4DR1E

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 30
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr1E02
2LUPB 5A2QC 4JI5I 4DV5I 4LF5I 2OI2A 1ELOA 1ZXNA 4DR5I 3QT6A 3F0NA 4KHPI 4LFAE 3T1HE 2V34A 4B3MI 4JV5E 4DR4E 2LTSA 1X48A 2YT4A 1RREA 1N36E 4MYUA 4B3TE 3H4LA 4DR1I 4X65E 1VISA 2ZM6I 4DUYI 2KHXA 3VYYA 1KKHA 4FWGA 4WFTA 3T1YE 5A2QQ 3QT7A 3PYGA 5FLXQ 5BR8I 1N0VC 3J7Yp 2ZBKB 4DV4E 4X62E 1KVKA 4HXZA 1N32E 1O0WA 4RPFA 2UUCE 4LFAI 4YHHI 1KTVA 1B62A 4KQVA 1FJGE 3ZKBA 1N32I 2IHR1 4USKA 2JVAA 2LTRA 2HKEA 4OX9E 1EKZA 1XNRE 4YY3I 4DKKA 1FJGI 2ZM6E 1UILA 3ADJA 1QU6A 4Z7CA 3K1JA 1N34E 2HK2A 4LF7E 2RS7A 1HNWE 1U2RA 4JI4E 4X62I 4LF6E 4DR5E 5BR8E 4JI0I 2MDRA 2UUBE 4GKKE 1UHZA 2E5LE 4JI2I 1X47A 4LFBE 4NXMI 3J7AM 4DR6I 4X65I 4YHHE 1XNRI 1Z59A 2L3JA 1FKAE 1ZXMA 1Z0BA 2VQEE 4B3ME 1WUUA 3J81C 1EI1A 1I94I 3HULA 3K17A 2RSMA 2RS6A 4X66E 4DV3E 2N3GA 2NA2A 2BM0A 4JYAE 1HR0I 2L2KB 1DARA 4K0KE 3QT5A 3ZKDA 3PYFA 1N0UA 2UXDE 4HY1A 1HR0E 4EMDA 2NUEA 3WU6A 4DR2E 3OTOI 4Z7YA 3ZZ0A 4NXNI 2UUCI 4X64E 3ADLA 4DV4I 4HACB 3JAMQ 3ZZUA 4DV2I 1HNXE 4JI8E 1N36I 2DMYA 3ADIA 2F4VI 1K47A 4DU7A 2Q2EB 3V5RA 4JYAI 5FLXC 4DR6E 4JI4I 4FN5A 4B3SI 1NHIA 2V2ZA 4JI7I 4DV1I 4DV6E 4JI3E 1YYWA 4DR3E 1Z5AA 2LJPA 1X49A 4WUBA 2J7KA 1GQEA 4X64I 3HTXA 2UXBI 4DXLA 1XHKA 4DV0I 2L3CA 1BKNA 3JAMC 1HNXI 4X8WA 2UU9E 1FNMA 4DUZE 4DV0E 4DR7I 4DV3I 1J5EI 1IBME 4LFCI 2X7IA 4P52A 2NUGA 4LF7I 4DV7I 3T1HI 2UU9I 4WYQB 3M6AA 2EZ6A 4OOGC 2R42A 4MYTA 4HYMA 3PYEA 4X66I 1NHHA 4AQYE 1ZM4A 1KIJA 3J80C 4FWDA 2VQFE 2UXBE 4DUZI 3LTOA 1B63A 3D4JA 1N33I 1RQ0A 1Z0CA 1MU5A 2JY9A 3LNUA 3LLHA 5LL6R 1Z0GA 4GKJE 1Z0VA 2EFGA 2HFSA 4DPYA 1ZM2A 4AQYI 2GS8A 3C4BA 1H7SA 4WUDA 4B3TI 4USMA 4JI5E 1YYKA 3VYXA 1D6TA 3WU5A 4XTJA 2LRSA 2X36A 3QT8A 2HHHI 5IWAE 4FWHA 1T4OA 2HFUA 3LPSA 1Z0TA 2UUAE 3V2UC 4JI6E 4DU8A 2LJHA 2LUQA 1QZRA 4WUCA 5LMNE 5LMUI 1S16A 5GMEA 1WHQA 2B7TA 2L33A 2N3HA 4GKJI 4DR4I 4DV5E 4LF5E 1YYOA 2B3TB 4DV6I 2UUAI 5GMDA 4LF4I 4JI1E 2CZ9A 4YY3E 4DPTA 3J80Q 1J5EE 1XMOI 3B78A 1T4LB 1PIEA 1XNQI 2V2VA 2V8PA 1IBLE 3T1YI 4DUYE 1A6FA 1Z5BA 2E1RA 4DV2E 4OX9I 4LF8I 1H74A 3Q1QA 4I3HA 4B3SE 4ZVIA 3WU4A 4ED4A 4UT4A 1I94E 5LMUE 5LMNI 1FWLA 2B7VA 4KHPE 1Z0EA 4DV7E 2VQFI 2VQEI 2DB2A 1Z0WA 4UTGA 1XMQI 4JI7E 2CPNA 1NZ0A 2HK3A 4GKKI 4LF4E 3J81Q 1XNQE 5IWAI 3P1XA 1IBKE 3J7AG 4LFBI 4JI3I 4FW9A 4PRVA 2NUFA 4JG4A 2WW4A 1EA6A 1RC7A 2V2QA 4HACA 3B82A 1H7UA 4JI6I 5IT9C 1HNWI 4LF8E 4DR7E 1FWKA 1J26A 4NXNE 4DPXA 4M30A 4JI0E 1H73A 2AJ4A 3CWVA 2F4VE 1XMQE 4DV1E 1IBMI 1XMOE 2HKJA 4PRXA 1DI2A 4JI1I 1N33E 2VF3A 5L3JA 4URLA 1STUA 3C4TA 2RTXA 1OJ4A 2NPFA 1MG7A 1H72C 4LF9E 4DR1E 2LBSB 4P7AA 4DR3I 1ZM9A 2UXCI 4K0KI 3PYDA 1N34I 1HNZI 4JI8I 4LF9I 4DPUA 2HHHE 1T4NA 2L2MA 4PU9A 2E5LI 4LFCE 4NXME 2BV3A 2A2DA 1IBKI 1PVGA 2XEXA 4LF6I 1HNZE 5CFFE 2DEJA 1PKPA 1ZM3A 1YZ9A 1NHJA 3WU3A 3B8HA 3ZZTA 1RR9A 4DPWA 4B3RI 1UEKA 3GONA 2DEIA 2UXCE 3ADGA 2UUBI 1Z5CA 4R1FA 1WHNA 3ZM7A 3OTOE 4DR2I 1IBLI 4JI2E 2R3VA 2A2CA 1MX0A 1S4EA 5IT9Q 1FI4A 4B3RE 1ZBTA 4JV5I 4M2ZA 2L2NA 2DIXA 2ZITA 4M1KA 2BM1A 2UXDI
chains in the Genus database with same CATH superfamily
2LUPB 3JTZA 5A2QC 1GTKA 2GO4A 4ZYEA 4JI5I 2EPMX 4R03A 4J3DA 2OI2A 4DV5I 4LF5I 2WP8A 2EQ3A 2Z5CB 1ELOA 1ZXNA 3M7ND 5AC5A 4DR5I 3QT6A 3F0NA 4OKGA 4LFAE 3T1HE 3U1KA 1EH8A 5AE2A 4R2RA 2V34A 4B3MI 4KHPI 4JV5E 1A1JA 2V86A 4DR4E 2LTSA 2O1TA 1YHCA 2NN6F 3M85G 1X48A 2YT4A 1RREA 1BBOA 2EOXA 1N36E 4IZKB 4MYUA 4BA1B 4B3TE 3M99B 4P78A 3H4LA 4DR1I 2EMFA 3HXLA 4X65E 1VISA 2RQLA 2ZM6I 4DUYI 2KHXA 3VYYA 1KKHA 4FWGA 1B69A 2EOOA 2PRTA 4OO1E 4WFTA 2Z5BB 2CVEA 4F54A 2EL5A 4O24A 2FV4B 5JEAF 3T1YE 5A2QQ 4GEQB 3QT7A 2YSOA 3KZZA 1YFHA 1BB8A 3PYGA 5FLXQ 5BR8I 1N0VC 1ZU1A 3J7Yp 2ZBKB 4DV4E 2EMXA 1MGTA 4X62E 1BBGA 2YRHA 1KVKA 4HXZA 1N32E 1O0WA 4O4KA 4RPFA 2UUCE 4U3BA 3H1CA 4R2SA 1IQOA 1AH5A 3IWDA 4LFAI 1Y6ZA 1WJPA 4YHHI 1KTVA 2ENCA 3LMLA 4BHCA 1B62A 4KQVA 5C0XC 1FJGE 2JT2A 3F6HA 2ELZA 3ZKBA 1N32I 2IHR1 4F9AB 4USKA 2JVAA 2LTRA 4MLVA 2HKEA 2EORA 4IFDF 3L00A 4OX9E 2BB8A 1EKZA 1XNRE 3VHTB 4YY3I 4DKKA 1FJGI 2R1FA 1UILA 2JOXA 3ADJA 1QU6A 2ZM6E 1JK1A 1A1HA 2YTPA 4Z7CA 5K36E 4LCFA 3K1JA 4OZEA 1N34E 2HK2A 4MQYA 4BS9A 2YRKA 4LF7E 2O3ZA 2YRMA 2RS7A 1HNWE 5KL7A 1P42A 4R2CA 1U2RA 4IJDA 1YUIA 4JI4E 2BA1D 4X62I 