1XMOE

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xmoE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmoE02
2LBSB 2L2MA 4YHHI 4OOGC 1EA6A 3T1YE 1IBKI 1HNWI 4PRXA 1QU6A 1J26A 2UUBE 3PYDA 2LJPA 2LRSA 1Z0TA 4LF6E 3QT8A 5FLXQ 4FN5A 1N0UA 1XMOI 1RREA 4X64E 4URLA 3PYFA 1NHIA 4JI7I 2NA2A 3PYGA 3ZKBA 4B3MI 2J7KA 4DR7I 4LFBE 2V2VA 2WW4A 2E1RA 2UU9I 1Z59A 4HACA 5FLXC 4JI3I 4DV1I 3VYYA 3C4TA 4DUYE 1PVGA 3J7AM 1FNMA 2OI2A 2UUCI 4JI1E 4LF4E 4DV0E 1WHNA 4JI8E 1XMQE 4MYUA 4LF9E 4JI0I 1BKNA 4EMDA 2DEIA 1I94E 4KHPI 3GONA 1O0WA 2L3CA 3T1YI 2DMYA 1RC7A 2CZ9A 2B3TB 4DUZE 3HULA 2UUBI 4LFCE 1S4EA 2B7TA 1ZM2A 2L3JA 4JYAE 4LF6I 4M30A 2ZM6E 4DXLA 4USMA 4I3HA 1IBLE 1Z5AA 4Z7CA 1HNZE 1STUA 4GKJE 4X64I 5BR8I 1DI2A 4JI6I 2UXBE 2LUQA 2X7IA 4LFBI 2NUEA 4DPYA 4P52A 2YT4A 1HNXE 2A2CA 1KKHA 2EFGA 4DR6E 1N33I 4DV7I 3ZZTA 2L2KB 2L33A 2NPFA 2N3HA 4DUYI 1Z0BA 3V5RA 4FWHA 2XEXA 1FKAE 4P7AA 4JI1I 4LF4I 4DV0I 4LF5E 4JI8I 1ZM9A 4B3RE 1U2RA 1ZBTA 5LL6R 2X36A 4DR4I 4WYQB 3ADIA 4DR5E 4JI4E 1FJGE 2DEJA 5IT9C 4USKA 1X47A 4DV5E 1Z5BA 4DUZI 2MDRA 2B7VA 4NXNE 4LFCI 1S16A 3OTOI 3V2UC 4JI2E 3WU4A 3ZZ0A 2VQEI 2ZM6I 3H4LA 1ZM4A 1MG7A 1QZRA 2F4VE 4GKJI 2LJHA 5LMUE 2R42A 4PRVA 1HR0I 2UXBI 4OX9E 1EKZA 4JG4A 1MU5A 4GKKE 2ZBKB 2BV3A 2E5LE 4DR6I 2GS8A 3CWVA 5IWAI 4LF8E 4DR2I 5LMNE 2JVAA 4DPWA 5L3JA 1UEKA 1Z0WA 4NXME 4R1FA 5A2QC 4HYMA 2UXDI 4HY1A 1VISA 3D4JA 1UHZA 2KHXA 1N34I 1H7UA 1WHQA 4LF5I 4X62I 1N0VC 4AQYI 4JI4I 1FJGI 1X48A 4DR1E 4DV5I 5GMDA 1YZ9A 3WU5A 4NXNI 1XNRE 4JI2I 2HFSA 4YY3E 2V2QA 2AJ4A 3LNUA 1K47A 1KTVA 3LPSA 1MX0A 1H74A 2HFUA 2RS6A 1NHHA 5LMUI 3P1XA 4OX9I 1KIJA 1OJ4A 4DKKA 3Q1QA 4DV2E 4GKKI 3JAMC 1FI4A 2RTXA 2UXCE 2E5LI 4LFAE 4X66E 4DV4E 4X65E 1B62A 3T1HE 1Z0VA 2JY9A 4B3SE 4LF8I 1XNQE 3QT5A 2A2DA 1IBME 4XTJA 4NXMI 5CFFE 3B78A 3K17A 4UT4A 2NUFA 4DV6E 1UILA 2UUAE 2LUPB 4JV5E 