1XMOE

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xmoE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmoE02
4LFAE 1YYKA 2L2NA 2EFGA 1HNWE 1FI4A 1NZ0A 4JI3E 1RQ0A 4JI8E 1B63A 1NHHA 2BV3A 4PU9A 3D4JA 1FJGI 4HACA 5L3JA 4X65E 4JYAI 1I94I 3GONA 4LFAI 3V2UC 1HNWI 5GMDA 4JI8I 4JI3I 1X48A 4B3SE 1YYWA 3LNUA 3ADGA 4JI6E 1A6FA 1Z59A 1EKZA 4X65I 1T4NA 2UXCE 2BM1A 2E1RA 2DB2A 4LFBE 4WUBA 2NPFA 2L33A 3F0NA 4B3SI 1H74A 4GKJE 4KQVA 2V2ZA 1ELOA 1KIJA 1WHQA 4LF4E 2LUPB 4XTJA 2UXCI 2HFSA 4LFBI 5IT9Q 2UXDE 4GKJI 3LLHA 3PYFA 4DPXA 4FW9A 4LF4I 4JI2E 3WU3A 1ZXMA 1PVGA 3P1XA 2UXDI 4ED4A 3PYDA 4JI2I 1KVKA 4DR3E 4WUCA 4R1FA 2IHR1 4WYQB 4DU7A 4DV5E 2L3JA 4DXLA 1ZM9A 1YZ9A 1XNQE 2WW4A 2UU9E 1J5EE 4DR3I 2V34A 1H72C 2LJHA 2JY9A 3V5RA 4FWGA 2CPNA 1ZM2A 4HY1A 4DV5I 4DV0E 4EMDA 1BKNA 1XNQI 4DR6E 3B8HA 2UU9I 4LF5E 2LTRA 1J5EI 1N0VC 3LPSA 4USKA 4DV0I 2B7TA 1IBME 4JI0E 3ZZUA 4DR6I 3K17A 2EZ6A 3J7Yp 2VF3A 4LF5I 4NXME 4UTGA 4X62E 1FKAE 1ZM4A 1Z0TA 4P52A 4URLA 3C4BA 4MYTA 3J81C 1IBMI 3ZM7A 4JI0I 4USMA 4DV4E 2Q2EB 4JI5E 4LF8E 3T1YI 4DR5E 1KKHA 4DUZE 4NXMI 4DV3E 4X62I 4B3TE 1Z0EA 3ZZ0A 1RC7A 4YHHE 4DV4I 4JI5I 4LF8I 4DR5I 4LF9E 4DUZI 4DPYA 4DV3I 1IBKE 2GS8A 3JAMQ 4B3TI 4MYUA 4M30A 4DR2E 1GQEA 4YHHI 4M2ZA 1WHNA 4LF9I 4JI6I 3WU4A 4Z7CA 3Q1QA 1IBKI 1DARA 4AQYE 1RREA 2HHHE 2NUFA 4HXZA 1XMQE 2DMYA 5BR8E 5A2QC 2MDRA 4DR2I 1X49A 1S4EA 4DR1E 2NUEA 3CWVA 3HULA 1N32E 1NHJA 2ZBKB 4AQYI 2HHHI 1XMQI 5BR8I 2B3TB 2HFUA 2LTSA 4DPTA 3B82A 3PYEA 4DR1I 1IBLE 4LF7E 4OOGC 1N32I 3OTOE 2NA2A 1ZXNA 1N33E 3VYXA 2L2MA 4JI7E 1IBLI 3ADJA 3ADLA 4LF7I 1XMOE 4B3ME 3OTOI 2L2KB 4JV5E 2UUAE 1N33I 3T1HE 1FWKA 1FWLA 2VQFE 1T4OA 4JI7I 2UXBE 3B78A 4X64E 2LUQA 2LBSB 1STUA 4DV1E 1XMOI 4NXNE 4B3MI 3J80C 4JV5I 2UUAI 2ZM6E 2ZITA 3T1HI 3WU5A 1ZM3A 4WUDA 2VQFI 1H7SA 2X36A 2UXBI 4LF6E 1H73A 2LJPA 4X64I 1UILA 1FNMA 1XHKA 4DV1I 4NXNI 4PRVA 4WFTA 3J7AG 4JI1E 2NUGA 1Z5BA 3QT5A 3J7AM 2ZM6I 2BM0A 2N3HA 2F4VE 3C4TA 1VISA 5GMEA 4X66E 1H7UA 2J7KA 4LF6I 2V8PA 1ZBTA 4GKKE 4DPUA 3QT6A 1HR0E 4DPWA 4JI1I 1UEKA 3QT7A 3ZZTA 5CFFE 2F4VI 4ZVIA 4X66I 2V2QA 5LMNE 2R42A 1K47A 4GKKI 1S16A 2RSMA 4LFCE 1N0UA 1HR0I 1MU5A 1T4LB 2DIXA 2XEXA 5LMNI 2UUBE 4K0KE 2E5LE 2LRSA 1QU6A 2DEJA 3J81Q 2RTXA 4LFCI 3ADIA 2AJ4A 4OX9E 1Z0BA 2UUCE 2HKEA 4DR4E 4M1KA 5IT9C 1MX0A 4HYMA 1U2RA 4P7AA 2HKJA 2UUBI 4K0KI 2E5LI 2YT4A 5LMUE 4FN5A 4OX9I 1PIEA 1Z0WA 2UUCI 1N36E 1Z0VA 5LL6R 4DR4I 2N3GA 2L3CA 1XNRE 2OI2A 1KTVA 2V2VA 3H4LA 4FWHA 5LMUI 4DV6E 1YYOA 2RS7A 1N34E 4DUYE 1MG7A 1N36I 5IWAE 1WUUA 1Z5CA 3VYYA 1OJ4A 1XNRI 5A2QQ 1X47A 4DV6I 1UHZA 1N34I 4DUYI 1Z0GA 1Z0CA 3ZKDA 1B62A 2A2CA 5IWAI 1QZRA 4X8WA 2KHXA 2VQEE 4DU8A 4YY3E 3QT8A 3K1JA 4DR7E 1D6TA 1HNXE 5FLXC 2VQEI 1Z5AA 4JI4E 3PYGA 4DKKA 2B7VA 4KHPE 1EI1A 4YY3I 3ZKBA 2R3VA 2HK3A 4DR7I 1HNZE 1HNXI 4UT4A 4FWDA 1J26A 3M6AA 2JVAA 1EA6A 3WU6A 4JI4I 4I3HA 4HACB 4KHPI 4B3RE 4DV7E 1O0WA 3J80Q 2X7IA 2A2DA 1HNZI 4DV2E 1PKPA 4Z7YA 5FLXQ 4RPFA 4PRXA 3HTXA 2RS6A 4JG4A 3T1YE 2HK2A 1DI2A 2CZ9A 1RR9A 4B3RI 4DV7I 3LTOA 1FJGE 2DEIA 3JAMC 4JYAE 1I94E 1NHIA 4DV2I
chains in the Genus database with same CATH superfamily
2Z5CB 4LFAE 1YYKA 2L2NA 2EFGA 1HNWE 1FI4A 1NZ0A 4JI3E 1RQ0A 4JI8E 1B63A 2IESA 4L8NA 1NHHA 5AASA 2BV3A 1EH8A 2MDGA 5KL7A 3D4JA 1BBOA 4PU9A 4U3BA 1FJGI 3MSWA 5A69A 4MU4A 2PO0A 4HACA 2EORA 2RQLA 5L3JA 4X65E 4JYAI 1I94I 3EPKA 3GONA 4LFAI 3V2UC 1HNWI 5GMDA 4JI8I 4JI3I 3EQ1A 2CG9A 1PJTA 1TF3A 4OO1F 1X48A 2J65A 4B3SE 5AC4A 3K85A 2F8BA 5DNXA 2F1DA 2DGCA 2FV4B 3ADGA 1YYWA 4JI6E 1A6FA 1R6LA 3LNUA 4BS9A 1Z59A 4OO1D 2EPRA 1USVA 1Y5YA 4JI5I 3DJWA 4OZEA 1EKZA 4MU0A 4KWYA 4X65I 3P06A 3RMPA 1GTKA 1T4NA 2UXCE 4JYAE 2O1WA 2BM1A 3H1CA 2E1RA 2EPZA 2D9HA 2DB2A 4LFBE 2YWQA 4WUBA 2L92A 2NPFA 2L33A 3F0NA 2YTQA 2Z5CA 3ZKBA 2GO4A 4B3SI 2CGEA 1H74A 4GKJE 4KQVA 3AUZA 5F3WA 2V2ZA 5JEAC 1ELOA 5A6BA 3M7ND 1LLMC 1KIJA 3P3GA 4ZYGA 1WHQA 4LF4E 2PO1A 2LUPB 2I13A 4XTJA 4BHBA 2UXCI 2CSHA 3LMLA 2EMAA 3PS2A 2HFSA 3ECRA 3M85D 4LFBI 5IT9Q 1A1LA 3Q6MA 2EPUA 2V8QB 3KWRA 2UXDE 2RPCA 4FW6A 4LCFA 2ODRD 4AM3A 1UN6B 4GKJI 3LLHA 1R6MA 3PYFA 2EN1A 2EMZA 4DPXA 2MC5A 4FW9A 2HGHA 4LF4I 4JI2E 3WU3A 1A1GA 2K4VA 2YSPA 3GLLA 1ZXMA 2EM6A 2CT1A 2EMIA 4LU9A 1A1IA 1PVGA 3P3EA 4OO1E 3P1XA 1PJSA 4ISAA 4WX9A 2UXDI 4ED4A 2EQ1A 3C6MA 