2C37A

Rnase ph core of the archaeal exosome in complex with u8 rna
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
260
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 76
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c37A01
1R6LA 2NN6F 5K36C 2BA1D 1OYRA 2JEAA 2BA0G 2NN6D 4OO1C 2NN6B 1E3HA 2PO0B 3B4TA 3M7NG 4IFDC 2WP8B 2NN6A 5JEAF 2PO0A 1UDNA 3CDIA 5JEAD 2WP8A 4AM3A 2JEBB 4BA1B 2JEBA 4BA1A 2JE6B 1R6MA 5C0XC 1OYSA 2PO1B 2C38B 3H1CA 2JE6A 4AIMA 5K36F 2PO1A 1UDOA 2BA1G 2C38A 2PO2B 3M7ND 1E3PA 5K36D 4NBQA 4OO1F 5K36E 5K36B 3M85D 4IFDF 2PO2A 4OO1D 5C0XE 4OO1E 4OO1B 5K36A 4AIDA 4IFDD 4IFDE 4IFDB 3KRNA 4OO1A 4IFDA 3GCMA 3U1KA 2NN6C 2C37B 2BA0D 2WNRB 2C37A 3GLLA 5C0XF 2C39B 5JEAC 2WNRA 3L7ZB 2PNZB 5C0XD 1UDSA 5C0XB 1OYPA 2C39A 2NN6E 3L7ZA 2PNZA 3HKMA 5C0XA 3M85G 4BA2B 3DD6A 3GMEA 2BR2B 1UDQA 4BA2A 5JEAE 5JEAB 2BR2A 3CDJA 5JEAA 2JEAB
chains in the Genus database with same CATH superfamily
4FN5A 4FWGA 2NN6F 4JI2I 3QT5A 2BA1D 2Q2EB 4WUDA 2GS8A 1N32I 2NN6D 4PRVA 1E3HA 3HJCA 2PNMA 4M1KA 2NPFA 1Z0BA 1PVGA 1K47A 2NN6A 3V5RA 2PO0A 1UDNA 2EFGA 4X64E 4PRXA 2O3ZA 4USMA 1N34E 4AM3A 1N36I 4Z7CA 1IBMI 1FI4A 3PYEA 3V2UC 1UEKA 4LCHA 3ZKBA 4MYTA 4BA1B 2HK3A 4URLA 3PS1A 3PYGA 4JI4E 1KTVA 2JE6B 5C0XC 3Q1QA 1PKPA 2XEXA 2UUAI 5LMUE 3WU5A 4FW5A 4K0KI 4NXME 4DPWA 4HACB 5IWAI 2BA1G 2C38A 4JI6I 2PO2B 3M7ND 1E3PA 4X65E 4NBQA 4OO1F 5K36E 5K36B 2V2VA 3P3CA 1ZM3A 4IFDF 4OO1D 5C0XE 3OTOI 4DR4E 1N33I 4LF7E 4AIDA 4DR6E 4IFDD 4DR2I 2ZM6I 4OO1A 3P3GA 3ZZUA 1Z0WA 1IBKE 2JT2A 4Z7YA 3GCMA 4DR3I 4IFDA 3J80C 4JI0E 4DR7E 1Z0VA 3U1KA 4B3ME 2NN6C 4JG4A 2PNLA 2VQFE 4LFAI 1U2RA 2V8PA 4LFBI 3J80Q 3GLLA 4USKA 2C39B 4DV5E 3T1YI 2WNRA 4LFCE 3PYFA 2CZ9A 4P52A 4DPUA 4JYAI 1Z5CA 1RHYA 2NN6E 5FLXC 1P42A 1HNZI 4FW6A 4HXZA 1FWKA 4DV7E 3ZKDA 3LNUA 2OI2A 4I3HA 4JI5I 2F4VI 5FLXQ 2UXBE 4FWDA 3K1JA 4KHPI 2X36A 2ZBKB 1H73A 4N3OA 3PYDA 4JI8I 1ZXNA 4DPTA 2CVEA 2UU9E 4JI1I 3J81C 4JI7E 3T1HI 4DR1I 4LF8E 1RREA 4DV3I 4LF6I 1R6LA 5DRRA 4IS9A 1H74A 5BR8I 1KVKA 1OYRA 2JEAA 4B3RE 4DV0E 3ZM7A 2V2ZA 4OO1C 1ELOA 2HHHI 3B4TA 2UUBI 4IFDC 3B78A 4HYMA 3CWVA 2AJ4A 5JEAF 2VQEE 4X66E 3PS2A 3K17A 1PIEA 