2C37A

Rnase ph core of the archaeal exosome in complex with u8 rna
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
260
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
total genus 76
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c37A01
5JEAB 2JEBB 2PO0A 3U1KA 2NN6D 2C38A 4AIDA 1UDOA 2C37B 5K36F 3KRNA 2BR2A 1R6MA 2JE6B 4BA2B 3L7ZA 4OO1A 4OO1E 3M85G 5JEAA 2WNRA 3GLLA 4IFDE 4AIMA 5K36A 3GMEA 4AM3A 3L7ZB 4OO1B 2NN6E 1R6LA 4IFDD 2C39B 5C0XC 1UDSA 2C37A 5C0XE 5JEAF 2NN6B 5C0XF 3H1CA 2WNRB 4IFDC 5K36B 3M7NG 4NBQA 5C0XD 5C0XB 2PO2B 3GCMA 5JEAC 2BA1G 2JEAA 1OYSA 4IFDF 2C39A 3CDIA 2BA0G 3DD6A 5JEAD 1E3HA 2JEAB 1UDNA 2PNZA 5JEAE 2PO2A 1OYPA 2PO1A 5K36E 4IFDA 5C0XA 4BA2A 1E3PA 1UDQA 2PNZB 4OO1C 2JE6A 2NN6A 3CDJA 2BR2B 4BA1B 5K36D 2C38B 2BA0D 4BA1A 3M7ND 4OO1F 2JEBA 2PO0B 3B4TA 4OO1D 2BA1D 2NN6C 2WP8A 1OYRA 5K36C 4IFDB 2PO1B 3HKMA 2NN6F 3M85D 2WP8B
chains in the Genus database with same CATH superfamily
1MG7A 2NN6D 1MU5A 1Z5BA 4LF5E 2ZM6E 4AIDA 1UDOA 2C37B 5K36F 2HFSA 5EL9A 4HXZA 4JI0I 4JYAI 3PS3A 1BKNA 1S4EA 4DR1E 4UTGA 2HHHI 1ZXNA 4YHHE 1HNWE 1H72C 4JI2E 4IZJA 4X62I 3QT8A 5EKWA 4B3ME 4MU4A 1KIJA 2ZITA 4HY1A 4DR4I 2VQFI 3LPSA 1N0VC 4GKKI 4DR1I 4FW9A 4DR7E 2HKEA 4MU0A 4DV4E 3T1YE 5A2QQ 1R6LA 1FNMA 2UUCE 5FLXQ 1UDSA 5DRQA 4DUZI 2ZM6I 4LFCE 1HK7A 4USKA 2NN6B 4LF9E 2WNRB 2GS8A 5K36B 3V2UC 5ELWA 1Y4SA 4IS9A 1IBLI 4DPWA 1UEKA 5FWKA 2JEAA 1OYSA 1PIEA 4LFCI 2C39A 3QT5A 4LFAI 1N34E 1WUUA 2CZ9A 1FKAE 1YHCA 2AE8A 4DPXA 4DU8A 5JEAD 3QT6A 4DV4I 3T1YI 1N32I 4DPUA 3J7AM 2UXCI 4B3SI 2O1UA 2JEAB 1UDNA 2PNZA 4DV1I 4ZVIA 1K47A 4FW7A 1FI4A 3ZKDA 2PO1A 1FJGI 2OI2A 4IFDA 5FLXC 4GKKE 2A2DA 4XTJA 4FW5A 3T1HE 4LOMA 2HHHE 4OO1C 4GQUA 4LPFA 2NN6A 3NZKA 4DR6E 4LCHA 1Z0WA 3JAMQ 1RHYA 4DXLA 2Z5CB 4DU7A 4GKJI 3ZZUA 1FJGE 2BM0A 5A2QC 4B3TE 5K36C 4IFDB 1XNRE 1D6TA 2PO1B 2J65A 2E1RA 2WW4A 3HKMA 4LFBI 3HJCA 3M85D 2PO0A 4B3TI 4NXNE 1IBME 4K0KI 1Z0CA 1N33E 1N36I 1HR0E 2C38A 1YH8A 1PVGA 4DUYE 2UUAE 2BR2A 2X36A 1N0UA 2JE6B 2DEIA 3J7AG 2F4VE 4I3HA 1HNXI 4JI7E 4LCFA 5IT9C 3M85G 3ZZ0A 3Q6MA 1Z59A 3GLLA 5K36A 5IWAI 1Z5CA 3WU4A 4M1KA 4EMDA 1NHIA 1I94E 3L7ZB 4OO1B 4OKGA 1XNQI 