4DR1E

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 30
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr1E02
4DV3I 1Z0GA 3JAMQ 4DV5I 4JI4I 3CWVA 4OX9E 4JI2I 2VF3A 5A2QQ 4LF7E 4KQVA 1B63A 4GKJI 3ZZ0A 4PU9A 1T4NA 4DR1E 4DV2E 4KHPI 2F4VE 1HR0I 2LBSB 1PKPA 2UUAE 1J26A 2UXBE 3ZKBA 4JI1E 4DV4I 1HNZI 1DI2A 4LF8E 4LF6I 4P7AA 4X66E 1IBLE 3QT5A 3WU5A 1WHQA 2VQFI 3LLHA 3C4TA 4YHHI 4AQYE 2UUCI 2UU9I 1KKHA 4GKKI 2KHXA 3J7Yp 1ZBTA 1Z0EA 4DUZI 1XMOI 2BV3A 4DR7E 4M30A 5LMUI 3WU6A 1IBKI 2V2VA 5IWAE 2XEXA 4JV5I 5LL6R 3B78A 1XNRI 1FJGE 4X64I 1N34E 3VYXA 2HHHI 4R1FA 3QT7A 4DV7E 4JI7E 2NUEA 4FWHA 2J7KA 2B7TA 2V2ZA 4JYAI 2HKJA 4LF9I 1S16A 4B3TE 4JI0I 1O0WA 1T4OA 2RS6A 1K47A 2OI2A 4HY1A 1IBME 4UTGA 2IHR1 4OOGC 4URLA 1J5EE 5FLXC 1H74A 1N33I 4DU8A 4JI3E 4K0KE 3P1XA 4JI5E 2ZM6I 4M2ZA 4NXMI 2LJHA 3GONA 1H73A 1XMQI 4X62E 2E5LE 4DR5I 4FWDA 4FWGA 1FI4A 1Z59A 2EZ6A 4DR3I 4MYTA 4LFBI 3K1JA 3PYDA 3LPSA 3J7AG 3T1HI 1H72C 2DIXA 4DR4E 1XNQI 1RQ0A 3WU3A 3PYEA 1N0VC 4P52A 2UUBE 3V5RA 2L2MA 4NXNE 1GQEA 2DEJA 3C4BA 4Z7YA 4X65I 2NPFA 2LJPA 4LF4I 2RS7A 3ZKDA 2BM1A 1HNXI 4Z7CA 4DPUA 1KTVA 4DR6E 4LF5E 4B3RE 3T1YI 1FWKA 4DUYI 1X47A 1UILA 2A2DA 1I94I 3OTOI 4DV6E 2UUCE 4DV3E 3J80Q 1MU5A 1Z0VA 1X48A 4LF7I 4JI2E 1NZ0A 1XHKA 4GKJE 5BR8I 5LMNI 3H4LA 4JG4A 4LFAI 2LTRA 2UXBI 2UXDI 4USKA 4DV6I 5IT9Q 1B62A 5FLXQ 2DB2A 2N3GA 1NHHA 4LF6E 4DV1I 1YYKA 4FN5A 2CPNA 3D4JA 4FW9A 1RREA 1YYOA 4YHHE 4YY3I 2UU9E 3HULA 1ZM4A 2JY9A 4GKKE 2ZITA 3HTXA 1XMOE 2AJ4A 5LMUE 2LRSA 1WHNA 2V34A 1IBKE 1DARA 4JV5E 4XTJA 1FJGI 3ADGA 4JI6I 1XNRE 4X64E 1N32E 2UXCI 4DV7I 2HHHE 2BM0A 3JAMC 3ADLA 4HXZA 4JI7I 1EA6A 4USMA 4JYAE 4B3TI 4HACA 4LF9E 2LTSA 2HFUA 4JI0E 4WUBA 1UHZA 4JI8I 2B3TB 1EKZA 4DV0E 4WYQB 1Z0CA 1UEKA 3LTOA 4X8WA 1N33E 1OJ4A 4NXME 2ZBKB 4X62I 1BKNA 2E5LI 1XMQE 4DR5E 1Z0TA 1HNWI 3J81C 3ZZTA 1N36I 4DR3E 4LFBE 4DKKA 1NHJA 1T4LB 4DXLA 2NUFA 1MX0A 3T1HE 1ZM2A 4WUCA 1U2RA 2UUBI 2X36A 1X49A 2HFSA 1QZRA 2VQEI 2L2KB 4B3SE 4NXNI 3M6AA 1D6TA 4LFCI 4B3ME 2LUQA 1ELOA 4X65E 4DR2E 1Z5AA 4ED4A 2L3JA 1EI1A 1HNXE 1WUUA 4LF5I 4B3RI 3T1YE 4OX9I 4DUYE 4DV5E 4JI4E 3ZZUA 1VISA 2Q2EB 3LNUA 3OTOE 4DPYA 1ZXNA 2DMYA 4RPFA 4DV2I 2V8PA 4DR1I 2F4VI 1RC7A 2MDRA 3PYGA 4KHPE 1Z5BA 1HR0E 2UUAI 2LUPB 2L3CA 1FNMA 4JI1I 4DPXA 3B82A 4DV4E 1HNZE 4LF8I 5BR8E 2B7VA 5LMNE 4DPTA 4X66I 4MYUA 1IBLI 1KVKA 2RSMA 4LFAE 3VYYA 2VQFE 2UXDE 5GMEA 4AQYI 1ZXMA 1ZM3A 3QT6A 2X7IA 2NUGA 4DU7A 4DV1E 3K17A 4PRVA 4HYMA 1H7UA 1YYWA 4DR7I 4DUZE 1S4EA 3J81Q 4YY3E 2YT4A 4WFTA 5IWAI 4DPWA 2HK3A 1N34I 3J7AM 5A2QC 4PRXA 1N32I 4JI6E 2UXCE 3J80C 1IBMI 2HKEA 3ADJA 2WW4A 3ZM7A 5CFFE 1Z0WA 1J5EI 2R3VA 4JI3I 4UT4A 4K0KI 1RR9A 2JVAA 4JI5I 3ADIA 4EMDA 2DEIA 4I3HA 2R42A 4JI8E 2ZM6E 1PVGA 3F0NA 4DV0I 5IT9C 1KIJA 4M1KA 2E1RA 1FWLA 2RTXA 1A6FA 1HNWE 5L3JA 4DR4I 2V2QA 1ZM9A 1FKAE 1XNQE 5GMDA 2EFGA 2A2CA 1QU6A 1N36E 1MG7A 1N0UA 2CZ9A 1NHIA 2HK2A 1YZ9A 4HACB 3V2UC 1PIEA 4B3SI 2VQEE 4LF4E 3QT8A 3WU4A 1Z0BA 3Q1QA 2L33A 4DR6I 4B3MI 2L2NA 2NA2A 4LFCE 3PYFA 1Z5CA 4DR2I 1H7SA 4ZVIA 4WUDA 1STUA 1I94E 2GS8A 3B8HA 2N3HA
chains in the Genus database with same CATH superfamily
2EMAA 4DV3I 1Z0GA 4L5NC 3JAMQ 3C6MA 2KOUA 4R2RA 4DV5I 4JI4I 2GQ0A 3CWVA 2ENHA 2EQ0A 4OX9E 1P47A 4GQUA 4ZYHA 2VF3A 3GLLA 4R2EA 5A2QQ 5JEAB 4JI2I 4BA2A 1R6MA 1X6EA 4LF7E 4KQVA 3M99B 1B63A 2EMCA 3F6HA 2BA1G 4GKJI 2YU5A 2EN8A 2MC5A 4BHBA 3ZZ0A 3M7NG 4PU9A 2V89A 1T4NA 4KZSA 4DR1E 3IWBA 4DV2E 2F4VE 4KHPI 1F2IG 1HR0I 2V83A 2LBSB 2I13A 2EORA 1PKPA 2UUAE 1J26A 2JEAB 2EN4A 2UXBE 4OO1C 2E72A 1YH8A 3ZKBA 2EOIA 4JI1E 2K7IA 4DV4I 1HNZI 1DI2A 2MDGA 2BBGA 4LF8E 5DRPA 4P7AA 4LF6I 4X66E 1IBLE 2NN6C 3LMLA 3QT5A 3WU5A 1WHQA 2VQFI 3LLHA 1PJSA 2YTPA 4IZKA 4MU0A 1YFHA 4RH8A 3C4TA 1JK1A 4AQYE 3HPZA 3UHMA 4YHHI 2Z5EA 2UUCI 2UU9I 1A1LA 2KONA 2EN3A 1KKHA 4GKKI 2KHXA 4MLVA 4MDTA 3J7Yp 2GPIA 1ZBTA 2C39B 4L8NA 1Z0EA 2ODRC 2PNZA 1VI7A 4FW5A 2BB8A 2Q8UA 1A1JA 4DUZI 1XMOI 2BV3A 4DR7E 1YPNA 4M30A 5LMUI 3WU6A 2JT2A 4TUIA 2DLQA 5AC5A 1IBKI 2V86A 2V2VA 2Z5CA 2M1SA 3CDIA 2EOOA 4J8ZA 5C0XB 5IWAE 5KL5A 2XEXA 4JV5I 4IS9A 3K6QA 3BF2A 5LL6R 4BS9A 2CTDA 3B78A 3AV0A 1XNRI 1FJGE 4X64I 1N34E 1Y6ZA 3VYXA 3P3GA 2EM9A 2HHHI 2DSYA 2BA0G 4R1FA 2YTEA 3QT7A 2RQLA 4DV7E 2JWOA 4JI7E 2NUEA 4FWHA 2J7KA 3MHSC 1BB8A 2EN6A 2B7TA 