2C37A

Rnase ph core of the archaeal exosome in complex with u8 rna
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
260
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 76
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c37A01
4IFDF 5K36F 3L7ZA 3H1CA 5JEAF 2BA1D 4AIMA 4IFDC 5JEAC 3KRNA 3GMEA 2PO1A 2C38A 5K36D 3L7ZB 1E3PA 2BA1G 2PO0B 5C0XA 2NN6A 2C39B 3CDJA 2PO1B 2C38B 4OO1A 1OYPA 3DD6A 4BA1B 1R6MA 2JEBA 5C0XB 2NN6B 3GCMA 2WP8A 4OO1B 3U1KA 5C0XE 2NN6E 3B4TA 2JEBB 4IFDD 1UDSA 1OYRA 4OO1E 5JEAD 2WP8B 2JEAA 3GLLA 5K36A 5JEAA 2NN6F 4NBQA 1R6LA 5C0XC 1E3HA 2JEAB 2NN6C 5K36B 3HKMA 4OO1C 3CDIA 2PNZA 2JE6A 2PO2A 5K36E 5JEAE 3M85D 1OYSA 2BA0D 2PNZB 4IFDA 2PO2B 5C0XF 4AM3A 1UDNA 2BR2A 2WNRA 3M85G 3M7ND 4OO1F 2PO0A 4AIDA 2BA0G 5K36C 2C39A 4IFDB 5C0XD 2C37A 5JEAB 2BR2B 2NN6D 2WNRB 3M7NG 4BA1A 4IFDE 4OO1D 4BA2A 2C37B 1UDOA 2JE6B 1UDQA 4BA2B
chains in the Genus database with same CATH superfamily
4LF6I 5K36F 1RHYA 5FWKA 1USUA 4AIMA 1ZM9A 1Z5AA 5DNXA 4IFDC 1ZXNA 5JEAC 2J7KA 2C38A 3NZKA 4WUCA 1ZXMA 4GQUA 4LF8E 1Z5CA 4DXLA 3GONA 5C0XA 4U3DA 1N0VC 2NN6A 4UTGA 4MU4A 2CZ9A 1KKHA 1OYPA 1YH8A 1OJ4A 2O1WA 4JI7E 1R6MA 2HHHI 2Z5BB 4DV6I 1XMOI 1XMQE 4LFBE 5C0XE 4KQVA 4DV1E 4X64E 2NN6E 3T1HI 4JI4I 2Z5CB 3J7AG 1OYRA 2F1DA 4JI8E 4B3RE 5IWAI 4IZJB 1HNWE 4JG4A 2CGEA 2Q2EB 5K36A 1XNRI 1EI1A 5BR8E 2GO4A 4LF5E 1R6LA 4LFAI 5C0XC 1XHKA 1HNXI 2NN6C 3PYFA 4DR3E 5IT9C 3HKMA 4JYAE 2JE6A 2UU9I 4OZEA 5K36E 1FI4A 1FWKA 4NXNE 2UXBI 3QT5A 2ZBKB 2BA0D 5EL9A 1ZM3A 4DR7E 2IOPA 3PRYA 1IBKI 1IBME 3M85G 2AE8A 3M7ND 4OO1F 4X66I 2PO0A 1RR9A 4FW4A 2IERA 5K36C 1Y4UA 5LMUI 1IBLI 4IFDB 5JEAB 1QZRA 5A2QC 1I94I 4FN5A 4JI2E 4DR1I 1Z59A 2C37B 2DEJA 4IZKB 2VF3A 4J3DA 2VQFE 4LFCI 2UUCI 4B3MI 4PU9A 1KIJA 3LTOA 3OTOE 5ELWA 3LPSA 4DV2E 2HK2A 3WU5A 1HNZI 1VI7A 4KHPI 1H73A 1KVKA 5DNLA 4B3TE 4YHHI 4ISAA 2PO1A 1Z0EA 4U3BA 4LF7I 4FWHA 4UT4A 2VQEI 2BA1G 3ZM7A 4JI1E 2C39B 3CDJA 4DV3E 3Q1QA 1N34E 1H7SA 3CWVA 4DPUA 2C38B 4OO1A 4LF9E 1HK7A 1Z0TA 2NPFA 5FLXQ 4B3SE 2BV3A 4K0KE 4BA1B 2BM1A 4DV4E 1D6TA 5C0XB 1XXEA 2NN6B 4DUYI 3UHMA 4DU7A 1H72C 3B82A 3PYDA 4JI0I 3U1KA 3QT8A 1J5EE 2UUAE 1N36E 4LF4E 