4DR1E

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr1E02
4X66I 2KHXA 1B62A 4DV7I 4FN5A 2UXDI 3WU5A 4EMDA 3J7Yp 1Z5BA 2BM1A 2UXBI 3QT7A 2HHHI 4HYMA 1O0WA 2WW4A 5A2QC 2DEJA 1A6FA 4P7AA 2LBSB 4LF6E 1H72C 3F0NA 4DR3I 2UXCI 1Z5AA 2L3CA 4OOGC 3VYYA 4DV4E 4M2ZA 1H74A 4JYAE 1KTVA 2UUAE 2CZ9A 2L2MA 1D6TA 4X65I 4DR2I 2N3HA 3V5RA 2HKEA 1N33E 4LF4I 1U2RA 4I3HA 2L3JA 3QT6A 4UT4A 3B82A 5BR8I 2HK2A 2MDRA 1NHHA 1YYOA 2R42A 4JI4I 4WUBA 4ED4A 3LTOA 5IT9Q 4AQYE 2NUEA 1J5EI 4JI8I 4DKKA 4X64E 2IHR1 4GKJI 1ZM2A 1IBKI 3JAMQ 4B3ME 2N3GA 1WHNA 1Z0TA 4XTJA 4DR6E 4DV0E 5LMNE 4YY3E 1ZXMA 2NUFA 4LF8I 1XMQI 2ZM6I 3T1YI 1Z0BA 4NXMI 2YT4A 1Z0VA 2J7KA 3QT8A 4ZVIA 3ADGA 4YHHI 4JV5E 4DUZE 4DR1E 4B3RI 4JI1I 2HFUA 1XHKA 3LNUA 4GKKI 1FKAE 3ZKBA 2E5LE 1ZM3A 3OTOI 3J80Q 2UUBI 5FLXC 2RS7A 4OX9I 3ZM7A 3T1HE 4B3TE 2RS6A 1NHIA 1Z0CA 1HNXI 1UEKA 2VQFE 4USMA 3WU4A 1OJ4A 4LFCE 2VQEI 4LFBI 5BR8E 1N34I 3HULA 4K0KE 2NUGA 3C4TA 5GMEA 2XEXA 4DV6E 4PRXA 1I94E 1YYWA 4GKJE 1XMOE 4NXNI 2LJHA 4KQVA 2LTRA 2CPNA 1N0UA 4JI2I 1MX0A 3PYFA 2L2KB 2ZM6E 4LF7E 2DB2A 2GS8A 4PRVA 4DR5I 4DR7I 4Z7YA 4JI3E 2HFSA 4JI1E 1GQEA 2L2NA 2R3VA 1N36I 1HNZE 1RQ0A 3ZZUA 1Z5CA 1H73A 4LFAI 4DPWA 2ZITA 5L3JA 4RPFA 4X62E 1RC7A 4DPTA 1N32I 4JI6I 1HNWI 1XNRE 5A2QQ 4DV3I 2F4VE 2V2VA 2X7IA 4JI5E 2BV3A 1MU5A 1FJGI 4LF5E 4JI0E 5IWAI 5LMUI 1H7SA 3PYEA 1YYKA 4DUYI 1X48A 4DPXA 2UU9E 2RTXA 2LRSA 1IBMI 4X8WA 4B3SI 4LF9E 1KIJA 4WUCA 2LUPB 1RREA 4X66E 4DR4I 3JAMC 1IBLI 2A2DA 1Z0WA 4DV7E 1ZM4A 2UXDE 1NHJA 2B3TB 5CFFE 2UXBE 2HHHE 1HR0I 5LL6R 3ZKDA 4JI7I 1DARA 2LUQA 1S16A 2V2ZA 4HY1A 1WHQA 4HXZA 4MYUA 4DR5E 4KHPI 1T4LB 2B7TA 4DR3E 2UXCE 1Z59A 2DEIA 2ZBKB 2EFGA 4X65E 3P1XA 3H4LA 4DV2I 4LF6I 2UUCI 4USKA 4DR2E 1RR9A 1DI2A 1T4NA 4URLA 4FW9A 4R1FA 4DV4I 4HACB 3J81Q 4JYAI 2UUAI 4LF4E 3ADIA 1NZ0A 3CWVA 2HK3A 2LTSA 4DV1I 3B8HA 1UHZA 3V2UC 4JI4E 2B7VA 1N33I 3ADLA 4PU9A 1J5EE 4UTGA 4JI8E 1IBME 4DV5I 1IBKE 1UILA 1FWKA 4DPUA 2AJ4A 4LF8E 1XMQE 4AQYI 3T1YE 3QT5A 4NXME 4YHHE 3LPSA 2BM0A 2L33A 2NA2A 4B3RE 4B3MI 2EZ6A 1WUUA 4Z7CA 1QZRA 4KHPE 1FNMA 4DR6I 4DV0I 1FWLA 4YY3I 4GKKE 2DMYA 4WUDA 5LMNI 4WFTA 2X36A 4WYQB 3OTOE 2UUBE 1YZ9A 2LJPA 1MG7A 4MYTA 1ZXNA 4OX9E 4JV5I 4DUZI 4DR1I 2JY9A 2V34A 1KKHA 4DV2E 1STUA 1HNXE 2HKJA 1ELOA 2UUCE 1N0VC 3K17A 1KVKA 3Q1QA 3WU3A 2E5LI 3HTXA 2VQEE 2V2QA 4LFBE 2E1RA 3T1HI 3J7AG 1XNQI 4B3TI 3ZZ0A 3D4JA 1N34E 1S4EA 4DV1E 1ZM9A 2VQFI 1EKZA 5IT9C 4LFCI 1EA6A 1VISA 4JG4A 1ZBTA 4DV5E 4NXNE 4K0KI 2OI2A 3ZZTA 1QU6A 2RSMA 1K47A 3M6AA 4DU8A 3ADJA 4JI2E 1PVGA 4DV6I 1I94I 1H7UA 1Z0GA 1XMOI 4DR7E 4P52A 2A2CA 3PYDA 2JVAA 1N36E 3J80C 4LFAE 3VYXA 1X47A 4LF7I 1N32E 4JI6E 1HNWE 4DXLA 4DU7A 4JI3I 4M1KA 4DV3E 1J26A 1T4OA 1HNZI 3J7AM 3J81C 5GMDA 1PKPA 5FLXQ 2V8PA 1FJGE 4X62I 2NPFA 3B78A 1XNQE 5IWAE 5LMUE 1XNRI 1EI1A 2F4VI 1X49A 4DUYE 4DPYA 4JI5I 3PYGA 3LLHA 1BKNA 2DIXA 2VF3A 4LF5I 4HACA 4JI0I 4B3SE 1PIEA 1B63A 4M30A 4DR4E 3WU6A 4FWGA 1IBLE 3GONA 3C4BA 1Z0EA 1FI4A 2UU9I 1HR0E 4FWDA 4X64I 4FWHA 4JI7E 2Q2EB 4LF9I 3K1JA
chains in the Genus database with same CATH superfamily
1G2FC 2EMWA 4X66I 1Y4SA 2EOSA 1G2DC 2PNZA 2N8XA 1SR9A 2R1FA 4J3DA 2KHXA 1B62A 4DV7I 4FN5A 2UXDI 3RMPA 3WU5A 2M4IA 4EMDA 3J7Yp 1Z5BA 3HJCA 2BM1A 4F6MA 1A1KA 3QT7A 2HHHI 4HYMA 2UXBI 3F6GA 4KWYA 5K36B 1O0WA 2WW4A 2E1MA 5A2QC 2DEJA 1A6FA 5KL7A 4P7AA 1MEYC 4HEIA 2LBSB 4LF6E 1H72C 5EKWA 4ZYEA 2G7HA 2NABA 5JEAD 3F0NA 4DR3I 2UXCI 2YRMA 2NN6D 1RMDA 1USUA 1Z5AA 4IFDA 4OOGC 3L00A 2L3CA 3VYYA 3PRYA 4DV4E 4M2ZA 3VHTB 1H74A 4JYAE 1KTVA 2UUAE 2GPIA 2CZ9A 1X3CA 2L2MA 5C0XB 1D6TA 2EMCA 1UDSA 5KL6A 2M1SA 4X65I 2L6MA 1OYRA 2DMIA 4OO1D 5K36E 2EMHA 2BB8A 4DR2I 2N3HA 2EPNA 1A1GA 2YZTA 3V5RA 2HKEA 3M85D 4R2EA 2CSHA 1N33E 1X6EA 1U2RA 4LF4I 4I3HA 2L3JA 1IQSA 3QT6A 1P42A 4FW6A 2LMZA 4UT4A 2JR1A 3B82A 2V88A 5BR8I 2JEAB 2RPCA 2HK2A 2DLQA 2MDRA 5C0XA 4OO1F 4IZJA 4R2DA 2EQ0A 4O5GA 3TQMA 1NHHA 2GQ0A 1YYOA 2O1VA 2R42A 4JI4I 2PO0B 2CVEA 4WUBA 4OO1C 4ED4A 3QG5C 3LTOA 3PS1A 5IT9Q 4AQYE 2NUEA 1J5EI 4JI8I 5F3WA 4DKKA 5LLQA 1DGCA 1TF3A 4X9JA 4WPYA 4X64E 2IHR1 4FK5C 1RHYA 4GKJI 2PO1B 1ZM2A 3MHHC 3CDJA 4R2SA 3CDIA 1IBKI 2V8QB 2HJJA 3JAMQ 4B3ME 2N3GA 2EPPA 1WHNA 2BBGA 4BS9A 1Z0TA 2GHFA 4XTJA 4DR6E 4DV0E 5LMNE 4YY3E 5JEAB 1ZXMA 2ENCA 2PNLA 2NUFA 2EN7A 2NN6B 