1NEIA 5DRRA 4AM3A 1IQSA 4BC9A 2HGHA 4LF6E 1YSAC 2EQ0A 4DR5E 2MDGA 5BR8E 4JI0I 2JEAB 1OYSA 1UBDC 2MDRA 2UUBE 4GKKE 4WPYA 2MKNA 2M4IA 3KZYA 2EOIA 1UHZA 2E5LE 2IOQA 4JI2I 1X47A 4BCAA 4LFBE 1OYPA 4NXMI 3M85D 1YUJA 2PO0A 4BMJA 3J7AM 2C37A 4X65I 4DR6I 4YHHE 3IWBA 2IERA 1XNRI 1Z59A 2L3JA 1FKAE 2EPLX 5IXMB 3PS1A 4BA2A 2V89A 3RMPA 1ZXMA 4R2EA 1Z0BA 3EQ1A 2NN6A 1A1IA 3CDIA 2VQEE 4B3ME 1WUUA 5K36B 1X3CA 2Z5BA 2LJUA 3J81C 3VK6A 1EI1A 1I94I 1EH6A 3HULA 2PO0B 1SFEA 2D9HA 4QNKA 3K17A 4ZYHA 2RSMA 2RS6A 1A1LA 1Y60A 5ELWA 1KJKA 5EL9A 4X66E 4DV3E 2N3GA 2NA2A 1UDQA 3BIDA 2BM0A 3GMEA 4JYAE 1L4SA 2H36X 2EJ4A 2V87A 1HR0I 2L2KB 5AE1A 1DARA 4K0KE 4F2JC 2YSPA 4M9VC 3QT5A 1GZ6A 3ZKDA 3PYFA 2ENHA 1T39A 1N0UA 2UXDE 2EN8A 4HY1A 4IFDD 1HR0E 1PJQA 2EL4A 2FTXB 4EMDA 2NUEA 4IFDC 4QNJA 4DR2E 3WU6A 3OTOI 5T6JA 4Z7YA 2RPCA 3ZZ0A 4NXNI 2UUCI 2YTGA 2J65A 4X64E 3ADLA 5EKWA 2MKDA 2BA0G 2EWLA 4DV4I 3HJCA 4HACB 3JAMQ 3ZZUA 4N4RB 4DV2I 4MU4A 1HNXE 4JI8E 3P3EA 1N36I 2DMYA 4F6NA 3C6KA 3C6MA 2ODRD 2JEAA 3ADIA 2F4VI 1K47A 1N3GA 2JEBB 4DU7A 2Q2EB 2LO3A 3V5RA 2WBSA 2EPRA 5DRPA 4JYAI 5FLXC 2EPZA 3MHHC 4DR6E 5C0XF 2IOPA 4NHRA 2EOJA 3DJWA 4JI4I 5C0XD 4FN5A 4B3SI 1NHIA 2V2ZA 4JI7I 1RMDA 4DV1I 4DV6E 5TSEA 5KL2A 3THNA 4JI3E 3B4TA 4L8NA 4IZJD 3M7NG 4R2QA 2EMWA 4DR3E 1YYWA 5JEAE 1Z5AA 2L92A 2A25A 5IV8B 2EOSA 1X49A 2LJPA 4WUBA 2JEBA 2J7KA 2EM6A 2EMYA 2G7HA 2LVHA 1GQEA 4X64I 3HTXA 4F6MA 4DXLA 2UXBI 1DGCA 2PNLA 2C37B 1XHKA 4DV0I 3Q6NA 2EMIA 2YTIA 2EPKX 2I9IA 3AUZA 2L3CA 2EPNA 2YTEA 1BKNA 3JAMC 4NBQA 1HNXI 1UN6B 4HEIA 2WZOA 4X8WA 1P47A 4RHBB 2UU9E 1FNMA 4DUZE 3PRYA 4FW3A 4LOMA 4MU3A 2ENAA 2HJJA 4O43A 4BBYA 4DV0E 2WNRB 3NZKA 3UHMA 4DV3I 4IZJA 4DR7I 1J5EI 1IBME 5ADZA 4LFCI 2EMHA 2X7IA 2NN6C 2KONA 2VF1A 5DROA 2RSIA 2NUGA 4P52A 4LF7I 2EOZA 4DV7I 3T1HI 2UU9I 4WYQB 3M6AA 2ADRA 2EZ6A 4OOGC 2M9AA 1Y5YA 2CG9A 2R42A 4MYTA 5A6JA 4HYMA 3PYEA 4X66I 2EM9A 1NHHA 2PO2A 4AQYE 1ZM4A 3Q6MA 4L5NC 1KIJA 3J80C 2YTJA 2EN3A 5A69A 2M1SA 4FWDA 4RH8A 4WXCA 1XXEA 4IFDE 2VQFE 2UXBE 2O1WA 4I8OA 4DUZI 3LTOA 1B63A 1X6EA 3OMLA 3D4JA 1N33I 1LLMC 1RQ0A 3HPZA 2LT7A 1MU5A 1Y4SA 1Z0CA 2O1VA 4Q28A 3TQMA 2JY9A 2K4VA 1X6FA 4F9CB 2M7QA 3LNUA 3LLHA 2YTDA 4OO1B 5LL6R 2V8QB 1SR9A 4GKJE 1Z0VA 1Z0GA 2EOYA 2EN4A 5KL3A 2EFGA 2HFSA 3PS3A 2PO2B 4BHBA 4DPYA 1ZM2A 4AQYI 2GS8A 3C4BA 2YZTA 1H7SA 2BBGA 2J7JA 4WUDA 1TF3A 2PNMA 4B3TI 1F2IG 2NN6B 4JI5E 4MU1A 1YYKA 4USMA 5A6BA 5KL5A 5A6AA 3VYXA 1EH7A 4R8OA 1D6TA 2JXPA 3WU5A 1ZAAC 4XTJA 2LRSA 2X36A 3QT8A 2IESA 2HHHI 5IWAE 3ZOQB 2WP8B 1T4OA 2EMAA 2JOBA 1VI7A 2HFUA 4FWHA 2DSYA 3LPSA 1X6HA 1Z0TA 4MU0A 2EN7A 2EM3A 2UUAE 3V2UC 5K36A 2EOMA 4P7DA 2VESA 2Z5CA 2BA0D 4JI6E 4DU8A 1USVA 4OO1A 2LJHA 3GLLA 2LUQA 2GHFA 1A1FA 4IS1C 1QZRA 2YTOA 4WUCA 4LU9A 5LMNE 2JPAA 2NN6E 5LMUI 3F6GA 2EM7A 1S16A 5GMEA 3KRNA 2KOUA 1OYRA 2EOEA 1QNTA 1WHQA 3JU0A 2CSHA 2B7TA 2L33A 4ZYGA 2N3HA 4GKJI 3UK3C 2EPOA 5A6KA 3P76A 4DR4I 4DV5E 4LF5E 1YYOA 3QG5C 2B3TB 3BGHA 4DV6I 3EPJA 2UUAI 2VRDA 3IWCA 5GMDA 2EP3A 3P3GA 4LF4I 2JYAA 4JI1E 2CZ9A 4YY3E 4Q35B 4TUIA 4DPTA 3J80Q 1J5EE 2E72A 4FW5A 4BA1A 3HPSA 5JEAD 1XMOI 1ZR9A 2YU5A 3B78A 2YWQA 2VE7C 4X9JA 1T4LB 1PIEA 2CTDA 1XNQI 2V2VA 2V8PA 2O1UA 1IBLE 3T1YI 5AE3A 4DUYE 1A6FA 2DGCA 1Z5BA 2E1RA 4DV2E 4GZNC 4N3OA 2N8XA 2WCC3 2JWOA 2GQ0A 2WBTA 5DNYA 1JK2A 5AASA 4OX9I 1DQ3A 1H74A 4LF8I 3Q1QA 4I3HA 4B3SE 4ZVIA 2V88A 3WU4A 4ED4A 4UT4A 1I94E 1YPNA 5LMUE 5LMNI 1FWLA 2B7VA 3BBGA 4IS9A 3H09A 2BR2A 2EM2A 4KHPE 5C0XA 2EOQA 1Z0EA 4DV7E 2VQFI 2EPUA 2VQEI 3EPKA 1UDOA 2DB2A 1WXRA 2JR1A 4LCHA 1Z0WA 4UTGA 1IMUA 5DRQA 2EPCA 3K85A 4JI7E 1XMQI 1X5WA 2PNZA 2CPNA 1NZ0A 1Z1BA 2HK3A 3DD6A 4OO1C 2WBUA 4GKKI 4OO1D 4LF4E 1RHYA 2ELYA 1XNQE 3J81Q 1PJTA 5IWAI 3P1XA 2JE6A 1IBKE 4LTYA 1KYQA 3J7AG 2EMCA 1HK7A 1R6MA 1Y4UA 5KL6A 4LFBI 5K36D 4JI3I 4FW9A 4IZKA 4ZYDA 5K36F 4PRVA 2HC5A 4M0VA 2JP9A 2NUFA 4AIMA 4KWYA 4JG4A 3L7ZB 2EL6A 2WW4A 2PNZB 5AC4A 1A1KA 1EA6A 1RC7A 2V2QA 4HACA 4AIDA 4WXDA 5A6BD 1TF6A 2F1DA 4WSPA 3B82A 2YTFA 5JEAC 1A1GA 1UDSA 1H7UA 4JI6I 5IT9C 1AAYA 4LF8E 1HNWI 4DR7E 2DRPA 3PS2A 4U3DA 2GLIA 1FWKA 1J26A 2EN2A 2EM4A 3EPLA 4NXNE 1PJSA 4LCGA 4DPXA 4M30A 2EOHA 4JI0E 1H73A 2AJ4A 3CWVA 2LCEA 4NZVA 2K7IA 2EMKA 2F4VE 1XMQE 3AV0A 4DV1E 1TN9A 1IBMI 2DMIA 5LLQA 1XMOE 1E3PA 2GO3A 2DLQA 2YU8A 2PO1A 