4DR1E

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr1E02
1I94I 3ADGA 1Z0WA 4NXMI 1Z0GA 4JI5I 1ZM3A 2L2NA 3WU5A 4DUYI 4LF9E 2UUCE 1ZM2A 1A6FA 3ZZTA 1U2RA 1BKNA 3K17A 4MYTA 1FWLA 2EZ6A 2JVAA 4JI6I 4DV3I 3OTOI 3VYXA 1XMQI 1Z5CA 4DR7E 3ADLA 1H73A 1PIEA 1IBMI 4JV5I 4WUCA 2UU9I 2UXDE 2HKEA 4DR4E 1ZBTA 4AQYI 4DPUA 2NA2A 2RTXA 1FNMA 4LF4I 1T4OA 4ED4A 4LF5I 4ZVIA 2GS8A 2VQFI 3JAMQ 2UXBE 2ZITA 1B62A 2ZBKB 2X7IA 4JI0E 4DR6I 4B3RI 4X64E 3J80C 1NHHA 2R42A 4DV1E 4DR1E 2JY9A 1Z0VA 1J5EI 2KHXA 4Z7YA 4B3SE 1H7SA 5CFFE 4K0KE 4DV2E 2NUFA 3T1HE 2HHHE 5IWAI 2AJ4A 4DV4E 1IBKE 4JI1I 4URLA 4DV5E 4X8WA 4B3TE 4FWDA 1KVKA 1T4NA 3WU3A 2A2DA 1YYKA 2LBSB 4LFCE 4GKJE 4HYMA 4EMDA 4YHHE 1HNXI 1HNWI 2L3JA 3ZKBA 4DU7A 3ZZ0A 2YT4A 4DUZE 2LTRA 1YZ9A 1STUA 1H74A 2MDRA 2V2QA 4LF6E 1UEKA 1YYWA 4DR3I 1MX0A 3V5RA 4X66I 5LL6R 4HACB 3J81Q 1ZM9A 1S4EA 3PYGA 2CPNA 3LLHA 1D6TA 3ZZUA 4USMA 1Z59A 1T4LB 4DR2E 1X47A 2VQEE 2LRSA 1MG7A 4JYAE 4GKKI 3WU4A 2V8PA 4LF8E 1N34E 5LMNI 3T1YE 4KQVA 4LFAE 1HR0I 1XHKA 4DR7I 1K47A 4USKA 2DIXA 2UUAE 3J7Yp 1N32E 2WW4A 1UILA 3PYDA 3GONA 4DR4I 2LUPB 1NHIA 4DR5E 4JI4E 4Z7CA 4M1KA 2RS6A 4JI0I 4B3ME 4X64I 2B7TA 2F4VE 1Z0BA 2LTSA 4DV7I 4JI7I 3JAMC 2NUGA 1MU5A 4DKKA 1KKHA 4B3SI 2L33A 5BR8E 4K0KI 1X48A 1XNQI 4DV2I 4DU8A 2A2CA 4JI3E 3V2UC 1WUUA 4X62E 4DV4I 2ZM6E 4LFBI 1N0VC 1N36E 4KHPI 4DV5I 4PRVA 3WU6A 4I3HA 4JI5E 1NZ0A 4B3TI 2V2VA 4DV0E 1O0WA 2B3TB 5GMDA 4GKJI 4YHHI 4PRXA 1B63A 3QT5A 2HK2A 3HULA 4DUZI 1S16A 3LPSA 1YYOA 4JI6E 4DV3E 3OTOE 2E5LI 2R3VA 1XMQE 2NPFA 4DPXA 4LF6I 4WFTA 4JV5E 2RSMA 1XMOE 4LF7E 4AQYE 4LF4E 1N0UA 4LF5E 1DARA 4HXZA 4DR2I 3J81C 5A2QQ 2VQEI 2LUQA 3B82A 4M30A 4DV6E 3P1XA 4B3RE 2UXCE 5FLXQ 4LF8I 1DI2A 3J7AG 2NUEA 1N34I 4DPWA 3T1YI 2E1RA 3PYFA 3QT7A 5LMUI 1Z0TA 1VISA 1H7UA 1XNRI 3F0NA 2UUAI 3PYEA 2UUBE 2XEXA 4LF9I 4UTGA 3Q1QA 2UUCI 1PVGA 1RREA 1FKAE 2L2MA 2EFGA 2DEJA 3LTOA 3C4TA 2DB2A 3D4JA 3C4BA 4JI4I 3B8HA 3VYYA 4JI8E 2OI2A 5IT9Q 4B3MI 2HFSA 4NXNE 3CWVA 2IHR1 1HNXE 1HNWE 2V2ZA 1N33E 2UXDI 2VF3A 1Z0EA 1IBLE 1PKPA 1ZXNA 1HNZE 2HKJA 4M2ZA 2V34A 1UHZA 4JI3I 5L3JA 4X66E 2DMYA 2BM1A 4JI2E 2UXBI 2ZM6I 4X65E 4R1FA 1FWKA 1N36I 1FJGE 2B7VA 4DV1I 2HFUA 1EI1A 1KTVA 4DXLA 4DR1I 4DV0I 4WUDA 1ZM4A 3H4LA 3LNUA 4GKKE 1RR9A 3T1HI 2CZ9A 2HHHI 5LMNE 4OX9E 4FWHA 1HR0E 1RC7A 4YY3E 1IBKI 2LJHA 1I94E 1WHQA 4NXME 1XMOI 4LF7I 2L2KB 4DUYE 5GMEA 4LFCI 1H72C 1KIJA 2DEIA 3ADIA 3K1JA 4DV6I 1GQEA 1OJ4A 2UXCI 2L3CA 2J7KA 4JG4A 4WYQB 4PU9A 2Q2EB 2N3HA 1IBME 2N3GA 2UU9E 4JI7E 4DV7E 3M6AA 1J26A 5A2QC 3J80Q 1XNQE 1NHJA 4RPFA 1ELOA 5FLXC 2UUBI 2HK3A 2VQFE 4P52A 4MYUA 4P7AA 4LFBE 3B78A 1Z5AA 4WUBA 4XTJA 4DR6E 4KHPE 1FI4A 4JYAI 1EA6A 1Z5BA 4JI8I 4LFAI 1J5EE 4NXNI 1EKZA 3ADJA 2BM0A 1ZXMA 4DPTA 1N32I 1QU6A 4FW9A 1N33I 5IWAE 2LJPA 1IBLI 1Z0CA 2E5LE 1QZRA 1HNZI 5IT9C 2BV3A 4DR5I 3J7AM 1X49A 3HTXA 4FWGA 4JI1E 4JI2I 4X65I 3QT8A 1RQ0A 1WHNA 4UT4A 1FJGI 4OOGC 2F4VI 4FN5A 4HACA 3ZKDA 5BR8I 4HY1A 2RS7A 4DR3E 4X62I 4OX9I 5LMUE 3ZM7A 4DPYA 4YY3I 2X36A 3QT6A 1XNRE
chains in the Genus database with same CATH superfamily
1I94I 3ADGA 1Z0WA 4MU4A 4NXMI 1Z0GA 3LMLA 4JI5I 1ZM3A 2L2NA 2E1MA 2L8TA 2F8BA 3WU5A 4DUYI 4QNJA 4LF9E 4LCHA 2UUCE 1ZM2A 1AH5A 4F6NA 1A6FA 3ZZTA 1U2RA 2EPPA 1Y6ZA 1BKNA 3K17A 4MYTA 2D9HA 2O3ZA 1FWLA 3Q6MA 2EZ6A 2JVAA 4JI6I 4DV3I 3OTOI 2WNRB 4IFDA 2EPRA 3VYXA 5K36D 2C39A 1XMQI 5JEAC 1Z5CA 4N3OA 4DR7E 2WCC3 2B9DA 2GQ0A 3ADLA 1SFEA 4BC7A 1H73A 1PIEA 1IBMI 4JV5I 4WUCA 4BA2B 2UU9I 1R6LA 4O24A 1Y4UA 2UXDE 2HKEA 4DR4E 1ZBTA 4AQYI 3EPJA 1IQOA 1WXRA 1WJPA 1YUIA 2NA2A 2RTXA 2YTJA 1FNMA 4DPUA 5C0XA 1T4OA 4LF4I 4ED4A 2PO0B 2EN6A 2EMGA 2V89A 2JE6B 4ZVIA 4LF5I 2GS8A 3M7ND 2EOQA 2YTPA 2YTNA 2CGEA 3L7ZA 2VQFI 2JR1A 2NN6C 2EOHA 2HGHA 2BA0G 5DROA 2UXBE 3JAMQ 4OO1E 2YTGA 2ZITA 2JEBB 1B62A 2ZBKB 2X7IA 4JI0E 2ENCA 2NN6F 4DR6I 2WBTA 4B3RI 4X64E 4WSGA 3J80C 1NHHA 2KONA 2EN4A 2R42A 4DV1E 4MDTA 4DR1E 2JY9A 1Z0VA 1J5EI 2KHXA 2C37A 5TSEA 4Z7YA 4B3SE 1H7SA 2EOMA 5CFFE 1USUA 2FTXB 1ZAAC 2EN1A 2BA0D 4K0KE 1OYPA 2Z5BA 3B4TA 3IWDA 3EPLA 4DV2E 2M9AA 2K4VA 1TF3A 1BBGA 2NUFA 3T1HE 2LO3A 2HHHE 5IWAI 4ZYHA 2AJ4A 4MU3A 4DV4E 2V83A 2PO2A 1KYQA 5JEAA 4ISAA 1IBKE 4JI1I 4URLA 4DV5E 3HPZA 5EL9A 4X8WA 2J7JA 4B3TE 1RHYA 4FWDA 2YRHA 4F9AB 1KVKA 1T4NA 3WU3A 2A2DA 