1PJSA 2ZM6I 1XMQI 3T1YI 1Z0BA 4LF8I 4NXMI 2YT4A 2EM7A 1Z0VA 2J7KA 3QT8A 4ZVIA 3ADGA 2WCC3 4YHHI 4JV5E 4DUZE 4DR1E 5AC4A 4B3RI 2RSIA 4JI1I 2HFUA 4U3BA 1AAYA 1XHKA 5K36D 3LNUA 2LT7A 4L5NC 1FKAE 1UDNA 3ZKBA 4GKKI 4HTGA 5IV8B 2E5LE 2EM6A 1ZM3A 4Q35B 3OTOI 3J80Q 4LTYA 2UUBI 5FLXC 5JEAE 2RS7A 2GLIA 4OX9I 2NN6E 5A6KA 3T1HE 3ZM7A 5JEAA 4BBYA 4B3TE 2RS6A 3GCMA 3BF2A 3THOB 1NHIA 4R2RA 2EM2A 1Z0CA 1HNXI 1UEKA 1WRJA 3IWDA 4AIDA 2V87A 4FW7A 5ADZA 2VQFE 2YTGA 4USMA 1MGTA 1KJKA 2BA1D 4FW5A 4LU9A 4M9VC 1OJ4A 4LFCE 3WU4A 2C38B 5K36F 2EPMX 4OO1A 2VQEI 4LFBI 5KL5A 2JWOA 4MQYA 2EM9A 5DNYA 3JTZA 3JU0A 2WP8B 3M85G 5K36C 5BR8E 1N34I 3HULA 2Z5CB 3U1YA 1NEIA 3HPZA 4K0KE 3H09A 1IMUA 3BIDA 5C0XF 2JP9A 2NUGA 2FGGA 3C4TA 2MC6A 1GZ6A 2CG9A 5GMEA 2XEXA 3Q6NA 3M7NG 4DV6E 4PRXA 3MHSC 4ZYDA 1I94E 4GEQB 4P7DA 1JK1A 1YUJA 1YYWA 4GKJE 1XMOE 1L4SA 4NXNI 4LOMA 2LJHA 5EL9A 4WSGA 4KQVA 2WP8A 3OMLA 2LTRA 5AASA 2JPAA 2CPNA 1N0UA 4JI2I 1MX0A 1Y60A 3PYFA 2EN6A 4F9AB 2L2KB 2ZM6E 1TF6A 4LF7E 2DB2A 2GS8A 1WJPA 2JT2A 2EOQA 1EH6A 4PRVA 4DR5I 4WXCA 4DR7I 4Z7YA 4JI3E 2MDGA 2HFSA 2ODRC 3ZZTA 4JI1E 2EOJA 1GQEA 3L7ZA 2EMYA 2L2NA 2R3VA 1N36I 3EPKA 1HNZE 1RQ0A 3ZZUA 1Z5CA 2M9AA 1H73A 2EMKA 4LFAI 4DPWA 2LO3A 2ZITA 2ENAA 5L3JA 5TSEA 3EPJA 4RPFA 4X62E 1RC7A 4DPTA 1N32I 4TUGA 2EPOA 2Z5EA 4JI6I 1USVA 1HNWI 1XNRE 5K36A 4U3DA 5A2QQ 2EN8A 2JEBB 5DRPA 5JEAF 2F4VE 4DV3I 2V2VA 2X7IA 2NN6F 4NBQA 2F8BA 2EPUA 4M0VA 4ZYGA 4IS1C 4JI5E 1OYSA 2BV3A 4LCHA 1YHCA 4NZVA 2EMGA 5JEAC 2EOEA 3BBGA 1MU5A 1FJGI 4LF5E 2NN6C 2EOFA 4JI0E 2BA0G 5IWAI 5LMUI 1H7SA 4IFDD 4J8ZA 3PYEA 1YYKA 4DUYI 5IXMB 2PNMA 4N4RB 2L8TA 1X48A 4DPXA 2JEBA 2Z5BB 1QNTA 2E72A 4LCFA 2K7IA 1YFHA 2H36X 2RTXA 2LRSA 1WXRA 2UU9E 1IBMI 2O1UA 4IJDA 4X8WA 4B3SI 2YTDA 1BBOA 3IWCA 4LF9E 1KIJA 3PS3A 4WUCA 2VESA 2LUPB 1T38A 3AUZA 1RREA 4X66E 1Y5YA 3JAMC 4BA2B 4DR4I 3THNA 3IWBA 2JEAA 1IBLI 2FV4B 2A2DA 5DROA 1Z0WA 4DV7E 4AQYI 1ZM4A 2UXDE 1NHJA 2B3TB 5CFFE 4WX9A 2EOXA 2UXBE 2HHHE 1IQOA 3DJWA 2PO0A 1HR0I 5LL6R 4WXDA 3ZKDA 2EPLX 4JI7I 1DARA 2LUQA 3ZOQB 1E3HA 1S16A 2V2ZA 4AIMA 2JE6B 4HY1A 1WHQA 4ZYHA 1PJTA 1ZAAC 2HGHA 4HXZA 4MYUA 4DR5E 3F6HA 1T4LB 4KHPI 3C6KA 4ISAA 2B7TA 4DR3E 1PJQA 2UXCE 2C39B 2PO1A 1Z59A 2DEIA 4F54A 2ZBKB 4DMIA 2AE8A 3KWRA 2EFGA 5AE1A 4BA2A 3BGHA 4BHCA 4Q28A 2A25A 2GO3A 2EOIA 5DNLA 2PO2B 3KZZA 5KL3A 2EOHA 4X65E 3P1XA 2NN6A 3HQ1A 3H4LA 4FW4A 4BA1B 4DV2I 4F2JC 4LPFA 4LF6I 2UUCI 2YSOA 2YPNA 4DR2E 4USKA 1RR9A 1DI2A 2EMAA 1T4NA 1B69A 2EOZA 2YTEA 4URLA 4FW9A 4MU3A 4R1FA 4DV4I 2JE6A 4IFDB 2EMFA 4HACB 4I8OA 4O4KA 5AE3A 3J81Q 4LF4E 2UUAI 4JYAI 3EPLA 2KOUA 4F9CB 3ADIA 1NZ0A 3P06A 4N3OA 3CWVA 4BMJA 2HK3A 2HC5A 5DNXA 2JYAA 5DRQA 2YSPA 4OZEA 2I13A 1Y4UA 2DRPA 2LTSA 2PRTA 4DV1I 3B8HA 1UHZA 2YTIA 3KZYA 2EM3A 3V2UC 4BA1A 4JI4E 2B7VA 2EQ1A 4IZJD 2C37B 2B9DA 2CTDA 1N33I 3ADLA 4PU9A 3LMLA 1J5EE 4JI8E 4UTGA 4IFDE 2ENHA 2C38A 1IBME 2EORA 2PNZB 2EWLA 1A1JA 4MU1A 4DV5I 2V83A 1IBKE 4GZNC 5AC5A 1UILA 3L7ZB 1X5WA 1VI7A 1R6MA 4L8NA 3B4TA 2WBUA 5KL4A 1FWKA 2Z5CA 1UDOA 1EH7A 1YH8A 2YU5A 2AJ4A 3GMEA 4DPUA 4LF8E 2EMBA 1XMQE 4OKGA 2O1WA 2K4VA 3T1YE 1YSAC 4NXME 1OYPA 3QT5A 4YHHE 3EQ1A 1UN6B 3LPSA 2BM0A 2L33A 2RQLA 2J7JA 2YWQA 2NA2A 2EPKX 2EOYA 4B3RE 3KRNA 3H1CA 2EPXA 4B3MI 2EZ6A 1WUUA 4Z7CA 2JOBA 4KHPE 1QZRA 4F9BB 4O43A 2CT1A 2EL5A 3HPSA 1FNMA 4DR6I 2MKNA 5ELWA 4DV0I 1FWLA 4YY3I 4GKKE 2DMYA 3M99B 4WUDA 5LMNI 4WFTA 1BB8A 4NHRA 2X36A 1GTKA 4WYQB 1DQ3A 3OTOE 2F1DA 2UUBE 1YZ9A 2LJPA 3UHMA 2EN3A 1MG7A 3HXLA 1ZXNA 4OX9E 2IERA 3Q6MA 2EMZA 4MYTA 4DUZI 4DR1I 4JV5I 3VK6A 5A6JA 2LVHA 2JY9A 2V34A 1T39A 2EN1A 1KKHA 2CGEA 4DV2E 1STUA 1HNXE 2HKJA 4RHBB 2UUCE 1ELOA 1N0VC 2IOQA 3K17A 5A69A 2FTXB 2L92A 1KVKA 3Q1QA 3PS2A 3WU3A 2E5LI 5AE2A 3HTXA 1PDAA 2KONA 2YTFA 4MLVA 2VQEE 4P78A 4LFBE 2O1TA 2V2QA 2E1RA 4IZJB 3T1HI 3J7AG 2BA1G 1XNQI 2DSYA 2DLKA 3P76A 4B3TI 3ZZ0A 3ECRA 3D4JA 1N34E 1TN9A 2YRHA 2EN2A 1HK7A 4R2AA 1S4EA 5A6BD 1KYQA 4DV1E 1X6HA 1ZBQA 1A1FA 2IOPA 1ZM9A 3U1KA 1YUIA 2VQFI 1EKZA 5IT9C 4LFCI 1UDQA 4MU4A 1EA6A 1BBGA 2YRKA 2WNRB 4BCAA 1VISA 2LJUA 2Q8UA 5C0XE 4MLQA 4IS9A 4JG4A 2I9IA 1R6LA 1ZBTA 4R8OA 2M7QA 4DV5E 4NXNE 4IFDF 4K0KI 1YPNA 2EJ4A 4R03A 2OI2A 1QU6A 2EM0A 2RSMA 1AH5A 4R2CA 1K47A 2WBTA 2J65A 3M6AA 3ADJA 4DU8A 3M7ND 2EPCA 2IESA 2YTPA 3P3GA 