1XMOE

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xmoE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmoE02
2NUGA 4LF8E 4B3TI 1BKNA 4HYMA 1H7UA 2NA2A 1XNQE 4NXME 4DV5E 2GS8A 4XTJA 4AQYE 4OX9E 4DV0E 2HK2A 2F4VI 1PIEA 4K0KI 1Z0CA 4DV6E 5A2QQ 4DR5I 2E5LI 2YT4A 1Z0EA 3F0NA 4PU9A 2MDRA 1XHKA 4JV5E 4RPFA 4B3MI 1ZBTA 4FWDA 4R1FA 3LTOA 4FWGA 4DV4I 3WU5A 3ZZTA 2UUCI 2CZ9A 4M30A 4X8WA 3Q1QA 2HKEA 2NPFA 1KKHA 4M2ZA 3J7Yp 3LNUA 3C4BA 2UU9E 4LF8I 1DI2A 4DUZE 1MU5A 2L2MA 1OJ4A 1XNQI 4X66I 4DR3E 4DV5I 4DU8A 4OX9I 4DV0I 1YYOA 4FWHA 1U2RA 4DV6I 4HXZA 4DV2E 4LF7I 3HULA 4I3HA 3ZZUA 4WUCA 3QT7A 5LMNI 4JV5I 2N3HA 4YHHE 1N34E 4UTGA 2UUBE 1QZRA 4HY1A 4JI6I 1HNXI 4LFCE 1D6TA 2B3TB 2LUQA 1HNWE 2DEJA 3ADJA 3V2UC 2HKJA 4JI4I 4DUZI 1H73A 2BM1A 4DR3I 4DV1E 3M6AA 5IT9C 5GMEA 4B3SE 4DV2I 4DV3E 3ADGA 4NXNI 1H74A 4DR5E 1HNZI 4DR6I 1FI4A 1N34I 1MX0A 3WU4A 3J80C 1H72C 4JI3E 4P52A 4DPTA 1NHIA 2UUCE 4PRVA 4DR2I 1Z0BA 1ZXMA 4WFTA 4B3RI 4LFCI 1T4OA 4JI8E 4HACB 4GKJI 1KTVA 4KQVA 2BM0A 1XNRE 2DIXA 4JI2I 1Z59A 2ZM6I 2VQFE 3T1YI 2LJHA 1RC7A 4USKA 1B62A 4X66E 1DARA 4JI7I 3WU6A 4Z7CA 4DV1I 1S4EA 3GONA 1B63A 1UEKA 4DV3I 4B3SI 1RQ0A 4LF7E 5IWAE 3K17A 4ED4A 4YY3I 2V8PA 5LMNE 5LMUE 3QT5A 3B78A 3T1HI 3J7AM 4JI3I 2EFGA 4LF5E 3JAMC 1N0VC 1RREA 4JI6E 1HNXE 4JI8I 2B7TA 4JI0E 1XMOI 5L3JA 4M1KA 1Z0WA 1XNRI 4JI4E 2L3JA 2VQFI 2LTSA 2UXCI 4DU7A 2ZBKB 2WW4A 3ZZ0A 1H7SA 1IBKE 4GKKE 3B82A 4WYQB 1EKZA 4P7AA 3ZM7A 4MYUA 1ZXNA 3J81Q 4NXNE 3VYXA 1HNZE 4DR6E 4LF4E 3PYDA 5IWAI 2B7VA 5LMUI 5FLXC 4KHPE 2UUAI 4DR1E 4LF5I 3J7AG 4DR2E 1X47A 4B3RE 2LBSB 2EZ6A 4WUDA 4JI0I 4DUYE 4GKJE 4OOGC 3ZKDA 4DXLA 1NHHA 1XMQI 5IT9Q 4JI2E 2A2DA 4HACA 1Z0TA 4Z7YA 2ZM6E 3T1YE 1N32E 1IBKI 2A2CA 1I94I 4GKKI 3ADIA 4JI1E 2OI2A 4JI7E 3K1JA 2LJPA 4LFAE 3J80Q 2V2QA 2N3GA 2AJ4A 2JY9A 4FN5A 4LF4I 4X64I 2UXBE 3VYYA 4YY3E 5LL6R 1FJGI 4KHPI 1ZM4A 2J7KA 3T1HE 4DPXA 4DR1I 2HK3A 2RS7A 1STUA 2LTRA 1YYKA 1X49A 2LUPB 4DV7E 4DUYI 1ZM2A 2L2KB 2HFSA 3PYFA 3QT6A 4WUBA 1XMOE 1MG7A 4DPUA 1Z5BA 2DEIA 2V34A 4USMA 1N32I 2UXCE 2X7IA 4DPWA 4JYAI 4DR4I 2VF3A 1EI1A 2E1RA 3PYGA 4JI1I 3D4JA 3ZKBA 4EMDA 4LFAI 4JG4A 1ZM3A 3JAMQ 4DKKA 1IBLE 2UXBI 2R3VA 1O0WA 3PYEA 2UUAE 4PRXA 1HR0E 2L2NA 4LF9I 2HHHI 2CPNA 1K47A 1N0UA 4FW9A 1J5EE 4DV7I 1UHZA 3LLHA 3LPSA 5BR8E 1XMQE 2UXDI 2V2VA 5CFFE 4X62I 2JVAA 4X65I 2LRSA 2HFUA 5A2QC 1VISA 1YYWA 1I94E 4UT4A 2VQEI 5FLXQ 1IBMI 3HTXA 1IBLI 1N33I 2NUEA 1T4LB 4X64E 1NZ0A 1A6FA 1FJGE 2BV3A 1HR0I 1PVGA 1WHQA 1Z0GA 4NXMI 2Q2EB 3C4TA 2RSMA 1EA6A 4DPYA 4AQYI 3CWVA 4JI5E 4LFBE 1J5EI 4ZVIA 4LF6E 2L3CA 1UILA 4DR7E 5BR8I 2RS6A 2DMYA 1FWKA 3OTOE 2IHR1 1ZM9A 2X36A 1Z0VA 3B8HA 3V5RA 3J81C 4JYAE 1J26A 4DR4E 1GQEA 2XEXA 4MYTA 1YZ9A 2V2ZA 3ADLA 1Z5CA 2UU9I 1N36E 1Z5AA 4B3TE 1ELOA 4LF9E 1QU6A 2HHHE 1KVKA 1RR9A 4JI5I 4LFBI 3H4LA 1KIJA 2R42A 2F4VE 1X48A 4K0KE 3P1XA 2KHXA 4LF6I 1FKAE 2E5LE 4DR7I 3WU3A 1WUUA 4URLA 2ZITA 1PKPA 1FNMA 5GMDA 3OTOI 4YHHI 2UXDE 2DB2A 4B3ME 2UUBI 4X62E 4X65E 2RTXA 4DV4E 1FWLA 2NUFA 3QT8A 1T4NA 2VQEE 1IBME 1HNWI 1NHJA 2L33A 1WHNA 1N33E 1S16A 1N36I
chains in the Genus database with same CATH superfamily
2NUGA 4LF8E 2WBTA 2EOQA 1T38A 4B3TI 1BKNA 1UDOA 1WXRA 2VESA 4R2PA 4HYMA 1H7UA 2EN7A 2NA2A 3KZYA 1XNQE 4NXME 2G7HA 1X6EA 2PNZA 4DV5E 4FW4A 5IXMB 2GS8A 4MDTA 4AQYE 4XTJA 4OX9E 4DV0E 2CTDA 2HK2A 2F4VI 2JT2A 3DJWA 2L8TA 1PIEA 4K0KI 2FGGA 1Z0CA 4DV6E 2I9IA 5A2QQ 4DR5I 2E5LI 1EH6A 2YT4A 2DSYA 1OYSA 1Z0EA 4IFDB 2CSHA 5DRPA 3F0NA 2GO4A 4PU9A 2MDRA 3IWBA 4R8OA 1XHKA 1PJTA 2NN6F 5JEAF 5K36E 2EPPA 4JV5E 4RPFA 4B3MI 1ZBTA 4O43A 4FWDA 1AAYA 4ZYGA 3LTOA 4FWGA 4R1FA 4DV4I 3WU5A 1MGTA 3ZZTA 2CZ9A 4AIDA 2EN4A 2JOXA 2UUCI 4M30A 4F9CB 4X8WA 3Q1QA 3B4TA 2EM6A 2HKEA 3DD6A 2NPFA 2J7JA 1YUJA 5EL9A 5AE1A 2PO1A 4MQYA 4NZVA 1TN9A 4M2ZA 2MC5A 4F54A 1Z1BA 1KKHA 3GLLA 3J7Yp 3LNUA 1IQOA 2PNZB 2B9DA 3C4BA 2UU9E 4LCHA 5DNLA 4LF8I 1DI2A 5ELWA 2EMXA 5K36B 2EN8A 5DRQA 4DUZE 1MU5A 5TSEA 2L2MA 1OJ4A 1XNQI 4X66I 1YPNA 4DR3E 4DV5I 4DU8A 3CDIA 4DV0I 2EOYA 4OX9I 1YYOA 5JEAD 2EM9A 5A6KA 4FWHA 1U2RA 5FWKA 4DV6I 4HXZA 4OKGA 4DV2E 3LMLA 2YWQA 4LCGA 4ZYEA 2LVHA 4LF7I 3HULA 4I3HA 3ZZUA 4N3OA 2LT7A 4IFDC 4WUCA 2WP8A 2WNRA 3QT7A 5LMNI 2LMZA 4R2EA 1SFEA 2DMIA 4JV5I 2N3HA 4YHHE 2EPUA 2KONA 1N34E 4UTGA 2UUBE 2YTDA 1QZRA 