4FW9A 1NHJA 4DV3E 5IT9Q 1DARA 2N3GA 1FWLA 2RSMA 3ZM7A 4DR1I 1XMOE 2IHR1 1XMQI 4LF9I 4M2ZA 1ZXNA 1FWKA 1T4NA 4JI7E 4K0KE 1XNRI 1I94I 4YY3I 2HK2A 4WUDA 4DU8A 3ZZUA 1T4OA 3VYXA 4HACB 2HHHE 3QT7A 1NZ0A 3C4BA 4JYAI 4JI3E 4DV1E 4KQVA 4DV2I 3J81Q 1IBLI 4FWDA 2CPNA 5A2QQ 1HNZI 2UXCI 4X66I 4DV4I 2V2ZA 4JI5E 4X65I 3T1HI 3M6AA 4B3SI 2BM0A 3LLHA 1GQEA 1IBMI 3F0NA 1HNXI 4JI0E 4DPUA 4LF7E 4KHPE 4DV6I 2UUAI 4JV5I 3J7Yp 1N36E 2VQFE 3J81C 4X8WA 1PIEA 4DV3I 4DU7A 3K1JA 3ZKDA 1N32E 2BM1A 4PU9A 2DB2A 4B3RI 1YYWA 5BR8E 4JI6E 1ZXMA 2LTSA 4K0KI 4DR5I 1RR9A 4WUBA 4RPFA 4M1KA 2HHHI 3JAMQ 1N33E 4DV7E 1H73A 3QT6A 1J5EE 2EZ6A 4DR3E 5GMEA 4Z7YA 3J80Q 1EI1A 1B63A 1X49A 2F4VI 4JI5I 3PYEA 1T4LB 4UTGA 2HK3A 2V8PA 2RS7A 3B82A 2L2NA 2V34A 4DR4E 1H7SA 3LTOA 1H72C 1ZM3A 4LF7I 4DPXA 3ADGA 4B3TE 5LMNI 1N36I 2VQFI 3J80C 3HTXA 1D6TA 1Z0EA 1Z0GA 1RQ0A 2HKEA 3OTOE 4YHHE 1N32I 2VQEE 1IBKE 1HNWE 4WFTA 1PKPA 2VF3A 3B8HA 2Q2EB 1HR0E 2NUGA 1A6FA 4ED4A 1YYKA 4DPTA 4MYTA 5IWAE 1KVKA 1XHKA 3ADLA 1J5EI 4DR2E 4DR3I 4B3ME 4DR7E 2UXDE 2HKJA 4WUCA 1ELOA 4FWGA 3J7AG 1N34E 2UU9E 3ADJA 2DIXA 1WUUA 1YYOA 3WU6A 4ZVIA 3WU3A 4LFAI 2R3VA 4HXZA 4X62E 1Z0CA 2UUCE 1Z5CA 4AQYE 4B3TI 1XNQI 2ZITA 2LTRA
chains in the Genus database with same CATH superfamily
2LBSB 2EL6A 2EPAA 3P06A 2L2MA 2FGGA 3JTZA 2ELZA 1ZU1A 1P42A 4YHHI 4OOGC 1EA6A 3T1YE 2PNLA 1IBKI 4BA2B 1YUJA 1HNWI 5KL7A 2HJJA 4PRXA 2VRDA 2BA0G 1QU6A 2H36X 4L5NC 3K85A 3KWRA 1J26A 1EH6A 1BB8A 4MLVA 1TF3A 2UUBE 3PYDA 2LJPA 3C6KA 2EE8A 2EP3A 2LRSA 4I8OA 4LF6E 1Z0TA 1PDAA 3QT8A 4OO1F 2M7QA 5FLXQ 4FN5A 3TQMA 1Y60A 3PRYA 1N0UA 2CG9A 3QG5C 2ENAA 2EM9A 4R2DA 1RREA 1XMOI 4M0VA 4X64E 4ZYEA 2ENHA 3PYFA 4URLA 3GMEA 1NHIA 4JI7I 4L8NA 2NA2A 4Q35B 3PYGA 3KZZA 4MU3A 2V87A 3ZKBA 2O1UA 4OO1A 2JOXA 2J7KA 4B3MI 4DR7I 4LFBE 3M7ND 2JWOA 3AV0A 2V2VA 2WW4A 1NEIA 3M85G 3MHHC 5K36F 2JP9A 