1XMOE

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xmoE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmoE02
2Q2EB 1XHKA 4KHPE 4B3TE 1K47A 4B3RE 2UUBE 2HHHI 2X7IA 3JAMC 1QU6A 4USKA 4NXNI 4DV3I 2HK2A 2E5LE 1ZM4A 5A2QQ 1EI1A 3B8HA 2BV3A 4FWDA 2LBSB 3V5RA 4ZVIA 4FW9A 2HFSA 4PU9A 4DPUA 4DR2E 1S4EA 4LFCI 2ZBKB 3LLHA 4DR7I 2EFGA 2VQEE 2VQEI 2NUFA 4JI6I 1EA6A 1HNZE 4MYUA 3QT8A 3ADIA 2LUPB 4B3SE 2F4VE 4LFBI 4JI5I 4JI2I 4K0KI 3J80C 1PKPA 2ZM6E 4DV1E 2BM0A 1J5EI 3J81Q 1XMOI 4JI8E 3T1YI 1XNQI 3OTOE 2VQFE 4X65I 3QT6A 1NHHA 1KIJA 3WU5A 4JI0I 2GS8A 2X36A 1N0UA 4Z7CA 4YHHI 1T4NA 1YYWA 4X66E 2LJHA 4JG4A 2EZ6A 5IT9C 1OJ4A 1ZXNA 5FLXC 2VF3A 5L3JA 4M2ZA 3J7Yp 4DV4E 1ELOA 4HACA 2B7TA 4LF5E 3J7AG 1N32E 1WHQA 1XMQI 4DV2E 4JI1I 4P7AA 1N0VC 1RR9A 3J81C 5LMNI 4DU7A 3B82A 1N36E 2CZ9A 3V2UC 1I94I 2L3JA 4DUZI 1YYOA 1Z59A 2UXCE 1X47A 4DV5I 5GMDA 1B63A 4DV7I 3C4TA 2RS6A 2L3CA 2R3VA 4PRXA 1GQEA 4B3ME 4JYAE 3GONA 3ZM7A 1XNRE 4DPTA 1O0WA 4LF9I 4WUDA 1IBME 4DR3I 2LRSA 1KKHA 4LF4E 4LF4I 1H73A 4DR5I 2V34A 2UU9I 2YT4A 4LF8E 2V2ZA 2A2CA 2DMYA 1BKNA 2N3GA 1VISA 1H72C 1MG7A 5BR8I 2HHHE 2UUAI 4X62E 1HNXI 4X62I 4NXNE 4JI3I 4DV3E 2JY9A 1STUA 2HKJA 4HYMA 4OOGC 1IBKI 3PYEA 4DR1I 1N33I 4AQYI 1IBLI 4HY1A 4KQVA 2L2MA 4LFCE 4DR7E 4JI7I 1Z5AA 4I3HA 3LTOA 4WUCA 4DPXA 4JI6E 2V2QA 2E1RA 2DEIA 2UUCI 4LFBE 1B62A 1PVGA 4DR6I 4UT4A 4JI5E 4JI2E 4K0KE 1NHJA 4DV0I 5IWAE 4WUBA 5IWAI 3T1HI 3ADJA 1J5EE 1XMOE 3T1YE 1UHZA 1XNQE 4LFAI 3QT7A 1RREA 4X65E 4X8WA 3LNUA 1PIEA 4NXMI 4JI0E 3WU4A 1X49A 2MDRA 4YHHE 5A2QC 2L2KB 1U2RA 2AJ4A 1N34I 1H74A 1Z5CA 1H7SA 3M6AA 2DEJA 4WFTA 2DB2A 4DUYI 4URLA 4GKKI 1XMQE 2WW4A 3LPSA 2UXBI 3WU6A 1S16A 2RTXA 4OX9I 1ZM3A 1HR0I 4JI1E 4JI4I 1Z0BA 1NZ0A 2A2DA 5LMNE 4M1KA 2LUQA 1MX0A 1I94E 4DUZE 4JV5E 1FNMA 4JV5I 1A6FA 1T4LB 1FJGI 4DV5E 1Z0CA 5LMUI 3QT5A 1T4OA 3PYGA 4DV7E 4FWHA 4X64I 4HACB 1X48A 3JAMQ 4LF9E 2LTSA 4DR3E 1H7UA 2UXDI 2CPNA 4USMA 3VYXA 4DR5E 2L2NA 4DV6I 1FWLA 2UU9E 4HXZA 4Z7YA 1RC7A 4LF7I 1MU5A 4PRVA 2IHR1 2NUGA 5BR8E 2UUAE 2V8PA 1HNXE 4JI3E 1WHNA 1FKAE 3B78A 4DPWA 1IBKE 3J80Q 4DR1E 4FWGA 4DR4I 1N33E 4LF6I 2OI2A 2XEXA 4AQYE 1IBLE 4GKJI 3PYDA 3ZKDA 1WUUA 1Z5BA 1ZM9A 4KHPI 4JI7E 4B3TI 5GMEA 4B3RI 2UUBI 1RQ0A 1UILA 3PYFA 4XTJA 2JVAA 3C4BA 2V2VA 2UUCE 2E5LI 4EMDA 2J7KA 3Q1QA 4DR6E 4DKKA 4DV0E 3ADLA 4RPFA 3D4JA 4ED4A 2RS7A 2RSMA 2LJPA 3T1HE 4WYQB 4DR2I 5IT9Q 4LFAE 5FLXQ 4DU8A 3ADGA 1HNZI 4NXME 2KHXA 1KVKA 5LL6R 4M30A 4B3SI 2F4VI 1HNWE 1HNWI 3K1JA 2HK3A 1DI2A 2ZM6I 4DV1I 1YYKA 4UTGA 1N34E 4MYTA 1DARA 4JI8I 2R42A 2HFUA 3OTOI 1Z0VA 2VQFI 4DXLA 2NA2A 1Z0EA 3CWVA 1EKZA 4DUYE 1Z0TA 4GKKE 4X66I 1ZM2A 2UXBE 4OX9E 1J26A 1HR0E 3ZKBA 4JI4E 2NPFA 4FN5A 5CFFE 3ZZ0A 1ZXMA 3F0NA 1FJGE 2ZITA 3WU3A 4DV4I 1NHIA 2BM1A 2NUEA 4YY3E 5LMUE 4YY3I 4LF5I 1UEKA 1ZBTA 1FI4A 1N32I 3K17A 3J7AM 4X64E 1Z0GA 4DV2I 1D6TA 3ZZUA 1N36I 3ZZTA 2UXDE 2UXCI 3P1XA 4R1FA 4DV6E 1FWKA 3VYYA 2HKEA 4LF7E 3H4LA 1KTVA 4B3MI 4JYAI 3HTXA 1QZRA 1XNRI 3HULA 2LTRA 1YZ9A 1Z0WA 2DIXA 1IBMI 2B7VA 2B3TB 4P52A 4DR4E 4LF6E 4DPYA 4LF8I 2L33A 2N3HA 4GKJE
chains in the Genus database with same CATH superfamily
2Q2EB 2WBTA 1XHKA 4KHPE 2NN6B 2RQLA 4B3TE 2VRDA 4LTYA 1K47A 3VK6A 4B3RE 1OYRA 2EL4A 2UUBE 2HHHI 4GZNC 2V8QB 2X7IA 3HKMA 4ZYEA 3JAMC 1QU6A 4USKA 4NXNI 4DV3I 5A6KA 2DLKA 2HK2A 2E5LE 2N8XA 3L00A 3RMPA 1PJTA 4AIDA 2WP8A 3P06A 2EPCA 1ZM4A 2YRHA 2BA1G 4IS1C 1UDNA 1EI1A 5A2QQ 3B8HA 1Z1BA 1VI7A 2BV3A 2Q8UA 2EJ4A 1YUJA 4FWDA 4OO1A 2L8TA 2LBSB 5JEAF 3V5RA 4ZVIA 2YTEA 2NN6F 4MU0A 4FW9A 3M99B 2HFSA 4O4KA 5AE3A 4PU9A 2C39B 4DPUA 4DR2E 1S4EA 4LFCI 2ZBKB 3LLHA 4DR7I 2EFGA 2VQEE 2EN3A 2VQEI 2JP9A 2NUFA 2JEBB 4J3DA 4JI6I 1EA6A 2JT2A 2LJUA 1HNZE 4NBQA 4MYUA 5AC4A 3QT8A 4MQYA 5K36D 2M4IA 3ADIA 2YTOA 2VE7C 1A1FA 2LUPB 2EMAA 2A25A 4B3SE 2HGHA 2F4VE 4QNKA 4LFBI 3DF6A 1MGTA 3DJWA 4JI2I 4JI5I 4K0KI 3J80C 3VHTB 4F9BB 2IOPA 1PKPA 2O1TA 4AIMA 2ZM6E 4DV1E 1Y4SA 4R2RA 4MDTA 2BM0A 1J5EI 5AC5A 3J81Q 1XMOI 4JI8E 3T1YI 3EPLA 5C0XC 4LCHA 2WP8B 2EOZA 1XNQI 4R2CA 4BA2A 5EL9A 3OTOE 2M1SA 2VQFE 2CGEA 3QT6A 4BA1A 4X65I 2JEAA 4OO1B 1ZBQA 1NHHA 3UK3C 1KIJA 2RSIA 2CG9A 4JI0I 2GS8A 2X36A 3WU5A 4R2AA 1R6MA 1N0UA 2V86A 4Z7CA 3K6QA 4YHHI 2EPKX 2EQ0A 1T4NA 2CTDA 1YYWA 4X66E 2H36X 2LJHA 4JG4A 1T38A 4R2PA 2YZTA 2EZ6A 