2O1UA 4MU4A 4HY1A 2PO1B 4BBYA 5T6JA 4NBQA 5KL4A 2O1VA 2EM8A 4JI6I 1HNXI 1UDNA 1RMDA 4LFCE 2EM7A 2B3TB 2YZTA 1D6TA 2LJUA 2LUQA 2EM5A 2EMLA 1HNWE 2IERA 3L00A 1ZR9A 2EE8A 2F1DA 2A25A 4RH8A 2DEJA 1BBGA 4R03A 3ADJA 3HQ1A 3EPJA 3EPLA 5KL3A 3V2UC 5KL5A 3CDJA 2HKJA 4WX9A 4JI4I 5K36C 3UHMA 4DUZI 3HJCA 4ISAA 1H73A 2BM1A 4Q28A 4DR3I 3HXLA 4IS1C 1UDSA 2LCEA 4IS9A 5AASA 3PS3A 3EPHA 1R6LA 4L8NA 4DV1E 2YRMA 2EMZA 3M6AA 5IT9C 5GMEA 4B3SE 4DV2I 4DV3E 3ADGA 4NXNI 1H74A 4LTYA 4BCAA 3DF6A 4DR5E 2JP9A 1HNZI 4DR6I 3FIGA 2GHFA 4F2JC 1FI4A 1GZ6A 3MHHC 2EM3A 3PS1A 4LCFA 2EOIA 2CG9A 2M4IA 1N34I 3HPSA 1MX0A 3WU4A 4WSPA 3J80C 1H72C 3F6GA 4JI3E 4P52A 4DPTA 4L5NC 4BMJA 2UUCE 1NHIA 3JTZA 1Y60A 4PRVA 1Z0BA 4DR2I 1ZXMA 4IFDA 4WFTA 2O1TA 5A6JA 4B3RI 2EMGA 4LFCI 5DRRA 2JEAA 2M7QA 1T4OA 2D9HA 2V85A 4JI8E 4HACB 4IZJA 4GKJI 1WJPA 2EPZA 2K7IA 1DQ3A 1KTVA 4P78A 3P3GA 4KQVA 2BM0A 1A1LA 2BBGA 1A1JA 3ZOQB 1XNRE 2DIXA 2YTEA 1UN6B 4JI2I 1USVA 2EJ4A 5KL7A 1Z59A 2YRKA 2VQFE 2ZM6I 3T1YI 2LJHA 1RC7A 4OO1F 4USKA 3H09A 4KWYA 5C0XF 1B62A 4X66E 1YFHA 1DARA 2BA0D 4R2RA 4JI7I 3WU6A 4FW3A 2EPNA 5KL2A 4Z7CA 4DV1I 5K36A 1S4EA 3BBGA 5LLQA 1B63A 1UEKA 1NEIA 2EMAA 3GONA 4DV3I 4B3SI 1RQ0A 1X6HA 4O5GA 2EOSA 1YSAC 4O24A 4LF7E 2EQ1A 5IWAE 2DLQA 2JR1A 3C6KA 4R2CA 2V8PA 1G2FC 2EN2A 3K17A 5LMNE 4ED4A 4YY3I 5LMUE 2JEAB 3QT5A 2YTQA 4DMIA 2PNLA 3B78A 4IZJB 3T1HI 3J7AM 4JI3I 3M99B 3P76A 2EFGA 3JAMC 4LF5E 3P3CA 2DLKA 1N0VC 4N4RB 1RREA 4JI6E 1HNXE 2EOHA 2EL4A 2GPIA 3C6MA 5DNYA 4JI8I 2C37B 2HGHA 2Z5CA 5C0XD 4OO1D 2B7TA 2V89A 4JI0E 1SR9A 1XMOI 4QNKA 2EPOA 2EOZA 2AE8A 5L3JA 4M1KA 2BA1D 1RHYA 1Z0WA 1XNRI 1VI7A 1Y4SA 4LU9A 2ODRD 4JI4E 2L3JA 4AIMA 2VQFI 5IV8B 4R2AA 2LTSA 2UXCI 4DU7A 2V8QB 4F9AB 4KZSA 2YTNA 2EWLA 2M9AA 2ZBKB 2WZOA 2WW4A 3ZZ0A 1H7SA 1IBKE 2JE6A 4GKKE 3B82A 2LV2A 4WYQB 2V88A 4HTGA 5AE3A 1EKZA 1YUIA 2NN6D 4P7AA 3ZM7A 4MYUA 2EL6A 1ZXNA 3J81Q 1P47A 4NXNE 3VYXA 4BHBA 4M9VC 4ZYDA 1HNZE 4DR6E 4LF4E 3PYDA 5IWAI 1ZBQA 2EQ0A 3PS2A 2B7VA 5LMUI 5FLXC 2BA0G 2ADRA 4KHPE 2UUAI 2ENHA 1JK1A 2Z5CB 4BA1A 4DR1E 4LF5I 2YSPA 3J7AG 4DR2E 4F6MA 1X47A 4GQUA 4OZEA 4B3RE 2LBSB 3QG5C 2YU5A 2ENAA 2EZ6A 3M7ND 1EH7A 5A6BA 4WUDA 4IFDF 4JI0I 5DROA 4DUYE 4GKJE 4OOGC 4AM3A 3ZKDA 4BC7A 2LO3A 4DXLA 1X5WA 1OYPA 1BB8A 1NHHA 1XMQI 2JE6B 2J65A 2IESA 4DPWA 3MSWA 5IT9Q 4JI2E 4FW5A 1B69A 2A2DA 3PRYA 4HACA 3UK3C 1Z0TA 4MU1A 2ZM6E 3T1YE 2I13A 1N32E 4Z7YA 3RMPA 2EMKA 2EMBA 2GQ0A 3U1KA 5EKWA 1IBKI 2A2CA 1I94I 2EPLX 4GKKI 1YHCA 3ADIA 2EOMA 3KZZA 4JI1E 2EMIA 2EL5A 2OI2A 2PO2B 4JI7E 3IWCA 2EM2A 3GCMA 4J3DA 3K1JA 5F3WA 2LJPA 4LFAE 3J80Q 2V2QA 2N3GA 5KL6A 2YSOA 2JY9A 2AJ4A 4FN5A 4BA1B 4LF4I 1T39A 1YH8A 4X64I 5K36F 2UXBE 3VYYA 2YTPA 5A6AA 2EOXA 4YY3E 2LE2A 5LL6R 1HK7A 1OYRA 2EPAA 4MU0A 4KHPI 1FJGI 4WXCA 1KYQA 4IFDD 1ZM4A 2J7KA 1A1FA 3T1HE 4DPXA 4DR1I 5JEAB 4ZYHA 2JWOA 3MHSC 2EPXA 2V83A 3Q6MA 4R2QA 2K4VA 2RS7A 2HK3A 1STUA 2LTRA 1YYKA 4LPFA 1LLMC 1X49A 2LUPB 2PRTA 1L4SA 1PJQA 2KOUA 2VF1A 4DV7E 4DUYI 1ZM2A 5ADZA 2L2KB 2EPCA 2JOBA 2HFSA 3PYFA 3L7ZA 1XMOE 3QT6A 4P7DA 4WUBA 4M0VA 4BC9A 1MG7A 2MC6A 4DPUA 1Z5BA 2DEIA 2V34A 2C37A 2HJJA 4MU3A 4USMA 1N32I 3NZKA 3M7NG 1DGCA 2UXCE 1Y6ZA 4TUIA 2C39B 2C38B 2EN3A 2X7IA 1PDAA 2VF3A 4DR4I 4JYAI 5K36D 5AC4A 1EI1A 2E1RA 3HKMA 4IZKB 3OMLA 3PYGA 4JI1I 2YTOA 5A69A 1Y4UA 3D4JA 3ZKBA 4EMDA 3EQ1A 4LFAI 4JG4A 1XXEA 1ZM3A 4FW7A 4LOMA 3JAMQ 3KWRA 2JEBB 4DKKA 3M85D 1IBLE 3KRNA 1NCSA 2UXBI 1A1IA 2R3VA 4AQYI 1O0WA 2DRPA 3PYEA 1A1KA 4O4KA 2YTIA 4U3DA 2UUAE 4PRXA 1HR0E 2L2NA 2NN6C 5JEAC 4LF9I 3JU0A 2CGEA 3L7ZB 5DNXA 2HHHI 3K85A 1E3PA 2CPNA 2RQLA 2EP3A 2V86A 2EOFA 2V87A 4HEIA 1K47A 1N0UA 4FW9A 2EOEA 1UBDC 1J5EE 3P06A 4DV7I 4Q35B 1UHZA 3LLHA 2FTXB 3LPSA 3Q6NA 5BR8E 1MEYC 1A1GA 1EH8A 2EOOA 2YPNA 3BGHA 1ZAAC 2E1MA 1XMQE 2O1WA 4BS9A 1IQSA 4BHCA 2UXDI 4I8OA 2V2VA 3U1YA 5CFFE 2EN6A 4X62I 4R2SA 2JVAA 4J8ZA 4X65I 4BA2B 2ELZA 2LRSA 2HFUA 5A2QC 2ELYA 1P42A 1YYWA 1VISA 3AUZA 1I94E 4UT4A 2L92A 2EMYA 2VRDA 5FLXQ 4QNJA 2VQEI 1AH5A 1IBMI 1R6MA 4TUGA 2EN1A 2YTFA 4F9BB 1KJKA 3HPZA 3HTXA 1IBLI 1N33I 2NUEA 2Z5EA 4OO1A 5C0XA 2L6MA 1T4LB 4X64E 2M1SA 1NZ0A 2GO3A 2EMCA 2PO2A 2O3ZA 2VE7C 1A6FA 4MLQA 2EORA 2N8XA 1FJGE 1PJSA 2BV3A 1HR0I 3GMEA 1PVGA 1WHQA 4NHRA 1F2IG 1Z0GA 4NXMI 2Q2EB 3C4TA 2RSMA 1GTKA 5A6BD 1EA6A 2EPKX 