2C37A

Rnase ph core of the archaeal exosome in complex with u8 rna
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
260
Chain Sequence
b'MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
molecule tags Hydrolase
source organism Sulfolobus solfataricus
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
total genus 76
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c37A01
4OO1A 2PO0B 2JEAB 3GLLA 1UDOA 1E3HA 2PNZA 3L7ZA 4NBQA 2C37A 5JEAA 3M7ND 3H1CA 2PNZB 1OYPA 2C39B 5C0XC 2BR2B 2PO1B 4AIMA 3M85D 2JEBA 2JEBB 5K36F 2PO0A 3GMEA 2C39A 4BA2A 4IFDB 4IFDD 2NN6F 4IFDF 5JEAC 1R6MA 5C0XF 2NN6D 1UDSA 5JEAF 5K36E 2PO1A 5C0XD 1UDNA 2BA0D 3CDIA 2BA1G 3CDJA 5C0XB 5K36B 4BA1B 2JE6A 2PO2A 4IFDE 2NN6E 4AIDA 2NN6A 3GCMA 2BA0G 5K36A 2NN6C 1UDQA 2WNRB 2NN6B 1E3PA 4AM3A 2JE6B 4OO1E 4BA1A 2C38A 4OO1C 5C0XA 4OO1F 1OYSA 3B4TA 2WP8A 2C38B 3HKMA 5K36C 5K36D 1R6LA 2WNRA 5JEAD 2PO2B 3U1KA 4OO1B 2WP8B 3M85G 4OO1D 4IFDC 3L7ZB 5JEAB 1OYRA 2JEAA 3M7NG 2BR2A 3DD6A 2C37B 5JEAE 5C0XE 4IFDA 4BA2B 2BA1D 3KRNA
chains in the Genus database with same CATH superfamily
4OO1A 2VESA 4OX9E 4GKKI 3GLLA 4DV2I 1UEKA 2PNZA 4NBQA 2C37A 4GKKE 1VI7A 4JI0I 4X62E 4LF8E 3K17A 1P42A 1OYPA 1XMQI 4X66I 2Z5CA 1K47A 4MU1A 1ELOA 4LFCE 4AIMA 3M85D 1N32E 2UXDE 1PVGA 4B3RI 2O1WA 2JEBB 5BR8E 1XHKA 2O1VA 4USKA 2E5LI 4B3SE 4DR4I 3F0NA 3PYEA 4DR6E 1USUA 4IFDB 5GMEA 2F4VE 1ZM4A 4DUYE 4N3OA 4LF8I 4DV2E 1Y4SA 5C0XF 5A2QQ 4KHPE 5JEAF 3PS3A 4FW9A 4J3DA 4DV4I 5C0XD 1KIJA 4JI8E 3CDIA 4DR1I 1B63A 4NXMI 4UTGA 3CDJA 5FLXQ 1N33I 2F1DA 4DR2I 4HACA 4IFDE 3PYFA 4AIDA 1PKPA 3GCMA 1IBMI 4P52A 4LF7E 1Z0WA 2V2QA 3JAMC 2UUCI 2UXBI 2NPFA 4JI7E 1UDQA 5FWKA 2WNRB 1I94I 4FW5A 3JAMQ 2IESA 4OO1E 1Z0BA 2Z5BA 4LF9I 1OYSA 2WP8A 2C38B 3OTOI 3M6AA 1DARA 1RR9A 4DR3E 4DV3E 1WUUA 5BR8I 3P3GA 4NXNI 4B3TI 3M85G 1KTVA 4K0KE 1Y4UA 4DR4E 2OI2A 5DROA 4DU7A 1PIEA 1N32I 4LFAI 2EFGA 3ZZTA 4JI6I 5DRPA 4MQYA 3ZZUA 4K0KI 1H72C 4I3HA 2VQFE 4NXME 2UXDI 1N36I 4RPFA 1ZXMA 4DV3I 1S16A 4QNJA 4JI2I 1KKHA 4IZKB 1N34E 2IERA 1A6FA 5LMUI 4DV7I 1XNQE 2V34A 4KQVA 3DD6A 4DUZI 5L3JA 4LF9E 1FI4A 4DV7E 1XNQI 4DR5I 1IBKE 1HNZE 1HK7A 2UUAE 1Z0GA 3QT5A 1UDOA 2IOPA 3D4JA 4EMDA 