3FIGA 4JI2E 4IFDC 1PVGA 2V86A 1NCSA 4DV6I 2LCEA 2Z5BA 1I94I 1LLMC 5DRRA 4KZSA 3K6QA 1H7UA 2ELYA 1Z0GA 1XMOI 4DR7E 2JOXA 2WNRA 4P52A 3NZKA 2EE8A 2A2CA 2WZOA 4IZKB 2MC5A 2JVAA 3PYDA 2O3ZA 1X6FA 4BC9A 1N36E 5T6JA 4FW3A 4O24A 2YTNA 1A1IA 3J80C 3UK3C 4LFAE 3EPHA 4LCGA 1A1HA 3VYXA 4MU0A 3AV0A 1P47A 1X47A 4LF7I 2DGCA 2EPZA 3GLLA 2EOOA 4R2QA 1E3PA 1N32E 4JI6E 1HNWE 4RH8A 4DXLA 4DU7A 2V89A 2VE7C 4M1KA 2EPAA 4JI3I 2EM8A 2VF1A 4DV3E 1J26A 1T4OA 4OO1B 2MKDA 1HNZI 3J7AM 1A1LA 1JK2A 1ZU1A 2C39A 3J81C 1EH8A 5GMDA 2WBSA 4WSPA 1PKPA 4IZKA 5FLXQ 3P3CA 2V8PA 2EL4A 1Z1BA 1FJGE 1Y6ZA 2NPFA 2D9HA 5A6AA 4X62I 3B78A 2VRDA 2EP3A 1XNQE 5IWAE 5LMUE 2PO2A 2R76A 1XNRI 2EMLA 1EI1A 3C6MA 3DD6A 2F4VI 1X49A 4AM3A 4DUYE 2EMXA 2EN4A 2EOMA 1SFEA 4DPYA 5C0XD 2LV2A 2EMIA 2BR2B 4JI5I 4QNJA 3PYGA 3LLHA 4OO1E 1BKNA 2BA0D 4R2PA 4TUIA 3K85A 2YTQA 2LE2A 2DIXA 2YTOA 2VF3A 4HACA 2EM4A 2JXPA 4F6NA 4QNKA 4LF5I 4JI0I 4B3SE 5A6BA 1PIEA 1B63A 3P3EA 2EM5A 4M30A 5KL2A 3DF6A 1UBDC 2YU8A 4DR4E 4GQUA 3WU6A 4FWGA 1IBLE 5FWKA 2V85A 1N3GA 2ELZA 3GONA 4BHBA 3C4BA 2YTJA 1Z0EA 3MSWA 4MDTA 4BC7A 1FI4A 2GO4A 2EPRA 2UU9I 2ODRD 1HR0E 2EL6A 2ADRA 4FWDA 4X64I 4FWHA 2C37A 2BR2A 4JI7E 1XXEA 3HKMA 2Q2EB 4LF9I 1ZR9A 3K1JA 5C0XC 1F2IG 2EQ3A
chains in the Genus database with same CATH topology
4X66I 1Y4SA 1SR9A 2KHXA 1B62A 4DV7I 4FN5A 2UXDI 3RMPA 3WU5A 2M4IA 4EMDA 3J7Yp 1Z5BA 3HJCA 2BM1A 2UXBI 3QT7A 2HHHI 4HYMA 3F6GA 1O0WA 2WW4A 2E1MA 5A2QC 2DEJA 1A6FA 4P7AA 2LBSB 4LF6E 1H72C 2G7HA 3F0NA 4DR3I 2UXCI 1USUA 1Z5AA 4OOGC 2L3CA 3VYYA 3PRYA 4DV4E 4M2ZA 1H74A 4JYAE 1KTVA 2UUAE 2CZ9A 2L2MA 1D6TA 2M1SA 4X65I 2L6MA 4DR2I 2N3HA 2YZTA 3V5RA 2HKEA 1N33E 4LF4I 1U2RA 4I3HA 2L3JA 3QT6A 4UT4A 2LMZA 2JR1A 3B82A 2V88A 5BR8I 2HK2A 2MDRA 4IZJA 1NHHA 2GQ0A 1YYOA 2O1VA 2R42A 4JI4I 4WUBA 4ED4A 3LTOA 5IT9Q 4AQYE 2NUEA 1J5EI 4JI8I 5F3WA 4DKKA 4WPYA 4X64E 2IHR1 4GKJI 1ZM2A 1IBKI 2V8QB 3JAMQ 4B3ME 2N3GA 1WHNA 4BS9A 1Z0TA 4XTJA 4DR6E 4DV0E 5LMNE 4YY3E 1ZXMA 2PNLA 2NUFA 4LF8I 1XMQI 2ZM6I 3T1YI 1Z0BA 4NXMI 2YT4A 1Z0VA 2J7KA 3QT8A 4ZVIA 3ADGA 4YHHI 4JV5E 4DUZE 4DR1E 4B3RI 4JI1I 2HFUA 1XHKA 3LNUA 4GKKI 4L5NC 1FKAE 3ZKBA 2E5LE 1ZM3A 3OTOI 3J80Q 4LTYA 2UUBI 5FLXC 2RS7A 4OX9I 3ZM7A 3T1HE 4BBYA 4B3TE 2RS6A 1NHIA 1Z0CA 1HNXI 1UEKA 3IWDA 2V87A 5ADZA 2VQFE 4USMA 3WU4A 4LU9A 1OJ4A 4LFCE 2VQEI 4LFBI 2JWOA 5DNYA 3JTZA 3JU0A 5BR8E 1N34I 3HULA 2Z5CB 3HPZA 4K0KE 3H09A 2NUGA 2FGGA 3C4TA 2MC6A 1GZ6A 2CG9A 5GMEA 2XEXA 3Q6NA 4DV6E 4PRXA 1I94E 4GEQB 4P7DA 1YYWA 4GKJE 1XMOE 4NXNI 2LJHA 4KQVA 3OMLA 2LTRA 5AASA 2CPNA 1N0UA 4JI2I 1MX0A 3PYFA 2L2KB 4F9AB 2ZM6E 4LF7E 2DB2A 2GS8A 4PRVA 4DR5I 4DR7I 4Z7YA 4JI3E 2HFSA 2ODRC 4JI1E 1GQEA 2L2NA 2R3VA 1N36I 1HNZE 1RQ0A 3ZZUA 1Z5CA 1H73A 4LFAI 4DPWA 2ZITA 5L3JA 4RPFA 4X62E 1RC7A 4DPTA 1N32I 4TUGA 4JI6I 2Z5EA 1HNWI 1USVA 1XNRE 5A2QQ 4DV3I 2F4VE 2V2VA 2X7IA 2F8BA 4M0VA 4JI5E 2BV3A 1MU5A 1FJGI 4LF5E 4JI0E 5IWAI 5LMUI 1H7SA 4J8ZA 3PYEA 1YYKA 4DUYI 2PNMA 2L8TA 1X48A 4DPXA 2Z5BB 2UU9E 2H36X 2RTXA 2LRSA 1WXRA 1IBMI 2O1UA 4X8WA 4B3SI 3IWCA 4LF9E 1KIJA 4WUCA 2LUPB 3AUZA 1RREA 4X66E 4DR4I 3JAMC 3IWBA 1IBLI 2FV4B 2A2DA 1Z0WA 4DV7E 1ZM4A 2UXDE 1NHJA 2B3TB 5CFFE 2UXBE 2HHHE 1HR0I 3DJWA 5LL6R 3ZKDA 4JI7I 1DARA 2LUQA 3ZOQB 1S16A 2V2ZA 4HY1A 1WHQA 4HXZA 4MYUA 4DR5E 3F6HA 1T4LB 4KHPI 2B7TA 4DR3E 2UXCE 1Z59A 2DEIA 4F54A 2ZBKB 4DMIA 3KWRA 2EFGA 5AE1A 4Q28A 4X65E 3P1XA 3HQ1A 3H4LA 4DV2I 4LF6I 2UUCI 4USKA 4DR2E 1RR9A 1DI2A 1T4NA 4URLA 4FW9A 4R1FA 4DV4I 4HACB 4I8OA 5AE3A 3J81Q 2UUAI 4LF4E 4JYAI 2KOUA 4F9CB 3ADIA 1NZ0A 3P06A 4N3OA 3CWVA 4BMJA 2HK3A 1Y4UA 2LTSA 4DV1I 3B8HA 1UHZA 3V2UC 4JI4E 2B7VA 4IZJD 1N33I 2B9DA 3ADLA 4PU9A 3LMLA 1J5EE 4JI8E 4UTGA 1IBME 2EWLA 4DV5I 2V83A 1IBKE 1UILA 4L8NA 1FWKA 2Z5CA 4DPUA 2AJ4A 4LF8E 1XMQE 4AQYI 2O1WA 2K4VA 3T1YE 4NXME 3QT5A 4YHHE 3LPSA 2BM0A 2L33A 2NA2A 4B3RE 4B3MI 2EZ6A 1WUUA 4Z7CA 2JOBA 4KHPE 1QZRA 4F9BB 3HPSA 1FNMA 4DR6I 4DV0I 1FWLA 4YY3I 4GKKE 2DMYA 4WUDA 5LMNI 4WFTA 2X36A 4WYQB 1DQ3A 3OTOE 2UUBE 1YZ9A 2LJPA 1MG7A 3Q6MA 3HXLA 1ZXNA 4OX9E 4MYTA 4DUZI 4JV5I 4DR1I 3VK6A 2JY9A 2V34A 1KKHA 2CGEA 4DV2E 1STUA 1HNXE 2HKJA 1ELOA 2UUCE 1N0VC 2IOQA 3K17A 1KVKA 2FTXB 2L92A 3Q1QA 3WU3A 2E5LI 5AE2A 3HTXA 2O1TA 2KONA 2VQEE 2V2QA 4LFBE 4P78A 2E1RA 4IZJB 3T1HI 3J7AG 1XNQI 