2HKJA 4PRXA 1WRJA 3ECRA 4FK5C 1DI2A 4JI1I 4BA2B 2EQ1A 1PDAA 1N33E 2VF3A 3L7ZA 4OO1F 2EMGA 4URLA 2C38B 5L3JA 4GQUA 1E3HA 3HKMA 2CT1A 4HTGA 1STUA 3C4TA 2RTXA 4FW6A 3HQ1A 4FW7A 2C39B 4MLQA 5DNXA 4ISAA 1OJ4A 2EOFA 2NN6D 5FWKA 3MHSC 1R6LA 3P3CA 2NPFA 4KZSA 5JEAB 4FW4A 2ODRC 1MG7A 1H72C 4LF9E 1YH8A 4DR1E 2EPAA 2LBSB 4P7AA 2EPXA 3KWRA 4DR3I 1ZM9A 2Z5EA 3EPHA 4R2DA 2C38A 2UXCI 4WX9A 4K0KI 2NABA 2V83A 4WSGA 2EMZA 3MSWA 3PYDA 1N34I 1HNZI 4JI8I 5C0XB 4LF9I 4DPUA 2MC6A 2HHHE 1T4NA 2L2MA 4PU9A 4IZJB 2E1MA 2E5LI 2L8TA 5JEAA 4BC7A 4LFCE 2EMLA 2LE2A 4NXME 2PO1B 1UDNA 4DMIA 4F9BB 3CDJA 2BR2B 4TUGA 2LMZA 3P06A 2BV3A 2EM5A 2A2DA 1IBKI 1PVGA 1T38A 2XEXA 2B9DA 4IFDB 4LF6I 2EMBA 1HNZE 5CFFE 2DEJA 2JE6B 4O5GA 1PKPA 2R76A 4R2AA 1YZ9A 1ZM3A 2EN1A 1NHJA 2YTQA 2CGEA 3WU3A 5F3WA 1G2FC 3B8HA 1RR9A 3ZZTA 4DPWA 1MEYC 4MDTA 2I13A 4B3RI 2EE8A 1UEKA 3GONA 2DEIA 3GCMA 2UXCE 5C0XE 3ADGA 4R2PA 3K6QA 4LPFA 2LV2A 2AE8A 2BA1G 2EPPA 2V85A 2UUBI 1Z5CA 2L6MA 4R1FA 5DNLA 1WHNA 1NCSA 5KL4A 3ZM7A 3DF6A 2EN6A 3OTOE 4DR2I 4J8ZA 1IBLI 2FGGA 4JI2E 2R3VA 3BF2A 1ZBQA 2EM0A 2Q8UA 2YPNA 1G2DC 2A2CA 5K36C 2DLKA 1MX0A 1USUA 1S4EA 3FIGA 5IT9Q 2GPIA 3THOB 1FI4A 2EM8A 1ZBTA 4B3RE 4JV5I 4IFDA 2C39A 4M2ZA 2L2NA 2F8BA 3U1YA 2WNRA 2DIXA 2ZITA 4M1KA 2MC5A 2BM1A 2YTNA 2UXDI
chains in the Genus database with same CATH topology
2LUPB 3JTZA 5A2QC 4JI5I 4R03A 4DV5I 4LF5I 2OI2A 2Z5CB 1ELOA 1ZXNA 4DR5I 3QT6A 3F0NA 4KHPI 4LFAE 3T1HE 5AE2A 2V34A 4B3MI 4JV5E 2V86A 4DR4E 2LTSA 2O1TA 1X48A 2YT4A 1RREA 4IZKB 1N36E 4MYUA 4B3TE 3H4LA 4P78A 4DR1I 3HXLA 4X65E 1VISA 2ZM6I 4DUYI 2KHXA 3VYYA 1KKHA 4FWGA 4WFTA 2Z5BB 4F54A 2FV4B 3T1YE 5A2QQ 4GEQB 3QT7A 3PYGA 5FLXQ 5BR8I 1N0VC 3J7Yp 2ZBKB 4DV4E 4X62E 1KVKA 4HXZA 1N32E 1O0WA 4RPFA 2UUCE 3IWDA 4LFAI 1Y6ZA 4YHHI 1KTVA 3LMLA 1B62A 4KQVA 1FJGE 3F6HA 3ZKBA 1N32I 2IHR1 4F9AB 4USKA 2JVAA 2LTRA 2HKEA 4OX9E 1EKZA 1XNRE 4YY3I 4DKKA 1FJGI 2ZM6E 1UILA 2JOXA 3ADJA 1QU6A 4Z7CA 3K1JA 1N34E 2HK2A 4BS9A 4LF7E 2RS7A 1HNWE 1U2RA 4JI4E 4X62I 4BC9A 4LF6E 4DR5E 5BR8E 4JI0I 2MDRA 2UUBE 4GKKE 4WPYA 2M4IA 1UHZA 2E5LE 2IOQA 4JI2I 1X47A 4BCAA 4LFBE 4NXMI 4BMJA 3J7AM 4DR6I 4X65I 4YHHE 3IWBA 1XNRI 1Z59A 2L3JA 1FKAE 2V89A 3RMPA 1ZXMA 1Z0BA 2VQEE 4B3ME 1WUUA 2Z5BA 3J81C 3VK6A 1EI1A 1I94I 3HULA 3K17A 2RSMA 2RS6A 4X66E 4DV3E 2N3GA 2NA2A 2BM0A 4JYAE 2H36X 2V87A 1HR0I 2L2KB 5AE1A 1DARA 4K0KE 3QT5A 3ZKDA 1GZ6A 3PYFA 1N0UA 2UXDE 4HY1A 1HR0E 2FTXB 4EMDA 2NUEA 3WU6A 4DR2E 3OTOI 5T6JA 4Z7YA 3ZZ0A 4NXNI 2UUCI 4X64E 3ADLA 4DV4I 2EWLA 3HJCA 4HACB 3JAMQ 3ZZUA 4DV2I 1HNXE 4JI8E 1N36I 2DMYA 2ODRD 3ADIA 2F4VI 1K47A 4DU7A 2Q2EB 3V5RA 4JYAI 5FLXC 4DR6E 2IOPA 3DJWA 4JI4I 4FN5A 4B3SI 1NHIA 2V2ZA 4JI7I 4DV1I 4DV6E 4JI3E 4L8NA 4IZJD 1YYWA 4DR3E 1Z5AA 2L92A 2LJPA 1X49A 4WUBA 2J7KA 2G7HA 1GQEA 4X64I 3HTXA 2UXBI 4DXLA 2PNLA 1XHKA 4DV0I 3Q6NA 3AUZA 2L3CA 1BKNA 3JAMC 1HNXI 4X8WA 2WZOA 3PRYA 2UU9E 1FNMA 4DUZE 4DV0E 4BBYA 4DR7I 4DV3I 4IZJA 1J5EI 1IBME 5ADZA 4LFCI 2X7IA 2KONA 2VF1A 4P52A 2NUGA 4LF7I 4DV7I 3T1HI 2UU9I 4WYQB 3M6AA 2EZ6A 4OOGC 2R42A 2CG9A 4MYTA 4HYMA 3PYEA 4X66I 1NHHA 4AQYE 1ZM4A 3Q6MA 4L5NC 1KIJA 3J80C 2M1SA 4FWDA 2VQFE 2UXBE 2O1WA 4I8OA 4DUZI 3LTOA 1B63A 3OMLA 3D4JA 1N33I 1Y4SA 1RQ0A 3HPZA 1MU5A 1Z0CA 2O1VA 4Q28A 2JY9A 2K4VA 4F9CB 2M7QA 3LNUA 3LLHA 5LL6R 2V8QB 1SR9A 4GKJE 1Z0VA 1Z0GA 2EFGA 2HFSA 4DPYA 1ZM2A 4AQYI 2GS8A 3C4BA 2YZTA 1H7SA 4WUDA 2PNMA 4B3TI 4USMA 4JI5E 1YYKA 3VYXA 4R8OA 1D6TA 3WU5A 4XTJA 2LRSA 2X36A 3QT8A 2HHHI 5IWAE 3ZOQB 4FWHA 1T4OA 2JOBA 2HFUA 2DSYA 3LPSA 1Z0TA 2UUAE 3V2UC 4P7DA 2Z5CA 4JI6E 4DU8A 1USVA 2LJHA 2LUQA 1QZRA 4WUCA 4LU9A 5LMNE 5LMUI 3F6GA 1S16A 5GMEA 2KOUA 1WHQA 3JU0A 2B7TA 2L33A 2N3HA 4GKJI 4DR4I 4DV5E 4LF5E 1YYOA 2B3TB 4DV6I 2UUAI 3IWCA 5GMDA 4LF4I 4JI1E 2CZ9A 4YY3E 4TUIA 4DPTA 3J80Q 1J5EE 3HPSA 1XMOI 3B78A 2VE7C 1T4LB 1PIEA 1XNQI 2V2VA 2V8PA 2O1UA 1IBLE 3T1YI 5AE3A 4DUYE 1A6FA 1Z5BA 2E1RA 4DV2E 4N3OA 2JWOA 2GQ0A 5DNYA 4OX9I 5AASA 1DQ3A 1H74A 4LF8I 3Q1QA 4I3HA 4B3SE 4ZVIA 2V88A 3WU4A 4ED4A 4UT4A 1I94E 5LMUE 5LMNI 1FWLA 2B7VA 3H09A 4KHPE 1Z0EA 4DV7E 2VQFI 2VQEI 2DB2A 1WXRA 2JR1A 1Z0WA 4UTGA 3K85A 1XMQI 4JI7E 2CPNA 1NZ0A 2HK3A 4GKKI 4LF4E 3J81Q 1XNQE 5IWAI 3P1XA 1IBKE 4LTYA 3J7AG 1HK7A 1Y4UA 4LFBI 4JI3I 4FW9A 4IZKA 4PRVA 4M0VA 2NUFA 4JG4A 2WW4A 