1YFHA 3CDIA 3PYDA 2VESA 3L7ZB 4OO1C 2EL5A 4JI2I 4F6MA 1KVKA 2EM5A 2EN6A 1GZ6A 4DR3E 2PNZB 2EN2A 4WUCA 4F2JC 2PNMA 3TQMA 2IHR1 4R1FA 4WYQB 3VHTB 4DU7A 1QNTA 2EMGA 4DV5E 2L3JA 1AH5A 2Z5EA 2BA0D 2LO3A 1ZM9A 1YZ9A 4GZNC 4MU3A 4DXLA 2A25A 2ELZA 3C6KA 3DD6A 2EN3A 1XNQE 2LT7A 2WW4A 4BMJA 2EPLX 2UU9E 3JTZA 1YH8A 1J5EE 2FTXB 1Y4UA 1MGTA 4R8OA 1H72C 2V34A 4LOMA 2LJHA 4DR3I 2EMXA 2JY9A 3V5RA 1IQSA 4FWGA 2CPNA 5DNYA 1ZM2A 2EMHA 4R2SA 4HY1A 1X6EA 4DV5I 4DV0E 2JOBA 2NABA 2EL6A 4EMDA 2ODRC 2YTEA 1BKNA 1XNQI 4BBYA 4DR6E 3B8HA 2EN8A 1F2IG 2YPNA 2UU9I 2YRKA 2LTRA 1DGCA 4LF5E 1N0VC 1J5EI 3LPSA 4USKA 2BA1D 3L7ZA 4F9CB 2EQ3A 1OYRA 2PNZA 3HPZA 2JR1A 4DV0I 2JEAB 2B7TA 2EN7A 1IBME 4BA1B 4JI0E 1OYPA 3ZZUA 4DR6I 3K17A 2EZ6A 3J7Yp 5DROA 2VF3A 4LF5I 2G7HA 3THNA 2LJUA 2GPIA 4NXME 1RMDA 4UTGA 5T6JA 4X62E 5K36B 1FKAE 1ZM4A 1Z0TA 4P52A 4URLA 3MHHC 3C4BA 3KRNA 2YTGA 2AE8A 5DRPA 3F6HA 1JK2A 3J81C 4MYTA 1IBMI 2ADRA 3ZM7A 4JI0I 4Q35B 4USMA 5AC5A 4DV4E 2Q2EB 4JI5E 4LF8E 3T1YI 4DR5E 1KKHA 4DUZE 2LCEA 4AIDA 2E1MA 1JK1A 4NXMI 2PO1B 3BBGA 4DV3E 4X62I 4WSPA 4N4RB 4B3TE 2JXPA 1Z0EA 4LCHA 3ZZ0A 1RC7A 2JT2A 1UBDC 4YHHE 2JEAA 4DV4I 2R76A 2GO3A 4GQUA 1Z1BA 4BA1A 4LF9E 2O3ZA 2YTNA 4DR5I 4DUZI 4LF8I 4F9BB 4DPYA 2WCC3 3GCMA 4R2QA 2KOUA 4DV3I 1IMUA 2DMIA 1IBKE 2GS8A 2EOYA 1XXEA 3JAMQ 4B3TI 5K36A 4F54A 1E3PA 4MYUA 2EL4A 2EM0A 2NN6B 4M30A 4DR2E 1GQEA 1MEYC 2FGGA 5DRQA 4YHHI 1UDSA 2YU5A 1WHNA 4M2ZA 4NBQA 2JE6B 4LF9I 1AAYA 2JP9A 4WPYA 4JI6I 3WU4A 5A6KA 4Z7CA 1IBKI 1PDAA 4AQYE 1DARA 1RREA 3Q1QA 2HHHE 4RHBB 2NUFA 4BC7A 4F9AB 1BB8A 1XMQE 2K7IA 4HXZA 2YTIA 4HEIA 2DMYA 1P42A 5BR8E 5A2QC 3CDJA 2MDRA 2N8XA 1NHIA 2PNLA 3KZYA 2EE8A 4DR2I 1X49A 1S4EA 4DR1E 2J7JA 4R2AA 2PRTA 1A1HA 2NUEA 3CWVA 2WNRB 5C0XA 3H09A 5TSEA 1N32E 3HULA 1NHJA 2ZBKB 4AQYI 5AE1A 3EPHA 2HHHI 4MLVA 1XMQI 2Q8UA 5A6AA 5BR8I 4BA2B 2B3TB 2WBTA 2HFUA 2CVEA 2R1FA 2LTSA 1ZAAC 3B82A 4DPTA 3K6QA 3PYEA 4DR1I 1IBLE 4BCAA 2NN6A 4LF7E 4IS9A 3U1KA 5A6BD 4J3DA 1Y4SA 4OOGC 2LE2A 5KL6A 1YHCA 2JE6A 1N32I 2M9AA 2WZOA 4WSGA 4TUIA 3OTOE 4P7DA 3M99B 5EKWA 3FIGA 2NA2A 1N33E 1ZXNA 2O1UA 2WBUA 3VYXA 3HKMA 1G2DC 4FW5A 5JEAB 2EOSA 2L2MA 4MQYA 2M1SA 4JI7E 5KL2A 2BBGA 3ADJA 2V89A 5LLQA 3ADLA 1IBLI 4LF7I 1TF6A 2EPPA 4J8ZA 2HJJA 3MHSC 4WXDA 1XMOE 1YPNA 1SFEA 2YTDA 1G2FC 3BGHA 3HPSA 2EWLA 4B3ME 3OTOI 2L2KB 3KZZA 3THOB 4JV5E 2EM9A 2UUAE 2NN6F 2WNRA 2EOJA 4M9VC 1N33I 3T1HE 1VI7A 1FWKA 1X5WA 3GMEA 1FWLA 2VQFE 2C37B 2EPKX 1T4OA 2NN6D 2E72A 4JI7I 2YU8A 2UXBE 3IWCA 3B78A 4X64E 3U1YA 4BA2A 2LUQA 2LBSB 1STUA 4DV1E 2DSYA 1XMOI 4NXNE 4BHCA 3L00A 4B3MI 3QG5C 2ENAA 3BF2A 3J80C 4FW4A 1PJQA 4JV5I 2UUAI 4AIMA 2ZM6E 1T39A 4IZKB 2ZITA 4FW3A 3T1HI 3WU5A 1ZM3A 3JU0A 2WP8B 1H7SA 2C38B 2X36A 4WUDA 2VQFI 2DRPA 2EPAA 2LV2A 4LF6E 4HTGA 2EJ4A 1H73A 2LJPA 4X64I 2UXBI 1NCSA 4TUGA 5JEAA 4OO1B 2EOQA 5AE2A 4R2EA 1UILA 1FNMA 1XHKA 4N3OA 4DV1I 4NXNI 2VE7C 4R2PA 4PRVA 2L8TA 4M0VA 4WFTA 2YTFA 2ENHA 3J7AG 2VF1A 4JI1E 1TN9A 2NUGA 1Z5BA 3PS3A 3QT5A 2I9IA 4IS1C 1SR9A 2BM0A 2ZM6I 3J7AM 2JWOA 2N3HA 3HQ1A 1A1KA 2F4VE 3C4TA 1VISA 1N3GA 4X66E 5GMEA 1H7UA 2J7KA 4LF6I 5FWKA 2C37A 2V8PA 1ZBTA 3ZOQB 1P47A 1UDQA 2EPNA 2YTJA 4GKKE 2EMCA 2EMLA 1IQOA 2EPMX 3B4TA 4FK5C 4DPUA 3QT6A 1HR0E 2NN6E 5ELWA 4DPWA 4JI1I 3PS1A 2EPXA 1ZU1A 1UEKA 3QT7A 3ZZTA 2EQ0A 5CFFE 5KL3A 2EOOA 3IWBA 2F4VI 4ZVIA 4X66I 2V2QA 5LMNE 4IZKA 2NN6C 2YZTA 2WP8A 2R42A 2C38A 5EL9A 4KZSA 1K47A 4GKKI 2JPAA 1X6HA 2RSMA 4LFCE 1A1FA 1N0UA 2EM2A 1S16A 2GQ0A 4R03A 1MU5A 4OO1A 1HR0I 4O4KA 2V87A 5C0XB 2EOZA 1L4SA 2EMWA 3HXLA 1T4LB 3DF6A 2M7QA 2RSIA 2ENCA 2DIXA 1DQ3A 4RH8A 2XEXA 4FW7A 5LMNI 4L5NC 4LPFA 2UUBE 4K0KE 2E5LE 2LRSA 1QU6A 2DEJA 4F6NA 3J81Q 2RTXA 4LFCI 2V88A 5A6JA 4IFDB 3P76A 2V83A 4P78A 3ADIA 2AJ4A 3VK6A 4OX9E 1Z0BA 1ZBQA 1WXRA 2UUCE 2MC6A 4DR4E 2HKEA 4M1KA 5IT9C 1A1JA 1MX0A 4HYMA 1U2RA 4Q28A 3UHMA 2YTPA 4P7AA 1YSAC 2HKJA 2UUBI 2EM4A 4K0KI 3NZKA 2E5LI 2BA1G 1Y6ZA 1USUA 2WBSA 2LVHA 1RHYA 2YT4A 4LCGA 5LMUE 4FN5A 5JEAE 2BR2B 4OX9I 5K36F 1PIEA 1Z0WA 1EH6A 2UUCI 1UDNA 2EP3A 5LL6R 1N36E 2DLKA 1Z0VA 4IZJB 4DR4I 4U3DA 5KL5A 5K36D 2N3GA 4OKGA 4ZYDA 2L3CA 1NEIA 4O43A 1XNRE 2OI2A 1KTVA 2LMZA 2BB8A 2V2VA 2YTOA 1HK7A 3H4LA 4FWHA 5LMUI 4DV6E 1YYOA 4R2DA 2RS7A 1N34E 4IFDA 4DUYE 3EPJA 1MG7A 4QNJA 1N36I 3P3CA 5IWAE 2JEBB 