1Z0BA 4U3DA 2BM1A 2JT2A 3J81Q 3P06A 4FWHA 1P42A 2O3ZA 4JI1E 5C0XF 5LL6R 4DV2E 1ZM2A 1IBLE 4IFDC 3J80Q 1Z0TA 3M7NG 4JYAE 4NBQA 4MYUA 1XNQE 5JEAC 4DPYA 4B3RI 5L3JA 1N33I 2HK3A 4DV7I 1J5EI 1EA6A 5DRPA 4DR3E 4OX9I 2BA0G 4QNKA 4WUDA 1VISA 3DD6A 1DARA 2HKJA 1B62A 1MX0A 2UU9E 3Q1QA 1IBKI 4LF4I 4DV3I 4DR2I 4LCGA 1ZXMA 4USMA 3J81C 5JEAE 2PO2A 4NXME 5LMUI 1UDQA 2X7IA 4FWGA 4ISAA 2PNZB 4JI5I 4DV5E 3P76A 4YY3E 2UXBE 4AQYE 2JE6A 3F0NA 2VQEE 3ZM7A 3CDJA 2UXDE 2BR2B 4JI6E 2F1DA 5BR8E 1ELOA 2CVEA 3M7ND 2LJPA 4JI3E 4DR5E 1NZ0A 3B4TA 1HNZE 4B3SE 1HNZI 3LNUA 2BA1D 4DV0I 5DRRA 3J80C 1OYRA 2IOPA 2Z5BA 2CG9A 4KHPI 4JI5E 1N34I 2GO3A 4OZEA 2BV3A 2PNLA 4J3DA 4FWDA 5JEAB 1USUA 2JEBB 4YY3I 2UXBI 1IBKE 5LMUE 4LF7E 3KRNA 2R42A 4MDTA 1XMOE 4IZKB 2E5LE 2VESA 1R6MA 1B63A 4X64E 3HULA 3P3GA 4OX9E 2EFGA 2UUBE 2UXCE 3M6AA 3D4JA 4ED4A 1ZM9A 1USVA 4IFDE 4DR7I 1Z0VA 2IESA 4JI4E 1KVKA 1U2RA 2A2CA 2CGEA 2VQFE 4FW6A 4HACB 1EI1A 3UHMA 4X66I 4DR4E 2O1TA 4U3BA 3B8HA 2C39B 5C0XC 4LF7I 2C37A 5C0XE 2GQ0A 5JEAF 3ZZTA 1XMQI 4DV0E 3H1CA 4HYMA 4PU9A 2V2VA 4JI4I 4JV5E 2IOQA 5C0XB 1NHJA 4JI8E 3GCMA 1NHHA 4PRXA 2Z5BB 3PS2A 2E5LI 1Z0GA 5IWAE 1Y5YA 4QNJA 2V2QA 3K1JA 3CDIA 4JV5I 1A6FA 4JI2I 2V2ZA 4X65I 3OTOE 1RR9A 3GONA 3WU6A 2XEXA 1XMQE 1E3HA 3T1HI 4URLA 2V8PA 1H74A 2J7KA 3B82A 4Z7CA 4KHPE 4LF6I 1VI7A 1Y60A 5K36E 5C0XA 1E3PA 4MU1A 1XNRI 1J5EE 2UUBI 1Z5AA 2Z5CA 2R3VA 1N32E 3PS1A 1Z0EA 3H4LA 3K17A 4X64I 4JG4A 2O1VA 4DV6E 4P52A 1XMOI 3U1YA 4PRVA 1HNXE 1S16A 3QT7A 2JEBA 4DV7E 4MU3A 1FWLA 3OTOI 3PYGA 4DUYI 1ZM4A 3P3CA 1QZRA 2WP8B 3PYEA 3Q6NA 1IBMI 4K0KE 3U1KA 1Y6ZA 4DV3E 4DR2E 4X65E 2PNMA 2Z5EA 4WUCA 4DV6I 2GO4A 4FW3A 4DV1E 3WU3A 4B3RE 5DNLA 2NPFA 3K85A 1KKHA 5IT9Q 3WU5A 1Y4UA 4BA2B 4RPFA 3L7ZA 4OO1A 4OO1E 5JEAA 4LF6E 4LFAE 2WNRA 2VQEI 4AIMA 3GMEA 4X66E 3JAMC 4JI1I 4AM3A 2UU9I 1H7UA 1KTVA 2NN6E 4NXNI 4IFDD 2DEJA 1PKPA 1HR0I 5GMEA 4HACA 5GMDA 3ZKBA 4DR5I 4IZJD 4JI8I 4IZJB 4LF8E 1ZM3A 5C0XD 1H7SA 2PO2B 4DV2I 3PYFA 1RREA 2BA1G 5DNXA 4YHHI 1HNWI 2ZBKB 2F4VI 4IFDF 4R1FA 4X62E 4DR6I 4IZKA 1FWKA 4FW4A 2O1WA 4N3OA 4WUBA 4JI0E 4UT4A 4LF4E 1I94I 4LFBE 4DUZE 2IERA 4FN5A 3B78A 2HFUA 2UUCI 5BR8I 1OYPA 1H73A 1OJ4A 2UXDI 4BA2A 4GKJE 4P7AA 4DR3I 4AQYI 4DV5I 4JI3I 3LTOA 4MYTA 4B3MI 3PYDA 4JI6I 2VF3A 4BA1B 5K36D 2C38B 2BA0D 4BA1A 2UUAI 4OO1F 5LMNE 4JI7I 5LMNI 2AJ4A 4KQVA 3V5RA 4Z7YA 1XXEA 2PO0B 1N36E 3P3EA 4OO1D 4NXMI 2NN6C 2WP8A 4MQYA 2V34A 5DROA 2Q2EB 4LF8I 1XHKA 3CWVA 2NN6F 4LF5I 4LF9I 3PRYA 2HK2A 4DPTA