2LMZA 2V85A 5C0XE 3MHSC 5IT9C 4IZJD 1P42A 3P76A 3L7ZB 1E3PA 4N3OA 1OJ4A 1ZXNA 5FLXC 4OO1F 2VF3A 5L3JA 4L8NA 4M2ZA 2EMCA 3J7Yp 4DV4E 1ELOA 4HACA 2B7TA 4M9VC 5A6AA 4LF5E 3J7AG 2HJJA 1N32E 1QNTA 1WHQA 2DMIA 1JK1A 1XMQI 4IJDA 4BA1B 4DV2E 4JI1I 1R6LA 4P7AA 2JEAB 4R03A 1N0VC 3J81C 1RR9A 5LMNI 4DU7A 3B82A 1N36E 2CZ9A 3PS3A 3V2UC 1I94I 2L3JA 1T39A 3AUZA 4DUZI 2BA0G 2YPNA 1YYOA 1Z59A 4N4RB 2EOIA 2UXCE 1X47A 4F2JC 1USVA 4R2EA 5GMDA 4DV5I 1USUA 4IFDD 2MDGA 1B63A 4O5GA 1GZ6A 2ENAA 5A6JA 4DV7I 4AM3A 3C4TA 2JOBA 2RS6A 5TSEA 2IESA 2L3CA 1KJKA 2R3VA 4PRXA 5DROA 1GQEA 2EPXA 4B3ME 4JYAE 2J65A 3GONA 1SFEA 3ZM7A 1XNRE 4DPTA 5A6BD 2LCEA 2Z5CA 1DQ3A 2EN1A 1O0WA 3QG5C 5FWKA 1EH7A 2EMLA 5JEAB 4LF9I 4WUDA 1IBME 3CDJA 4DR3I 3F6GA 2YRMA 2LRSA 1L4SA 2I9IA 2EQ3A 4LF4E 1KKHA 4LF4I 2YTDA 1H73A 3THOB 4DR5I 2FGGA 2EOFA 4R2QA 3ECRA 1OYPA 2V34A 4FW6A 4GQUA 4KWYA 4Q28A 2UU9I 2YT4A 4LF8E 1RHYA 2V2ZA 2A2CA 1YFHA 2DMYA 2C37A 1UBDC 1BKNA 2BB8A 2N3GA 2IOQA 2JE6A 1VISA 1SR9A 4MU1A 1H72C 1MG7A 4NZVA 2EN8A 4BCAA 5BR8I 1AH5A 2VF1A 2HHHE 2UUAI 4X62E 1HNXI 4X62I 4TUGA 5K36C 5ADZA 2DRPA 1UDSA 2HC5A 4NXNE 4JI3I 2K4VA 4DV3E 2GLIA 2JY9A 1STUA 2EM3A 2AE8A 2BA1D 2GO4A 2YSPA 2EOQA 4OOGC 2HKJA 4FW3A 4HYMA 4OKGA 4I8OA 1IBKI 3PYEA 2LE2A 2EOSA 5JEAC 4F6MA 1YH8A 4DR1I 2NN6C 4LPFA 5C0XA 1N33I 1EH8A 2YTGA 4BC9A 4AQYI 1IBLI 4HY1A 4KQVA 1YUIA 1X6EA 2L2MA 4LFCE 4DR7E 1F2IG 4JI7I 1RMDA 5K36E 1Z5AA 4I3HA 4P7DA 3LTOA 4WX9A 4IZKA 4WUCA 4DPXA 4JI6E 4DMIA 2M7QA 4ZYDA 2V2QA 2E1RA 4OZEA 2DEIA 2Z5BB 2C38A 2UUCI 2EOJA 1HK7A 2Z5EA 2PO0A 4LFBE 1B62A 1PVGA 5KL2A 4DR6I 4UT4A 4JI5E 4JI2E 4K0KE 3DD6A 1NHJA 3JTZA 4DV0I 5IWAE 4WUBA 5IWAI 1Y6ZA 2ENHA 4BS9A 5JEAD 1A1IA 3T1HI 2BR2A 3ADJA 1EH6A 3P3CA 2NN6D 1J5EE 1XMOE 3B4TA 3T1YE 1XXEA 4IS9A 1UHZA 1XNQE 4LFAI 2PNLA 3QT7A 1RREA 2ELYA 2EOYA 3HXLA 4TUIA 4X65E 2LV2A 4X8WA 5DNLA 3LNUA 1PIEA 4ZYGA 4BC7A 4U3BA 5C0XB 4NXMI 4JI0E 3EPHA 4ISAA 3WU4A 1PJSA 1X49A 2MDRA 4YHHE 1IMUA 2CVEA 5A2QC 3PRYA 2L2KB 1U2RA 4IZKB 2AJ4A 3HPZA 2GQ0A 3MHHC 1N34I 3U1KA 4X9JA 3IWDA 1H74A 1X3CA 1Z5CA 2C38B 1H7SA 2YU8A 2EQ1A 5KL7A 2EM8A 4IFDC 3M6AA 1PJQA 1BBOA 2DEJA 5C0XF 4FK5C 5KL6A 2FV4B 2YU5A 3BIDA 2BR2B 4WFTA 2DB2A 2ODRD 4DUYI 4URLA 1WXRA 3H09A 4GKKI 1XMQE 4QNJA 4BA2B 2WW4A 3LPSA 2UXBI 3WU6A 1S16A 2RTXA 4OX9I 1ZM3A 3Q6NA 3M85D 1HR0I 1NEIA 5AE1A 2E1MA 2KONA 4JI1E 4JI4I 1N3GA 2EMBA 1Z0BA 1NZ0A 2A2DA 3KRNA 5LMNE 4M1KA 2LUQA 1MX0A 2WCC3 3EQ1A 4RHBB 4IFDE 2YTPA 1I94E 4M0VA 2D9HA 4DUZE 4JV5E 1FNMA 4JV5I 1A6FA 1T4LB 4OO1D 1FJGI 4WSGA 4DV5E 2PO2A 4HTGA 4WPYA 2MC6A 1Z0CA 2EMYA 5LMUI 4R2SA 3QT5A 1T4OA 3PYGA 2I13A 5AE2A 4DV7E 2YWQA 4FWHA 3JU0A 4KZSA 1LLMC 2MC5A 3UHMA 5DNXA 5K36A 2EPNA 2DLQA 3PS2A 4X64I 2RPCA 1TF3A 2EMWA 2EMXA 2J7JA 2EM6A 2EPLX 2MKDA 4HACB 1X48A 3JAMQ 4LF9E 4P78A 2LTSA 4DR3E 1H7UA 5JEAA 4BBYA 3M7ND 1IQSA 2UXDI 2EOEA 2NN6A 2CPNA 1B69A 4USMA 3CDIA 3ZOQB 3F6HA 3VYXA 4DR5E 2M9AA 3BGHA 2JPAA 2EPMX 3OMLA 2L2NA 4DV6I 1FWLA 2IERA 2UU9E 4HXZA 2YTFA 4Z7YA 1Y60A 1RC7A 4LF7I 4J8ZA 1MU5A 1Y4UA 2WNRA 4PRVA 2EL6A 1ZAAC 1JK2A 2IHR1 2NUGA 3THNA 5BR8E 2UUAE 1UN6B 1IQOA 4F54A 1HNXE 2PNMA 2V8PA 1DGCA 4JI3E 1WHNA 4RH8A 3HJCA 1GTKA 2MKNA 2C39A 1FKAE 2F1DA 2VESA 2JWOA 3B78A 4DPWA 5K36B 4IZJA 4U3DA 2CSHA 2JEBA 1IBKE 2GHFA 2O1VA 3J80Q 4DR1E 4FWGA 2EMIA 4DR4I 2ENCA 2EN4A 4O43A 5LLQA 1N33E 4MLQA 2Z5CB 2OI2A 4LF6I 2XEXA 2PO1A 5A69A 5T6JA 4AQYE 1IBLE 4GKJI 2EE8A 3PYDA 3ZKDA 1WUUA 1Z5BA 1ZM9A 4BMJA 4JI7E 4KHPI 4B3TI 5GMEA 2YSOA 4B3RI 4F6NA 2UUBI 1RQ0A 3P3EA 3KWRA 1UILA 4NHRA 4Q35B 3PYFA 3AV0A 2EOMA 4XTJA 2JVAA 3C4BA 2EMFA 4WXCA 2EN7A 2UUCE 2V2VA 4EMDA 2E5LI 2C37B 2J7KA 3Q1QA 5K36F 5JEAE 2V87A 3HPSA 4DR6E 2NN6E 2F8BA 4DKKA 2EOXA 1A1KA 2EM4A 2JE6B 2WNRB 2O1WA 4DV0E 3H1CA 3ADLA 4LCGA 4RPFA 2KOUA 2EMGA 2DSYA 3D4JA 2RS7A 4ED4A 2K7IA 2RSMA 2LJPA 4IFDA 3T1HE 1BB8A 2PNZA 4WYQB 1G2DC 3GLLA 5KL4A 4DR2I 5IT9Q 4LFAE 4IZJB 4GEQB 3BF2A 5FLXQ 4DU8A 1X6FA 3ADGA 1HNZI 5A6BA 2ODRC 4NXME 2PO1B 3GMEA 5DNYA 2KHXA 1KVKA 5LL6R 3K85A 4M30A 4B3SI 2EMZA 3EPJA 3L7ZA 3NZKA 1HNWE 2F4VI 1HNWI 5DRRA 2YTJA 2JR1A 5EKWA 3K1JA 1BBGA 1G2FC 2HK3A 1DI2A 2ZM6I 4DV1I 1YYKA 2JOXA 4UTGA 1ZU1A 1N34E 1Y5YA 2O3ZA 4MYTA 2EORA 1DARA 1X6HA 4JI8I 1X5WA 2R42A 2EOHA 1YSAC 4OO1C 1E3HA 3PS1A 2PO0B 2HFUA 1NCSA 2L92A 2V88A 1A1GA 4F9AB 