1WUUA 1Z5CA 3VYYA 1OJ4A 3HJCA 1XNRI 2CTDA 5A2QQ 1X47A 2YRHA 4QNKA 5C0XF 1T38A 1WRJA 4DV6I 2Z5BB 1UHZA 2EM8A 1N34I 4DUYI 1Z0GA 2EMKA 1Z0CA 5C0XD 2EOXA 4I8OA 2EOHA 2EPOA 2BR2A 3PRYA 5IV8B 1B62A 2A2CA 3ZKDA 5IWAI 4O24A 2B9DA 2ELYA 2L6MA 4IZJA 1QZRA 4X8WA 4IFDF 2GHFA 1OYSA 1X6FA 2PO2B 2KHXA 2VQEE 5KL4A 5K36E 4IFDD 4DU8A 2IOPA 4MLQA 4YY3E 1KJKA 2YSOA 1Y60A 4LTYA 3QT8A 3K1JA 4DR7E 2IERA 2DLQA 5K36C 1D6TA 1BBGA 2MKDA 5FLXC 1HNXE 2JEBA 3M7NG 4X9JA 2VQEI 1E3HA 1Z5AA 4ZYEA 3BIDA 1YUJA 5ADZA 5DRRA 4R2RA 3AV0A 2C39B 2EM3A 4JI4E 3PYGA 3OMLA 4DKKA 2EPCA 2B7VA 2EMBA 4WXCA 4KHPE 1EI1A 2Z5BA 3M85G 4YY3I 2VRDA 2EM7A 3IWDA 3UK3C 2H36X 1WJPA 2YRMA 4GEQB 2HK3A 2IOQA 1ZR9A 2R3VA 4IZJD 4DR7I 2V86A 1HNZE 4BC9A 5C0XE 1HNXI 2EOMA 4UT4A 4FWDA 1J26A 3M6AA 2JVAA 1EA6A 5IXMB 3WU6A 2PO2A 4JI4I 5DNLA 2PO0B 4IJDA 4I3HA 4HACB 4KHPI 2EMYA 4B3RE 1YUIA 4DV7E 5C0XC 1O0WA 2JYAA 2EOEA 2KONA 4IFDE 3J80Q 2JOXA 2HC5A 2X7IA 2A2DA 4MDTA 1HNZI 4DV2E 1PKPA 4R2CA 5JEAF 4Z7YA 5FLXQ 2MKNA 2EMFA 2V85A 4RPFA 4PRXA 3HTXA 1B69A 2GLIA 2RS6A 4JG4A 2O1VA 2EN4A 3T1YE 2HK2A 1DI2A 2CZ9A 1KYQA 4NZVA 1RR9A 3Q6NA 3F6GA 4DMIA 5JEAD 4IFDC 2M4IA 4NHRA 4B3RI 2EOIA 4ZYHA 3LTOA 4DV7I 1FJGE 2O1TA 2C39A 4MU1A 3EPLA 5AE3A 3JAMC 2DEIA 1UDOA 4O5GA 2EOFA 1I94E 2BA0G 1EH7A 4DV2I 1X3CA
chains in the Genus database with same CATH topology
2Z5CB 4LFAE 1YYKA 2L2NA 2EFGA 1HNWE 1FI4A 1NZ0A 4JI3E 1RQ0A 4JI8E 1B63A 4L8NA 1NHHA 5AASA 2BV3A 4PU9A 3D4JA 1FJGI 3MSWA 4HACA 5L3JA 4X65E 4JYAI 1I94I 3GONA 4LFAI 3V2UC 1HNWI 5GMDA 4JI8I 4JI3I 2CG9A 1X48A 4B3SE 3K85A 2F8BA 1YYWA 2FV4B 3ADGA 3LNUA 4JI6E 1A6FA 4BS9A 1Z59A 1USVA 3DJWA 1EKZA 4X65I 3P06A 3RMPA 1T4NA 2UXCE 2O1WA 2BM1A 2E1RA 2DB2A 4LFBE 4WUBA 2L92A 2NPFA 2L33A 3F0NA 2Z5CA 4B3SI 2CGEA 1H74A 4GKJE 4KQVA 3AUZA 5F3WA 2V2ZA 1ELOA 1KIJA 1WHQA 4LF4E 2LUPB 4XTJA 2UXCI 3LMLA 2HFSA 4LFBI 5IT9Q 3Q6MA 2V8QB 3KWRA 2UXDE 4GKJI 2ODRD 3LLHA 3PYFA 4DPXA 2MC5A 4FW9A 4LF4I 4JI2E 3WU3A 2K4VA 1ZXMA 4LU9A 1PVGA 3P1XA 2UXDI 4ED4A 3PYDA 4JI2I 1KVKA 1GZ6A 4DR3E 4WUCA 2PNMA 4R1FA 2IHR1 4WYQB 4DU7A 4DV5E 2L3JA 2Z5EA 4DXLA 1ZM9A 1YZ9A 1XNQE 2WW4A 4BMJA 2UU9E 3JTZA 1J5EE 2FTXB 1Y4UA 4DR3I 4R8OA 1H72C 2V34A 2LJHA 2JY9A 3V5RA 4FWGA 2CPNA 5DNYA 1ZM2A 4HY1A 4DV5I 4DV0E 2JOBA 4EMDA 2ODRC 1BKNA 1XNQI 4DR6E 4BBYA 3B8HA 2UU9I 4LF5E 2LTRA 1J5EI 1N0VC 3LPSA 4USKA 4F9CB 3HPZA 2JR1A 4DV0I 2B7TA 1IBME 4JI0E 3ZZUA 4DR6I 3K17A 2EZ6A 3J7Yp 2VF3A 4LF5I 2G7HA 4NXME 4UTGA 5T6JA 4X62E 1FKAE 1ZM4A 1Z0TA 4P52A 4URLA 3C4BA 3F6HA 3J81C 4MYTA 1IBMI 3ZM7A 4JI0I 4USMA 4DV4E 2Q2EB 4JI5E 4LF8E 3T1YI 4DR5E 1KKHA 4DUZE 2E1MA 4NXMI 4DV3E 4X62I 4WSPA 4B3TE 1Z0EA 3ZZ0A 1RC7A 4YHHE 4DV4I 4JI5I 4LF8I 4DR5I 4LF9E 4DUZI 4F9BB 4DPYA 2KOUA 4DV3I 1IBKE 2GS8A 3JAMQ 4B3TI 4F54A 4MYUA 4M30A 4DR2E 1GQEA 2FGGA 4YHHI 4M2ZA 1WHNA 4LF9I 4JI6I 4WPYA 3WU4A 4Z7CA 3Q1QA 1IBKI 1DARA 4AQYE 1RREA 2HHHE 2NUFA 4BC7A 4F9AB 4HXZA 1XMQE 2DMYA 5BR8E 5A2QC 2MDRA 2PNLA 4DR2I 1X49A 1S4EA 4DR1E 2NUEA 3CWVA 3H09A 3HULA 1N32E 1NHJA 2ZBKB 4AQYI 5AE1A 2HHHI 1XMQI 5BR8I 2B3TB 2HFUA 2LTSA 4DPTA 3B82A 3K6QA 3PYEA 4DR1I 1IBLE 4BCAA 4LF7E 1Y4SA 4OOGC 2LE2A 1N32I 2WZOA 4TUIA 3OTOE 4P7DA 3FIGA 2NA2A 1N33E 1ZXNA 2O1UA 3VYXA 2L2MA 2M1SA 4JI7E 1IBLI 3ADJA 2V89A 3ADLA 4LF7I 4J8ZA 1XMOE 4B3ME 3HPSA 3OTOI 2EWLA 2L2KB 4JV5E 2UUAE 1N33I 3T1HE 1FWKA 1FWLA 2VQFE 1T4OA 4JI7I 2UXBE 3B78A 3IWCA 4X64E 2LUQA 2LBSB 1STUA 4DV1E 2DSYA 1XMOI 4NXNE 4B3MI 3J80C 4JV5I 2UUAI 2ZM6E 4IZKB 2ZITA 3T1HI 3WU5A 1ZM3A 3JU0A 4WUDA 1H7SA 2X36A 2VQFI 2UXBI 4LF6E 1H73A 2LJPA 4X64I 4TUGA 5AE2A 1UILA 1FNMA 1XHKA 4N3OA 4DV1I 4NXNI 2VE7C 4PRVA 2L8TA 4M0VA 4WFTA 3J7AG 2VF1A 4JI1E 2NUGA 1Z5BA 3QT5A 3J7AM 1SR9A 2BM0A 2ZM6I 2JWOA 2N3HA 3HQ1A 2F4VE 3C4TA 1VISA 5GMEA 4X66E 1H7UA 2J7KA 4LF6I 5FWKA 2V8PA 1ZBTA 3ZOQB 4GKKE 4DPUA 3QT6A 1HR0E 4DPWA 4JI1I 1UEKA 3QT7A 3ZZTA 5CFFE 3IWBA 2F4VI 4ZVIA 4X66I 2V2QA 5LMNE 4IZKA 2YZTA 2R42A 4KZSA 1K47A 4GKKI 1S16A 2RSMA 4LFCE 1N0UA 2GQ0A 4R03A 1MU5A 1HR0I 2V87A 3HXLA 1T4LB 3DF6A 2M7QA 2DIXA 1DQ3A 2XEXA 5LMNI 4L5NC 2UUBE 4K0KE 2E5LE 2LRSA 1QU6A 2DEJA 3J81Q 2RTXA 4LFCI 2V88A 2V83A 4P78A 3ADIA 2AJ4A 3VK6A 4OX9E 1Z0BA 1ZBQA 1WXRA 2UUCE 2MC6A 4DR4E 2HKEA 4M1KA 5IT9C 1MX0A 4HYMA 1U2RA 4Q28A 4P7AA 2HKJA 2UUBI 4K0KI 2E5LI 1Y6ZA 1USUA 2YT4A 5LMUE 