chains in the Genus database with same CATH topology
5JEAB 2JEBB 2PO0A 3U1KA 2NN6D 2C38A 4AIDA 1UDOA 2C37B 5K36F 3KRNA 2BR2A 1R6MA 2JE6B 4BA2B 3L7ZA 4OO1A 4OO1E 3M85G 5JEAA 2WNRA 3GLLA 4IFDE 4AIMA 5K36A 3GMEA 4AM3A 3L7ZB 4OO1B 2NN6E 1R6LA 4IFDD 2C39B 5C0XC 1UDSA 2C37A 5C0XE 5JEAF 2NN6B 5C0XF 3H1CA 2WNRB 4IFDC 5K36B 3M7NG 4NBQA 5C0XD 5C0XB 2PO2B 3GCMA 5JEAC 2BA1G 2JEAA 1OYSA 4IFDF 2C39A 3CDIA 2BA0G 3DD6A 5JEAD 1E3HA 2JEAB 1UDNA 2PNZA 5JEAE 2PO2A 1OYPA 2PO1A 5K36E 4IFDA 5C0XA 4BA2A 1E3PA 1UDQA 2PNZB 4OO1C 2JE6A 2NN6A 3CDJA 2BR2B 4BA1B 5K36D 2C38B 2BA0D 4BA1A 3M7ND 4OO1F 2JEBA 2PO0B 3B4TA 4OO1D 2BA1D 2NN6C 2WP8A 1OYRA 5K36C 4IFDB 2PO1B 3HKMA 2NN6F 3M85D 2WP8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA B;  2JEB B;  2PO0 A;  3U1K A;  2NN6 D;  2C38 A;  4AID A;  1UDO A;  2C37 B;  5K36 F;  3KRN A;  2BR2 A;  1R6M A;  2JE6 B;  4BA2 B;  3L7Z A;  4OO1 A;  4OO1 E;  3M85 G;  5JEA A;  2WNR A;  3GLL A;  4IFD E;  4AIM A;  5K36 A;  3GME A;  4AM3 A;  3L7Z B;  4OO1 B;  2NN6 E;  1R6L A;  4IFD D;  2C39 B;  5C0X C;  1UDS A;  2C37 A;  5C0X E;  5JEA F;  2NN6 B;  5C0X F;  3H1C A;  2WNR B;  4IFD C;  5K36 B;  3M7N G;  4NBQ A;  5C0X D;  5C0X B;  2PO2 B;  3GCM A;  5JEA C;  2BA1 G;  2JEA A;  1OYS A;  4IFD F;  2C39 A;  3CDI A;  2BA0 G;  3DD6 A;  5JEA D;  1E3H A;  2JEA B;  1UDN A;  2PNZ A;  5JEA E;  2PO2 A;  1OYP A;  2PO1 A;  5K36 E;  4IFD A;  5C0X A;  4BA2 A;  1E3P A;  1UDQ A;  2PNZ B;  4OO1 C;  2JE6 A;  2NN6 A;  3CDJ A;  2BR2 B;  4BA1 B;  5K36 D;  2C38 B;  2BA0 D;  4BA1 A;  3M7N D;  4OO1 F;  2JEB A;  2PO0 B;  3B4T A;  4OO1 D;  2BA1 D;  2NN6 C;  2WP8 A;  1OYR A;  5K36 C;  4IFD B;  2PO1 B;  3HKM A;  2NN6 F;  3M85 D;  2WP8 B; 
#chains in the Genus database with same CATH topology