2DSYA 4B3TI 3ZZ0A 3D4JA 1N34E 1HK7A 1S4EA 4DV1E 1ZBQA 2IOPA 1ZM9A 2VQFI 1EKZA 5IT9C 4LFCI 1EA6A 4BCAA 1VISA 4JG4A 1ZBTA 4R8OA 2M7QA 4DV5E 4NXNE 4K0KI 2OI2A 4R03A 3ZZTA 1QU6A 2RSMA 1K47A 3M6AA 4DU8A 3ADJA 3FIGA 4JI2E 1PVGA 2V86A 4DV6I 2Z5BA 1I94I 4KZSA 3K6QA 1H7UA 1Z0GA 1XMOI 4DR7E 2JOXA 4P52A 2A2CA 2WZOA 4IZKB 2MC5A 2JVAA 3PYDA 4BC9A 1N36E 5T6JA 3J80C 4LFAE 3VYXA 3AV0A 1X47A 4LF7I 1N32E 4JI6E 1HNWE 4DXLA 4DU7A 2V89A 2VE7C 4M1KA 4JI3I 2VF1A 4DV3E 1J26A 1T4OA 1HNZI 3J7AM 3J81C 5GMDA 4WSPA 1PKPA 4IZKA 5FLXQ 2V8PA 1FJGE 1Y6ZA 4X62I 2NPFA 3B78A 1XNQE 5IWAE 5LMUE 1XNRI 1EI1A 2F4VI 1X49A 4DUYE 4DPYA 4JI5I 3PYGA 3LLHA 1BKNA 4TUIA 3K85A 2LE2A 2DIXA 2VF3A 4LF5I 4HACA 4JI0I 4B3SE 1PIEA 1B63A 4M30A 3DF6A 4DR4E 3WU6A 4FWGA 1IBLE 5FWKA 2V85A 3GONA 3C4BA 1Z0EA 3MSWA 4BC7A 1FI4A 2UU9I 2ODRD 1HR0E 4FWDA 4X64I 4FWHA 4JI7E 2Q2EB 4LF9I 3K1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 I;  2KHX A;  1B62 A;  4DV7 I;  4FN5 A;  2UXD I;  3WU5 A;  4EMD A;  3J7Y p;  1Z5B A;  2BM1 A;  2UXB I;  3QT7 A;  2HHH I;  4HYM A;  1O0W A;  2WW4 A;  5A2Q C;  2DEJ A;  1A6F A;  4P7A A;  2LBS B;  4LF6 E;  1H72 C;  3F0N A;  4DR3 I;  2UXC I;  1Z5A A;  2L3C A;  4OOG C;  3VYY A;  4DV4 E;  4M2Z A;  1H74 A;  4JYA E;  1KTV A;  2UUA E;  2CZ9 A;  2L2M A;  1D6T A;  4X65 I;  4DR2 I;  2N3H A;  3V5R A;  2HKE A;  1N33 E;  4LF4 I;  1U2R A;  4I3H A;  2L3J A;  3QT6 A;  4UT4 A;  3B82 A;  5BR8 I;  2HK2 A;  2MDR A;  1NHH A;  1YYO A;  2R42 A;  4JI4 I;  4WUB A;  4ED4 A;  3LTO A;  5IT9 Q;  4AQY E;  2NUE A;  1J5E I;  4JI8 I;  4DKK A;  4X64 E;  2IHR 1;  4GKJ I;  1ZM2 A;  1IBK I;  3JAM Q;  4B3M E;  2N3G A;  1WHN A;  1Z0T A;  4XTJ A;  4DR6 E;  4DV0 E;  5LMN E;  4YY3 E;  1ZXM A;  2NUF A;  4LF8 I;  1XMQ I;  2ZM6 I;  3T1Y I;  1Z0B A;  4NXM I;  2YT4 A;  1Z0V A;  2J7K A;  3QT8 A;  4ZVI A;  3ADG A;  4YHH I;  4JV5 E;  4DUZ E;  4DR1 E;  4B3R I;  4JI1 I;  2HFU A;  1XHK A;  3LNU A;  4GKK I;  1FKA E;  3ZKB A;  2E5L E;  1ZM3 A;  3OTO I;  3J80 Q;  2UUB I;  5FLX C;  2RS7 A;  4OX9 I;  3ZM7 A;  3T1H E;  4B3T E;  2RS6 A;  1NHI A;  1Z0C A;  1HNX I;  1UEK A;  2VQF E;  4USM A;  3WU4 A;  1OJ4 A;  4LFC E;  2VQE I;  4LFB I;  5BR8 E;  1N34 I;  3HUL A;  4K0K E;  2NUG A;  3C4T A;  5GME A;  2XEX A;  4DV6 E;  4PRX A;  1I94 E;  1YYW A;  4GKJ E;  1XMO E;  4NXN I;  2LJH A;  4KQV A;  2LTR A;  2CPN A;  1N0U A;  4JI2 I;  1MX0 A;  3PYF A;  2L2K B;  2ZM6 E;  4LF7 E;  2DB2 A;  2GS8 A;  4PRV A;  4DR5 I;  4DR7 I;  4Z7Y A;  4JI3 E;  2HFS A;  4JI1 E;  1GQE A;  2L2N A;  2R3V A;  1N36 I;  1HNZ E;  1RQ0 A;  3ZZU A;  1Z5C A;  1H73 A;  4LFA I;  4DPW A;  2ZIT A;  5L3J A;  4RPF A;  4X62 E;  1RC7 A;  4DPT A;  1N32 I;  4JI6 I;  1HNW I;  1XNR E;  5A2Q Q;  4DV3 I;  2F4V E;  2V2V A;  2X7I A;  4JI5 E;  2BV3 A;  1MU5 A;  1FJG I;  4LF5 E;  4JI0 E;  5IWA I;  5LMU I;  1H7S A;  3PYE A;  1YYK A;  4DUY I;  1X48 A;  4DPX A;  2UU9 E;  2RTX A;  2LRS A;  1IBM I;  4X8W A;  4B3S I;  4LF9 E;  1KIJ A;  4WUC A;  2LUP B;  1RRE A;  4X66 E;  4DR4 I;  3JAM C;  1IBL I;  2A2D A;  1Z0W A;  4DV7 E;  1ZM4 A;  2UXD E;  1NHJ A;  2B3T B;  5CFF E;  2UXB E;  2HHH E;  1HR0 I;  5LL6 R;  3ZKD A;  4JI7 I;  1DAR A;  2LUQ A;  1S16 A;  2V2Z A;  4HY1 A;  1WHQ A;  4HXZ A;  4MYU A;  4DR5 E;  4KHP I;  1T4L B;  2B7T A;  4DR3 E;  2UXC E;  1Z59 A;  2DEI A;  2ZBK B;  2EFG A;  4X65 E;  3P1X A;  3H4L A;  4DV2 I;  4LF6 I;  2UUC I;  4USK A;  4DR2 E;  1RR9 A;  1DI2 A;  1T4N A;  4URL A;  4FW9 A;  4R1F A;  4DV4 I;  4HAC B;  3J81 Q;  4JYA I;  2UUA I;  4LF4 E;  3ADI A;  1NZ0 A;  3CWV A;  2HK3 A;  2LTS A;  4DV1 I;  3B8H A;  1UHZ A;  3V2U C;  4JI4 E;  2B7V A;  1N33 I;  3ADL A;  4PU9 A;  1J5E E;  4UTG A;  4JI8 E;  1IBM E;  4DV5 I;  1IBK E;  1UIL A;  1FWK A;  4DPU A;  2AJ4 A;  4LF8 E;  1XMQ E;  4AQY I;  3T1Y E;  3QT5 A;  4NXM E;  4YHH E;  3LPS A;  2BM0 A;  2L33 A;  2NA2 A;  4B3R E;  4B3M I;  2EZ6 A;  1WUU A;  4Z7C A;  1QZR A;  4KHP E;  1FNM A;  4DR6 I;  4DV0 I;  1FWL A;  4YY3 I;  4GKK E;  2DMY A;  4WUD A;  5LMN I;  4WFT A;  2X36 A;  4WYQ B;  3OTO E;  2UUB E;  1YZ9 A;  2LJP A;  1MG7 A;  4MYT A;  1ZXN A;  4OX9 E;  4JV5 I;  4DUZ I;  4DR1 I;  2JY9 A;  2V34 A;  1KKH A;  4DV2 E;  1STU A;  1HNX E;  2HKJ A;  1ELO A;  2UUC E;  1N0V C;  3K17 A;  1KVK A;  3Q1Q A;  