4NXME 4DR5I 2R42A 2Z5EA 1UDSA 3B78A 4OO1E 4YY3E 4URLA 2PNLA 2XEXA 4ZVIA 2IESA 1Z0GA 4JV5E 2UXDE 3J80C 4JI6E 2F4VI 3PYEA 4X65E 4OX9I 5LMNE 5L3JA 5K36B 3JAMC 4WUBA 4OO1C 3Q6NA 4LCFA 1USVA 1HR0I 1N32E 3P3CA 2A2DA 1FJGE 3Q6MA 1FKAE 2PO2A 2V34A 2GS8A 1BKNA 3T1YE 2E5LE 4DV0I 4DUZI 2UUBE 3D4JA 4JI5E 4DV5I 4ED4A 4AM3A 4N3OA 2BR2A 1FNMA 2WNRA 4DR2E 3J81C 3ZKBA 5GMDA 1Y60A 1N33E 4DV7E 1H7UA 3ZZ0A 4GKJE 2V2VA 1MX0A 1MU5A 1Y6ZA 4LF8I 2UXCE 1NHJA 3QT6A 2V8PA 1XNQE 1ELOA 3H4LA 4BA2A 4R1FA 4FW9A 4Z7YA 4LOMA 4JI3E 1PKPA 2PNMA 4JI7I 4GKKE 1ZM2A 4X62E 5LL6R 4IZJD 3ZZTA 4IFDF 1XMQI 3L7ZA 3H1CA 5JEAF 4LFBI 1S16A 4FW7A 4DV1I 4X64I 4DR6E 2LJPA 1NHIA 2X7IA 3KRNA 2HFUA 2ZM6E 4JI8I 4B3RI 1E3PA 4FW5A 2O1VA 1HNWI 4FWDA 2R3VA 3P76A 4QNJA 1Z0BA 4AQYE 1EA6A 5BR8I 2PO1B 4LF5I 4IS9A 4Z7CA 1Z0VA 3DD6A 3QT7A 4I3HA 1YHCA 4MU0A 4DR3I 4DR4E 2X36A 2JEBA 5IT9Q 4MYTA 3WU3A 4JYAI 4LF6E 3GCMA 2WP8A 3PS3A 4OO1B 2BM0A 4NXNI 1VISA 3WU6A 2GQ0A 4USKA 3K1JA 4IFDD 1B63A 5JEAD 2O1UA 4HY1A 3ZKDA 2EFGA 4DR7I 2JEAA 4M1KA 3GLLA 1IBMI 4FW3A 2J65A 5JEAA 2NN6F 1Z5BA 1B62A 2HFSA 4PRVA 3ZZUA 2V2ZA 3F0NA 2HHHE 5A2QQ 2E1RA 3CDIA 2PNZA 4DV6E 1H74A 1XMOE 1WUUA 4JI2I 3U1YA 1U2RA 1RREA 3P06A 3PS2A 5JEAE 3T1HE 4JI4E 3M85D 2VQFI 2AJ4A 3V2UC 2WW4A 4FW6A 5IWAE 4PRXA 2PO2B 1P42A 4DU8A 1UDNA 3OTOI 3V5RA 3P3GA 4DV2I 1XNRE 1NZ0A 4B3TI 2BA0G 4LFAE 2VESA 4EMDA 2C39A 4USMA 1HNXE 5C0XD 1MG7A 2BR2B 2NN6D 2WNRB 3B8HA 3HULA 4LPFA 4HACA 3M7NG 4JI1I 4BA1A 4DV3I 1N34I 4MYUA 2UU9E 4LF9I 2UXBE 4B3SI 1UDOA 3J7AM 4K0KI 3PYGA 2CVEA 4DV4I 2JE6B 1UDQA 4BA2B 1DARA 2GO3A 5EKWA 1IBKE 1J5EI 2UUAI 2BA1D 1N36I 4LF4I 4NXMI 2O1TA 3K85A 4X66E 3GMEA 1IBLE 5LMUE 5DRPA 4YY3I 5K36D 2ZITA 3L7ZB 2HKEA 2PO0B 1I94E 2Z5BA 4HXZA 4MU1A 4HYMA 5GMEA 4MU3A 4JV5I 3J80Q 4DR1E 2UXDI 2HK3A 4JI6I 5DRQA 4MQYA 4X65I 4P7AA 3PS1A 5LMNI 3JAMQ 4LFCE 2UUCE 1A6FA 2OI2A 2Z5CA 4B3ME 4MDTA 1N32I 3K17A 1FJGI 4IZJA 3B4TA 3T1YI 1HNZE 2IOQA 2JEBB 4KHPE 2E5LI 1K47A 2DEIA 1PVGA 4YHHE 4LF7E 2UUBI 4JI5I 2WP8B 5DROA 2VQEE 4DPYA 1Z0WA 3J81Q 4DR2I 4LCGA 1Z0CA 4NBQA 4DPTA 1N33I 1N0UA 4DV7I 2HKJA 4GKJI 1E3HA 3P3EA 2JEAB 3M6AA 5FLXC 1Y5YA 3HJCA 1S4EA 2UXCI 1XNQI 4DUYE 2O3ZA 1NHHA 4JI0E 4P52A 5DRRA 4DR5E 2CG9A 4JI3I 1PIEA 4GKKI 1OYSA 4OKGA 2V2QA 4QNKA 4WUDA 4X62I 2PNZB 4IFDA 5C0XF 4DR6I 4DPWA 4AIDA 2ZM6I 1ZM4A 1UEKA 2F4VE 2C37A 3LNUA 4OX9E 4XTJA 4IZKA 1KTVA 4RPFA 1HR0E 4AQYI 4IFDE 4OO1D 2JT2A 1Y4SA 4LCHA 1FWLA 2A2CA 3WU4A 4DV0E 4DR4I 4FWGA 4HACB 4DUZE 4DPXA 4DV5E