3JU0A 4F6MA 2LBSB 1YYKA 4LFCE 4GKJE 4HYMA 4EMDA 4WX9A 4YHHE 1HNXI 1HNWI 2ADRA 5AASA 2PO1B 5K36E 2L3JA 3ZKBA 4DU7A 3ZZ0A 2GLIA 2NN6A 2YT4A 4DUZE 2I13A 2EMYA 3P3CA 2GPIA 1WRJA 4IS9A 2LTRA 2UU9E 3THNA 1STUA 3C6KA 2EMZA 4F2JC 1YZ9A 1H74A 1UDSA 2O1WA 2EMXA 1UN6B 2EL5A 4QNKA 4BA1A 2MDRA 2EM5A 2V2QA 1X5WA 4LF6E 1YYWA 1UEKA 4DR3I 4LTYA 4M9VC 1MX0A 3V5RA 4X66I 5LL6R 1YHCA 4R2AA 2GO3A 4HACB 3J81Q 1ZM9A 1S4EA 2CPNA 3PYGA 3LLHA 1YUJA 3Q6NA 4OKGA 1X6FA 2EPCA 5A69A 4OO1D 2EOOA 2LT7A 1D6TA 3OMLA 4IFDF 3ZZUA 4USMA 2M4IA 1OYSA 1DQ3A 2YTQA 3P3GA 1Z59A 2BB8A 5A6BA 1T4LB 4DR2E 2BA1D 1X47A 4LCGA 1X6EA 2VQEE 2LRSA 1MG7A 5ADZA 4JYAE 5FWKA 4GKKI 3MHHC 3WU4A 4HEIA 4M0VA 2V8PA 4LF8E 2YRMA 1N34E 5LMNI 4MU1A 3T1YE 4KQVA 4LFAE 4LPFA 5C0XF 2YTEA 3M99B 1HR0I 2JPAA 1XHKA 5KL4A 4IZKA 4DR7I 4BS9A 1K47A 3PS3A 4USKA 2JEAB 3TQMA 2DIXA 1RMDA 2FV4B 2UUAE 3J7Yp 2Z5CB 3UHMA 2RQLA 2EOJA 1N32E 2WW4A 2PNZA 4NZVA 1UILA 2N8XA 5A6AA 2EL6A 2O1TA 3GONA 3PYDA 4DR4I 2EMKA 2C39B 1B69A 2LUPB 1Y5YA 1NHIA 4DR5E 2YWQA 3H1CA 3HJCA 1XXEA 4WSPA 5AC4A 3AUZA 4JI4E 5DRQA 2K7IA 3M7NG 1PJQA 5ELWA 4Z7CA 4R2CA 4M1KA 2RS6A 5LLQA 2WZOA 2E72A 4JI0I 4B3ME 2EOIA 4X64I 2B7TA 2O1UA 3L7ZB 2DRPA 3QG5C 2F4VE 1MGTA 2EPKX 1Z0BA 2KOUA 2YTDA 2IOQA 2LTSA 4DV7I 5JEAF 3JAMC 1KJKA 1AAYA 4IZJA 4R2EA 2R1FA 2NUGA 1MU5A 4DKKA 1KKHA 1UDNA 2JOBA 4B3SI 2L33A 2YTOA 5BR8E 4AM3A 5AC5A 4K0KI 1X48A 1XNQI 2V8QB 4DU8A 2Q8UA 3H09A 2A2CA 2BR2A 4DV2I 4JI3E 4MQYA 3V2UC 1WUUA 2MKNA 4X62E 4WXDA 4DV4I 2ZM6E 2C37B 4Q28A 3K6QA 4LFBI 2PRTA 2V87A 1USVA 1Y60A 1N0VC 3BBGA 1N36E 4KHPI 1A1JA 4O4KA 2IERA 5F3WA 4DV5I 2C38A 4PRVA 2PNMA 3WU6A 2IOPA 4BHBA 4I3HA 4JI5E 2YRKA 1NZ0A 4B3TI 2V2VA 5JEAD 4I8OA 4DV0E 4R2RA 2WNRA 1O0WA 2B3TB 2L92A 5GMDA 3DJWA 1F2IG 4GKJI 3ZOQB 2VF1A 4YHHI 1A1HA 1B63A 1A1LA 4PRXA 2EM6A 2VE7C 3QT5A 5DRPA 2HK2A 3HULA 4DUZI 4JI7I 2EPNA 2LJUA 1S16A 4L8NA 2EORA 4R2DA 3LPSA 4GQUA 1YYOA 4JI6E 4DV3E 3OTOE 2E5LI 3JTZA 3P06A 1NEIA 4FK5C 3MHSC 1XMQE 4Q35B 2R3VA 3CDJA 2NPFA 4DPXA 4LF6I 3P3EA 1IMUA 4FW4A 2JWOA 4WFTA 2NN6B 5A6KA 4JV5E 4OO1C 4DMIA 2EMBA 2RSMA 1XMOE 4LF7E 2HC5A 1HK7A 1A1KA 2EQ1A 4AQYE 2EMLA 3EPHA 3GMEA 4LF4E 4BA1B 1N0UA 2EJ4A 4KWYA 1TN9A 4LF5E 3IWBA 2EM4A 1DARA 2DLKA 3ECRA 2WBUA 2V88A 4HXZA 2YU5A 4DR2I 4IFDE 3J81C 2ELZA 5A2QQ 2VQEI 2LUQA 2ODRC 3B82A 2NN6D 4M30A 4DV6E 3P1XA 4B3RE 2UXCE 2M7QA 2ENHA 3KRNA 1QNTA 4R2PA 5FLXQ 2BA1G 3J7AG 1DI2A 2NUEA 4LF8I 1N34I 3FIGA 1P47A 4DPWA 4R8OA 2E1RA 3PYFA 3QT7A 3T1YI 2A25A 5LMUI 4U3BA 2LMZA 3U1YA 1Z0TA 1VISA 2EM2A 2EMIA 1G2FC 2I9IA 3BIDA 4AIMA 1H7UA 4FW3A 5C0XE 4BCAA 2EPZA 2JP9A 3F0NA 5T6JA 1XNRI 2UUAI 1JK1A 3PYEA 2EQ0A 2HJJA 2UUBE 2EMWA 2XEXA 4LF9I 4FW6A 4UTGA 4J8ZA 2UUCI 3BF2A 2EM9A 1BB8A 1PVGA 1RREA 3Q1QA 1FKAE 1A1GA 2L2MA 2JOXA 2EFGA 2DEJA 1T39A 3LTOA 3C4TA 5KL2A 5K36C 2DB2A 2L6MA 3D4JA 3C4BA 2EP3A 2PNZB 4JI4I 3KZYA 4MLQA 5A6JA 1A1IA 3B8HA 3P76A 4OO1A 1YSAC 3VYYA 1DGCA 4JI8E 2OI2A 1VI7A 4X9JA 5IT9Q 4B3MI 3DF6A 5K36F 2DGCA 2HFSA 2MC6A 4NXNE 2IHR1 3CWVA 5DRRA 2VRDA 5DNYA 4BHCA 1HNXE 1HNWE 1Y4SA 2WP8A 2YZTA 4BMJA 2V2ZA 3VHTB 1E3HA 4WXCA 1PJSA 4F9CB 1N33E 3M85G 4IFDB 2UXDI 2VF3A 4AIDA 1Z0EA 1IBLE 1PKPA 1ZXNA 1HNZE 2HKJA 3PS1A 4GEQB 3K85A 5JEAE 1YH8A 1ZU1A 4M2ZA 3GLLA 2V34A 1UHZA 1YFHA 4LU9A 4JI3I 5L3JA 2LV2A 2EM3A 4X66E 2DMYA 3KWRA 2BM1A 4JI2E 2UXBI 2ZM6I 4IZJB 4X65E 4R1FA 4NBQA 1NCSA 2EN2A 1FWKA 5C0XB 2DSYA 2YSOA 3THOB 4MU0A 1N36I 1EH8A 2MDGA 1T38A 1FJGE 2B7VA 2EN7A 3M85D 4DV1I 2HFUA 4IFDD 1EI1A 1KTVA 2J65A 2NN6E 4DXLA 2EOFA 4DR1I 4DV0I 5IXMB 4WUDA 4BBYA 1ZM4A 2MKDA 3PS2A 1TF6A 2M1SA 5AE1A 3H4LA 2C38B 3LNUA 2JEAA 4GKKE 1OYRA 5K36A 1RR9A 2Z5CA 4IZJD 3T1HI 3HKMA 4R2SA 2CZ9A 2HHHI 2EPAA 5LMNE 2PNLA 5C0XD 2EMAA 4ZYGA 4OX9E 2IESA 1HR0E 4FWHA 5AE2A 1RC7A 4IJDA 4YY3E 2BBGA 1R6MA 4ZYEA 2EPOA 1IBKI 2V85A 2Z5BB 2LJHA 3HQ1A 4O5GA 3L00A 2LE2A 2EL4A 2EOXA 1I94E 1WHQA 4NXME 1XMOI 2H36X 2L2KB 4LF7I 2YU8A 4DUYE 2PO2B 2GHFA 2RSIA 4NHRA 3DD6A 5GMEA 4LCFA 4LFCI 1X3CA 5JEAB 1UBDC 1SR9A 2G7HA 4ZYDA 2YTIA 1MEYC 1H72C 3NZKA 1KIJA 4HTGA 2DEIA 4BA2A 3ADIA 1X6HA 4J3DA 2EN3A 5DNLA 3U1KA 3K1JA 4DV6I 1GQEA 3HPSA 1OJ4A 2UXCI 2L3CA 2PO0A 2J7KA 2JE6A 1E3PA 4GZNC 4JG4A 4WYQB 4F54A 2JXPA 4F9BB 4PU9A 2Q2EB 2N3HA 1IBME 1JK2A 2N3GA 2EMFA 2EWLA 2LVHA 4RHBB 4JI7E 2EPUA 5KL7A 3BGHA 