3WU3 A;  2E5L I;  3HTX A;  2VQE E;  2V2Q A;  4LFB E;  2E1R A;  3T1H I;  3J7A G;  1XNQ I;  4B3T I;  3ZZ0 A;  3D4J A;  1N34 E;  1S4E A;  4DV1 E;  1ZM9 A;  2VQF I;  1EKZ A;  5IT9 C;  4LFC I;  1EA6 A;  1VIS A;  4JG4 A;  1ZBT A;  4DV5 E;  4NXN E;  4K0K I;  2OI2 A;  3ZZT A;  1QU6 A;  2RSM A;  1K47 A;  3M6A A;  4DU8 A;  3ADJ A;  4JI2 E;  1PVG A;  4DV6 I;  1I94 I;  1H7U A;  1Z0G A;  1XMO I;  4DR7 E;  4P52 A;  2A2C A;  3PYD A;  2JVA A;  1N36 E;  3J80 C;  4LFA E;  3VYX A;  1X47 A;  4LF7 I;  1N32 E;  4JI6 E;  1HNW E;  4DXL A;  4DU7 A;  4JI3 I;  4M1K A;  4DV3 E;  1J26 A;  1T4O A;  1HNZ I;  3J7A M;  3J81 C;  5GMD A;  1PKP A;  5FLX Q;  2V8P A;  1FJG E;  4X62 I;  2NPF A;  3B78 A;  1XNQ E;  5IWA E;  5LMU E;  1XNR I;  1EI1 A;  2F4V I;  1X49 A;  4DUY E;  4DPY A;  4JI5 I;  3PYG A;  3LLH A;  1BKN A;  2DIX A;  2VF3 A;  4LF5 I;  4HAC A;  4JI0 I;  4B3S E;  1PIE A;  1B63 A;  4M30 A;  4DR4 E;  3WU6 A;  4FWG A;  1IBL E;  3GON A;  3C4B A;  1Z0E A;  1FI4 A;  2UU9 I;  1HR0 E;  4FWD A;  4X64 I;  4FWH A;  4JI7 E;  2Q2E B;  4LF9 I;  3K1J A; 
#chains in the Genus database with same CATH topology
 1G2F C;  2EMW A;  4X66 I;  1Y4S A;  2EOS A;  1G2D C;  2PNZ A;  2N8X A;  1SR9 A;  2R1F A;  4J3D A;  2KHX A;  1B62 A;  4DV7 I;  4FN5 A;  2UXD I;  3RMP A;  3WU5 A;  2M4I A;  4EMD A;  3J7Y p;  1Z5B A;  3HJC A;  2BM1 A;  4F6M A;  1A1K A;  3QT7 A;  2HHH I;  4HYM A;  2UXB I;  3F6G A;  4KWY A;  5K36 B;  1O0W A;  2WW4 A;  2E1M A;  5A2Q C;  2DEJ A;  1A6F A;  5KL7 A;  4P7A A;  1MEY C;  4HEI A;  2LBS B;  4LF6 E;  1H72 C;  5EKW A;  4ZYE A;  2G7H A;  2NAB A;  5JEA D;  3F0N A;  4DR3 I;  2UXC I;  2YRM A;  2NN6 D;  1RMD A;  1USU A;  1Z5A A;  4IFD A;  4OOG C;  3L00 A;  2L3C A;  3VYY A;  3PRY A;  4DV4 E;  4M2Z A;  3VHT B;  1H74 A;  4JYA E;  1KTV A;  2UUA E;  2GPI A;  2CZ9 A;  1X3C A;  2L2M A;  5C0X B;  1D6T A;  2EMC A;  1UDS A;  5KL6 A;  2M1S A;  4X65 I;  2L6M A;  1OYR A;  2DMI A;  4OO1 D;  5K36 E;  2EMH A;  2BB8 A;  4DR2 I;  2N3H A;  2EPN A;  1A1G A;  2YZT A;  3V5R A;  2HKE A;  3M85 D;  4R2E A;  2CSH A;  1N33 E;  1X6E A;  1U2R A;  4LF4 I;  4I3H A;  2L3J A;  1IQS A;  3QT6 A;  1P42 A;  4FW6 A;  2LMZ A;  4UT4 A;  2JR1 A;  3B82 A;  2V88 A;  5BR8 I;  2JEA B;  2RPC A;  2HK2 A;  2DLQ A;  2MDR A;  5C0X A;  4OO1 F;  4IZJ A;  4R2D A;  2EQ0 A;  4O5G A;  3TQM A;  1NHH A;  2GQ0 A;  1YYO A;  2O1V A;  2R42 A;  4JI4 I;  2PO0 B;  2CVE A;  4WUB A;  4OO1 C;  4ED4 A;  3QG5 C;  3LTO A;  3PS1 A;  5IT9 Q;  4AQY E;  2NUE A;  1J5E I;  4JI8 I;  5F3W A;  4DKK A;  5LLQ A;  1DGC A;  1TF3 A;  4X9J A;  4WPY A;  4X64 E;  2IHR 1;  4FK5 C;  1RHY A;  4GKJ I;  2PO1 B;  1ZM2 A;  3MHH C;  3CDJ A;  4R2S A;  3CDI A;  1IBK I;  2V8Q B;  2HJJ A;  3JAM Q;  4B3M E;  2N3G A;  2EPP A;  1WHN A;  2BBG A;  4BS9 A;  1Z0T A;  2GHF A;  4XTJ A;  4DR6 E;  4DV0 E;  5LMN E;  4YY3 E;  5JEA B;  1ZXM A;  2ENC A;  2PNL A;  2NUF A;  2EN7 A;  2NN6 B;  1PJS A;  2ZM6 I;  1XMQ I;  3T1Y I;  1Z0B A;  4LF8 I;  4NXM I;  2YT4 A;  2EM7 A;  1Z0V A;  2J7K A;  3QT8 A;  4ZVI A;  3ADG A;  2WCC 3;  4YHH I;  4JV5 E;  4DUZ E;  4DR1 E;  5AC4 A;  4B3R I;  2RSI A;  4JI1 I;  2HFU A;  4U3B A;  1AAY A;  1XHK A;  5K36 D;  3LNU A;  2LT7 A;  4L5N C;  1FKA E;  1UDN A;  3ZKB A;  4GKK I;  4HTG A;  5IV8 B;  2E5L E;  2EM6 A;  1ZM3 A;  4Q35 B;  3OTO I;  3J80 Q;  4LTY A;  2UUB I;  5FLX C;  5JEA E;  2RS7 A;  2GLI A;  4OX9 I;  2NN6 E;  5A6K A;  3T1H E;  3ZM7 A;  5JEA A;  4BBY A;  4B3T E;  2RS6 A;  3GCM A;  3BF2 A;  3THO B;  1NHI A;  4R2R A;  2EM2 A;  1Z0C A;  1HNX I;  1UEK A;  1WRJ A;  3IWD A;  4AID A;  2V87 A;  4FW7 A;  5ADZ A;  2VQF E;  2YTG A;  4USM A;  1MGT A;  1KJK A;  2BA1 D;  4FW5 A;  4LU9 A;  4M9V C;  1OJ4 A;  4LFC E;  3WU4 A;  2C38 B;  5K36 F;  2EPM X;  4OO1 A;  2VQE I;  4LFB I;  5KL5 A;  2JWO A;  4MQY A;  2EM9 A;  5DNY A;  3JTZ A;  3JU0 A;  2WP8 B;  3M85 G;  5K36 C;  5BR8 E;  1N34 I;  3HUL A;  2Z5C B;  3U1Y A;  1NEI A;  3HPZ A;  4K0K E;  3H09 A;  1IMU A;  3BID A;  5C0X F;  2JP9 A;  2NUG A;  2FGG A;  3C4T A;  2MC6 A;  1GZ6 A;  2CG9 A;  5GME A;  2XEX A;  3Q6N A;  3M7N G;  4DV6 E;  4PRX A;  3MHS C;  4ZYD A;  1I94 E;  4GEQ B;  4P7D A;  1JK1 A;  1YUJ A;  1YYW A;  4GKJ E;  1XMO E;  1L4S A;  4NXN I;  4LOM A;  2LJH A;  5EL9 A;  4WSG A;  4KQV