  4YHH I;  4JI2 E;  2C39 A;  2E1R A;  2IER A;  1Z0T A;  2VQE I;  4YHH E;  4LF5 I;  5IT9 Q;  2CZ9 A;  2XEX A;  1N34 I;  1NHJ A;  4HAC A;  2UUB E;  2VQE E;  2A2C A;  1XNR I;  3F0N A;  4IZK B;  1I94 I;  4DV3 E;  3T1H E;  1N36 E;  4IZJ D;  1DAR A;  4JG4 A;  4NXN I;  2UUC I;  4DUY I;  1H7S A;  4LFB I;  4DR5 I;  5DNL A;  3Q1Q A;  4KQV A;  2UUC E;  3PS2 A;  1FWK A;  2HKE A;  4LFB E;  2NN6 F;  4YY3 E;  4DR5 E;  2V2Z A;  2ZIT A;  1PVG A;  3PYG A;  1NZ0 A;  1UEK A;  3P3G A;  5IWA E;  4GKJ I;  2Z5C A;  3QT6 A;  1HK7 A;  4OO1 B;  2DEI A;  3GON A;  5K36 D;  2BA1 D;  1Z0W A;  4WUD A;  4FW4 A;  4JI7 E;  4B3R I;  1Y60 A;  2BR2 B;  1NHH A;  4LF7 I;  1H72 C;  3B82 A;  4I3H A;  3PRY A;  4DUZ I;  2GQ0 A;  4PRX A;  4DV4 E;  4JYA I;  4U3D A;  4OKG A;  4N3O A;  4LF7 E;  2X36 A;  4DPT A;  2UU9 I;  4B3T I;  1EA6 A;  4OO1 E;  2GO3 A;  2PNZ B;  1ZM4 A;  3WU3 A;  2UU9 E;  4DV5 I;  4MU4 A;  1KVK A;  2Z5E A;  4R1F A;  1Z0E A;  4AID A;  2IOQ A;  4NBQ A;  3UHM A;  3B78 A;  3J80 C;  2CGE A;  4JV5 I;  4IFD A;  3T1Y E;  1OYR A;  1Z0C A;  4JV5 E;  1E3P A;  5DNX A;  4DU8 A;  1XNQ I;  4EMD A;  2WP8 B;  3Q6N A;  3NZK A;  5C0X B;  2WNR A;  5LMN I;  4LF9 E;  4DV7 I;  2C39 B;  3ZKD A;  2O3Z A;  1ELO A;  4P52 A;  1ZM9 A;  4LOM A;  5DRR A;  4HYM A;  4HAC B;  4KHP I;  3M85 G;  1J5E E;  2UXC I;  2C38 A;  4LF8 E;  4OO1 D;  3KRN A;  3J7A M;  4KHP E;  4X66 I;  1IBM E;  2UXC E;  2JE6 A;  1EI1 A;  2BM1 A;  4FW3 A;  2PO1 A;  3ZZU A;  2BA1 G;  2BM0 A;  5JEA A;  5GME A;  4USK A;  2EFG A;  4MQY A;  1UDQ A;  4JI4 I;  2IES A;  5L3J A;  3B8H A;  2Z5C B;  4JI3 I;  5DRO A;  1HNZ I;  4X64 E;  4JI2 I;  1HNZ E;  2AE8 A;  1HNW E;  4OX9 I;  4LFA E;  1K47 A;  2ZM6 E;  2UUB I;  3CWV A;  4OX9 E;  4FW7 A;  1N32 E;  1XMO E;  4LCG A;  1XMQ I;  1RHY A;  2DEJ A;  3QT5 A;  1ZM2 A;  5FWK A;  4DV3 I;  3T1H I;  1N36 I;  1XMQ E;  3JAM C;  1Z5A A;  4DR3 I;  4NXM E;  2V2V A;  3PS1 A;  2LJP A;  3PYF A;  5C0X D;  1R6L A;  4DR3 E;  4GKK I;  2F4V E;  1H7U A;  4YY3 I;  4HXZ A;  1FNM A;  5IWA I;  4GKK E;  4DV0 I;  5LL6 R;  4IFD B;  3D4J A;  5K36 F;  4U3B A;  3HKM A;  4FWG A;  5A2Q Q;  1PIE A;  3PYD A;  3CDI A;  4DV0 E;  2VES A;  4JI7 I;  3PS3 A;  1ZXM A;  1FI4 A;  2JEB A;  2NN6 A;  4FW6 A;  2NN6 C; 
#chains in the Genus database with same CATH homology
 5C0X F;  4NBQ A;  2WNR B;  3CDJ A;  2PNZ A;  4IFD A;  1UDO A;  2C37 A;  4BA1 A;  4IFD E;  5K36 B;  2PO0 B;  5C0X E;  5C0X C;  1OYR A;  4AIM A;  1E3P A;  3GME A;  5JEA F;  2WP8 B;  1OYP A;  5C0X B;  2WNR A;  2C38 B;  4BA2 B;  4AM3 A;  1UDN A;  2C39 B;  5JEA C;  1R6M A;  2JE6 B;  2PO0 A;  5K36 A;  3B4T A;  5K36 E;  2PO1 B;  5K36 C;  3GCM A;  5JEA B;  3M85 G;  2WP8 A;  4BA2 A;  5C0X A;  2C38 A;  3M85 D;  4OO1 D;  3KRN A;  3U1K A;  2C39 A;  2BA0 G;  2JE6 A;  2PO1 A;  2BA1 G;  3GLL A;  2NN6 D;  5JEA A;  5JEA E;  1UDQ A;  3M7N G;  4OO1 F;  4IFD D;  2NN6 F;  3H1C A;  2JEA B;  2BA0 D;  1OYS A;  2PO2 B;  3L7Z B;  4OO1 B;  5K36 D;  2BA1 D;  4IFD F;  1E3H A;  3DD6 A;  2BR2 B;  3M7N D;  5C0X D;  2JEA A;  1R6L A;  2JEB B;  2NN6 B;  4IFD C;  2PO2 A;  3L7Z A;  4OO1 A;  1UDS A;  4OO1 E;  4OO1 C;  2PNZ B;  4IFD B;  2C37 B;  4BA1 B;  5K36 F;  3HKM A;  2BR2 A;  5JEA D;  3CDI A;  2JEB A;  2NN6 A;  4AID A;  2NN6 E;  2NN6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...