 1MG7 A;  2NN6 D;  1MU5 A;  1Z5B A;  4LF5 E;  2ZM6 E;  4AID A;  1UDO A;  2C37 B;  5K36 F;  2HFS A;  5EL9 A;  4HXZ A;  4JI0 I;  4JYA I;  3PS3 A;  1BKN A;  1S4E A;  4DR1 E;  4UTG A;  2HHH I;  1ZXN A;  4YHH E;  1HNW E;  1H72 C;  4JI2 E;  4IZJ A;  4X62 I;  3QT8 A;  5EKW A;  4B3M E;  4MU4 A;  1KIJ A;  2ZIT A;  4HY1 A;  4DR4 I;  2VQF I;  3LPS A;  1N0V C;  4GKK I;  4DR1 I;  4FW9 A;  4DR7 E;  2HKE A;  4MU0 A;  4DV4 E;  3T1Y E;  5A2Q Q;  1R6L A;  1FNM A;  2UUC E;  5FLX Q;  1UDS A;  5DRQ A;  4DUZ I;  2ZM6 I;  4LFC E;  1HK7 A;  4USK A;  2NN6 B;  4LF9 E;  2WNR B;  2GS8 A;  5K36 B;  3V2U C;  5ELW A;  1Y4S A;  4IS9 A;  1IBL I;  4DPW A;  1UEK A;  5FWK A;  2JEA A;  1OYS A;  1PIE A;  4LFC I;  2C39 A;  3QT5 A;  4LFA I;  1N34 E;  1WUU A;  2CZ9 A;  1FKA E;  1YHC A;  2AE8 A;  4DPX A;  4DU8 A;  5JEA D;  3QT6 A;  4DV4 I;  3T1Y I;  1N32 I;  4DPU A;  3J7A M;  2UXC I;  4B3S I;  2O1U A;  2JEA B;  1UDN A;  2PNZ A;  4DV1 I;  4ZVI A;  1K47 A;  4FW7 A;  1FI4 A;  3ZKD A;  2PO1 A;  1FJG I;  2OI2 A;  4IFD A;  5FLX C;  4GKK E;  2A2D A;  4XTJ A;  4FW5 A;  3T1H E;  4LOM A;  2HHH E;  4OO1 C;  4GQU A;  4LPF A;  2NN6 A;  3NZK A;  4DR6 E;  4LCH A;  1Z0W A;  3JAM Q;  1RHY A;  4DXL A;  2Z5C B;  4DU7 A;  4GKJ I;  3ZZU A;  1FJG E;  2BM0 A;  5A2Q C;  4B3T E;  5K36 C;  4IFD B;  1XNR E;  1D6T A;  2PO1 B;  2J65 A;  2E1R A;  2WW4 A;  3HKM A;  4LFB I;  3HJC A;  3M85 D;  2PO0 A;  4B3T I;  4NXN E;  1IBM E;  4K0K I;  1Z0C A;  1N33 E;  1N36 I;  1HR0 E;  2C38 A;  1YH8 A;  1PVG A;  4DUY E;  2UUA E;  2BR2 A;  2X36 A;  1N0U A;  2JE6 B;  2DEI A;  3J7A G;  2F4V E;  4I3H A;  1HNX I;  4JI7 E;  4LCF A;  5IT9 C;  3M85 G;  3ZZ0 A;  3Q6M A;  1Z59 A;  3GLL A;  5K36 A;  5IWA I;  1Z5C A;  3WU4 A;  4M1K A;  4EMD A;  1NHI A;  1I94 E;  3L7Z B;  4OO1 B;  4OKG A;  1XNQ I;  1Z0B A;  4U3D A;  2BM1 A;  2JT2 A;  3J81 Q;  3P06 A;  4FWH A;  1P42 A;  2O3Z A;  4JI1 E;  5C0X F;  5LL6 R;  4DV2 E;  1ZM2 A;  1IBL E;  4IFD C;  3J80 Q;  1Z0T A;  3M7N G;  4JYA E;  4NBQ A;  4MYU A;  1XNQ E;  5JEA C;  4DPY A;  4B3R I;  5L3J A;  1N33 I;  2HK3 A;  4DV7 I;  1J5E I;  1EA6 A;  5DRP A;  4DR3 E;  4OX9 I;  2BA0 G;  4QNK A;  4WUD A;  1VIS A;  3DD6 A;  1DAR A;  2HKJ A;  1B62 A;  1MX0 A;  2UU9 E;  3Q1Q A;  1IBK I;  4LF4 I;  