A;  2WP8 A;  3OML A;  2LTR A;  5AAS A;  2JPA A;  2CPN A;  1N0U A;  4JI2 I;  1MX0 A;  1Y60 A;  3PYF A;  2EN6 A;  4F9A B;  2L2K B;  2ZM6 E;  1TF6 A;  4LF7 E;  2DB2 A;  2GS8 A;  1WJP A;  2JT2 A;  2EOQ A;  1EH6 A;  4PRV A;  4DR5 I;  4WXC A;  4DR7 I;  4Z7Y A;  4JI3 E;  2MDG A;  2HFS A;  2ODR C;  3ZZT A;  4JI1 E;  2EOJ A;  1GQE A;  3L7Z A;  2EMY A;  2L2N A;  2R3V A;  1N36 I;  3EPK A;  1HNZ E;  1RQ0 A;  3ZZU A;  1Z5C A;  2M9A A;  1H73 A;  2EMK A;  4LFA I;  4DPW A;  2LO3 A;  2ZIT A;  2ENA A;  5L3J A;  5TSE A;  3EPJ A;  4RPF A;  4X62 E;  1RC7 A;  4DPT A;  1N32 I;  4TUG A;  2EPO A;  2Z5E A;  4JI6 I;  1USV A;  1HNW I;  1XNR E;  5K36 A;  4U3D A;  5A2Q Q;  2EN8 A;  2JEB B;  5DRP A;  5JEA F;  2F4V E;  4DV3 I;  2V2V A;  2X7I A;  2NN6 F;  4NBQ A;  2F8B A;  2EPU A;  4M0V A;  4ZYG A;  4IS1 C;  4JI5 E;  1OYS A;  2BV3 A;  4LCH A;  1YHC A;  4NZV A;  2EMG A;  5JEA C;  2EOE A;  3BBG A;  1MU5 A;  1FJG I;  4LF5 E;  2NN6 C;  2EOF A;  4JI0 E;  2BA0 G;  5IWA I;  5LMU I;  1H7S A;  4IFD D;  4J8Z A;  3PYE A;  1YYK A;  4DUY I;  5IXM B;  2PNM A;  4N4R B;  2L8T A;  1X48 A;  4DPX A;  2JEB A;  2Z5B B;  1QNT A;  2E72 A;  4LCF A;  2K7I A;  1YFH A;  2H36 X;  2RTX A;  2LRS A;  1WXR A;  2UU9 E;  1IBM I;  2O1U A;  4IJD A;  4X8W A;  4B3S I;  2YTD A;  1BBO A;  3IWC A;  4LF9 E;  1KIJ A;  3PS3 A;  4WUC A;  2VES A;  2LUP B;  1T38 A;  3AUZ A;  1RRE A;  4X66 E;  1Y5Y A;  3JAM C;  4BA2 B;  4DR4 I;  3THN A;  3IWB A;  2JEA A;  1IBL I;  2FV4 B;  2A2D A;  5DRO A;  1Z0W A;  4DV7 E;  4AQY I;  1ZM4 A;  2UXD E;  1NHJ A;  2B3T B;  5CFF E;  4WX9 A;  2EOX A;  2UXB E;  2HHH E;  1IQO A;  3DJW A;  2PO0 A;  1HR0 I;  5LL6 R;  4WXD A;  3ZKD A;  2EPL X;  4JI7 I;  1DAR A;  2LUQ A;  3ZOQ B;  1E3H A;  1S16 A;  2V2Z A;  4AIM A;  2JE6 B;  4HY1 A;  1WHQ A;  4ZYH A;  1PJT A;  1ZAA C;  2HGH A;  4HXZ A;  4MYU A;  4DR5 E;  3F6H A;  1T4L B;  4KHP I;  3C6K A;  4ISA A;  2B7T A;  4DR3 E;  1PJQ A;  2UXC E;  2C39 B;  2PO1 A;  1Z59 A;  2DEI A;  4F54 A;  2ZBK B;  4DMI A;  2AE8 A;  3KWR A;  2EFG A;  5AE1 A;  4BA2 A;  3BGH A;  4BHC A;  4Q28 A;  2A25 A;  2GO3 A;  2EOI A;  5DNL A;  2PO2 B;  3KZZ A;  5KL3 A;  2EOH A;  4X65 E;  3P1X A;  2NN6 A;  3HQ1 A;  3H4L A;  4FW4 A;  4BA1 B;  4DV2 I;  4F2J C;  4LPF A;  4LF6 I;  2UUC I;  2YSO A;  2YPN A;  4DR2 E;  4USK A;  1RR9 A;  1DI2 A;  2EMA A;  1T4N A;  1B69 A;  2EOZ A;  2YTE A;  4URL A;  4FW9 A;  4MU3 A;  4R1F A;  4DV4 I;  2JE6 A;  4IFD B;  2EMF A;  4HAC B;  4I8O A;  4O4K A;  5AE3 A;  3J81 Q;  4LF4 E;  2UUA I;  4JYA I;  3EPL A;  2KOU A;  4F9C B;  3ADI A;  1NZ0 A;  3P06 A;  4N3O A;  3CWV A;  4BMJ A;  2HK3 A;  2HC5 A;  5DNX A;  2JYA A;  5DRQ A;  2YSP A;  4OZE A;  2I13 A;  1Y4U A;  2DRP A;  2LTS A;  2PRT A;  4DV1 I;  3B8H A;  1UHZ A;  2YTI A;  3KZY A;  2EM3 A;  3V2U C;  4BA1 A;  4JI4 E;  2B7V A;  2EQ1 A;  4IZJ D;  2C37 B;  2B9D A;  2CTD A;  1N33 I;  3ADL A;  4PU9 A;  3LML A;  1J5E E;  4JI8 E;  4UTG A;  4IFD E;  2ENH A;  2C38 A;  1IBM E;  2EOR A;  2PNZ B;  2EWL A;  1A1J A;  4MU1 A;  4DV5 I;  2V83 A;  1IBK E;  4GZN C;  5AC5 A;  1UIL A;  3L7Z B;  1X5W A;  1VI7 A;  1R6M A;  4L8N A;  3B4T A;  2WBU A;  5KL4 A;  1FWK A;  2Z5C A;  1UDO A;  1EH7 A;  1YH8 A;  2YU5 A;  2AJ4 A;  3GME A;  4DPU A;  4LF8 E;  2EMB A;  1XMQ E;  4OKG A;  2O1W A;  2K4V A;  3T1Y E;  1YSA C;  4NXM E;  1OYP A;  3QT5 A;  4YHH E;  3EQ1 A;  1UN6 B;  3LPS A;  2BM0 A;  2L33 A;  2RQL A;  2J7J A;  2YWQ A;  2NA2 A;  2EPK X;  2EOY A;  4B3R E;  3KRN A;  3H1C A;  2EPX A;  4B3M I;  2EZ6 A;  1WUU A;  4Z7C A;  2JOB A;  4KHP E;  1QZR A;  4F9B B;  4O43 A;  2CT1 A;  2EL5 A;  3HPS A;  1FNM A;  4DR6 I;  2MKN A;  5ELW A;  4DV0 I;  1FWL A;  4YY3 I;  4GKK E;  2DMY A;  3M99 B;  4WUD A;  5LMN I;  4WFT A;  1BB8 A;  4NHR A;  2X36 A;  1GTK A;  4WYQ B;  1DQ3 A;  3OTO E;  2F1D A;  2UUB E;  1YZ9 A;  2LJP A;  3UHM A;  2EN3 A;  1MG7 A;  3HXL A;  1ZXN A;  4OX9 E;  2IER A;  3Q6M A;  2EMZ A;  4MYT A;  4DUZ I;  4DR1 I;  4JV5 I;  3VK6 A;  5A6J A;  2LVH A;  2JY9 A;  2V34 A;  1T39 A;  2EN1 A;  1KKH A;  2CGE A;  4DV2 E;  1STU A;  1HNX E;  2HKJ A;  4RHB B;  2UUC E;  1ELO A;  1N0V C;  2IOQ A;  3K17 A;  5A69 A;  2FTX B;  2L92 A;  1KVK A;  3Q1Q A;  3PS2 A;  3WU3 A;  2E5L I;  5AE2 A;  3HTX A;  1PDA A;  2KON A;  2YTF