4DR1E

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr1E02
2UXDI 1XNQI 3B8HA 2EZ6A 1D6TA 1ZBTA 1YYOA 1PVGA 5LL6R 5IWAI 2EFGA 4DV6E 4X64I 1X47A 4LFBE 2V2QA 4WYQB 1KTVA 2X36A 4JV5E 4Z7CA 5IT9Q 5LMNE 1EA6A 1B63A 4R1FA 5A2QC 4DV6I 3HULA 3ADLA 1XNRI 3OTOE 2B7VA 1ZXMA 4LFBI 1XMQE 4JV5I 1Z5CA 5LMNI 2V2VA 1Z0GA 4OOGC 1H7SA 3OTOI 4HYMA 4HACB 4LFAE 3ZM7A 2MDRA 4RPFA 3V5RA 1FWLA 1XHKA 1RR9A 4DKKA 4LF7E 2KHXA 4WFTA 4B3RE 1HNWE 1A6FA 1U2RA 4LFAI 5A2QQ 4PRVA 2V2ZA 1WUUA 4UTGA 1MG7A 2GS8A 1X49A 2A2CA 4LF7I 1J5EE 1HNWI 1PKPA 3LPSA 2YT4A 2UUCE 1N34E 3ZZUA 4DPXA 2X7IA 1I94E 1NHHA 3CWVA 1NHJA 3WU4A 1UHZA 1J5EI 4LFCI 4JI1I 2DB2A 2NUEA 3K1JA 4GKKI 4DPUA 3WU3A 3LNUA 3J81C 4USMA 1KIJA 1HR0E 4WUCA 2BM1A 1N0VC 4DR4E 2B3TB 2N3HA 1T4OA 1N33E 4DPTA 2JVAA 3C4BA 1HR0I 1BKNA 4DV2E 3WU5A 1Z0TA 4DR4I 4LF4I 3T1YE 4JI3I 2LTRA 2DMYA 1DARA 1ZM4A 4JI4I 1N33I 3D4JA 4FW9A 1Z5AA 2CPNA 4DU7A 1B62A 2AJ4A 4AQYE 4DV2I 1XMOE 4DV5E 4DR3E 3J81Q 4HXZA 2UUAE 2V8PA 1YZ9A 1GQEA 1N0UA 1RREA 3F0NA 4PU9A 4X8WA 4AQYI 1XMOI 4DV5I 4DR6E 3J7AM 4NXME 3PYFA 2UUAI 4NXNE 1UEKA 4DPYA 1IBKE 1NHIA 4K0KE 4M30A 4DR6I 4B3ME 4NXMI 2JY9A 1FNMA 2LJHA 1Z0BA 5GMDA 4NXNI 1ZM2A 4ZVIA 1IBKI 1UILA 4JI6E 1Z0EA 1H73A 2RS7A 4X65E 4KQVA 4K0KI 1HNZE 3P1XA 2ZM6E 1XMQI 4P52A 4P7AA 4I3HA 4B3MI 2L3CA 2RS6A 2HHHE 4OX9E 3V2UC 4DUZE 4JYAE 1K47A 1QZRA 2E5LE 4X65I 4DR1E 1J26A 2LRSA 1HNZI 2ZM6I 3C4TA 3QT7A 2E1RA 4LF8E 2HHHI 4OX9I 5LMUE 2DEJA 4DUZI 2L3JA 4JYAI 5GMEA 1KKHA 2E5LI 4JI8E 4DR1I 4B3RI 1YYKA 4USKA 3PYDA 2CZ9A 2BV3A 5LMUI 4DV7E 1IBLE 4GKJE 2WW4A 1Z0WA 4WUBA 1VISA 4JI8I 1MX0A 1O0WA 4LF9E 4JI5E 2OI2A 4DV4E 2UUCI 1DI2A 1N34I 3ZZ0A 1H74A 2VF3A 1I94I 4DV7I 1IBLI 4GKJI 3T1HE 2VQEE 5L3JA 1WHQA 4DU8A 4JG4A 3JAMC 4LF9I 4JI7E 4JI5I 3Q1QA 4DV4I 4MYTA 2HK3A 4DPWA 2V34A 2Q2EB 4DV0E 3M6AA 2VQEI 4HY1A 3QT8A 3J7Yp 4DR5E 4JI7I 1HNXE 3ZKDA 4DV0I 1MU5A 4X62E 4DV3E 1S4EA 2HKJA 4YHHE 1ELOA 4Z7YA 2UU9E 2L33A 4LF5E 3VYXA 2R42A 1FJGE 3ADIA 1HNXI 3T1YI 1Z0VA 2LJPA 1Z5BA 4X62I 5IWAE 3JAMQ 4DUYE 3VYYA 3B82A 4LF5I 4PRXA 1FJGI 3LLHA 4DR3I 2J7KA 1NZ0A 1Z0CA 1YYWA 3ZZTA 2R3VA 4DUYI 5BR8E 4LF6E 1ZM3A 4URLA 1XNRE 4ED4A 4JI0E 1EI1A 2A2DA 1WHNA 1X48A 1EKZA 4FWGA 2UXBE 5BR8I 4LF6I 5FLXC 2UXCE 1PIEA 3GONA 1KVKA 4JI0I 1ZM9A 3J80C 2L2MA 4DXLA 1N36E 4KHPE 2HK2A 4JI2E 2XEXA 2NPFA 4JI6I 4HACA 1FKAE 3QT6A 2UXBI 1Z59A 2UXCI 3QT5A 1RQ0A 3H4LA 2LUPB 1N36I 4KHPI 2HFSA 4JI2I 1FWKA 4DR2E 3ZKBA 4X66E 2VQFE 1N32E 4LF8I 1OJ4A 4B3TE 5FLXQ 4FWDA 2NUGA 4MYUA 4DR2I 3WU6A 1STUA 3J80Q 1RC7A 4EMDA 4X66I 2RTXA 2VQFI 1IBME 2L2KB 3ADJA 4DR7E 1N32I 4LFCE 4FWHA 4XTJA 4JI1E 1S16A 4DV1E 4B3TI 2ZITA 3LTOA 4GKKE 1QU6A 2HFUA 2DEIA 1IBMI 2IHR1 2HKEA 2LUQA 2LTSA 1ZXNA 4M1KA 4DR7I 4B3SE 2F4VE 3ADGA 2NA2A 2NUFA 2UUBE 2B7TA 2RSMA 1H72C 4DV1I 3T1HI 4YY3E 4UT4A 3J7AG 4M2ZA 1H7UA 2DIXA 4WUDA 4B3SI 2F4VI 2UUBI 2L2NA 4LF4E 4JI3E 4JI4E 4YY3I 2BM0A 5IT9C 3PYEA 1T4LB 4DR5I 2UXDE 1XNQE 3K17A 3B78A 1T4NA 4FN5A 4DV3I 2N3GA 2ZBKB 3PYGA 4YHHI 3HTXA 1FI4A 2LBSB 2UU9I 4X64E 5CFFE
chains in the Genus database with same CATH superfamily
2UXDI 1XNQI 2GO3A 2VESA 4IS1C 3B8HA 4R2QA 3PS2A 2EZ6A 1D6TA 1ZBTA 1F2IG 5T6JA 1YYOA 1PVGA 5LL6R 5IWAI 2EP3A 3BF2A 3IWDA 5AE2A 3DF6A 1A1KA 2EFGA 4DV6E 4X64I 4QNKA 2EOJA 2M9AA 2J65A 4AIMA 1USUA 5A6JA 3VHTB 1X47A 2YWQA 1A1IA 2JOBA 2YTJA 3GCMA 1R6MA 4LFBE 1NEIA 2V2QA 2DMIA 4WYQB 1KTVA 5K36D 1EH6A 4L8NA 2X36A 4JV5E 4Z7CA 4WPYA 5IT9Q 2CT1A 2JEBB 5LMNE 1EA6A 1B63A 5A2QC 2V83A 1PJTA 3P3CA 4R1FA 1T38A 2ODRD 2PNZA 4DV6I 3HULA 2EPNA 3ADLA 4BA2B 3GLLA 1XNRI 3OTOE 2BA1D 2B7VA 1ZXMA 1YPNA 2YTGA 1RMDA 2ADRA 2Z5CB 4IJDA 5DRPA 1N3GA 4LFBI 5A6BD 4R2CA 1XMQE 4F9BB 4JV5I 1Z5CA 3P3GA 5LMNI 2V2VA 1Z0GA 4OOGC 4LOMA 1H7SA 1P42A 1EH7A 4X64E 3OTOI 2EMHA 5AC4A 1E3PA 1EH8A 1A1HA 1L4SA 4HYMA 4MDTA 2KOUA 4HACB 1X6EA 4LFAE 4MU4A 2AE8A 3HPZA 2MDRA 4RPFA 3ZM7A 3V5RA 3C6KA 1X5WA 2DSYA 5K36A 2EPCA 3HXLA 1WRJA 3UK3C 1FWLA 2EMLA 1RR9A 1XHKA 2EE8A 4DKKA 2EOXA 1MEYC 2KHXA 4LF7E 4IS9A 1B69A 4WFTA 4B3RE 1HNWE 1A6FA 1U2RA 4LPFA 4LFAI 5A2QQ 4PRVA 2ELYA 2V2ZA 2CGEA 1WUUA 4WSPA 4UTGA 2EM9A 1MG7A 2EN7A 4IFDD 2LCEA 2GS8A 1X49A 2A2CA 2BR2B 3MHHC 2EM4A 2HJJA 3C6MA 3KZYA 5A69A 1A1LA 3HJCA 4LF7I 1J5EE 1HNWI 2EMIA 3TQMA 1PKPA 3LPSA 4FW7A 1USVA 4LCFA 2EPOA 5LLQA 2WP8B 