1Z0VA 2EM5A 4MU4A 3OTOI 4DXLA 4BHBA 2VQFI 2EM9A 5IV8B 2NA2A 2EN6A 2EOOA 4MLVA 4HEIA 4IFDB 2PNZB 2PRTA 1Z0EA 2YTNA 1EKZA 2EMHA 3CWVA 4FW7A 4DUYE 2R1FA 1Z0TA 2NABA 1YPNA 4GKKE 2FTXB 2EP3A 2L6MA 1ZM2A 4X66I 2UXBE 4WSPA 5KL5A 3C6KA 3IWBA 4R2DA 1HR0E 4OX9E 1J26A 3ZKBA 2EPPA 4JI4E 2EL5A 2EWLA 5DRQA 4OO1E 2E72A 2NPFA 2EPOA 1UDOA 4R8OA 2ELZA 3TQMA 2WBUA 2BA0D 2O1UA 5CFFE 4FN5A 2GPIA 4O24A 3Q6MA 3ZZ0A 5C0XD 2ADRA 2EPZA 1ZXMA 3F0NA 1FJGE 2ZITA 3WU3A 1KYQA 4DV4I 4IFDF 1NHIA 2BBGA 3MSWA 4BHCA 1AAYA 2BM1A 2NUEA 4YY3E 1ZR9A 5LMUE 4YY3I 4LF5I 4MU3A 2EPAA 2EPUA 2N3HA 1ZBTA 1FI4A 1UEKA 1YHCA 4FW5A 1N32I 4ZYHA 3K17A 2V83A 2EM7A 3KZYA 3J7AM 4X64E 1PDAA 3LMLA 1A1HA 1Z0GA 2EN2A 2EPRA 5IXMB 3P3GA 5DRPA 3ZZUA 4FW4A 4F9CB 4DV2I 3M85G 1D6TA 4L5NC 1N36I 3U1YA 2EM2A 4LCFA 3ZZTA 2UXDE 3IWCA 3HQ1A 2LVHA 2YRKA 2V89A 3C6MA 2JXPA 1WJPA 2YTIA 3P1XA 4WXDA 4R1FA 2UXCI 1OYSA 4DV6E 2WZOA 2CT1A 3FIGA 3BBGA 1FWKA 3VYYA 2HKEA 2YTQA 3KZZA 4LF7E 2B9DA 3H4LA 1KTVA 4B3MI 4JYAI 3HTXA 1QZRA 1XNRI 3HULA 1WRJA 2PO2B 2LTRA 1YZ9A 1MEYC 1Z0WA 2DIXA 1IBMI 2LT7A 2EMKA 2B7VA 2WBSA 5ELWA 3M7NG 1TF6A 2B3TB 1UDQA 5KL3A 1A1JA 4LOMA 2GO3A 2JYAA 5AASA 1TN9A 4DR4E 4P52A 2EM0A 4LF6E 1P47A 2LO3A 3GCMA 2DGCA 2Z5BA 4DPYA 4LF8I 4LU9A 2L33A 2R76A 5F3WA 2G7HA 4GKJE 3EPKA 1A1LA
chains in the Genus database with same CATH topology
2Q2EB 1XHKA 4KHPE 4B3TE 4LTYA 1K47A 3VK6A 4B3RE 2UUBE 2HHHI 2X7IA 2V8QB 3JAMC 1QU6A 4USKA 4NXNI 4DV3I 2HK2A 2E5LE 3RMPA 3P06A 1ZM4A 5A2QQ 1EI1A 3B8HA 2BV3A 4FWDA 2L8TA 2LBSB 3V5RA 4ZVIA 4FW9A 2HFSA 5AE3A 4PU9A 4DPUA 4DR2E 1S4EA 4LFCI 2ZBKB 3LLHA 4DR7I 2EFGA 2VQEE 2VQEI 2NUFA 4JI6I 1EA6A 1HNZE 4MYUA 3QT8A 2M4IA 3ADIA 2VE7C 2LUPB 4B3SE 2F4VE 4LFBI 3DF6A 3DJWA 4JI5I 4JI2I 4K0KI 3J80C 4F9BB 2IOPA 1PKPA 2O1TA 2ZM6E 4DV1E 1Y4SA 2BM0A 1J5EI 3J81Q 1XMOI 4JI8E 3T1YI 1XNQI 3OTOE 2M1SA 2VQFE 2CGEA 3QT6A 4X65I 1ZBQA 1NHHA 2CG9A 1KIJA 3WU5A 4JI0I 2GS8A 2X36A 1N0UA 2V86A 4Z7CA 3K6QA 4YHHI 1T4NA 1YYWA 4X66E 2H36X 2LJHA 4JG4A 2YZTA 2EZ6A 2LMZA 2V85A 5IT9C 4IZJD 4N3OA 1OJ4A 1ZXNA 5FLXC 2VF3A 5L3JA 4L8NA 4M2ZA 3J7Yp 4DV4E 1ELOA 4HACA 2B7TA 4LF5E 3J7AG 1N32E 1WHQA 1XMQI 4DV2E 4JI1I 4P7AA 4R03A 1N0VC 3J81C 1RR9A 5LMNI 4DU7A 3B82A 1N36E 2CZ9A 3V2UC 1I94I 2L3JA 3AUZA 4DUZI 1YYOA 1Z59A 2UXCE 1X47A 1USVA 4DV5I 5GMDA 1USUA 1B63A 1GZ6A 4DV7I 3C4TA 2JOBA 2RS6A 2L3CA 2R3VA 4PRXA 1GQEA 4B3ME 4JYAE 3GONA 3ZM7A 1XNRE 4DPTA 2Z5CA 1DQ3A 1O0WA 5FWKA 4LF9I 4WUDA 1IBME 4DR3I 3F6GA 2LRSA 1KKHA 4LF4E 4LF4I 1H73A 4DR5I 2FGGA 2V34A 4Q28A 2UU9I 2YT4A 4LF8E 2V2ZA 2A2CA 2DMYA 1BKNA 2N3GA 2IOQA 1VISA 1SR9A 1H72C 1MG7A 4BCAA 5BR8I 2HHHE 2VF1A 2UUAI 4X62E 1HNXI 4X62I 4TUGA 5ADZA 4NXNE 4JI3I 2K4VA 4DV3E 2JY9A 1STUA 2HKJA 4HYMA 4OOGC 4I8OA 1IBKI 3PYEA 2LE2A 4DR1I 1N33I 4BC9A 4AQYI 1IBLI 4HY1A 4KQVA 2L2MA 4LFCE 4DR7E 4JI7I 1Z5AA 4I3HA 4P7DA 3LTOA 4IZKA 4WUCA 4DPXA 4JI6E 4DMIA 2M7QA 2V2QA 2E1RA 2DEIA 2Z5BB 2UUCI 1HK7A 2Z5EA 4LFBE 1B62A 1PVGA 4DR6I 4UT4A 4JI5E 4JI2E 4K0KE 1NHJA 3JTZA 4DV0I 5IWAE 4WUBA 5IWAI 1Y6ZA 4BS9A 3T1HI 3ADJA 1J5EE 1XMOE 3T1YE 1UHZA 1XNQE 4LFAI 2PNLA 3QT7A 1RREA 3HXLA 4TUIA 4X65E 4X8WA 3LNUA 1PIEA 4BC7A 4NXMI 4JI0E 3WU4A 1X49A 2MDRA 4YHHE 5A2QC 3PRYA 2L2KB 1U2RA 4IZKB 2AJ4A 3HPZA 2GQ0A 1N34I 1H74A 3IWDA 1Z5CA 1H7SA 3M6AA 2DEJA 2FV4B 4WFTA 2DB2A 2ODRD 4DUYI 4URLA 1WXRA 3H09A 4GKKI 1XMQE 2WW4A 3LPSA 2UXBI 3WU6A 1S16A 2RTXA 4OX9I 1ZM3A 3Q6NA 1HR0I 5AE1A 4JI1E 2E1MA 2KONA 4JI4I 1Z0BA 1NZ0A 2A2DA 5LMNE 4M1KA 2LUQA 1MX0A 1I94E 4M0VA 4DUZE 4JV5E 1FNMA 4JV5I 1A6FA 1T4LB 1FJGI 4DV5E 4WPYA 2MC6A 1Z0CA 5LMUI 3QT5A 1T4OA 3PYGA 5AE2A 4DV7E 4FWHA 3JU0A 4KZSA 2MC5A 4X64I 4HACB 1X48A 3JAMQ 4LF9E 4P78A 2LTSA 4DR3E 1H7UA 4BBYA 2UXDI 2CPNA 4USMA 3ZOQB 3F6HA 3VYXA 4DR5E 3OMLA 2L2NA 4DV6I 1FWLA 2UU9E 4HXZA 4Z7YA 1RC7A 4LF7I 4J8ZA 1MU5A 1Y4UA 4PRVA 2IHR1 2NUGA 5BR8E 2UUAE 2V8PA 2PNMA 4F54A 1HNXE 4JI3E 1WHNA 3HJCA 1FKAE 3B78A 2JWOA 4DPWA 4IZJA 2O1VA 1IBKE 3J80Q 4DR1E 4FWGA 4DR4I 2Z5CB 1N33E 4LF6I 2OI2A 2XEXA 5T6JA 4AQYE 1IBLE 4GKJI 3PYDA 3ZKDA 1WUUA 1Z5BA 1ZM9A 4BMJA 4JI7E 4KHPI 4B3TI 5GMEA 4B3RI 2UUBI 1RQ0A 3KWRA 1UILA 3PYFA 3AV0A 4XTJA 2JVAA 3C4BA 2V2VA 2UUCE 2E5LI 4EMDA 2J7KA 3Q1QA 2V87A 3HPSA 4DR6E 2F8BA 4DKKA 2O1WA 4DV0E 3ADLA 4RPFA 2KOUA 2DSYA 3D4JA 2RS7A 4ED4A 2RSMA 2LJPA 3T1HE 