3IWDA 3THNA 1USUA 3CWVA 4JI5E 3H1CA 4DPYA 4LFBE 5C0XE 1J5EI 2H36X 3EPKA 4ZVIA 1TF6A 2MDGA 1WRJA 4WPYA 2NN6A 5JEAA 4LF6E 2L3CA 1UILA 2WCC3 4DR7E 5BR8I 2RS6A 2DMYA 4GEQB 2F8BA 1FWKA 2PO0A 2YRHA 4WSGA 2R76A 4R2DA 2HC5A 2JXPA 3OTOE 1JK2A 2IHR1 2CVEA 1ZM9A 2Z5BA 2X36A 2BB8A 3P3EA 4MLVA 1Z0VA 3B8HA 2NN6E 5JEAE 3J81C 1A1HA 3V5RA 4JYAE 1X6FA 1G2DC 4DR4E 1J26A 2PNMA 4U3BA 4OO1B 5C0XB 2EPMX 1UDQA 4GZNC 2BA1G 2IOPA 1BBOA 2EMWA 4RHBB 4F6NA 2MKNA 1GQEA 2XEXA 2Q8UA 2JPAA 2C39A 2C38A 4MYTA 2IOQA 2BR2A 1YZ9A 1QNTA 2V2ZA 3ADLA 1Z5CA 4IZKA 2DGCA 2WBUA 2UU9I 1N36E 1Z5AA 2RPCA 4IJDA 4B3TE 1ELOA 2FV4B 3K6QA 2JEBA 2EMFA 2NN6B 1Y5YA 2YTJA 1X3CA 4LF9E 1IMUA 1QU6A 2HHHE 1KVKA 4FK5C 1RR9A 4IZJD 4JI5I 1N3GA 4LFBI 3H4LA 2WP8B 2WNRB 3AV0A 2PO0B 2R1FA 5AE2A 1KIJA 2R42A 2EM4A 3TQMA 3BF2A 2F4VE 1X48A 4K0KE 2EQ3A 3P1XA 2Z5BB 2KHXA 4OO1E 3M85G 4LF6I 2RSIA 2GLIA 1FKAE 2E5LE 4DR7I 2YU8A 3WU3A 1WUUA 4WXDA 2ENCA 2EOJA 3ECRA 2CT1A 4X9JA 1E3HA 2ZITA 1PKPA 4URLA 3VHTB 1FNMA 4FW6A 5GMDA 3OTOI 3VK6A 4YHHI 2UXDE 2E72A 1ZU1A 2DB2A 4B3ME 2UUBI 2NABA 4X62E 4X65E 2JYAA 2RTXA 4DV4E 2BR2B 1FWLA 4OO1C 2NUFA 5C0XC 3QT8A 1TF3A 1T4NA 3THOB 2VQEE 1IBME 1HNWI 2YTGA 4BA2A 1NHJA 2L33A 2WBSA 3F6HA 2EPRA 5AC5A 2EM0A 1WHNA 2ODRC 2MKDA 4IFDE 1N33E 3BIDA 1S16A 1N36I 2EMHA
chains in the Genus database with same CATH topology
2NUGA 4LF8E 4B3TI 1BKNA 1WXRA 4HYMA 1H7UA 2NA2A 1XNQE 4NXME 2G7HA 4DV5E 2GS8A 4XTJA 4AQYE 4OX9E 4DV0E 2HK2A 2F4VI 3DJWA 2L8TA 1PIEA 4K0KI 2FGGA 1Z0CA 4DV6E 5A2QQ 4DR5I 2E5LI 2YT4A 2DSYA 1Z0EA 3F0NA 4PU9A 2MDRA 3IWBA 4R8OA 1XHKA 4JV5E 4RPFA 4B3MI 1ZBTA 4FWDA 4R1FA 3LTOA 4FWGA 4DV4I 3WU5A 3ZZTA 2UUCI 2CZ9A 2JOXA 4M30A 4F9CB 4X8WA 3Q1QA 2HKEA 2NPFA 5AE1A 1KKHA 4M2ZA 2MC5A 4F54A 3J7Yp 3LNUA 2B9DA 3C4BA 2UU9E 4LF8I 1DI2A 4DUZE 1MU5A 2L2MA 1OJ4A 1XNQI 4X66I 4DR3E 4DV5I 4DU8A 4OX9I 4DV0I 1YYOA 4FWHA 1U2RA 5FWKA 4DV6I 4HXZA 4DV2E 3LMLA 4LF7I 3HULA 4I3HA 3ZZUA 4N3OA 4WUCA 3QT7A 5LMNI 2LMZA 4JV5I 2N3HA 4YHHE 2KONA 1N34E 4UTGA 2UUBE 1QZRA 2O1UA 4HY1A 4BBYA 5T6JA 2O1VA 4JI6I 1HNXI 4LFCE 1D6TA 2B3TB 2YZTA 2LUQA 1HNWE 2DEJA 4R03A 3ADJA 3HQ1A 3V2UC 2HKJA 4JI4I 4DUZI 3HJCA 1H73A 2BM1A 4Q28A 4DR3I 3HXLA 5AASA 4L8NA 4DV1E 3M6AA 5IT9C 5GMEA 4B3SE 4DV2I 4DV3E 3ADGA 4NXNI 1H74A 4LTYA 4BCAA 3DF6A 4DR5E 1HNZI 4DR6I 3FIGA 1FI4A 1GZ6A 2CG9A 2M4IA 1N34I 3HPSA 1MX0A 3WU4A 4WSPA 3J80C 1H72C 3F6GA 4JI3E 4P52A 4DPTA 4L5NC 4BMJA 2UUCE 1NHIA 3JTZA 4PRVA 4DR2I 1Z0BA 1ZXMA 4WFTA 2O1TA 4B3RI 4LFCI 2M7QA 1T4OA 2V85A 4JI8E 4HACB 4IZJA 4GKJI 1DQ3A 1KTVA 4P78A 4KQVA 2BM0A 3ZOQB 1XNRE 2DIXA 4JI2I 1USVA 1Z59A 2ZM6I 2VQFE 3T1YI 2LJHA 1RC7A 4USKA 3H09A 1B62A 4X66E 1DARA 4JI7I 3WU6A 4Z7CA 4DV1I 1S4EA 1B63A 1UEKA 3GONA 4DV3I 4B3SI 1RQ0A 4LF7E 5IWAE 3K17A 4ED4A 2JR1A 4YY3I 2V8PA 5LMNE 5LMUE 3QT5A 4DMIA 2PNLA 3B78A 4IZJB 3T1HI 3J7AM 4JI3I 2EFGA 3JAMC 4LF5E 1N0VC 1RREA 4JI6E 1HNXE 5DNYA 4JI8I 2Z5CA 2B7TA 2V89A 4JI0E 1SR9A 1XMOI 5L3JA 4M1KA 1Z0WA 1XNRI 1Y4SA 4LU9A 2ODRD 4JI4E 2L3JA 2VQFI 2LTSA 2UXCI 4DU7A 2V8QB 4F9AB 2EWLA 4KZSA 2ZBKB 2WZOA 2WW4A 3ZZ0A 1H7SA 1IBKE 4GKKE 3B82A 4WYQB 5AE3A 2V88A 1EKZA 4P7AA 3ZM7A 4MYUA 1ZXNA 3J81Q 4NXNE 3VYXA 1HNZE 4DR6E 4LF4E 3PYDA 5IWAI 1ZBQA 2B7VA 5LMUI 5FLXC 4KHPE 2UUAI 2Z5CB 4DR1E 4LF5I 3J7AG 4DR2E 1X47A 4B3RE 2LBSB 2EZ6A 4WUDA 4JI0I 4DUYE 4GKJE 4OOGC 3ZKDA 4BC7A 4DXLA 1NHHA 1XMQI 3MSWA 5IT9Q 4JI2E 2A2DA 3PRYA 4HACA 1Z0TA 4Z7YA 2ZM6E 3T1YE 1N32E 3RMPA 2GQ0A 1IBKI 2A2CA 1I94I 4GKKI 3ADIA 4JI1E 2OI2A 4JI7E 3IWCA 3K1JA 5F3WA 2LJPA 4LFAE 3J80Q 2V2QA 2N3GA 2AJ4A 2JY9A 4FN5A 4LF4I 4X64I 2UXBE 3VYYA 4YY3E 2LE2A 5LL6R 1HK7A 1FJGI 4KHPI 1ZM4A 2J7KA 3T1HE 4DPXA 4DR1I 2JWOA 2V83A 3Q6MA 2K4VA 2RS7A 2HK3A 1STUA 2LTRA 1YYKA 1X49A 2LUPB 2KOUA 2VF1A 4DV7E 4DUYI 1ZM2A 5ADZA 2L2KB 2HFSA 2JOBA 3PYFA 3QT6A 4WUBA 1XMOE 4P7DA 4M0VA 4BC9A 1MG7A 2MC6A 4DPUA 1Z5BA 2DEIA 2V34A 4USMA 1N32I 2UXCE 1Y6ZA 2X7IA 4TUIA 4DPWA 4JYAI 4DR4I 2VF3A 1EI1A 2E1RA 4IZKB 3OMLA 3PYGA 4JI1I 1Y4UA 3D4JA 3ZKBA 4EMDA 4LFAI 4JG4A 1ZM3A 3JAMQ 3KWRA 4DKKA 1IBLE 2UXBI 2R3VA 1O0WA 3PYEA 2UUAE 4PRXA 1HR0E 2L2NA 4LF9I 3JU0A 2CGEA 2HHHI 3K85A 2CPNA 1K47A 2V86A 2V87A 1N0UA 4FW9A 1J5EE 3P06A 4DV7I 1UHZA 3LLHA 2FTXB 3LPSA 3Q6NA 5BR8E 2O1WA 2E1MA 1XMQE 4BS9A 2UXDI 4I8OA 2V2VA 5CFFE 4X62I 2JVAA 4J8ZA 4X65I 