1LLMC 4O43A 3BBGA 2E1RA 1IQSA 1X3CA 2UU9I 1Z59A 2F8BA 2Q8UA 4HACA 5FLXC 4JI3I 4DV1I 3VYYA 2EMAA 2L6MA 4WSPA 1BBOA 1MEYC 2C37A 3C4TA 4DUYE 1PVGA 3J7AM 1FNMA 2OI2A 2DLKA 2EN6A 2I9IA 5K36A 4BA1A 2UUCI 5JEAC 2KONA 2C39B 2EPXA 4JI1E 4LF4E 2N8XA 3VK6A 4DV0E 1WHNA 4IS9A 3F6HA 2C38B 2EMFA 4JI8E 2CTDA 3GLLA 2WBSA 1XMQE 3HPZA 1WRJA 4LF9E 4MYUA 4Q28A 1BKNA 4JI0I 4EMDA 3RMPA 2DEIA 2PO0B 4QNJA 5C0XC 1I94E 4KHPI 4BC7A 2EPPA 3GONA 1O0WA 2L3CA 2EN7A 3T1YI 2Z5CA 2DMYA 1RC7A 3EPJA 1UDNA 5JEAD 4GQUA 2CZ9A 2B3TB 4KZSA 4DUZE 3HULA 5AASA 4IFDA 2UUBI 4LFCE 2EM7A 1S4EA 2B7TA 3BIDA 1ZM2A 2L3JA 2YTQA 1WXRA 1N3GA 4JYAE 4LF6I 3MHSC 4M30A 2ZM6E 3Q6MA 4DXLA 2LVHA 4I3HA 4USMA 5C0XD 1IBLE 1Z5AA 4Z7CA 2RQLA 4R2CA 1HNZE 1STUA 3OMLA 4GKJE 1A1IA 4X64I 5BR8I 1DI2A 4JI6I 3DD6A 2UXBE 1A1LA 2VF1A 2LUQA 2EMCA 2X7IA 1ZR9A 2EMHA 4LFBI 1QNTA 2NUEA 4DPYA 4P52A 2YT4A 2EPOA 1HNXE 2A2CA 2GO4A 2DMIA 1KKHA 2EFGA 4DR6E 1N33I 2LE2A 4DV7I 3ZZTA 4FW3A 2D9HA 2L2KB 2PO1A 2L33A 4R8OA 4OO1E 2IERA 2GO3A 3KRNA 2EPLX 2PNZA 2NPFA 5IXMB 2N3HA 1BBGA 4DUYI 2BBGA 1Z0BA 4WXDA 3V5RA 2EMYA 1R6MA 2XEXA 2LJUA 1FKAE 4FWHA 2VE7C 2BA1D 4P7AA 4JI1I 4LF4I 2K4VA 4DV0I 2YSPA 2YSOA 2WP8A 5TSEA 4LF5E 4JI8I 1ZM9A 4B3RE 1U2RA 3M7NG 1UDOA 5K36E 5JEAF 1ZBTA 5LL6R 4OO1B 2BR2A 2X36A 4DR4I 4NHRA 4WYQB 1EH7A 5KL6A 3ADIA 1JK1A 4DR5E 1USUA 1F2IG 4JI4E 1FJGE 2DEJA 2CVEA 4U3BA 5IT9C 4USKA 4MQYA 1EH8A 1X47A 4DV5E 1WJPA 1Z5BA 4DUZI 5C0XF 4FW4A 5A6KA 2MDRA 1Y6ZA 2B7VA 5JEAA 4NXNE 2EMIA 3EPHA 1S16A 4LFCI 3OTOI 2C37B 2FV4B 3CDJA 3V2UC 4JI2E 2JE6A 4IS1C 3VHTB 2EPRA 2K7IA 4MU1A 1A1KA 3WU4A 3ZZ0A 2VQEI 5K36B 4P7DA 2ZM6I 3H4LA 1ZM4A 4BA1B 2PO2A 3LMLA 2PRTA 2EM5A 4IFDE 2YU8A 4NBQA 1MG7A 2YRMA 1QZRA 5C0XA 2F4VE 2V86A 4GKJI 2ENCA 2LJHA 1HK7A 5LMUE 2R42A 4PRVA 1HR0I 2EOIA 2UXBI 2WBUA 3THOB 4OX9E 1NCSA 1EKZA 4JG4A 1MU5A 4GKKE 2ZBKB 2BV3A 2Z5CB 4LU9A 