A;  4MLV A;  2VQE E;  4P78 A;  4LFB E;  2O1T A;  2V2Q A;  2E1R A;  4IZJ B;  3T1H I;  3J7A G;  2BA1 G;  1XNQ I;  2DSY A;  2DLK A;  3P76 A;  4B3T I;  3ZZ0 A;  3ECR A;  3D4J A;  1N34 E;  1TN9 A;  2YRH A;  2EN2 A;  1HK7 A;  4R2A A;  1S4E A;  5A6B D;  1KYQ A;  4DV1 E;  1X6H A;  1ZBQ A;  1A1F A;  2IOP A;  1ZM9 A;  3U1K A;  1YUI A;  2VQF I;  1EKZ A;  5IT9 C;  4LFC I;  1UDQ A;  4MU4 A;  1EA6 A;  1BBG A;  2YRK A;  2WNR B;  4BCA A;  1VIS A;  2LJU A;  2Q8U A;  5C0X E;  4MLQ A;  4IS9 A;  4JG4 A;  2I9I A;  1R6L A;  1ZBT A;  4R8O A;  2M7Q A;  4DV5 E;  4NXN E;  4IFD F;  4K0K I;  1YPN A;  2EJ4 A;  4R03 A;  2OI2 A;  1QU6 A;  2EM0 A;  2RSM A;  1AH5 A;  4R2C A;  1K47 A;  2WBT A;  2J65 A;  3M6A A;  3ADJ A;  4DU8 A;  3M7N D;  2EPC A;  2IES A;  2YTP A;  3P3G A;  3FIG A;  4JI2 E;  4IFD C;  1PVG A;  2V86 A;  1NCS A;  4DV6 I;  2LCE A;  2Z5B A;  1I94 I;  1LLM C;  5DRR A;  4KZS A;  3K6Q A;  1H7U A;  2ELY A;  1Z0G A;  1XMO I;  4DR7 E;  2JOX A;  2WNR A;  4P52 A;  3NZK A;  2EE8 A;  2A2C A;  2WZO A;  4IZK B;  2MC5 A;  2JVA A;  3PYD A;  2O3Z A;  1X6F A;  4BC9 A;  1N36 E;  5T6J A;  4FW3 A;  4O24 A;  2YTN A;  1A1I A;  3J80 C;  3UK3 C;  4LFA E;  3EPH A;  4LCG A;  1A1H A;  3VYX A;  4MU0 A;  3AV0 A;  1P47 A;  1X47 A;  4LF7 I;  2DGC A;  2EPZ A;  3GLL A;  2EOO A;  4R2Q A;  1E3P A;  1N32 E;  4JI6 E;  1HNW E;  4RH8 A;  4DXL A;  4DU7 A;  2V89 A;  2VE7 C;  4M1K A;  2EPA A;  4JI3 I;  2EM8 A;  2VF1 A;  4DV3 E;  1J26 A;  1T4O A;  4OO1 B;  2MKD A;  1HNZ I;  3J7A M;  1A1L A;  1JK2 A;  1ZU1 A;  2C39 A;  3J81 C;  1EH8 A;  5GMD A;  2WBS A;  4WSP A;  1PKP A;  4IZK A;  5FLX Q;  3P3C A;  2V8P A;  2EL4 A;  1Z1B A;  1FJG E;  1Y6Z A;  2NPF A;  2D9H A;  5A6A A;  4X62 I;  3B78 A;  2VRD A;  2EP3 A;  1XNQ E;  5IWA E;  5LMU E;  2PO2 A;  2R76 A;  1XNR I;  2EML A;  1EI1 A;  3C6M A;  3DD6 A;  2F4V I;  1X49 A;  4AM3 A;  4DUY E;  2EMX A;  2EN4 A;  2EOM A;  1SFE A;  4DPY A;  5C0X D;  2LV2 A;  2EMI A;  2BR2 B;  4JI5 I;  4QNJ A;  3PYG A;  3LLH A;  4OO1 E;  1BKN A;  2BA0 D;  4R2P A;  4TUI A;  3K85 A;  2YTQ A;  2LE2 A;  2DIX A;  2YTO A;  2VF3 A;  4HAC A;  2EM4 A;  2JXP A;  4F6N A;  4QNK A;  4LF5 I;  4JI0 I;  4B3S E;  5A6B A;  1PIE A;  1B63 A;  3P3E A;  2EM5 A;  4M30 A;  5KL2 A;  3DF6 A;  1UBD C;  2YU8 A;  4DR4 E;  4GQU A;  3WU6 A;  4FWG A;  1IBL E;  5FWK A;  2V85 A;  1N3G A;  2ELZ A;  3GON A;  4BHB A;  3C4B A;  2YTJ A;  1Z0E A;  3MSW A;  4MDT A;  4BC7 A;  1FI4 A;  2GO4 A;  2EPR A;  2UU9 I;  2ODR D;  1HR0 E;  2EL6 A;  2ADR A;  4FWD A;  4X64 I;  4FWH A;  2C37 A;  2BR2 A;  4JI7 E;  1XXE A;  3HKM A;  2Q2E B;  4LF9 I;  1ZR9 A;  3K1J A;  5C0X C;  1F2I G;  2EQ3 A; 
#chains in the Genus database with same CATH homology
 4X66 I;  1Y4S A;  1SR9 A;  2KHX A;  1B62 A;  4DV7 I;  4FN5 A;  2UXD I;  3RMP A;  3WU5 A;  2M4I A;  4EMD A;  3J7Y p;  1Z5B A;  3HJC A;  2BM1 A;  2UXB I;  3QT7 A;  2HHH I;  4HYM A;  3F6G A;  1O0W A;  2WW4 A;  2E1M A;  5A2Q C;  2DEJ A;  1A6F A;  4P7A A;  2LBS B;  4LF6 E;  1H72 C;  2G7H A;  3F0N A;  4DR3 I;  2UXC I;  1USU A;  1Z5A A;  4OOG C;  2L3C A;  3VYY A;  3PRY A;  4DV4 E;  4M2Z A;  1H74 A;  4JYA E;  1KTV A;  2UUA E;  2CZ9 A;  2L2M A;  1D6T A;  2M1S A;  4X65 I;  2L6M A;  4DR2 I;  2N3H A;  2YZT A;  3V5R A;  2HKE A;  1N33 E;  4LF4 I;  1U2R A;  4I3H A;  2L3J A;  3QT6 A;  4UT4 A;  2LMZ A;  2JR1 A;  3B82 A;  2V88 A;  5BR8 I;  2HK2 A;  2MDR A;  4IZJ A;  1NHH A;  2GQ0 A;  1YYO A;  2O1V A;  2R42 A;  4JI4 I;  4WUB A;  4ED4 A;  3LTO A;  5IT9 Q;  4AQY E;  2NUE A;  1J5E I;  4JI8 I;  5F3W A;  4DKK A;  4WPY A;  4X64 E;  2IHR 1;  4GKJ I;  1ZM2 A;  1IBK I;  2V8Q B;  3JAM Q;  4B3M E;  2N3G A;  1WHN A;  4BS9 A;  1Z0T A;  4XTJ A;  4DR6 E;  4DV0 E;  5LMN E;  4YY3 E;  1ZXM A;  2PNL A;  2NUF A;  4LF8 I;  1XMQ I;  2ZM6 I;  3T1Y I;  1Z0B A;  4NXM I;  2YT4 A;  1Z0V A;  2J7K A;  3QT8 A;  4ZVI A;  3ADG A;  4YHH I;  4JV5 E;  4DUZ E;  4DR1 E;  4B3R I;  4JI1 I;  2HFU A;  1XHK A;  3LNU A;  4GKK I;  4L5N C;  1FKA E;  3ZKB A;  2E5L E;  1ZM3 A;  3OTO I;  3J80 Q;  4LTY A;  2UUB I;  5FLX C;  2RS7 A;  4OX9 I;  3ZM7 A;  3T1H E;  4BBY A;  4B3T E;  2RS6 A;  1NHI A;  1Z0C A;  1HNX I;  1UEK A;  3IWD A;  2V87 A;  5ADZ A;  2VQF E;  4USM A;  3WU4 A;  4LU9 A;  1OJ4 A;  4LFC E;  2VQE I;  4LFB