4OKGA 4WXDA 2EL4A 2V2ZA 4WXCA 4JYAI 2HKJA 3KZZA 4LF9I 2EPAA 1S16A 4B3TE 3MHHC 1Z1BA 4GZNC 4JI0I 3PS3A 1O0WA 3M85G 1T4OA 2RS6A 1K47A 2OI2A 2CVEA 4HY1A 4U3DA 1IBME 4UTGA 3VK6A 2JP9A 2IHR1 1A1KA 2LE2A 2MKNA 4N4RB 3P76A 3GCMA 4OOGC 2EPOA 4FW4A 1OYRA 4URLA 1J5EE 5FLXC 4OO1A 2EQ1A 1H74A 3EPKA 4DU8A 1N33I 5AC4A 2MKDA 4JI3E 4IFDB 4OO1F 2EQ3A 3IWCA 1IBLI 4K0KE 3P1XA 4JI5E 2ZM6I 4M2ZA 4NXMI 2LJHA 2NN6A 3GONA 1OYPA 3HJCA 2VF1A 2EPKX 1H73A 4X62E 2E5LE 4DR5I 1XMQI 2NN6F 1AH5A 2EMWA 1FI4A 4FWGA 2JEBB 2LO3A 4FWDA 1Z59A 2C37B 4AM3A 3THNA 1N3GA 3HQ1A 4MLQA 1AAYA 2A25A 2EOJA 1JK2A 2EOEA 4TUGA 2O3ZA 2EZ6A 4DR3I 4MYTA 4OO1E 4DMIA 4LFBI 1MEYC 3K1JA 1T39A 3LPSA 3PYDA 2N8XA 2L6MA 2RSIA 3J7AG 3T1HI 1H72C 2DIXA 2JPAA 3UK3C 4DR4E 1XNQI 2NN6E 1RQ0A 5A6BA 3WU3A 4J3DA 3DF6A 3H09A 3PYEA 1N0VC 4P52A 4R2PA 4FW6A 2UUBE 2EOSA 2LMZA 2HJJA 5LLQA 3V5RA 2LCEA 2FGGA 2V87A 2L2MA 2CSHA 4NXNE 1GQEA 1UDQA 4F9BB 2DEJA 2JOBA 3C4BA 4Z7YA 2EMHA 4X65I 2EMZA 5DNYA 5JEAD 2NPFA 2LJPA 1EH8A 3P3EA 4LF4I 5F3WA 2RS7A 3ZKDA 2R76A 2YTGA 1DGCA 3JU0A 1G2DC 2DRPA 2HGHA 2BM1A 5DNLA 2PO0B 4Z7CA 1HNXI 4Q35B 5K36B 2Z5BA 1UDOA 4DPUA 1KTVA 4DR6E 4BA1B 4LF5E 4B3RE 1IQOA 3IWDA 1FWKA 4DUYI 3T1YI 1IQSA 1X47A 2YWQA 4MU1A 1EH7A 1UILA 2A2DA 2BR2A 2F8BA 1I94I 1YHCA 3OTOI 5A6KA 2NN6B 1WJPA 4BC7A 5AE3A 4R2DA 1TN9A 1UDNA 2PNLA 4DV6E 2ELZA 2UUCE 1OYSA 2EOQA 5FWKA 2WBSA 5AASA 4DV3E 5A69A 2IOQA 3J80Q 4R2AA 1MU5A 1Z0VA 4NBQA 1X48A 4LF7I 4JI2E 1NZ0A 3L7ZB 3THOB 1XHKA 4ZYDA 1T38A 2GLIA 4GKJE 2R1FA 1USVA 5LMNI 3H4LA 5BR8I 4F54A 3U1KA 4JG4A 2MC6A 1XXEA 4LFAI 4LTYA 2LTRA 2EL5A 2UXBI 2UXDI 1WRJA 4I8OA 4USKA 4DV6I 5IT9Q 4U3BA 1B62A 5FLXQ 2JE6A 3GMEA 1X3CA 5DRQA 2DB2A 2N3GA 5KL3A 1NHHA 4LF6E 4DV1I 5C0XD 5ELWA 4HEIA 3HKMA 1YYKA 3P3CA 2BA0D 2CPNA 2O1WA 3D4JA 4FN5A 4FW9A 1RREA 1YYOA 4YHHE 1PJQA 2EM6A 3OMLA 2EPZA 2M4IA 1SFEA 1NCSA 2UU9E 4YY3I 1ZR9A 2EPRA 2AE8A 3HULA 5JEAC 1ZM4A 2JY9A 4GKKE 2Z5BB 2ZITA 1ZAAC 2IOPA 3H1CA 4F6NA 2EM7A 3M85D 1G2FC 2WNRA 3HTXA 5KL7A 1XMOE 2AJ4A 2HC5A 2G7HA 3HPSA 4ISAA 4BA2B 3F6GA 2EM0A 5LMUE 2LRSA 4KWYA 3DD6A 2PRTA 3PRYA 4FW3A 1WHNA 4ZYEA 1IBKE 2V34A 1DARA 2VESA 2WBTA 4NZVA 4JV5E 2EPLX 2H36X 1E3HA 4XTJA 1FJGI 3ADGA 4IZJD 4JI6I 1XNRE 4X64E 1N32E 2WP8A 4IFDD 2UXCI 5A6JA 4DV7I 2HHHE 2BM0A 3JAMC 3ADLA 2IERA 4HXZA 4JI7I 4LF8I 1EA6A 4USMA 3L00A 2LV2A 2EN1A 4GEQB 4JYAE 3JTZA 4B3TI 4HACA 4LF9E 2C38A 2LTSA 2HFUA 2YTFA 2NABA 4JI0E 4IZKB 1SR9A 3BIDA 4WUBA 4R03A 4X9JA 2I9IA 4R8OA 1UHZA 2EWLA 1LLMC 4JI8I 2B3TB 1EKZA 4BMJA 2JR1A 1RMDA 1NEIA 4WX9A 1R6LA 4DV0E 1A1HA 2EJ4A 4WYQB 2CGEA 1Z0CA 1UEKA 3LTOA 3B4TA 2PNZB 4X8WA 4HTGA 1N33E 4QNKA 5C0XC 4R2SA 2L8TA 2EOHA 1Y5YA 1DQ3A 2VE7C 1OJ4A 2YZTA 4NXME 2ZBKB 3BBGA 4X62I 1BKNA 2E5LI 2Z5CB 2O1TA 2YSPA 1XMQE 4DR5E 1Z0TA 2PO1A 1HNWI 2EOFA 3J81C 2YTJA 2M7QA 3ZZTA 4F9AB 2JYAA 2PNMA 5JEAA 1UN6B 2LT7A 5KL2A 1N36I 5JEAF 3KZYA 2EMKA 4DR3E 4LFBE 5K36D 1X6HA 3QG5C 4IJDA 4DKKA 1NHJA 1T4LB 4DXLA 2NUFA 2V85A 1MX0A 3T1HE 1ZM2A 1B69A 4P78A 2EL6A 2WP8B 4WUCA 1U2RA 3MSWA 2UUBI 2X36A 1RHYA 4MQYA 1X49A 2BA1D 2HFSA 4F6MA 1QZRA 2VQEI 4IFDC 2L2KB 2EM2A 4B3SE 1ZBQA 1KJKA 3M7ND 3ZOQB 4NXNI 5KL4A 3M6AA 5JEAE 1D6TA 1BBOA 1A1IA 2C38B 3Q6MA 5ADZA 1YUJA 4LFCI 4OO1B 4B3ME 2IESA 2EOMA 2LUQA 1ELOA 4X65E 4DR2E 2RPCA 1Z5AA 4ED4A 2YSOA 2LVHA 4O43A 1YSAC 2O1UA 1WXRA 2ODRD 2L3JA 1EI1A 3EPLA 1HNXE 1WUUA 1TF3A 4LF5I 4B3RI 5TSEA 1A1FA 1IMUA 3T1YE 2DMIA 4OX9I 4DUYE 4DV5E 4JI4E 4M0VA 1Y4SA 3ZZUA 5AE2A 1YUIA 2EPUA 1VISA 2Q2EB 1HK7A 5EL9A 2E1MA 2V88A 2DLKA 4WSPA 3LNUA 3OTOE 3U1YA 2EM5A 3FIGA 2YU8A 5DNXA 4DPYA 5C0XA 1ZXNA 2PO1B 2DMYA 4Q28A 4RPFA 2V8PA 4DV2I 4DR1I 1RC7A 2MDRA 4OZEA 2F4VI 3PYGA 4KHPE 1Z5BA 5C0XF 2EM8A 1HR0E 2J65A 4MU3A 2UUAI 4MU4A 2LUPB 2GO3A 2L3CA 1FNMA 2EM3A 4QNJA 4JI1I 4DPXA 3NZKA 4LCHA 3B82A 4DV4E 2EPMX 1HNZE 5BR8E 2B7VA 5A6AA 5LMNE 4DPTA 4X66I 1GZ6A 3Q6NA 2EN2A 2EMLA 1KVKA 2YTDA 2RSMA 4LCGA 4MYUA 4LFAE 1MGTA 3VYYA 5K36C 2VQFE 3AUZA 2UXDE 3DJWA 5GMEA 4AQYI 2EE8A 5C0XE 4BCAA 1QNTA 2GHFA 1ZXMA 1ZM3A 4IS1C 3QT6A 2EMGA 2X7IA 2NUGA 4FW7A 4DU7A 4DV1E 5KL6A 2DGCA 3K17A 4IZJA 4PRVA 4HYMA 4P7DA 1H7UA 1YYWA 4IFDA 4DR7I 4DUZE 1S4EA 2ADRA 2BR2B 4YY3E 2YT4A 4BHCA 3J81Q 4IFDF 4R2QA 4LPFA 4WFTA 2EPPA 2B9DA 3VHTB 4R2CA 1GTKA 5IWAI 3TQMA 2WZOA 2JEBA 2L92A 2YTIA 1P42A 4DPWA 