2YT4A 1T39A 2UUCE 1N34E 4WXCA 3ZZUA 2NN6D 2EM7A 4DPXA 2X7IA 2YRKA 1I94E 1NHHA 1UDQA 3CWVA 1NHJA 5AE1A 4O43A 3AV0A 1Z1BA 3DD6A 3WU4A 5F3WA 1UHZA 2EOFA 2YZTA 1J5EI 4OKGA 4LFCI 4IFDE 4JI1I 2DB2A 2V89A 4R2DA 4ISAA 2NUEA 5KL4A 3K1JA 4GKKI 4DPUA 3WU3A 2JT2A 2BA0D 3VK6A 3K85A 2R1FA 2EM2A 4LTYA 3LNUA 4BBYA 3J81C 5JEAD 2O1WA 4USMA 4AM3A 1X3CA 2LV2A 2PNMA 4F9AB 4IFDA 1MGTA 2NN6E 3THNA 1KIJA 1HR0E 2EL5A 3P3EA 2BM1A 4WUCA 4NZVA 5IXMB 1N0VC 4DR4E 2EM5A 4FW5A 2LVHA 2B3TB 2N3HA 1GTKA 1T4OA 4R2AA 1JK2A 2PO0A 1N33E 4Q35B 1Y60A 3B4TA 2EPRA 4DPTA 4N3OA 2EORA 2JVAA 3Q6MA 2G7HA 2EM0A 3C4BA 3IWBA 1GZ6A 2NN6A 3THOB 3HKMA 3H1CA 1IQOA 1HR0I 1BKNA 4M9VC 2EN2A 4DV2E 3WU5A 4BS9A 1Z0TA 2FV4B 1Y5YA 4LF4I 3T1YE 4JI3I 4DR4I 2LTRA 1YHCA 2YSPA 2DMYA 4X9JA 1DARA 1ZM4A 4JI4I 1N33I 2GQ0A 2R76A 2V85A 2WBUA 1AH5A 3D4JA 4BA1B 4FW9A 2EMWA 1Z5AA 2C37A 4MLQA 2CPNA 1G2FC 4R2SA 2F1DA 2Z5BB 4DU7A 1AAYA 1B62A 2WBSA 2EMZA 2AJ4A 4AQYE 5JEAA 4DV2I 1XMOE 4DV5E 4DR3E 2EWLA 3J81Q 4HXZA 1IQSA 4FK5C 2V87A 2UUAE 2ENAA 2C38A 2EOMA 2V8PA 1YZ9A 2EPAA 1GQEA 3U1YA 1N0UA 3EPHA 1JK1A 1RHYA 1RREA 2EOIA 2EPUA 3F0NA 4PU9A 3K6QA 4X8WA 4AQYI 2L6MA 1XMOI 2VF1A 4MLVA 4DV5I 4P78A 4DR6E 4ZYDA 2EOHA 5EL9A 2F8BA 4NXME 4U3DA 3PYFA 3J7AM 2NN6C 1WXRA 2DGCA 2EOOA 2UUAI 4NXNE 1UEKA 4DPYA 4BC9A 3BBGA 2Q8UA 3M85G 2B9DA 2EL6A 1DGCA 4O4KA 3QG5C 1IBKE 2EL4A 1NHIA 4K0KE 5DROA 2PNZB 4M30A 2WNRA 5A6AA 4DR6I 4B3ME 1IMUA 1A1FA 4NXMI 2EMAA 2JY9A 1FNMA 2LJHA 1Z0BA 2A25A 3P76A 5GMDA 1ZM2A 4NXNI 4Q28A 2GHFA 5K36E 5K36F 2JYAA 2BA1G 4ZVIA 1X6FA 1IBKI 1UILA 2BBGA 4JI6E 1H73A 1UDOA 2RS7A 3ECRA 1YH8A 2JPAA 4X65E 1Y6ZA 2IESA 3P06A 2WNRB 2EN6A 4KZSA 1HNZE 3P1XA 2PRTA 2ZM6E 4KQVA 4K0KI 1XMQI 3M99B 4P52A 4P7AA 4I3HA 4B3MI 2L3CA 4OZEA 2RS6A 2HHHE 4OX9E 3EQ1A 3V2UC 4TUGA 2I13A 2PO1A 4DUZE 5C0XD 4JYAE 1K47A 3NZKA 1QZRA 4J8ZA 2E5LE 4X65I 2V88A 4DR1E 2RPCA 1J26A 2LRSA 1UDSA 4MU0A 2ZM6I 1HNZI 3C4TA 3QT7A 2YU8A 5K36B 2CTDA 2YTOA 4LU9A 2EOQA 2E1RA 5A6BA 4LF8E 2HHHI 3JTZA 5LMUE 4TUIA 2IOQA 4OX9I 2DEJA 2EM8A 2EOYA 2EQ1A 4DUZI 2L3JA 2WZOA 3M85D 4JYAI 3F6HA 3L7ZA 1KKHA 5GMEA 2E5LI 4JI8E 4R03A 4DR1I 4B3RI 4OO1D 2YTQA 1YYKA 4USKA 3PYDA 2CZ9A 4P7DA 2BV3A 2FGGA 4WXDA 2EQ3A 2K4VA 5LMUI 2EOEA 2N8XA 5AE3A 2CG9A 2K7IA 3DJWA 3IWCA 4DV7E 3MSWA 1IBLE 4GKJE 2WW4A 3H09A 4NHRA 1Z0WA 4WUBA 1VISA 4JI8I 3M7ND 4IFDF 3KRNA 1MX0A 4WX9A 1O0WA 1YUIA 4LF9E 5K36C 4JI5E 5C0XA 2OI2A 4DV4E 4WSGA 2UUCI 1SFEA 1DI2A 1N34I 3ZZ0A 1H74A 2ODRC 1ZAAC 1PJSA 2VF3A 1UN6B 4IZJD 1I94I 4OO1E 4M0VA 4DV7I 5KL3A 1IBLI 4GKJI 3T1HE 2VQEE 5L3JA 1WHQA 2NN6F 2E72A 4R8OA 4BC7A 4DU8A 3JAMC 4JG4A 4LF9I 4JI7E 4JI5I 2JEAA 1OYRA 5DNYA 2JE6A 3Q1QA 2EOZA 5DNLA 2MKDA 2HK3A 4MYTA 4DPWA 4DV4I 2V34A 4OO1A 2D9HA 2Q2EB 4IFDB 1YFHA 2V86A 4DV0E 2BA0G 2O1TA 5KL6A 1ZBQA 3M6AA 2VQEI 2I9IA 2MKNA 2O1VA 4F9CB 4DMIA 1PJQA 4HY1A 5A6KA 3QT8A 2PO0B 3J7Yp 4DR5E 4U3BA 4JI7I 1HNXE 5JEAF 5JEAE 4BMJA 3ZOQB 3MHSC 4GEQB 2NN6B 4J3DA 3ZKDA 2RSIA 1MU5A 4DV0I 4X62E 4IZKA 2YTEA 2EQ0A 4DV3E 5KL5A 1S4EA 2YTFA 4YHHE 1ELOA 2HKJA 4Z7YA 2GPIA 1R6LA 2UU9E 2L33A 4LF5E 3VYXA 3ADIA 1FJGE 1KJKA 2CVEA 2R42A 1HNXI 2EN3A 2YU5A 2EMKA 3T1YI 4RHBB 1PDAA 2EMFA 1Z0VA 1HK7A 2C37B 2LJPA 4IFDC 3CDJA 1Z5BA 4X62I 2M4IA 5JEAB 5IWAE 2EPLX 5TSEA 3JAMQ 4DUYE 3F6GA 3VYYA 3B82A 2LO3A 2EMBA 4LF5I 4PRXA 1FJGI 1BB8A 2C38B 1YSAC 2HGHA 2O1UA 1ZU1A 3LLHA 3EPLA 4R2EA 4FW4A 4DR3I 1ZR9A 1TN9A 2H36X 2J7KA 4GZNC 2RQLA 1NZ0A 1YYWA 1Z0CA 3ZZTA 2JWOA 2R3VA 3CDIA 4GQUA 2FTXB 2YTNA 1OYSA 4DUYI 4O24A 3HQ1A 2YRMA 5BR8E 4LF6E 1ZM3A 4URLA 1XNRE 4ED4A 2JEBA 4MU1A 4F6NA 4JI0E 4AIDA 4MU3A 2WBTA 5IV8B 2EPKX 2JR1A 3JU0A 2IOPA 2DLQA 4I8OA 4BA2A 4KWYA 1A1GA 1EI1A 2YSOA 2A2DA 1E3HA 5JEAC 5KL2A 1WHNA 1X48A 1EKZA 2Z5CA 4FWGA 5FWKA 2YTDA 2UXBE 5BR8I 1WJPA 5FLXC 4LF6I 2UXCE 1PIEA 2M7QA 5AC5A 2DLKA 3GONA 1KVKA 4JI0I 1ZM9A 3J80C 2L2MA 1LLMC 2YPNA 3BIDA 1TF3A 2EPMX 1P47A 4DXLA 1N36E 4KHPE 3U1KA 2YTPA 2HK2A 4JI2E 2EJ4A 2XEXA 2NPFA 4JI6I 4HACA 1FKAE 3QT6A 5DRRA 2EMGA 2UXBI 1Z59A 2UXCI 3QT5A 2LJUA 1DQ3A 1KYQA 2PO1B 1Y4SA 1TF6A 1G2DC 1RQ0A 3H4LA 5EKWA 2LUPB 1N36I 4KHPI 2HC5A 4BHCA 2HFSA 4JI2I 1FWKA 2C39A 2EN8A 4LCHA 4DR2E 4R2PA 1NCSA 2EPPA 2PNLA 3ZKBA 4X66E 2VQFE 2O3ZA 2EMCA 1BBGA 5C0XF 5C0XE 2VRDA 1SR9A 2CSHA 2YRHA 2EN4A 2C39B 1N32E 3L7ZB 3PS1A 4LF8I 