4FN5A 4OX9I 1PIEA 1Z0WA 2UUCI 1N36E 5LL6R 1Z0VA 4DR4I 4IZJB 2N3GA 2L3CA 1XNRE 2OI2A 1KTVA 2LMZA 2V2VA 1HK7A 3H4LA 4FWHA 5LMUI 4DV6E 1YYOA 2RS7A 1N34E 4DUYE 1MG7A 1N36I 5IWAE 1WUUA 1Z5CA 3VYYA 1OJ4A 3HJCA 1XNRI 5A2QQ 1X47A 4DV6I 2Z5BB 1UHZA 1N34I 4DUYI 1Z0GA 1Z0CA 4I8OA 3PRYA 3ZKDA 1B62A 2A2CA 5IWAI 2B9DA 2L6MA 4IZJA 1QZRA 4X8WA 2KHXA 2VQEE 4DU8A 2IOPA 4YY3E 4LTYA 3QT8A 3K1JA 4DR7E 1D6TA 5FLXC 1HNXE 2VQEI 1Z5AA 5ADZA 3AV0A 4JI4E 3PYGA 3OMLA 4DKKA 2B7VA 4KHPE 1EI1A 2Z5BA 4YY3I 3IWDA 3ZKBA 2H36X 4GEQB 2HK3A 2R3VA 4IZJD 2IOQA 4DR7I 2V86A 1HNZE 4BC9A 1HNXI 4UT4A 4FWDA 1J26A 3M6AA 2JVAA 1EA6A 3WU6A 4JI4I 4I3HA 4HACB 4KHPI 4B3RE 4DV7E 1O0WA 2KONA 3J80Q 2JOXA 2X7IA 2A2DA 1HNZI 4DV2E 1PKPA 4Z7YA 5FLXQ 2V85A 4RPFA 4PRXA 3HTXA 2RS6A 4JG4A 2O1VA 3T1YE 2HK2A 1DI2A 2CZ9A 1RR9A 3Q6NA 3F6GA 4DMIA 2M4IA 4B3RI 4DV7I 3LTOA 1FJGE 2O1TA 5AE3A 3JAMC 2DEIA 4JYAE 1I94E 1NHIA 4DV2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA E;  1YYK A;  2L2N A;  2EFG A;  1HNW E;  1FI4 A;  1NZ0 A;  4JI3 E;  1RQ0 A;  4JI8 E;  1B63 A;  1NHH A;  2BV3 A;  4PU9 A;  3D4J A;  1FJG I;  4HAC A;  5L3J A;  4X65 E;  4JYA I;  1I94 I;  3GON A;  4LFA I;  3V2U C;  1HNW I;  5GMD A;  4JI8 I;  4JI3 I;  1X48 A;  4B3S E;  1YYW A;  3LNU A;  3ADG A;  4JI6 E;  1A6F A;  1Z59 A;  1EKZ A;  4X65 I;  1T4N A;  2UXC E;  2BM1 A;  2E1R A;  2DB2 A;  4LFB E;  4WUB A;  2NPF A;  2L33 A;  3F0N A;  4B3S I;  1H74 A;  4GKJ E;  4KQV A;  2V2Z A;  1ELO A;  1KIJ A;  1WHQ A;  4LF4 E;  2LUP B;  4XTJ A;  2UXC I;  2HFS A;  4LFB I;  5IT9 Q;  2UXD E;  4GKJ I;  3LLH A;  3PYF A;  4DPX A;  4FW9 A;  4LF4 I;  4JI2 E;  3WU3 A;  1ZXM A;  1PVG A;  3P1X A;  2UXD I;  4ED4 A;  3PYD A;  4JI2 I;  1KVK A;  4DR3 E;  4WUC A;  4R1F A;  2IHR 1;  4WYQ B;  4DU7 A;  4DV5 E;  2L3J A;  4DXL A;  1ZM9 A;  1YZ9 A;  1XNQ E;  2WW4 A;  2UU9 E;  1J5E E;  4DR3 I;  2V34 A;  1H72 C;  2LJH A;  2JY9 A;  3V5R A;  4FWG A;  2CPN A;  1ZM2 A;  4HY1 A;  4DV5 I;  4DV0 E;  4EMD A;  1BKN A;  1XNQ I;  4DR6 E;  3B8H A;  2UU9 I;  4LF5 E;  2LTR A;  1J5E I;  1N0V C;  3LPS A;  4USK A;  4DV0 I;  2B7T A;  1IBM E;  4JI0 E;  3ZZU A;  4DR6 I;  3K17 A;  2EZ6 A;  3J7Y p;  2VF3 A;  4LF5 I;  4NXM E;  4UTG A;  4X62 E;  1FKA E;  1ZM4 A;  1Z0T A;  4P52 A;  4URL A;  3C4B A;  4MYT A;  3J81 C;  1IBM I;  3ZM7 A;  4JI0 I;  4USM A;  4DV4 E;  2Q2E B;  4JI5 E;  4LF8 E;  3T1Y I;  4DR5 E;  1KKH A;  4DUZ E;  4NXM I;  4DV3 E;  4X62 I;  4B3T E;  1Z0E A;  3ZZ0 A;  1RC7 A;  4YHH E;  4DV4 I;  4JI5 I;  4LF8 I;  4DR5 I;  4LF9 E;  4DUZ I;  4DPY A;  4DV3 I;  1IBK E;  2GS8 A;  3JAM Q;  4B3T I;  4MYU A;  4M30 A;  4DR2 E;  1GQE A;  4YHH I;  4M2Z A;  1WHN A;  4LF9 I;  4JI6 I;  3WU4 A;  4Z7C A;  3Q1Q A;  1IBK I;  1DAR A;  4AQY E;  1RRE A;  2HHH E;  2NUF A;  4HXZ A;  1XMQ E;  2DMY A;  5BR8 E;  5A2Q C;  2MDR A;  4DR2 I;  1X49 A;  1S4E A;  4DR1 E;  2NUE A;  3CWV A;  3HUL A;  1N32 E;  1NHJ A;  2ZBK B;  4AQY I;  2HHH I;  1XMQ I;  5BR8 I;  2B3T B;  2HFU A;  2LTS A;  4DPT A;  3B82 A;  3PYE A;  4DR1 I;  1IBL E;  4LF7 E;  4OOG C;  1N32 I;  3OTO E;  2NA2 A;  1ZXN A;  1N33 E;  3VYX A;  2L2M A;  4JI7 E;  1IBL I;  3ADJ A;  3ADL A;  4LF7 I;  1XMO E;  4B3M E;  3OTO I;  2L2K B;  4JV5 E;  2UUA E;  1N33 I;  3T1H E;  1FWK A;  1FWL A;  2VQF E;  1T4O A;  4JI7 I;  2UXB E;  3B78 A;  4X64 E;  2LUQ A;  2LBS B;  1STU A;  4DV1 E;  1XMO I;  4NXN E;  4B3M I;  3J80 C;  4JV5 I;  2UUA I;  2ZM6 E;  2ZIT A;  3T1H I;  3WU5 A;  1ZM3 A;  4WUD A;  2VQF I;  1H7S A;  2X36 A;  2UXB I;  4LF6 E;  1H73 A;  2LJP A;  4X64 I;  1UIL A;  1FNM A;  1XHK A;  4DV1 I;  4NXN I;  4PRV A;  4WFT A;  3J7A G;  4JI1 E;  2NUG A;  1Z5B A;  3QT5 A;  3J7A M;  2ZM6 I;  2BM0 A;  2N3H A;  2F4V E;  3C4T A;  1VIS A;  5GME A;  4X66 E;  1H7U A;  2J7K A;  4LF6 I;  2V8P A;  1ZBT A;  4GKK E;  4DPU A;  3QT6 A;  1HR0 E;  4DPW A;  4JI1 I;  1UEK A;  3QT7 A;  3ZZT A;  5CFF E;  2F4V I;  4ZVI A;  4X66 I;  2V2Q A;  5LMN E;  2R42 A;  1K47 A;  4GKK I;  1S16 A;  2RSM A;  4LFC E;  1N0U A;  1HR0 I;  1MU5 A;  1T4L B;  2DIX A;  2XEX A;  5LMN I;  2UUB E;  4K0K E;  2E5L E;  2LRS A;  1QU6 A;  2DEJ A;  3J81 Q;  2RTX A;  4LFC I;  3ADI A;  2AJ4 A;  4OX9 E;  1Z0B A;  2UUC E;  2HKE A;  4DR4 E;  4M1K A;  5IT9 C;  1MX0 A;  4HYM A;  1U2R A;  4P7A A;  2HKJ A;  