1EA6A 1RC7A 2V2QA 4HACA 3B82A 4WSPA 1H7UA 4JI6I 5IT9C 1HNWI 4LF8E 4DR7E 1FWKA 1J26A 4NXNE 4DPXA 4M30A 4JI0E 1H73A 2AJ4A 3CWVA 2F4VE 1XMQE 3AV0A 4DV1E 1IBMI 1XMOE 2HKJA 4PRXA 1DI2A 4JI1I 1N33E 2VF3A 5L3JA 4URLA 1STUA 3C4TA 2RTXA 3HQ1A 1OJ4A 5FWKA 2NPFA 4KZSA 2ODRC 1MG7A 1H72C 4LF9E 2LBSB 4DR1E 4P7AA 4DR3I 3KWRA 1ZM9A 2Z5EA 2UXCI 4K0KI 2V83A 3MSWA 3PYDA 1N34I 1HNZI 4JI8I 4LF9I 4DPUA 2MC6A 2HHHE 1T4NA 2L2MA 4PU9A 4IZJB 2E1MA 2E5LI 2L8TA 4BC7A 4LFCE 2LE2A 4NXME 4DMIA 4F9BB 4TUGA 2LMZA 3P06A 2BV3A 2A2DA 1IBKI 1PVGA 2XEXA 2B9DA 4LF6I 1HNZE 5CFFE 2DEJA 1PKPA 1ZM3A 1YZ9A 1NHJA 2CGEA 3WU3A 5F3WA 3B8HA 3ZZTA 1RR9A 4DPWA 4B3RI 1UEKA 3GONA 2DEIA 2UXCE 3ADGA 3K6QA 2V85A 2UUBI 1Z5CA 2L6MA 4R1FA 1WHNA 3ZM7A 3DF6A 3OTOE 4DR2I 4J8ZA 1IBLI 2FGGA 4JI2E 2R3VA 1ZBQA 2A2CA 1MX0A 1USUA 1S4EA 3FIGA 5IT9Q 1FI4A 4B3RE 1ZBTA 4JV5I 4M2ZA 2L2NA 2F8BA 2DIXA 2ZITA 4M1KA 2MC5A 2BM1A 2UXDI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUP B;  5A2Q C;  4JI5 I;  4DV5 I;  4LF5 I;  2OI2 A;  1ELO A;  1ZXN A;  4DR5 I;  3QT6 A;  3F0N A;  4KHP I;  4LFA E;  3T1H E;  2V34 A;  4B3M I;  4JV5 E;  4DR4 E;  2LTS A;  1X48 A;  2YT4 A;  1RRE A;  1N36 E;  4MYU A;  4B3T E;  3H4L A;  4DR1 I;  4X65 E;  1VIS A;  2ZM6 I;  4DUY I;  2KHX A;  3VYY A;  1KKH A;  4FWG A;  4WFT A;  3T1Y E;  5A2Q Q;  3QT7 A;  3PYG A;  5FLX Q;  5BR8 I;  1N0V C;  3J7Y p;  2ZBK B;  4DV4 E;  4X62 E;  1KVK A;  4HXZ A;  1N32 E;  1O0W A;  4RPF A;  2UUC E;  4LFA I;  4YHH I;  1KTV A;  1B62 A;  4KQV A;  1FJG E;  3ZKB A;  1N32 I;  2IHR 1;  4USK A;  2JVA A;  2LTR A;  2HKE A;  4OX9 E;  1EKZ A;  1XNR E;  4YY3 I;  4DKK A;  1FJG I;  2ZM6 E;  1UIL A;  3ADJ A;  1QU6 A;  4Z7C A;  3K1J A;  1N34 E;  2HK2 A;  4LF7 E;  2RS7 A;  1HNW E;  1U2R A;  4JI4 E;  4X62 I;  4LF6 E;  4DR5 E;  5BR8 E;  4JI0 I;  2MDR A;  2UUB E;  4GKK E;  1UHZ A;  2E5L E;  4JI2 I;  1X47 A;  4LFB E;  4NXM I;  3J7A M;  4DR6 I;  4X65 I;  4YHH E;  1XNR I;  1Z59 A;  2L3J A;  1FKA E;  1ZXM A;  1Z0B A;  2VQE E;  4B3M E;  1WUU A;  3J81 C;  1EI1 A;  1I94 I;  3HUL A;  3K17 A;  2RSM A;  2RS6 A;  4X66 E;  4DV3 E;  2N3G A;  2NA2 A;  2BM0 A;  4JYA E;  1HR0 I;  2L2K B;  1DAR A;  4K0K E;  3QT5 A;  3ZKD A;  3PYF A;  1N0U A;  2UXD E;  4HY1 A;  1HR0 E;  4EMD A;  2NUE A;  3WU6 A;  4DR2 E;  3OTO I;  4Z7Y A;  3ZZ0 A;  4NXN I;  2UUC I;  4X64 E;  3ADL A;  4DV4 I;  4HAC B;  3JAM Q;  3ZZU A;  4DV2 I;  1HNX E;  4JI8 E;  1N36 I;  2DMY A;  3ADI A;  2F4V I;  1K47 A;  4DU7 A;  2Q2E B;  3V5R A;  4JYA I;  5FLX C;  4DR6 E;  4JI4 I;  4FN5 A;  4B3S I;  1NHI A;  2V2Z A;  4JI7 I;  4DV1 I;  4DV6 E;  4JI3 E;  1YYW A;  4DR3 E;  1Z5A A;  2LJP A;  1X49 A;  4WUB A;  2J7K A;  1GQE A;  4X64 I;  3HTX A;  2UXB I;  4DXL A;  1XHK A;  4DV0 I;  2L3C A;  1BKN A;  3JAM C;  1HNX I;  4X8W A;  2UU9 E;  1FNM A;  4DUZ E;  4DV0 E;  4DR7 I;  4DV3 I;  1J5E I;  1IBM E;  4LFC I;  2X7I A;  4P52 A;  2NUG A;  4LF7 I;  4DV7 I;  3T1H I;  2UU9 I;  4WYQ B;  3M6A A;  2EZ6 A;  4OOG C;  2R42 A;  4MYT A;  4HYM A;  3PYE A;  4X66 I;  1NHH A;  4AQY E;  1ZM4 A;  1KIJ A;  3J80 C;  4FWD A;  2VQF E;  2UXB E;  4DUZ I;  3LTO A;  1B63 A;  3D4J A;  1N33 I;  1RQ0 A;  1Z0C A;  1MU5 A;  2JY9 A;  3LNU A;  3LLH A;  5LL6 R;  1Z0G A;  4GKJ E;  1Z0V A;  2EFG A;  2HFS A;  4DPY A;  1ZM2 A;  4AQY I;  2GS8 A;  3C4B A;  1H7S A;  4WUD A;  4B3T I;  4USM A;  4JI5 E;  1YYK A;  3VYX A;  1D6T A;  3WU5 A;  4XTJ A;  2LRS A;  2X36 A;  3QT8 A;  2HHH I;  5IWA E;  4FWH A;  1T4O A;  2HFU A;  3LPS A;  1Z0T A;  2UUA E;  3V2U C;  4JI6 E;  4DU8 A;  2LJH A;  2LUQ A;  1QZR A;  4WUC A;  5LMN E;  5LMU I;  1S16 A;  5GME A;  1WHQ A;  2B7T A;  2L33 A;  2N3H A;  4GKJ I;  4DR4 I;  4DV5 E;  4LF5 E;  1YYO A;  2B3T B;  4DV6 I;  2UUA I;  5GMD A;  4LF4 I;  4JI1 E;  2CZ9 A;  4YY3 E;  4DPT A;  3J80 Q;  1J5E E;  1XMO I;  3B78 A;  1T4L B;  1PIE A;  1XNQ I;  2V2V A;  2V8P A;  1IBL E;  3T1Y I;  4DUY E;  1A6F A;  1Z5B A;  2E1R A;  4DV2 E;  4OX9 I;  4LF8 I;  1H74 A;  3Q1Q A;  4I3H A;  4B3S E;  4ZVI A;  3WU4 A;  4ED4 A;  4UT4 A;  1I94 E;  5LMU E;  5LMN I;  1FWL A;  2B7V A;  4KHP E;  1Z0E A;  4DV7 E;  2VQF I;  2VQE I;  2DB2 A;  1Z0W A;  4UTG A;  1XMQ I;  4JI7 E;  2CPN A;  1NZ0 A;  2HK3 A;  4GKK I;  4LF4 E;  3J81 Q;  1XNQ E;  5IWA I;  3P1X A;  1IBK E;  3J7A G;  