2E1MA 2BR2A 2IERA 2LT7A 1OJ4A 1UBDC 4B3TE 5FLXQ 4FWDA 1Y4UA 2NUGA 4MYUA 4F54A 2L8TA 2EM6A 4BCAA 1A1JA 2DRPA 4FW6A 3WU6A 4DR2I 1STUA 3HPSA 3J80Q 1RC7A 4R2RA 2WP8A 3RMPA 2EMYA 4EMDA 4X66I 2RTXA 2LMZA 3UHMA 2VQFI 1IBME 2L2KB 2VE7C 3ADJA 2PO2A 2EN1A 4HEIA 4DR7E 1OYPA 1N32I 4LFCE 4FWHA 4XTJA 4JI1E 4OO1F 2L92A 1S16A 4DV1E 3PS3A 4B3TI 2YTIA 1YUJA 2ZITA 5DNXA 5C0XB 3LTOA 2JOXA 4GKKE 1XXEA 2PO2B 2Z5EA 3M7NG 1QU6A 3PRYA 2HFUA 4FW3A 2DEIA 2MC6A 2EPXA 1IBMI 2IHR1 2HKEA 2LUQA 4MQYA 4L5NC 2EMXA 2LTSA 2JP9A 1ZXNA 4M1KA 4DR7I 3KZZA 2EOSA 2J7JA 5ADZA 4B3SE 4BHBA 2F4VE 3ADGA 2NA2A 2ENHA 2NUFA 2B7TA 2RSMA 2UUBE 1H72C 2GO4A 4DV1I 2JEAB 2EPZA 2JE6B 3T1HI 3KWRA 4YY3E 4UT4A 4OO1B 4N4RB 1BBOA 3J7AG 4RH8A 4M2ZA 4QNJA 1H7UA 3EPJA 1Z0EA 3Q6NA 4LCGA 1QNTA 2DIXA 3BGHA 2ENCA 5AASA 4WUDA 4B3SI 2F4VI 4NBQA 2NABA 2BB8A 4ZYEA 2UUBI 2L2NA 4LF4E 4JI3E 5C0XC 1X6HA 4ZYGA 4JI4E 3FIGA 4IZJA 4YY3I 4HTGA 2BM0A 5IT9C 1T4LB 3PYEA 4DR5I 2UXDE 1XNQE 5DRQA 2MDGA 1VI7A 2ELZA 4F6MA 4F2JC 3B78A 3K17A 4IZKB 2JXPA 4BA1A 4ZYHA 5ELWA 2LE2A 2GLIA 3LMLA 4IZJB 4O5GA 2KONA 1T4NA 2V8QB 3AUZA 2Z5BA 4FN5A 1UDNA 3L00A 4DV3I 2N3GA 3EPKA 2ZBKB 3PYGA 3HTXA 1FI4A 5KL7A 2WCC3 2LBSB 4YHHI 4OO1C 2UU9I 2M1SA 2MC5A 3OMLA 2EM3A 5CFFE 3GMEA
chains in the Genus database with same CATH topology
2UXDI 1XNQI 3B8HA 2EZ6A 1D6TA 1ZBTA 5T6JA 1YYOA 1PVGA 5LL6R 5IWAI 3IWDA 5AE2A 3DF6A 2EFGA 4DV6E 4X64I 1USUA 1X47A 2JOBA 4LFBE 2V2QA 4WYQB 1KTVA 4L8NA 2X36A 4JV5E 4Z7CA 4WPYA 5IT9Q 5LMNE 1EA6A 1B63A 5A2QC 2V83A 4R1FA 2ODRD 4DV6I 3HULA 3ADLA 1XNRI 3OTOE 2B7VA 1ZXMA 2Z5CB 4LFBI 1XMQE 4F9BB 4JV5I 1Z5CA 5LMNI 2V2VA 1Z0GA 4OOGC 1H7SA 3OTOI 4HYMA 2KOUA 4HACB 4LFAE 3HPZA 2MDRA 4RPFA 3ZM7A 3V5RA 2DSYA 3HXLA 1FWLA 1XHKA 1RR9A 4DKKA 4LF7E 2KHXA 4WFTA 4B3RE 1HNWE 1A6FA 1U2RA 4LFAI 5A2QQ 4PRVA 2V2ZA 2CGEA 1WUUA 4WSPA 4UTGA 1MG7A 2GS8A 1X49A 2A2CA 3HJCA 4LF7I 1J5EE 1HNWI 1PKPA 3LPSA 1USVA 2YT4A 2UUCE 1N34E 3ZZUA 4DPXA 2X7IA 1I94E 1NHHA 3CWVA 1NHJA 5AE1A 3AV0A 3WU4A 5F3WA 1UHZA 2YZTA 1J5EI 4LFCI 4JI1I 2DB2A 2V89A 2NUEA 3K1JA 4GKKI 4DPUA 3WU3A 3K85A 3VK6A 4LTYA 3LNUA 4BBYA 3J81C 2O1WA 4USMA 2PNMA 4F9AB 1KIJA 1HR0E 4WUCA 2BM1A 1N0VC 4DR4E 2B3TB 2N3HA 1T4OA 1N33E 4DPTA 4N3OA 2JVAA 3Q6MA 2G7HA 3IWBA 3C4BA 1GZ6A 1HR0I 1BKNA 4DV2E 3WU5A 4BS9A 1Z0TA 2FV4B 4DR4I 4LF4I 3T1YE 4JI3I 2LTRA 2DMYA 1DARA 1ZM4A 4JI4I 1N33I 2GQ0A 2V85A 3D4JA 4FW9A 1Z5AA 2CPNA 4DU7A 2Z5BB 1B62A 2AJ4A 4AQYE 4DV2I 1XMOE 4DV5E 4DR3E 2EWLA 3J81Q 4HXZA 2V87A 2UUAE 2V8PA 1YZ9A 1GQEA 1N0UA 1RREA 3F0NA 4PU9A 3K6QA 4X8WA 4AQYI 2L6MA 1XMOI 2VF1A 4DV5I 4P78A 4DR6E 3J7AM 2F8BA 4NXME 3PYFA 1WXRA 2UUAI 4NXNE 1UEKA 4DPYA 4BC9A 2B9DA 1IBKE 1NHIA 4K0KE 4M30A 4DR6I 4B3ME 4NXMI 2JY9A 1FNMA 2LJHA 1Z0BA 5GMDA 4NXNI 1ZM2A 4Q28A 4ZVIA 1IBKI 1UILA 4JI6E 1Z0EA 1H73A 2RS7A 4X65E 1Y6ZA 3P06A 4KZSA 4KQVA 1HNZE 3P1XA 4K0KI 2ZM6E 1XMQI 4P52A 4P7AA 4I3HA 4B3MI 2L3CA 2RS6A 2HHHE 4OX9E 3V2UC 4TUGA 4DUZE 4JYAE 1K47A 1QZRA 4J8ZA 2E5LE 4X65I 2V88A 4DR1E 1J26A 2LRSA 1HNZI 2ZM6I 3C4TA 3QT7A 4LU9A 2E1RA 2MC5A 4LF8E 2HHHI 3JTZA 5LMUE 4TUIA 2IOQA 4OX9I 2DEJA 4DUZI 2L3JA 2WZOA 4JYAI 3F6HA 5GMEA 1KKHA 2E5LI 4JI8E 4R03A 4DR1I 4B3RI 1YYKA 4USKA 3PYDA 2CZ9A 4P7DA 2BV3A 2FGGA 2K4VA 5LMUI 5AE3A 2CG9A 3DJWA 3IWCA 4DV7E 3MSWA 1IBLE 4GKJE 2WW4A 3H09A 1Z0WA 4WUBA 1VISA 4JI8I 1MX0A 1O0WA 4LF9E 4JI5E 2OI2A 4DV4E 2UUCI 1DI2A 1N34I 3ZZ0A 1H74A 2ODRC 2VF3A 1I94I 4IZJD 4M0VA 4DV7I 1IBLI 4GKJI 3T1HE 2VQEE 5L3JA 1WHQA 4R8OA 4BC7A 4DU8A 3JAMC 4JG4A 4LF9I 4JI7E 4JI5I 5DNYA 3Q1QA 4DV4I 4MYTA 2HK3A 4DPWA 2V34A 2Q2EB 2V86A 4DV0E 2O1TA 1ZBQA 3M6AA 2VQEI 2O1VA 4HY1A 4F9CB 4DMIA 3QT8A 3J7Yp 4DR5E 4JI7I 1HNXE 4BMJA 3ZOQB 4GEQB 3ZKDA 4DV0I 1MU5A 4X62E 4IZKA 4DV3E 1S4EA 2HKJA 4YHHE 1ELOA 4Z7YA 2UU9E 2L33A 4LF5E 3VYXA 3ADIA 1FJGE 2R42A 1HNXI 3T1YI 1Z0VA 1HK7A 2LJPA 1Z5BA 4X62I 2M4IA 5IWAE 3JAMQ 4DUYE 3F6GA 3VYYA 3B82A 4LF5I 4PRXA 1FJGI 2O1UA 3LLHA 4DR3I 2H36X 2J7KA 1NZ0A 1Z0CA 1YYWA 3ZZTA 2JWOA 2R3VA 2FTXB 4DUYI 3HQ1A 5BR8E 4LF6E 1ZM3A 4URLA 1XNRE 4ED4A 4JI0E 2IOPA 2JR1A 3JU0A 4I8OA 1EI1A 2A2DA 1WHNA 1X48A 1EKZA 2Z5CA 4FWGA 5FWKA 2UXBE 5BR8I 4LF6I 5FLXC 2UXCE 1PIEA 2M7QA 3GONA 1KVKA 4JI0I 1ZM9A 3J80C 2L2MA 4DXLA 1N36E 4KHPE 2HK2A 4JI2E 2XEXA 2NPFA 4JI6I 4HACA 1FKAE 3QT6A 2UXBI 1Z59A 2UXCI 3QT5A 1DQ3A 1Y4SA 1RQ0A 3H4LA 2LUPB 1N36I 4KHPI 2HFSA 4JI2I 1FWKA 4DR2E 2PNLA 3ZKBA 4X66E 2VQFE 1SR9A 1N32E 4LF8I 2E1MA 1OJ4A 4B3TE 5FLXQ 4FWDA 1Y4UA 2NUGA 4MYUA 4F54A 2L8TA 4BCAA 4DR2I 3WU6A 1STUA 3HPSA 3J80Q 1RC7A 4EMDA 3RMPA 4X66I 2RTXA 2LMZA 2VQFI 1IBME 2L2KB 2VE7C 3ADJA 4DR7E 1N32I 4LFCE 4FWHA 4XTJA 4JI1E 2L92A 1S16A 4DV1E 4B3TI 2ZITA 3LTOA 2JOXA 4GKKE 2Z5EA 1QU6A 3PRYA 2HFUA 2DEIA 2MC6A 1IBMI 2IHR1 2HKEA 2LUQA 4L5NC 2LTSA 1ZXNA 4M1KA 4DR7I 5ADZA 4B3SE 2F4VE 3ADGA 2NA2A 2NUFA 2UUBE 2B7TA 2RSMA 1H72C 4DV1I 3T1HI 3KWRA 4YY3E 4UT4A 3J7AG 4M2ZA 1H7UA 3Q6NA 2DIXA 5AASA 4WUDA 4B3SI 2F4VI 2UUBI 2L2NA 4LF4E 4JI3E 4JI4E 3FIGA 4IZJA 4YY3I 2BM0A 5IT9C 1T4LB 3PYEA 4DR5I 2UXDE 1XNQE 3K17A 3B78A 4IZKB 2LE2A 3LMLA 4IZJB 2KONA 1T4NA 2V8QB 3AUZA 2Z5BA 4FN5A 4DV3I 2N3GA 2ZBKB 3PYGA 4YHHI 3HTXA 1FI4A 2LBSB 2UU9I 2M1SA 4X64E 3OMLA 5CFFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD I;  1XNQ I;  3B8H A;  2EZ6 A;  1D6T A;  1ZBT A;  1YYO A;  1PVG A;  5LL6 R;  5IWA I;  2EFG A;  4DV6 E;  4X64 I;  1X47 A;  4LFB E;  2V2Q A;  4WYQ B;  1KTV A;  2X36 A;  4JV5 E;  4Z7C A;  5IT9 Q;  5LMN E;  1EA6 A;  1B63 A;  4R1F A;  5A2Q C;  4DV6 I;  3HUL A;  3ADL A;  1XNR I;  3OTO E;  2B7V A;  1ZXM A;  4LFB I;  1XMQ E;  4JV5 I;  1Z5C A;  5LMN I;  2V2V A;  1Z0G A;  4OOG C;  1H7S A;  3OTO I;  4HYM A;  4HAC B;  4LFA E;  3ZM7 A;  2MDR A;  4RPF A;  3V5R A;  1FWL A;  1XHK A;  1RR9 A;  4DKK A;  4LF7 E;  2KHX A;  4WFT A;  4B3R E;  1HNW E;  1A6F A;  1U2R A;  4LFA I;  5A2Q Q;  4PRV A;  2V2Z A;  1WUU A;  4UTG A;  1MG7 A;  2GS8 A;  1X49 A;  2A2C A;  4LF7 I;  1J5E E;  1HNW I;  1PKP A;  3LPS A;  2YT4 A;  2UUC E;  1N34 E;  3ZZU A;  4DPX A;  2X7I A;  1I94 E;  1NHH A;  3CWV A;  1NHJ A;  3WU4 A;  1UHZ A;  1J5E I;  4LFC I;  4JI1 I;  2DB2 A;  2NUE A;  3K1J A;  4GKK I;  4DPU A;  3WU3 A;  3LNU A;  3J81 C;  4USM A;  1KIJ A;  1HR0 E;  4WUC A;  2BM1 A;  1N0V C;  4DR4 E;  2B3T B;  2N3H A;  1T4O A;  1N33 E;  4DPT A;  2JVA A;  3C4B A;  1HR0 I;  1BKN A;  4DV2 E;  3WU5 A;  1Z0T A;  4DR4 I;  4LF4 I;  3T1Y E;  4JI3 I;  2LTR A;  2DMY A;  1DAR A;  1ZM4 A;  4JI4 I;  1N33 I;  3D4J A;  4FW9 A;  1Z5A A;  2CPN A;  4DU7 A;  1B62 A;  2AJ4 A;  4AQY E;  4DV2 I;  1XMO E;  4DV5 E;  4DR3 E;  3J81 Q;  4HXZ A;  2UUA E;  2V8P A;  1YZ9 A;  1GQE A;  1N0U A;  1RRE A;  3F0N A;  4PU9 A;  4X8W A;  4AQY I;  1XMO I;  4DV5 I;  4DR6 E;  3J7A M;  4NXM E;  3PYF A;  2UUA I;  4NXN E;  1UEK A;  4DPY A;  1IBK E;  1NHI A;  4K0K E;  4M30 A;  4DR6 I;  4B3M E;  4NXM I;  2JY9 A;  1FNM A;  2LJH A;  1Z0B A;  5GMD A;  4NXN I;  1ZM2 A;  4ZVI A;  1IBK I;  1UIL A;  4JI6 E;  1Z0E A;  1H73 A;  2RS7 A;  4X65 E;  4KQV A;  4K0K I;  1HNZ E;  3P1X A;  2ZM6 E;  1XMQ I;  4P52 A;  4P7A A;  4I3H A;  4B3M I;  2L3C A;  2RS6 A;  2HHH E;  4OX9 E;  3V2U C;  4DUZ E;  4JYA E;  1K47 A;  1QZR A;  2E5L E;  4X65 I;  4DR1 E;  1J26 A;  2LRS A;  1HNZ I;  2ZM6 I;  3C4T A;  3QT7 A;  2E1R A;  4LF8 E;  2HHH I;  4OX9 I;  5LMU E;  2DEJ A;  4DUZ I;  2L3J A;  4JYA I;  5GME A;  1KKH A;  2E5L I;  4JI8 E;  4DR1 I;  4B3R I;  1YYK A;  4USK A;  3PYD A;  2CZ9 A;  2BV3 A;  5LMU I;  4DV7 E;  1IBL E;  4GKJ E;  2WW4 A;  1Z0W A;  4WUB A;  1VIS A;  4JI8 I;  1MX0 A;  1O0W A;  4LF9 E;  4JI5 E;  2OI2 A;  4DV4 E;  2UUC I;  1DI2 A;  1N34 I;  3ZZ0 A;  1H74 A;  2VF3 A;  1I94 I;  4DV7 I;  1IBL I;  4GKJ I;  3T1H E;  2VQE E;  5L3J A;  1WHQ A;  4DU8 A;  4JG4 A;  3JAM C;  4LF9 I;  4JI7 E;  4JI5 I;  3Q1Q A;  4DV4 I;  4MYT A;  2HK3 A;  4DPW A;  2V34 A;  2Q2E B;  4DV0 E;  3M6A A;  2VQE I;  4HY1 A;  3QT8 A;  3J7Y p;  4DR5 E;  4JI7 I;  1HNX E;  3ZKD A;  4DV0 I;  1MU5 A;  4X62 E;  4DV3 E;  1S4E A;  2HKJ A;  4YHH E;  1ELO A;  4Z7Y A;  2UU9 E;  2L33 A;  4LF5 E;  3VYX A;  2R42 A;  1FJG E;  3ADI A;  1HNX I;  3T1Y I;  1Z0V A;  2LJP A;  1Z5B A;  4X62 I;  5IWA E;  3JAM Q;  4DUY E;  3VYY A;  3B82 A;  4LF5 I;  4PRX A;  1FJG I;  3LLH A;  4DR3 I;  2J7K A;  1NZ0 A;  1Z0C A;  1YYW A;  3ZZT A;  2R3V A;  4DUY I;  5BR8 E;  4LF6 E;  1ZM3 A;  4URL A;  1XNR E;  4ED4 A;  4JI0 E;  1EI1 A;  2A2D A;  1WHN A;  1X48 A;  1EKZ A;  4FWG A;  2UXB E;  5BR8 I;  4LF6 I;  5FLX C;  2UXC E;  1PIE A;  3GON A;  1KVK A;  4JI0 I;  1ZM9 A;  3J80 C;  2L2M A;  4DXL A;  1N36 E;  4KHP E;  2HK2 A;  