4WYQB 4DR2I 5IT9Q 4LFAE 4IZJB 4GEQB 5FLXQ 4DU8A 3ADGA 1HNZI 2ODRC 4NXME 5DNYA 2KHXA 1KVKA 5LL6R 3K85A 4M30A 4B3SI 2F4VI 1HNWE 1HNWI 2JR1A 3K1JA 2HK3A 1DI2A 2ZM6I 4DV1I 1YYKA 2JOXA 4UTGA 1N34E 4MYTA 1DARA 4JI8I 2R42A 2HFUA 2L92A 2V88A 4F9AB 1Z0VA 3OTOI 2VQFI 4DXLA 2NA2A 1Z0EA 3CWVA 1EKZA 4DUYE 1Z0TA 4GKKE 2FTXB 2L6MA 4X66I 1ZM2A 2UXBE 4WSPA 1J26A 3IWBA 1HR0E 4OX9E 3ZKBA 4JI4E 2EWLA 2NPFA 4R8OA 4FN5A 2O1UA 5CFFE 3Q6MA 3ZZ0A 1ZXMA 3F0NA 1FJGE 2ZITA 3WU3A 4DV4I 1NHIA 3MSWA 2BM1A 2NUEA 4YY3E 5LMUE 4YY3I 4LF5I 1UEKA 1ZBTA 1FI4A 1N32I 3K17A 2V83A 3J7AM 4X64E 1Z0GA 3LMLA 4DV2I 1D6TA 3ZZUA 4F9CB 4L5NC 1N36I 3ZZTA 2UXDE 3IWCA 3HQ1A 2V89A 2UXCI 3P1XA 4R1FA 4DV6E 2WZOA 3FIGA 1FWKA 3VYYA 2HKEA 4LF7E 2B9DA 3H4LA 1KTVA 4B3MI 4JYAI 3HTXA 1QZRA 1XNRI 3HULA 2LTRA 1YZ9A 1Z0WA 2DIXA 1IBMI 2B7VA 2B3TB 5AASA 4DR4E 4P52A 4LF6E 2Z5BA 4DPYA 4LF8I 4LU9A 2L33A 2N3HA 5F3WA 2G7HA 4GKJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2E B;  1XHK A;  4KHP E;  4B3T E;  1K47 A;  4B3R E;  2UUB E;  2HHH I;  2X7I A;  3JAM C;  1QU6 A;  4USK A;  4NXN I;  4DV3 I;  2HK2 A;  2E5L E;  1ZM4 A;  5A2Q Q;  1EI1 A;  3B8H A;  2BV3 A;  4FWD A;  2LBS B;  3V5R A;  4ZVI A;  4FW9 A;  2HFS A;  4PU9 A;  4DPU A;  4DR2 E;  1S4E A;  4LFC I;  2ZBK B;  3LLH A;  4DR7 I;  2EFG A;  2VQE E;  2VQE I;  2NUF A;  4JI6 I;  1EA6 A;  1HNZ E;  4MYU A;  3QT8 A;  3ADI A;  2LUP B;  4B3S E;  2F4V E;  4LFB I;  4JI5 I;  4JI2 I;  4K0K I;  3J80 C;  1PKP A;  2ZM6 E;  4DV1 E;  2BM0 A;  1J5E I;  3J81 Q;  1XMO I;  4JI8 E;  3T1Y I;  1XNQ I;  3OTO E;  2VQF E;  4X65 I;  3QT6 A;  1NHH A;  1KIJ A;  3WU5 A;  4JI0 I;  2GS8 A;  2X36 A;  1N0U A;  4Z7C A;  4YHH I;  1T4N A;  1YYW A;  4X66 E;  2LJH A;  4JG4 A;  2EZ6 A;  5IT9 C;  1OJ4 A;  1ZXN A;  5FLX C;  2VF3 A;  5L3J A;  4M2Z A;  3J7Y p;  4DV4 E;  1ELO A;  4HAC A;  2B7T A;  4LF5 E;  3J7A G;  1N32 E;  1WHQ A;  1XMQ I;  4DV2 E;  4JI1 I;  4P7A A;  1N0V C;  1RR9 A;  3J81 C;  5LMN I;  4DU7 A;  3B82 A;  1N36 E;  2CZ9 A;  3V2U C;  1I94 I;  2L3J A;  4DUZ I;  1YYO A;  1Z59 A;  2UXC E;  1X47 A;  4DV5 I;  5GMD A;  1B63 A;  4DV7 I;  3C4T A;  2RS6 A;  2L3C A;  2R3V A;  4PRX A;  1GQE A;  4B3M E;  4JYA E;  3GON A;  3ZM7 A;  1XNR E;  4DPT A;  1O0W A;  4LF9 I;  4WUD A;  1IBM E;  4DR3 I;  2LRS A;  1KKH A;  4LF4 E;  4LF4 I;  1H73 A;  4DR5 I;  2V34 A;  2UU9 I;  2YT4 A;  4LF8 E;  2V2Z A;  2A2C A;  2DMY A;  1BKN A;  2N3G A;  1VIS A;  1H72 C;  1MG7 A;  5BR8 I;  2HHH E;  2UUA I;  4X62 E;  1HNX I;  4X62 I;  4NXN E;  4JI3 I;  4DV3 E;  2JY9 A;  1STU A;  2HKJ A;  4HYM A;  4OOG C;  1IBK I;  3PYE A;  4DR1 I;  1N33 I;  4AQY I;  1IBL I;  4HY1 A;  4KQV A;  2L2M A;  4LFC E;  4DR7 E;  4JI7 I;  1Z5A A;  4I3H A;  3LTO A;  4WUC A;  4DPX A;  4JI6 E;  2V2Q A;  2E1R A;  2DEI A;  2UUC I;  4LFB E;  1B62 A;  1PVG A;  4DR6 I;  4UT4 A;  4JI5 E;  4JI2 E;  4K0K E;  1NHJ A;  4DV0 I;  5IWA E;  4WUB A;  5IWA I;  3T1H I;  3ADJ A;  1J5E E;  1XMO E;  3T1Y E;  1UHZ A;  1XNQ E;  4LFA I;  3QT7 A;  1RRE A;  4X65 E;  4X8W A;  3LNU A;  1PIE A;  4NXM I;  4JI0 E;  3WU4 A;  1X49 A;  2MDR A;  4YHH E;  5A2Q C;  2L2K B;  1U2R A;  2AJ4 A;  1N34 I;  1H74 A;  1Z5C A;  1H7S A;  3M6A A;  2DEJ A;  4WFT A;  2DB2 A;  4DUY I;  4URL A;  4GKK I;  1XMQ E;  2WW4 A;  3LPS A;  2UXB I;  3WU6 A;  1S16 A;  2RTX A;  4OX9 I;  1ZM3 A;  1HR0 I;  4JI1 E;  4JI4 I;  1Z0B A;  1NZ0 A;  2A2D A;  5LMN E;  4M1K A;  2LUQ A;  1MX0 A;  1I94 E;  4DUZ E;  4JV5 E;  1FNM A;  4JV5 I;  1A6F A;  1T4L B;  1FJG I;  4DV5 E;  1Z0C A;  5LMU I;  3QT5 A;  1T4O A;  3PYG A;  4DV7 E;  4FWH A;  4X64 I;  4HAC B;  1X48 A;  3JAM Q;  4LF9 E;  2LTS A;  4DR3 E;  1H7U A;  2UXD I;  2CPN A;  4USM A;  3VYX A;  4DR5 E;  2L2N A;  4DV6 I;  1FWL A;  2UU9 E;  4HXZ A;  4Z7Y A;  1RC7 A;  4LF7 I;  1MU5 A;  4PRV A;  2IHR 1;  2NUG A;  5BR8 E;  2UUA E;  2V8P A;  1HNX E;  4JI3 E;  1WHN A;  1FKA E;  3B78 A;  4DPW A;  1IBK E;  3J80 Q;  4DR1 E;  4FWG A;  4DR4 I;  1N33 E;  4LF6 I;  2OI2 A;  2XEX A;  4AQY E;  1IBL E;  4GKJ I;  3PYD A;  3ZKD A;  1WUU A;  1Z5B A;  1ZM9 A;  4KHP I;  4JI7 E;  4B3T I;  5GME A;  4B3R I;  2UUB I;  1RQ0 A;  1UIL A;  3PYF A;  4XTJ A;  2JVA A;  3C4B A;  2V2V A;  2UUC E;  2E5L I;  4EMD A;  2J7K A;  3Q1Q A;  4DR6 E;  4DKK A;  4DV0 E;  3ADL A;  4RPF A;  