2VESA 3J7AM 1XNRI 5JEAD 1Y60A 2WP8A 4J3DA 3M6AA 1XMQI 4LFBE 2BV3A 4NXNI 2JEBB 1USUA 1XHKA 4AQYI 4LF7I 1NHJA 3K85A 4JV5I 4YHHI 4B3TE 2PO1B 1I94I 5GMDA 5GMEA 2DEJA 1NHIA 4LF5E 1Z0TA 1B63A 4JI3I 1H72C 3WU3A 1HR0I 3U1YA 1Z5AA 1ZM9A 4IZKA 4JI1E 1FKAE 1USVA 4LPFA 2Z5CB 2J7KA 1HNWI 4DV3E 4IZJB 1MX0A 4GKJI 4B3SI 1XMOE 1Y5YA 4OZEA 2HHHE 1IBLI 2UXDE 2UUCE 2IERA 2E5LI 2J65A 2VF3A 2C37A 1HNXE 2Z5BB 4X62I 1Z0GA 5JEAC 4OX9E 3L7ZB 3LTOA 2PNZB 3ZZ0A 4LF9I 1UDSA 2UXCE 5C0XB 4DR5I 1J5EE 3QT7A 4XTJA 5A2QQ 4JI2E 4AQYE 1N32E 2A2CA 4BA2B 5DNLA 3UHMA 2BR2B 3NZKA 1YHCA 1UDQA 4FW3A 2IOQA 5JEAE 5JEAB 5DROA 4JI3E 4YY3I 3CDJA 1H7SA 2F1DA 4DV4I 1N36E 1IBME 3GONA 5LMNI 1FJGI 4MU0A 4DUZI 5LL6R 4WUBA 4ED4A 2GO3A 2NN6B 3F0NA 3Q6MA 4RPFA 4DXLA 4B3SE 2PO0B 4ISAA 3M7NG 2IESA 4GKKI 4WUCA 2UUAE 1KKHA 4DUYI 4DV6I 3CDIA 2ZITA 4K0KE 5DNXA 2E5LE 5IWAE 4DPXA 4JI6E 4LCFA 1NHHA 4R1FA 3OTOE 1N33E 4DR5E 4BA1A 4QNJA 4FW4A 2O1UA 5DRPA 4DR2E 2ZM6E 1OYSA 5ELWA 2C38B 3H1CA 2JE6A 4DR3E 5IT9Q 5K36F 5L3JA 1Z0EA 4MU3A 2V34A 1N34I 4LFAE 5K36D 4HACA 3M85D 2PO2A 4JI4I 4OO1E 2BM0A 4OO1B 1N0UA 2R3VA 5K36A 3T1YE 1YH8A 4IFDE 4IFDB 5LMUI 2Z5EA 4JYAE 1Z5BA 1NZ0A 1HNZE 3PS3A 2R42A 2E1RA 4X65I 4JI5E 4LF4I 2F4VE 2BA0D 4DUYE 4DV2I 4UTGA 4OKGA 2WNRB 4KHPE 4JI8E 1WUUA 1Y4SA 4MU1A 1ZM2A 3ZZTA 2O1TA 4DR4I 1VI7A 4FW9A 4DR6I 2HK2A 2CG9A 1OYPA 3T1HE 1IBKI 2C39A 3PRYA 4MYUA 4DR1E 2O1VA 4LF6E 1Z0CA 4JI0I 4DR7I 5BR8E 4B3MI 3M85G 4MDTA 2VQFI 4KQVA 3DD6A 1QZRA 2V2QA 3P3EA 3B82A 2UUBE 1B62A 4MQYA 1FNMA 2A2DA 2O1WA 4DV5I 5EL9A 1XNRE 3JAMC 4LFCI 2JEAB 5A2QC 1XMQE 4NXNE 5K36C 2DEIA 3WU4A 3WU6A 3JAMQ 4LOMA 4U3BA 4DV7I 2BA0G 2IOPA 1XNQI 1S4EA 3H4LA 4DU7A 2UXBI 2WW4A 4JV5E 2WP8B 4DV1I 4YHHE 1I94E 3Q6NA 1A6FA 2CGEA 1ZXMA 2UU9I 4LF4E 4JI7I 1HR0E 4DV2E 1Z59A 4LF8I 1FWLA 2HKJA 1MU5A 4B3RI 4DV0I 1DARA 2JEBA 1HNWE 1R6MA 3P06A 4GKJE 2VQEI 4LCGA 4X66I 2HKEA 3B8HA 2HFUA 4P7AA 4UT4A 4U3DA 3LPSA 4AIMA 1BKNA 1S16A 1IBLE 2PO1A 1UDOA 3D4JA 4IZKB 1OJ4A 4DU8A 2GQ0A 4X62E 4IZJD 4ZVIA 3P76A 4PU9A 4FWHA 3KRNA 4LF9E 4B3TI 3J7AG 3QT8A 2Z5CA 1RR9A 5IT9C 4LF5I 4IZJA 1XNQE 1KIJA 2BM1A 4X64I 3QT6A 2C37B 4DV1E 4EMDA 4QNKA 2GO4A 1HK7A 5C0XF 4YY3E 1XXEA 5C0XD 2Z5BA 3J81Q 1EA6A 2X7IA 1XMOI 4DV4E 1MG7A 3L7ZA 2PNZA 4MU4A 5LMNE 3HKMA 5C0XA 3HULA 1VISA 4GQUA 4DUZE 1FJGE 2UXDI 2UUCI 2AE8A 4HY1A 3GMEA 4NXMI 4DPYA 1Y6ZA 4GKKE 1HNXI 2LJPA 4BA2A 2HFSA 1ZM4A 2BR2A 1D6TA 4DV6E 4FW7A 1EI1A 1Y4UA 4OX9I 1H7UA 5EKWA 1N0VC 5JEAA 2UXCI 5DRQA 5FWKA 1J5EI