chains in the Genus database with same CATH topology
4IFDF 5K36F 3L7ZA 3H1CA 5JEAF 2BA1D 4AIMA 4IFDC 5JEAC 3KRNA 3GMEA 2PO1A 2C38A 5K36D 3L7ZB 1E3PA 2BA1G 2PO0B 5C0XA 2NN6A 2C39B 3CDJA 2PO1B 2C38B 4OO1A 1OYPA 3DD6A 4BA1B 1R6MA 2JEBA 5C0XB 2NN6B 3GCMA 2WP8A 4OO1B 3U1KA 5C0XE 2NN6E 3B4TA 2JEBB 4IFDD 1UDSA 1OYRA 4OO1E 5JEAD 2WP8B 2JEAA 3GLLA 5K36A 5JEAA 2NN6F 4NBQA 1R6LA 5C0XC 1E3HA 2JEAB 2NN6C 5K36B 3HKMA 4OO1C 3CDIA 2PNZA 2JE6A 2PO2A 5K36E 5JEAE 3M85D 1OYSA 2BA0D 2PNZB 4IFDA 2PO2B 5C0XF 4AM3A 1UDNA 2BR2A 2WNRA 3M85G 3M7ND 4OO1F 2PO0A 4AIDA 2BA0G 5K36C 2C39A 4IFDB 5C0XD 2C37A 5JEAB 2BR2B 2NN6D 2WNRB 3M7NG 4BA1A 4IFDE 4OO1D 4BA2A 2C37B 1UDOA 2JE6B 1UDQA 4BA2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD F;  5K36 F;  3L7Z A;  3H1C A;  5JEA F;  2BA1 D;  4AIM A;  4IFD C;  5JEA C;  3KRN A;  3GME A;  2PO1 A;  2C38 A;  5K36 D;  3L7Z B;  1E3P A;  2BA1 G;  2PO0 B;  5C0X A;  2NN6 A;  2C39 B;  3CDJ A;  2PO1 B;  2C38 B;  4OO1 A;  1OYP A;  3DD6 A;  4BA1 B;  1R6M A;  2JEB A;  5C0X B;  2NN6 B;  3GCM A;  2WP8 A;  4OO1 B;  3U1K A;  5C0X E;  2NN6 E;  3B4T A;  2JEB B;  4IFD D;  1UDS A;  1OYR A;  4OO1 E;  5JEA D;  2WP8 B;  2JEA A;  3GLL A;  5K36 A;  5JEA A;  2NN6 F;  4NBQ A;  1R6L A;  5C0X C;  1E3H A;  2JEA B;  2NN6 C;  5K36 B;  3HKM A;  4OO1 C;  3CDI A;  2PNZ A;  2JE6 A;  2PO2 A;  5K36 E;  5JEA E;  3M85 D;  1OYS A;  2BA0 D;  2PNZ B;  4IFD A;  2PO2 B;  5C0X F;  4AM3 A;  1UDN A;  2BR2 A;  2WNR A;  3M85 G;  3M7N D;  4OO1 F;  2PO0 A;  4AID A;  2BA0 G;  5K36 C;  2C39 A;  4IFD B;  5C0X D;  2C37 A;  5JEA B;  2BR2 B;  2NN6 D;  2WNR B;  3M7N G;  4BA1 A;  4IFD E;  4OO1 D;  4BA2 A;  2C37 B;  1UDO A;  2JE6 B;  1UDQ A;  4BA2 B; 
#chains in the Genus database with same CATH topology