3D4J A;  4ED4 A;  2RS7 A;  2RSM A;  2LJP A;  3T1H E;  4WYQ B;  4DR2 I;  5IT9 Q;  4LFA E;  5FLX Q;  4DU8 A;  3ADG A;  1HNZ I;  4NXM E;  2KHX A;  1KVK A;  5LL6 R;  4M30 A;  4B3S I;  2F4V I;  1HNW E;  1HNW I;  3K1J A;  2HK3 A;  1DI2 A;  2ZM6 I;  4DV1 I;  1YYK A;  4UTG A;  1N34 E;  4MYT A;  1DAR A;  4JI8 I;  2R42 A;  2HFU A;  3OTO I;  1Z0V A;  2VQF I;  4DXL A;  2NA2 A;  1Z0E A;  3CWV A;  1EKZ A;  4DUY E;  1Z0T A;  4GKK E;  4X66 I;  1ZM2 A;  2UXB E;  4OX9 E;  1J26 A;  1HR0 E;  3ZKB A;  4JI4 E;  2NPF A;  4FN5 A;  5CFF E;  3ZZ0 A;  1ZXM A;  3F0N A;  1FJG E;  2ZIT A;  3WU3 A;  4DV4 I;  1NHI A;  2BM1 A;  2NUE A;  4YY3 E;  5LMU E;  4YY3 I;  4LF5 I;  1UEK A;  1ZBT A;  1FI4 A;  1N32 I;  3K17 A;  3J7A M;  4X64 E;  1Z0G A;  4DV2 I;  1D6T A;  3ZZU A;  1N36 I;  3ZZT A;  2UXD E;  2UXC I;  3P1X A;  4R1F A;  4DV6 E;  1FWK A;  3VYY A;  2HKE A;  4LF7 E;  3H4L A;  1KTV A;  4B3M I;  4JYA I;  3HTX A;  1QZR A;  1XNR I;  3HUL A;  2LTR A;  1YZ9 A;  1Z0W A;  2DIX A;  1IBM I;  2B7V A;  2B3T B;  4P52 A;  4DR4 E;  4LF6 E;  4DPY A;  4LF8 I;  2L33 A;  2N3H A;  4GKJ E; 
#chains in the Genus database with same CATH topology
 2Q2E B;  2WBT A;  1XHK A;  4KHP E;  2NN6 B;  2RQL A;  4B3T E;  2VRD A;  4LTY A;  1K47 A;  3VK6 A;  4B3R E;  1OYR A;  2EL4 A;  2UUB E;  2HHH I;  4GZN C;  2V8Q B;  2X7I A;  3HKM A;  4ZYE A;  3JAM C;  1QU6 A;  4USK A;  4NXN I;  4DV3 I;  5A6K A;  2DLK A;  2HK2 A;  2E5L E;  2N8X A;  3L00 A;  3RMP A;  1PJT A;  4AID A;  2WP8 A;  3P06 A;  2EPC A;  1ZM4 A;  2YRH A;  2BA1 G;  4IS1 C;  1UDN A;  1EI1 A;  5A2Q Q;  3B8H A;  1Z1B A;  1VI7 A;  2BV3 A;  2Q8U A;  2EJ4 A;  1YUJ A;  4FWD A;  4OO1 A;  2L8T A;  2LBS B;  5JEA F;  3V5R A;  4ZVI A;  2YTE A;  2NN6 F;  4MU0 A;  4FW9 A;  3M99 B;  2HFS A;  4O4K A;  5AE3 A;  4PU9 A;  2C39 B;  4DPU A;  4DR2 E;  1S4E A;  4LFC I;  2ZBK B;  3LLH A;  4DR7 I;  2EFG A;  2VQE E;  2EN3 A;  2VQE I;  2JP9 A;  2NUF A;  2JEB B;  4J3D A;  4JI6 I;  1EA6 A;  2JT2 A;  2LJU A;  1HNZ E;  4NBQ A;  4MYU A;  5AC4 A;  3QT8 A;  4MQY A;  5K36 D;  2M4I A;  3ADI A;  2YTO A;  2VE7 C;  1A1F A;  2LUP B;  2EMA A;  2A25 A;  4B3S E;  2HGH A;  2F4V E;  4QNK A;  4LFB I;  3DF6 A;  1MGT A;  3DJW A;  4JI2 I;  4JI5 I;  4K0K I;  3J80 C;  3VHT B;  4F9B B;  2IOP A;  1PKP A;  2O1T A;  4AIM A;  2ZM6 E;  4DV1 E;  1Y4S A;  4R2R A;  4MDT A;  2BM0 A;  1J5E I;  5AC5 A;  3J81 Q;  1XMO I;  4JI8 E;  3T1Y I;  3EPL A;  5C0X C;  4LCH A;  2WP8 B;  2EOZ A;  1XNQ I;  4R2C A;  4BA2 A;  5EL9 A;  3OTO E;  2M1S A;  2VQF E;  2CGE A;  3QT6 A;  4BA1 A;  4X65 I;  2JEA A;  4OO1 B;  1ZBQ A;  1NHH A;  3UK3 C;  1KIJ A;  2RSI A;  2CG9 A;  4JI0 I;  2GS8 A;  2X36 A;  3WU5 A;  4R2A A;  1R6M A;  1N0U A;  2V86 A;  4Z7C A;  3K6Q A;  4YHH I;  2EPK X;  2EQ0 A;  1T4N A;  2CTD A;  1YYW A;  4X66 E;  2H36 X;  2LJH A;  4JG4 A;  1T38 A;  4R2P A;  2YZT A;  2EZ6 A;  2LMZ A;  2V85 A;  5C0X E;  3MHS C;  5IT9 C;  4IZJ D;  1P42 A;  3P76 A;  3L7Z B;  1E3P A;  4N3O A;  1OJ4 A;  1ZXN A;  5FLX C;  4OO1 F;  2VF3 A;  5L3J A;  4L8N A;  4M2Z A;  2EMC A;  3J7Y p;  4DV4 E;  1ELO A;  4HAC A;  2B7T A;  4M9V C;  5A6A A;  4LF5 E;  3J7A G;  2HJJ A;  1N32 E;  1QNT A;  1WHQ A;  2DMI A;  1JK1 A;  1XMQ I;  4IJD A;  4BA1 B;  4DV2 E;  4JI1 I;  1R6L A;  4P7A A;  2JEA B;  4R03 A;  1N0V C;  3J81 C;  1RR9 A;  5LMN I;  4DU7 A;  3B82 A;  1N36 E;  2CZ9 A;  3PS3 A;  3V2U C;  1I94 I;  2L3J A;  1T39 A;  3AUZ A;  4DUZ I;  2BA0 G;  2YPN A;  1YYO A;  1Z59 A;  4N4R B;  2EOI A;  2UXC E;  1X47 A;  4F2J C;  1USV A;  4R2E A;  5GMD A;  4DV5 I;  1USU A;  4IFD D;  2MDG A;  1B63 A;  4O5G A;  1GZ6 A;  2ENA A;  5A6J A;  4DV7 I;  4AM3 A;  3C4T A;  2JOB A;  2RS6 A;  5TSE A;  2IES A;  2L3C A;  1KJK A;  2R3V A;  4PRX A;  5DRO A;  1GQE A;  2EPX A;  4B3M E;  4JYA E;  2J65 A;  3GON A;  1SFE A;  3ZM7 A;  1XNR E;  4DPT A;  5A6B D;  2LCE A;  2Z5C A;  1DQ3 A;  2EN1 A;  1O0W A;  3QG5 C;  5FWK A;  1EH7 A;  2EML A;  5JEA B;  4LF9 I;  4WUD A;  1IBM E;  3CDJ A;  4DR3 I;  3F6G A;  2YRM A;  2LRS A;  1L4S A;  2I9I A;  2EQ3 A;  4LF4 E;  1KKH A;  4LF4 I;  2YTD A;  1H73 A;  3THO B;  4DR5 I;  2FGG A;  2EOF A;  4R2Q A;  3ECR A;  1OYP A;  2V34 A;  4FW6 A;  4GQU A;  4KWY A;  4Q28 A;  2UU9 I;  2YT4 A;  4LF8 E;  1RHY A;  2V2Z A;  2A2C A;  1YFH A;  