4KZSA 4DV7E 4FW5A 3C6MA 2EM8A 2JEBA 1N3GA 3M6AA 5A2QC 3UK3C 1J26A 2DMIA 2LCEA 2GO4A 5KL3A 4IS1C 2FGGA 3J80Q 4OO1F 1ZR9A 1XNQE 1NHJA 1ELOA 2AE8A 4RPFA 5FLXC 2VESA 2UUBI 3F6HA 2HK3A 2VQFE 1GTKA 4P52A 2EE8A 2CTDA 4MYUA 4P7AA 4LFBE 3B78A 2MC5A 2EQ3A 5KL5A 1Z5AA 4WUBA 2ENAA 4DR6E 4KHPE 1FI4A 4XTJA 1UDOA 4JYAI 2DLQA 4RH8A 2R76A 4BC9A 4WPYA 1EA6A 2EPMX 4FW7A 1Z5BA 4JI8I 1IQSA 1GZ6A 2CSHA 2EM0A 5KL6A 4U3DA 4LFAI 1J5EE 4NXNI 2EN8A 1EKZA 4P7DA 3ADJA 2EMCA 2BM0A 1A1FA 1ZXMA 3IWCA 3KZZA 3CDIA 1QU6A 4DPTA 4OO1B 4FW9A 1N32I 2EPLX 2YTFA 2EPXA 5IWAE 2LJPA 1N33I 4R03A 2EMHA 1IBLI 1Z0CA 1UDQA 4IZKB 2E5LE 1QZRA 1HNZI 5IT9C 4N4RB 2BV3A 2EM7A 4DR5I 3J7AM 1X49A 2WP8B 3HTXA 2RPCA 5AE3A 4FWGA 4JI1E 4JI2I 2PO1A 5A6BD 3MSWA 2JT2A 3RMPA 4OZEA 3F6GA 4X65I 3QT8A 1RQ0A 3GCMA 2WBSA 4IFDC 1WHNA 4R2QA 3VK6A 3AV0A 4UT4A 1L4SA 4TUGA 2F1DA 2ELYA 1FJGI 1PJTA 2V86A 4OOGC 2NABA 2F4VI 1G2DC 4FN5A 2EOEA 1ZBQA 2YSPA 2EOSA 4P78A 4HACA 5DNXA 3ZKDA 5C0XC 3EPKA 5BR8I 3EQ1A 2JYAA 4HY1A 1Z1BA 2CT1A 4TUIA 4LOMA 1PDAA 4O43A 1YPNA 2RS7A 4L5NC 2YPNA 2EOYA 2Z5EA 5IV8B 4DR3E 5EKWA 1P42A 2CVEA 4X62I 1LLMC 4OX9I 2ODRD 5LMUE 2O1VA 1EH7A 3ZM7A 2EOZA 4DPYA 1EH6A 4YY3I 2CG9A 2X36A 3PRYA 1BBOA 3QT6A 4MLVA 3HXLA 1XNRE 5K36B 2BR2B
chains in the Genus database with same CATH topology
1I94I 3ADGA 1Z0WA 4NXMI 1Z0GA 3LMLA 4JI5I 1ZM3A 2L2NA 2E1MA 2L8TA 2F8BA 3WU5A 4DUYI 4LF9E 2UUCE 1ZM2A 1A6FA 3ZZTA 1U2RA 1Y6ZA 1BKNA 3K17A 4MYTA 1FWLA 3Q6MA 2EZ6A 2JVAA 4JI6I 4DV3I 3OTOI 3VYXA 1XMQI 1Z5CA 4N3OA 4DR7E 2B9DA 2GQ0A 3ADLA 4BC7A 1H73A 1PIEA 1IBMI 4JV5I 4WUCA 2UU9I 1Y4UA 2UXDE 2HKEA 4DR4E 1ZBTA 4AQYI 4DPUA 1WXRA 2NA2A 2RTXA 1FNMA 4LF4I 1T4OA 4ED4A 2V89A 4LF5I 4ZVIA 2GS8A 2CGEA 2VQFI 2JR1A 3JAMQ 2UXBE 2ZITA 1B62A 2ZBKB 2X7IA 4JI0E 4DR6I 4B3RI 4X64E 3J80C 1NHHA 2KONA 2R42A 4DV1E 4DR1E 2JY9A 1Z0VA 1J5EI 2KHXA 4Z7YA 4B3SE 1H7SA 5CFFE 1USUA 2FTXB 2Z5BA 4K0KE 3IWDA 4DV2E 2NUFA 2K4VA 3T1HE 2HHHE 5IWAI 2AJ4A 4DV4E 2V83A 1IBKE 4JI1I 4URLA 4DV5E 3HPZA 4X8WA 4B3TE 4FWDA 4F9AB 1KVKA 1T4NA 3WU3A 2A2DA 3JU0A 2LBSB 1YYKA 4LFCE 4GKJE 4HYMA 4EMDA 4YHHE 1HNXI 1HNWI 5AASA 2L3JA 3ZKBA 4DU7A 3ZZ0A 2YT4A 4DUZE 2LTRA 1YZ9A 2O1WA 1STUA 1H74A 2MDRA 2V2QA 4LF6E 1UEKA 1YYWA 4DR3I 4LTYA 1MX0A 3V5RA 4X66I 5LL6R 4HACB 3J81Q 1ZM9A 1S4EA 2CPNA 3PYGA 3LLHA 3Q6NA 1D6TA 3OMLA 3ZZUA 4USMA 2M4IA 1DQ3A 1Z59A 1T4LB 4DR2E 1X47A 2VQEE 2LRSA 1MG7A 5ADZA 4JYAE 5FWKA 4GKKI 3WU4A 4M0VA 2V8PA 4LF8E 1N34E 5LMNI 3T1YE 4KQVA 4LFAE 1HR0I 1XHKA 4IZKA 4DR7I 4BS9A 1K47A 4USKA 2DIXA 2FV4B 2UUAE 3J7Yp 2Z5CB 1N32E 2WW4A 1UILA 2O1TA 3GONA 3PYDA 4DR4I 2LUPB 1NHIA 4DR5E 3HJCA 4WSPA 3AUZA 4JI4E 4Z7CA 4M1KA 2RS6A 2WZOA 4JI0I 4B3ME 4X64I 2B7TA 2O1UA 2F4VE 1Z0BA 2KOUA 2IOQA 2LTSA 4DV7I 4JI7I 3JAMC 4IZJA 2NUGA 1MU5A 4DKKA 1KKHA 2JOBA 4B3SI 2L33A 5BR8E 4K0KI 1X48A 1XNQI 2V8QB 4DU8A 3H09A 2A2CA 4DV2I 4JI3E 3V2UC 1WUUA 4X62E 4DV4I 2ZM6E 4Q28A 3K6QA 4LFBI 2V87A 1USVA 1N0VC 1N36E 4KHPI 5F3WA 4DV5I 4PRVA 2PNMA 3WU6A 2IOPA 4I3HA 4JI5E 1NZ0A 4B3TI 2V2VA 4I8OA 4DV0E 1O0WA 2B3TB 2L92A 5GMDA 3DJWA 4GKJI 3ZOQB 2VF1A 4YHHI 4PRXA 1B63A 2VE7C 3QT5A 2HK2A 3HULA 4DUZI 1S16A 4L8NA 3LPSA 1YYOA 4JI6E 4DV3E 3OTOE 2E5LI 3JTZA 3P06A 2R3VA 1XMQE 2NPFA 4DPXA 4LF6I 2JWOA 4WFTA 4JV5E 4DMIA 2RSMA 1XMOE 4LF7E 1HK7A 4AQYE 4LF4E 1N0UA 4LF5E 3IWBA 1DARA 2V88A 4HXZA 4DR2I 3J81C 5A2QQ 2VQEI 2LUQA 2ODRC 3B82A 4M30A 4DV6E 3P1XA 4B3RE 2UXCE 2M7QA 5FLXQ 4LF8I 3J7AG 1DI2A 2NUEA 1N34I 3FIGA 4DPWA 4R8OA 2E1RA 3PYFA 3QT7A 3T1YI 5LMUI 2LMZA 1Z0TA 1VISA 1H7UA 4BCAA 1XNRI 3F0NA 5T6JA 2UUAI 3PYEA 2UUBE 2XEXA 4LF9I 4UTGA 4J8ZA 2UUCI 3Q1QA 1PVGA 1RREA 1FKAE 2L2MA 2JOXA 2EFGA 2DEJA 3LTOA 3C4TA 2DB2A 2L6MA 3D4JA 3C4BA 4JI4I 3B8HA 3VYYA 4JI8E 2OI2A 5IT9Q 4B3MI 3DF6A 2HFSA 2MC6A 4NXNE 2IHR1 3CWVA 5DNYA 1HNXE 1HNWE 1Y4SA 2YZTA 4BMJA 2V2ZA 4F9CB 1N33E 2UXDI 2VF3A 1Z0EA 1IBLE 1PKPA 1ZXNA 1HNZE 2HKJA 4GEQB 3K85A 4M2ZA 2V34A 1UHZA 4LU9A 4JI3I 5L3JA 4X66E 2DMYA 3KWRA 2BM1A 4JI2E 2UXBI 2ZM6I 4IZJB 4X65E 4R1FA 1FWKA 2DSYA 1N36I 1FJGE 2B7VA 4DV1I 2HFUA 1EI1A 1KTVA 4DXLA 4DR1I 4DV0I 4WUDA 4BBYA 1ZM4A 2M1SA 5AE1A 3H4LA 3LNUA 4GKKE 1RR9A 2Z5CA 4IZJD 3T1HI 2CZ9A 2HHHI 5LMNE 2PNLA 4OX9E 4FWHA 1HR0E 5AE2A 1RC7A 4YY3E 1IBKI 2V85A 2Z5BB 2LJHA 3HQ1A 1I94E 2LE2A 1WHQA 4NXME 1XMOI 2H36X 2L2KB 