2C37A

Rnase ph core of the archaeal exosome in complex with u8 rna
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
260
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
total genus 76
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c37A01
5C0XE 5K36E 5K36A 1OYSA 1OYRA 3U1KA 1UDNA 2PO2B 2NN6A 5K36D 5JEAA 2C38A 3M7NG 4NBQA 2WP8A 2NN6D 4OO1A 4BA2B 3HKMA 4IFDB 4OO1C 2C39A 2PO0A 2BR2A 5C0XB 2JE6A 2PO1A 4IFDF 3CDJA 3M85D 4OO1F 5C0XF 1R6LA 2PO2A 5JEAD 2C37A 4AM3A 4BA1A 2BA1D 4OO1B 1UDOA 5K36C 4IFDA 3DD6A 4AIMA 4IFDD 3GLLA 5C0XA 4AIDA 2JE6B 1E3PA 2JEBB 2PO1B 4IFDE 1E3HA 3M85G 2WNRB 3GMEA 4OO1D 2BA0G 2BA1G 2PNZB 4OO1E 2JEAB 2C37B 3B4TA 2BA0D 4BA1B 2WNRA 5C0XC 2NN6E 2PNZA 2NN6C 5K36B 3CDIA 2JEAA 5JEAC 1UDQA 5JEAB 1OYPA 2C38B 3GCMA 2JEBA 2WP8B 5K36F 3L7ZB 3H1CA 2NN6F 3KRNA 4BA2A 1R6MA 1UDSA 5JEAF 3M7ND 2C39B 2PO0B 5C0XD 4IFDC 5JEAE 3L7ZA 2BR2B 2NN6B
chains in the Genus database with same CATH superfamily
1QZRA 2R42A 2V2ZA 3V5RA 1ZM9A 2IESA 5K36E 1HNXI 2ZITA 1OYSA 3P3GA 2CGEA 2E1RA 2V2VA 1FJGE 1UDNA 2NN6A 4DUZE 4DV1E 2UUCI 3LTOA 3HULA 2O1VA 4JG4A 4URLA 1HNZI 3J7AG 5DROA 1N0UA 2XEXA 1D6TA 1Z0VA 3HKMA 4JI6I 4IFDB 5A2QC 4OO1C 2PO0A 2BR2A 4P52A 1HNWE 4DR7I 4JI4I 5C0XB 4AQYE 1Y60A 4LF8I 2JE6A 1ZM3A 3PYFA 4PU9A 5FWKA 2GS8A 2UUAE 2PO1A 3OTOI 4FW7A 4Z7CA 4IFDF 1H7UA 4X65I 2HKJA 3K1JA 2PNMA 4OO1F 5C0XF 4X65E 5GMDA 4DU7A 3P06A 5FLXQ 3OTOE 2UUAI 3P76A 4FWGA 4LF8E 4AQYI 5EL9A 3WU5A 4JI4E 4DR7E 1HNWI 4IZKA 1VI7A 3D4JA 4OO1B 3ZZ0A 4U3BA 2HFUA 4JI6E 2Q2EB 2A2CA 4AIMA 2O1WA 1Z5CA 5L3JA 2HK2A 4FWHA 2VF3A 1HNZE 4IZJD 3WU4A 1Y5YA 2JE6B 2PO1B 2GO3A 3JAMC 2UUCE 4DV1I 4IZJB 4DUZI 1B63A 2AJ4A 2WNRB 1FJGI 4XTJA 3PYGA 1HNXE 4DPUA 3M6AA 4J3DA 2C37B 4DR4I 1N32I 2F4VE 2PNZA 5IWAI 4X66E 5LL6R 3WU6A 5K36B 1NZ0A 4JI3I 2UUBE 4OZEA 4PRVA 5ELWA 1UDQA 4JI8E 4DR6I 4DV2I 4GKKI 4B3TI 2JEBA 1H72C 4NXNI 1FWKA 1WUUA 5DNXA 4DV4I 2PNLA 3K17A 1MX0A 4JV5I 4BA2A 1N33E 2E5LI 1DARA 2C39B 4UTGA 5JEAE 1U2RA 3L7ZA 1EI1A 4MU3A 2UXDI 2AE8A 1OJ4A 4OKGA 5C0XE 3K85A 3PYEA 4DPXA 1PKPA 2HK3A 4LFCI 2PO2B 1UEKA 4JI2E 5JEAA 4DR2I 4NBQA 3M7NG 4FW4A 2WP8A 1XHKA 1HR0E 3LPSA 1Z0CA 4LF5I 4BA2B 1ZM2A 