4LFB I;  4JI3 I;  4FW9 A;  4PRV A;  2NUF A;  4JG4 A;  2WW4 A;  1EA6 A;  1RC7 A;  2V2Q A;  4HAC A;  3B82 A;  1H7U A;  4JI6 I;  5IT9 C;  1HNW I;  4LF8 E;  4DR7 E;  1FWK A;  1J26 A;  4NXN E;  4DPX A;  4M30 A;  4JI0 E;  1H73 A;  2AJ4 A;  3CWV A;  2F4V E;  1XMQ E;  4DV1 E;  1IBM I;  1XMO E;  2HKJ A;  4PRX A;  1DI2 A;  4JI1 I;  1N33 E;  2VF3 A;  5L3J A;  4URL A;  1STU A;  3C4T A;  2RTX A;  1OJ4 A;  2NPF A;  1MG7 A;  1H72 C;  4LF9 E;  4DR1 E;  2LBS B;  4P7A A;  4DR3 I;  1ZM9 A;  2UXC I;  4K0K I;  3PYD A;  1N34 I;  1HNZ I;  4JI8 I;  4LF9 I;  4DPU A;  2HHH E;  1T4N A;  2L2M A;  4PU9 A;  2E5L I;  4LFC E;  4NXM E;  2BV3 A;  2A2D A;  1IBK I;  1PVG A;  2XEX A;  4LF6 I;  1HNZ E;  5CFF E;  2DEJ A;  1PKP A;  1ZM3 A;  1YZ9 A;  1NHJ A;  3WU3 A;  3B8H A;  3ZZT A;  1RR9 A;  4DPW A;  4B3R I;  1UEK A;  3GON A;  2DEI A;  2UXC E;  3ADG A;  2UUB I;  1Z5C A;  4R1F A;  1WHN A;  3ZM7 A;  3OTO E;  4DR2 I;  1IBL I;  4JI2 E;  2R3V A;  2A2C A;  1MX0 A;  1S4E A;  5IT9 Q;  1FI4 A;  4B3R E;  1ZBT A;  4JV5 I;  4M2Z A;  2L2N A;  2DIX A;  2ZIT A;  4M1K A;  2BM1 A;  2UXD I; 
#chains in the Genus database with same CATH topology
 2LUP B;  3JTZ A;  5A2Q C;  1GTK A;  2GO4 A;  4ZYE A;  4JI5 I;  2EPM X;  4R03 A;  4J3D A;  2OI2 A;  4DV5 I;  4LF5 I;  2WP8 A;  2EQ3 A;  2Z5C B;  1ELO A;  1ZXN A;  3M7N D;  5AC5 A;  4DR5 I;  3QT6 A;  3F0N A;  4OKG A;  4LFA E;  3T1H E;  3U1K A;  1EH8 A;  5AE2 A;  4R2R A;  2V34 A;  4B3M I;  4KHP I;  4JV5 E;  1A1J A;  2V86 A;  4DR4 E;  2LTS A;  2O1T A;  1YHC A;  2NN6 F;  3M85 G;  1X48 A;  2YT4 A;  1RRE A;  1BBO A;  2EOX A;  1N36 E;  4IZK B;  4MYU A;  4BA1 B;  4B3T E;  3M99 B;  4P78 A;  3H4L A;  4DR1 I;  2EMF A;  3HXL A;  4X65 E;  1VIS A;  2RQL A;  2ZM6 I;  4DUY I;  2KHX A;  3VYY A;  1KKH A;  4FWG A;  1B69 A;  2EOO A;  2PRT A;  4OO1 E;  4WFT A;  2Z5B B;  2CVE A;  4F54 A;  2EL5 A;  4O24 A;  2FV4 B;  5JEA F;  3T1Y E;  5A2Q Q;  4GEQ B;  3QT7 A;  2YSO A;  3KZZ A;  1YFH A;  1BB8 A;  3PYG A;  5FLX Q;  5BR8 I;  1N0V C;  1ZU1 A;  3J7Y p;  2ZBK B;  4DV4 E;  2EMX A;  1MGT A;  4X62 E;  1BBG A;  2YRH A;  1KVK A;  4HXZ A;  1N32 E;  1O0W A;  4O4K A;  4RPF A;  2UUC E;  4U3B A;  3H1C A;  4R2S A;  1IQO A;  1AH5 A;  3IWD A;  4LFA I;  1Y6Z A;  1WJP A;  4YHH I;  1KTV A;  2ENC A;  3LML A;  4BHC A;  1B62 A;  4KQV A;  5C0X C;  1FJG E;  2JT2 A;  3F6H A;  2ELZ A;  3ZKB A;  1N32 I;  2IHR 1;  4F9A B;  4USK A;  2JVA A;  2LTR A;  4MLV A;  2HKE A;  2EOR A;  4IFD F;  3L00 A;  4OX9 E;  2BB8 A;  1EKZ A;  1XNR E;  3VHT B;  4YY3 I;  4DKK A;  1FJG I;  2R1F A;  1UIL A;  2JOX A;  3ADJ A;  1QU6 A;  2ZM6 E;  1JK1 A;  1A1H A;  2YTP A;  4Z7C A;  5K36 E;  4LCF A;  3K1J A;  4OZE A;  1N34 E;  2HK2 A;  4MQY A;  4BS9 A;  2YRK A;  4LF7 E;  2O3Z A;  2YRM A;  2RS7 A;  1HNW E;  5KL7 A;  1P42 A;  4R2C A;  1U2R A;  4IJD A;  1YUI A;  4JI4 E;  2BA1 D;  4X62 I;  1NEI A;  5DRR A;  4AM3 A;  1IQS A;  4BC9 A;  2HGH A;  4LF6 E;  1YSA C;  2EQ0 A;  4DR5 E;  2MDG A;  5BR8 E;  4JI0 I;  2JEA B;  1OYS A;  1UBD C;  2MDR A;  2UUB E;  4GKK E;  4WPY A;  2MKN A;  2M4I A;  3KZY A;  2EOI A;  1UHZ A;  2E5L E;  2IOQ A;  4JI2 I;  1X47 A;  4BCA A;  4LFB E;  1OYP A;  4NXM I;  3M85 D;  1YUJ A;  2PO0 A;  4BMJ A;  3J7A M;  2C37 A;  4X65 I;  4DR6 I;  4YHH E;  3IWB A;  2IER A;  1XNR I;  1Z59 A;  2L3J A;  1FKA E;  2EPL X;  5IXM B;  3PS1 A;  4BA2 A;  2V89 A;  3RMP A;  1ZXM A;  4R2E A;  1Z0B A;  3EQ1 A;  2NN6 A;  1A1I A;  3CDI A;  2VQE E;  4B3M E;  1WUU A;  5K36 B;  1X3C A;  2Z5B A;  2LJU A;  3J81 C;  3VK6 A;  1EI1 A;  1I94 I;  1EH6 A;  3HUL A;  2PO0 B;  1SFE A;  2D9H A;  4QNK A;  3K17 A;  4ZYH A;  2RSM A;  2RS6 A;  1A1L A;  1Y60 A;  5ELW A;  1KJK A;  5EL9 A;  4X66 E;  4DV3 E;  2N3G A;  2NA2 A;  1UDQ A;  3BID A;  2BM0 A;  3GME A;  4JYA E;  1L4S A;  2H36 X;  2EJ4 A;  2V87 A;  1HR0 I;  2L2K B;  5AE1 A;  1DAR A;  4K0K E;  4F2J C;  2YSP A;  4M9V C;  3QT5 A;  1GZ6 A;  3ZKD A;  3PYF A;  2ENH A;  1T39 A;  1N0U A;  2UXD E;  2EN8 A;  4HY1 A;  4IFD D;  1HR0 E;  1PJQ A;  2EL4 A;  2FTX B;  4EMD A;  2NUE A;  4IFD C;  4QNJ A;  4DR2 E;  3WU6 A;  3OTO I;  5T6J A;  4Z7Y A;  2RPC A;  3ZZ0 A;  4NXN I;  2UUC I;  2YTG A;  2J65 A;  4X64 E;  3ADL A;  5EKW A;  2MKD A;  2BA0 G;  2EWL A;  4DV4 I;  3HJC A;  4HAC B;  3JAM Q;  