4M9VC 1E3PA 1X6FA 2V8QB 1A1GA 2ELYA 2C37A 2HK3A 1N34I 2M9AA 4F2JC 3J7AM 2WBUA 5DROA 3RMPA 5IV8B 1PJTA 5DRRA 4N3OA 4IFDE 2YTQA 2O1VA 2EOZA 2EMFA 5A2QC 4PRXA 5EKWA 2GO4A 1N32I 4JI6E 5AE1A 2UXCE 2JOXA 1KYQA 3J80C 1Y60A 1IBMI 2HKEA 2VRDA 2JE6B 1Y4UA 1PDAA 2ENCA 3ADJA 3CDJA 2WW4A 3ZM7A 4LU9A 4FK5C 5CFFE 2PO2A 4WSGA 1Z0WA 2EMBA 1J5EI 5IXMB 2R3VA 4JI3I 4O24A 4AIMA 3C6KA 2EPNA 2YTNA 1UBDC 4UT4A 4K0KI 1RR9A 2JVAA 4JI5I 3ADIA 4EMDA 2DEIA 4I3HA 2D9HA 2EN7A 2R42A 2CG9A 4JI8E 2ZM6E 1PVGA 5IT9C 2PO0A 3F0NA 4DV0I 5K36A 3EPHA 3EPJA 1EH6A 1KIJA 2YRHA 2EMYA 1USUA 2E1RA 4WPYA 4IZJB 4M1KA 4BA1A 5K36F 3P06A 2WNRB 4O4KA 2EPXA 3HXLA 4RHBB 1FWLA 2RTXA 2J7JA 5T6JA 4LOMA 1A6FA 1L4SA 3ECRA 2ENAA 4BC9A 1HNWE 2LJUA 5L3JA 2YRKA 2WCC3 4DR4I 4OO1D 2V2QA 1ZM9A 5K36E 1X5WA 1FKAE 1XNQE 2CT1A 3L7ZA 5GMDA 4AIDA 2EFGA 2JEAA 3K85A 2A2CA 4NHRA 3KRNA 1QU6A 1N36E 1MG7A 4LCFA 1N0UA 2NN6D 2CZ9A 2EPCA 3PS2A 1NHIA 2HK2A 1YZ9A 2EOXA 4F9CB 4HACB 3V2UC 1BBGA 2YRMA 1ZU1A 3BGHA 2EM4A 4O5GA 3EQ1A 3KWRA 1PIEA 2EP3A 4B3SI 2FV4B 1TF6A 2K4VA 2VQEE 4LF4E 2JXPA 3QT8A 3PS1A 1Z0BA 3WU4A 2PO2B 3Q1QA 4BBYA 2L33A 4DR6I 2FTXB 4B3MI 2L2NA 2C39A 2NA2A 2EMIA 4LFCE 4ZYGA 3PYFA 2YTOA 1Z5CA 4DR2I 2F1DA 5A6BD 1H7SA 2EMXA 4ZVIA 4WUDA 2EOYA 1STUA 1I94E 1UDSA 2GS8A 3B8HA 2N3HA 2YPNA
chains in the Genus database with same CATH topology
4DV3I 1Z0GA 4L5NC 3JAMQ 2KOUA 4DV5I 4JI4I 2GQ0A 3CWVA 4OX9E 4JI2I 2VF3A 5A2QQ 4LF7E 4KQVA 1B63A 3F6HA 4GKJI 2MC5A 3ZZ0A 4PU9A 2V89A 1T4NA 4KZSA 4DR1E 3IWBA 4DV2E 2F4VE 4KHPI 1HR0I 2V83A 2LBSB 1PKPA 2UUAE 1J26A 2UXBE 3ZKBA 4JI1E 4DV4I 1HNZI 1DI2A 4LF8E 4LF6I 4P7AA 4X66E 1IBLE 3LMLA 3QT5A 3WU5A 1WHQA 2VQFI 3LLHA 4IZKA 3C4TA 4YHHI 4AQYE 3HPZA 2Z5EA 2UUCI 2UU9I 2KONA 1KKHA 4GKKI 2KHXA 3J7Yp 1ZBTA 4L8NA 1Z0EA 2ODRC 4DUZI 1XMOI 2BV3A 4DR7E 4M30A 5LMUI 3WU6A 4TUIA 1IBKI 2V86A 2V2VA 2Z5CA 2M1SA 4J8ZA 5IWAE 2XEXA 4JV5I 3K6QA 4BS9A 5LL6R 3B78A 3AV0A 1XNRI 1FJGE 4X64I 1N34E 1Y6ZA 3VYXA 2HHHI 2DSYA 4R1FA 3QT7A 4DV7E 2JWOA 4JI7E 2NUEA 4FWHA 2J7KA 2B7TA 2V2ZA 4JYAI 2HKJA 4LF9I 1S16A 4B3TE 4JI0I 1O0WA 1T4OA 2RS6A 1K47A 2OI2A 4HY1A 1IBME 4UTGA 3VK6A 2IHR1 2LE2A 4OOGC 4URLA 1J5EE 5FLXC 1H74A 1N33I 4DU8A 4JI3E 3IWCA 4K0KE 3P1XA 4JI5E 2ZM6I 4M2ZA 4NXMI 2LJHA 3GONA 3HJCA 1H73A 2VF1A 1XMQI 4X62E 2E5LE 4DR5I 4FWDA 4FWGA 1FI4A 1Z59A 3HQ1A 4TUGA 2EZ6A 4DR3I 4MYTA 4DMIA 4LFBI 3K1JA 3PYDA 3LPSA 2L6MA 3J7AG 3T1HI 1H72C 2DIXA 4DR4E 1XNQI 1RQ0A 3WU3A 3DF6A 3H09A 3PYEA 1N0VC 4P52A 2UUBE 2LMZA 3V5RA 2FGGA 2V87A 2L2MA 4NXNE 1GQEA 4F9BB 2DEJA 2JOBA 3C4BA 4Z7YA 4X65I 5DNYA 2NPFA 2LJPA 4LF4I 5F3WA 2RS7A 3ZKDA 2BM1A 3JU0A 1HNXI 4Z7CA 2Z5BA 4DPUA 1KTVA 4DR6E 4LF5E 4B3RE 3T1YI 3IWDA 1FWKA 4DUYI 1X47A 1UILA 2A2DA 2F8BA 1I94I 3OTOI 4BC7A 5AE3A 2PNLA 4DV6E 2UUCE 5FWKA 5AASA 4DV3E 2IOQA 3J80Q 1MU5A 1Z0VA 1X48A 4LF7I 4JI2E 1NZ0A 1XHKA 4GKJE 1USVA 5BR8I 5LMNI 3H4LA 4F54A 4JG4A 2MC6A 4LFAI 4LTYA 2LTRA 2UXBI 2UXDI 4I8OA 4USKA 4DV6I 5IT9Q 1B62A 5FLXQ 2DB2A 2N3GA 1NHHA 4LF6E 4DV1I 1YYKA 2CPNA 2O1WA 3D4JA 4FN5A 4FW9A 1RREA 1YYOA 4YHHE 2M4IA 3OMLA 4YY3I 2UU9E 3HULA 1ZM4A 2JY9A 4GKKE 2Z5BB 2ZITA 2IOPA 3HTXA 1XMOE 2AJ4A 2G7HA 3HPSA 3F6GA 5LMUE 2LRSA 1WHNA 1IBKE 2V34A 1DARA 4JV5E 2H36X 4XTJA 1FJGI 3ADGA 4IZJD 4JI6I 1XNRE 4X64E 1N32E 2UXCI 4DV7I 2HHHE 2BM0A 3JAMC 3ADLA 4HXZA 4JI7I 1EA6A 4USMA 4GEQB 4JYAE 3JTZA 4B3TI 4HACA 4LF9E 2LTSA 2HFUA 4JI0E 4IZKB 1SR9A 4WUBA 4R03A 4R8OA 1UHZA 2EWLA 4JI8I 2B3TB 1EKZA 4BMJA 2JR1A 4DV0E 4WYQB 2CGEA 1Z0CA 1UEKA 3LTOA 4X8WA 1N33E 2L8TA 1DQ3A 2VE7C 1OJ4A 2YZTA 4NXME 2ZBKB 4X62I 1BKNA 2E5LI 2Z5CB 2O1TA 1XMQE 4DR5E 1Z0TA 1HNWI 3J81C 2M7QA 3ZZTA 4F9AB 2PNMA 1N36I 4DR3E 4LFBE 4DKKA 1NHJA 1T4LB 4DXLA 2NUFA 2V85A 1MX0A 3T1HE 1ZM2A 4P78A 4WUCA 1U2RA 3MSWA 2UUBI 2X36A 1X49A 2HFSA 1QZRA 2VQEI 2L2KB 4B3SE 1ZBQA 3ZOQB 4NXNI 3M6AA 1D6TA 3Q6MA 5ADZA 4LFCI 4B3ME 2LUQA 1ELOA 4X65E 4DR2E 1Z5AA 4ED4A 2O1UA 1WXRA 2ODRD 2L3JA 1EI1A 1HNXE 1WUUA 4LF5I 4B3RI 3T1YE 4OX9I 4DUYE 4DV5E 4JI4E 4M0VA 1Y4SA 3ZZUA 5AE2A 1VISA 2Q2EB 1HK7A 2E1MA 2V88A 4WSPA 3LNUA 3OTOE 3FIGA 4DPYA 1ZXNA 2DMYA 4Q28A 4RPFA 2V8PA 4DV2I 4DR1I 1RC7A 2MDRA 2F4VI 3PYGA 4KHPE 1Z5BA 1HR0E 2UUAI 2LUPB 2L3CA 1FNMA 4JI1I 4DPXA 3B82A 4DV4E 1HNZE 4LF8I 5BR8E 2B7VA 5LMNE 4DPTA 4X66I 1GZ6A 3Q6NA 4MYUA 1KVKA 1IBLI 2RSMA 