4JI2 E;  2XEX A;  2NPF A;  4JI6 I;  4HAC A;  1FKA E;  3QT6 A;  2UXB I;  1Z59 A;  2UXC I;  3QT5 A;  1RQ0 A;  3H4L A;  2LUP B;  1N36 I;  4KHP I;  2HFS A;  4JI2 I;  1FWK A;  4DR2 E;  3ZKB A;  4X66 E;  2VQF E;  1N32 E;  4LF8 I;  1OJ4 A;  4B3T E;  5FLX Q;  4FWD A;  2NUG A;  4MYU A;  4DR2 I;  3WU6 A;  1STU A;  3J80 Q;  1RC7 A;  4EMD A;  4X66 I;  2RTX A;  2VQF I;  1IBM E;  2L2K B;  3ADJ A;  4DR7 E;  1N32 I;  4LFC E;  4FWH A;  4XTJ A;  4JI1 E;  1S16 A;  4DV1 E;  4B3T I;  2ZIT A;  3LTO A;  4GKK E;  1QU6 A;  2HFU A;  2DEI A;  1IBM I;  2IHR 1;  2HKE A;  2LUQ A;  2LTS A;  1ZXN A;  4M1K A;  4DR7 I;  4B3S E;  2F4V E;  3ADG A;  2NA2 A;  2NUF A;  2UUB E;  2B7T A;  2RSM A;  1H72 C;  4DV1 I;  3T1H I;  4YY3 E;  4UT4 A;  3J7A G;  4M2Z A;  1H7U A;  2DIX A;  4WUD A;  4B3S I;  2F4V I;  2UUB I;  2L2N A;  4LF4 E;  4JI3 E;  4JI4 E;  4YY3 I;  2BM0 A;  5IT9 C;  3PYE A;  1T4L B;  4DR5 I;  2UXD E;  1XNQ E;  3K17 A;  3B78 A;  1T4N A;  4FN5 A;  4DV3 I;  2N3G A;  2ZBK B;  3PYG A;  4YHH I;  3HTX A;  1FI4 A;  2LBS B;  2UU9 I;  4X64 E;  5CFF E; 
#chains in the Genus database with same CATH topology
 2UXD I;  1XNQ I;  2GO3 A;  2VES A;  4IS1 C;  3B8H A;  4R2Q A;  3PS2 A;  2EZ6 A;  1D6T A;  1ZBT A;  1F2I G;  5T6J A;  1YYO A;  1PVG A;  5LL6 R;  5IWA I;  2EP3 A;  3BF2 A;  3IWD A;  5AE2 A;  3DF6 A;  1A1K A;  2EFG A;  4DV6 E;  4X64 I;  4QNK A;  2EOJ A;  2M9A A;  2J65 A;  4AIM A;  1USU A;  5A6J A;  3VHT B;  1X47 A;  2YWQ A;  1A1I A;  2JOB A;  2YTJ A;  3GCM A;  1R6M A;  4LFB E;  1NEI A;  2V2Q A;  2DMI A;  4WYQ B;  1KTV A;  5K36 D;  1EH6 A;  4L8N A;  2X36 A;  4JV5 E;  4Z7C A;  4WPY A;  5IT9 Q;  2CT1 A;  2JEB B;  5LMN E;  1EA6 A;  1B63 A;  5A2Q C;  2V83 A;  1PJT A;  3P3C A;  4R1F A;  1T38 A;  2ODR D;  2PNZ A;  4DV6 I;  3HUL A;  2EPN A;  3ADL A;  4BA2 B;  3GLL A;  1XNR I;  3OTO E;  2BA1 D;  2B7V A;  1ZXM A;  1YPN A;  2YTG A;  1RMD A;  2ADR A;  2Z5C B;  4IJD A;  5DRP A;  1N3G A;  4LFB I;  5A6B D;  4R2C A;  1XMQ E;  4F9B B;  4JV5 I;  1Z5C A;  3P3G A;  5LMN I;  2V2V A;  1Z0G A;  4OOG C;  4LOM A;  1H7S A;  1P42 A;  1EH7 A;  4X64 E;  3OTO I;  2EMH A;  5AC4 A;  1E3P A;  1EH8 A;  1A1H A;  1L4S A;  4HYM A;  4MDT A;  2KOU A;  4HAC B;  1X6E A;  4LFA E;  4MU4 A;  2AE8 A;  3HPZ A;  2MDR A;  4RPF A;  3ZM7 A;  3V5R A;  3C6K A;  1X5W A;  2DSY A;  5K36 A;  2EPC A;  3HXL A;  1WRJ A;  3UK3 C;  1FWL A;  2EML A;  1RR9 A;  1XHK A;  2EE8 A;  4DKK A;  2EOX A;  1MEY C;  2KHX A;  4LF7 E;  4IS9 A;  1B69 A;  4WFT A;  4B3R E;  1HNW E;  1A6F A;  1U2R A;  4LPF A;  4LFA I;  5A2Q Q;  4PRV A;  2ELY A;  2V2Z A;  2CGE A;  1WUU A;  4WSP A;  4UTG A;  2EM9 A;  1MG7 A;  2EN7 A;  4IFD D;  2LCE A;  2GS8 A;  1X49 A;  2A2C A;  2BR2 B;  3MHH C;  2EM4 A;  2HJJ A;  3C6M A;  3KZY A;  5A69 A;  1A1L A;  3HJC A;  4LF7 I;  1J5E E;  1HNW I;  2EMI A;  3TQM A;  1PKP A;  3LPS A;  4FW7 A;  1USV A;  4LCF A;  2EPO A;  5LLQ A;  2WP8 B;  2YT4 A;  1T39 A;  2UUC E;  1N34 E;  4WXC A;  3ZZU A;  2NN6 D;  2EM7 A;  4DPX A;  2X7I A;  2YRK A;  1I94 E;  1NHH A;  1UDQ A;  3CWV A;  1NHJ A;  5AE1 A;  4O43 A;  3AV0 A;  1Z1B A;  3DD6 A;  3WU4 A;  5F3W A;  1UHZ A;  2EOF A;  2YZT A;  1J5E I;  4OKG A;  4LFC I;  4IFD E;  4JI1 I;  2DB2 A;  2V89 A;  4R2D A;  4ISA A;  2NUE A;  5KL4 A;  3K1J A;  4GKK I;  4DPU A;  3WU3 A;  2JT2 A;  2BA0 D;  3VK6 A;  3K85 A;  2R1F A;  2EM2 A;  4LTY A;  3LNU A;  4BBY A;  3J81 C;  5JEA D;  2O1W A;  4USM A;  4AM3 A;  1X3C A;  2LV2 A;  2PNM A;  4F9A B;  4IFD A;  1MGT A;  2NN6 E;  3THN A;  1KIJ A;  1HR0 E;  2EL5 A;  3P3E A;  2BM1 A;  4WUC A;  4NZV A;  5IXM B;  1N0V C;  4DR4 E;  2EM5 A;  4FW5 A;  2LVH A;  2B3T B;  2N3H A;  1GTK A;  1T4O A;  4R2A A;  1JK2 A;  2PO0 A;  1N33 E;  4Q35 B;  1Y60 A;  3B4T A;  2EPR A;  4DPT A;  4N3O A;  2EOR A;  2JVA A;  3Q6M A;  2G7H A;  2EM0 A;  3C4B A;  3IWB A;  1GZ6 A;  2NN6 A;  3THO B;  3HKM A;  3H1C A;  1IQO A;  1HR0 I;  1BKN A;  4M9V C;  2EN2 A;  4DV2 E;  3WU5 A;  4BS9 A;  1Z0T A;  2FV4 B;  1Y5Y A;  4LF4 I;  3T1Y E;  4JI3 I;  4DR4 I;  2LTR A;  1YHC A;  2YSP A;  2DMY A;  4X9J A;  1DAR A;  1ZM4 A;  4JI4 I;  1N33 I;  2GQ0 A;  2R76 A;  2V85 A;  2WBU A;  1AH5 A;  3D4J A;  4BA1 B;  4FW9 A;  2EMW A;  1Z5A A;  2C37 A;  4MLQ A;  2CPN A;  1G2F C;  4R2S A;  2F1D A;  