1FJGI 3PRYA 3L7ZA 4U3BA 1HNWE 3NZKA 1XXEA 1BKNA 4DPTA 2UUCE 4B3SI 1NHIA 4OKGA 3U1YA 4IZKA 4Z7YA 2ZBKB 4FWDA 4DV0I 4FW6A 3H4LA 1D6TA 4PRVA 4JI1E 4IS9A 3OTOE 1Z5CA 4X64E 3P06A 2X7IA 2O1TA 1U2RA 4DR5E 1HNZI 4YY3E 2UUAI 2GO4A 3GMEA 4FW4A 2O1UA 1KVKA 3B82A 2BM0A 5DNLA 4DUZE 4WUDA 1FKAE 4IFDF 5LMNE 4JI1I 5K36E 1XMOE 1MX0A 3WU3A 5GMDA 1OJ4A 4IZJD 3WU6A 4JI5I 4MU3A 3CWVA 4LFBI 1MG7A 4JI3I 3ZZ0A 4FWGA 4GKJI 5LL6R 5DRQA 1HNWI 4B3RE 5IWAI 2HKJA 2HFSA 2JE6A 1XMQE 4DV6I 4UT4A 2VQEE 3HJCA 2BA0G 3WU4A 2NN6C 4KHPI 1Z5BA 4FW3A 1Z0CA 1YHCA 5IT9C 2BM1A 2JE6B 1Z0EA 1HR0E 4JYAE 3PYDA 3GONA 2UUBI 3B4TA 3T1HI 4DR7E 3WU5A 4B3ME 2V8PA 1IBLE 5K36C 4B3TE 4JV5I 4DV5I 4LF5E 2PO2B 3U1KA 2GO3A 4WUCA 4OO1D 2VF3A 4U3DA 4FN5A 5FLXC 4X62I 5JEAB 1RHYA 1FWKA 5EL9A 3B8HA 4DV4E 3M7NG 1XNRI 2BR2A 2CVEA 3P76A 1J5EE 1Z0TA 2UXBE 2LJPA 2PNMA 3PS1A 5IT9Q 4Z7CA 2V2ZA 1Z0VA 4LCFA 2PO0B 1E3HA 2HKEA 1QZRA 1Y60A 3H1CA 2PNZB 4HACB 2UUBE 1FJGE 3J81Q 2C39B 2HK3A 4XTJA 5C0XC 3T1HE 4DR7I 1B62A 2J65A 2PO1B 4QNKA 1Z59A 4LF6E 2JEBA 4LOMA 3Q1QA 2Z5EA 1VISA 3Q6MA 5K36F 2HFUA 4M1KA 1HNXI 1N34I 2WW4A 2C39A 2GQ0A 4X64I 1I94E 4BA2A 3T1YE 4JI7I 4IFDD 4IZJB 2NN6F 4USMA 4DV0E 3J7AM 2UU9I 5IWAE 5JEAC 1R6MA 4GQUA 2NN6D 4JV5E 4AQYE 2E1RA 2X36A 1H7SA 3V2UC 4X66E 3Q6NA 1FWLA 2BA1G 1J5EI 4YHHI 5LMNI 5K36B 2Q2EB 3ZM7A 3HULA 4LF4I 3QT7A 2AJ4A 3K1JA 5K36A 1FNMA 1NZ0A 2F4VI 4YHHE 1RREA 2HK2A 2A2CA 4DPXA 4DV1E 4LF5I 3J80C 2VQFI 1ZM2A 1EA6A 4ISAA 4BA1A 4URLA 4JI4I 2C38A 4B3MI 4X65E 2XEXA 3B78A 3HKMA 1HR0I 4LCHA 3J80Q 1S4EA 4FW7A 5EKWA 2J7KA 1HNXE 1R6LA 5JEAD 2PNLA 3LPSA 2CGEA 2WP8B 3QT6A 4JG4A 3ZKBA 4LF4E 4DU8A 4LF6I 2UXCI 5DNXA 4JI2E 4P7AA 1OYRA 4DR6I 2JEAA 1EI1A 4PRXA 2R3VA 4X65I 4DV6E 3QT8A 4AQYI 1Z5AA 4HY1A 4ZVIA 5C0XE 4JI4E 4IFDA 1MU5A 4LFBE 4R1FA 3J81C 3KRNA 1N0UA 4NXNE 2R42A 2JEAB 1ZM3A 3V5RA 5JEAA 3M7ND 4MU0A 2AE8A 1H74A 3PYGA 5ELWA 3LNUA 1NHHA 4ED4A 3PS2A 2BR2B 2A2DA 2BV3A 1YH8A 5LMUE 4DUYI 2IOQA 3K85A 5A2QC 4DPWA 2PO0A 3ZKDA 4JI6E 2E5LE 2UU9E 3J7AG 2HHHE 3T1YI 1N33E 5DRRA 1UDSA 2PO1A 2ZM6I 4JYAI 2Z5BB 4JI8I 4DPUA 4DR1E 1UDNA 4MU4A 2BA0D 1IBKI 2JT2A 1ZXNA 5C0XB 4MDTA 4BA1B 1N36E 2PO2A 1Y6ZA 2NN6E 2NN6A 4LFAE 2DEIA 2ZITA 4JI3E 