4MYUA 2BM0A 4X62E 4FW9A 1EA6A 2UXBI 1IBMI 2IERA 4JI0I 4DR1I 4LOMA 1NHIA 1IBKI 4DV7E 1Y4UA 3QT8A 2VQEE 1B62A 1RR9A 4AM3A 1PIEA 4BA1A 4R1FA 2ZBKB 4JI5E 1P42A 4LCGA 4YY3E 5K36C 1IBLE 4USKA 4IFDA 3Q6MA 3ZKDA 4MDTA 4DV6I 1N36E 4IFDD 5C0XA 1E3PA 3J80C 4LFAI 1E3HA 4LFBI 2VESA 1Z5BA 4LF7I 4B3SE 4OO1D 1YH8A 3T1HI 2DEIA 2PNZB 2DEJA 2JT2A 4JI7I 4DV3E 3UHMA 1H73A 3B4TA 2BA0D 4USMA 5C0XC 2UU9I 1XNQE 2UXCI 4DR5I 1A6FA 2NN6C 1XNRI 5JEAC 5LMUI 4NXME 2VQFI 4HXZA 4DR3I 4OX9I 4LF9I 4X64E 1OYPA 2C38B 2Z5BA 5DRPA 4Z7YA 2CZ9A 4DV5E 2NN6F 2A2DA 5DNLA 1UDSA 4JYAE 5JEAF 3M7ND 2BV3A 4DUYI 2CG9A 4KHPE 2NN6B 1N34E 3GONA 2EFGA 3F0NA 1MG7A 4DXLA 1ELOA 3J81Q 4B3RE 4N3OA 4JI1I 4YHHE 5K36A 4WUDA 4GQUA 3PRYA 2HHHI 2HKEA 5K36D 4U3DA 4LF4E 3QT5A 1N0VC 2C38A 2V34A 5BR8E 3ZZTA 2NPFA 2ZM6I 2O3ZA 1ZXMA 3P3EA 1I94I 2BM1A 4GKJE 4MYTA 5LMNE 2C39A 3QT7A 1XMOE 3J80Q 4MU0A 3V2UC 3H4LA 1J5EI 5DRQA 5IT9Q 1Z59A 1BKNA 3CDJA 1XMQE 4B3MI 4DV0E 4K0KI 3T1YI 4WUCA 4LF6E 1Z5AA 4LF6I 3T1YE 1R6LA 4K0KE 2PO2A 1USUA 4DV0I 1NHJA 1XMQI 4B3ME 5JEAD 1XXEA 1J5EE 3Q1QA 4FW6A 4FW5A 1XMOI 2BA1D 1Y4SA 5LMNI 4GKJI 1FNMA 1I94E 3B82A 2ZM6E 4IZKB 1KVKA 3U1YA 3GLLA 2HFSA 4ISAA 4QNJA 3ZKBA 5BR8I 4IFDE 4LF4I 1Z0WA 3M85G 1KIJA 1ZM4A 4HY1A 2HHHE 4KQVA 3JAMQ 3B8HA 3B78A 2BA0G 4DPYA 2BA1G 4YHHI 4JI1E 4LCHA 4B3RI 2J65A 4IZJA 1N34I 4KHPI 4BA1B 3NZKA 2NN6E 1KTVA 2Z5BB 4DUYE 3CDIA 2JEAA 4JYAI 4M1KA 1PVGA 5FLXC 4DV5I 3GCMA 3LNUA 4RPFA 5K36F 3L7ZB 3H1CA 2IOPA 4X64I 1Y6ZA 2V2QA 4LF9E 4DR3E 2VQFE 4NXMI 1H7SA 4OX9E 1USVA 2Z5EA 4QNKA 3KRNA 5LMUE 1R6MA 2WW4A 5DRRA 1XNRE 2PO0B 4DR5E 4LCFA 1XNQI 4IFDC 2UXCE 2BR2B 2UU9E 3WU3A 4FW3A 5A2QQ 3PS1A 2O1UA 4FN5A 4IS9A 4JI7E 4DV3I 4MQYA 3Q6NA 2CVEA 3PS3A 3T1HE 4DU8A 1OYRA 3U1KA 4B3SI 4LF7E 1Z0TA 2Z5CA 4LFBE 1K47A 3QT6A 3ZM7A 1KKHA 4LFAE 1YHCA 4DV6E 1N36I 2NN6D 4OO1A 1HK7A 2LJPA 1IBLI 1S4EA 1H74A 4YY3I 4JI5I 3PYDA 5IT9C 2OI2A 1Z0EA 2VQEI 3J7AM 1RHYA 4DV7I 2V8PA 3M85D 1IBKE 2Z5CB 4DR1E 4JI0E 1IBME 2C37A 2UXBE 4ZVIA 1FKAE 1Z0BA 1RREA 4X62I 3PS2A 4DPTA 1NHHA 4I3HA 1UDOA 1VISA 3HJCA 4LF5E 3DD6A 2O1TA 3J81C 1HR0I 4PRXA 1S16A 4AIDA 2JEBB 4DR2E 1Z0GA 4JI2I 2IOQA 4UT4A 2X7IA 3GMEA 2X36A 4LPFA 4LFCE 2R3VA 1FWLA 4ED4A 4OO1E 4MU1A 2GQ0A 1ZXNA 2JEAB 2GO4A 2UXDE 4HACB 2WNRA 4MU4A 4DPWA 1MU5A 2E5LE 4JV5E 1N33I 3ZZUA 5GMEA 4DV4E 4HYMA 1FI4A 4NXNE 5JEAB 4B3TE 2WP8B 4GKKE 3CWVA 4DV2E 4DR6E 4JI8I 4EMDA 4WUBA 2J7KA 2UUBI 4JI3E 5EKWA 4X66I 5C0XD 5IWAE 2F4VI 4FWDA 2F1DA 1N32E 4P7AA 3P3CA 4DR4E 4HACA