chains in the Genus database with same CATH topology
1R6LA 2NN6F 5K36C 2BA1D 1OYRA 2JEAA 2BA0G 2NN6D 4OO1C 2NN6B 1E3HA 2PO0B 3B4TA 3M7NG 4IFDC 2WP8B 2NN6A 5JEAF 2PO0A 1UDNA 3CDIA 5JEAD 2WP8A 4AM3A 2JEBB 4BA1B 2JEBA 4BA1A 2JE6B 1R6MA 5C0XC 1OYSA 2PO1B 2C38B 3H1CA 2JE6A 4AIMA 5K36F 2PO1A 1UDOA 2BA1G 2C38A 2PO2B 3M7ND 1E3PA 5K36D 4NBQA 4OO1F 5K36E 5K36B 3M85D 4IFDF 2PO2A 4OO1D 5C0XE 4OO1E 4OO1B 5K36A 4AIDA 4IFDD 4IFDE 4IFDB 3KRNA 4OO1A 4IFDA 3GCMA 3U1KA 2NN6C 2C37B 2BA0D 2WNRB 2C37A 3GLLA 5C0XF 2C39B 5JEAC 2WNRA 3L7ZB 2PNZB 5C0XD 1UDSA 5C0XB 1OYPA 2C39A 2NN6E 3L7ZA 2PNZA 3HKMA 5C0XA 3M85G 4BA2B 3DD6A 3GMEA 2BR2B 1UDQA 4BA2A 5JEAE 5JEAB 2BR2A 3CDJA 5JEAA 2JEAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6L A;  2NN6 F;  5K36 C;  2BA1 D;  1OYR A;  2JEA A;  2BA0 G;  2NN6 D;  4OO1 C;  2NN6 B;  1E3H A;  2PO0 B;  3B4T A;  3M7N G;  4IFD C;  2WP8 B;  2NN6 A;  5JEA F;  2PO0 A;  1UDN A;  3CDI A;  5JEA D;  2WP8 A;  4AM3 A;  2JEB B;  4BA1 B;  2JEB A;  4BA1 A;  2JE6 B;  1R6M A;  5C0X C;  1OYS A;  2PO1 B;  2C38 B;  3H1C A;  2JE6 A;  4AIM A;  5K36 F;  2PO1 A;  1UDO A;  2BA1 G;  2C38 A;  2PO2 B;  3M7N D;  1E3P A;  5K36 D;  4NBQ A;  4OO1 F;  5K36 E;  5K36 B;  3M85 D;  4IFD F;  2PO2 A;  4OO1 D;  5C0X E;  4OO1 E;  4OO1 B;  5K36 A;  4AID A;  4IFD D;  4IFD E;  4IFD B;  3KRN A;  4OO1 A;  4IFD A;  3GCM A;  3U1K A;  2NN6 C;  2C37 B;  2BA0 D;  2WNR B;  2C37 A;  3GLL A;  5C0X F;  2C39 B;  5JEA C;  2WNR A;  3L7Z B;  2PNZ B;  5C0X D;  1UDS A;  5C0X B;  1OYP A;  2C39 A;  2NN6 E;  3L7Z A;  2PNZ A;  3HKM A;  5C0X A;  3M85 G;  4BA2 B;  3DD6 A;  3GME A;  2BR2 B;  1UDQ A;  4BA2 A;  5JEA E;  5JEA B;  2BR2 A;  3CDJ A;  5JEA A;  2JEA B; 
#chains in the Genus database with same CATH topology