2UUB I;  4K0K I;  2E5L I;  2YT4 A;  5LMU E;  4FN5 A;  4OX9 I;  1PIE A;  1Z0W A;  2UUC I;  1N36 E;  1Z0V A;  5LL6 R;  4DR4 I;  2N3G A;  2L3C A;  1XNR E;  2OI2 A;  1KTV A;  2V2V A;  3H4L A;  4FWH A;  5LMU I;  4DV6 E;  1YYO A;  2RS7 A;  1N34 E;  4DUY E;  1MG7 A;  1N36 I;  5IWA E;  1WUU A;  1Z5C A;  3VYY A;  1OJ4 A;  1XNR I;  5A2Q Q;  1X47 A;  4DV6 I;  1UHZ A;  1N34 I;  4DUY I;  1Z0G A;  1Z0C A;  3ZKD A;  1B62 A;  2A2C A;  5IWA I;  1QZR A;  4X8W A;  2KHX A;  2VQE E;  4DU8 A;  4YY3 E;  3QT8 A;  3K1J A;  4DR7 E;  1D6T A;  1HNX E;  5FLX C;  2VQE I;  1Z5A A;  4JI4 E;  3PYG A;  4DKK A;  2B7V A;  4KHP E;  1EI1 A;  4YY3 I;  3ZKB A;  2R3V A;  2HK3 A;  4DR7 I;  1HNZ E;  1HNX I;  4UT4 A;  4FWD A;  1J26 A;  3M6A A;  2JVA A;  1EA6 A;  3WU6 A;  4JI4 I;  4I3H A;  4HAC B;  4KHP I;  4B3R E;  4DV7 E;  1O0W A;  3J80 Q;  2X7I A;  2A2D A;  1HNZ I;  4DV2 E;  1PKP A;  4Z7Y A;  5FLX Q;  4RPF A;  4PRX A;  3HTX A;  2RS6 A;  4JG4 A;  3T1Y E;  2HK2 A;  1DI2 A;  2CZ9 A;  1RR9 A;  4B3R I;  4DV7 I;  3LTO A;  1FJG E;  2DEI A;  3JAM C;  4JYA E;  1I94 E;  1NHI A;  4DV2 I; 
#chains in the Genus database with same CATH topology
 2Z5C B;  4LFA E;  1YYK A;  2L2N A;  2EFG A;  1HNW E;  1FI4 A;  1NZ0 A;  4JI3 E;  1RQ0 A;  4JI8 E;  1B63 A;  2IES A;  4L8N A;  1NHH A;  5AAS A;  2BV3 A;  1EH8 A;  2MDG A;  5KL7 A;  3D4J A;  1BBO A;  4PU9 A;  4U3B A;  1FJG I;  3MSW A;  5A69 A;  4MU4 A;  2PO0 A;  4HAC A;  2EOR A;  2RQL A;  5L3J A;  4X65 E;  4JYA I;  1I94 I;  3EPK A;  3GON A;  4LFA I;  3V2U C;  1HNW I;  5GMD A;  4JI8 I;  4JI3 I;  3EQ1 A;  2CG9 A;  1PJT A;  1TF3 A;  4OO1 F;  1X48 A;  2J65 A;  4B3S E;  5AC4 A;  3K85 A;  2F8B A;  5DNX A;  2F1D A;  2DGC A;  2FV4 B;  3ADG A;  1YYW A;  4JI6 E;  1A6F A;  1R6L A;  3LNU A;  4BS9 A;  1Z59 A;  4OO1 D;  2EPR A;  1USV A;  1Y5Y A;  4JI5 I;  3DJW A;  4OZE A;  1EKZ A;  4MU0 A;  4KWY A;  4X65 I;  3P06 A;  3RMP A;  1GTK A;  1T4N A;  2UXC E;  4JYA E;  2O1W A;  2BM1 A;  3H1C A;  2E1R A;  2EPZ A;  2D9H A;  2DB2 A;  4LFB E;  2YWQ A;  4WUB A;  2L92 A;  2NPF A;  2L33 A;  3F0N A;  2YTQ A;  2Z5C A;  3ZKB A;  2GO4 A;  4B3S I;  2CGE A;  1H74 A;  4GKJ E;  4KQV A;  3AUZ A;  5F3W A;  2V2Z A;  5JEA C;  1ELO A;  5A6B A;  3M7N D;  1LLM C;  1KIJ A;  3P3G A;  4ZYG A;  1WHQ A;  4LF4 E;  2PO1 A;  2LUP B;  2I13 A;  4XTJ A;  4BHB A;  2UXC I;  2CSH A;  3LML A;  2EMA A;  3PS2 A;  2HFS A;  3ECR A;  3M85 D;  4LFB I;  5IT9 Q;  1A1L A;  3Q6M A;  2EPU A;  2V8Q B;  3KWR A;  2UXD E;  2RPC A;  4FW6 A;  4LCF A;  2ODR D;  4AM3 A;  1UN6 B;  4GKJ I;  3LLH A;  1R6M A;  3PYF A;  2EN1 A;  2EMZ A;  4DPX A;  2MC5 A;  4FW9 A;  2HGH A;  4LF4 I;  4JI2 E;  3WU3 A;  1A1G A;  2K4V A;  2YSP A;  3GLL A;  1ZXM A;  2EM6 A;  2CT1 A;  2EMI A;  4LU9 A;  1A1I A;  1PVG A;  3P3E A;  4OO1 E;  3P1X A;  1PJS A;  4ISA A;  4WX9 A;  2UXD I;  4ED4 A;  2EQ1 A;  3C6M A;  1YFH A;  3CDI A;  3PYD A;  2VES A;  3L7Z B;  4OO1 C;  2EL5 A;  4JI2 I;  4F6M A;  1KVK A;  2EM5 A;  2EN6 A;  1GZ6 A;  4DR3 E;  2PNZ B;  2EN2 A;  4WUC A;  4F2J C;  2PNM A;  3TQM A;  2IHR 1;  4R1F A;  4WYQ B;  3VHT B;  4DU7 A;  1QNT A;  2EMG A;  4DV5 E;  2L3J A;  1AH5 A;  2Z5E A;  2BA0 D;  2LO3 A;  1ZM9 A;  1YZ9 A;  4GZN C;  4MU3 A;  4DXL A;  2A25 A;  2ELZ A;  3C6K A;  3DD6 A;  2EN3 A;  1XNQ E;  2LT7 A;  2WW4 A;  4BMJ A;  2EPL X;  2UU9 E;  3JTZ A;  1YH8 A;  1J5E E;  2FTX B;  1Y4U A;  1MGT A;  4R8O A;  1H72 C;  2V34 A;  4LOM A;  2LJH A;  4DR3 I;  2EMX A;  2JY9 A;  3V5R A;  1IQS A;  4FWG A;  2CPN A;  5DNY A;  1ZM2 A;  2EMH A;  4R2S A;  4HY1 A;  1X6E A;  4DV5 I;  4DV0 E;  2JOB A;  2NAB A;  2EL6 A;  4EMD A;  2ODR C;  2YTE A;  1BKN A;  1XNQ I;  4BBY A;  4DR6 E;  3B8H A;  2EN8 A;  1F2I G;  2YPN A;  2UU9 I;  2YRK A;  2LTR A;  1DGC A;  4LF5 E;  1N0V C;  1J5E I;  3LPS A;  4USK A;  2BA1 D;  3L7Z A;  4F9C B;  2EQ3 A;  1OYR A;  2PNZ A;  3HPZ A;  2JR1 A;  4DV0 I;  2JEA B;  2B7T A;  2EN7 A;  1IBM E;  4BA1 B;  4JI0 E;  1OYP A;  3ZZU A;  4DR6 I;  3K17 A;  2EZ6 A;  3J7Y p;  5DRO A;  2VF3 A;  4LF5 I;  2G7H A;  3THN A;  2LJU A;  2GPI A;  4NXM E;  1RMD A;  4UTG A;  5T6J A;  4X62 E;  5K36 B;  1FKA E;  1ZM4 A;  1Z0T A;  4P52 A;  4URL A;  3MHH C;  3C4B A;  3KRN A;  2YTG A;  2AE8 A;  5DRP A;  3F6H A;  1JK2 A;  3J81 C;  4MYT A;  1IBM I;  