chains in the Genus database with same CATH topology
5C0XE 5K36E 5K36A 1OYSA 1OYRA 3U1KA 1UDNA 2PO2B 2NN6A 5K36D 5JEAA 2C38A 3M7NG 4NBQA 2WP8A 2NN6D 4OO1A 4BA2B 3HKMA 4IFDB 4OO1C 2C39A 2PO0A 2BR2A 5C0XB 2JE6A 2PO1A 4IFDF 3CDJA 3M85D 4OO1F 5C0XF 1R6LA 2PO2A 5JEAD 2C37A 4AM3A 4BA1A 2BA1D 4OO1B 1UDOA 5K36C 4IFDA 3DD6A 4AIMA 4IFDD 3GLLA 5C0XA 4AIDA 2JE6B 1E3PA 2JEBB 2PO1B 4IFDE 1E3HA 3M85G 2WNRB 3GMEA 4OO1D 2BA0G 2BA1G 2PNZB 4OO1E 2JEAB 2C37B 3B4TA 2BA0D 4BA1B 2WNRA 5C0XC 2NN6E 2PNZA 2NN6C 5K36B 3CDIA 2JEAA 5JEAC 1UDQA 5JEAB 1OYPA 2C38B 3GCMA 2JEBA 2WP8B 5K36F 3L7ZB 3H1CA 2NN6F 3KRNA 4BA2A 1R6MA 1UDSA 5JEAF 3M7ND 2C39B 2PO0B 5C0XD 4IFDC 5JEAE 3L7ZA 2BR2B 2NN6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X E;  5K36 E;  5K36 A;  1OYS A;  1OYR A;  3U1K A;  1UDN A;  2PO2 B;  2NN6 A;  5K36 D;  5JEA A;  2C38 A;  3M7N G;  4NBQ A;  2WP8 A;  2NN6 D;  4OO1 A;  4BA2 B;  3HKM A;  4IFD B;  4OO1 C;  2C39 A;  2PO0 A;  2BR2 A;  5C0X B;  2JE6 A;  2PO1 A;  4IFD F;  3CDJ A;  3M85 D;  4OO1 F;  5C0X F;  1R6L A;  2PO2 A;  5JEA D;  2C37 A;  4AM3 A;  4BA1 A;  2BA1 D;  4OO1 B;  1UDO A;  5K36 C;  4IFD A;  3DD6 A;  4AIM A;  4IFD D;  3GLL A;  5C0X A;  4AID A;  2JE6 B;  1E3P A;  2JEB B;  2PO1 B;  4IFD E;  1E3H A;  3M85 G;  2WNR B;  3GME A;  4OO1 D;  2BA0 G;  2BA1 G;  2PNZ B;  4OO1 E;  2JEA B;  2C37 B;  3B4T A;  2BA0 D;  4BA1 B;  2WNR A;  5C0X C;  2NN6 E;  2PNZ A;  2NN6 C;  5K36 B;  3CDI A;  2JEA A;  5JEA C;  1UDQ A;  5JEA B;  1OYP A;  2C38 B;  3GCM A;  2JEB A;  2WP8 B;  5K36 F;  3L7Z B;  3H1C A;  2NN6 F;  3KRN A;  4BA2 A;  1R6M A;  1UDS A;  5JEA F;  3M7N D;  2C39 B;  2PO0 B;  5C0X D;  4IFD C;  5JEA E;  3L7Z A;  2BR2 B;  2NN6 B; 
#chains in the Genus database with same CATH topology