 4FN5 A;  4FWG A;  2NN6 F;  4JI2 I;  3QT5 A;  2BA1 D;  2Q2E B;  4WUD A;  2GS8 A;  1N32 I;  2NN6 D;  4PRV A;  1E3H A;  3HJC A;  2PNM A;  4M1K A;  2NPF A;  1Z0B A;  1PVG A;  1K47 A;  2NN6 A;  3V5R A;  2PO0 A;  1UDN A;  2EFG A;  4X64 E;  4PRX A;  2O3Z A;  4USM A;  1N34 E;  4AM3 A;  1N36 I;  4Z7C A;  1IBM I;  1FI4 A;  3PYE A;  3V2U C;  1UEK A;  4LCH A;  3ZKB A;  4MYT A;  4BA1 B;  2HK3 A;  4URL A;  3PS1 A;  3PYG A;  4JI4 E;  1KTV A;  2JE6 B;  5C0X C;  3Q1Q A;  1PKP A;  2XEX A;  2UUA I;  5LMU E;  3WU5 A;  4FW5 A;  4K0K I;  4NXM E;  4DPW A;  4HAC B;  5IWA I;  2BA1 G;  2C38 A;  4JI6 I;  2PO2 B;  3M7N D;  1E3P A;  4X65 E;  4NBQ A;  4OO1 F;  5K36 E;  5K36 B;  2V2V A;  3P3C A;  1ZM3 A;  4IFD F;  4OO1 D;  5C0X E;  3OTO I;  4DR4 E;  1N33 I;  4LF7 E;  4AID A;  4DR6 E;  4IFD D;  4DR2 I;  2ZM6 I;  4OO1 A;  3P3G A;  3ZZU A;  1Z0W A;  1IBK E;  2JT2 A;  4Z7Y A;  3GCM A;  4DR3 I;  4IFD A;  3J80 C;  4JI0 E;  4DR7 E;  1Z0V A;  3U1K A;  4B3M E;  2NN6 C;  4JG4 A;  2PNL A;  2VQF E;  4LFA I;  1U2R A;  2V8P A;  4LFB I;  3J80 Q;  3GLL A;  4USK A;  2C39 B;  4DV5 E;  3T1Y I;  2WNR A;  4LFC E;  3PYF A;  2CZ9 A;  4P52 A;  4DPU A;  4JYA I;  1Z5C A;  1RHY A;  2NN6 E;  5FLX C;  1P42 A;  1HNZ I;  4FW6 A;  4HXZ A;  1FWK A;  4DV7 E;  3ZKD A;  3LNU A;  2OI2 A;  4I3H A;  4JI5 I;  2F4V I;  5FLX Q;  2UXB E;  4FWD A;  3K1J A;  4KHP I;  2X36 A;  2ZBK B;  1H73 A;  4N3O A;  3PYD A;  4JI8 I;  1ZXN A;  4DPT A;  2CVE A;  2UU9 E;  4JI1 I;  3J81 C;  4JI7 E;  3T1H I;  4DR1 I;  4LF8 E;  1RRE A;  4DV3 I;  4LF6 I;  1R6L A;  5DRR A;  4IS9 A;  1H74 A;  5BR8 I;  1KVK A;  1OYR A;  2JEA A;  4B3R E;  4DV0 E;  3ZM7 A;  2V2Z A;  4OO1 C;  1ELO A;  2HHH I;  3B4T A;  2UUB I;  4IFD C;  3B78 A;  4HYM A;  3CWV A;  2AJ4 A;  5JEA F;  2VQE E;  4X66 E;  3PS2 A;  3K17 A;  1PIE A;  2VES A;  3J7A M;  1XNR I;  5JEA D;  1Y60 A;  2WP8 A;  4J3D A;  3M6A A;  1XMQ I;  4LFB E;  2BV3 A;  4NXN I;  2JEB B;  1USU A;  1XHK A;  4AQY I;  4LF7 I;  1NHJ A;  3K85 A;  4JV5 I;  4YHH I;  4B3T E;  2PO1 B;  1I94 I;  5GMD A;  5GME A;  2DEJ A;  1NHI A;  4LF5 E;  1Z0T A;  1B63 A;  4JI3 I;  1H72 C;  3WU3 A;  1HR0 I;  3U1Y A;  1Z5A A;  1ZM9 A;  4IZK A;  4JI1 E;  1FKA E;  1USV A;  4LPF A;  2Z5C B;  2J7K A;  1HNW I;  4DV3 E;  4IZJ B;  1MX0 A;  4GKJ I;  4B3S I;  1XMO E;  1Y5Y A;  4OZE A;  2HHH E;  1IBL I;  2UXD E;  2UUC E;  2IER A;  2E5L I;  2J65 A;  2VF3 A;  2C37 A;  1HNX E;  2Z5B B;  4X62 I;  1Z0G A;  5JEA C;  4OX9 E;  3L7Z B;  3LTO A;  2PNZ B;  3ZZ0 A;  4LF9 I;  1UDS A;  2UXC E;  5C0X B;  4DR5 I;  1J5E E;  3QT7 A;  4XTJ A;  5A2Q Q;  4JI2 E;  4AQY E;  1N32 E;  2A2C A;  4BA2 B;  5DNL A;  3UHM A;  2BR2 B;  3NZK A;  1YHC A;  1UDQ A;  4FW3 A;  2IOQ A;  5JEA E;  5JEA B;  5DRO A;  4JI3 E;  4YY3 I;  3CDJ A;  1H7S A;  2F1D A;  4DV4 I;  1N36 E;  1IBM E;  3GON A;  5LMN I;  1FJG I;  4MU0 A;  4DUZ I;  5LL6 R;  4WUB A;  4ED4 A;  2GO3 A;  2NN6 B;  3F0N A;  3Q6M A;  4RPF A;  4DXL A;  4B3S E;  2PO0 B;  4ISA A;  3M7N G;  2IES A;  4GKK I;  4WUC A;  2UUA E;  1KKH A;  4DUY I;  4DV6 I;  3CDI A;  2ZIT A;  4K0K E;  5DNX A;  2E5L E;  5IWA E;  4DPX A;  4JI6 E;  4LCF A;  1NHH A;  4R1F A;  3OTO E;  1N33 E;  4DR5 E;  4BA1 A;  4QNJ A;  4FW4 A;  2O1U A;  5DRP A;  4DR2 E;  2ZM6 E;  1OYS A;  5ELW A;  2C38 B;  3H1C A;  2JE6 A;  4DR3 E;  5IT9 Q;  5K36 F;  5L3J A;  1Z0E A;  4MU3 A;  2V34 A;  1N34 I;  4LFA E;  5K36 D;  4HAC A;  3M85 D;  2PO2 A;  4JI4 I;  4OO1 E;  2BM0 A;  4OO1 B;  1N0U A;  2R3V A;  5K36 A;  3T1Y E;  1YH8 A;  4IFD E;  4IFD B;  5LMU I;  2Z5E A;  4JYA E;  1Z5B A;  1NZ0 A;  1HNZ E;  3PS3 A;  2R42 A;  2E1R A;  4X65 I;  4JI5 E;  4LF4 I;  2F4V E;  2BA0 D;  4DUY E;  4DV2 I;  4UTG A;  4OKG A;  2WNR B;  4KHP E;  4JI8 E;  1WUU A;  1Y4S A;  4MU1 A;  1ZM2 A;  3ZZT A;  2O1T A;  4DR4 I;  1VI7 A;  4FW9 A;  4DR6 I;  2HK2 A;  2CG9 A;  1OYP A;  3T1H E;  1IBK I;  2C39 A;  3PRY A;  4MYU A;  4DR1 E;  2O1V A;  4LF6 E;  1Z0C A;  4JI0 I;  4DR7 I;  5BR8 E;  4B3M I;  3M85 G;  4MDT A;  2VQF I;  4KQV A;  3DD6 A;  1QZR A;  2V2Q A;  3P3E A;  3B82 A;  2UUB E;  1B62 A;  4MQY A;  1FNM A;  2A2D A;  2O1W A;  4DV5 I;  5EL9 A;  1XNR E;  3JAM C;  4LFC I;  2JEA B;  5A2Q C;  1XMQ E;  4NXN E;  5K36 C;  2DEI A;  3WU4 A;  3WU6 A;  3JAM Q;  4LOM A;  4U3B A;  4DV7 I;  2BA0 G;  2IOP A;  1XNQ I;  1S4E A;  3H4L A;  4DU7 A;  2UXB I;  2WW4 A;  4JV5 E;  2WP8 B;  4DV1 I;  4YHH E;  1I94 E;  3Q6N A;  1A6F A;  2CGE A;  1ZXM A;  2UU9 