2YWQA 2E5LE 1X6HA 2V85A 4DR6I 2GS8A 3CWVA 5DNLA 5IWAI 2JEAA 4IFDB 2EN2A 4LF8E 4DR2I 5LMNE 2JVAA 2YPNA 1G2DC 1IMUA 2WNRB 4LCHA 4DPWA 2YTJA 5L3JA 5A2QC 1UEKA 4NXME 1Z0WA 4R1FA 4HYMA 2UXDI 4HY1A 4O24A 4BMJA 2EOJA 1VISA 3D4JA 4O4KA 2EL4A 5AE1A 4F2JC 1UHZA 2KHXA 2LO3A 2EPZA 1A1GA 1H7UA 5DNYA 1N34I 1WHQA 5DROA 4R03A 4MDTA 5EL9A 4LF5I 2GHFA 3HKMA 3AUZA 4TUGA 1X6EA 2EPUA 4IZJD 4X62I 2A25A 2EOOA 1X6FA 3EQ1A 1N0VC 4AQYI 4F9BB 3U1KA 4JI4I 2EPKX 1FJGI 1SFEA 2PO1B 1X48A 3UK3C 4DR1E 4DV5I 5GMDA 1YZ9A 4MLQA 3WU5A 4AIMA 4NXNI 4AM3A 2EOZA 2EL5A 1KYQA 2EQ0A 1XNRE 2BA1G 5DNXA 2HFSA 4YY3E 4JI2I 5F3WA 5ADZA 2V2QA 2AJ4A 4TUIA 3LNUA 4MU4A 3DJWA 1K47A 1KTVA 3LPSA 2IOPA 4N4RB 1MX0A 2YTPA 3B4TA 2DLQA 2J7JA 1H74A 1RHYA 5A69A 2WP8B 2HFUA 3PS1A 2RS6A 4DMIA 1NHHA 5LMUI 3HPSA 2BR2B 3EPKA 5AE2A 3P1XA 4F9AB 3P76A 4OX9I 2V88A 3HJCA 2EOQA 1KIJA 4WSGA 4DKKA 1OJ4A 3L7ZA 4DV2E 3Q1QA 3JAMC 2EM4A 4OZEA 1FI4A 2RTXA 4GKKI 2AE8A 4F6NA 2UXCE 3ECRA 2O1VA 4LFAE 2E5LI 5T6JA 4X66E 4DV4E 4IZKA 4X65E 1B62A 4J8ZA 2YTDA 3IWCA 3T1HE 1Z0VA 2JY9A 4B3SE 2JR1A 2WBTA 4LF8I 1XNQE 2JE6B 4HEIA 2GPIA 3L00A 2NN6C 3HQ1A 3P3EA 3QT5A 4BCAA 2E1MA 2A2DA 2HC5A 3KZYA 1IBME 1E3HA 4XTJA 4NXMI 2RPCA 4ZYHA 2HGHA 2PO2B 5CFFE 1L4SA 3B78A 2PNMA 3K17A 4IJDA 2V8QB 3UHMA 3THNA 2NUFA 4DV6E 1UILA 2LMZA 2LUPB 2UUAE 4JV5E 4FW9A 4R2EA 1GTKA 2JXPA 5EKWA 1NHJA 1AAYA 3HXLA 4R2AA 4LCGA 2V89A 4DV3E 2YU5A 5FWKA 5IT9Q 2EQ3A 2J65A 4KWYA 2NN6D 2CSHA 1DARA 2N3GA 5KL2A 1FWLA 1USVA 2LT7A 2IOQA 2RSMA 3ZM7A 2CGEA 2EM2A 4IZJA 2JEAB 4DR1I 3Q6NA 2FTXB 3IWBA 3ZOQB 2YZTA 2MKNA 3FIGA 1XMOE 2EN4A 2IHR1 1XMQI 2EOHA 3DF6A 4LF9I 2EMGA 4M2ZA 2L92A 1ZXNA 1FWKA 1T4NA 4JI7E 5AC5A 4K0KE 1XNRI 1I94I 4YY3I 1PJQA 4BHCA 2HK2A 4WUDA 4DU8A 3ZZUA 5K36C 2WZOA 1T4OA 1UDSA 4N3OA 4ZYGA 2EOSA 2KOUA 4BC9A 3VYXA 2HHHE 4HACB 3QT7A 1NZ0A 3H1CA 2F1DA 4GEQB 2GLIA 4M9VC 