4LF7I 4DUYE 5GMEA 4LFCI 1SR9A 2G7HA 1H72C 1KIJA 2DEIA 3ADIA 3K1JA 4DV6I 1GQEA 3HPSA 1OJ4A 2UXCI 2L3CA 2J7KA 4JG4A 4WYQB 4F54A 4F9BB 4PU9A 2Q2EB 2N3HA 1IBME 2N3GA 2EWLA 4JI7E 4DV7E 2UU9E 4KZSA 3M6AA 5A2QC 1J26A 3J80Q 2FGGA 1XNQE 1NHJA 4RPFA 1ELOA 5FLXC 2UUBI 3F6HA 2HK3A 2VQFE 4P52A 4MYUA 4P7AA 4LFBE 3B78A 2MC5A 1Z5AA 4WUBA 4XTJA 4DR6E 4KHPE 1FI4A 4JYAI 4BC9A 4WPYA 1EA6A 1Z5BA 4JI8I 1GZ6A 4LFAI 1J5EE 4NXNI 1EKZA 4P7DA 3ADJA 2BM0A 1ZXMA 3IWCA 4DPTA 1N32I 1QU6A 4FW9A 1N33I 5IWAE 2LJPA 4R03A 1IBLI 1Z0CA 4IZKB 2E5LE 1QZRA 1HNZI 5IT9C 2BV3A 4DR5I 3J7AM 1X49A 3HTXA 5AE3A 4FWGA 4JI1E 4JI2I 3MSWA 3RMPA 4X65I 3F6GA 3QT8A 1RQ0A 1WHNA 3VK6A 3AV0A 4UT4A 4TUGA 1FJGI 2V86A 4OOGC 2F4VI 4FN5A 1ZBQA 4P78A 4HACA 3ZKDA 5BR8I 4HY1A 4TUIA 2RS7A 4L5NC 2Z5EA 4DR3E 4X62I 4OX9I 2ODRD 5LMUE 2O1VA 3ZM7A 4DPYA 4YY3I 2CG9A 2X36A 3PRYA 3QT6A 3HXLA 1XNRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 I;  3ADG A;  1Z0W A;  4NXM I;  1Z0G A;  4JI5 I;  1ZM3 A;  2L2N A;  3WU5 A;  4DUY I;  4LF9 E;  2UUC E;  1ZM2 A;  1A6F A;  3ZZT A;  1U2R A;  1BKN A;  3K17 A;  4MYT A;  1FWL A;  2EZ6 A;  2JVA A;  4JI6 I;  4DV3 I;  3OTO I;  3VYX A;  1XMQ I;  1Z5C A;  4DR7 E;  3ADL A;  1H73 A;  1PIE A;  1IBM I;  4JV5 I;  4WUC A;  2UU9 I;  2UXD E;  2HKE A;  4DR4 E;  1ZBT A;  4AQY I;  4DPU A;  2NA2 A;  2RTX A;  1FNM A;  4LF4 I;  1T4O A;  4ED4 A;  4LF5 I;  4ZVI A;  2GS8 A;  2VQF I;  3JAM Q;  2UXB E;  2ZIT A;  1B62 A;  2ZBK B;  2X7I A;  4JI0 E;  4DR6 I;  4B3R I;  4X64 E;  3J80 C;  1NHH A;  2R42 A;  4DV1 E;  4DR1 E;  2JY9 A;  1Z0V A;  1J5E I;  2KHX A;  4Z7Y A;  4B3S E;  1H7S A;  5CFF E;  4K0K E;  4DV2 E;  2NUF A;  3T1H E;  2HHH E;  5IWA I;  2AJ4 A;  4DV4 E;  1IBK E;  4JI1 I;  4URL A;  4DV5 E;  4X8W A;  4B3T E;  4FWD A;  1KVK A;  1T4N A;  3WU3 A;  2A2D A;  1YYK A;  2LBS B;  4LFC E;  4GKJ E;  4HYM A;  4EMD A;  4YHH E;  1HNX I;  1HNW I;  2L3J A;  3ZKB A;  4DU7 A;  3ZZ0 A;  2YT4 A;  4DUZ E;  2LTR A;  1YZ9 A;  1STU A;  1H74 A;  2MDR A;  2V2Q A;  4LF6 E;  1UEK A;  1YYW A;  4DR3 I;  1MX0 A;  3V5R A;  4X66 I;  5LL6 R;  4HAC B;  3J81 Q;  1ZM9 A;  1S4E A;  3PYG A;  2CPN A;  3LLH A;  1D6T A;  3ZZU A;  4USM A;  1Z59 A;  1T4L B;  4DR2 E;  1X47 A;  2VQE E;  2LRS A;  1MG7 A;  4JYA E;  4GKK I;  3WU4 A;  2V8P A;  4LF8 E;  1N34 E;  5LMN I;  3T1Y E;  4KQV A;  4LFA E;  1HR0 I;  1XHK A;  4DR7 I;  1K47 A;  4USK A;  2DIX A;  2UUA E;  3J7Y p;  1N32 E;  2WW4 A;  1UIL A;  3PYD A;  3GON A;  4DR4 I;  2LUP B;  1NHI A;  4DR5 E;  4JI4 E;  4Z7C A;  4M1K A;  2RS6 A;  4JI0 I;  4B3M E;  4X64 I;  2B7T A;  2F4V E;  1Z0B A;  2LTS A;  4DV7 I;  4JI7 I;  3JAM C;  2NUG A;  1MU5 A;  4DKK A;  1KKH A;  4B3S I;  2L33 A;  5BR8 E;  4K0K I;  1X48 A;  1XNQ I;  4DV2 I;  4DU8 A;  2A2C A;  4JI3 E;  3V2U C;  1WUU A;  4X62 E;  4DV4 I;  2ZM6 E;  4LFB I;  1N0V C;  1N36 E;  4KHP I;  4DV5 I;  4PRV A;  3WU6 A;  4I3H A;  4JI5 E;  1NZ0 A;  4B3T I;  2V2V A;  4DV0 E;  1O0W A;  2B3T B;  5GMD A;  4GKJ I;  4YHH I;  4PRX A;  1B63 A;  3QT5 A;  2HK2 A;  3HUL A;  4DUZ I;  1S16 A;  3LPS A;  1YYO A;  4JI6 E;  4DV3 E;  3OTO E;  2E5L I;  2R3V A;  1XMQ E;  2NPF A;  4DPX A;  4LF6 I;  4WFT A;  4JV5 E;  2RSM A;  1XMO E;  4LF7 E;  4AQY E;  4LF4 E;  1N0U A;  4LF5 E;  1DAR A;  4HXZ A;  4DR2 I;  3J81 C;  5A2Q Q;  2VQE I;  2LUQ A;  3B82 A;  4M30 A;  4DV6 E;  3P1X A;  4B3R E;  2UXC E;  5FLX Q;  4LF8 I;  1DI2 A;  3J7A G;  2NUE A;  1N34 I;  4DPW A;  3T1Y I;  2E1R A;  3PYF A;  3QT7 A;  5LMU I;  1Z0T A;  1VIS A;  1H7U A;  1XNR I;  3F0N A;  2UUA I;  3PYE A;  2UUB E;  2XEX A;  4LF9 I;  4UTG A;  3Q1Q A;  2UUC I;  1PVG A;  1RRE A;  1FKA E;  2L2M A;  2EFG A;  2DEJ A;  3LTO A;  3C4T A;  2DB2 A;  3D4J A;  3C4B A;  4JI4 I;  3B8H A;  3VYY A;  4JI8 E;  2OI2 A;  5IT9 Q;  4B3M I;  2HFS A;  4NXN E;  3CWV A;  2IHR 1;  1HNX E;  1HNW E;  2V2Z A;  1N33 E;  2UXD I;  2VF3 A;  1Z0E A;  1IBL E;  1PKP A;  1ZXN A;  1HNZ E;  2HKJ A;  4M2Z A;  2V34 A;  1UHZ A;  4JI3 I;  5L3J A;  4X66 E;  2DMY A;  2BM1 A;  4JI2 E;  2UXB I;  2ZM6 I;  4X65 E;  4R1F A;  1FWK A;  1N36 I;  1FJG E;  2B7V A;  4DV1 I;  2HFU A;  1EI1 A;  1KTV A;  4DXL A;  4DR1 I;  4DV0 I;  4WUD A;  1ZM4 A;  3H4L A;  3LNU A;  4GKK E;  1RR9 A;  3T1H I;  2CZ9 A;  2HHH I;  5LMN E;  4OX9 E;  4FWH A;  1HR0 