2ADR A;  3ZM7 A;  4JI0 I;  4Q35 B;  4USM A;  5AC5 A;  4DV4 E;  2Q2E B;  4JI5 E;  4LF8 E;  3T1Y I;  4DR5 E;  1KKH A;  4DUZ E;  2LCE A;  4AID A;  2E1M A;  1JK1 A;  4NXM I;  2PO1 B;  3BBG A;  4DV3 E;  4X62 I;  4WSP A;  4N4R B;  4B3T E;  2JXP A;  1Z0E A;  4LCH A;  3ZZ0 A;  1RC7 A;  2JT2 A;  1UBD C;  4YHH E;  2JEA A;  4DV4 I;  2R76 A;  2GO3 A;  4GQU A;  1Z1B A;  4BA1 A;  4LF9 E;  2O3Z A;  2YTN A;  4DR5 I;  4DUZ I;  4LF8 I;  4F9B B;  4DPY A;  2WCC 3;  3GCM A;  4R2Q A;  2KOU A;  4DV3 I;  1IMU A;  2DMI A;  1IBK E;  2GS8 A;  2EOY A;  1XXE A;  3JAM Q;  4B3T I;  5K36 A;  4F54 A;  1E3P A;  4MYU A;  2EL4 A;  2EM0 A;  2NN6 B;  4M30 A;  4DR2 E;  1GQE A;  1MEY C;  2FGG A;  5DRQ A;  4YHH I;  1UDS A;  2YU5 A;  1WHN A;  4M2Z A;  4NBQ A;  2JE6 B;  4LF9 I;  1AAY A;  2JP9 A;  4WPY A;  4JI6 I;  3WU4 A;  5A6K A;  4Z7C A;  1IBK I;  1PDA A;  4AQY E;  1DAR A;  1RRE A;  3Q1Q A;  2HHH E;  4RHB B;  2NUF A;  4BC7 A;  4F9A B;  1BB8 A;  1XMQ E;  2K7I A;  4HXZ A;  2YTI A;  4HEI A;  2DMY A;  1P42 A;  5BR8 E;  5A2Q C;  3CDJ A;  2MDR A;  2N8X A;  1NHI A;  2PNL A;  3KZY A;  2EE8 A;  4DR2 I;  1X49 A;  1S4E A;  4DR1 E;  2J7J A;  4R2A A;  2PRT A;  1A1H A;  2NUE A;  3CWV A;  2WNR B;  5C0X A;  3H09 A;  5TSE A;  1N32 E;  3HUL A;  1NHJ A;  2ZBK B;  4AQY I;  5AE1 A;  3EPH A;  2HHH I;  4MLV A;  1XMQ I;  2Q8U A;  5A6A A;  5BR8 I;  4BA2 B;  2B3T B;  2WBT A;  2HFU A;  2CVE A;  2R1F A;  2LTS A;  1ZAA C;  3B82 A;  4DPT A;  3K6Q A;  3PYE A;  4DR1 I;  1IBL E;  4BCA A;  2NN6 A;  4LF7 E;  4IS9 A;  3U1K A;  5A6B D;  4J3D A;  1Y4S A;  4OOG C;  2LE2 A;  5KL6 A;  1YHC A;  2JE6 A;  1N32 I;  2M9A A;  2WZO A;  4WSG A;  4TUI A;  3OTO E;  4P7D A;  3M99 B;  5EKW A;  3FIG A;  2NA2 A;  1N33 E;  1ZXN A;  2O1U A;  2WBU A;  3VYX A;  3HKM A;  1G2D C;  4FW5 A;  5JEA B;  2EOS A;  2L2M A;  4MQY A;  2M1S A;  4JI7 E;  5KL2 A;  2BBG A;  3ADJ A;  2V89 A;  5LLQ A;  3ADL A;  1IBL I;  4LF7 I;  1TF6 A;  2EPP A;  4J8Z A;  2HJJ A;  3MHS C;  4WXD A;  1XMO E;  1YPN A;  1SFE A;  2YTD A;  1G2F C;  3BGH A;  3HPS A;  2EWL A;  4B3M E;  3OTO I;  2L2K B;  3KZZ A;  3THO B;  4JV5 E;  2EM9 A;  2UUA E;  2NN6 F;  2WNR A;  2EOJ A;  4M9V C;  1N33 I;  3T1H E;  1VI7 A;  1FWK A;  1X5W A;  3GME A;  1FWL A;  2VQF E;  2C37 B;  2EPK X;  1T4O A;  2NN6 D;  2E72 A;  4JI7 I;  2YU8 A;  2UXB E;  3IWC A;  3B78 A;  4X64 E;  3U1Y A;  4BA2 A;  2LUQ A;  2LBS B;  1STU A;  4DV1 E;  2DSY A;  1XMO I;  4NXN E;  4BHC A;  3L00 A;  4B3M I;  3QG5 C;  2ENA A;  3BF2 A;  3J80 C;  4FW4 A;  1PJQ A;  4JV5 I;  2UUA I;  4AIM A;  2ZM6 E;  1T39 A;  4IZK B;  2ZIT A;  4FW3 A;  3T1H I;  3WU5 A;  1ZM3 A;  3JU0 A;  2WP8 B;  1H7S A;  2C38 B;  2X36 A;  4WUD A;  2VQF I;  2DRP A;  2EPA A;  2LV2 A;  4LF6 E;  4HTG A;  2EJ4 A;  1H73 A;  2LJP A;  4X64 I;  2UXB I;  1NCS A;  4TUG A;  5JEA A;  4OO1 B;  2EOQ A;  5AE2 A;  4R2E A;  1UIL A;  1FNM A;  1XHK A;  4N3O A;  4DV1 I;  4NXN I;  2VE7 C;  4R2P A;  4PRV A;  2L8T A;  4M0V A;  4WFT A;  2YTF A;  2ENH A;  3J7A G;  2VF1 A;  4JI1 E;  1TN9 A;  2NUG A;  1Z5B A;  3PS3 A;  3QT5 A;  2I9I A;  4IS1 C;  1SR9 A;  2BM0 A;  2ZM6 I;  3J7A M;  2JWO A;  2N3H A;  3HQ1 A;  1A1K A;  2F4V E;  3C4T A;  1VIS A;  1N3G A;  4X66 E;  5GME A;  1H7U A;  2J7K A;  4LF6 I;  5FWK A;  2C37 A;  2V8P A;  1ZBT A;  3ZOQ B;  1P47 A;  1UDQ A;  2EPN A;  2YTJ A;  4GKK E;  2EMC A;  2EML A;  1IQO A;  2EPM X;  3B4T A;  4FK5 C;  4DPU A;  3QT6 A;  1HR0 E;  2NN6 E;  5ELW A;  4DPW A;  4JI1 I;  3PS1 A;  2EPX A;  1ZU1 A;  1UEK A;  3QT7 A;  3ZZT A;  2EQ0 A;  5CFF E;  5KL3 A;  2EOO A;  3IWB A;  2F4V I;  4ZVI A;  4X66 I;  2V2Q A;  5LMN E;  4IZK A;  2NN6 C;  2YZT A;  2WP8 A;  2R42 A;  2C38 A;  5EL9 A;  4KZS A;  1K47 A;  4GKK I;  2JPA A;  1X6H A;  2RSM A;  4LFC E;  1A1F A;  1N0U A;  2EM2 A;  1S16 A;  2GQ0 A;  4R03 A;  1MU5 A;  4OO1 A;  1HR0 I;  4O4K A;  2V87 A;  5C0X B;  2EOZ A;  1L4S A;  2EMW A;  3HXL A;  1T4L B;  3DF6 A;  2M7Q A;  2RSI A;  2ENC A;  2DIX A;  1DQ3 A;  4RH8 A;  2XEX A;  4FW7 A;  5LMN I;  4L5N C;  4LPF A;  2UUB E;  4K0K E;  2E5L E;  2LRS A;  1QU6 A;  2DEJ A;  4F6N A;  3J81 Q;  2RTX A;  4LFC I;  2V88 A;  5A6J A;  4IFD B;  3P76 A;  2V83 A;  4P78 A;  3ADI A;  2AJ4 A;  3VK6 A;  4OX9 E;  1Z0B A;  1ZBQ A;  1WXR A;  2UUC E;  2MC6 A;  4DR4 E;  