 4LF6 I;  5K36 F;  1RHY A;  5FWK A;  1USU A;  4AIM A;  1ZM9 A;  1Z5A A;  5DNX A;  4IFD C;  1ZXN A;  5JEA C;  2J7K A;  2C38 A;  3NZK A;  4WUC A;  1ZXM A;  4GQU A;  4LF8 E;  1Z5C A;  4DXL A;  3GON A;  5C0X A;  4U3D A;  1N0V C;  2NN6 A;  4UTG A;  4MU4 A;  2CZ9 A;  1KKH A;  1OYP A;  1YH8 A;  1OJ4 A;  2O1W A;  4JI7 E;  1R6M A;  2HHH I;  2Z5B B;  4DV6 I;  1XMO I;  1XMQ E;  4LFB E;  5C0X E;  4KQV A;  4DV1 E;  4X64 E;  2NN6 E;  3T1H I;  4JI4 I;  2Z5C B;  3J7A G;  1OYR A;  2F1D A;  4JI8 E;  4B3R E;  5IWA I;  4IZJ B;  1HNW E;  4JG4 A;  2CGE A;  2Q2E B;  5K36 A;  1XNR I;  1EI1 A;  5BR8 E;  2GO4 A;  4LF5 E;  1R6L A;  4LFA I;  5C0X C;  1XHK A;  1HNX I;  2NN6 C;  3PYF A;  4DR3 E;  5IT9 C;  3HKM A;  4JYA E;  2JE6 A;  2UU9 I;  4OZE A;  5K36 E;  1FI4 A;  1FWK A;  4NXN E;  2UXB I;  3QT5 A;  2ZBK B;  2BA0 D;  5EL9 A;  1ZM3 A;  4DR7 E;  2IOP A;  3PRY A;  1IBK I;  1IBM E;  3M85 G;  2AE8 A;  3M7N D;  4OO1 F;  4X66 I;  2PO0 A;  1RR9 A;  4FW4 A;  2IER A;  5K36 C;  1Y4U A;  5LMU I;  1IBL I;  4IFD B;  5JEA B;  1QZR A;  5A2Q C;  1I94 I;  4FN5 A;  4JI2 E;  4DR1 I;  1Z59 A;  2C37 B;  2DEJ A;  4IZK B;  2VF3 A;  4J3D A;  2VQF E;  4LFC I;  2UUC I;  4B3M I;  4PU9 A;  1KIJ A;  3LTO A;  3OTO E;  5ELW A;  3LPS A;  4DV2 E;  2HK2 A;  3WU5 A;  1HNZ I;  1VI7 A;  4KHP I;  1H73 A;  1KVK A;  5DNL A;  4B3T E;  4YHH I;  4ISA A;  2PO1 A;  1Z0E A;  4U3B A;  4LF7 I;  4FWH A;  4UT4 A;  2VQE I;  2BA1 G;  3ZM7 A;  4JI1 E;  2C39 B;  3CDJ A;  4DV3 E;  3Q1Q A;  1N34 E;  1H7S A;  3CWV A;  4DPU A;  2C38 B;  4OO1 A;  4LF9 E;  1HK7 A;  1Z0T A;  2NPF A;  5FLX Q;  4B3S E;  2BV3 A;  4K0K E;  4BA1 B;  2BM1 A;  4DV4 E;  1D6T A;  5C0X B;  1XXE A;  2NN6 B;  4DUY I;  3UHM A;  4DU7 A;  1H72 C;  3B82 A;  3PYD A;  4JI0 I;  3U1K A;  3QT8 A;  1J5E E;  2UUA E;  1N36 E;  4LF4 E;  4NXM E;  4DR5 I;  2R42 A;  2Z5E A;  1UDS A;  3B78 A;  4OO1 E;  4YY3 E;  4URL A;  2PNL A;  2XEX A;  4ZVI A;  2IES A;  1Z0G A;  4JV5 E;  2UXD E;  3J80 C;  4JI6 E;  2F4V I;  3PYE A;  4X65 E;  4OX9 I;  5LMN E;  5L3J A;  5K36 B;  3JAM C;  4WUB A;  4OO1 C;  3Q6N A;  4LCF A;  1USV A;  1HR0 I;  1N32 E;  3P3C A;  2A2D A;  1FJG E;  3Q6M A;  1FKA E;  2PO2 A;  2V34 A;  2GS8 A;  1BKN A;  3T1Y E;  2E5L E;  4DV0 I;  4DUZ I;  2UUB E;  3D4J