1ZM9A 3UHMA 2CZ9A 1Y5YA 1NHJA 2NN6B 2CG9A 4WUBA 1E3PA 4MYUA 4AM3A 4DPYA 4LFCI 2GS8A 4OO1C 4MYTA 5C0XA 1XMOI 4DR3I 4JI0E 4OO1F 2UXCE 4LPFA 4OX9I 4YY3I 5K36D 3P3CA 1H7UA 1XNRE 2WNRA 2VQEI 4PU9A 2ZM6E 2O3ZA 3P3EA 4OO1B 4IFDC 1H73A 4FWHA 2HHHI 3L7ZB 1N0VC 1IBME 4GKJE 1IBLI 4DXLA 4LF7I 4DR2E 4HYMA 1USVA 4DV5E 2Z5CB 4JI5E 4HXZA 4LCGA 4DV1I 2V2VA 3LTOA 4IZJA 2C37B 2DEJA 5JEAE 4OZEA 4BA2B 2BA1D
chains in the Genus database with same CATH topology
4OO1A 2PO0B 2JEAB 3GLLA 1UDOA 1E3HA 2PNZA 3L7ZA 4NBQA 2C37A 5JEAA 3M7ND 3H1CA 2PNZB 1OYPA 2C39B 5C0XC 2BR2B 2PO1B 4AIMA 3M85D 2JEBA 2JEBB 5K36F 2PO0A 3GMEA 2C39A 4BA2A 4IFDB 4IFDD 2NN6F 4IFDF 5JEAC 1R6MA 5C0XF 2NN6D 1UDSA 5JEAF 5K36E 2PO1A 5C0XD 1UDNA 2BA0D 3CDIA 2BA1G 3CDJA 5C0XB 5K36B 4BA1B 2JE6A 2PO2A 4IFDE 2NN6E 4AIDA 2NN6A 3GCMA 2BA0G 5K36A 2NN6C 1UDQA 2WNRB 2NN6B 1E3PA 4AM3A 2JE6B 4OO1E 4BA1A 2C38A 4OO1C 5C0XA 4OO1F 1OYSA 3B4TA 2WP8A 2C38B 3HKMA 5K36C 5K36D 1R6LA 2WNRA 5JEAD 2PO2B 3U1KA 4OO1B 2WP8B 3M85G 4OO1D 4IFDC 3L7ZB 5JEAB 1OYRA 2JEAA 3M7NG 2BR2A 3DD6A 2C37B 5JEAE 5C0XE 4IFDA 4BA2B 2BA1D 3KRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 A;  2PO0 B;  2JEA B;  3GLL A;  1UDO A;  1E3H A;  2PNZ A;  3L7Z A;  4NBQ A;  2C37 A;  5JEA A;  3M7N D;  3H1C A;  2PNZ B;  1OYP A;  2C39 B;  5C0X C;  2BR2 B;  2PO1 B;  4AIM A;  3M85 D;  2JEB A;  2JEB B;  5K36 F;  2PO0 A;  3GME A;  2C39 A;  4BA2 A;  4IFD B;  4IFD D;  2NN6 F;  4IFD F;  5JEA C;  1R6M A;  5C0X F;  2NN6 D;  1UDS A;  5JEA F;  5K36 E;  2PO1 A;  5C0X D;  1UDN A;  2BA0 D;  3CDI A;  2BA1 G;  3CDJ A;  5C0X B;  5K36 B;  4BA1 B;  2JE6 A;  2PO2 A;  4IFD E;  2NN6 E;  4AID A;  2NN6 A;  3GCM A;  2BA0 G;  5K36 A;  2NN6 C;  1UDQ A;  2WNR B;  2NN6 B;  1E3P A;  4AM3 A;  2JE6 B;  4OO1 E;  4BA1 A;  2C38 A;  4OO1 C;  5C0X A;  4OO1 F;  1OYS A;  3B4T A;  2WP8 A;  2C38 B;  3HKM A;  5K36 C;  5K36 D;  1R6L A;  2WNR A;  5JEA D;  2PO2 B;  3U1K A;  4OO1 B;  2WP8 B;  3M85 G;  4OO1 D;  4IFD C;  3L7Z B;  5JEA B;  1OYR A;  2JEA A;  3M7N G;  2BR2 A;  3DD6 A;  2C37 B;  5JEA E;  5C0X E;  4IFD A;  4BA2 B;  2BA1 D;  3KRN A; 
#chains in the Genus database with same CATH topology