4LFAE 3VYYA 2VQFE 3AUZA 2UXDE 3DJWA 5GMEA 4AQYI 4BCAA 1ZXMA 1ZM3A 3QT6A 2X7IA 2NUGA 4DU7A 4DV1E 4IZJA 3K17A 4PRVA 4HYMA 4P7DA 1H7UA 1YYWA 4DR7I 4DUZE 1S4EA 3J81Q 4YY3E 2YT4A 4WFTA 2B9DA 5IWAI 2WZOA 2L92A 4DPWA 2V8QB 2HK3A 1N34I 3J7AM 3RMPA 4N3OA 2O1VA 5A2QC 4PRXA 1N32I 4JI6E 5AE1A 2UXCE 2JOXA 3J80C 1IBMI 2HKEA 1Y4UA 3ADJA 2WW4A 3ZM7A 4LU9A 5CFFE 1Z0WA 1J5EI 2R3VA 4JI3I 4UT4A 4K0KI 1RR9A 2JVAA 4JI5I 3ADIA 4EMDA 2DEIA 4I3HA 2R42A 2CG9A 4JI8E 2ZM6E 1PVGA 5IT9C 3F0NA 4DV0I 1KIJA 1USUA 4M1KA 4IZJB 2E1RA 4WPYA 3P06A 3HXLA 1FWLA 2RTXA 5T6JA 1A6FA 4BC9A 1HNWE 5L3JA 4DR4I 2V2QA 1ZM9A 1FKAE 1XNQE 5GMDA 2EFGA 3K85A 2A2CA 1QU6A 1N36E 1MG7A 1N0UA 2CZ9A 1NHIA 2HK2A 1YZ9A 4F9CB 4HACB 3V2UC 1PIEA 3KWRA 4B3SI 2FV4B 2K4VA 2VQEE 4LF4E 3QT8A 3WU4A 1Z0BA 3Q1QA 4BBYA 2L33A 4DR6I 2FTXB 4B3MI 2L2NA 2NA2A 4LFCE 3PYFA 1Z5CA 4DR2I 1H7SA 4ZVIA 4WUDA 1STUA 1I94E 2GS8A 3B8HA 2N3HA 3PRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 I;  1Z0G A;  3JAM Q;  4DV5 I;  4JI4 I;  3CWV A;  4OX9 E;  4JI2 I;  2VF3 A;  5A2Q Q;  4LF7 E;  4KQV A;  1B63 A;  4GKJ I;  3ZZ0 A;  4PU9 A;  1T4N A;  4DR1 E;  4DV2 E;  4KHP I;  2F4V E;  1HR0 I;  2LBS B;  1PKP A;  2UUA E;  1J26 A;  2UXB E;  3ZKB A;  4JI1 E;  4DV4 I;  1HNZ I;  1DI2 A;  4LF8 E;  4LF6 I;  4P7A A;  4X66 E;  1IBL E;  3QT5 A;  3WU5 A;  1WHQ A;  2VQF I;  3LLH A;  3C4T A;  4YHH I;  4AQY E;  2UUC I;  2UU9 I;  1KKH A;  4GKK I;  2KHX A;  3J7Y p;  1ZBT A;  1Z0E A;  4DUZ I;  1XMO I;  2BV3 A;  4DR7 E;  4M30 A;  5LMU I;  3WU6 A;  1IBK I;  2V2V A;  5IWA E;  2XEX A;  4JV5 I;  5LL6 R;  3B78 A;  1XNR I;  1FJG E;  4X64 I;  1N34 E;  3VYX A;  2HHH I;  4R1F A;  3QT7 A;  4DV7 E;  4JI7 E;  2NUE A;  4FWH A;  2J7K A;  2B7T A;  2V2Z A;  4JYA I;  2HKJ A;  4LF9 I;  1S16 A;  4B3T E;  4JI0 I;  1O0W A;  1T4O A;  2RS6 A;  1K47 A;  2OI2 A;  4HY1 A;  1IBM E;  4UTG A;  2IHR 1;  4OOG C;  4URL A;  1J5E E;  5FLX C;  1H74 A;  1N33 I;  4DU8 A;  4JI3 E;  4K0K E;  3P1X A;  4JI5 E;  2ZM6 I;  4M2Z A;  4NXM I;  2LJH A;  3GON A;  1H73 A;  1XMQ I;  4X62 E;  2E5L E;  4DR5 I;  4FWD A;  4FWG A;  1FI4 A;  1Z59 A;  2EZ6 A;  4DR3 I;  4MYT A;  4LFB I;  3K1J A;  3PYD A;  3LPS A;  3J7A G;  3T1H I;  1H72 C;  2DIX A;  4DR4 E;  1XNQ I;  1RQ0 A;  3WU3 A;  3PYE A;  1N0V C;  4P52 A;  2UUB E;  3V5R A;  2L2M A;  4NXN E;  1GQE A;  2DEJ A;  3C4B A;  4Z7Y A;  4X65 I;  2NPF A;  2LJP A;  4LF4 I;  2RS7 A;  3ZKD A;  2BM1 A;  1HNX I;  4Z7C A;  4DPU A;  1KTV A;  4DR6 E;  4LF5 E;  4B3R E;  3T1Y I;  1FWK A;  4DUY I;  1X47 A;  1UIL A;  2A2D A;  1I94 I;  3OTO I;  4DV6 E;  2UUC E;  4DV3 E;  3J80 Q;  1MU5 A;  1Z0V A;  1X48 A;  4LF7 I;  4JI2 E;  1NZ0 A;  1XHK A;  4GKJ E;  5BR8 I;  5LMN I;  3H4L A;  4JG4 A;  4LFA I;  2LTR A;  2UXB I;  2UXD I;  4USK A;  4DV6 I;  5IT9 Q;  1B62 A;  5FLX Q;  2DB2 A;  2N3G A;  1NHH A;  4LF6 E;  4DV1 I;  1YYK A;  4FN5 A;  2CPN A;  3D4J A;  4FW9 A;  1RRE A;  1YYO A;  4YHH E;  4YY3 I;  2UU9 E;  3HUL A;  1ZM4 A;  2JY9 A;  4GKK E;  2ZIT A;  3HTX A;  1XMO E;  2AJ4 A;  5LMU E;  2LRS A;  1WHN A;  2V34 A;  1IBK E;  1DAR A;  4JV5 E;  4XTJ A;  1FJG I;  3ADG A;  4JI6 I;  1XNR E;  4X64 E;  1N32 E;  2UXC I;  4DV7 I;  2HHH E;  2BM0 A;  3JAM C;  3ADL A;  4HXZ A;  4JI7 I;  1EA6 A;  4USM A;  4JYA E;  4B3T I;  4HAC A;  4LF9 E;  2LTS A;  2HFU A;  4JI0 E;  4WUB A;  1UHZ A;  4JI8 I;  2B3T B;  1EKZ A;  4DV0 E;  4WYQ B;  1Z0C A;  1UEK A;  3LTO A;  4X8W A;  1N33 E;  1OJ4 A;  4NXM E;  2ZBK B;  4X62 I;  1BKN A;  2E5L I;  1XMQ E;  4DR5 E;  1Z0T A;  1HNW I;  3J81 C;  3ZZT A;  1N36 I;  4DR3 E;  4LFB E;  4DKK A;  1NHJ A;  1T4L B;  4DXL A;  2NUF A;  1MX0 A;  3T1H E;  1ZM2 A;  4WUC A;  1U2R A;  2UUB I;  2X36 A;  1X49 A;  2HFS A;  1QZR A;  2VQE I;  2L2K B;  4B3S E;  4NXN I;  3M6A A;  1D6T A;  4LFC I;  4B3M E;  2LUQ A;  1ELO A;  4X65 E;  4DR2 E;  1Z5A A;  4ED4 A;  2L3J A;  1EI1 A;  1HNX E;  1WUU A;  4LF5 I;  4B3R I;  3T1Y E;  4OX9 I;  4DUY E;  4DV5 E;  4JI4 E;  3ZZU A;  1VIS A;  2Q2E B;  3LNU A;  3OTO E;  4DPY A;  1ZXN A;  2DMY A;  4RPF A;  4DV2 I;  2V8P A;  4DR1 I;  2F4V I;  1RC7 A;  2MDR A;  3PYG A;  4KHP E;  1Z5B A;  1HR0 E;  2UUA I;  2LUP B;  2L3C A;  1FNM A;  4JI1 I;  4DPX A;  3B82 A;  4DV4 E;  1HNZ E;  4LF8 I;  5BR8 E;  2B7V A;  5LMN E;  4DPT A;  4X66 I;  