I;  2JWO A;  5DNY A;  3JTZ A;  3JU0 A;  5BR8 E;  1N34 I;  3HUL A;  2Z5C B;  3HPZ A;  4K0K E;  3H09 A;  2NUG A;  2FGG A;  3C4T A;  2MC6 A;  1GZ6 A;  2CG9 A;  5GME A;  2XEX A;  3Q6N A;  4DV6 E;  4PRX A;  1I94 E;  4GEQ B;  4P7D A;  1YYW A;  4GKJ E;  1XMO E;  4NXN I;  2LJH A;  4KQV A;  3OML A;  2LTR A;  5AAS A;  2CPN A;  1N0U A;  4JI2 I;  1MX0 A;  3PYF A;  2L2K B;  4F9A B;  2ZM6 E;  4LF7 E;  2DB2 A;  2GS8 A;  4PRV A;  4DR5 I;  4DR7 I;  4Z7Y A;  4JI3 E;  2HFS A;  2ODR C;  4JI1 E;  1GQE A;  2L2N A;  2R3V A;  1N36 I;  1HNZ E;  1RQ0 A;  3ZZU A;  1Z5C A;  1H73 A;  4LFA I;  4DPW A;  2ZIT A;  5L3J A;  4RPF A;  4X62 E;  1RC7 A;  4DPT A;  1N32 I;  4TUG A;  4JI6 I;  2Z5E A;  1HNW I;  1USV A;  1XNR E;  5A2Q Q;  4DV3 I;  2F4V E;  2V2V A;  2X7I A;  2F8B A;  4M0V A;  4JI5 E;  2BV3 A;  1MU5 A;  1FJG I;  4LF5 E;  4JI0 E;  5IWA I;  5LMU I;  1H7S A;  4J8Z A;  3PYE A;  1YYK A;  4DUY I;  2PNM A;  2L8T A;  1X48 A;  4DPX A;  2Z5B B;  2UU9 E;  2H36 X;  2RTX A;  2LRS A;  1WXR A;  1IBM I;  2O1U A;  4X8W A;  4B3S I;  3IWC A;  4LF9 E;  1KIJ A;  4WUC A;  2LUP B;  3AUZ A;  1RRE A;  4X66 E;  4DR4 I;  3JAM C;  3IWB A;  1IBL I;  2FV4 B;  2A2D A;  1Z0W A;  4DV7 E;  1ZM4 A;  2UXD E;  1NHJ A;  2B3T B;  5CFF E;  2UXB E;  2HHH E;  1HR0 I;  3DJW A;  5LL6 R;  3ZKD A;  4JI7 I;  1DAR A;  2LUQ A;  3ZOQ B;  1S16 A;  2V2Z A;  4HY1 A;  1WHQ A;  4HXZ A;  4MYU A;  4DR5 E;  3F6H A;  1T4L B;  4KHP I;  2B7T A;  4DR3 E;  2UXC E;  1Z59 A;  2DEI A;  4F54 A;  2ZBK B;  4DMI A;  3KWR A;  2EFG A;  5AE1 A;  4Q28 A;  4X65 E;  3P1X A;  3HQ1 A;  3H4L A;  4DV2 I;  4LF6 I;  2UUC I;  4USK A;  4DR2 E;  1RR9 A;  1DI2 A;  1T4N A;  4URL A;  4FW9 A;  4R1F A;  4DV4 I;  4HAC B;  4I8O A;  5AE3 A;  3J81 Q;  2UUA I;  4LF4 E;  4JYA I;  2KOU A;  4F9C B;  3ADI A;  1NZ0 A;  3P06 A;  4N3O A;  3CWV A;  4BMJ A;  2HK3 A;  1Y4U A;  2LTS A;  4DV1 I;  3B8H A;  1UHZ A;  3V2U C;  4JI4 E;  2B7V A;  4IZJ D;  1N33 I;  2B9D A;  3ADL A;  4PU9 A;  3LML A;  1J5E E;  4JI8 E;  4UTG A;  1IBM E;  2EWL A;  4DV5 I;  2V83 A;  1IBK E;  1UIL A;  4L8N A;  1FWK A;  2Z5C A;  4DPU A;  2AJ4 A;  4LF8 E;  1XMQ E;  4AQY I;  2O1W A;  2K4V A;  3T1Y E;  4NXM E;  3QT5 A;  4YHH E;  3LPS A;  2BM0 A;  2L33 A;  2NA2 A;  4B3R E;  4B3M I;  2EZ6 A;  1WUU A;  4Z7C A;  2JOB A;  4KHP E;  1QZR A;  4F9B B;  3HPS A;  1FNM A;  4DR6 I;  4DV0 I;  1FWL A;  4YY3 I;  4GKK E;  2DMY A;  4WUD A;  5LMN I;  4WFT A;  2X36 A;  4WYQ B;  1DQ3 A;  3OTO E;  2UUB E;  1YZ9 A;  2LJP A;  1MG7 A;  3Q6M A;  3HXL A;  1ZXN A;  4OX9 E;  4MYT A;  4DUZ I;  4JV5 I;  4DR1 I;  3VK6 A;  2JY9 A;  2V34 A;  1KKH A;  2CGE A;  4DV2 E;  1STU A;  1HNX E;  2HKJ A;  1ELO A;  2UUC E;  1N0V C;  2IOQ A;  3K17 A;  1KVK A;  2FTX B;  2L92 A;  3Q1Q A;  3WU3 A;  2E5L I;  5AE2 A;  3HTX A;  2O1T A;  2KON A;  2VQE E;  2V2Q A;  4LFB E;  4P78 A;  2E1R A;  4IZJ B;  3T1H I;  3J7A G;  1XNQ I;  2DSY A;  4B3T I;  3ZZ0 A;  3D4J A;  1N34 E;  1HK7 A;  1S4E A;  4DV1 E;  1ZBQ A;  2IOP A;  1ZM9 A;  2VQF I;  1EKZ A;  5IT9 C;  4LFC I;  1EA6 A;  4BCA A;  1VIS A;  4JG4 A;  1ZBT A;  4R8O A;  2M7Q A;  4DV5 E;  4NXN E;  4K0K I;  2OI2 A;  4R03 A;  3ZZT A;  1QU6 A;  2RSM A;  1K47 A;  3M6A A;  4DU8 A;  3ADJ A;  3FIG A;  4JI2 E;  1PVG A;  2V86 A;  4DV6 I;  2Z5B A;  1I94 I;  4KZS A;  3K6Q A;  1H7U A;  1Z0G A;  1XMO I;  4DR7 E;  2JOX A;  4P52 A;  2A2C A;  2WZO A;  4IZK B;  2MC5 A;  2JVA A;  3PYD A;  4BC9 A;  1N36 E;  5T6J A;  3J80 C;  4LFA E;  3VYX A;  3AV0 A;  1X47 A;  4LF7 I;  1N32 E;  4JI6 E;  1HNW E;  4DXL A;  4DU7 A;  2V89 A;  2VE7 C;  4M1K A;  4JI3 I;  2VF1 A;  4DV3 E;  1J26 A;  1T4O A;  1HNZ I;  3J7A M;  3J81 C;  5GMD A;  4WSP A;  1PKP A;  4IZK A;  5FLX Q;  2V8P A;  1FJG E;  1Y6Z A;  4X62 I;  2NPF A;  3B78 A;  1XNQ E;  5IWA E;  5LMU E;  1XNR I;  1EI1 A;  2F4V I;  1X49 A;  4DUY E;  4DPY A;  4JI5 I;  3PYG A;  3LLH A;  1BKN A;  4TUI A;  3K85 A;  2LE2 A;  2DIX A;  2VF3 A;  4LF5 I;  4HAC A;  4JI0 I;  4B3S E;  1PIE A;  1B63 A;  4M30 A;  3DF6 A;  4DR4 E;  3WU6 A;  4FWG A;  1IBL E;  5FWK A;  2V85 A;  3GON A;  3C4B A;  1Z0E A;  3MSW A;  4BC7 A;  1FI4 A;  2UU9 I;  2ODR D;  1HR0 E;  4FWD A;  4X64 I;  4FWH A;  4JI7 E;  2Q2E B;  4LF9 I;  3K1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...