I;  4LF4 E;  4JI7 I;  1HR0 E;  4DV2 E;  1Z59 A;  4LF8 I;  1FWL A;  2HKJ A;  1MU5 A;  4B3R I;  4DV0 I;  1DAR A;  2JEB A;  1HNW E;  1R6M A;  3P06 A;  4GKJ E;  2VQE I;  4LCG A;  4X66 I;  2HKE A;  3B8H A;  2HFU A;  4P7A A;  4UT4 A;  4U3D A;  3LPS A;  4AIM A;  1BKN A;  1S16 A;  1IBL E;  2PO1 A;  1UDO A;  3D4J A;  4IZK B;  1OJ4 A;  4DU8 A;  2GQ0 A;  4X62 E;  4IZJ D;  4ZVI A;  3P76 A;  4PU9 A;  4FWH A;  3KRN A;  4LF9 E;  4B3T I;  3J7A G;  3QT8 A;  2Z5C A;  1RR9 A;  5IT9 C;  4LF5 I;  4IZJ A;  1XNQ E;  1KIJ A;  2BM1 A;  4X64 I;  3QT6 A;  2C37 B;  4DV1 E;  4EMD A;  4QNK A;  2GO4 A;  1HK7 A;  5C0X F;  4YY3 E;  1XXE A;  5C0X D;  2Z5B A;  3J81 Q;  1EA6 A;  2X7I A;  1XMO I;  4DV4 E;  1MG7 A;  3L7Z A;  2PNZ A;  4MU4 A;  5LMN E;  3HKM A;  5C0X A;  3HUL A;  1VIS A;  4GQU A;  4DUZ E;  1FJG E;  2UXD I;  2UUC I;  2AE8 A;  4HY1 A;  3GME A;  4NXM I;  4DPY A;  1Y6Z A;  4GKK E;  1HNX I;  2LJP A;  4BA2 A;  2HFS A;  1ZM4 A;  2BR2 A;  1D6T A;  4DV6 E;  4FW7 A;  1EI1 A;  1Y4U A;  4OX9 I;  1H7U A;  5EKW A;  1N0V C;  5JEA A;  2UXC I;  5DRQ A;  5FWK A;  1J5E I; 
#chains in the Genus database with same CATH homology
 1R6L A;  2NN6 F;  5K36 C;  2BA1 D;  1OYR A;  2JEA A;  2BA0 G;  2NN6 D;  4OO1 C;  2NN6 B;  1E3H A;  2PO0 B;  3B4T A;  3M7N G;  4IFD C;  2WP8 B;  2NN6 A;  5JEA F;  2PO0 A;  1UDN A;  3CDI A;  5JEA D;  2WP8 A;  4AM3 A;  2JEB B;  4BA1 B;  2JEB A;  4BA1 A;  2JE6 B;  1R6M A;  5C0X C;  1OYS A;  2PO1 B;  2C38 B;  3H1C A;  2JE6 A;  4AIM A;  5K36 F;  2PO1 A;  1UDO A;  2BA1 G;  2C38 A;  2PO2 B;  3M7N D;  1E3P A;  5K36 D;  4NBQ A;  4OO1 F;  5K36 E;  5K36 B;  3M85 D;  4IFD F;  2PO2 A;  4OO1 D;  5C0X E;  4OO1 E;  4OO1 B;  5K36 A;  4AID A;  4IFD D;  4IFD E;  4IFD B;  3KRN A;  4OO1 A;  4IFD A;  3GCM A;  3U1K A;  2NN6 C;  2C37 B;  2BA0 D;  2WNR B;  2C37 A;  3GLL A;  5C0X F;  2C39 B;  5JEA C;  2WNR A;  3L7Z B;  2PNZ B;  5C0X D;  1UDS A;  5C0X B;  1OYP A;  2C39 A;  2NN6 E;  3L7Z A;  2PNZ A;  3HKM A;  5C0X A;  3M85 G;  4BA2 B;  3DD6 A;  3GME A;  2BR2 B;  1UDQ A;  4BA2 A;  5JEA E;  5JEA B;  2BR2 A;  3CDJ A;  5JEA A;  2JEA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...