3ZZU A;  4N4R B;  4DV2 I;  4MU4 A;  1HNX E;  4JI8 E;  3P3E A;  1N36 I;  2DMY A;  4F6N A;  3C6K A;  3C6M A;  2ODR D;  2JEA A;  3ADI A;  2F4V I;  1K47 A;  1N3G A;  2JEB B;  4DU7 A;  2Q2E B;  2LO3 A;  3V5R A;  2WBS A;  2EPR A;  5DRP A;  4JYA I;  5FLX C;  2EPZ A;  3MHH C;  4DR6 E;  5C0X F;  2IOP A;  4NHR A;  2EOJ A;  3DJW A;  4JI4 I;  5C0X D;  4FN5 A;  4B3S I;  1NHI A;  2V2Z A;  4JI7 I;  1RMD A;  4DV1 I;  4DV6 E;  5TSE A;  5KL2 A;  3THN A;  4JI3 E;  3B4T A;  4L8N A;  4IZJ D;  3M7N G;  4R2Q A;  2EMW A;  4DR3 E;  1YYW A;  5JEA E;  1Z5A A;  2L92 A;  2A25 A;  5IV8 B;  2EOS A;  1X49 A;  2LJP A;  4WUB A;  2JEB A;  2J7K A;  2EM6 A;  2EMY A;  2G7H A;  2LVH A;  1GQE A;  4X64 I;  3HTX A;  4F6M A;  4DXL A;  2UXB I;  1DGC A;  2PNL A;  2C37 B;  1XHK A;  4DV0 I;  3Q6N A;  2EMI A;  2YTI A;  2EPK X;  2I9I A;  3AUZ A;  2L3C A;  2EPN A;  2YTE A;  1BKN A;  3JAM C;  4NBQ A;  1HNX I;  1UN6 B;  4HEI A;  2WZO A;  4X8W A;  1P47 A;  4RHB B;  2UU9 E;  1FNM A;  4DUZ E;  3PRY A;  4FW3 A;  4LOM A;  4MU3 A;  2ENA A;  2HJJ A;  4O43 A;  4BBY A;  4DV0 E;  2WNR B;  3NZK A;  3UHM A;  4DV3 I;  4IZJ A;  4DR7 I;  1J5E I;  1IBM E;  5ADZ A;  4LFC I;  2EMH A;  2X7I A;  2NN6 C;  2KON A;  2VF1 A;  5DRO A;  2RSI A;  2NUG A;  4P52 A;  4LF7 I;  2EOZ A;  4DV7 I;  3T1H I;  2UU9 I;  4WYQ B;  3M6A A;  2ADR A;  2EZ6 A;  4OOG C;  2M9A A;  1Y5Y A;  2CG9 A;  2R42 A;  4MYT A;  5A6J A;  4HYM A;  3PYE A;  4X66 I;  2EM9 A;  1NHH A;  2PO2 A;  4AQY E;  1ZM4 A;  3Q6M A;  4L5N C;  1KIJ A;  3J80 C;  2YTJ A;  2EN3 A;  5A69 A;  2M1S A;  4FWD A;  4RH8 A;  4WXC A;  1XXE A;  4IFD E;  2VQF E;  2UXB E;  2O1W A;  4I8O A;  4DUZ I;  3LTO A;  1B63 A;  1X6E A;  3OML A;  3D4J A;  1N33 I;  1LLM C;  1RQ0 A;  3HPZ A;  2LT7 A;  1MU5 A;  1Y4S A;  1Z0C A;  2O1V A;  4Q28 A;  3TQM A;  2JY9 A;  2K4V A;  1X6F A;  4F9C B;  2M7Q A;  3LNU A;  3LLH A;  2YTD A;  4OO1 B;  5LL6 R;  2V8Q B;  1SR9 A;  4GKJ E;  1Z0V A;  1Z0G A;  2EOY A;  2EN4 A;  5KL3 A;  2EFG A;  2HFS A;  3PS3 A;  2PO2 B;  4BHB A;  4DPY A;  1ZM2 A;  4AQY I;  2GS8 A;  3C4B A;  2YZT A;  1H7S A;  2BBG A;  2J7J A;  4WUD A;  1TF3 A;  2PNM A;  4B3T I;  1F2I G;  2NN6 B;  4JI5 E;  4MU1 A;  1YYK A;  4USM A;  5A6B A;  5KL5 A;  5A6A A;  3VYX A;  1EH7 A;  4R8O A;  1D6T A;  2JXP A;  3WU5 A;  1ZAA C;  4XTJ A;  2LRS A;  2X36 A;  3QT8 A;  2IES A;  2HHH I;  5IWA E;  3ZOQ B;  2WP8 B;  1T4O A;  2EMA A;  2JOB A;  1VI7 A;  2HFU A;  4FWH A;  2DSY A;  3LPS A;  1X6H A;  1Z0T A;  4MU0 A;  2EN7 A;  2EM3 A;  2UUA E;  3V2U C;  5K36 A;  2EOM A;  4P7D A;  2VES A;  2Z5C A;  2BA0 D;  4JI6 E;  4DU8 A;  1USV A;  4OO1 A;  2LJH A;  3GLL A;  2LUQ A;  2GHF A;  1A1F A;  4IS1 C;  1QZR A;  2YTO A;  4WUC A;  4LU9 A;  5LMN E;  2JPA A;  2NN6 E;  5LMU I;  3F6G A;  2EM7 A;  1S16 A;  5GME A;  3KRN A;  2KOU A;  1OYR A;  2EOE A;  1QNT A;  1WHQ A;  3JU0 A;  2CSH A;  2B7T A;  2L33 A;  4ZYG A;  2N3H A;  4GKJ I;  3UK3 C;  2EPO A;  5A6K A;  3P76 A;  4DR4 I;  4DV5 E;  4LF5 E;  1YYO A;  3QG5 C;  2B3T B;  3BGH A;  4DV6 I;  3EPJ A;  2UUA I;  2VRD A;  3IWC A;  5GMD A;  2EP3 A;  3P3G A;  4LF4 I;  2JYA A;  4JI1 E;  2CZ9 A;  4YY3 E;  4Q35 B;  4TUI A;  4DPT A;  3J80 Q;  1J5E E;  2E72 A;  4FW5 A;  4BA1 A;  3HPS A;  5JEA D;  1XMO I;  1ZR9 A;  2YU5 A;  3B78 A;  2YWQ A;  2VE7 C;  4X9J A;  1T4L B;  1PIE A;  2CTD A;  1XNQ I;  2V2V A;  2V8P A;  2O1U A;  1IBL E;  3T1Y I;  5AE3 A;  4DUY E;  1A6F A;  2DGC A;  1Z5B A;  2E1R A;  4DV2 E;  4GZN C;  4N3O A;  2N8X A;  2WCC 3;  2JWO A;  2GQ0 A;  2WBT A;  5DNY A;  1JK2 A;  5AAS A;  4OX9 I;  1DQ3 A;  1H74 A;  4LF8 I;  3Q1Q A;  4I3H A;  4B3S E;  4ZVI A;  2V88 A;  3WU4 A;  4ED4 A;  4UT4 A;  1I94 E;  1YPN A;  5LMU E;  5LMN I;  1FWL A;  2B7V A;  3BBG A;  4IS9 A;  3H09 A;  2BR2 A;  2EM2 A;  4KHP E;  5C0X A;  2EOQ A;  1Z0E A;  4DV7 E;  2VQF I;  2EPU A;  2VQE I;  3EPK A;  1UDO A;  2DB2 A;  1WXR A;  2JR1 A;  4LCH A;  1Z0W A;  4UTG A;  1IMU A;  5DRQ A;  2EPC A;  3K85 A;  4JI7 E;  1XMQ I;  1X5W A;  2PNZ A;  2CPN A;  1NZ0 A;  1Z1B A;  2HK3 A;  3DD6 A;  4OO1 C;  2WBU A;  4GKK I;  4OO1 D;  4LF4 E;  1RHY A;  2ELY A;  1XNQ E;  3J81 Q;  1PJT A;  5IWA I;  3P1X A;  2JE6 A;  1IBK E;  4LTY A;  1KYQ A;  3J7A G;  2EMC A;  1HK7 A;  1R6M A;  1Y4U A;  5KL6 A;  4LFB I;  5K36 D;  