4MYU A;  1IBL I;  1KVK A;  2RSM A;  4LFA E;  3VYY A;  2VQF E;  2UXD E;  5GME A;  4AQY I;  1ZXM A;  1ZM3 A;  3QT6 A;  2X7I A;  2NUG A;  4DU7 A;  4DV1 E;  3K17 A;  4PRV A;  4HYM A;  1H7U A;  1YYW A;  4DR7 I;  4DUZ E;  1S4E A;  3J81 Q;  4YY3 E;  2YT4 A;  4WFT A;  5IWA I;  4DPW A;  2HK3 A;  1N34 I;  3J7A M;  5A2Q C;  4PRX A;  1N32 I;  4JI6 E;  2UXC E;  3J80 C;  1IBM I;  2HKE A;  3ADJ A;  2WW4 A;  3ZM7 A;  5CFF E;  1Z0W A;  1J5E I;  2R3V A;  4JI3 I;  4UT4 A;  4K0K I;  1RR9 A;  2JVA A;  4JI5 I;  3ADI A;  4EMD A;  2DEI A;  4I3H A;  2R42 A;  4JI8 E;  2ZM6 E;  1PVG A;  3F0N A;  4DV0 I;  5IT9 C;  1KIJ A;  4M1K A;  2E1R A;  1FWL A;  2RTX A;  1A6F A;  1HNW E;  5L3J A;  4DR4 I;  2V2Q A;  1ZM9 A;  1FKA E;  1XNQ E;  5GMD A;  2EFG A;  2A2C A;  1QU6 A;  1N36 E;  1MG7 A;  1N0U A;  2CZ9 A;  1NHI A;  2HK2 A;  1YZ9 A;  4HAC B;  3V2U C;  1PIE A;  4B3S I;  2VQE E;  4LF4 E;  3QT8 A;  3WU4 A;  1Z0B A;  3Q1Q A;  2L33 A;  4DR6 I;  4B3M I;  2L2N A;  2NA2 A;  4LFC E;  3PYF A;  1Z5C A;  4DR2 I;  1H7S A;  4ZVI A;  4WUD A;  1STU A;  1I94 E;  2GS8 A;  3B8H A;  2N3H A; 
#chains in the Genus database with same CATH topology
 2EMA A;  4DV3 I;  1Z0G A;  4L5N C;  3JAM Q;  3C6M A;  2KOU A;  4R2R A;  4DV5 I;  4JI4 I;  2GQ0 A;  3CWV A;  2ENH A;  2EQ0 A;  4OX9 E;  1P47 A;  4GQU A;  4ZYH A;  2VF3 A;  3GLL A;  4R2E A;  5A2Q Q;  5JEA B;  4JI2 I;  4BA2 A;  1R6M A;  1X6E A;  4LF7 E;  4KQV A;  3M99 B;  1B63 A;  2EMC A;  3F6H A;  2BA1 G;  4GKJ I;  2YU5 A;  2EN8 A;  2MC5 A;  4BHB A;  3ZZ0 A;  3M7N G;  4PU9 A;  2V89 A;  1T4N A;  4KZS A;  4DR1 E;  3IWB A;  4DV2 E;  2F4V E;  4KHP I;  1F2I G;  1HR0 I;  2V83 A;  2LBS B;  2I13 A;  2EOR A;  1PKP A;  2UUA E;  1J26 A;  2JEA B;  2EN4 A;  2UXB E;  4OO1 C;  2E72 A;  1YH8 A;  3ZKB A;  2EOI A;  4JI1 E;  2K7I A;  4DV4 I;  1HNZ I;  1DI2 A;  2MDG A;  2BBG A;  4LF8 E;  5DRP A;  4P7A A;  4LF6 I;  4X66 E;  1IBL E;  2NN6 C;  3LML A;  3QT5 A;  3WU5 A;  1WHQ A;  2VQF I;  3LLH A;  1PJS A;  2YTP A;  4IZK A;  4MU0 A;  1YFH A;  4RH8 A;  3C4T A;  1JK1 A;  4AQY E;  3HPZ A;  3UHM A;  4YHH I;  2Z5E A;  2UUC I;  2UU9 I;  1A1L A;  2KON A;  2EN3 A;  1KKH A;  4GKK I;  2KHX A;  4MLV A;  4MDT A;  3J7Y p;  2GPI A;  1ZBT A;  2C39 B;  4L8N A;  1Z0E A;  2ODR C;  2PNZ A;  1VI7 A;  4FW5 A;  2BB8 A;  2Q8U A;  1A1J A;  4DUZ I;  1XMO I;  2BV3 A;  4DR7 E;  1YPN A;  4M30 A;  5LMU I;  3WU6 A;  2JT2 A;  4TUI A;  2DLQ A;  5AC5 A;  1IBK I;  2V86 A;  2V2V A;  2Z5C A;  2M1S A;  3CDI A;  2EOO A;  4J8Z A;  5C0X B;  5IWA E;  5KL5 A;  2XEX A;  4JV5 I;  4IS9 A;  3K6Q A;  3BF2 A;  5LL6 R;  4BS9 A;  2CTD A;  3B78 A;  3AV0 A;  1XNR I;  1FJG E;  4X64 I;  1N34 E;  1Y6Z A;  3VYX A;  3P3G A;  2EM9 A;  2HHH I;  2DSY A;  2BA0 G;  4R1F A;  2YTE A;  3QT7 A;  2RQL A;  4DV7 E;  2JWO A;  4JI7 E;  2NUE A;  4FWH A;  2J7K A;  3MHS C;  1BB8 A;  2EN6 A;  2B7T A;  4OKG A;  4WXD A;  2EL4 A;  2V2Z A;  4WXC A;  4JYA I;  2HKJ A;  3KZZ A;  4LF9 I;  2EPA A;  1S16 A;  4B3T E;  3MHH C;  1Z1B A;  4GZN C;  4JI0 I;  3PS3 A;  1O0W A;  3M85 G;  1T4O A;  2RS6 A;  1K47 A;  2OI2 A;  2CVE A;  4HY1 A;  4U3D A;  1IBM E;  4UTG A;  3VK6 A;  2JP9 A;  2IHR 1;  1A1K A;  2LE2 A;  2MKN A;  4N4R B;  3P76 A;  3GCM A;  4OOG C;  2EPO A;  4FW4 A;  1OYR A;  4URL A;  1J5E E;  5FLX C;  4OO1 A;  2EQ1 A;  1H74 A;  3EPK A;  4DU8 A;  1N33 I;  5AC4 A;  2MKD A;  4JI3 E;  4IFD B;  4OO1 F;  2EQ3 A;  3IWC A;  1IBL I;  4K0K E;  3P1X A;  4JI5 E;  2ZM6 I;  4M2Z A;  4NXM I;  2LJH A;  2NN6 A;  3GON A;  1OYP A;  3HJC A;  2VF1 A;  2EPK X;  1H73 A;  4X62 E;  2E5L E;  4DR5 I;  1XMQ I;  2NN6 F;  1AH5 A;  2EMW A;  1FI4 A;  4FWG A;  2JEB B;  2LO3 A;  4FWD A;  1Z59 A;  2C37 B;  4AM3 A;  3THN A;  1N3G A;  3HQ1 A;  4MLQ A;  1AAY A;  2A25 A;  2EOJ A;  1JK2 A;  2EOE A;  4TUG A;  2O3Z A;  2EZ6 A;  4DR3 I;  4MYT A;  4OO1 E;  4DMI A;  4LFB I;  1MEY C;  3K1J A;  1T39 A;  3LPS A;  3PYD A;  2N8X A;  2L6M A;  2RSI A;  3J7A G;  3T1H I;  1H72 C;  2DIX A;  2JPA A;  3UK3 C;  4DR4 E;  1XNQ I;  2NN6 E;  1RQ0 A;  5A6B A;  3WU3 A;  4J3D A;  3DF6 A;  3H09 A;  3PYE A;  1N0V C;  4P52 A;  4R2P A;  4FW6 A;  2UUB E;  2EOS A;  2LMZ A;  2HJJ A;  5LLQ A;  3V5R A;  2LCE A;  2FGG A;  2V87 A;  2L2M A;  2CSH A;  4NXN E;  1GQE A;  1UDQ A;  4F9B B;  2DEJ A;  