 1QZR A;  2R42 A;  2V2Z A;  3V5R A;  1ZM9 A;  2IES A;  5K36 E;  1HNX I;  2ZIT A;  1OYS A;  3P3G A;  2CGE A;  2E1R A;  2V2V A;  1FJG E;  1UDN A;  2NN6 A;  4DUZ E;  4DV1 E;  2UUC I;  3LTO A;  3HUL A;  2O1V A;  4JG4 A;  4URL A;  1HNZ I;  3J7A G;  5DRO A;  1N0U A;  2XEX A;  1D6T A;  1Z0V A;  3HKM A;  4JI6 I;  4IFD B;  5A2Q C;  4OO1 C;  2PO0 A;  2BR2 A;  4P52 A;  1HNW E;  4DR7 I;  4JI4 I;  5C0X B;  4AQY E;  1Y60 A;  4LF8 I;  2JE6 A;  1ZM3 A;  3PYF A;  4PU9 A;  5FWK A;  2GS8 A;  2UUA E;  2PO1 A;  3OTO I;  4FW7 A;  4Z7C A;  4IFD F;  1H7U A;  4X65 I;  2HKJ A;  3K1J A;  2PNM A;  4OO1 F;  5C0X F;  4X65 E;  5GMD A;  4DU7 A;  3P06 A;  5FLX Q;  3OTO E;  2UUA I;  3P76 A;  4FWG A;  4LF8 E;  4AQY I;  5EL9 A;  3WU5 A;  4JI4 E;  4DR7 E;  1HNW I;  4IZK A;  1VI7 A;  3D4J A;  4OO1 B;  3ZZ0 A;  4U3B A;  2HFU A;  4JI6 E;  2Q2E B;  2A2C A;  4AIM A;  2O1W A;  1Z5C A;  5L3J A;  2HK2 A;  4FWH A;  2VF3 A;  1HNZ E;  4IZJ D;  3WU4 A;  1Y5Y A;  2JE6 B;  2PO1 B;  2GO3 A;  3JAM C;  2UUC E;  4DV1 I;  4IZJ B;  4DUZ I;  1B63 A;  2AJ4 A;  2WNR B;  1FJG I;  4XTJ A;  3PYG A;  1HNX E;  4DPU A;  3M6A A;  4J3D A;  2C37 B;  4DR4 I;  1N32 I;  2F4V E;  2PNZ A;  5IWA I;  4X66 E;  5LL6 R;  3WU6 A;  5K36 B;  1NZ0 A;  4JI3 I;  2UUB E;  4OZE A;  4PRV A;  5ELW A;  1UDQ A;  4JI8 E;  4DR6 I;  4DV2 I;  4GKK I;  4B3T I;  2JEB A;  1H72 C;  4NXN I;  1FWK A;  1WUU A;  5DNX A;  4DV4 I;  2PNL A;  3K17 A;  1MX0 A;  4JV5 I;  4BA2 A;  1N33 E;  2E5L I;  1DAR A;  2C39 B;  4UTG A;  5JEA E;  1U2R A;  3L7Z A;  1EI1 A;  4MU3 A;  2UXD I;  2AE8 A;  1OJ4 A;  4OKG A;  5C0X E;  3K85 A;  3PYE A;  4DPX A;  1PKP A;  2HK3 A;  4LFC I;  2PO2 B;  1UEK A;  4JI2 E;  5JEA A;  4DR2 I;  4NBQ A;  3M7N G;  4FW4 A;  2WP8 A;  1XHK A;  1HR0 E;  3LPS A;  1Z0C A;  4LF5 I;  4BA2 B;  1ZM2 A;  4MYU A;  2BM0 A;  4X62 E;  4FW9 A;  1EA6 A;  2UXB I;  1IBM I;  2IER A;  4JI0 I;  4DR1 I;  4LOM A;  1NHI A;  1IBK I;  4DV7 E;  1Y4U A;  3QT8 A;  2VQE E;  1B62 A;  1RR9 A;  4AM3 A;  1PIE A;  4BA1 A;  4R1F A;  2ZBK B;  4JI5 E;  1P42 A;  4LCG A;  4YY3 E;  5K36 C;  1IBL E;  4USK A;  4IFD A;  3Q6M A;  3ZKD A;  4MDT A;  4DV6 I;  1N36 E;  4IFD D;  5C0X A;  1E3P A;  3J80 C;  4LFA I;  1E3H A;  4LFB I;  2VES A;  1Z5B A;  4LF7 I;  4B3S E;  