2LRSA 2HFUA 5A2QC 1VISA 1YYWA 3AUZA 1I94E 4UT4A 2L92A 2VQEI 5FLXQ 1IBMI 4TUGA 4F9BB 3HPZA 3HTXA 1IBLI 1N33I 2NUEA 2Z5EA 2L6MA 1T4LB 4X64E 2M1SA 1NZ0A 2VE7C 1A6FA 1FJGE 2BV3A 1HR0I 1PVGA 1WHQA 1Z0GA 4NXMI 2Q2EB 3C4TA 2RSMA 1EA6A 3IWDA 1USUA 3CWVA 4DPYA 4AQYI 4JI5E 4LFBE 1J5EI 2H36X 4ZVIA 4WPYA 4LF6E 2L3CA 1UILA 4DR7E 5BR8I 2RS6A 2DMYA 4GEQB 2F8BA 1FWKA 3OTOE 2IHR1 1ZM9A 2Z5BA 2X36A 1Z0VA 3B8HA 3J81C 3V5RA 4JYAE 1J26A 2PNMA 4DR4E 2IOPA 1GQEA 2XEXA 4MYTA 2IOQA 1YZ9A 2V2ZA 3ADLA 1Z5CA 4IZKA 2UU9I 1N36E 1Z5AA 4B3TE 1ELOA 2FV4B 3K6QA 4LF9E 1QU6A 2HHHE 1KVKA 1RR9A 4IZJD 4JI5I 4LFBI 3H4LA 3AV0A 5AE2A 1KIJA 2R42A 2F4VE 1X48A 4K0KE 3P1XA 2Z5BB 2KHXA 4LF6I 1FKAE 2E5LE 4DR7I 3WU3A 1WUUA 4URLA 2ZITA 1PKPA 1FNMA 5GMDA 3OTOI 3VK6A 4YHHI 2UXDE 2DB2A 4B3ME 2UUBI 4X62E 4X65E 2RTXA 4DV4E 1FWLA 2NUFA 3QT8A 1T4NA 2VQEE 1IBME 1HNWI 1NHJA 2L33A 3F6HA 1WHNA 2ODRC 1N33E 1S16A 1N36I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUG A;  4LF8 E;  4B3T I;  1BKN A;  4HYM A;  1H7U A;  2NA2 A;  1XNQ E;  4NXM E;  4DV5 E;  2GS8 A;  4XTJ A;  4AQY E;  4OX9 E;  4DV0 E;  2HK2 A;  2F4V I;  1PIE A;  4K0K I;  1Z0C A;  4DV6 E;  5A2Q Q;  4DR5 I;  2E5L I;  2YT4 A;  1Z0E A;  3F0N A;  4PU9 A;  2MDR A;  1XHK A;  4JV5 E;  4RPF A;  4B3M I;  1ZBT A;  4FWD A;  4R1F A;  3LTO A;  4FWG A;  4DV4 I;  3WU5 A;  3ZZT A;  2UUC I;  2CZ9 A;  4M30 A;  4X8W A;  3Q1Q A;  2HKE A;  2NPF A;  1KKH A;  4M2Z A;  3J7Y p;  3LNU A;  3C4B A;  2UU9 E;  4LF8 I;  1DI2 A;  4DUZ E;  1MU5 A;  2L2M A;  1OJ4 A;  1XNQ I;  4X66 I;  4DR3 E;  4DV5 I;  4DU8 A;  4OX9 I;  4DV0 I;  1YYO A;  4FWH A;  1U2R A;  4DV6 I;  4HXZ A;  4DV2 E;  4LF7 I;  3HUL A;  4I3H A;  3ZZU A;  4WUC A;  3QT7 A;  5LMN I;  4JV5 I;  2N3H A;  4YHH E;  1N34 E;  4UTG A;  2UUB E;  1QZR A;  4HY1 A;  4JI6 I;  1HNX I;  4LFC E;  1D6T A;  2B3T B;  2LUQ A;  1HNW E;  2DEJ A;  3ADJ A;  3V2U C;  2HKJ A;  4JI4 I;  4DUZ I;  1H73 A;  2BM1 A;  4DR3 I;  4DV1 E;  3M6A A;  5IT9 C;  5GME A;  4B3S E;  4DV2 I;  4DV3 E;  3ADG A;  4NXN I;  1H74 A;  4DR5 E;  1HNZ I;  4DR6 I;  1FI4 A;  1N34 I;  1MX0 A;  3WU4 A;  3J80 C;  1H72 C;  4JI3 E;  4P52 A;  4DPT A;  1NHI A;  2UUC E;  4PRV A;  4DR2 I;  1Z0B A;  1ZXM A;  4WFT A;  4B3R I;  4LFC I;  1T4O A;  4JI8 E;  4HAC B;  4GKJ I;  1KTV A;  4KQV A;  2BM0 A;  1XNR E;  2DIX A;  4JI2 I;  1Z59 A;  2ZM6 I;  2VQF E;  3T1Y I;  2LJH A;  1RC7 A;  4USK A;  1B62 A;  4X66 E;  1DAR A;  4JI7 I;  3WU6 A;  4Z7C A;  4DV1 I;  1S4E A;  3GON A;  1B63 A;  1UEK A;  4DV3 I;  4B3S I;  1RQ0 A;  4LF7 E;  5IWA E;  3K17 A;  4ED4 A;  4YY3 I;  2V8P A;  5LMN E;  5LMU E;  3QT5 A;  3B78 A;  3T1H I;  3J7A M;  4JI3 I;  2EFG A;  4LF5 E;  3JAM C;  1N0V C;  1RRE A;  4JI6 E;  1HNX E;  4JI8 I;  2B7T A;  4JI0 E;  1XMO I;  5L3J A;  4M1K A;  1Z0W A;  1XNR I;  4JI4 E;  2L3J A;  2VQF I;  2LTS A;  2UXC I;  4DU7 A;  2ZBK B;  2WW4 A;  3ZZ0 A;  1H7S A;  1IBK E;  4GKK E;  3B82 A;  4WYQ B;  1EKZ A;  4P7A A;  3ZM7 A;  4MYU A;  1ZXN A;  3J81 Q;  4NXN E;  3VYX A;  1HNZ E;  4DR6 E;  4LF4 E;  3PYD A;  5IWA I;  2B7V A;  5LMU I;  5FLX C;  4KHP E;  2UUA I;  4DR1 E;  4LF5 I;  3J7A G;  4DR2 E;  1X47 A;  4B3R E;  2LBS B;  2EZ6 A;  4WUD A;  4JI0 I;  4DUY E;  4GKJ E;  4OOG C;  3ZKD A;  4DXL A;  1NHH A;  1XMQ I;  5IT9 Q;  4JI2 E;  2A2D A;  4HAC A;  1Z0T A;  4Z7Y A;  2ZM6 E;  3T1Y E;  1N32 E;  1IBK I;  2A2C A;  1I94 I;  4GKK I;  3ADI A;  4JI1 E;  2OI2 A;  4JI7 E;  3K1J A;  2LJP A;  4LFA E;  3J80 Q;  2V2Q A;  2N3G A;  2AJ4 A;  2JY9 A;  4FN5 A;  4LF4 I;  4X64 I;  2UXB E;  3VYY A;  4YY3 E;  5LL6 R;  1FJG I;  4KHP I;  1ZM4 A;  2J7K A;  3T1H E;  4DPX A;  4DR1 I;  2HK3 A;  2RS7 A;  1STU A;  2LTR A;  1YYK A;  1X49 A;  2LUP B;  4DV7 E;  4DUY I;  1ZM2 A;  2L2K B;  2HFS A;  3PYF A;  3QT6 A;  4WUB A;  1XMO E;  1MG7 A;  4DPU A;  1Z5B A;  2DEI A;  2V34 A;  4USM A;  1N32 I;  2UXC E;  2X7I A;  4DPW A;  4JYA I;  4DR4 I;  2VF3 A;  1EI1 A;  2E1R A;  3PYG A;  4JI1 I;  3D4J A;  3ZKB A;  4EMD A;  4LFA I;  4JG4 A;  1ZM3 A;  3JAM Q;  4DKK A;  1IBL E;  2UXB I;  2R3V A;  1O0W A;  3PYE A;  2UUA E;  4PRX A;  1HR0 E;  2L2N A;  4LF9 I;  2HHH I;  2CPN A;  1K47 A;  1N0U A;  4FW9 A;  1J5E E;  4DV7 I;  1UHZ A;  3LLH A;  3LPS A;  5BR8 E;  1XMQ E;  2UXD I;  2V2V A;  5CFF E;  4X62 I;  2JVA A;  4X65 I;  2LRS A;  2HFU A;  5A2Q C;  1VIS A;  1YYW A;  1I94 E;  4UT4 A;  2VQE I;  5FLX Q;  1IBM I;  3HTX A;  1IBL I;  1N33 I;  2NUE A;  1T4L B;  4X64 E;  1NZ0 A;  1A6F A;  1FJG E;  2BV3 A;  1HR0 I;  1PVG A;  1WHQ A;  1Z0G A;  4NXM I;  2Q2E B;  3C4T A;  2RSM A;  1EA6 A;  4DPY A;  4AQY I;  3CWV A;  4JI5 E;  4LFB E;  1J5E I;  4ZVI A;  4LF6 E;  2L3C A;  1UIL A;  4DR7 E;  5BR8 I;  2RS6 A;  2DMY A;  1FWK A;  3OTO E;  2IHR 1;  1ZM9 A;  2X36 A;  1Z0V A;  3B8H A;  3V5R A;  3J81 C;  4JYA E;  1J26 A;  4DR4 E;  1GQE A;  2XEX A;  4MYT A;  1YZ9 A;  2V2Z A;  3ADL A;  1Z5C A;  2UU9 I;  1N36 E;  1Z5A A;  4B3T E;  1ELO A;  4LF9 E;  1QU6 A;  2HHH E;  1KVK A;  1RR9 A;  4JI5 I;  4LFB I;  3H4L A;  1KIJ A;  2R42 A;  2F4V E;  1X48 A;  4K0K E;  3P1X A;  2KHX A;  4LF6 I;  1FKA E;  2E5L E;  4DR7 I;  3WU3 A;  1WUU A;  4URL A;  2ZIT A;  1PKP A;  1FNM A;  5GMD A;  3OTO I;  4YHH I;  2UXD E;  2DB2 A;  4B3M E;  2UUB I;  4X62 E;  4X65 E;  2RTX A;  4DV4 E;  1FWL A;  2NUF A;  3QT8 A;  1T4N A;  2VQE E;  1IBM E;  1HNW I;  1NHJ A;  2L33 A;  1WHN A;  1N33 E;  1S16 A;  1N36 I; 
#chains in the Genus database with same CATH topology
 2NUG A;  4LF8 E;  2WBT A;  2EOQ A;  1T38 A;  4B3T I;  1BKN A;  1UDO A;  1WXR A;  2VES A;  4R2P A;  4HYM A;  1H7U A;  2EN7 A;  2NA2 A;  3KZY A;  1XNQ E;  4NXM E;  2G7H A;  1X6E A;  2PNZ A;  4DV5 E;  4FW4 A;  5IXM B;  2GS8 A;  4MDT A;  4AQY E;  4XTJ A;  4OX9 E;  4DV0 E;  2CTD A;  2HK2 A;  2F4V I;  2JT2 A;  3DJW A;  2L8T A;  1PIE A;  4K0K I;  2FGG A;  1Z0C A;  4DV6 E;  2I9I A;  5A2Q Q;  4DR5 I;  2E5L I;  1EH6 A;  2YT4 A;  2DSY A;  1OYS A;  1Z0E A;  4IFD B;  2CSH A;  5DRP A;  3F0N A;  2GO4 A;  4PU9 A;  2MDR A;  3IWB A;  4R8O A;  1XHK A;  1PJT A;  2NN6 F;  5JEA F;  5K36 E;  2EPP A;  4JV5 E;  4RPF A;  4B3M I;  1ZBT A;  4O43 A;  4FWD A;  1AAY A;  4ZYG A;  3LTO A;  4FWG A;  4R1F A;  4DV4 I;  3WU5 A;  1MGT A;  3ZZT A;  2CZ9 A;  4AID A;  2EN4 A;  2JOX A;  2UUC I;  4M30 A;  4F9C B;  4X8W A;  3Q1Q A;  3B4T A;  2EM6 A;  2HKE A;  3DD6 A;  2NPF A;  2J7J A;  1YUJ A;  5EL9 A;  5AE1 A;  2PO1 A;  4MQY A;  4NZV A;  1TN9 A;  4M2Z A;  2MC5 A;  4F54 A;  1Z1B A;  1KKH A;  3GLL A;  3J7Y p;  3LNU A;  1IQO A;  2PNZ B;  2B9D A;  3C4B A;  2UU9 E;  4LCH A;  5DNL A;  4LF8 I;  1DI2 A;  5ELW A;  2EMX A;  5K36 B;  2EN8 A;  5DRQ A;  4DUZ E;  1MU5 A;  5TSE A;  2L2M A;  1OJ4 A;  1XNQ I;  4X66 I;  1YPN A;  4DR3 E;  4DV5 I;  4DU8 A;  3CDI A;  4DV0 I;  2EOY A;  4OX9 I;  1YYO A;  5JEA D;  2EM9 A;  5A6K A;  4FWH A;  1U2R A;  5FWK A;  4DV6 I;  4HXZ A;  4OKG A;  4DV2 E;  3LML A;  2YWQ A;  4LCG A;  4ZYE A;  2LVH A;  4LF7 I;  3HUL A;  4I3H A;  3ZZU A;  4N3O A;  2LT7 A;  4IFD C;  4WUC A;  2WP8 A;  2WNR A;  3QT7 A;  5LMN I;  2LMZ A;  4R2E A;  1SFE A;  2DMI A;  4JV5 I;  2N3H A;  4YHH E;  2EPU A;  2KON A;  1N34 E;  4UTG A;  2UUB E;  2YTD A;  1QZR A;  2O1U A;  4MU4 A;  4HY1 A;  2PO1 B;  4BBY A;  5T6J A;  4NBQ A;  5KL4 A;  2O1V A;  2EM8 A;  4JI6 I;  1HNX I;  1UDN A;  1RMD A;  4LFC E;  2EM7 A;  2B3T B;  2YZT A;  1D6T A;  2LJU A;  2LUQ A;  2EM5 A;  2EML A;  1HNW E;  2IER A;  3L00 A;  1ZR9 A;  2EE8 A;  2F1D A;  2A25 A;  4RH8 A;  2DEJ A;  1BBG A;  4R03 A;  3ADJ A;  3HQ1 A;  3EPJ A;  3EPL A;  5KL3 A;  3V2U C;  5KL5 A;  3CDJ A;  2HKJ A;  4WX9 A;  4JI4 I;  5K36 C;  3UHM A;  4DUZ I;  3HJC A;  4ISA A;  1H73 A;  2BM1 A;  4Q28 A;  4DR3 I;  3HXL A;  4IS1 C;  1UDS A;  2LCE A;  4IS9 A;  5AAS A;  3PS3 A;  3EPH A;  1R6L A;  4L8N A;  4DV1 E;  2YRM A;  2EMZ A;  3M6A A;  5IT9 C;  5GME A;  4B3S E;  4DV2 I;  4DV3 E;  3ADG A;  4NXN I;  1H74 A;  4LTY A;  4BCA A;  3DF6 A;  4DR5 E;  2JP9 A;  1HNZ I;  4DR6 I;  3FIG A;  2GHF A;  4F2J C;  1FI4 A;  1GZ6 A;  3MHH C;  2EM3 A;  3PS1 A;  4LCF A;  2EOI A;  2CG9 A;  2M4I A;  1N34 I;  3HPS A;  1MX0 A;  3WU4 A;  4WSP A;  3J80 C;  1H72 C;  3F6G A;  4JI3 E;  4P52 A;  4DPT A;  4L5N C;  4BMJ A;  2UUC E;  1NHI A;  3JTZ A;  1Y60 A;  4PRV A;  1Z0B A;  4DR2 I;  1ZXM A;  4IFD A;  4WFT A;  2O1T A;  5A6J A;  4B3R I;  2EMG A;  4LFC I;  5DRR A;  2JEA A;  2M7Q A;  1T4O A;  2D9H A;  2V85 A;  4JI8 E;  4HAC B;  4IZJ A;  4GKJ I;  1WJP A;  2EPZ A;  2K7I A;  1DQ3 A;  1KTV A;  4P78 A;  3P3G A;  4KQV A;  2BM0 A;  1A1L A;  2BBG A;  1A1J A;  3ZOQ B;  1XNR E;  2DIX A;  