2JOB A;  3C4B A;  4Z7Y A;  2EMH A;  4X65 I;  2EMZ A;  5DNY A;  5JEA D;  2NPF A;  2LJP A;  1EH8 A;  3P3E A;  4LF4 I;  5F3W A;  2RS7 A;  3ZKD A;  2R76 A;  2YTG A;  1DGC A;  3JU0 A;  1G2D C;  2DRP A;  2HGH A;  2BM1 A;  5DNL A;  2PO0 B;  4Z7C A;  1HNX I;  4Q35 B;  5K36 B;  2Z5B A;  1UDO A;  4DPU A;  1KTV A;  4DR6 E;  4BA1 B;  4LF5 E;  4B3R E;  1IQO A;  3IWD A;  1FWK A;  4DUY I;  3T1Y I;  1IQS A;  1X47 A;  2YWQ A;  4MU1 A;  1EH7 A;  1UIL A;  2A2D A;  2BR2 A;  2F8B A;  1I94 I;  1YHC A;  3OTO I;  5A6K A;  2NN6 B;  1WJP A;  4BC7 A;  5AE3 A;  4R2D A;  1TN9 A;  1UDN A;  2PNL A;  4DV6 E;  2ELZ A;  2UUC E;  1OYS A;  2EOQ A;  5FWK A;  2WBS A;  5AAS A;  4DV3 E;  5A69 A;  2IOQ A;  3J80 Q;  4R2A A;  1MU5 A;  1Z0V A;  4NBQ A;  1X48 A;  4LF7 I;  4JI2 E;  1NZ0 A;  3L7Z B;  3THO B;  1XHK A;  4ZYD A;  1T38 A;  2GLI A;  4GKJ E;  2R1F A;  1USV A;  5LMN I;  3H4L A;  5BR8 I;  4F54 A;  3U1K A;  4JG4 A;  2MC6 A;  1XXE A;  4LFA I;  4LTY A;  2LTR A;  2EL5 A;  2UXB I;  2UXD I;  1WRJ A;  4I8O A;  4USK A;  4DV6 I;  5IT9 Q;  4U3B A;  1B62 A;  5FLX Q;  2JE6 A;  3GME A;  1X3C A;  5DRQ A;  2DB2 A;  2N3G A;  5KL3 A;  1NHH A;  4LF6 E;  4DV1 I;  5C0X D;  5ELW A;  4HEI A;  3HKM A;  1YYK A;  3P3C A;  2BA0 D;  2CPN A;  2O1W A;  3D4J A;  4FN5 A;  4FW9 A;  1RRE A;  1YYO A;  4YHH E;  1PJQ A;  2EM6 A;  3OML A;  2EPZ A;  2M4I A;  1SFE A;  1NCS A;  2UU9 E;  4YY3 I;  1ZR9 A;  2EPR A;  2AE8 A;  3HUL A;  5JEA C;  1ZM4 A;  2JY9 A;  4GKK E;  2Z5B B;  2ZIT A;  1ZAA C;  2IOP A;  3H1C A;  4F6N A;  2EM7 A;  3M85 D;  1G2F C;  2WNR A;  3HTX A;  5KL7 A;  1XMO E;  2AJ4 A;  2HC5 A;  2G7H A;  3HPS A;  4ISA A;  4BA2 B;  3F6G A;  2EM0 A;  5LMU E;  2LRS A;  4KWY A;  3DD6 A;  2PRT A;  3PRY A;  4FW3 A;  1WHN A;  4ZYE A;  1IBK E;  2V34 A;  1DAR A;  2VES A;  2WBT A;  4NZV A;  4JV5 E;  2EPL X;  2H36 X;  1E3H A;  4XTJ A;  1FJG I;  3ADG A;  4IZJ D;  4JI6 I;  1XNR E;  4X64 E;  1N32 E;  2WP8 A;  4IFD D;  2UXC I;  5A6J A;  4DV7 I;  2HHH E;  2BM0 A;  3JAM C;  3ADL A;  2IER A;  4HXZ A;  4JI7 I;  4LF8 I;  1EA6 A;  4USM A;  3L00 A;  2LV2 A;  2EN1 A;  4GEQ B;  4JYA E;  3JTZ A;  4B3T I;  4HAC A;  4LF9 E;  2C38 A;  2LTS A;  2HFU A;  2YTF A;  2NAB A;  4JI0 E;  4IZK B;  1SR9 A;  3BID A;  4WUB A;  4R03 A;  4X9J A;  2I9I A;  4R8O A;  1UHZ A;  2EWL A;  1LLM C;  4JI8 I;  2B3T B;  1EKZ A;  4BMJ A;  2JR1 A;  1RMD A;  1NEI A;  4WX9 A;  1R6L A;  4DV0 E;  1A1H A;  2EJ4 A;  4WYQ B;  2CGE A;  1Z0C A;  1UEK A;  3LTO A;  3B4T A;  2PNZ B;  4X8W A;  4HTG A;  1N33 E;  4QNK A;  5C0X C;  4R2S A;  2L8T A;  2EOH A;  1Y5Y A;  1DQ3 A;  2VE7 C;  1OJ4 A;  2YZT A;  4NXM E;  2ZBK B;  3BBG A;  4X62 I;  1BKN A;  2E5L I;  2Z5C B;  2O1T A;  2YSP A;  1XMQ E;  4DR5 E;  1Z0T A;  2PO1 A;  1HNW I;  2EOF A;  3J81 C;  2YTJ A;  2M7Q A;  3ZZT A;  4F9A B;  2JYA A;  2PNM A;  5JEA A;  1UN6 B;  2LT7 A;  5KL2 A;  1N36 I;  5JEA F;  3KZY A;  2EMK A;  4DR3 E;  4LFB E;  5K36 D;  1X6H A;  3QG5 C;  4IJD A;  4DKK A;  1NHJ A;  1T4L B;  4DXL A;  2NUF A;  2V85 A;  1MX0 A;  3T1H E;  1ZM2 A;  1B69 A;  4P78 A;  2EL6 A;  2WP8 B;  4WUC A;  1U2R A;  3MSW A;  2UUB I;  2X36 A;  1RHY A;  4MQY A;  1X49 A;  2BA1 D;  2HFS A;  4F6M A;  1QZR A;  2VQE I;  4IFD C;  2L2K B;  2EM2 A;  4B3S E;  1ZBQ A;  1KJK A;  3M7N D;  3ZOQ B;  4NXN I;  5KL4 A;  3M6A A;  5JEA E;  1D6T A;  1BBO A;  1A1I A;  2C38 B;  3Q6M A;  5ADZ A;  1YUJ A;  4LFC I;  4OO1 B;  4B3M E;  2IES A;  2EOM A;  2LUQ A;  1ELO A;  4X65 E;  4DR2 E;  2RPC A;  1Z5A A;  4ED4 A;  2YSO A;  2LVH A;  4O43 A;  1YSA C;  2O1U A;  1WXR A;  2ODR D;  2L3J A;  1EI1 A;  3EPL A;  1HNX E;  1WUU A;  1TF3 A;  4LF5 I;  4B3R I;  5TSE A;  1A1F A;  1IMU A;  3T1Y E;  2DMI A;  4OX9 I;  4DUY E;  4DV5 E;  4JI4 E;  4M0V A;  1Y4S A;  3ZZU A;  5AE2 A;  1YUI A;  2EPU A;  1VIS A;  2Q2E B;  1HK7 A;  5EL9 A;  2E1M A;  2V88 A;  2DLK A;  4WSP A;  3LNU A;  3OTO E;  3U1Y A;  2EM5 A;  3FIG A;  2YU8 A;  5DNX A;  4DPY A;  5C0X A;  1ZXN A;  2PO1 B;  2DMY A;  4Q28 A;  4RPF A;  2V8P A;  4DV2 I;  4DR1 I;  1RC7 A;  2MDR A;  4OZE A;  2F4V I;  3PYG A;  4KHP E;  1Z5B A;  5C0X F;  2EM8 A;  1HR0 E;  2J65 A;  4MU3 A;  2UUA I;  4MU4 A;  2LUP B;  2GO3 A;  2L3C A;  1FNM A;  2EM3 A;  4QNJ A;  4JI1 I;  4DPX A;  3NZK A;  4LCH A;  3B82 A;  4DV4 E;  