2Z5B B;  4DU7 A;  1AAY A;  1B62 A;  2WBS A;  2EMZ A;  2AJ4 A;  4AQY E;  5JEA A;  4DV2 I;  1XMO E;  4DV5 E;  4DR3 E;  2EWL A;  3J81 Q;  4HXZ A;  1IQS A;  4FK5 C;  2V87 A;  2UUA E;  2ENA A;  2C38 A;  2EOM A;  2V8P A;  1YZ9 A;  2EPA A;  1GQE A;  3U1Y A;  1N0U A;  3EPH A;  1JK1 A;  1RHY A;  1RRE A;  2EOI A;  2EPU A;  3F0N A;  4PU9 A;  3K6Q A;  4X8W A;  4AQY I;  2L6M A;  1XMO I;  2VF1 A;  4MLV A;  4DV5 I;  4P78 A;  4DR6 E;  4ZYD A;  2EOH A;  5EL9 A;  2F8B A;  4NXM E;  4U3D A;  3PYF A;  3J7A M;  2NN6 C;  1WXR A;  2DGC A;  2EOO A;  2UUA I;  4NXN E;  1UEK A;  4DPY A;  4BC9 A;  3BBG A;  2Q8U A;  3M85 G;  2B9D A;  2EL6 A;  1DGC A;  4O4K A;  3QG5 C;  1IBK E;  2EL4 A;  1NHI A;  4K0K E;  5DRO A;  2PNZ B;  4M30 A;  2WNR A;  5A6A A;  4DR6 I;  4B3M E;  1IMU A;  1A1F A;  4NXM I;  2EMA A;  2JY9 A;  1FNM A;  2LJH A;  1Z0B A;  2A25 A;  3P76 A;  5GMD A;  1ZM2 A;  4NXN I;  4Q28 A;  2GHF A;  5K36 E;  5K36 F;  2JYA A;  2BA1 G;  4ZVI A;  1X6F A;  1IBK I;  1UIL A;  2BBG A;  4JI6 E;  1H73 A;  1UDO A;  2RS7 A;  3ECR A;  1YH8 A;  2JPA A;  4X65 E;  1Y6Z A;  2IES A;  3P06 A;  2WNR B;  2EN6 A;  4KZS A;  1HNZ E;  3P1X A;  2PRT A;  2ZM6 E;  4KQV A;  4K0K I;  1XMQ I;  3M99 B;  4P52 A;  4P7A A;  4I3H A;  4B3M I;  2L3C A;  4OZE A;  2RS6 A;  2HHH E;  4OX9 E;  3EQ1 A;  3V2U C;  4TUG A;  2I13 A;  2PO1 A;  4DUZ E;  5C0X D;  4JYA E;  1K47 A;  3NZK A;  1QZR A;  4J8Z A;  2E5L E;  4X65 I;  2V88 A;  4DR1 E;  2RPC A;  1J26 A;  2LRS A;  1UDS A;  4MU0 A;  2ZM6 I;  1HNZ I;  3C4T A;  3QT7 A;  2YU8 A;  5K36 B;  2CTD A;  2YTO A;  4LU9 A;  2EOQ A;  2E1R A;  5A6B A;  4LF8 E;  2HHH I;  3JTZ A;  5LMU E;  4TUI A;  2IOQ A;  4OX9 I;  2DEJ A;  2EM8 A;  2EOY A;  2EQ1 A;  4DUZ I;  2L3J A;  2WZO A;  3M85 D;  4JYA I;  3F6H A;  3L7Z A;  1KKH A;  5GME A;  2E5L I;  4JI8 E;  4R03 A;  4DR1 I;  4B3R I;  4OO1 D;  2YTQ A;  1YYK A;  4USK A;  3PYD A;  2CZ9 A;  4P7D A;  2BV3 A;  2FGG A;  4WXD A;  2EQ3 A;  2K4V A;  5LMU I;  2EOE A;  2N8X A;  5AE3 A;  2CG9 A;  2K7I A;  3DJW A;  3IWC A;  4DV7 E;  3MSW A;  1IBL E;  4GKJ E;  2WW4 A;  3H09 A;  4NHR A;  1Z0W A;  4WUB A;  1VIS A;  4JI8 I;  3M7N D;  4IFD F;  3KRN A;  1MX0 A;  4WX9 A;  1O0W A;  1YUI A;  4LF9 E;  5K36 C;  4JI5 E;  5C0X A;  2OI2 A;  4DV4 E;  4WSG A;  2UUC I;  1SFE A;  1DI2 A;  1N34 I;  3ZZ0 A;  1H74 A;  2ODR C;  1ZAA C;  1PJS A;  2VF3 A;  1UN6 B;  4IZJ D;  1I94 I;  4OO1 E;  4M0V A;  4DV7 I;  5KL3 A;  1IBL I;  4GKJ I;  3T1H E;  2VQE E;  5L3J A;  1WHQ A;  2NN6 F;  2E72 A;  4R8O A;  4BC7 A;  4DU8 A;  3JAM C;  4JG4 A;  4LF9 I;  4JI7 E;  4JI5 I;  2JEA A;  1OYR A;  5DNY A;  2JE6 A;  3Q1Q A;  2EOZ A;  5DNL A;  2MKD A;  2HK3 A;  4MYT A;  4DPW A;  4DV4 I;  2V34 A;  4OO1 A;  2D9H A;  2Q2E B;  4IFD B;  1YFH A;  2V86 A;  4DV0 E;  2BA0 G;  2O1T A;  5KL6 A;  1ZBQ A;  3M6A A;  2VQE I;  2I9I A;  2MKN A;  2O1V A;  4F9C B;  4DMI A;  1PJQ A;  4HY1 A;  5A6K A;  3QT8 A;  2PO0 B;  3J7Y p;  4DR5 E;  4U3B A;  4JI7 I;  1HNX E;  5JEA F;  5JEA E;  4BMJ A;  3ZOQ B;  3MHS C;  4GEQ B;  2NN6 B;  4J3D A;  3ZKD A;  2RSI A;  1MU5 A;  4DV0 I;  4X62 E;  4IZK A;  2YTE A;  2EQ0 A;  4DV3 E;  5KL5 A;  1S4E A;  2YTF A;  4YHH E;  1ELO A;  2HKJ A;  4Z7Y A;  2GPI A;  1R6L A;  2UU9 E;  2L33 A;  4LF5 E;  3VYX A;  3ADI A;  1FJG E;  1KJK A;  2CVE A;  2R42 A;  1HNX I;  2EN3 A;  2YU5 A;  2EMK A;  3T1Y I;  4RHB B;  1PDA A;  2EMF A;  1Z0V A;  1HK7 A;  2C37 B;  2LJP A;  4IFD C;  3CDJ A;  1Z5B A;  4X62 I;  2M4I A;  5JEA B;  5IWA E;  2EPL X;  5TSE A;  3JAM Q;  4DUY E;  3F6G A;  3VYY A;  3B82 A;  2LO3 A;  2EMB A;  4LF5 I;  4PRX A;  1FJG I;  1BB8 A;  2C38 B;  1YSA C;  2HGH A;  2O1U A;  1ZU1 A;  3LLH A;  3EPL A;  4R2E A;  4FW4 A;  4DR3 I;  1ZR9 A;  1TN9 A;  2H36 X;  2J7K A;  4GZN C;  2RQL A;  1NZ0 A;  1YYW A;  1Z0C A;  3ZZT A;  2JWO A;  2R3V A;  3CDI A;  4GQU A;  2FTX B;  2YTN A;  1OYS A;  4DUY I;  4O24 A;  3HQ1 A;  2YRM A;  5BR8 E;  4LF6 E;  1ZM3 A;  4URL A;  1XNR E;  4ED4 A;  2JEB A;  4MU1 A;  4F6N A;  4JI0 E;  4AID A;  4MU3 A;  2WBT A;  5IV8 B;  2EPK X;  2JR1 A;  3JU0 A;  2IOP A;  2DLQ A;  4I8O A;  4BA2 A;  4KWY A;  1A1G A;  1EI1 A;  2YSO A;  2A2D A;  1E3H A;  5JEA C;  5KL2 A;  1WHN A;  1X48 A;  1EKZ A;  2Z5C A;  4FWG A;  5FWK A;  2YTD A;  2UXB E;  5BR8 I;  1WJP