2YTE A;  1UN6 B;  4JI2 I;  1USV A;  2EJ4 A;  5KL7 A;  1Z59 A;  2YRK A;  2VQF E;  2ZM6 I;  3T1Y I;  2LJH A;  1RC7 A;  4OO1 F;  4USK A;  3H09 A;  4KWY A;  5C0X F;  1B62 A;  4X66 E;  1YFH A;  1DAR A;  2BA0 D;  4R2R A;  4JI7 I;  3WU6 A;  4FW3 A;  2EPN A;  5KL2 A;  4Z7C A;  4DV1 I;  5K36 A;  1S4E A;  3BBG A;  5LLQ A;  1B63 A;  1UEK A;  1NEI A;  2EMA A;  3GON A;  4DV3 I;  4B3S I;  1RQ0 A;  1X6H A;  4O5G A;  2EOS A;  1YSA C;  4O24 A;  4LF7 E;  2EQ1 A;  5IWA E;  2DLQ A;  2JR1 A;  3C6K A;  4R2C A;  2V8P A;  1G2F C;  2EN2 A;  3K17 A;  5LMN E;  4ED4 A;  4YY3 I;  5LMU E;  2JEA B;  3QT5 A;  2YTQ A;  4DMI A;  2PNL A;  3B78 A;  4IZJ B;  3T1H I;  3J7A M;  4JI3 I;  3M99 B;  3P76 A;  2EFG A;  3JAM C;  4LF5 E;  3P3C A;  2DLK A;  1N0V C;  4N4R B;  1RRE A;  4JI6 E;  1HNX E;  2EOH A;  2EL4 A;  2GPI A;  3C6M A;  5DNY A;  4JI8 I;  2C37 B;  2HGH A;  2Z5C A;  5C0X D;  4OO1 D;  2B7T A;  2V89 A;  4JI0 E;  1SR9 A;  1XMO I;  4QNK A;  2EPO A;  2EOZ A;  2AE8 A;  5L3J A;  4M1K A;  2BA1 D;  1RHY A;  1Z0W A;  1XNR I;  1VI7 A;  1Y4S A;  4LU9 A;  2ODR D;  4JI4 E;  2L3J A;  4AIM A;  2VQF I;  5IV8 B;  4R2A A;  2LTS A;  2UXC I;  4DU7 A;  2V8Q B;  4F9A B;  4KZS A;  2YTN A;  2EWL A;  2M9A A;  2ZBK B;  2WZO A;  2WW4 A;  3ZZ0 A;  1H7S A;  1IBK E;  2JE6 A;  4GKK E;  3B82 A;  2LV2 A;  4WYQ B;  2V88 A;  4HTG A;  5AE3 A;  1EKZ A;  1YUI A;  2NN6 D;  4P7A A;  3ZM7 A;  4MYU A;  2EL6 A;  1ZXN A;  3J81 Q;  1P47 A;  4NXN E;  3VYX A;  4BHB A;  4M9V C;  4ZYD A;  1HNZ E;  4DR6 E;  4LF4 E;  3PYD A;  5IWA I;  1ZBQ A;  2EQ0 A;  3PS2 A;  2B7V A;  5LMU I;  5FLX C;  2BA0 G;  2ADR A;  4KHP E;  2UUA I;  2ENH A;  1JK1 A;  2Z5C B;  4BA1 A;  4DR1 E;  4LF5 I;  2YSP A;  3J7A G;  4DR2 E;  4F6M A;  1X47 A;  4GQU A;  4OZE A;  4B3R E;  2LBS B;  3QG5 C;  2YU5 A;  2ENA A;  2EZ6 A;  3M7N D;  1EH7 A;  5A6B A;  4WUD A;  4IFD F;  4JI0 I;  5DRO A;  4DUY E;  4GKJ E;  4OOG C;  4AM3 A;  3ZKD A;  4BC7 A;  2LO3 A;  4DXL A;  1X5W A;  1OYP A;  1BB8 A;  1NHH A;  1XMQ I;  2JE6 B;  2J65 A;  2IES A;  4DPW A;  3MSW A;  5IT9 Q;  4JI2 E;  4FW5 A;  1B69 A;  2A2D A;  3PRY A;  4HAC A;  3UK3 C;  1Z0T A;  4MU1 A;  2ZM6 E;  3T1Y E;  2I13 A;  1N32 E;  4Z7Y A;  3RMP A;  2EMK A;  2EMB A;  2GQ0 A;  3U1K A;  5EKW A;  1IBK I;  2A2C A;  1I94 I;  2EPL X;  4GKK I;  1YHC A;  3ADI A;  2EOM A;  3KZZ A;  4JI1 E;  2EMI A;  2EL5 A;  2OI2 A;  2PO2 B;  4JI7 E;  3IWC A;  2EM2 A;  3GCM A;  4J3D A;  3K1J A;  5F3W A;  2LJP A;  4LFA E;  3J80 Q;  2V2Q A;  2N3G A;  5KL6 A;  2YSO A;  2JY9 A;  2AJ4 A;  4FN5 A;  4BA1 B;  4LF4 I;  1T39 A;  1YH8 A;  4X64 I;  5K36 F;  2UXB E;  3VYY A;  2YTP A;  5A6A A;  2EOX A;  4YY3 E;  2LE2 A;  5LL6 R;  1HK7 A;  1OYR A;  2EPA A;  4MU0 A;  4KHP I;  1FJG I;  4WXC A;  1KYQ A;  4IFD D;  1ZM4 A;  2J7K A;  1A1F A;  3T1H E;  4DPX A;  4DR1 I;  5JEA B;  4ZYH A;  2JWO A;  3MHS C;  2EPX A;  2V83 A;  3Q6M A;  4R2Q A;  2K4V A;  2RS7 A;  2HK3 A;  1STU A;  2LTR A;  1YYK A;  4LPF A;  1LLM C;  1X49 A;  2LUP B;  2PRT A;  1L4S A;  1PJQ A;  2KOU A;  2VF1 A;  4DV7 E;  4DUY I;  1ZM2 A;  5ADZ A;  2L2K B;  2EPC A;  2JOB A;  2HFS A;  3PYF A;  3L7Z A;  1XMO E;  3QT6 A;  4P7D A;  4WUB A;  4M0V A;  4BC9 A;  1MG7 A;  2MC6 A;  4DPU A;  1Z5B A;  2DEI A;  2V34 A;  2C37 A;  2HJJ A;  4MU3 A;  4USM A;  1N32 I;  3NZK A;  3M7N G;  1DGC A;  2UXC E;  1Y6Z A;  4TUI A;  2C39 B;  2C38 B;  2EN3 A;  2X7I A;  1PDA A;  2VF3 A;  4DR4 I;  4JYA I;  5K36 D;  5AC4 A;  1EI1 A;  2E1R A;  3HKM A;  4IZK B;  3OML A;  3PYG A;  4JI1 I;  2YTO A;  5A69 A;  1Y4U A;  3D4J A;  3ZKB A;  4EMD A;  3EQ1 A;  4LFA I;  4JG4 A;  1XXE A;  1ZM3 A;  4FW7 A;  4LOM A;  3JAM Q;  3KWR A;  2JEB B;  4DKK A;  3M85 D;  1IBL E;  3KRN A;  1NCS A;  2UXB I;  1A1I A;  2R3V A;  4AQY I;  1O0W A;  2DRP A;  3PYE A;  1A1K A;  4O4K A;  2YTI A;  4U3D A;  2UUA E;  4PRX A;  1HR0 E;  2L2N A;  2NN6 C;  5JEA C;  4LF9 I;  3JU0 A;  2CGE A;  3L7Z B;  5DNX A;  2HHH I;  3K85 A;  1E3P A;  2CPN A;  2RQL A;  2EP3 A;  2V86 A;  2EOF A;  2V87 A;  4HEI A;  1K47 A;  1N0U A;  4FW9 A;  2EOE A;  1UBD C;  1J5E E;  3P06 A;  4DV7 I;  4Q35 B;  1UHZ A;  3LLH A;  2FTX B;  3LPS A;  3Q6N A;  5BR8 E;  1MEY C;  1A1G A;  1EH8 A;  2EOO A;  2YPN A;  3BGH A;  1ZAA C;  2E1M A;  1XMQ E;  2O1W A;  4BS9 A;  1IQS A;  