 4OO1 A;  2VES A;  4OX9 E;  4GKK I;  3GLL A;  4DV2 I;  1UEK A;  2PNZ A;  4NBQ A;  2C37 A;  4GKK E;  1VI7 A;  4JI0 I;  4X62 E;  4LF8 E;  3K17 A;  1P42 A;  1OYP A;  1XMQ I;  4X66 I;  2Z5C A;  1K47 A;  4MU1 A;  1ELO A;  4LFC E;  4AIM A;  3M85 D;  1N32 E;  2UXD E;  1PVG A;  4B3R I;  2O1W A;  2JEB B;  5BR8 E;  1XHK A;  2O1V A;  4USK A;  2E5L I;  4B3S E;  4DR4 I;  3F0N A;  3PYE A;  4DR6 E;  1USU A;  4IFD B;  5GME A;  2F4V E;  1ZM4 A;  4DUY E;  4N3O A;  4LF8 I;  4DV2 E;  1Y4S A;  5C0X F;  5A2Q Q;  4KHP E;  5JEA F;  3PS3 A;  4FW9 A;  4J3D A;  4DV4 I;  5C0X D;  1KIJ A;  4JI8 E;  3CDI A;  4DR1 I;  1B63 A;  4NXM I;  4UTG A;  3CDJ A;  5FLX Q;  1N33 I;  2F1D A;  4DR2 I;  4HAC A;  4IFD E;  3PYF A;  4AID A;  1PKP A;  3GCM A;  1IBM I;  4P52 A;  4LF7 E;  1Z0W A;  2V2Q A;  3JAM C;  2UUC I;  2UXB I;  2NPF A;  4JI7 E;  1UDQ A;  5FWK A;  2WNR B;  1I94 I;  4FW5 A;  3JAM Q;  2IES A;  4OO1 E;  1Z0B A;  2Z5B A;  4LF9 I;  1OYS A;  2WP8 A;  2C38 B;  3OTO I;  3M6A A;  1DAR A;  1RR9 A;  4DR3 E;  4DV3 E;  1WUU A;  5BR8 I;  3P3G A;  4NXN I;  4B3T I;  3M85 G;  1KTV A;  4K0K E;  1Y4U A;  4DR4 E;  2OI2 A;  5DRO A;  4DU7 A;  1PIE A;  1N32 I;  4LFA I;  2EFG A;  3ZZT A;  4JI6 I;  5DRP A;  4MQY A;  3ZZU A;  4K0K I;  1H72 C;  4I3H A;  2VQF E;  4NXM E;  2UXD I;  1N36 I;  4RPF A;  1ZXM A;  4DV3 I;  1S16 A;  4QNJ A;  4JI2 I;  1KKH A;  4IZK B;  1N34 E;  2IER A;  1A6F A;  5LMU I;  4DV7 I;  1XNQ E;  2V34 A;  4KQV A;  3DD6 A;  4DUZ I;  5L3J A;  4LF9 E;  1FI4 A;  4DV7 E;  1XNQ I;  4DR5 I;  1IBK E;  1HNZ E;  1HK7 A;  2UUA E;  1Z0G A;  3QT5 A;  1UDO A;  2IOP A;  3D4J A;  4EMD A;  1FJG I;  3PRY A;  3L7Z A;  4U3B A;  1HNW E;  3NZK A;  1XXE A;  1BKN A;  4DPT A;  2UUC E;  4B3S I;  1NHI A;  4OKG A;  3U1Y A;  4IZK A;  4Z7Y A;  2ZBK B;  4FWD A;  4DV0 I;  4FW6 A;  3H4L A;  1D6T A;  4PRV A;  4JI1 E;  4IS9 A;  3OTO E;  1Z5C A;  4X64 E;  3P06 A;  2X7I A;  2O1T A;  1U2R A;  4DR5 E;  1HNZ I;  4YY3 E;  2UUA I;  2GO4 A;  3GME A;  4FW4 A;  2O1U A;  1KVK A;  3B82 A;  2BM0 A;  5DNL A;  4DUZ E;  4WUD A;  1FKA E;  4IFD F;  5LMN E;  4JI1 I;  5K36 E;  1XMO E;  1MX0 A;  3WU3 A;  5GMD A;  1OJ4 A;  4IZJ D;  3WU6 A;  4JI5 I;  4MU3 A;  3CWV A;  4LFB I;  