A;  5FLX C;  4LF6 I;  2UXC E;  1PIE A;  2M7Q A;  5AC5 A;  2DLK A;  3GON A;  1KVK A;  4JI0 I;  1ZM9 A;  3J80 C;  2L2M A;  1LLM C;  2YPN A;  3BID A;  1TF3 A;  2EPM X;  1P47 A;  4DXL A;  1N36 E;  4KHP E;  3U1K A;  2YTP A;  2HK2 A;  4JI2 E;  2EJ4 A;  2XEX A;  2NPF A;  4JI6 I;  4HAC A;  1FKA E;  3QT6 A;  5DRR A;  2EMG A;  2UXB I;  1Z59 A;  2UXC I;  3QT5 A;  2LJU A;  1DQ3 A;  1KYQ A;  2PO1 B;  1Y4S A;  1TF6 A;  1G2D C;  1RQ0 A;  3H4L A;  5EKW A;  2LUP B;  1N36 I;  4KHP I;  2HC5 A;  4BHC A;  2HFS A;  4JI2 I;  1FWK A;  2C39 A;  2EN8 A;  4LCH A;  4DR2 E;  4R2P A;  1NCS A;  2EPP A;  2PNL A;  3ZKB A;  4X66 E;  2VQF E;  2O3Z A;  2EMC A;  1BBG A;  5C0X F;  5C0X E;  2VRD A;  1SR9 A;  2CSH A;  2YRH A;  2EN4 A;  2C39 B;  1N32 E;  3L7Z B;  3PS1 A;  4LF8 I;  2E1M A;  2BR2 A;  2IER A;  2LT7 A;  1OJ4 A;  1UBD C;  4B3T E;  5FLX Q;  4FWD A;  1Y4U A;  2NUG A;  4MYU A;  4F54 A;  2L8T A;  2EM6 A;  4BCA A;  1A1J A;  2DRP A;  4FW6 A;  3WU6 A;  4DR2 I;  1STU A;  3HPS A;  3J80 Q;  1RC7 A;  4R2R A;  2WP8 A;  3RMP A;  2EMY A;  4EMD A;  4X66 I;  2RTX A;  2LMZ A;  3UHM A;  2VQF I;  1IBM E;  2L2K B;  2VE7 C;  3ADJ A;  2PO2 A;  2EN1 A;  4HEI A;  4DR7 E;  1OYP A;  1N32 I;  4LFC E;  4FWH A;  4XTJ A;  4JI1 E;  4OO1 F;  2L92 A;  1S16 A;  4DV1 E;  3PS3 A;  4B3T I;  2YTI A;  1YUJ A;  2ZIT A;  5DNX A;  5C0X B;  3LTO A;  2JOX A;  4GKK E;  1XXE A;  2PO2 B;  2Z5E A;  3M7N G;  1QU6 A;  3PRY A;  2HFU A;  4FW3 A;  2DEI A;  2MC6 A;  2EPX A;  1IBM I;  2IHR 1;  2HKE A;  2LUQ A;  4MQY A;  4L5N C;  2EMX A;  2LTS A;  2JP9 A;  1ZXN A;  4M1K A;  4DR7 I;  3KZZ A;  2EOS A;  2J7J A;  5ADZ A;  4B3S E;  4BHB A;  2F4V E;  3ADG A;  2NA2 A;  2ENH A;  2NUF A;  2B7T A;  2RSM A;  2UUB E;  1H72 C;  2GO4 A;  4DV1 I;  2JEA B;  2EPZ A;  2JE6 B;  3T1H I;  3KWR A;  4YY3 E;  4UT4 A;  4OO1 B;  4N4R B;  1BBO A;  3J7A G;  4RH8 A;  4M2Z A;  4QNJ A;  1H7U A;  3EPJ A;  1Z0E A;  3Q6N A;  4LCG A;  1QNT A;  2DIX A;  3BGH A;  2ENC A;  5AAS A;  4WUD A;  4B3S I;  2F4V I;  4NBQ A;  2NAB A;  2BB8 A;  4ZYE A;  2UUB I;  2L2N A;  4LF4 E;  4JI3 E;  5C0X C;  1X6H A;  4ZYG A;  4JI4 E;  3FIG A;  4IZJ A;  4YY3 I;  4HTG A;  2BM0 A;  5IT9 C;  1T4L B;  3PYE A;  4DR5 I;  2UXD E;  1XNQ E;  5DRQ A;  2MDG A;  1VI7 A;  2ELZ A;  4F6M A;  4F2J C;  3B78 A;  3K17 A;  4IZK B;  2JXP A;  4BA1 A;  4ZYH A;  5ELW A;  2LE2 A;  2GLI A;  3LML A;  4IZJ B;  4O5G A;  2KON A;  1T4N A;  2V8Q B;  3AUZ A;  2Z5B A;  4FN5 A;  1UDN A;  3L00 A;  4DV3 I;  2N3G A;  3EPK A;  2ZBK B;  3PYG A;  3HTX A;  1FI4 A;  5KL7 A;  2WCC 3;  2LBS B;  4YHH I;  4OO1 C;  2UU9 I;  2M1S A;  2MC5 A;  3OML A;  2EM3 A;  5CFF E;  3GME A; 
#chains in the Genus database with same CATH homology
 2UXD I;  1XNQ I;  3B8H A;  2EZ6 A;  1D6T A;  1ZBT A;  5T6J A;  1YYO A;  1PVG A;  5LL6 R;  5IWA I;  3IWD A;  5AE2 A;  3DF6 A;  2EFG A;  4DV6 E;  4X64 I;  1USU A;  1X47 A;  2JOB A;  4LFB E;  2V2Q A;  4WYQ B;  1KTV A;  4L8N A;  2X36 A;  4JV5 E;  4Z7C A;  4WPY A;  5IT9 Q;  5LMN E;  1EA6 A;  1B63 A;  5A2Q C;  2V83 A;  4R1F A;  2ODR D;  4DV6 I;  3HUL A;  3ADL A;  1XNR I;  3OTO E;  2B7V A;  1ZXM A;  2Z5C B;  4LFB I;  1XMQ E;  4F9B B;  4JV5 I;  1Z5C A;  5LMN I;  2V2V A;  1Z0G A;  4OOG C;  1H7S A;  3OTO I;  4HYM A;  2KOU A;  4HAC B;  4LFA E;  3HPZ A;  2MDR A;  4RPF A;  3ZM7 A;  3V5R A;  2DSY A;  3HXL A;  1FWL A;  1XHK A;  1RR9 A;  4DKK A;  4LF7 E;  2KHX A;  4WFT A;  4B3R E;  1HNW E;  1A6F A;  1U2R A;  4LFA I;  5A2Q Q;  4PRV A;  2V2Z A;  2CGE A;  1WUU A;  4WSP A;  4UTG A;  1MG7 A;  2GS8 A;  1X49 A;  2A2C A;  3HJC A;  4LF7 I;  1J5E E;  1HNW I;  1PKP A;  3LPS A;  1USV A;  2YT4 A;  2UUC E;  1N34 E;  3ZZU A;  4DPX A;  2X7I A;  1I94 E;  1NHH A;  3CWV A;  1NHJ A;  5AE1 A;  3AV0 A;  3WU4 A;  5F3W A;  1UHZ A;  2YZT A;  1J5E I;  4LFC I;  4JI1 I;  2DB2 A;  2V89 A;  2NUE A;  3K1J A;  4GKK I;  4DPU A;  3WU3 A;  3K85 A;  3VK6 A;  4LTY A;  3LNU A;  4BBY A;  3J81 C;  2O1W A;  4USM A;  2PNM A;  4F9A B;  1KIJ A;  1HR0 E;  4WUC A;  2BM1 A;  1N0V C;  4DR4 E;  2B3T B;  2N3H A;  1T4O A;  1N33 E;  4DPT A;  4N3O A;  2JVA A;  3Q6M A;  2G7H A;  3IWB A;  3C4B A;  1GZ6 A;  1HR0 I;  1BKN A;  4DV2 E;  3WU5 A;  4BS9 A;  1Z0T A;  2FV4 B;  4DR4 I;  4LF4 I;  3T1Y E;  4JI3 I;  2LTR A;  2DMY