4DV3 I;  4DR2 I;  4LCG A;  1ZXM A;  4USM A;  3J81 C;  5JEA E;  2PO2 A;  4NXM E;  5LMU I;  1UDQ A;  2X7I A;  4FWG A;  4ISA A;  2PNZ B;  4JI5 I;  4DV5 E;  3P76 A;  4YY3 E;  2UXB E;  4AQY E;  2JE6 A;  3F0N A;  2VQE E;  3ZM7 A;  3CDJ A;  2UXD E;  2BR2 B;  4JI6 E;  2F1D A;  5BR8 E;  1ELO A;  2CVE A;  3M7N D;  2LJP A;  4JI3 E;  4DR5 E;  1NZ0 A;  3B4T A;  1HNZ E;  4B3S E;  1HNZ I;  3LNU A;  2BA1 D;  4DV0 I;  5DRR A;  3J80 C;  1OYR A;  2IOP A;  2Z5B A;  2CG9 A;  4KHP I;  4JI5 E;  1N34 I;  2GO3 A;  4OZE A;  2BV3 A;  2PNL A;  4J3D A;  4FWD A;  5JEA B;  1USU A;  2JEB B;  4YY3 I;  2UXB I;  1IBK E;  5LMU E;  4LF7 E;  3KRN A;  2R42 A;  4MDT A;  1XMO E;  4IZK B;  2E5L E;  2VES A;  1R6M A;  1B63 A;  4X64 E;  3HUL A;  3P3G A;  4OX9 E;  2EFG A;  2UUB E;  2UXC E;  3M6A A;  3D4J A;  4ED4 A;  1ZM9 A;  1USV A;  4IFD E;  4DR7 I;  1Z0V A;  2IES A;  4JI4 E;  1KVK A;  1U2R A;  2A2C A;  2CGE A;  2VQF E;  4FW6 A;  4HAC B;  1EI1 A;  3UHM A;  4X66 I;  4DR4 E;  2O1T A;  4U3B A;  3B8H A;  2C39 B;  5C0X C;  4LF7 I;  2C37 A;  5C0X E;  2GQ0 A;  5JEA F;  3ZZT A;  1XMQ I;  4DV0 E;  3H1C A;  4HYM A;  4PU9 A;  2V2V A;  4JI4 I;  4JV5 E;  2IOQ A;  5C0X B;  1NHJ A;  4JI8 E;  3GCM A;  1NHH A;  4PRX A;  2Z5B B;  3PS2 A;  2E5L I;  1Z0G A;  5IWA E;  1Y5Y A;  4QNJ A;  2V2Q A;  3K1J A;  3CDI A;  4JV5 I;  1A6F A;  4JI2 I;  2V2Z A;  4X65 I;  3OTO E;  1RR9 A;  3GON A;  3WU6 A;  2XEX A;  1XMQ E;  1E3H A;  3T1H I;  4URL A;  2V8P A;  1H74 A;  2J7K A;  3B82 A;  4Z7C A;  4KHP E;  4LF6 I;  1VI7 A;  1Y60 A;  5K36 E;  5C0X A;  1E3P A;  4MU1 A;  1XNR I;  1J5E E;  2UUB I;  1Z5A A;  2Z5C A;  2R3V A;  1N32 E;  3PS1 A;  1Z0E A;  3H4L A;  3K17 A;  4X64 I;  4JG4 A;  2O1V A;  4DV6 E;  4P52 A;  1XMO I;  3U1Y A;  4PRV A;  1HNX E;  1S16 A;  3QT7 A;  2JEB A;  4DV7 E;  4MU3 A;  1FWL A;  3OTO I;  3PYG A;  4DUY I;  1ZM4 A;  3P3C A;  1QZR A;  2WP8 B;  3PYE A;  3Q6N A;  1IBM I;  4K0K E;  3U1K A;  1Y6Z A;  4DV3 E;  4DR2 E;  4X65 E;  2PNM A;  2Z5E A;  4WUC A;  4DV6 I;  2GO4 A;  4FW3 A;  4DV1 E;  3WU3 A;  4B3R E;  5DNL A;  2NPF A;  3K85 A;  1KKH A;  5IT9 Q;  3WU5 A;  1Y4U A;  4BA2 B;  4RPF A;  3L7Z A;  4OO1 A;  4OO1 