2HKE A;  4M1K A;  5IT9 C;  1A1J A;  1MX0 A;  4HYM A;  1U2R A;  4Q28 A;  3UHM A;  2YTP A;  4P7A A;  1YSA C;  2HKJ A;  2UUB I;  2EM4 A;  4K0K I;  3NZK A;  2E5L I;  2BA1 G;  1Y6Z A;  1USU A;  2WBS A;  2LVH A;  1RHY A;  2YT4 A;  4LCG A;  5LMU E;  4FN5 A;  5JEA E;  2BR2 B;  4OX9 I;  5K36 F;  1PIE A;  1Z0W A;  1EH6 A;  2UUC I;  1UDN A;  2EP3 A;  5LL6 R;  1N36 E;  2DLK A;  1Z0V A;  4IZJ B;  4DR4 I;  4U3D A;  5KL5 A;  5K36 D;  2N3G A;  4OKG A;  4ZYD A;  2L3C A;  1NEI A;  4O43 A;  1XNR E;  2OI2 A;  1KTV A;  2LMZ A;  2BB8 A;  2V2V A;  2YTO A;  1HK7 A;  3H4L A;  4FWH A;  5LMU I;  4DV6 E;  1YYO A;  4R2D A;  2RS7 A;  1N34 E;  4IFD A;  4DUY E;  3EPJ A;  1MG7 A;  4QNJ A;  1N36 I;  3P3C A;  5IWA E;  2JEB B;  1WUU A;  1Z5C A;  3VYY A;  1OJ4 A;  3HJC A;  1XNR I;  2CTD A;  5A2Q Q;  1X47 A;  2YRH A;  4QNK A;  5C0X F;  1T38 A;  1WRJ A;  4DV6 I;  2Z5B B;  1UHZ A;  2EM8 A;  1N34 I;  4DUY I;  1Z0G A;  2EMK A;  1Z0C A;  5C0X D;  2EOX A;  4I8O A;  2EOH A;  2EPO A;  2BR2 A;  3PRY A;  5IV8 B;  1B62 A;  2A2C A;  3ZKD A;  5IWA I;  4O24 A;  2B9D A;  2ELY A;  2L6M A;  4IZJ A;  1QZR A;  4X8W A;  4IFD F;  2GHF A;  1OYS A;  1X6F A;  2PO2 B;  2KHX A;  2VQE E;  5KL4 A;  5K36 E;  4IFD D;  4DU8 A;  2IOP A;  4MLQ A;  4YY3 E;  1KJK A;  2YSO A;  1Y60 A;  4LTY A;  3QT8 A;  3K1J A;  4DR7 E;  2IER A;  2DLQ A;  5K36 C;  1D6T A;  1BBG A;  2MKD A;  5FLX C;  1HNX E;  2JEB A;  3M7N G;  4X9J A;  2VQE I;  1E3H A;  1Z5A A;  4ZYE A;  3BID A;  1YUJ A;  5ADZ A;  5DRR A;  4R2R A;  3AV0 A;  2C39 B;  2EM3 A;  4JI4 E;  3PYG A;  3OML A;  4DKK A;  2EPC A;  2B7V A;  2EMB A;  4WXC A;  4KHP E;  1EI1 A;  2Z5B A;  3M85 G;  4YY3 I;  2VRD A;  2EM7 A;  3IWD A;  3UK3 C;  2H36 X;  1WJP A;  2YRM A;  4GEQ B;  2HK3 A;  2IOQ A;  1ZR9 A;  2R3V A;  4IZJ D;  4DR7 I;  2V86 A;  1HNZ E;  4BC9 A;  5C0X E;  1HNX I;  2EOM A;  4UT4 A;  4FWD A;  1J26 A;  3M6A A;  2JVA A;  1EA6 A;  5IXM B;  3WU6 A;  2PO2 A;  4JI4 I;  5DNL A;  2PO0 B;  4IJD A;  4I3H A;  4HAC B;  4KHP I;  2EMY A;  4B3R E;  1YUI A;  4DV7 E;  5C0X C;  1O0W A;  2JYA A;  2EOE A;  2KON A;  4IFD E;  3J80 Q;  2JOX A;  2HC5 A;  2X7I A;  2A2D A;  4MDT A;  1HNZ I;  4DV2 E;  1PKP A;  4R2C A;  5JEA F;  4Z7Y A;  5FLX Q;  2MKN A;  2EMF A;  2V85 A;  4RPF A;  4PRX A;  3HTX A;  1B69 A;  2GLI A;  2RS6 A;  4JG4 A;  2O1V A;  2EN4 A;  3T1Y E;  2HK2 A;  1DI2 A;  2CZ9 A;  1KYQ A;  4NZV A;  1RR9 A;  3Q6N A;  3F6G A;  4DMI A;  5JEA D;  4IFD C;  2M4I A;  4NHR A;  4B3R I;  2EOI A;  4ZYH A;  3LTO A;  4DV7 I;  1FJG E;  2O1T A;  2C39 A;  4MU1 A;  3EPL A;  5AE3 A;  3JAM C;  2DEI A;  1UDO A;  4O5G A;  2EOF A;  1I94 E;  2BA0 G;  1EH7 A;  4DV2 I;  1X3C A; 
#chains in the Genus database with same CATH homology
 2Z5C B;  4LFA E;  1YYK A;  2L2N A;  2EFG A;  1HNW E;  1FI4 A;  1NZ0 A;  4JI3 E;  1RQ0 A;  4JI8 E;  1B63 A;  4L8N A;  1NHH A;  5AAS A;  2BV3 A;  4PU9 A;  3D4J A;  1FJG I;  3MSW A;  4HAC A;  5L3J A;  4X65 E;  4JYA I;  1I94 I;  3GON A;  4LFA I;  3V2U C;  1HNW I;  5GMD A;  4JI8 I;  4JI3 I;  2CG9 A;  1X48 A;  4B3S E;  3K85 A;  2F8B A;  1YYW A;  2FV4 B;  3ADG A;  3LNU A;  4JI6 E;  1A6F A;  4BS9 A;  1Z59 A;  1USV A;  3DJW A;  1EKZ A;  4X65 I;  3P06 A;  3RMP A;  1T4N A;  2UXC E;  2O1W A;  2BM1 A;  2E1R A;  2DB2 A;  4LFB E;  4WUB A;  2L92 A;  2NPF A;  2L33 A;  3F0N A;  2Z5C A;  4B3S I;  2CGE A;  1H74 A;  4GKJ E;  4KQV A;  3AUZ A;  5F3W A;  2V2Z A;  1ELO A;  1KIJ A;  1WHQ A;  4LF4 E;  2LUP B;  4XTJ A;  2UXC I;  3LML A;  2HFS A;  4LFB I;  5IT9 Q;  3Q6M A;  2V8Q B;  3KWR A;  2UXD E;  4GKJ I;  2ODR D;  3LLH A;  3PYF A;  4DPX A;  2MC5 A;  4FW9 A;  4LF4 I;  4JI2 E;  3WU3 A;  2K4V A;  1ZXM A;  4LU9 A;  1PVG A;  3P1X A;  2UXD I;  4ED4 A;  3PYD A;  4JI2 I;  1KVK A;  1GZ6 A;  4DR3 E;  4WUC A;  2PNM A;  4R1F A;  2IHR 1;  4WYQ B;  4DU7 A;  4DV5 E;  2L3J A;  2Z5E A;  4DXL A;  1ZM9 A;  1YZ9 A;  1XNQ E;  2WW4 A;  4BMJ A;  2UU9 E;  3JTZ A;  1J5E E;  2FTX B;  1Y4U A;  4DR3 I;  4R8O A;  1H72 C;  2V34 A;  2LJH A;  2JY9 A;  3V5R A;  4FWG A;  2CPN A;  5DNY A;  1ZM2 A;  4HY1 A;  4DV5 I;  4DV0 E;  2JOB A;  4EMD A;  2ODR C;  1BKN A;  1XNQ I;  4DR6 E;  4BBY A;  3B8H A;  2UU9 I;  4LF5 E;  2LTR A;  1J5E I;  1N0V C;  3LPS A;  4USK A;  4F9C B;  3HPZ A;  2JR1 A;  4DV0 I;  2B7T