4JI3 I;  4FW9 A;  4IZK A;  4ZYD A;  5K36 F;  4PRV A;  2HC5 A;  4M0V A;  2JP9 A;  2NUF A;  4AIM A;  4KWY A;  4JG4 A;  3L7Z B;  2EL6 A;  2WW4 A;  2PNZ B;  5AC4 A;  1A1K A;  1EA6 A;  1RC7 A;  2V2Q A;  4HAC A;  4AID A;  4WXD A;  5A6B D;  1TF6 A;  2F1D A;  4WSP A;  3B82 A;  2YTF A;  5JEA C;  1A1G A;  1UDS A;  1H7U A;  4JI6 I;  5IT9 C;  1AAY A;  4LF8 E;  1HNW I;  4DR7 E;  2DRP A;  3PS2 A;  4U3D A;  2GLI A;  1FWK A;  1J26 A;  2EN2 A;  2EM4 A;  3EPL A;  4NXN E;  1PJS A;  4LCG A;  4DPX A;  4M30 A;  2EOH A;  4JI0 E;  1H73 A;  2AJ4 A;  3CWV A;  2LCE A;  4NZV A;  2K7I A;  2EMK A;  2F4V E;  1XMQ E;  3AV0 A;  4DV1 E;  1TN9 A;  1IBM I;  2DMI A;  5LLQ A;  1XMO E;  1E3P A;  2GO3 A;  2DLQ A;  2YU8 A;  2PO1 A;  2HKJ A;  4PRX A;  1WRJ A;  3ECR A;  4FK5 C;  1DI2 A;  4JI1 I;  4BA2 B;  2EQ1 A;  1PDA A;  1N33 E;  2VF3 A;  3L7Z A;  4OO1 F;  2EMG A;  4URL A;  2C38 B;  5L3J A;  4GQU A;  1E3H A;  3HKM A;  2CT1 A;  4HTG A;  1STU A;  3C4T A;  2RTX A;  4FW6 A;  3HQ1 A;  4FW7 A;  2C39 B;  4MLQ A;  5DNX A;  4ISA A;  1OJ4 A;  2EOF A;  2NN6 D;  5FWK A;  3MHS C;  1R6L A;  3P3C A;  2NPF A;  4KZS A;  5JEA B;  4FW4 A;  2ODR C;  1MG7 A;  1H72 C;  4LF9 E;  1YH8 A;  4DR1 E;  2EPA A;  2LBS B;  4P7A A;  2EPX A;  3KWR A;  4DR3 I;  1ZM9 A;  2Z5E A;  3EPH A;  4R2D A;  2C38 A;  2UXC I;  4WX9 A;  4K0K I;  2NAB A;  2V83 A;  4WSG A;  2EMZ A;  3MSW A;  3PYD A;  1N34 I;  1HNZ I;  4JI8 I;  5C0X B;  4LF9 I;  4DPU A;  2MC6 A;  2HHH E;  1T4N A;  2L2M A;  4PU9 A;  4IZJ B;  2E1M A;  2E5L I;  2L8T A;  5JEA A;  4BC7 A;  4LFC E;  2EML A;  2LE2 A;  4NXM E;  2PO1 B;  1UDN A;  4DMI A;  4F9B B;  3CDJ A;  2BR2 B;  4TUG A;  2LMZ A;  3P06 A;  2BV3 A;  2EM5 A;  2A2D A;  1IBK I;  1PVG A;  1T38 A;  2XEX A;  2B9D A;  4IFD B;  4LF6 I;  2EMB A;  1HNZ E;  5CFF E;  2DEJ A;  2JE6 B;  4O5G A;  1PKP A;  2R76 A;  4R2A A;  1YZ9 A;  1ZM3 A;  2EN1 A;  1NHJ A;  2YTQ A;  2CGE A;  3WU3 A;  5F3W A;  1G2F C;  3B8H A;  1RR9 A;  3ZZT A;  4DPW A;  1MEY C;  4MDT A;  2I13 A;  4B3R I;  2EE8 A;  1UEK A;  3GON A;  2DEI A;  3GCM A;  2UXC E;  5C0X E;  3ADG A;  4R2P A;  3K6Q A;  4LPF A;  2LV2 A;  2AE8 A;  2BA1 G;  2EPP A;  2V85 A;  2UUB I;  1Z5C A;  2L6M A;  4R1F A;  5DNL A;  1WHN A;  1NCS A;  5KL4 A;  3ZM7 A;  3DF6 A;  2EN6 A;  3OTO E;  4DR2 I;  4J8Z A;  1IBL I;  2FGG A;  4JI2 E;  2R3V A;  3BF2 A;  1ZBQ A;  2EM0 A;  2Q8U A;  2YPN A;  1G2D C;  2A2C A;  5K36 C;  2DLK A;  1MX0 A;  1USU A;  1S4E A;  3FIG A;  5IT9 Q;  2GPI A;  3THO B;  1FI4 A;  2EM8 A;  1ZBT A;  4B3R E;  4JV5 I;  4IFD A;  2C39 A;  4M2Z A;  2L2N A;  2F8B A;  3U1Y A;  2WNR A;  2DIX A;  2ZIT A;  4M1K A;  2MC5 A;  2BM1 A;  2YTN A;  2UXD I; 
#chains in the Genus database with same CATH homology
 2LUP B;  3JTZ A;  5A2Q C;  4JI5 I;  4R03 A;  4DV5 I;  4LF5 I;  2OI2 A;  2Z5C B;  1ELO A;  1ZXN A;  4DR5 I;  3QT6 A;  3F0N A;  4KHP I;  4LFA E;  3T1H E;  5AE2 A;  2V34 A;  4B3M I;  4JV5 E;  2V86 A;  4DR4 E;  2LTS A;  2O1T A;  1X48 A;  2YT4 A;  1RRE A;  4IZK B;  1N36 E;  4MYU A;  4B3T E;  3H4L A;  4P78 A;  4DR1 I;  3HXL A;  4X65 E;  1VIS A;  2ZM6 I;  4DUY I;  2KHX A;  3VYY A;  1KKH A;  4FWG A;  4WFT A;  2Z5B B;  4F54 A;  2FV4 B;  3T1Y E;  5A2Q Q;  4GEQ B;  3QT7 A;  3PYG A;  5FLX Q;  5BR8 I;  1N0V C;  3J7Y p;  2ZBK B;  4DV4 E;  4X62 E;  1KVK A;  4HXZ A;  1N32 E;  1O0W A;  4RPF A;  2UUC E;  3IWD A;  4LFA I;  1Y6Z A;  4YHH I;  1KTV A;  3LML A;  1B62 A;  4KQV A;  1FJG E;  3F6H A;  3ZKB A;  1N32 I;  2IHR 1;  4F9A B;  4USK A;  2JVA A;  2LTR A;  2HKE A;  4OX9 E;  1EKZ A;  1XNR E;  4YY3 I;  4DKK A;  1FJG I;  2ZM6 E;  1UIL A;  2JOX A;  3ADJ A;  1QU6 A;  4Z7C A;  3K1J A;  1N34 E;  2HK2 A;  4BS9 A;  4LF7 E;  2RS7 A;  1HNW E;  1U2R A;  4JI4 E;  4X62 I;  4BC9 A;  4LF6 E;  4DR5 E;  5BR8 E;  4JI0 I;  2MDR A;  2UUB E;  4GKK E;  4WPY A;  2M4I A;  1UHZ A;  2E5L E;  2IOQ A;  4JI2 I;  1X47 A;  4BCA A;  4LFB E;  4NXM I;  4BMJ A;  3J7A M;  4DR6 I;  4X65 I;  4YHH E;  3IWB A;  1XNR I;  1Z59 A;  2L3J A;  1FKA E;  2V89 A;  3RMP A;  1ZXM A;  1Z0B A;  2VQE E;  4B3M E;  1WUU A;  2Z5B A;  3J81 C;  3VK6 A;  1EI1 A;  1I94 I;  3HUL A;  3K17 A;  2RSM A;  2RS6 A;  4X66 E;  4DV3 E;  2N3G A;  2NA2 A;  2BM0 A;  4JYA E;  2H36 X;  2V87 A;  1HR0 I;  2L2K B;  5AE1 A;  1DAR A;  4K0K E;  