1MG7 A;  4JI3 I;  3ZZ0 A;  4FWG A;  4GKJ I;  5LL6 R;  5DRQ A;  1HNW I;  4B3R E;  5IWA I;  2HKJ A;  2HFS A;  2JE6 A;  1XMQ E;  4DV6 I;  4UT4 A;  2VQE E;  3HJC A;  2BA0 G;  3WU4 A;  2NN6 C;  4KHP I;  1Z5B A;  4FW3 A;  1Z0C A;  1YHC A;  5IT9 C;  2BM1 A;  2JE6 B;  1Z0E A;  1HR0 E;  4JYA E;  3PYD A;  3GON A;  2UUB I;  3B4T A;  3T1H I;  4DR7 E;  3WU5 A;  4B3M E;  2V8P A;  1IBL E;  5K36 C;  4B3T E;  4JV5 I;  4DV5 I;  4LF5 E;  2PO2 B;  3U1K A;  2GO3 A;  4WUC A;  4OO1 D;  2VF3 A;  4U3D A;  4FN5 A;  5FLX C;  4X62 I;  5JEA B;  1RHY A;  1FWK A;  5EL9 A;  3B8H A;  4DV4 E;  3M7N G;  1XNR I;  2BR2 A;  2CVE A;  3P76 A;  1J5E E;  1Z0T A;  2UXB E;  2LJP A;  2PNM A;  3PS1 A;  5IT9 Q;  4Z7C A;  2V2Z A;  1Z0V A;  4LCF A;  2PO0 B;  1E3H A;  2HKE A;  1QZR A;  1Y60 A;  3H1C A;  2PNZ B;  4HAC B;  2UUB E;  1FJG E;  3J81 Q;  2C39 B;  2HK3 A;  4XTJ A;  5C0X C;  3T1H E;  4DR7 I;  1B62 A;  2J65 A;  2PO1 B;  4QNK A;  1Z59 A;  4LF6 E;  2JEB A;  4LOM A;  3Q1Q A;  2Z5E A;  1VIS A;  3Q6M A;  5K36 F;  2HFU A;  4M1K A;  1HNX I;  1N34 I;  2WW4 A;  2C39 A;  2GQ0 A;  4X64 I;  1I94 E;  4BA2 A;  3T1Y E;  4JI7 I;  4IFD D;  4IZJ B;  2NN6 F;  4USM A;  4DV0 E;  3J7A M;  2UU9 I;  5IWA E;  5JEA C;  1R6M A;  4GQU A;  2NN6 D;  4JV5 E;  4AQY E;  2E1R A;  2X36 A;  1H7S A;  3V2U C;  4X66 E;  3Q6N A;  1FWL A;  2BA1 G;  1J5E I;  4YHH I;  5LMN I;  5K36 B;  2Q2E B;  3ZM7 A;  3HUL A;  4LF4 I;  3QT7 A;  2AJ4 A;  3K1J A;  5K36 A;  1FNM A;  1NZ0 A;  2F4V I;  4YHH E;  1RRE A;  2HK2 A;  2A2C A;  4DPX A;  4DV1 E;  4LF5 I;  3J80 C;  2VQF I;  1ZM2 A;  1EA6 A;  4ISA A;  4BA1 A;  4URL A;  4JI4 I;  2C38 A;  4B3M I;  4X65 E;  2XEX A;  3B78 A;  3HKM A;  1HR0 I;  4LCH A;  3J80 Q;  1S4E A;  4FW7 A;  5EKW A;  2J7K A;  1HNX E;  1R6L A;  5JEA D;  2PNL A;  3LPS A;  2CGE A;  2WP8 B;  3QT6 A;  4JG4 A;  3ZKB A;  4LF4 E;  4DU8 A;  4LF6 I;  2UXC I;  5DNX A;  4JI2 E;  4P7A A;  1OYR A;  4DR6 I;  2JEA A;  1EI1 A;  4PRX A;  2R3V A;  4X65 I;  4DV6 E;  3QT8 A;  4AQY I;  1Z5A A;  4HY1 A;  4ZVI A;  5C0X E;  4JI4 E;  4IFD A;  1MU5 A;  4LFB E;  4R1F A;  3J81 C;  3KRN A;  1N0U A;  4NXN E;  2R42 A;  2JEA B;  1ZM3 A;  3V5R A;  5JEA A;  3M7N D;  4MU0 A;  