E;  1RC7 A;  4YY3 E;  1IBK I;  2LJH A;  1I94 E;  1WHQ A;  4NXM E;  1XMO I;  4LF7 I;  2L2K B;  4DUY E;  5GME A;  4LFC I;  1H72 C;  1KIJ A;  2DEI A;  3ADI A;  3K1J A;  4DV6 I;  1GQE A;  1OJ4 A;  2UXC I;  2L3C A;  2J7K A;  4JG4 A;  4WYQ B;  4PU9 A;  2Q2E B;  2N3H A;  1IBM E;  2N3G A;  2UU9 E;  4JI7 E;  4DV7 E;  3M6A A;  1J26 A;  5A2Q C;  3J80 Q;  1XNQ E;  1NHJ A;  4RPF A;  1ELO A;  5FLX C;  2UUB I;  2HK3 A;  2VQF E;  4P52 A;  4MYU A;  4P7A A;  4LFB E;  3B78 A;  1Z5A A;  4WUB A;  4XTJ A;  4DR6 E;  4KHP E;  1FI4 A;  4JYA I;  1EA6 A;  1Z5B A;  4JI8 I;  4LFA I;  1J5E E;  4NXN I;  1EKZ A;  3ADJ A;  2BM0 A;  1ZXM A;  4DPT A;  1N32 I;  1QU6 A;  4FW9 A;  1N33 I;  5IWA E;  2LJP A;  1IBL I;  1Z0C A;  2E5L E;  1QZR A;  1HNZ I;  5IT9 C;  2BV3 A;  4DR5 I;  3J7A M;  1X49 A;  3HTX A;  4FWG A;  4JI1 E;  4JI2 I;  4X65 I;  3QT8 A;  1RQ0 A;  1WHN A;  4UT4 A;  1FJG I;  4OOG C;  2F4V I;  4FN5 A;  4HAC A;  3ZKD A;  5BR8 I;  4HY1 A;  2RS7 A;  4DR3 E;  4X62 I;  4OX9 I;  5LMU E;  3ZM7 A;  4DPY A;  4YY3 I;  2X36 A;  3QT6 A;  1XNR E; 
#chains in the Genus database with same CATH topology
 1I94 I;  3ADG A;  1Z0W A;  4MU4 A;  4NXM I;  1Z0G A;  3LML A;  4JI5 I;  1ZM3 A;  2L2N A;  2E1M A;  2L8T A;  2F8B A;  3WU5 A;  4DUY I;  4QNJ A;  4LF9 E;  4LCH A;  2UUC E;  1ZM2 A;  1AH5 A;  4F6N A;  1A6F A;  3ZZT A;  1U2R A;  2EPP A;  1Y6Z A;  1BKN A;  3K17 A;  4MYT A;  2D9H A;  2O3Z A;  1FWL A;  3Q6M A;  2EZ6 A;  2JVA A;  4JI6 I;  4DV3 I;  3OTO I;  2WNR B;  4IFD A;  2EPR A;  3VYX A;  5K36 D;  2C39 A;  1XMQ I;  5JEA C;  1Z5C A;  4N3O A;  4DR7 E;  2WCC 3;  2B9D A;  2GQ0 A;  3ADL A;  1SFE A;  4BC7 A;  1H73 A;  1PIE A;  1IBM I;  4JV5 I;  4WUC A;  4BA2 B;  2UU9 I;  1R6L A;  4O24 A;  1Y4U A;  2UXD E;  2HKE A;  4DR4 E;  1ZBT A;  4AQY I;  3EPJ A;  1IQO A;  1WXR A;  1WJP A;  1YUI A;  2NA2 A;  2RTX A;  2YTJ A;  1FNM A;  4DPU A;  5C0X A;  1T4O A;  4LF4 I;  4ED4 A;  2PO0 B;  2EN6 A;  2EMG A;  2V89 A;  2JE6 B;  4ZVI A;  4LF5 I;  2GS8 A;  3M7N D;  2EOQ A;  2YTP A;  2YTN A;  2CGE A;  3L7Z A;  2VQF I;  2JR1 A;  2NN6 C;  2EOH A;  2HGH A;  2BA0 G;  5DRO A;  2UXB E;  3JAM Q;  4OO1 E;  2YTG A;  2ZIT A;  2JEB B;  1B62 A;  2ZBK B;  2X7I A;  4JI0 E;  2ENC A;  2NN6 F;  4DR6 I;  2WBT A;  4B3R I;  4X64 E;  4WSG A;  3J80 C;  1NHH A;  2KON A;  2EN4 A;  2R42 A;  4DV1 E;  4MDT A;  4DR1 E;  2JY9 A;  1Z0V A;  1J5E I;  2KHX A;  2C37 A;  5TSE A;  4Z7Y A;  4B3S E;  1H7S A;  2EOM A;  5CFF E;  1USU A;  2FTX B;  1ZAA C;  2EN1 A;  2BA0 D;  4K0K E;  1OYP A;  2Z5B A;  3B4T A;  3IWD A;  3EPL A;  4DV2 E;  2M9A A;  2K4V A;  1TF3 A;  1BBG A;  2NUF A;  3T1H E;  2LO3 A;  2HHH E;  5IWA I;  4ZYH A;  2AJ4 A;  4MU3 A;  4DV4 E;  2V83 A;  2PO2 A;  1KYQ A;  5JEA A;  4ISA A;  1IBK E;  4JI1 I;  4URL A;  4DV5 E;  3HPZ A;  5EL9 A;  4X8W A;  2J7J A;  4B3T E;  1RHY A;  4FWD A;  2YRH A;  4F9A B;  1KVK A;  1T4N A;  3WU3 A;  2A2D A;  3JU0 A;  4F6M A;  2LBS B;  1YYK A;  4LFC E;  4GKJ E;  4HYM A;  4EMD A;  4WX9 A;  4YHH E;  1HNX I;  1HNW I;  2ADR A;  5AAS A;  2PO1 B;  5K36 E;  2L3J A;  3ZKB A;  4DU7 A;  3ZZ0 A;  2GLI A;  2NN6 A;  2YT4 A;  4DUZ E;  2I13 A;  2EMY A;  3P3C A;  2GPI A;  1WRJ A;  4IS9 A;  2LTR A;  2UU9 E;  3THN A;  1STU A;  3C6K A;  2EMZ A;  4F2J C;  1YZ9 A;  1H74 A;  1UDS A;  2O1W A;  2EMX A;  1UN6 B;  2EL5 A;  4QNK A;  4BA1 A;  2MDR A;  2EM5 A;  2V2Q A;  1X5W A;  4LF6 E;  1YYW A;  1UEK A;  4DR3 I;  4LTY A;  4M9V C;  1MX0 A;  3V5R A;  4X66 I;  5LL6 R;  1YHC A;  4R2A A;  2GO3 A;  4HAC B;  3J81 Q;  1ZM9 A;  1S4E A;  2CPN A;  3PYG A;  3LLH A;  1YUJ A;  3Q6N A;  4OKG A;  1X6F A;  2EPC A;  5A69 A;  4OO1 D;  2EOO A;  2LT7 A;  1D6T A;  3OML A;  4IFD F;  3ZZU A;  4USM A;  2M4I A;  1OYS A;  1DQ3 A;  2YTQ A;  3P3G A;  1Z59 A;  2BB8 A;  5A6B A;  1T4L B;  4DR2 E;  2BA1 D;  1X47 A;  4LCG A;  1X6E A;  2VQE E;  2LRS A;  1MG7 A;  5ADZ A;  4JYA E;  5FWK A;  4GKK I;  3MHH C;  3WU4 A;  4HEI A;  4M0V A;  2V8P A;  4LF8 E;  2YRM A;  1N34 E;  5LMN I;  4MU1 A;  3T1Y E;  4KQV A;  4LFA E;  4LPF A;  5C0X F;  2YTE A;  3M99 B;  1HR0 I;  2JPA A;  1XHK A;  5KL4 A;  4IZK A;  4DR7 I;  4BS9 A;  1K47 A;  3PS3 A;  4USK A;  2JEA B;  3TQM A;  2DIX A;  1RMD A;  2FV4 B;  2UUA E;  3J7Y p;  2Z5C B;  3UHM A;  2RQL A;  2EOJ A;  1N32 E;  2WW4 A;  2PNZ A;  4NZV A;  1UIL A;  2N8X A;  5A6A A;  2EL6 A;  2O1T A;  3GON A;  3PYD A;  4DR4 I;  2EMK A;  2C39 B;  1B69 A;  2LUP B;  1Y5Y A;  1NHI A;  4DR5 E;  2YWQ A;  3H1C A;  3HJC A;  1XXE A;  4WSP A;  5AC4 A;  3AUZ A;  4JI4 E;  5DRQ A;  2K7I A;  3M7N G;  1PJQ A;  5ELW A;  4Z7C A;  4R2C A;  4M1K A;  2RS6 A;  5LLQ A;  2WZO A;  2E72 A;  4JI0 I;  4B3M E;  2EOI A;  4X64 I;  2B7T A;  2O1U A;  3L7Z B;  2DRP A;  3QG5 C;  2F4V E;  1MGT A;  2EPK X;  1Z0B A;  2KOU A;  2YTD A;  2IOQ A;  2LTS A;  4DV7 I;  5JEA F;  3JAM C;  1KJK A;  1AAY A;  4IZJ A;  4R2E A;  2R1F A;  2NUG A;  1MU5 A;  4DKK A;  1KKH A;  1UDN A;  2JOB A;  4B3S I;  2L33 A;  2YTO A;  5BR8 E;  4AM3 A;  5AC5 A;  4K0K I;  1X48 A;  1XNQ I;  2V8Q B;  4DU8 A;  2Q8U A;  3H09 A;  2A2C A;  2BR2 A;  4DV2 I;  4JI3 E;  4MQY A;  3V2U C;  1WUU A;  2MKN A;  4X62 E;  4WXD A;  4DV4 I;  2ZM6 E;  2C37 B;  4Q28 A;  3K6Q A;  4LFB I;  2PRT A;  2V87 A;  1USV A;  1Y60 A;  1N0V C;  3BBG A;  1N36 E;  4KHP I;  1A1J A;  4O4K A;  2IER A;  5F3W A;  4DV5 I;  2C38 A;  4PRV A;  2PNM A;  3WU6 A;  2IOP A;  4BHB A;  4I3H A;  4JI5 E;  2YRK A;  1NZ0 A;  4B3T I;  2V2V A;  5JEA D;  4I8O A;  4DV0 E;  4R2R A;  2WNR A;  1O0W A;  2B3T B;  2L92 A;  5GMD A;  3DJW A;  1F2I G;  4GKJ I;  3ZOQ B;  2VF1 A;  4YHH I;  1A1H A;  1B63 A;  1A1L A;  4PRX A;  2EM6 A;  2VE7 C;  3QT5 A;  5DRP A;  2HK2 A;  3HUL A;  4DUZ I;  4JI7 I;  2EPN A;  2LJU A;  1S16 A;  4L8N A;  2EOR A;  4R2D A;  3LPS A;  4GQU A;  1YYO A;  4JI6 E;  4DV3 E;  3OTO E;  2E5L I;  3JTZ A;  3P06 A;  1NEI A;  4FK5 C;  3MHS C;  1XMQ E;  4Q35 B;  2R3V A;  3CDJ A;  2NPF A;  4DPX A;  4LF6 I;  3P3E A;  1IMU A;  4FW4 A;  2JWO A;  4WFT A;  2NN6 B;  5A6K A;  4JV5 E;  4OO1 C;  4DMI A;  2EMB A;  2RSM A;  1XMO E;  4LF7 E;  2HC5 A;  1HK7 A;  1A1K A;  2EQ1 A;  4AQY E;  2EML A;  3EPH A;  3GME A;  4LF4 E;  4BA1 B;  1N0U A;  2EJ4 A;  4KWY A;  1TN9 A;  4LF5 E;  3IWB A;  2EM4 A;  1DAR A;  2DLK A;  3ECR A;  2WBU A;  2V88 A;  4HXZ A;  2YU5 A;  4DR2 I;  4IFD E;  3J81 C;  2ELZ A;  5A2Q Q;  2VQE I;  2LUQ A;  2ODR C;  3B82 A;  2NN6 D;  4M30 A;  4DV6 E;  3P1X A;  4B3R E;  2UXC E;  2M7Q A;  2ENH A;  3KRN A;  1QNT A;  4R2P A;  5FLX Q;  2BA1 G;  3J7A G;  1DI2 A;  2NUE A;  4LF8 I;  1N34 I;  3FIG A;  1P47 A;  4DPW A;  4R8O A;  2E1R A;  3PYF A;  3QT7 A;  3T1Y I;  2A25 A;  5LMU I;  4U3B A;  2LMZ A;  3U1Y A;  1Z0T A;  1VIS A;  2EM2 A;  2EMI A;  1G2F C;  2I9I A;  3BID A;  4AIM A;  1H7U A;  4FW3 A;  5C0X E;  4BCA A;  2EPZ A;  2JP9 A;  3F0N A;  5T6J A;  1XNR I;  2UUA I;  1JK1 A;  3PYE A;  2EQ0 A;  2HJJ A;  2UUB E;  2EMW A;  2XEX A;  4LF9 I;  4FW6 A;  4UTG A;  4J8Z A;  2UUC I;  3BF2 A;  2EM9 A;  1BB8 A;  1PVG A;  1RRE A;  3Q1Q A;  1FKA E;  1A1G A;  2L2M A;  2JOX A;  2EFG A;  2DEJ A;  1T39 A;  3LTO A;  3C4T A;  5KL2 A;  5K36 C;  2DB2 A;  2L6M A;  3D4J A;  3C4B A;  2EP3 A;  2PNZ B;  4JI4 I;  3KZY A;  4MLQ A;  5A6J A;  1A1I A;  3B8H A;  3P76 A;  4OO1 A;  1YSA C;  3VYY A;  1DGC A;  4JI8 E;  2OI2 A;  1VI7 A;  4X9J A;  5IT9 Q;  4B3M I;  3DF6 A;  5K36 F;  2DGC A;  2HFS A;  2MC6 A;  4NXN E;  2IHR 1;  3CWV A;  5DRR A;  2VRD A;  5DNY A;  4BHC A;  1HNX E;  1HNW E;  1Y4S A;  2WP8 A;  2YZT A;  4BMJ A;  2V2Z A;  3VHT B;  1E3H A;  4WXC A;  1PJS A;  4F9C B;  1N33 E;  3M85 G;  4IFD B;  2UXD I;  2VF3 A;  4AID A;  1Z0E A;  1IBL E;  1PKP A;  1ZXN A;  1HNZ E;  2HKJ A;  3PS1 A;  4GEQ B;  3K85 A;  5JEA E;  1YH8 A;  1ZU1 A;  4M2Z A;  3GLL A;  2V34 A;  1UHZ A;  1YFH A;  4LU9 A;  4JI3 I;  5L3J A;  2LV2 A;  2EM3 A;  4X66 E;  2DMY A;  3KWR A;  2BM1 A;  4JI2 E;  2UXB I;  2ZM6 I;  4IZJ B;  4X65 E;  4R1F A;  4NBQ A;  1NCS A;  2EN2 A;  1FWK A;  5C0X B;  2DSY A;  2YSO A;  3THO B;  4MU0 A;  1N36 I;  1EH8 A;  2MDG A;  1T38 A;  1FJG E;  2B7V A;  2EN7 A;  3M85 D;  4DV1 I;  2HFU A;  4IFD D;  1EI1 A;  1KTV A;  2J65 A;  2NN6 E;  4DXL A;  2EOF A;  4DR1 I;  4DV0 I;  5IXM B;  4WUD A;  4BBY A;  1ZM4 A;  2MKD A;  3PS2 A;  1TF6 A;  2M1S A;  5AE1 A;  3H4L A;  2C38 B;  3LNU A;  2JEA A;  4GKK E;  1OYR A;  5K36 A;  1RR9 A;  2Z5C A;  4IZJ D;  3T1H I;  3HKM A;  4R2S A;  2CZ9 A;  2HHH I;  2EPA A;  5LMN E;  2PNL A;  5C0X D;  2EMA A;  4ZYG A;  4OX9 E;  2IES A;  1HR0 E;  4FWH A;  5AE2 A;  1RC7 A;  4IJD