2DMY A;  2C37 A;  1UBD C;  1BKN A;  2BB8 A;  2N3G A;  2IOQ A;  2JE6 A;  1VIS A;  1SR9 A;  4MU1 A;  1H72 C;  1MG7 A;  4NZV A;  2EN8 A;  4BCA A;  5BR8 I;  1AH5 A;  2VF1 A;  2HHH E;  2UUA I;  4X62 E;  1HNX I;  4X62 I;  4TUG A;  5K36 C;  5ADZ A;  2DRP A;  1UDS A;  2HC5 A;  4NXN E;  4JI3 I;  2K4V A;  4DV3 E;  2GLI A;  2JY9 A;  1STU A;  2EM3 A;  2AE8 A;  2BA1 D;  2GO4 A;  2YSP A;  2EOQ A;  4OOG C;  2HKJ A;  4FW3 A;  4HYM A;  4OKG A;  4I8O A;  1IBK I;  3PYE A;  2LE2 A;  2EOS A;  5JEA C;  4F6M A;  1YH8 A;  4DR1 I;  2NN6 C;  4LPF A;  5C0X A;  1N33 I;  1EH8 A;  2YTG A;  4BC9 A;  4AQY I;  1IBL I;  4HY1 A;  4KQV A;  1YUI A;  1X6E A;  2L2M A;  4LFC E;  4DR7 E;  1F2I G;  4JI7 I;  1RMD A;  5K36 E;  1Z5A A;  4I3H A;  4P7D A;  3LTO A;  4WX9 A;  4IZK A;  4WUC A;  4DPX A;  4JI6 E;  4DMI A;  2M7Q A;  4ZYD A;  2V2Q A;  2E1R A;  4OZE A;  2DEI A;  2Z5B B;  2C38 A;  2UUC I;  2EOJ A;  1HK7 A;  2Z5E A;  2PO0 A;  4LFB E;  1B62 A;  1PVG A;  5KL2 A;  4DR6 I;  4UT4 A;  4JI5 E;  4JI2 E;  4K0K E;  3DD6 A;  1NHJ A;  3JTZ A;  4DV0 I;  5IWA E;  4WUB A;  5IWA I;  1Y6Z A;  2ENH A;  4BS9 A;  5JEA D;  1A1I A;  3T1H I;  2BR2 A;  3ADJ A;  1EH6 A;  3P3C A;  2NN6 D;  1J5E E;  1XMO E;  3B4T A;  3T1Y E;  1XXE A;  4IS9 A;  1UHZ A;  1XNQ E;  4LFA I;  2PNL A;  3QT7 A;  1RRE A;  2ELY A;  2EOY A;  3HXL A;  4TUI A;  4X65 E;  2LV2 A;  4X8W A;  5DNL A;  3LNU A;  1PIE A;  4ZYG A;  4BC7 A;  4U3B A;  5C0X B;  4NXM I;  4JI0 E;  3EPH A;  4ISA A;  3WU4 A;  1PJS A;  1X49 A;  2MDR A;  4YHH E;  1IMU A;  2CVE A;  5A2Q C;  3PRY A;  2L2K B;  1U2R A;  4IZK B;  2AJ4 A;  3HPZ A;  2GQ0 A;  3MHH C;  1N34 I;  3U1K A;  4X9J A;  3IWD A;  1H74 A;  1X3C A;  1Z5C A;  2C38 B;  1H7S A;  2YU8 A;  2EQ1 A;  5KL7 A;  2EM8 A;  4IFD C;  3M6A A;  1PJQ A;  1BBO A;  2DEJ A;  5C0X F;  4FK5 C;  5KL6 A;  2FV4 B;  2YU5 A;  3BID A;  2BR2 B;  4WFT A;  2DB2 A;  2ODR D;  4DUY I;  4URL A;  1WXR A;  3H09 A;  4GKK I;  1XMQ E;  4QNJ A;  4BA2 B;  2WW4 A;  3LPS A;  2UXB I;  3WU6 A;  1S16 A;  2RTX A;  4OX9 I;  1ZM3 A;  3Q6N A;  3M85 D;  1HR0 I;  1NEI A;  5AE1 A;  2E1M A;  2KON A;  4JI1 E;  4JI4 I;  1N3G A;  2EMB A;  1Z0B A;  1NZ0 A;  2A2D A;  3KRN A;  5LMN E;  4M1K A;  2LUQ A;  1MX0 A;  2WCC 3;  3EQ1 A;  4RHB B;  4IFD E;  2YTP A;  1I94 E;  4M0V A;  2D9H A;  4DUZ E;  4JV5 E;  1FNM A;  4JV5 I;  1A6F A;  1T4L B;  4OO1 D;  1FJG I;  4WSG A;  4DV5 E;  2PO2 A;  4HTG A;  4WPY A;  2MC6 A;  1Z0C A;  2EMY A;  5LMU I;  4R2S A;  3QT5 A;  1T4O A;  3PYG A;  2I13 A;  5AE2 A;  4DV7 E;  2YWQ A;  4FWH A;  3JU0 A;  4KZS A;  1LLM C;  2MC5 A;  3UHM A;  5DNX A;  5K36 A;  2EPN A;  2DLQ A;  3PS2 A;  4X64 I;  2RPC A;  1TF3 A;  2EMW A;  2EMX A;  2J7J A;  2EM6 A;  2EPL X;  2MKD A;  4HAC B;  1X48 A;  3JAM Q;  4LF9 E;  4P78 A;  2LTS A;  4DR3 E;  1H7U A;  5JEA A;  4BBY A;  3M7N D;  1IQS A;  2UXD I;  2EOE A;  2NN6 A;  2CPN A;  1B69 A;  4USM A;  3CDI A;  3ZOQ B;  3F6H A;  3VYX A;  4DR5 E;  2M9A A;  3BGH A;  2JPA A;  2EPM X;  3OML A;  2L2N A;  4DV6 I;  1FWL A;  2IER A;  2UU9 E;  4HXZ A;  2YTF A;  4Z7Y A;  1Y60 A;  1RC7 A;  4LF7 I;  4J8Z A;  1MU5 A;  1Y4U A;  2WNR A;  4PRV A;  2EL6 A;  1ZAA C;  1JK2 A;  2IHR 1;  2NUG A;  3THN A;  5BR8 E;  2UUA E;  1UN6 B;  1IQO A;  4F54 A;  1HNX E;  2PNM A;  2V8P A;  1DGC A;  4JI3 E;  1WHN A;  4RH8 A;  3HJC A;  1GTK A;  2MKN A;  2C39 A;  1FKA E;  2F1D A;  2VES A;  2JWO A;  3B78 A;  4DPW A;  5K36 B;  4IZJ A;  4U3D A;  2CSH A;  2JEB A;  1IBK E;  2GHF A;  2O1V A;  3J80 Q;  4DR1 E;  4FWG A;  2EMI A;  4DR4 I;  2ENC A;  2EN4 A;  4O43 A;  5LLQ A;  1N33 E;  4MLQ A;  2Z5C B;  2OI2 A;  4LF6 I;  2XEX A;  2PO1 A;  5A69 A;  5T6J A;  4AQY E;  1IBL E;  4GKJ I;  2EE8 A;  3PYD A;  3ZKD A;  1WUU A;  1Z5B A;  1ZM9 A;  4BMJ A;  4JI7 E;  4KHP I;  4B3T I;  5GME A;  2YSO A;  4B3R I;  4F6N A;  2UUB I;  1RQ0 A;  3P3E A;  3KWR A;  1UIL A;  4NHR A;  4Q35 B;  3PYF A;  3AV0 A;  2EOM A;  4XTJ A;  2JVA A;  3C4B A;  2EMF A;  4WXC A;  2EN7 A;  2UUC E;  2V2V A;  4EMD A;  2E5L I;  2C37 B;  2J7K A;  3Q1Q A;  5K36 F;  5JEA E;  2V87 A;  3HPS A;  4DR6 E;  2NN6 E;  2F8B A;  4DKK A;  2EOX A;  1A1K A;  2EM4 A;  2JE6 B;  2WNR B;  2O1W A;  4DV0 E;  3H1C A;  3ADL A;  4LCG A;  4RPF A;  2KOU A;  2EMG A;  2DSY A;  3D4J A;  2RS7 A;  4ED4 A;  