4BHC A;  2UXD I;  4I8O A;  2V2V A;  3U1Y A;  5CFF E;  2EN6 A;  4X62 I;  4R2S A;  2JVA A;  4J8Z A;  4X65 I;  4BA2 B;  2ELZ A;  2LRS A;  2HFU A;  5A2Q C;  2ELY A;  1P42 A;  1YYW A;  1VIS A;  3AUZ A;  1I94 E;  4UT4 A;  2L92 A;  2EMY A;  2VRD A;  5FLX Q;  4QNJ A;  2VQE I;  1AH5 A;  1IBM I;  1R6M A;  4TUG A;  2EN1 A;  2YTF A;  4F9B B;  1KJK A;  3HPZ A;  3HTX A;  1IBL I;  1N33 I;  2NUE A;  2Z5E A;  4OO1 A;  5C0X A;  2L6M A;  1T4L B;  4X64 E;  2M1S A;  1NZ0 A;  2GO3 A;  2EMC A;  2PO2 A;  2O3Z A;  2VE7 C;  1A6F A;  4MLQ A;  2EOR A;  2N8X A;  1FJG E;  1PJS A;  2BV3 A;  1HR0 I;  3GME A;  1PVG A;  1WHQ A;  4NHR A;  1F2I G;  1Z0G A;  4NXM I;  2Q2E B;  3C4T A;  2RSM A;  1GTK A;  5A6B D;  1EA6 A;  2EPK X;  3IWD A;  3THN A;  1USU A;  3CWV A;  4JI5 E;  3H1C A;  4DPY A;  4LFB E;  5C0X E;  1J5E I;  2H36 X;  3EPK A;  4ZVI A;  1TF6 A;  2MDG A;  1WRJ A;  4WPY A;  2NN6 A;  5JEA A;  4LF6 E;  2L3C A;  1UIL A;  2WCC 3;  4DR7 E;  5BR8 I;  2RS6 A;  2DMY A;  4GEQ B;  2F8B A;  1FWK A;  2PO0 A;  2YRH A;  4WSG A;  2R76 A;  4R2D A;  2HC5 A;  2JXP A;  3OTO E;  1JK2 A;  2IHR 1;  2CVE A;  1ZM9 A;  2Z5B A;  2X36 A;  2BB8 A;  3P3E A;  4MLV A;  1Z0V A;  3B8H A;  2NN6 E;  5JEA E;  3J81 C;  1A1H A;  3V5R A;  4JYA E;  1X6F A;  1G2D C;  4DR4 E;  1J26 A;  2PNM A;  4U3B A;  4OO1 B;  5C0X B;  2EPM X;  1UDQ A;  4GZN C;  2BA1 G;  2IOP A;  1BBO A;  2EMW A;  4RHB B;  4F6N A;  2MKN A;  1GQE A;  2XEX A;  2Q8U A;  2JPA A;  2C39 A;  2C38 A;  4MYT A;  2IOQ A;  2BR2 A;  1YZ9 A;  1QNT A;  2V2Z A;  3ADL A;  1Z5C A;  4IZK A;  2DGC A;  2WBU A;  2UU9 I;  1N36 E;  1Z5A A;  2RPC A;  4IJD A;  4B3T E;  1ELO A;  2FV4 B;  3K6Q A;  2JEB A;  2EMF A;  2NN6 B;  1Y5Y A;  2YTJ A;  1X3C A;  4LF9 E;  1IMU A;  1QU6 A;  2HHH E;  1KVK A;  4FK5 C;  1RR9 A;  4IZJ D;  4JI5 I;  1N3G A;  4LFB I;  3H4L A;  2WP8 B;  2WNR B;  3AV0 A;  2PO0 B;  2R1F A;  5AE2 A;  1KIJ A;  2R42 A;  2EM4 A;  3TQM A;  3BF2 A;  2F4V E;  1X48 A;  4K0K E;  2EQ3 A;  3P1X A;  2Z5B B;  2KHX A;  4OO1 E;  3M85 G;  4LF6 I;  2RSI A;  2GLI A;  1FKA E;  2E5L E;  4DR7 I;  2YU8 A;  3WU3 A;  1WUU A;  4WXD A;  2ENC A;  2EOJ A;  3ECR A;  2CT1 A;  4X9J A;  1E3H A;  2ZIT A;  1PKP A;  4URL A;  3VHT B;  1FNM A;  4FW6 A;  5GMD A;  3OTO I;  3VK6 A;  4YHH I;  2UXD E;  2E72 A;  1ZU1 A;  2DB2 A;  4B3M E;  2UUB I;  2NAB A;  4X62 E;  4X65 E;  2JYA A;  2RTX A;  4DV4 E;  2BR2 B;  1FWL A;  4OO1 C;  2NUF A;  5C0X C;  3QT8 A;  1TF3 A;  1T4N A;  3THO B;  2VQE E;  1IBM E;  1HNW I;  2YTG A;  4BA2 A;  1NHJ A;  2L33 A;  2WBS A;  3F6H A;  2EPR A;  5AC5 A;  2EM0 A;  1WHN A;  2ODR C;  2MKD A;  4IFD E;  1N33 E;  3BID A;  1S16 A;  1N36 I;  2EMH A; 
#chains in the Genus database with same CATH homology
 2NUG A;  4LF8 E;  4B3T I;  1BKN A;  1WXR A;  4HYM A;  1H7U A;  2NA2 A;  1XNQ E;  4NXM E;  2G7H A;  4DV5 E;  2GS8 A;  4XTJ A;  4AQY E;  4OX9 E;  4DV0 E;  2HK2 A;  2F4V I;  3DJW A;  2L8T A;  1PIE A;  4K0K I;  2FGG A;  1Z0C A;  4DV6 E;  5A2Q Q;  4DR5 I;  2E5L I;  2YT4 A;  2DSY A;  1Z0E A;  3F0N A;  4PU9 A;  2MDR A;  3IWB A;  4R8O A;  1XHK A;  4JV5 E;  4RPF A;  4B3M I;  1ZBT A;  4FWD A;  4R1F A;  3LTO A;  4FWG A;  4DV4 I;  3WU5 A;  3ZZT A;  2UUC I;  2CZ9 A;  2JOX A;  4M30 A;  4F9C B;  4X8W A;  3Q1Q A;  2HKE A;  2NPF A;  5AE1 A;  1KKH A;  4M2Z A;  2MC5 A;  4F54 A;  3J7Y p;  3LNU A;  2B9D A;  3C4B A;  2UU9 E;  4LF8 I;  1DI2 A;  4DUZ E;  1MU5 A;  2L2M A;  1OJ4 A;  1XNQ I;  4X66 I;  4DR3 E;  4DV5 I;  4DU8 A;  4OX9 I;  4DV0 I;  1YYO A;  4FWH A;  1U2R A;  5FWK A;  4DV6 I;  4HXZ A;  4DV2 E;  3LML A;  4LF7 I;  3HUL A;  4I3H A;  3ZZU A;  4N3O A;  4WUC A;  3QT7 A;  5LMN I;  2LMZ A;  4JV5 I;  2N3H A;  4YHH E;  2KON A;  1N34 E;  4UTG A;  2UUB E;  1QZR A;  2O1U A;  4HY1 A;  4BBY A;  5T6J A;  2O1V A;  4JI6 I;  1HNX I;  4LFC E;  1D6T A;  2B3T B;  2YZT A;  2LUQ A;  1HNW E;  2DEJ A;  4R03 A;  3ADJ A;  3HQ1 A;  3V2U C;  2HKJ A;  4JI4 I;  4DUZ I;  3HJC A;  1H73 A;  2BM1 A;  4Q28 A;  4DR3 I;  3HXL A;  5AAS A;  4L8N A;  4DV1 E;  3M6A A;  5IT9 C;  5GME A;  4B3S E;  4DV2 I;  4DV3 E;  3ADG A;  4NXN I;  1H74 A;  4LTY A;  4BCA A;  3DF6 A;  4DR5 E;  1HNZ I;  4DR6 I;  3FIG A;  1FI4 A;  1GZ6 A;  2CG9 A;  2M4I A;  1N34 I;  3HPS A;  1MX0 A;  3WU4 A;  4WSP A;  3J80 C;  1H72 