3QT5 A;  3ZKD A;  1GZ6 A;  3PYF A;  1N0U A;  2UXD E;  4HY1 A;  1HR0 E;  2FTX B;  4EMD A;  2NUE A;  3WU6 A;  4DR2 E;  3OTO I;  5T6J A;  4Z7Y A;  3ZZ0 A;  4NXN I;  2UUC I;  4X64 E;  3ADL A;  4DV4 I;  2EWL A;  3HJC A;  4HAC B;  3JAM Q;  3ZZU A;  4DV2 I;  1HNX E;  4JI8 E;  1N36 I;  2DMY A;  2ODR D;  3ADI A;  2F4V I;  1K47 A;  4DU7 A;  2Q2E B;  3V5R A;  4JYA I;  5FLX C;  4DR6 E;  2IOP A;  3DJW A;  4JI4 I;  4FN5 A;  4B3S I;  1NHI A;  2V2Z A;  4JI7 I;  4DV1 I;  4DV6 E;  4JI3 E;  4L8N A;  4IZJ D;  1YYW A;  4DR3 E;  1Z5A A;  2L92 A;  2LJP A;  1X49 A;  4WUB A;  2J7K A;  2G7H A;  1GQE A;  4X64 I;  3HTX A;  2UXB I;  4DXL A;  2PNL A;  1XHK A;  4DV0 I;  3Q6N A;  3AUZ A;  2L3C A;  1BKN A;  3JAM C;  1HNX I;  4X8W A;  2WZO A;  3PRY A;  2UU9 E;  1FNM A;  4DUZ E;  4DV0 E;  4BBY A;  4DR7 I;  4DV3 I;  4IZJ A;  1J5E I;  1IBM E;  5ADZ A;  4LFC I;  2X7I A;  2KON A;  2VF1 A;  4P52 A;  2NUG A;  4LF7 I;  4DV7 I;  3T1H I;  2UU9 I;  4WYQ B;  3M6A A;  2EZ6 A;  4OOG C;  2R42 A;  2CG9 A;  4MYT A;  4HYM A;  3PYE A;  4X66 I;  1NHH A;  4AQY E;  1ZM4 A;  3Q6M A;  4L5N C;  1KIJ A;  3J80 C;  2M1S A;  4FWD A;  2VQF E;  2UXB E;  2O1W A;  4I8O A;  4DUZ I;  3LTO A;  1B63 A;  3OML A;  3D4J A;  1N33 I;  1Y4S A;  1RQ0 A;  3HPZ A;  1MU5 A;  1Z0C A;  2O1V A;  4Q28 A;  2JY9 A;  2K4V A;  4F9C B;  2M7Q A;  3LNU A;  3LLH A;  5LL6 R;  2V8Q B;  1SR9 A;  4GKJ E;  1Z0V A;  1Z0G A;  2EFG A;  2HFS A;  4DPY A;  1ZM2 A;  4AQY I;  2GS8 A;  3C4B A;  2YZT A;  1H7S A;  4WUD A;  2PNM A;  4B3T I;  4USM A;  4JI5 E;  1YYK A;  3VYX A;  4R8O A;  1D6T A;  3WU5 A;  4XTJ A;  2LRS A;  2X36 A;  3QT8 A;  2HHH I;  5IWA E;  3ZOQ B;  4FWH A;  1T4O A;  2JOB A;  2HFU A;  2DSY A;  3LPS A;  1Z0T A;  2UUA E;  3V2U C;  4P7D A;  2Z5C A;  4JI6 E;  4DU8 A;  1USV A;  2LJH A;  2LUQ A;  1QZR A;  4WUC A;  4LU9 A;  5LMN E;  5LMU I;  3F6G A;  1S16 A;  5GME A;  2KOU A;  1WHQ A;  3JU0 A;  2B7T A;  2L33 A;  2N3H A;  4GKJ I;  4DR4 I;  4DV5 E;  4LF5 E;  1YYO A;  2B3T B;  4DV6 I;  2UUA I;  3IWC A;  5GMD A;  4LF4 I;  4JI1 E;  2CZ9 A;  4YY3 E;  4TUI A;  4DPT A;  3J80 Q;  1J5E E;  3HPS A;  1XMO I;  3B78 A;  2VE7 C;  1T4L B;  1PIE A;  1XNQ I;  2V2V A;  2V8P A;  2O1U A;  1IBL E;  3T1Y I;  5AE3 A;  4DUY E;  1A6F A;  1Z5B A;  2E1R A;  4DV2 E;  4N3O A;  2JWO A;  2GQ0 A;  5DNY A;  4OX9 I;  5AAS A;  1DQ3 A;  1H74 A;  4LF8 I;  3Q1Q A;  4I3H A;  4B3S E;  4ZVI A;  2V88 A;  3WU4 A;  4ED4 A;  4UT4 A;  1I94 E;  5LMU E;  5LMN I;  1FWL A;  2B7V A;  3H09 A;  4KHP E;  1Z0E A;  4DV7 E;  2VQF I;  2VQE I;  2DB2 A;  1WXR A;  2JR1 A;  1Z0W A;  4UTG A;  3K85 A;  1XMQ I;  4JI7 E;  2CPN A;  1NZ0 A;  2HK3 A;  4GKK I;  4LF4 E;  3J81 Q;  1XNQ E;  5IWA I;  3P1X A;  1IBK E;  4LTY A;  3J7A G;  1HK7 A;  1Y4U A;  4LFB I;  4JI3 I;  4FW9 A;  4IZK A;  4PRV A;  4M0V A;  2NUF A;  4JG4 A;  2WW4 A;  1EA6 A;  1RC7 A;  2V2Q A;  4HAC A;  3B82 A;  4WSP A;  1H7U A;  4JI6 I;  5IT9 C;  1HNW I;  4LF8 E;  4DR7 E;  1FWK A;  1J26 A;  4NXN E;  4DPX A;  4M30 A;  4JI0 E;  1H73 A;  2AJ4 A;  3CWV A;  2F4V E;  1XMQ E;  3AV0 A;  4DV1 E;  1IBM I;  1XMO E;  2HKJ A;  4PRX A;  1DI2 A;  4JI1 I;  1N33 E;  2VF3 A;  5L3J A;  4URL A;  1STU A;  3C4T A;  2RTX A;  3HQ1 A;  1OJ4 A;  5FWK A;  2NPF A;  4KZS A;  2ODR C;  1MG7 A;  1H72 C;  4LF9 E;  2LBS B;  4DR1 E;  4P7A A;  4DR3 I;  3KWR A;  1ZM9 A;  2Z5E A;  2UXC I;  4K0K I;  2V83 A;  3MSW A;  3PYD A;  1N34 I;  1HNZ I;  4JI8 I;  4LF9 I;  4DPU A;  2MC6 A;  2HHH E;  1T4N A;  2L2M A;  4PU9 A;  4IZJ B;  2E1M A;  2E5L I;  2L8T A;  4BC7 A;  4LFC E;  2LE2 A;  4NXM E;  4DMI A;  4F9B B;  4TUG A;  2LMZ A;  3P06 A;  2BV3 A;  2A2D A;  1IBK I;  1PVG A;  2XEX A;  2B9D A;  4LF6 I;  1HNZ E;  5CFF E;  2DEJ A;  1PKP A;  1ZM3 A;  1YZ9 A;  1NHJ A;  2CGE A;  3WU3 A;  5F3W A;  3B8H A;  3ZZT A;  1RR9 A;  4DPW A;  4B3R I;  1UEK A;  3GON A;  2DEI A;  2UXC E;  3ADG A;  3K6Q A;  2V85 A;  2UUB I;  1Z5C A;  2L6M A;  4R1F A;  1WHN A;  3ZM7 A;  3DF6 A;  3OTO E;  4DR2 I;  4J8Z A;  1IBL I;  2FGG A;  4JI2 E;  2R3V A;  1ZBQ A;  2A2C A;  1MX0 A;  1USU A;  1S4E A;  3FIG A;  5IT9 Q;  1FI4 A;  4B3R E;  1ZBT A;  4JV5 I;  4M2Z A;  2L2N A;  2F8B A;  2DIX A;  2ZIT A;  4M1K A;  2MC5 A;  2BM1 A;  2UXD I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...