2K7I A;  2RSM A;  2LJP A;  4IFD A;  3T1H E;  1BB8 A;  2PNZ A;  4WYQ B;  1G2D C;  3GLL A;  5KL4 A;  4DR2 I;  5IT9 Q;  4LFA E;  4IZJ B;  4GEQ B;  3BF2 A;  5FLX Q;  4DU8 A;  1X6F A;  3ADG A;  1HNZ I;  5A6B A;  2ODR C;  4NXM E;  2PO1 B;  3GME A;  5DNY A;  2KHX A;  1KVK A;  5LL6 R;  3K85 A;  4M30 A;  4B3S I;  2EMZ A;  3EPJ A;  3L7Z A;  3NZK A;  1HNW E;  2F4V I;  1HNW I;  5DRR A;  2YTJ A;  2JR1 A;  5EKW A;  3K1J A;  1BBG A;  1G2F C;  2HK3 A;  1DI2 A;  2ZM6 I;  4DV1 I;  1YYK A;  2JOX A;  4UTG A;  1ZU1 A;  1N34 E;  1Y5Y A;  2O3Z A;  4MYT A;  2EOR A;  1DAR A;  1X6H A;  4JI8 I;  1X5W A;  2R42 A;  2EOH A;  1YSA C;  4OO1 C;  1E3H A;  3PS1 A;  2PO0 B;  2HFU A;  1NCS A;  2L92 A;  2V88 A;  1A1G A;  4F9A B;  1Z0V A;  2EM5 A;  4MU4 A;  3OTO I;  4DXL A;  4BHB A;  2VQF I;  2EM9 A;  5IV8 B;  2NA2 A;  2EN6 A;  2EOO A;  4MLV A;  4HEI A;  4IFD B;  2PNZ B;  2PRT A;  1Z0E A;  2YTN A;  1EKZ A;  2EMH A;  3CWV A;  4FW7 A;  4DUY E;  2R1F A;  1Z0T A;  2NAB A;  1YPN A;  4GKK E;  2FTX B;  2EP3 A;  2L6M A;  1ZM2 A;  4X66 I;  2UXB E;  4WSP A;  5KL5 A;  3C6K A;  3IWB A;  4R2D A;  1HR0 E;  4OX9 E;  1J26 A;  3ZKB A;  2EPP A;  4JI4 E;  2EL5 A;  2EWL A;  5DRQ A;  4OO1 E;  2E72 A;  2NPF A;  2EPO A;  1UDO A;  4R8O A;  2ELZ A;  3TQM A;  2WBU A;  2BA0 D;  2O1U A;  5CFF E;  4FN5 A;  2GPI A;  4O24 A;  3Q6M A;  3ZZ0 A;  5C0X D;  2ADR A;  2EPZ A;  1ZXM A;  3F0N A;  1FJG E;  2ZIT A;  3WU3 A;  1KYQ A;  4DV4 I;  4IFD F;  1NHI A;  2BBG A;  3MSW A;  4BHC A;  1AAY A;  2BM1 A;  2NUE A;  4YY3 E;  1ZR9 A;  5LMU E;  4YY3 I;  4LF5 I;  4MU3 A;  2EPA A;  2EPU A;  2N3H A;  1ZBT A;  1FI4 A;  1UEK A;  1YHC A;  4FW5 A;  1N32 I;  4ZYH A;  3K17 A;  2V83 A;  2EM7 A;  3KZY A;  3J7A M;  4X64 E;  1PDA A;  3LML A;  1A1H A;  1Z0G A;  2EN2 A;  2EPR A;  5IXM B;  3P3G A;  5DRP A;  3ZZU A;  4FW4 A;  4F9C B;  4DV2 I;  3M85 G;  1D6T A;  4L5N C;  1N36 I;  3U1Y A;  2EM2 A;  4LCF A;  3ZZT A;  2UXD E;  3IWC A;  3HQ1 A;  2LVH A;  2YRK A;  2V89 A;  3C6M A;  2JXP A;  1WJP A;  2YTI A;  3P1X A;  4WXD A;  4R1F A;  2UXC I;  1OYS A;  4DV6 E;  2WZO A;  2CT1 A;  3FIG A;  3BBG A;  1FWK A;  3VYY A;  2HKE A;  2YTQ A;  3KZZ A;  4LF7 E;  2B9D A;  3H4L A;  1KTV A;  4B3M I;  4JYA I;  3HTX A;  1QZR A;  1XNR I;  3HUL A;  1WRJ A;  2PO2 B;  2LTR A;  1YZ9 A;  1MEY C;  1Z0W A;  2DIX A;  1IBM I;  2LT7 A;  2EMK A;  2B7V A;  2WBS A;  5ELW A;  3M7N G;  1TF6 A;  2B3T B;  1UDQ A;  5KL3 A;  1A1J A;  4LOM A;  2GO3 A;  2JYA A;  5AAS A;  1TN9 A;  4DR4 E;  4P52 A;  2EM0 A;  4LF6 E;  1P47 A;  2LO3 A;  3GCM A;  2DGC A;  2Z5B A;  4DPY A;  4LF8 I;  4LU9 A;  2L33 A;  2R76 A;  5F3W A;  2G7H A;  4GKJ E;  3EPK A;  1A1L A; 
#chains in the Genus database with same CATH homology
 2Q2E B;  1XHK A;  4KHP E;  4B3T E;  4LTY A;  1K47 A;  3VK6 A;  4B3R E;  2UUB E;  2HHH I;  2X7I A;  2V8Q B;  3JAM C;  1QU6 A;  4USK A;  4NXN I;  4DV3 I;  2HK2 A;  2E5L E;  3RMP A;  3P06 A;  1ZM4 A;  5A2Q Q;  1EI1 A;  3B8H A;  2BV3 A;  4FWD A;  2L8T A;  2LBS B;  3V5R A;  4ZVI A;  4FW9 A;  2HFS A;  5AE3 A;  4PU9 A;  4DPU A;  4DR2 E;  1S4E A;  4LFC I;  2ZBK B;  3LLH A;  4DR7 I;  2EFG A;  2VQE E;  2VQE I;  2NUF A;  4JI6 I;  1EA6 A;  1HNZ E;  4MYU A;  3QT8 A;  2M4I A;  3ADI A;  2VE7 C;  2LUP B;  4B3S E;  2F4V E;  4LFB I;  3DF6 A;  3DJW A;  4JI5 I;  4JI2 I;  4K0K I;  3J80 C;  4F9B B;  2IOP A;  1PKP A;  2O1T A;  2ZM6 E;  4DV1 E;  1Y4S A;  2BM0 A;  1J5E I;  3J81 Q;  1XMO I;  4JI8 E;  3T1Y I;  1XNQ I;  3OTO E;  2M1S A;  2VQF E;  2CGE A;  3QT6 A;  4X65 I;  1ZBQ A;  1NHH A;  2CG9 A;  1KIJ A;  3WU5 A;  4JI0 I;  2GS8 A;  2X36 A;  1N0U A;  2V86 A;  4Z7C A;  3K6Q A;  4YHH I;  1T4N A;  1YYW A;  4X66 E;  2H36 X;  2LJH A;  4JG4 A;  2YZT A;  2EZ6 A;  2LMZ A;  2V85 A;  5IT9 C;  4IZJ D;  4N3O A;  1OJ4 A;  1ZXN A;  5FLX C;  2VF3 A;  5L3J A;  4L8N A;  4M2Z A;  3J7Y p;  4DV4 E;  1ELO A;  4HAC A;  2B7T A;  4LF5 E;  3J7A G;  1N32 E;  1WHQ A;  1XMQ I;  4DV2 E;  4JI1 I;  4P7A A;  4R03 A;  1N0V C;  3J81 C;  1RR9 A;  5LMN I;  4DU7 A;  3B82 A;  1N36 E;  2CZ9 A;  3V2U C;  1I94 I;  2L3J A;  3AUZ A;  4DUZ I;  1YYO A;  1Z59 A;  2UXC E;  1X47 A;  1USV A;  4DV5 I;  5GMD A;  1USU A;  1B63 A;  1GZ6 A;  4DV7 I;  3C4T A;  2JOB A;  2RS6 A;  2L3C A;  2R3V A;  4PRX A;  1GQE A;  4B3M