A;  1DAR A;  1ZM4 A;  4JI4 I;  1N33 I;  2GQ0 A;  2V85 A;  3D4J A;  4FW9 A;  1Z5A A;  2CPN A;  4DU7 A;  2Z5B B;  1B62 A;  2AJ4 A;  4AQY E;  4DV2 I;  1XMO E;  4DV5 E;  4DR3 E;  2EWL A;  3J81 Q;  4HXZ A;  2V87 A;  2UUA E;  2V8P A;  1YZ9 A;  1GQE A;  1N0U A;  1RRE A;  3F0N A;  4PU9 A;  3K6Q A;  4X8W A;  4AQY I;  2L6M A;  1XMO I;  2VF1 A;  4DV5 I;  4P78 A;  4DR6 E;  3J7A M;  2F8B A;  4NXM E;  3PYF A;  1WXR A;  2UUA I;  4NXN E;  1UEK A;  4DPY A;  4BC9 A;  2B9D A;  1IBK E;  1NHI A;  4K0K E;  4M30 A;  4DR6 I;  4B3M E;  4NXM I;  2JY9 A;  1FNM A;  2LJH A;  1Z0B A;  5GMD A;  4NXN I;  1ZM2 A;  4Q28 A;  4ZVI A;  1IBK I;  1UIL A;  4JI6 E;  1Z0E A;  1H73 A;  2RS7 A;  4X65 E;  1Y6Z A;  3P06 A;  4KZS A;  4KQV A;  1HNZ E;  3P1X A;  4K0K I;  2ZM6 E;  1XMQ I;  4P52 A;  4P7A A;  4I3H A;  4B3M I;  2L3C A;  2RS6 A;  2HHH E;  4OX9 E;  3V2U C;  4TUG A;  4DUZ E;  4JYA E;  1K47 A;  1QZR A;  4J8Z A;  2E5L E;  4X65 I;  2V88 A;  4DR1 E;  1J26 A;  2LRS A;  1HNZ I;  2ZM6 I;  3C4T A;  3QT7 A;  4LU9 A;  2E1R A;  2MC5 A;  4LF8 E;  2HHH I;  3JTZ A;  5LMU E;  4TUI A;  2IOQ A;  4OX9 I;  2DEJ A;  4DUZ I;  2L3J A;  2WZO A;  4JYA I;  3F6H A;  5GME A;  1KKH A;  2E5L I;  4JI8 E;  4R03 A;  4DR1 I;  4B3R I;  1YYK A;  4USK A;  3PYD A;  2CZ9 A;  4P7D A;  2BV3 A;  2FGG A;  2K4V A;  5LMU I;  5AE3 A;  2CG9 A;  3DJW A;  3IWC A;  4DV7 E;  3MSW A;  1IBL E;  4GKJ E;  2WW4 A;  3H09 A;  1Z0W A;  4WUB A;  1VIS A;  4JI8 I;  1MX0 A;  1O0W A;  4LF9 E;  4JI5 E;  2OI2 A;  4DV4 E;  2UUC I;  1DI2 A;  1N34 I;  3ZZ0 A;  1H74 A;  2ODR C;  2VF3 A;  1I94 I;  4IZJ D;  4M0V A;  4DV7 I;  1IBL I;  4GKJ I;  3T1H E;  2VQE E;  5L3J A;  1WHQ A;  4R8O A;  4BC7 A;  4DU8 A;  3JAM C;  4JG4 A;  4LF9 I;  4JI7 E;  4JI5 I;  5DNY A;  3Q1Q A;  4DV4 I;  4MYT A;  2HK3 A;  4DPW A;  2V34 A;  2Q2E B;  2V86 A;  4DV0 E;  2O1T A;  1ZBQ A;  3M6A A;  2VQE I;  2O1V A;  4HY1 A;  4F9C B;  4DMI A;  3QT8 A;  3J7Y p;  4DR5 E;  4JI7 I;  1HNX E;  4BMJ A;  3ZOQ B;  4GEQ B;  3ZKD A;  4DV0 I;  1MU5 A;  4X62 E;  4IZK A;  4DV3 E;  1S4E A;  2HKJ A;  4YHH E;  1ELO A;  4Z7Y A;  2UU9 E;  2L33 A;  4LF5 E;  3VYX A;  3ADI A;  1FJG E;  2R42 A;  1HNX I;  3T1Y I;  1Z0V A;  1HK7 A;  2LJP A;  1Z5B A;  4X62 I;  2M4I A;  5IWA E;  3JAM Q;  4DUY E;  3F6G A;  3VYY A;  3B82 A;  4LF5 I;  4PRX A;  1FJG I;  2O1U A;  3LLH A;  4DR3 I;  2H36 X;  2J7K A;  1NZ0 A;  1Z0C A;  1YYW A;  3ZZT A;  2JWO A;  2R3V A;  2FTX B;  4DUY I;  3HQ1 A;  5BR8 E;  4LF6 E;  1ZM3 A;  4URL A;  1XNR E;  4ED4 A;  4JI0 E;  2IOP A;  2JR1 A;  3JU0 A;  4I8O A;  1EI1 A;  2A2D A;  1WHN A;  1X48 A;  1EKZ A;  2Z5C A;  4FWG A;  5FWK A;  2UXB E;  5BR8 I;  4LF6 I;  5FLX C;  2UXC E;  1PIE A;  2M7Q A;  3GON A;  1KVK A;  4JI0 I;  1ZM9 A;  3J80 C;  2L2M A;  4DXL A;  1N36 E;  4KHP E;  2HK2 A;  4JI2 E;  2XEX A;  2NPF A;  4JI6 I;  4HAC A;  1FKA E;  3QT6 A;  2UXB I;  1Z59 A;  2UXC I;  3QT5 A;  1DQ3 A;  1Y4S A;  1RQ0 A;  3H4L A;  2LUP B;  1N36 I;  4KHP I;  2HFS A;  4JI2 I;  1FWK A;  4DR2 E;  2PNL A;  3ZKB A;  4X66 E;  2VQF E;  1SR9 A;  1N32 E;  4LF8 I;  2E1M A;  1OJ4 A;  4B3T E;  5FLX Q;  4FWD A;  1Y4U A;  2NUG A;  4MYU A;  4F54 A;  2L8T A;  4BCA A;  4DR2 I;  3WU6 A;  1STU A;  3HPS A;  3J80 Q;  1RC7 A;  4EMD A;  3RMP A;  4X66 I;  2RTX A;  2LMZ A;  2VQF I;  1IBM E;  2L2K B;  2VE7 C;  3ADJ A;  4DR7 E;  1N32 I;  4LFC E;  4FWH A;  4XTJ A;  4JI1 E;  2L92 A;  1S16 A;  4DV1 E;  4B3T I;  2ZIT A;  3LTO A;  2JOX A;  4GKK E;  2Z5E A;  1QU6 A;  3PRY A;  2HFU A;  2DEI A;  2MC6 A;  1IBM I;  2IHR 1;  2HKE A;  2LUQ A;  4L5N C;  2LTS A;  1ZXN A;  4M1K A;  4DR7 I;  5ADZ A;  4B3S E;  2F4V E;  3ADG A;  2NA2 A;  2NUF A;  2UUB E;  2B7T A;  2RSM A;  1H72 C;  4DV1 I;  3T1H I;  3KWR A;  4YY3 E;  4UT4 A;  3J7A G;  4M2Z A;  1H7U A;  3Q6N A;  2DIX A;  5AAS A;  4WUD A;  4B3S I;  2F4V I;  2UUB I;  2L2N A;  4LF4 E;  4JI3 E;  4JI4 E;  3FIG A;  4IZJ A;  4YY3 I;  2BM0 A;  5IT9 C;  1T4L B;  3PYE A;  4DR5 I;  2UXD E;  1XNQ E;  3K17 A;  3B78 A;  4IZK B;  2LE2 A;  3LML A;  4IZJ B;  2KON A;  1T4N A;  2V8Q B;  3AUZ A;  2Z5B A;  4FN5 A;  4DV3 I;  2N3G A;  2ZBK B;  3PYG A;  4YHH I;  3HTX A;  1FI4 A;  2LBS B;  2UU9 I;  2M1S A;  4X64 E;  3OML A;  5CFF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...