2AE8 A;  1H74 A;  3PYG A;  5ELW A;  3LNU A;  1NHH A;  4ED4 A;  3PS2 A;  2BR2 B;  2A2D A;  2BV3 A;  1YH8 A;  5LMU E;  4DUY I;  2IOQ A;  3K85 A;  5A2Q C;  4DPW A;  2PO0 A;  3ZKD A;  4JI6 E;  2E5L E;  2UU9 E;  3J7A G;  2HHH E;  3T1Y I;  1N33 E;  5DRR A;  1UDS A;  2PO1 A;  2ZM6 I;  4JYA I;  2Z5B B;  4JI8 I;  4DPU A;  4DR1 E;  1UDN A;  4MU4 A;  2BA0 D;  1IBK I;  2JT2 A;  1ZXN A;  5C0X B;  4MDT A;  4BA1 B;  1N36 E;  2PO2 A;  1Y6Z A;  2NN6 E;  2NN6 A;  4LFA E;  2DEI A;  2ZIT A;  4JI3 E;  1ZM9 A;  3UHM A;  2CZ9 A;  1Y5Y A;  1NHJ A;  2NN6 B;  2CG9 A;  4WUB A;  1E3P A;  4MYU A;  4AM3 A;  4DPY A;  4LFC I;  2GS8 A;  4OO1 C;  4MYT A;  5C0X A;  1XMO I;  4DR3 I;  4JI0 E;  4OO1 F;  2UXC E;  4LPF A;  4OX9 I;  4YY3 I;  5K36 D;  3P3C A;  1H7U A;  1XNR E;  2WNR A;  2VQE I;  4PU9 A;  2ZM6 E;  2O3Z A;  3P3E A;  4OO1 B;  4IFD C;  1H73 A;  4FWH A;  2HHH I;  3L7Z B;  1N0V C;  1IBM E;  4GKJ E;  1IBL I;  4DXL A;  4LF7 I;  4DR2 E;  4HYM A;  1USV A;  4DV5 E;  2Z5C B;  4JI5 E;  4HXZ A;  4LCG A;  4DV1 I;  2V2V A;  3LTO A;  4IZJ A;  2C37 B;  2DEJ A;  5JEA E;  4OZE A;  4BA2 B;  2BA1 D; 
#chains in the Genus database with same CATH homology
 4OO1 A;  2PO0 B;  2JEA B;  3GLL A;  1UDO A;  1E3H A;  2PNZ A;  3L7Z A;  4NBQ A;  2C37 A;  5JEA A;  3M7N D;  3H1C A;  2PNZ B;  1OYP A;  2C39 B;  5C0X C;  2BR2 B;  2PO1 B;  4AIM A;  3M85 D;  2JEB A;  2JEB B;  5K36 F;  2PO0 A;  3GME A;  2C39 A;  4BA2 A;  4IFD B;  4IFD D;  2NN6 F;  4IFD F;  5JEA C;  1R6M A;  5C0X F;  2NN6 D;  1UDS A;  5JEA F;  5K36 E;  2PO1 A;  5C0X D;  1UDN A;  2BA0 D;  3CDI A;  2BA1 G;  3CDJ A;  5C0X B;  5K36 B;  4BA1 B;  2JE6 A;  2PO2 A;  4IFD E;  2NN6 E;  4AID A;  2NN6 A;  3GCM A;  2BA0 G;  5K36 A;  2NN6 C;  1UDQ A;  2WNR B;  2NN6 B;  1E3P A;  4AM3 A;  2JE6 B;  4OO1 E;  4BA1 A;  2C38 A;  4OO1 C;  5C0X A;  4OO1 F;  1OYS A;  3B4T A;  2WP8 A;  2C38 B;  3HKM A;  5K36 C;  5K36 D;  1R6L A;  2WNR A;  5JEA D;  2PO2 B;  3U1K A;  4OO1 B;  2WP8 B;  3M85 G;  4OO1 D;  4IFD C;  3L7Z B;  5JEA B;  1OYR A;  2JEA A;  3M7N G;  2BR2 A;  3DD6 A;  2C37 B;  5JEA E;  5C0X E;  4IFD A;  4BA2 B;  2BA1 D;  3KRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...