E;  5JEA A;  4LF6 E;  4LFA E;  2WNR A;  2VQE I;  4AIM A;  3GME A;  4X66 E;  3JAM C;  4JI1 I;  4AM3 A;  2UU9 I;  1H7U A;  1KTV A;  2NN6 E;  4NXN I;  4IFD D;  2DEJ A;  1PKP A;  1HR0 I;  5GME A;  4HAC A;  5GMD A;  3ZKB A;  4DR5 I;  4IZJ D;  4JI8 I;  4IZJ B;  4LF8 E;  1ZM3 A;  5C0X D;  1H7S A;  2PO2 B;  4DV2 I;  3PYF A;  1RRE A;  2BA1 G;  5DNX A;  4YHH I;  1HNW I;  2ZBK B;  2F4V I;  4IFD F;  4R1F A;  4X62 E;  4DR6 I;  4IZK A;  1FWK A;  4FW4 A;  2O1W A;  4N3O A;  4WUB A;  4JI0 E;  4UT4 A;  4LF4 E;  1I94 I;  4LFB E;  4DUZ E;  2IER A;  4FN5 A;  3B78 A;  2HFU A;  2UUC I;  5BR8 I;  1OYP A;  1H73 A;  1OJ4 A;  2UXD I;  4BA2 A;  4GKJ E;  4P7A A;  4DR3 I;  4AQY I;  4DV5 I;  4JI3 I;  3LTO A;  4MYT A;  4B3M I;  3PYD A;  4JI6 I;  2VF3 A;  4BA1 B;  5K36 D;  2C38 B;  2BA0 D;  4BA1 A;  2UUA I;  4OO1 F;  5LMN E;  4JI7 I;  5LMN I;  2AJ4 A;  4KQV A;  3V5R A;  4Z7Y A;  1XXE A;  2PO0 B;  1N36 E;  3P3E A;  4OO1 D;  4NXM I;  2NN6 C;  2WP8 A;  4MQY A;  2V34 A;  5DRO A;  2Q2E B;  4LF8 I;  1XHK A;  3CWV A;  2NN6 F;  4LF5 I;  4LF9 I;  3PRY A;  2HK2 A;  4DPT A; 
#chains in the Genus database with same CATH homology
 5JEA B;  2JEB B;  2PO0 A;  3U1K A;  2NN6 D;  2C38 A;  4AID A;  1UDO A;  2C37 B;  5K36 F;  3KRN A;  2BR2 A;  1R6M A;  2JE6 B;  4BA2 B;  3L7Z A;  4OO1 A;  4OO1 E;  3M85 G;  5JEA A;  2WNR A;  3GLL A;  4IFD E;  4AIM A;  5K36 A;  3GME A;  4AM3 A;  3L7Z B;  4OO1 B;  2NN6 E;  1R6L A;  4IFD D;  2C39 B;  5C0X C;  1UDS A;  2C37 A;  5C0X E;  5JEA F;  2NN6 B;  5C0X F;  3H1C A;  2WNR B;  4IFD C;  5K36 B;  3M7N G;  4NBQ A;  5C0X D;  5C0X B;  2PO2 B;  3GCM A;  5JEA C;  2BA1 G;  2JEA A;  1OYS A;  4IFD F;  2C39 A;  3CDI A;  2BA0 G;  3DD6 A;  5JEA D;  1E3H A;  2JEA B;  1UDN A;  2PNZ A;  5JEA E;  2PO2 A;  1OYP A;  2PO1 A;  5K36 E;  4IFD A;  5C0X A;  4BA2 A;  1E3P A;  1UDQ A;  2PNZ B;  4OO1 C;  2JE6 A;  2NN6 A;  3CDJ A;  2BR2 B;  4BA1 B;  5K36 D;  2C38 B;  2BA0 D;  4BA1 A;  3M7N D;  4OO1 F;  2JEB A;  2PO0 B;  3B4T A;  4OO1 D;  2BA1 D;  2NN6 C;  2WP8 A;  1OYR A;  5K36 C;  4IFD B;  2PO1 B;  3HKM A;  2NN6 F;  3M85 D;  2WP8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...