C;  3F6G A;  4JI3 E;  4P52 A;  4DPT A;  4L5N C;  4BMJ A;  2UUC E;  1NHI A;  3JTZ A;  4PRV A;  4DR2 I;  1Z0B A;  1ZXM A;  4WFT A;  2O1T A;  4B3R I;  4LFC I;  2M7Q A;  1T4O A;  2V85 A;  4JI8 E;  4HAC B;  4IZJ A;  4GKJ I;  1DQ3 A;  1KTV A;  4P78 A;  4KQV A;  2BM0 A;  3ZOQ B;  1XNR E;  2DIX A;  4JI2 I;  1USV A;  1Z59 A;  2ZM6 I;  2VQF E;  3T1Y I;  2LJH A;  1RC7 A;  4USK A;  3H09 A;  1B62 A;  4X66 E;  1DAR A;  4JI7 I;  3WU6 A;  4Z7C A;  4DV1 I;  1S4E A;  1B63 A;  1UEK A;  3GON A;  4DV3 I;  4B3S I;  1RQ0 A;  4LF7 E;  5IWA E;  3K17 A;  4ED4 A;  2JR1 A;  4YY3 I;  2V8P A;  5LMN E;  5LMU E;  3QT5 A;  4DMI A;  2PNL A;  3B78 A;  4IZJ B;  3T1H I;  3J7A M;  4JI3 I;  2EFG A;  3JAM C;  4LF5 E;  1N0V C;  1RRE A;  4JI6 E;  1HNX E;  5DNY A;  4JI8 I;  2Z5C A;  2B7T A;  2V89 A;  4JI0 E;  1SR9 A;  1XMO I;  5L3J A;  4M1K A;  1Z0W A;  1XNR I;  1Y4S A;  4LU9 A;  2ODR D;  4JI4 E;  2L3J A;  2VQF I;  2LTS A;  2UXC I;  4DU7 A;  2V8Q B;  4F9A B;  2EWL A;  4KZS A;  2ZBK B;  2WZO A;  2WW4 A;  3ZZ0 A;  1H7S A;  1IBK E;  4GKK E;  3B82 A;  4WYQ B;  5AE3 A;  2V88 A;  1EKZ A;  4P7A A;  3ZM7 A;  4MYU A;  1ZXN A;  3J81 Q;  4NXN E;  3VYX A;  1HNZ E;  4DR6 E;  4LF4 E;  3PYD A;  5IWA I;  1ZBQ A;  2B7V A;  5LMU I;  5FLX C;  4KHP E;  2UUA I;  2Z5C B;  4DR1 E;  4LF5 I;  3J7A G;  4DR2 E;  1X47 A;  4B3R E;  2LBS B;  2EZ6 A;  4WUD A;  4JI0 I;  4DUY E;  4GKJ E;  4OOG C;  3ZKD A;  4BC7 A;  4DXL A;  1NHH A;  1XMQ I;  3MSW A;  5IT9 Q;  4JI2 E;  2A2D A;  3PRY A;  4HAC A;  1Z0T A;  4Z7Y A;  2ZM6 E;  3T1Y E;  1N32 E;  3RMP A;  2GQ0 A;  1IBK I;  2A2C A;  1I94 I;  4GKK I;  3ADI A;  4JI1 E;  2OI2 A;  4JI7 E;  3IWC A;  3K1J A;  5F3W A;  2LJP A;  4LFA E;  3J80 Q;  2V2Q A;  2N3G A;  2AJ4 A;  2JY9 A;  4FN5 A;  4LF4 I;  4X64 I;  2UXB E;  3VYY A;  4YY3 E;  2LE2 A;  5LL6 R;  1HK7 A;  1FJG I;  4KHP I;  1ZM4 A;  2J7K A;  3T1H E;  4DPX A;  4DR1 I;  2JWO A;  2V83 A;  3Q6M A;  2K4V A;  2RS7 A;  2HK3 A;  1STU A;  2LTR A;  1YYK A;  1X49 A;  2LUP B;  2KOU A;  2VF1 A;  4DV7 E;  4DUY I;  1ZM2 A;  5ADZ A;  2L2K B;  2HFS A;  2JOB A;  3PYF A;  3QT6 A;  4WUB A;  1XMO E;  4P7D A;  4M0V A;  4BC9 A;  1MG7 A;  2MC6 A;  4DPU A;  1Z5B A;  2DEI A;  2V34 A;  4USM A;  1N32 I;  2UXC E;  1Y6Z A;  2X7I A;  4TUI A;  4DPW A;  4JYA I;  4DR4 I;  2VF3 A;  1EI1 A;  2E1R A;  4IZK B;  3OML A;  3PYG A;  4JI1 I;  1Y4U A;  3D4J A;  3ZKB A;  4EMD A;  4LFA I;  4JG4 A;  1ZM3 A;  3JAM Q;  3KWR A;  4DKK A;  1IBL E;  2UXB I;  2R3V A;  1O0W A;  3PYE A;  2UUA E;  4PRX A;  1HR0 E;  2L2N A;  4LF9 I;  3JU0 A;  2CGE A;  2HHH I;  3K85 A;  2CPN A;  1K47 A;  2V86 A;  2V87 A;  1N0U A;  4FW9 A;  1J5E E;  3P06 A;  4DV7 I;  1UHZ A;  3LLH A;  2FTX B;  3LPS A;  3Q6N A;  5BR8 E;  2O1W A;  2E1M A;  1XMQ E;  4BS9 A;  2UXD I;  4I8O A;  2V2V A;  5CFF E;  4X62 I;  2JVA A;  4J8Z A;  4X65 I;  2LRS A;  2HFU A;  5A2Q C;  1VIS A;  1YYW A;  3AUZ A;  1I94 E;  4UT4 A;  2L92 A;  2VQE I;  5FLX Q;  1IBM I;  4TUG A;  4F9B B;  3HPZ A;  3HTX A;  1IBL I;  1N33 I;  2NUE A;  2Z5E A;  2L6M A;  1T4L B;  4X64 E;  2M1S A;  1NZ0 A;  2VE7 C;  1A6F A;  1FJG E;  2BV3 A;  1HR0 I;  1PVG A;  1WHQ A;  1Z0G A;  4NXM I;  2Q2E B;  3C4T A;  2RSM A;  1EA6 A;  3IWD A;  1USU A;  3CWV A;  4DPY A;  4AQY I;  4JI5 E;  4LFB E;  1J5E I;  2H36 X;  4ZVI A;  4WPY A;  4LF6 E;  2L3C A;  1UIL A;  4DR7 E;  5BR8 I;  2RS6 A;  2DMY A;  4GEQ B;  2F8B A;  1FWK A;  3OTO E;  2IHR 1;  1ZM9 A;  2Z5B A;  2X36 A;  1Z0V A;  3B8H A;  3J81 C;  3V5R A;  4JYA E;  1J26 A;  2PNM A;  4DR4 E;  2IOP A;  1GQE A;  2XEX A;  4MYT A;  2IOQ A;  1YZ9 A;  2V2Z A;  3ADL A;  1Z5C A;  4IZK A;  2UU9 I;  1N36 E;  1Z5A A;  4B3T E;  1ELO A;  2FV4 B;  3K6Q A;  4LF9 E;  1QU6 A;  2HHH E;  1KVK A;  1RR9 A;  4IZJ D;  4JI5 I;  4LFB I;  3H4L A;  3AV0 A;  5AE2 A;  1KIJ A;  2R42 A;  2F4V E;  1X48 A;  4K0K E;  3P1X A;  2Z5B B;  2KHX A;  4LF6 I;  1FKA E;  2E5L E;  4DR7 I;  3WU3 A;  1WUU A;  4URL A;  2ZIT A;  1PKP A;  1FNM A;  5GMD A;  3OTO I;  3VK6 A;  4YHH I;  2UXD E;  2DB2 A;  4B3M E;  2UUB I;  4X62 E;  4X65 E;  2RTX A;  4DV4 E;  1FWL A;  2NUF A;  3QT8 A;  1T4N A;  2VQE E;  1IBM E;  1HNW I;  1NHJ A;  2L33 A;  3F6H A;  1WHN A;  2ODR C;  1N33 E;  1S16 A;  1N36 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...