2EPM X;  1HNZ E;  5BR8 E;  2B7V A;  5A6A A;  5LMN E;  4DPT A;  4X66 I;  1GZ6 A;  3Q6N A;  2EN2 A;  2EML A;  1KVK A;  2YTD A;  2RSM A;  4LCG A;  4MYU A;  4LFA E;  1MGT A;  3VYY A;  5K36 C;  2VQF E;  3AUZ A;  2UXD E;  3DJW A;  5GME A;  4AQY I;  2EE8 A;  5C0X E;  4BCA A;  1QNT A;  2GHF A;  1ZXM A;  1ZM3 A;  4IS1 C;  3QT6 A;  2EMG A;  2X7I A;  2NUG A;  4FW7 A;  4DU7 A;  4DV1 E;  5KL6 A;  2DGC A;  3K17 A;  4IZJ A;  4PRV A;  4HYM A;  4P7D A;  1H7U A;  1YYW A;  4IFD A;  4DR7 I;  4DUZ E;  1S4E A;  2ADR A;  2BR2 B;  4YY3 E;  2YT4 A;  4BHC A;  3J81 Q;  4IFD F;  4R2Q A;  4LPF A;  4WFT A;  2EPP A;  2B9D A;  3VHT B;  4R2C A;  1GTK A;  5IWA I;  3TQM A;  2WZO A;  2JEB A;  2L92 A;  2YTI A;  1P42 A;  4DPW A;  4M9V C;  1E3P A;  1X6F A;  2V8Q B;  1A1G A;  2ELY A;  2C37 A;  2HK3 A;  1N34 I;  2M9A A;  4F2J C;  3J7A M;  2WBU A;  5DRO A;  3RMP A;  5IV8 B;  1PJT A;  5DRR A;  4N3O A;  4IFD E;  2YTQ A;  2O1V A;  2EOZ A;  2EMF A;  5A2Q C;  4PRX A;  5EKW A;  2GO4 A;  1N32 I;  4JI6 E;  5AE1 A;  2UXC E;  2JOX A;  1KYQ A;  3J80 C;  1Y60 A;  1IBM I;  2HKE A;  2VRD A;  2JE6 B;  1Y4U A;  1PDA A;  2ENC A;  3ADJ A;  3CDJ A;  2WW4 A;  3ZM7 A;  4LU9 A;  4FK5 C;  5CFF E;  2PO2 A;  4WSG A;  1Z0W A;  2EMB A;  1J5E I;  5IXM B;  2R3V A;  4JI3 I;  4O24 A;  4AIM A;  3C6K A;  2EPN A;  2YTN A;  1UBD C;  4UT4 A;  4K0K I;  1RR9 A;  2JVA A;  4JI5 I;  3ADI A;  4EMD A;  2DEI A;  4I3H A;  2D9H A;  2EN7 A;  2R42 A;  2CG9 A;  4JI8 E;  2ZM6 E;  1PVG A;  5IT9 C;  2PO0 A;  3F0N A;  4DV0 I;  5K36 A;  3EPH A;  3EPJ A;  1EH6 A;  1KIJ A;  2YRH A;  2EMY A;  1USU A;  2E1R A;  4WPY A;  4IZJ B;  4M1K A;  4BA1 A;  5K36 F;  3P06 A;  2WNR B;  4O4K A;  2EPX A;  3HXL A;  4RHB B;  1FWL A;  2RTX A;  2J7J A;  5T6J A;  4LOM A;  1A6F A;  1L4S A;  3ECR A;  2ENA A;  4BC9 A;  1HNW E;  2LJU A;  5L3J A;  2YRK A;  2WCC 3;  4DR4 I;  4OO1 D;  2V2Q A;  1ZM9 A;  5K36 E;  1X5W A;  1FKA E;  1XNQ E;  2CT1 A;  3L7Z A;  5GMD A;  4AID A;  2EFG A;  2JEA A;  3K85 A;  2A2C A;  4NHR A;  3KRN A;  1QU6 A;  1N36 E;  1MG7 A;  4LCF A;  1N0U A;  2NN6 D;  2CZ9 A;  2EPC A;  3PS2 A;  1NHI A;  2HK2 A;  1YZ9 A;  2EOX A;  4F9C B;  4HAC B;  3V2U C;  1BBG A;  2YRM A;  1ZU1 A;  3BGH A;  2EM4 A;  4O5G A;  3EQ1 A;  3KWR A;  1PIE A;  2EP3 A;  4B3S I;  2FV4 B;  1TF6 A;  2K4V A;  2VQE E;  4LF4 E;  2JXP A;  3QT8 A;  3PS1 A;  1Z0B A;  3WU4 A;  2PO2 B;  3Q1Q A;  4BBY A;  2L33 A;  4DR6 I;  2FTX B;  4B3M I;  2L2N A;  2C39 A;  2NA2 A;  2EMI A;  4LFC E;  4ZYG A;  3PYF A;  2YTO A;  1Z5C A;  4DR2 I;  2F1D A;  5A6B D;  1H7S A;  2EMX A;  4ZVI A;  4WUD A;  2EOY A;  1STU A;  1I94 E;  1UDS A;  2GS8 A;  3B8H A;  2N3H A;  2YPN A; 
#chains in the Genus database with same CATH homology
 4DV3 I;  1Z0G A;  4L5N C;  3JAM Q;  2KOU A;  4DV5 I;  4JI4 I;  2GQ0 A;  3CWV A;  4OX9 E;  4JI2 I;  2VF3 A;  5A2Q Q;  4LF7 E;  4KQV A;  1B63 A;  3F6H A;  4GKJ I;  2MC5 A;  3ZZ0 A;  4PU9 A;  2V89 A;  1T4N A;  4KZS A;  4DR1 E;  3IWB A;  4DV2 E;  2F4V E;  4KHP I;  1HR0 I;  2V83 A;  2LBS B;  1PKP A;  2UUA E;  1J26 A;  2UXB E;  3ZKB A;  4JI1 E;  4DV4 I;  1HNZ I;  1DI2 A;  4LF8 E;  4LF6 I;  4P7A A;  4X66 E;  1IBL E;  3LML A;  3QT5 A;  3WU5 A;  1WHQ A;  2VQF I;  3LLH A;  4IZK A;  3C4T A;  4YHH I;  4AQY E;  3HPZ A;  2Z5E A;  2UUC I;  2UU9 I;  2KON A;  1KKH A;  4GKK I;  2KHX A;  3J7Y p;  1ZBT A;  4L8N A;  1Z0E A;  2ODR C;  4DUZ I;  1XMO I;  2BV3 A;  4DR7 E;  4M30 A;  5LMU I;  3WU6 A;  4TUI A;  1IBK I;  2V86 A;  2V2V A;  2Z5C A;  2M1S A;  4J8Z A;  5IWA E;  2XEX A;  4JV5 I;  3K6Q A;  4BS9 A;  5LL6 R;  3B78 A;  3AV0 A;  1XNR I;  1FJG E;  4X64 I;  1N34 E;  1Y6Z A;  3VYX A;  2HHH I;  2DSY A;  4R1F A;  3QT7 A;  4DV7 E;  2JWO A;  4JI7 E;  2NUE A;  4FWH A;  2J7K A;  2B7T A;  2V2Z A;  4JYA I;  2HKJ A;  4LF9 I;  1S16 A;  4B3T E;  4JI0 I;  1O0W A;  1T4O A;  2RS6 A;  1K47 A;  2OI2 A;  4HY1 A;  1IBM E;  4UTG A;  3VK6 A;  2IHR 1;  2LE2 A;  4OOG C;  4URL A;  1J5E E;  5FLX C;  1H74 A;  1N33 I;  4DU8 A;  4JI3 E;  3IWC A;  4K0K E;  3P1X A;  4JI5 E;  2ZM6 I;  4M2Z A;  4NXM I;  2LJH A;  3GON A;  3HJC A;  1H73 A;  2VF1 A;  1XMQ I;  4X62 E;  2E5L E;  4DR5 I;  4FWD A;  4FWG A;  1FI4 A;  1Z59 A;  3HQ1 A;  4TUG A;  2EZ6 A;  4DR3 I;  4MYT A;  4DMI A;  4LFB I;  3K1J A;  3PYD