4OO1 D;  1YH8 A;  3T1H I;  2DEI A;  2PNZ B;  2DEJ A;  2JT2 A;  4JI7 I;  4DV3 E;  3UHM A;  1H73 A;  3B4T A;  2BA0 D;  4USM A;  5C0X C;  2UU9 I;  1XNQ E;  2UXC I;  4DR5 I;  1A6F A;  2NN6 C;  1XNR I;  5JEA C;  5LMU I;  4NXM E;  2VQF I;  4HXZ A;  4DR3 I;  4OX9 I;  4LF9 I;  4X64 E;  1OYP A;  2C38 B;  2Z5B A;  5DRP A;  4Z7Y A;  2CZ9 A;  4DV5 E;  2NN6 F;  2A2D A;  5DNL A;  1UDS A;  4JYA E;  5JEA F;  3M7N D;  2BV3 A;  4DUY I;  2CG9 A;  4KHP E;  2NN6 B;  1N34 E;  3GON A;  2EFG A;  3F0N A;  1MG7 A;  4DXL A;  1ELO A;  3J81 Q;  4B3R E;  4N3O A;  4JI1 I;  4YHH E;  5K36 A;  4WUD A;  4GQU A;  3PRY A;  2HHH I;  2HKE A;  5K36 D;  4U3D A;  4LF4 E;  3QT5 A;  1N0V C;  2C38 A;  2V34 A;  5BR8 E;  3ZZT A;  2NPF A;  2ZM6 I;  2O3Z A;  1ZXM A;  3P3E A;  1I94 I;  2BM1 A;  4GKJ E;  4MYT A;  5LMN E;  2C39 A;  3QT7 A;  1XMO E;  3J80 Q;  4MU0 A;  3V2U C;  3H4L A;  1J5E I;  5DRQ A;  5IT9 Q;  1Z59 A;  1BKN A;  3CDJ A;  1XMQ E;  4B3M I;  4DV0 E;  4K0K I;  3T1Y I;  4WUC A;  4LF6 E;  1Z5A A;  4LF6 I;  3T1Y E;  1R6L A;  4K0K E;  2PO2 A;  1USU A;  4DV0 I;  1NHJ A;  1XMQ I;  4B3M E;  5JEA D;  1XXE A;  1J5E E;  3Q1Q A;  4FW6 A;  4FW5 A;  1XMO I;  2BA1 D;  1Y4S A;  5LMN I;  4GKJ I;  1FNM A;  1I94 E;  3B82 A;  2ZM6 E;  4IZK B;  1KVK A;  3U1Y A;  3GLL A;  2HFS A;  4ISA A;  4QNJ A;  3ZKB A;  5BR8 I;  4IFD E;  4LF4 I;  1Z0W A;  3M85 G;  1KIJ A;  1ZM4 A;  4HY1 A;  2HHH E;  4KQV A;  3JAM Q;  3B8H A;  3B78 A;  2BA0 G;  4DPY A;  2BA1 G;  4YHH I;  4JI1 E;  4LCH A;  4B3R I;  2J65 A;  4IZJ A;  1N34 I;  4KHP I;  4BA1 B;  3NZK A;  2NN6 E;  1KTV A;  2Z5B B;  4DUY E;  3CDI A;  2JEA A;  4JYA I;  4M1K A;  1PVG A;  5FLX C;  4DV5 I;  3GCM A;  3LNU A;  4RPF A;  5K36 F;  3L7Z B;  3H1C A;  2IOP A;  4X64 I;  1Y6Z A;  2V2Q A;  4LF9 E;  4DR3 E;  2VQF E;  4NXM I;  1H7S A;  4OX9 E;  1USV A;  2Z5E A;  4QNK A;  3KRN A;  5LMU E;  1R6M A;  2WW4 A;  5DRR A;  1XNR E;  2PO0 B;  4DR5 E;  4LCF A;  1XNQ I;  4IFD C;  2UXC E;  2BR2 B;  2UU9 E;  3WU3 A;  4FW3 A;  5A2Q Q;  3PS1 A;  2O1U A;  4FN5 A;  4IS9 A;  4JI7 E;  4DV3 I;  4MQY A;  3Q6N A;  2CVE A;  3PS3 A;  3T1H E;  4DU8 A;  1OYR A;  3U1K A;  4B3S I;  4LF7 E;  1Z0T