A;  4YY3 E;  2BBG A;  1R6M A;  4ZYE A;  2EPO A;  1IBK I;  2V85 A;  2Z5B B;  2LJH A;  3HQ1 A;  4O5G A;  3L00 A;  2LE2 A;  2EL4 A;  2EOX A;  1I94 E;  1WHQ A;  4NXM E;  1XMO I;  2H36 X;  2L2K B;  4LF7 I;  2YU8 A;  4DUY E;  2PO2 B;  2GHF A;  2RSI A;  4NHR A;  3DD6 A;  5GME A;  4LCF A;  4LFC I;  1X3C A;  5JEA B;  1UBD C;  1SR9 A;  2G7H A;  4ZYD A;  2YTI A;  1MEY C;  1H72 C;  3NZK A;  1KIJ A;  4HTG A;  2DEI A;  4BA2 A;  3ADI A;  1X6H A;  4J3D A;  2EN3 A;  5DNL A;  3U1K A;  3K1J A;  4DV6 I;  1GQE A;  3HPS A;  1OJ4 A;  2UXC I;  2L3C A;  2PO0 A;  2J7K A;  2JE6 A;  1E3P A;  4GZN C;  4JG4 A;  4WYQ B;  4F54 A;  2JXP A;  4F9B B;  4PU9 A;  2Q2E B;  2N3H A;  1IBM E;  1JK2 A;  2N3G A;  2EMF A;  2EWL A;  2LVH A;  4RHB B;  4JI7 E;  2EPU A;  5KL7 A;  3BGH A;  4KZS A;  4DV7 E;  4FW5 A;  3C6M A;  2EM8 A;  2JEB A;  1N3G A;  3M6A A;  5A2Q C;  3UK3 C;  1J26 A;  2DMI A;  2LCE A;  2GO4 A;  5KL3 A;  4IS1 C;  2FGG A;  3J80 Q;  4OO1 F;  1ZR9 A;  1XNQ E;  1NHJ A;  1ELO A;  2AE8 A;  4RPF A;  5FLX C;  2VES A;  2UUB I;  3F6H A;  2HK3 A;  2VQF E;  1GTK A;  4P52 A;  2EE8 A;  2CTD A;  4MYU A;  4P7A A;  4LFB E;  3B78 A;  2MC5 A;  2EQ3 A;  5KL5 A;  1Z5A A;  4WUB A;  2ENA A;  4DR6 E;  4KHP E;  1FI4 A;  4XTJ A;  1UDO A;  4JYA I;  2DLQ A;  4RH8 A;  2R76 A;  4BC9 A;  4WPY A;  1EA6 A;  2EPM X;  4FW7 A;  1Z5B A;  4JI8 I;  1IQS A;  1GZ6 A;  2CSH A;  2EM0 A;  5KL6 A;  4U3D A;  4LFA I;  1J5E E;  4NXN I;  2EN8 A;  1EKZ A;  4P7D A;  3ADJ A;  2EMC A;  2BM0 A;  1A1F A;  1ZXM A;  3IWC A;  3KZZ A;  3CDI A;  1QU6 A;  4DPT A;  4OO1 B;  4FW9 A;  1N32 I;  2EPL X;  2YTF A;  2EPX A;  5IWA E;  2LJP A;  1N33 I;  4R03 A;  2EMH A;  1IBL I;  1Z0C A;  1UDQ A;  4IZK B;  2E5L E;  1QZR A;  1HNZ I;  5IT9 C;  4N4R B;  2BV3 A;  2EM7 A;  4DR5 I;  3J7A M;  1X49 A;  2WP8 B;  3HTX A;  2RPC A;  5AE3 A;  4FWG A;  4JI1 E;  4JI2 I;  2PO1 A;  5A6B D;  3MSW A;  2JT2 A;  3RMP A;  4OZE A;  3F6G A;  4X65 I;  3QT8 A;  1RQ0 A;  3GCM A;  2WBS A;  4IFD C;  1WHN A;  4R2Q A;  3VK6 A;  3AV0 A;  4UT4 A;  1L4S A;  4TUG A;  2F1D A;  2ELY A;  1FJG I;  1PJT A;  2V86 A;  4OOG C;  2NAB A;  2F4V I;  1G2D C;  4FN5 A;  2EOE A;  1ZBQ A;  2YSP A;  2EOS A;  4P78 A;  4HAC A;  5DNX A;  3ZKD A;  5C0X C;  3EPK A;  5BR8 I;  3EQ1 A;  2JYA A;  4HY1 A;  1Z1B A;  2CT1 A;  4TUI A;  4LOM A;  1PDA A;  4O43 A;  1YPN A;  2RS7 A;  4L5N C;  2YPN A;  2EOY A;  2Z5E A;  5IV8 B;  4DR3 E;  5EKW A;  1P42 A;  2CVE A;  4X62 I;  1LLM C;  4OX9 I;  2ODR D;  5LMU E;  2O1V A;  1EH7 A;  3ZM7 A;  2EOZ A;  4DPY A;  1EH6 A;  4YY3 I;  2CG9 A;  2X36 A;  3PRY A;  1BBO A;  3QT6 A;  4MLV A;  3HXL A;  1XNR E;  5K36 B;  2BR2 B; 
#chains in the Genus database with same CATH homology
 1I94 I;  3ADG A;  1Z0W A;  4NXM I;  1Z0G A;  3LML A;  4JI5 I;  1ZM3 A;  2L2N A;  2E1M A;  2L8T A;  2F8B A;  3WU5 A;  4DUY I;  4LF9 E;  2UUC E;  1ZM2 A;  1A6F A;  3ZZT A;  1U2R A;  1Y6Z A;  1BKN A;  3K17 A;  4MYT A;  1FWL A;  3Q6M A;  2EZ6 A;  2JVA A;  4JI6 I;  4DV3 I;  3OTO I;  3VYX A;  1XMQ I;  1Z5C A;  4N3O A;  4DR7 E;  2B9D A;  2GQ0 A;  3ADL A;  4BC7 A;  1H73 A;  1PIE A;  1IBM I;  4JV5 I;  4WUC A;  2UU9 I;  1Y4U A;  2UXD E;  2HKE A;  4DR4 E;  1ZBT A;  4AQY I;  4DPU A;  1WXR A;  2NA2 A;  2RTX A;  1FNM A;  4LF4 I;  1T4O A;  4ED4 A;  2V89 A;  4LF5 I;  4ZVI A;  2GS8 A;  2CGE A;  2VQF I;  2JR1 A;  3JAM Q;  2UXB E;  2ZIT A;  1B62 A;  2ZBK B;  2X7I A;  4JI0 E;  4DR6 I;  4B3R I;  4X64 E;  3J80 C;  1NHH A;  2KON A;  2R42 A;  4DV1 E;  4DR1 E;  2JY9 A;  1Z0V A;  1J5E I;  2KHX A;  4Z7Y A;  4B3S E;  1H7S A;  5CFF E;  1USU A;  2FTX B;  2Z5B A;  4K0K E;  3IWD A;  4DV2 E;  2NUF A;  2K4V A;  3T1H E;  2HHH E;  5IWA I;  2AJ4 A;  4DV4 E;  2V83 A;  1IBK E;  4JI1 I;  4URL A;  4DV5 E;  3HPZ A;  4X8W A;  4B3T E;  4FWD A;  4F9A B;  1KVK A;  1T4N A;  3WU3 A;  2A2D A;  3JU0 A;  2LBS B;  1YYK A;  4LFC E;  4GKJ E;  4HYM A;  4EMD A;  4YHH E;  1HNX I;  1HNW I;  5AAS A;  2L3J A;  3ZKB A;  4DU7 A;  3ZZ0 A;  2YT4 A;  4DUZ E;  2LTR A;  1YZ9 A;  2O1W A;  1STU A;  1H74 A;  2MDR A;  2V2Q A;  4LF6 E;  1UEK A;  1YYW A;  4DR3 I;  4LTY A;  1MX0 A;  3V5R A;  4X66 I;  5LL6 R;  4HAC B;  3J81 Q;  1ZM9 A;  1S4E A;  2CPN A;  3PYG A;  3LLH A;  3Q6N A;  1D6T A;  3OML A;  3ZZU A;  4USM A;  2M4I