E;  4JYA E;  3GON A;  3ZM7 A;  1XNR E;  4DPT A;  2Z5C A;  1DQ3 A;  1O0W A;  5FWK A;  4LF9 I;  4WUD A;  1IBM E;  4DR3 I;  3F6G A;  2LRS A;  1KKH A;  4LF4 E;  4LF4 I;  1H73 A;  4DR5 I;  2FGG A;  2V34 A;  4Q28 A;  2UU9 I;  2YT4 A;  4LF8 E;  2V2Z A;  2A2C A;  2DMY A;  1BKN A;  2N3G A;  2IOQ A;  1VIS A;  1SR9 A;  1H72 C;  1MG7 A;  4BCA A;  5BR8 I;  2HHH E;  2VF1 A;  2UUA I;  4X62 E;  1HNX I;  4X62 I;  4TUG A;  5ADZ A;  4NXN E;  4JI3 I;  2K4V A;  4DV3 E;  2JY9 A;  1STU A;  2HKJ A;  4HYM A;  4OOG C;  4I8O A;  1IBK I;  3PYE A;  2LE2 A;  4DR1 I;  1N33 I;  4BC9 A;  4AQY I;  1IBL I;  4HY1 A;  4KQV A;  2L2M A;  4LFC E;  4DR7 E;  4JI7 I;  1Z5A A;  4I3H A;  4P7D A;  3LTO A;  4IZK A;  4WUC A;  4DPX A;  4JI6 E;  4DMI A;  2M7Q A;  2V2Q A;  2E1R A;  2DEI A;  2Z5B B;  2UUC I;  1HK7 A;  2Z5E A;  4LFB E;  1B62 A;  1PVG A;  4DR6 I;  4UT4 A;  4JI5 E;  4JI2 E;  4K0K E;  1NHJ A;  3JTZ A;  4DV0 I;  5IWA E;  4WUB A;  5IWA I;  1Y6Z A;  4BS9 A;  3T1H I;  3ADJ A;  1J5E E;  1XMO E;  3T1Y E;  1UHZ A;  1XNQ E;  4LFA I;  2PNL A;  3QT7 A;  1RRE A;  3HXL A;  4TUI A;  4X65 E;  4X8W A;  3LNU A;  1PIE A;  4BC7 A;  4NXM I;  4JI0 E;  3WU4 A;  1X49 A;  2MDR A;  4YHH E;  5A2Q C;  3PRY A;  2L2K B;  1U2R A;  4IZK B;  2AJ4 A;  3HPZ A;  2GQ0 A;  1N34 I;  1H74 A;  3IWD A;  1Z5C A;  1H7S A;  3M6A A;  2DEJ A;  2FV4 B;  4WFT A;  2DB2 A;  2ODR D;  4DUY I;  4URL A;  1WXR A;  3H09 A;  4GKK I;  1XMQ E;  2WW4 A;  3LPS A;  2UXB I;  3WU6 A;  1S16 A;  2RTX A;  4OX9 I;  1ZM3 A;  3Q6N A;  1HR0 I;  5AE1 A;  4JI1 E;  2E1M A;  2KON A;  4JI4 I;  1Z0B A;  1NZ0 A;  2A2D A;  5LMN E;  4M1K A;  2LUQ A;  1MX0 A;  1I94 E;  4M0V A;  4DUZ E;  4JV5 E;  1FNM A;  4JV5 I;  1A6F A;  1T4L B;  1FJG I;  4DV5 E;  4WPY A;  2MC6 A;  1Z0C A;  5LMU I;  3QT5 A;  1T4O A;  3PYG A;  5AE2 A;  4DV7 E;  4FWH A;  3JU0 A;  4KZS A;  2MC5 A;  4X64 I;  4HAC B;  1X48 A;  3JAM Q;  4LF9 E;  4P78 A;  2LTS A;  4DR3 E;  1H7U A;  4BBY A;  2UXD I;  2CPN A;  4USM A;  3ZOQ B;  3F6H A;  3VYX A;  4DR5 E;  3OML A;  2L2N A;  4DV6 I;  1FWL A;  2UU9 E;  4HXZ A;  4Z7Y A;  1RC7 A;  4LF7 I;  4J8Z A;  1MU5 A;  1Y4U A;  4PRV A;  2IHR 1;  2NUG A;  5BR8 E;  2UUA E;  2V8P A;  2PNM A;  4F54 A;  1HNX E;  4JI3 E;  1WHN A;  3HJC A;  1FKA E;  3B78 A;  2JWO A;  4DPW A;  4IZJ A;  2O1V A;  1IBK E;  3J80 Q;  4DR1 E;  4FWG A;  4DR4 I;  2Z5C B;  1N33 E;  4LF6 I;  2OI2 A;  2XEX A;  5T6J A;  4AQY E;  1IBL E;  4GKJ I;  3PYD A;  3ZKD A;  1WUU A;  1Z5B A;  1ZM9 A;  4BMJ A;  4JI7 E;  4KHP I;  4B3T I;  5GME A;  4B3R I;  2UUB I;  1RQ0 A;  3KWR A;  1UIL A;  3PYF A;  3AV0 A;  4XTJ A;  2JVA A;  3C4B A;  2V2V A;  2UUC E;  2E5L I;  4EMD A;  2J7K A;  3Q1Q A;  2V87 A;  3HPS A;  4DR6 E;  2F8B A;  4DKK A;  2O1W A;  4DV0 E;  3ADL A;  4RPF A;  2KOU A;  2DSY A;  3D4J A;  2RS7 A;  4ED4 A;  2RSM A;  2LJP A;  3T1H E;  4WYQ B;  4DR2 I;  5IT9 Q;  4LFA E;  4IZJ B;  4GEQ B;  5FLX Q;  4DU8 A;  3ADG A;  1HNZ I;  2ODR C;  4NXM E;  5DNY A;  2KHX A;  1KVK A;  5LL6 R;  3K85 A;  4M30 A;  4B3S I;  2F4V I;  1HNW E;  1HNW I;  2JR1 A;  3K1J A;  2HK3 A;  1DI2 A;  2ZM6 I;  4DV1 I;  1YYK A;  2JOX A;  4UTG A;  1N34 E;  4MYT A;  1DAR A;  4JI8 I;  2R42 A;  2HFU A;  2L92 A;  2V88 A;  4F9A B;  1Z0V A;  3OTO I;  2VQF I;  4DXL A;  2NA2 A;  1Z0E A;  3CWV A;  1EKZ A;  4DUY E;  1Z0T A;  4GKK E;  2FTX B;  2L6M A;  4X66 I;  1ZM2 A;  2UXB E;  4WSP A;  1J26 A;  3IWB A;  1HR0 E;  4OX9 E;  3ZKB A;  4JI4 E;  2EWL A;  2NPF A;  4R8O A;  4FN5 A;  2O1U A;  5CFF E;  3Q6M A;  3ZZ0 A;  1ZXM A;  3F0N A;  1FJG E;  2ZIT A;  3WU3 A;  4DV4 I;  1NHI A;  3MSW A;  2BM1 A;  2NUE A;  4YY3 E;  5LMU E;  4YY3 I;  4LF5 I;  1UEK A;  1ZBT A;  1FI4 A;  1N32 I;  3K17 A;  2V83 A;  3J7A M;  4X64 E;  1Z0G A;  3LML A;  4DV2 I;  1D6T A;  3ZZU A;  4F9C B;  4L5N C;  1N36 I;  3ZZT A;  2UXD E;  3IWC A;  3HQ1 A;  2V89 A;  2UXC I;  3P1X A;  4R1F A;  4DV6 E;  2WZO A;  3FIG A;  1FWK A;  3VYY A;  2HKE A;  4LF7 E;  2B9D A;  3H4L A;  1KTV A;  4B3M I;  4JYA I;  3HTX A;  1QZR A;  1XNR I;  3HUL A;  2LTR A;  1YZ9 A;  1Z0W A;  2DIX A;  1IBM I;  2B7V A;  2B3T B;  5AAS A;  4DR4 E;  4P52 A;  4LF6 E;  2Z5B A;  4DPY A;  4LF8 I;  4LU9 A;  2L33 A;  2N3H A;  5F3W A;  2G7H A;  4GKJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...