A;  1IBM E;  4JI0 E;  3ZZU A;  4DR6 I;  3K17 A;  2EZ6 A;  3J7Y p;  2VF3 A;  4LF5 I;  2G7H A;  4NXM E;  4UTG A;  5T6J A;  4X62 E;  1FKA E;  1ZM4 A;  1Z0T A;  4P52 A;  4URL A;  3C4B A;  3F6H A;  3J81 C;  4MYT A;  1IBM I;  3ZM7 A;  4JI0 I;  4USM A;  4DV4 E;  2Q2E B;  4JI5 E;  4LF8 E;  3T1Y I;  4DR5 E;  1KKH A;  4DUZ E;  2E1M A;  4NXM I;  4DV3 E;  4X62 I;  4WSP A;  4B3T E;  1Z0E A;  3ZZ0 A;  1RC7 A;  4YHH E;  4DV4 I;  4JI5 I;  4LF8 I;  4DR5 I;  4LF9 E;  4DUZ I;  4F9B B;  4DPY A;  2KOU A;  4DV3 I;  1IBK E;  2GS8 A;  3JAM Q;  4B3T I;  4F54 A;  4MYU A;  4M30 A;  4DR2 E;  1GQE A;  2FGG A;  4YHH I;  4M2Z A;  1WHN A;  4LF9 I;  4JI6 I;  4WPY A;  3WU4 A;  4Z7C A;  3Q1Q A;  1IBK I;  1DAR A;  4AQY E;  1RRE A;  2HHH E;  2NUF A;  4BC7 A;  4F9A B;  4HXZ A;  1XMQ E;  2DMY A;  5BR8 E;  5A2Q C;  2MDR A;  2PNL A;  4DR2 I;  1X49 A;  1S4E A;  4DR1 E;  2NUE A;  3CWV A;  3H09 A;  3HUL A;  1N32 E;  1NHJ A;  2ZBK B;  4AQY I;  5AE1 A;  2HHH I;  1XMQ I;  5BR8 I;  2B3T B;  2HFU A;  2LTS A;  4DPT A;  3B82 A;  3K6Q A;  3PYE A;  4DR1 I;  1IBL E;  4BCA A;  4LF7 E;  1Y4S A;  4OOG C;  2LE2 A;  1N32 I;  2WZO A;  4TUI A;  3OTO E;  4P7D A;  3FIG A;  2NA2 A;  1N33 E;  1ZXN A;  2O1U A;  3VYX A;  2L2M A;  2M1S A;  4JI7 E;  1IBL I;  3ADJ A;  2V89 A;  3ADL A;  4LF7 I;  4J8Z A;  1XMO E;  4B3M E;  3HPS A;  3OTO I;  2EWL A;  2L2K B;  4JV5 E;  2UUA E;  1N33 I;  3T1H E;  1FWK A;  1FWL A;  2VQF E;  1T4O A;  4JI7 I;  2UXB E;  3B78 A;  3IWC A;  4X64 E;  2LUQ A;  2LBS B;  1STU A;  4DV1 E;  2DSY A;  1XMO I;  4NXN E;  4B3M I;  3J80 C;  4JV5 I;  2UUA I;  2ZM6 E;  4IZK B;  2ZIT A;  3T1H I;  3WU5 A;  1ZM3 A;  3JU0 A;  4WUD A;  1H7S A;  2X36 A;  2VQF I;  2UXB I;  4LF6 E;  1H73 A;  2LJP A;  4X64 I;  4TUG A;  5AE2 A;  1UIL A;  1FNM A;  1XHK A;  4N3O A;  4DV1 I;  4NXN I;  2VE7 C;  4PRV A;  2L8T A;  4M0V A;  4WFT A;  3J7A G;  2VF1 A;  4JI1 E;  2NUG A;  1Z5B A;  3QT5 A;  3J7A M;  1SR9 A;  2BM0 A;  2ZM6 I;  2JWO A;  2N3H A;  3HQ1 A;  2F4V E;  3C4T A;  1VIS A;  5GME A;  4X66 E;  1H7U A;  2J7K A;  4LF6 I;  5FWK A;  2V8P A;  1ZBT A;  3ZOQ B;  4GKK E;  4DPU A;  3QT6 A;  1HR0 E;  4DPW A;  4JI1 I;  1UEK A;  3QT7 A;  3ZZT A;  5CFF E;  3IWB A;  2F4V I;  4ZVI A;  4X66 I;  2V2Q A;  5LMN E;  4IZK A;  2YZT A;  2R42 A;  4KZS A;  1K47 A;  4GKK I;  1S16 A;  2RSM A;  4LFC E;  1N0U A;  2GQ0 A;  4R03 A;  1MU5 A;  1HR0 I;  2V87 A;  3HXL A;  1T4L B;  3DF6 A;  2M7Q A;  2DIX A;  1DQ3 A;  2XEX A;  5LMN I;  4L5N C;  2UUB E;  4K0K E;  2E5L E;  2LRS A;  1QU6 A;  2DEJ A;  3J81 Q;  2RTX A;  4LFC I;  2V88 A;  2V83 A;  4P78 A;  3ADI A;  2AJ4 A;  3VK6 A;  4OX9 E;  1Z0B A;  1ZBQ A;  1WXR A;  2UUC E;  2MC6 A;  4DR4 E;  2HKE A;  4M1K A;  5IT9 C;  1MX0 A;  4HYM A;  1U2R A;  4Q28 A;  4P7A A;  2HKJ A;  2UUB I;  4K0K I;  2E5L I;  1Y6Z A;  1USU A;  2YT4 A;  5LMU E;  4FN5 A;  4OX9 I;  1PIE A;  1Z0W A;  2UUC I;  1N36 E;  5LL6 R;  1Z0V A;  4DR4 I;  4IZJ B;  2N3G A;  2L3C A;  1XNR E;  2OI2 A;  1KTV A;  2LMZ A;  2V2V A;  1HK7 A;  3H4L A;  4FWH A;  5LMU I;  4DV6 E;  1YYO A;  2RS7 A;  1N34 E;  4DUY E;  1MG7 A;  1N36 I;  5IWA E;  1WUU A;  1Z5C A;  3VYY A;  1OJ4 A;  3HJC A;  1XNR I;  5A2Q Q;  1X47 A;  4DV6 I;  2Z5B B;  1UHZ A;  1N34 I;  4DUY I;  1Z0G A;  1Z0C A;  4I8O A;  3PRY A;  3ZKD A;  1B62 A;  2A2C A;  5IWA I;  2B9D A;  2L6M A;  4IZJ A;  1QZR A;  4X8W A;  2KHX A;  2VQE E;  4DU8 A;  2IOP A;  4YY3 E;  4LTY A;  3QT8 A;  3K1J A;  4DR7 E;  1D6T A;  5FLX C;  1HNX E;  2VQE I;  1Z5A A;  5ADZ A;  3AV0 A;  4JI4 E;  3PYG A;  3OML A;  4DKK A;  2B7V A;  4KHP E;  1EI1 A;  2Z5B A;  4YY3 I;  3IWD A;  3ZKB A;  2H36 X;  4GEQ B;  2HK3 A;  2R3V A;  4IZJ D;  2IOQ A;  4DR7 I;  2V86 A;  1HNZ E;  4BC9 A;  1HNX I;  4UT4 A;  4FWD A;  1J26 A;  3M6A A;  2JVA A;  1EA6 A;  3WU6 A;  4JI4 I;  4I3H A;  4HAC B;  4KHP I;  4B3R E;  4DV7 E;  1O0W A;  2KON A;  3J80 Q;  2JOX A;  2X7I A;  2A2D A;  1HNZ I;  4DV2 E;  1PKP A;  4Z7Y A;  5FLX Q;  2V85 A;  4RPF A;  4PRX A;  3HTX A;  2RS6 A;  4JG4 A;  2O1V A;  3T1Y E;  2HK2 A;  1DI2 A;  2CZ9 A;  1RR9 A;  3Q6N A;  3F6G A;  4DMI A;  2M4I A;  4B3R I;  4DV7 I;  3LTO A;  1FJG E;  2O1T A;  5AE3 A;  3JAM C;  2DEI A;  4JYA E;  1I94 E;  1NHI A;  4DV2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...