A;  1DQ3 A;  1Z59 A;  1T4L B;  4DR2 E;  1X47 A;  2VQE E;  2LRS A;  1MG7 A;  5ADZ A;  4JYA E;  5FWK A;  4GKK I;  3WU4 A;  4M0V A;  2V8P A;  4LF8 E;  1N34 E;  5LMN I;  3T1Y E;  4KQV A;  4LFA E;  1HR0 I;  1XHK A;  4IZK A;  4DR7 I;  4BS9 A;  1K47 A;  4USK A;  2DIX A;  2FV4 B;  2UUA E;  3J7Y p;  2Z5C B;  1N32 E;  2WW4 A;  1UIL A;  2O1T A;  3GON A;  3PYD A;  4DR4 I;  2LUP B;  1NHI A;  4DR5 E;  3HJC A;  4WSP A;  3AUZ A;  4JI4 E;  4Z7C A;  4M1K A;  2RS6 A;  2WZO A;  4JI0 I;  4B3M E;  4X64 I;  2B7T A;  2O1U A;  2F4V E;  1Z0B A;  2KOU A;  2IOQ A;  2LTS A;  4DV7 I;  4JI7 I;  3JAM C;  4IZJ A;  2NUG A;  1MU5 A;  4DKK A;  1KKH A;  2JOB A;  4B3S I;  2L33 A;  5BR8 E;  4K0K I;  1X48 A;  1XNQ I;  2V8Q B;  4DU8 A;  3H09 A;  2A2C A;  4DV2 I;  4JI3 E;  3V2U C;  1WUU A;  4X62 E;  4DV4 I;  2ZM6 E;  4Q28 A;  3K6Q A;  4LFB I;  2V87 A;  1USV A;  1N0V C;  1N36 E;  4KHP I;  5F3W A;  4DV5 I;  4PRV A;  2PNM A;  3WU6 A;  2IOP A;  4I3H A;  4JI5 E;  1NZ0 A;  4B3T I;  2V2V A;  4I8O A;  4DV0 E;  1O0W A;  2B3T B;  2L92 A;  5GMD A;  3DJW A;  4GKJ I;  3ZOQ B;  2VF1 A;  4YHH I;  4PRX A;  1B63 A;  2VE7 C;  3QT5 A;  2HK2 A;  3HUL A;  4DUZ I;  1S16 A;  4L8N A;  3LPS A;  1YYO A;  4JI6 E;  4DV3 E;  3OTO E;  2E5L I;  3JTZ A;  3P06 A;  2R3V A;  1XMQ E;  2NPF A;  4DPX A;  4LF6 I;  2JWO A;  4WFT A;  4JV5 E;  4DMI A;  2RSM A;  1XMO E;  4LF7 E;  1HK7 A;  4AQY E;  4LF4 E;  1N0U A;  4LF5 E;  3IWB A;  1DAR A;  2V88 A;  4HXZ A;  4DR2 I;  3J81 C;  5A2Q Q;  2VQE I;  2LUQ A;  2ODR C;  3B82 A;  4M30 A;  4DV6 E;  3P1X A;  4B3R E;  2UXC E;  2M7Q A;  5FLX Q;  4LF8 I;  3J7A G;  1DI2 A;  2NUE A;  1N34 I;  3FIG A;  4DPW A;  4R8O A;  2E1R A;  3PYF A;  3QT7 A;  3T1Y I;  5LMU I;  2LMZ A;  1Z0T A;  1VIS A;  1H7U A;  4BCA A;  1XNR I;  3F0N A;  5T6J A;  2UUA I;  3PYE A;  2UUB E;  2XEX A;  4LF9 I;  4UTG A;  4J8Z A;  2UUC I;  3Q1Q A;  1PVG A;  1RRE A;  1FKA E;  2L2M A;  2JOX A;  2EFG A;  2DEJ A;  3LTO A;  3C4T A;  2DB2 A;  2L6M A;  3D4J A;  3C4B A;  4JI4 I;  3B8H A;  3VYY A;  4JI8 E;  2OI2 A;  5IT9 Q;  4B3M I;  3DF6 A;  2HFS A;  2MC6 A;  4NXN E;  2IHR 1;  3CWV A;  5DNY A;  1HNX E;  1HNW E;  1Y4S A;  2YZT A;  4BMJ A;  2V2Z A;  4F9C B;  1N33 E;  2UXD I;  2VF3 A;  1Z0E A;  1IBL E;  1PKP A;  1ZXN A;  1HNZ E;  2HKJ A;  4GEQ B;  3K85 A;  4M2Z A;  2V34 A;  1UHZ A;  4LU9 A;  4JI3 I;  5L3J A;  4X66 E;  2DMY A;  3KWR A;  2BM1 A;  4JI2 E;  2UXB I;  2ZM6 I;  4IZJ B;  4X65 E;  4R1F A;  1FWK A;  2DSY A;  1N36 I;  1FJG E;  2B7V A;  4DV1 I;  2HFU A;  1EI1 A;  1KTV A;  4DXL A;  4DR1 I;  4DV0 I;  4WUD A;  4BBY A;  1ZM4 A;  2M1S A;  5AE1 A;  3H4L A;  3LNU A;  4GKK E;  1RR9 A;  2Z5C A;  4IZJ D;  3T1H I;  2CZ9 A;  2HHH I;  5LMN E;  2PNL A;  4OX9 E;  4FWH A;  1HR0 E;  5AE2 A;  1RC7 A;  4YY3 E;  1IBK I;  2V85 A;  2Z5B B;  2LJH A;  3HQ1 A;  1I94 E;  2LE2 A;  1WHQ A;  4NXM E;  1XMO I;  2H36 X;  2L2K B;  4LF7 I;  4DUY E;  5GME A;  4LFC I;  1SR9 A;  2G7H A;  1H72 C;  1KIJ A;  2DEI A;  3ADI A;  3K1J A;  4DV6 I;  1GQE A;  3HPS A;  1OJ4 A;  2UXC I;  2L3C A;  2J7K A;  4JG4 A;  4WYQ B;  4F54 A;  4F9B B;  4PU9 A;  2Q2E B;  2N3H A;  1IBM E;  2N3G A;  2EWL A;  4JI7 E;  4DV7 E;  2UU9 E;  4KZS A;  3M6A A;  5A2Q C;  1J26 A;  3J80 Q;  2FGG A;  1XNQ E;  1NHJ A;  4RPF A;  1ELO A;  5FLX C;  2UUB I;  3F6H A;  2HK3 A;  2VQF E;  4P52 A;  4MYU A;  4P7A A;  4LFB E;  3B78 A;  2MC5 A;  1Z5A A;  4WUB A;  4XTJ A;  4DR6 E;  4KHP E;  1FI4 A;  4JYA I;  4BC9 A;  4WPY A;  1EA6 A;  1Z5B A;  4JI8 I;  1GZ6 A;  4LFA I;  1J5E E;  4NXN I;  1EKZ A;  4P7D A;  3ADJ A;  2BM0 A;  1ZXM A;  3IWC A;  4DPT A;  1N32 I;  1QU6 A;  4FW9 A;  1N33 I;  5IWA E;  2LJP A;  4R03 A;  1IBL I;  1Z0C A;  4IZK B;  2E5L E;  1QZR A;  1HNZ I;  5IT9 C;  2BV3 A;  4DR5 I;  3J7A M;  1X49 A;  3HTX A;  5AE3 A;  4FWG A;  4JI1 E;  4JI2 I;  3MSW A;  3RMP A;  4X65 I;  3F6G A;  3QT8 A;  1RQ0 A;  1WHN A;  3VK6 A;  3AV0 A;  4UT4 A;  4TUG A;  1FJG I;  2V86 A;  4OOG C;  2F4V I;  4FN5 A;  1ZBQ A;  4P78 A;  4HAC A;  3ZKD A;  5BR8 I;  4HY1 A;  4TUI A;  2RS7 A;  4L5N C;  2Z5E A;  4DR3 E;  4X62 I;  4OX9 I;  2ODR D;  5LMU E;  2O1V A;  3ZM7 A;  4DPY A;  4YY3 I;  2CG9 A;  2X36 A;  3PRY A;  3QT6 A;  3HXL A;  1XNR E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...