A;  2Z5C A;  4LFB E;  1K47 A;  3QT6 A;  3ZM7 A;  1KKH A;  4LFA E;  1YHC A;  4DV6 E;  1N36 I;  2NN6 D;  4OO1 A;  1HK7 A;  2LJP A;  1IBL I;  1S4E A;  1H74 A;  4YY3 I;  4JI5 I;  3PYD A;  5IT9 C;  2OI2 A;  1Z0E A;  2VQE I;  3J7A M;  1RHY A;  4DV7 I;  2V8P A;  3M85 D;  1IBK E;  2Z5C B;  4DR1 E;  4JI0 E;  1IBM E;  2C37 A;  2UXB E;  4ZVI A;  1FKA E;  1Z0B A;  1RRE A;  4X62 I;  3PS2 A;  4DPT A;  1NHH A;  4I3H A;  1UDO A;  1VIS A;  3HJC A;  4LF5 E;  3DD6 A;  2O1T A;  3J81 C;  1HR0 I;  4PRX A;  1S16 A;  4AID A;  2JEB B;  4DR2 E;  1Z0G A;  4JI2 I;  2IOQ A;  4UT4 A;  2X7I A;  3GME A;  2X36 A;  4LPF A;  4LFC E;  2R3V A;  1FWL A;  4ED4 A;  4OO1 E;  4MU1 A;  2GQ0 A;  1ZXN A;  2JEA B;  2GO4 A;  2UXD E;  4HAC B;  2WNR A;  4MU4 A;  4DPW A;  1MU5 A;  2E5L E;  4JV5 E;  1N33 I;  3ZZU A;  5GME A;  4DV4 E;  4HYM A;  1FI4 A;  4NXN E;  5JEA B;  4B3T E;  2WP8 B;  4GKK E;  3CWV A;  4DV2 E;  4DR6 E;  4JI8 I;  4EMD A;  4WUB A;  2J7K A;  2UUB I;  4JI3 E;  5EKW A;  4X66 I;  5C0X D;  5IWA E;  2F4V I;  4FWD A;  2F1D A;  1N32 E;  4P7A A;  3P3C A;  4DR4 E;  4HAC A; 
#chains in the Genus database with same CATH homology
 5C0X E;  5K36 E;  5K36 A;  1OYS A;  1OYR A;  3U1K A;  1UDN A;  2PO2 B;  2NN6 A;  5K36 D;  5JEA A;  2C38 A;  3M7N G;  4NBQ A;  2WP8 A;  2NN6 D;  4OO1 A;  4BA2 B;  3HKM A;  4IFD B;  4OO1 C;  2C39 A;  2PO0 A;  2BR2 A;  5C0X B;  2JE6 A;  2PO1 A;  4IFD F;  3CDJ A;  3M85 D;  4OO1 F;  5C0X F;  1R6L A;  2PO2 A;  5JEA D;  2C37 A;  4AM3 A;  4BA1 A;  2BA1 D;  4OO1 B;  1UDO A;  5K36 C;  4IFD A;  3DD6 A;  4AIM A;  4IFD D;  3GLL A;  5C0X A;  4AID A;  2JE6 B;  1E3P A;  2JEB B;  2PO1 B;  4IFD E;  1E3H A;  3M85 G;  2WNR B;  3GME A;  4OO1 D;  2BA0 G;  2BA1 G;  2PNZ B;  4OO1 E;  2JEA B;  2C37 B;  3B4T A;  2BA0 D;  4BA1 B;  2WNR A;  5C0X C;  2NN6 E;  2PNZ A;  2NN6 C;  5K36 B;  3CDI A;  2JEA A;  5JEA C;  1UDQ A;  5JEA B;  1OYP A;  2C38 B;  3GCM A;  2JEB A;  2WP8 B;  5K36 F;  3L7Z B;  3H1C A;  2NN6 F;  3KRN A;  4BA2 A;  1R6M A;  1UDS A;  5JEA F;  3M7N D;  2C39 B;  2PO0 B;  5C0X D;  4IFD C;  5JEA E;  3L7Z A;  2BR2 B;  2NN6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...