A;  3LPS A;  2L6M A;  3J7A G;  3T1H I;  1H72 C;  2DIX A;  4DR4 E;  1XNQ I;  1RQ0 A;  3WU3 A;  3DF6 A;  3H09 A;  3PYE A;  1N0V C;  4P52 A;  2UUB E;  2LMZ A;  3V5R A;  2FGG A;  2V87 A;  2L2M A;  4NXN E;  1GQE A;  4F9B B;  2DEJ A;  2JOB A;  3C4B A;  4Z7Y A;  4X65 I;  5DNY A;  2NPF A;  2LJP A;  4LF4 I;  5F3W A;  2RS7 A;  3ZKD A;  2BM1 A;  3JU0 A;  1HNX I;  4Z7C A;  2Z5B A;  4DPU A;  1KTV A;  4DR6 E;  4LF5 E;  4B3R E;  3T1Y I;  3IWD A;  1FWK A;  4DUY I;  1X47 A;  1UIL A;  2A2D A;  2F8B A;  1I94 I;  3OTO I;  4BC7 A;  5AE3 A;  2PNL A;  4DV6 E;  2UUC E;  5FWK A;  5AAS A;  4DV3 E;  2IOQ A;  3J80 Q;  1MU5 A;  1Z0V A;  1X48 A;  4LF7 I;  4JI2 E;  1NZ0 A;  1XHK A;  4GKJ E;  1USV A;  5BR8 I;  5LMN I;  3H4L A;  4F54 A;  4JG4 A;  2MC6 A;  4LFA I;  4LTY A;  2LTR A;  2UXB I;  2UXD I;  4I8O A;  4USK A;  4DV6 I;  5IT9 Q;  1B62 A;  5FLX Q;  2DB2 A;  2N3G A;  1NHH A;  4LF6 E;  4DV1 I;  1YYK A;  2CPN A;  2O1W A;  3D4J A;  4FN5 A;  4FW9 A;  1RRE A;  1YYO A;  4YHH E;  2M4I A;  3OML A;  4YY3 I;  2UU9 E;  3HUL A;  1ZM4 A;  2JY9 A;  4GKK E;  2Z5B B;  2ZIT A;  2IOP A;  3HTX A;  1XMO E;  2AJ4 A;  2G7H A;  3HPS A;  3F6G A;  5LMU E;  2LRS A;  1WHN A;  1IBK E;  2V34 A;  1DAR A;  4JV5 E;  2H36 X;  4XTJ A;  1FJG I;  3ADG A;  4IZJ D;  4JI6 I;  1XNR E;  4X64 E;  1N32 E;  2UXC I;  4DV7 I;  2HHH E;  2BM0 A;  3JAM C;  3ADL A;  4HXZ A;  4JI7 I;  1EA6 A;  4USM A;  4GEQ B;  4JYA E;  3JTZ A;  4B3T I;  4HAC A;  4LF9 E;  2LTS A;  2HFU A;  4JI0 E;  4IZK B;  1SR9 A;  4WUB A;  4R03 A;  4R8O A;  1UHZ A;  2EWL A;  4JI8 I;  2B3T B;  1EKZ A;  4BMJ A;  2JR1 A;  4DV0 E;  4WYQ B;  2CGE A;  1Z0C A;  1UEK A;  3LTO A;  4X8W A;  1N33 E;  2L8T A;  1DQ3 A;  2VE7 C;  1OJ4 A;  2YZT A;  4NXM E;  2ZBK B;  4X62 I;  1BKN A;  2E5L I;  2Z5C B;  2O1T A;  1XMQ E;  4DR5 E;  1Z0T A;  1HNW I;  3J81 C;  2M7Q A;  3ZZT A;  4F9A B;  2PNM A;  1N36 I;  4DR3 E;  4LFB E;  4DKK A;  1NHJ A;  1T4L B;  4DXL A;  2NUF A;  2V85 A;  1MX0 A;  3T1H E;  1ZM2 A;  4P78 A;  4WUC A;  1U2R A;  3MSW A;  2UUB I;  2X36 A;  1X49 A;  2HFS A;  1QZR A;  2VQE I;  2L2K B;  4B3S E;  1ZBQ A;  3ZOQ B;  4NXN I;  3M6A A;  1D6T A;  3Q6M A;  5ADZ A;  4LFC I;  4B3M E;  2LUQ A;  1ELO A;  4X65 E;  4DR2 E;  1Z5A A;  4ED4 A;  2O1U A;  1WXR A;  2ODR D;  2L3J A;  1EI1 A;  1HNX E;  1WUU A;  4LF5 I;  4B3R I;  3T1Y E;  4OX9 I;  4DUY E;  4DV5 E;  4JI4 E;  4M0V A;  1Y4S A;  3ZZU A;  5AE2 A;  1VIS A;  2Q2E B;  1HK7 A;  2E1M A;  2V88 A;  4WSP A;  3LNU A;  3OTO E;  3FIG A;  4DPY A;  1ZXN A;  2DMY A;  4Q28 A;  4RPF A;  2V8P A;  4DV2 I;  4DR1 I;  1RC7 A;  2MDR A;  2F4V I;  3PYG A;  4KHP E;  1Z5B A;  1HR0 E;  2UUA I;  2LUP B;  2L3C A;  1FNM A;  4JI1 I;  4DPX A;  3B82 A;  4DV4 E;  1HNZ E;  4LF8 I;  5BR8 E;  2B7V A;  5LMN E;  4DPT A;  4X66 I;  1GZ6 A;  3Q6N A;  4MYU A;  1KVK A;  1IBL I;  2RSM A;  4LFA E;  3VYY A;  2VQF E;  3AUZ A;  2UXD E;  3DJW A;  5GME A;  4AQY I;  4BCA A;  1ZXM A;  1ZM3 A;  3QT6 A;  2X7I A;  2NUG A;  4DU7 A;  4DV1 E;  4IZJ A;  3K17 A;  4PRV A;  4HYM A;  4P7D A;  1H7U A;  1YYW A;  4DR7 I;  4DUZ E;  1S4E A;  3J81 Q;  4YY3 E;  2YT4 A;  4WFT A;  2B9D A;  5IWA I;  2WZO A;  2L92 A;  4DPW A;  2V8Q B;  2HK3 A;  1N34 I;  3J7A M;  3RMP A;  4N3O A;  2O1V A;  5A2Q C;  4PRX A;  1N32 I;  4JI6 E;  5AE1 A;  2UXC E;  2JOX A;  3J80 C;  1IBM I;  2HKE A;  1Y4U A;  3ADJ A;  2WW4 A;  3ZM7 A;  4LU9 A;  5CFF E;  1Z0W A;  1J5E I;  2R3V A;  4JI3 I;  4UT4 A;  4K0K I;  1RR9 A;  2JVA A;  4JI5 I;  3ADI A;  4EMD A;  2DEI A;  4I3H A;  2R42 A;  2CG9 A;  4JI8 E;  2ZM6 E;  1PVG A;  5IT9 C;  3F0N A;  4DV0 I;  1KIJ A;  1USU A;  4M1K A;  4IZJ B;  2E1R A;  4WPY A;  3P06 A;  3HXL A;  1FWL A;  2RTX A;  5T6J A;  1A6F A;  4BC9 A;  1HNW E;  5L3J A;  4DR4 I;  2V2Q A;  1ZM9 A;  1FKA E;  1XNQ E;  5GMD A;  2EFG A;  3K85 A;  2A2C A;  1QU6 A;  1N36 E;  1MG7 A;  1N0U A;  2CZ9 A;  1NHI A;  2HK2 A;  1YZ9 A;  4F9C B;  4HAC B;  3V2U C;  1PIE A;  3KWR A;  4B3S I;  2FV4 B;  2K4V A;  2VQE E;  4LF4 E;  3QT8 A;  3WU4 A;  1Z0B A;  3Q1Q A;  4BBY A;  2L33 A;  4DR6 I;  2FTX B;  4B3M I;  2L2N A;  2NA2 A;  4LFC E;  3PYF A;  1Z5C A;  4DR2 I;  1H7S A;  4ZVI A;  4WUD A;  1STU A;  1I94 E;  2GS8 A;  3B8H A;  2N3H A;  3PRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...