A;  4JI5 E;  4DV5 I;  4ED4 A;  4AM3 A;  4N3O A;  2BR2 A;  1FNM A;  2WNR A;  4DR2 E;  3J81 C;  3ZKB A;  5GMD A;  1Y60 A;  1N33 E;  4DV7 E;  1H7U A;  3ZZ0 A;  4GKJ E;  2V2V A;  1MX0 A;  1MU5 A;  1Y6Z A;  4LF8 I;  2UXC E;  1NHJ A;  3QT6 A;  2V8P A;  1XNQ E;  1ELO A;  3H4L A;  4BA2 A;  4R1F A;  4FW9 A;  4Z7Y A;  4LOM A;  4JI3 E;  1PKP A;  2PNM A;  4JI7 I;  4GKK E;  1ZM2 A;  4X62 E;  5LL6 R;  4IZJ D;  3ZZT A;  4IFD F;  1XMQ I;  3L7Z A;  3H1C A;  5JEA F;  4LFB I;  1S16 A;  4FW7 A;  4DV1 I;  4X64 I;  4DR6 E;  2LJP A;  1NHI A;  2X7I A;  3KRN A;  2HFU A;  2ZM6 E;  4JI8 I;  4B3R I;  1E3P A;  4FW5 A;  2O1V A;  1HNW I;  4FWD A;  2R3V A;  3P76 A;  4QNJ A;  1Z0B A;  4AQY E;  1EA6 A;  5BR8 I;  2PO1 B;  4LF5 I;  4IS9 A;  4Z7C A;  1Z0V A;  3DD6 A;  3QT7 A;  4I3H A;  1YHC A;  4MU0 A;  4DR3 I;  4DR4 E;  2X36 A;  2JEB A;  5IT9 Q;  4MYT A;  3WU3 A;  4JYA I;  4LF6 E;  3GCM A;  2WP8 A;  3PS3 A;  4OO1 B;  2BM0 A;  4NXN I;  1VIS A;  3WU6 A;  2GQ0 A;  4USK A;  3K1J A;  4IFD D;  1B63 A;  5JEA D;  2O1U A;  4HY1 A;  3ZKD A;  2EFG A;  4DR7 I;  2JEA A;  4M1K A;  3GLL A;  1IBM I;  4FW3 A;  2J65 A;  5JEA A;  2NN6 F;  1Z5B A;  1B62 A;  2HFS A;  4PRV A;  3ZZU A;  2V2Z A;  3F0N A;  2HHH E;  5A2Q Q;  2E1R A;  3CDI A;  2PNZ A;  4DV6 E;  1H74 A;  1XMO E;  1WUU A;  4JI2 I;  3U1Y A;  1U2R A;  1RRE A;  3P06 A;  3PS2 A;  5JEA E;  3T1H E;  4JI4 E;  3M85 D;  2VQF I;  2AJ4 A;  3V2U C;  2WW4 A;  4FW6 A;  5IWA E;  4PRX A;  2PO2 B;  1P42 A;  4DU8 A;  1UDN A;  3OTO I;  3V5R A;  3P3G A;  4DV2 I;  1XNR E;  1NZ0 A;  4B3T I;  2BA0 G;  4LFA E;  2VES A;  4EMD A;  2C39 A;  4USM A;  1HNX E;  5C0X D;  1MG7 A;  2BR2 B;  2NN6 D;  2WNR B;  3B8H A;  3HUL A;  4LPF A;  4HAC A;  3M7N G;  4JI1 I;  4BA1 A;  4DV3 I;  1N34 I;  4MYU A;  2UU9 E;  4LF9 I;  2UXB E;  4B3S I;  1UDO A;  3J7A M;  4K0K I;  3PYG A;  2CVE A;  4DV4 I;  2JE6 B;  1UDQ A;  4BA2 B;  1DAR A;  2GO3 A;  5EKW A;  1IBK E;  1J5E I;  2UUA I;  2BA1 D;  1N36 I;  4LF4 I;  4NXM I;  2O1T A;  3K85 A;  4X66 E;  3GME A;  1IBL E;  5LMU E;  5DRP A;  4YY3 I;  5K36 D;  2ZIT A;  3L7Z B;  2HKE A;  2PO0 B;  1I94 E;  2Z5B A;  4HXZ A;  4MU1 A;  4HYM A;  5GME A;  4MU3 A;  4JV5 I;  3J80 Q;  4DR1 E;  2UXD I;  2HK3 A;  4JI6 I;  5DRQ A;  4MQY A;  4X65 I;  4P7A A;  3PS1 A;  5LMN I;  3JAM Q;  4LFC E;  2UUC E;  1A6F A;  2OI2 A;  2Z5C A;  4B3M E;  4MDT A;  1N32 I;  3K17 A;  1FJG I;  4IZJ A;  3B4T A;  3T1Y I;  1HNZ E;  2IOQ A;  2JEB B;  4KHP E;  2E5L I;  1K47 A;  2DEI A;  1PVG A;  4YHH E;  4LF7 E;  2UUB I;  4JI5 I;  2WP8 B;  5DRO A;  2VQE E;  4DPY A;  1Z0W A;  3J81 Q;  4DR2 I;  4LCG A;  1Z0C A;  4NBQ A;  4DPT A;  1N33 I;  1N0U A;  4DV7 I;  2HKJ A;  4GKJ I;  1E3H A;  3P3E A;  2JEA B;  3M6A A;  5FLX C;  1Y5Y A;  3HJC A;  1S4E A;  2UXC I;  1XNQ I;  4DUY E;  2O3Z A;  1NHH A;  4JI0 E;  4P52 A;  5DRR A;  4DR5 E;  2CG9 A;  4JI3 I;  1PIE A;  4GKK I;  1OYS A;  4OKG A;  2V2Q A;  4QNK A;  4WUD A;  4X62 I;  2PNZ B;  4IFD A;  5C0X F;  4DR6 I;  4DPW A;  4AID A;  2ZM6 I;  1ZM4 A;  1UEK A;  2F4V E;  2C37 A;  3LNU A;  4OX9 E;  4XTJ A;  4IZK A;  1KTV A;  4RPF A;  1HR0 E;  4AQY I;  4IFD E;  4OO1 D;  2JT2 A;  1Y4S A;  4LCH A;  1FWL A;  2A2C A;  3WU4 A;  4DV0 E;  4DR4 I;  4FWG A;  4HAC B;  4DUZ E;  4DPX A;  4DV5 E; 
#chains in the Genus database with same CATH homology
 4IFD F;  5K36 F;  3L7Z A;  3H1C A;  5JEA F;  2BA1 D;  4AIM A;  4IFD C;  5JEA C;  3KRN A;  3GME A;  2PO1 A;  2C38 A;  5K36 D;  3L7Z B;  1E3P A;  2BA1 G;  2PO0 B;  5C0X A;  2NN6 A;  2C39 B;  3CDJ A;  2PO1 B;  2C38 B;  4OO1 A;  1OYP A;  3DD6 A;  4BA1 B;  1R6M A;  2JEB A;  5C0X B;  2NN6 B;  3GCM A;  2WP8 A;  4OO1 B;  3U1K A;  5C0X E;  2NN6 E;  3B4T A;  2JEB B;  4IFD D;  1UDS A;  1OYR A;  4OO1 E;  5JEA D;  2WP8 B;  2JEA A;  3GLL A;  5K36 A;  5JEA A;  2NN6 F;  4NBQ A;  1R6L A;  5C0X C;  1E3H A;  2JEA B;  2NN6 C;  5K36 B;  3HKM A;  4OO1 C;  3CDI A;  2PNZ A;  2JE6 A;  2PO2 A;  5K36 E;  5JEA E;  3M85 D;  1OYS A;  2BA0 D;  2PNZ B;  4IFD A;  2PO2 B;  5C0X F;  4AM3 A;  1UDN A;  2BR2 A;  2WNR A;  3M85 G;  3M7N D;  4OO1 F;  2PO0 A;  4AID A;  2BA0 G;  5K36 C;  2C39 A;  4IFD B;  5C0X D;  2C37 A;  5JEA B;  2BR2 B;  2NN6 D;  2WNR B;  3M7N G;  4BA1 A;  4IFD E;  4OO1 D;  4BA2 A;  2C37 B;  1UDO A;  2JE6 B;  1UDQ A;  4BA2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...