3C4BA 4JYAI 1T38A 2EM3A 4WPYA 2LCEA 2EQ1A 2YTEA 5KL4A 4WX9A 4DV1E 4JI3E 4KQVA 4DV2I 3J81Q 2EN3A 1IBLI 1Y4UA 1YHCA 4LCFA 4FWDA 2CPNA 5A2QQ 1HNZI 1OYRA 2UXCI 4X66I 4NZVA 4FW7A 4DV4I 2V2ZA 4JI5E 4X65I 3EPLA 4IFDC 3T1HI 1DGCA 4FK5C 1YUIA 3M6AA 4B3SI 2BM0A 2EJ4A 4R2PA 3LLHA 1GQEA 2WCC3 1IBMI 2YTNA 3F0NA 3M99B 1GZ6A 3PS2A 4P78A 2LV2A 4BBYA 4ZYDA 1HNXI 2G7HA 4JI0E 4DPUA 2M4IA 1ZBQA 4LF7E 4KHPE 1MGTA 2Z5BA 2NN6F 3PS3A 1UBDC 4DV6I 2UUAI 1KJKA 3K6QA 4JV5I 4IFDD 3J7Yp 1N36E 2VQFE 3J81C 2MC6A 4X8WA 1A1HA 2O3ZA 1PIEA 4OKGA 4R2RA 4DV3I 4DU7A 2R76A 5KL3A 3L7ZB 2Z5EA 1E3PA 3K1JA 4ISAA 3ZKDA 1XXEA 4HTGA 2EWLA 1N32E 2BM1A 3P3CA 5AC4A 2NN6A 2EMLA 4IZKB 3MSWA 1B69A 4PU9A 2DB2A 1IQOA 4LOMA 3F6GA 5A6BD 3U1YA 2EN1A 2JEBA 4B3RI 1X5WA 1YYWA 2EOYA 2EPNA 5BR8E 2EMBA 1PJSA 2BB8A 2ODRC 4JI6E 1OYPA 1ZXMA 2LTSA 2IESA 2O1WA 4K0KI 2YTFA 5AE3A 4R2SA 3CDIA 1RR9A 4LPFA 4DR5I 4WUBA 1JK2A 2M1SA 1A1FA 2MDGA 2DRPA 4RPFA 4MU0A 4M1KA 1ZAAC 2HHHI 3JAMQ 4QNKA 1N33E 4X9JA 4DV7E 2PNZB 1H73A 3QT6A 4LTYA 2L8TA 1J5EE 2EZ6A 2ODRD 4DR3E 2CT1A 5GMEA 4Z7YA 2YTIA 3J80Q 3GCMA 1EI1A 5JEAE 1UDQA 2EMZA 4IZJB 1B63A 1X49A 2V83A 2F4VI 1DQ3A 5A6JA 4JI5I 3PYEA 4BA2A 1TN9A 4U3DA 4BS9A 1TF6A 2YRHA 4UT4A 1T4LB 4UTGA 2MC5A 2JPAA 2BA0D 2HK3A 2V8PA 2RS7A 3B82A 5C0XE 1PJTA 5KL5A 4IFDF 2L2NA 2V34A 2EMWA 4DR4E 1H7SA 3LTOA 1H72C 1ZM3A 4LF7I 1T39A 5DRPA 4DPXA 3ADGA 1YH8A 4FW5A 2JOBA 5JEAB 4B3TE 4R2QA 1VI7A 1SR9A 5LMNI 1N36I 2VQFI 3J80C 2I13A 3HTXA 2JYAA 5ELWA 1D6TA 2MKDA 1Z0EA 4O5GA 1Z0GA 2YRKA 1RQ0A 1Y5YA 3OTOE 2HKEA 1Y4SA 2RSIA 4YHHE 1P47A 2WNRA 1N32I 2EMKA 2VQEE 5C0XB 2EMXA 1IBKE 2E72A 4RH8A 1HNWE 4WFTA 5IV8B 2EN8A 2EPCA 1PKPA 5LLQA 2EM6A 2VF3A 3IWDA 2DGCA 3B8HA 3M85D 3P3GA 2Q2EB 4OO1C 2B9DA 4J3DA 5DRQA 2VESA 5A6BA 2NN6E 1HR0E 2M9AA 2EOMA 4WXCA 1YFHA 4AIDA 3NZKA 2EOFA 2EOXA 2NUGA 1A6FA 2Z5BB 4ED4A 4FW6A 1YYKA 2R1FA 4GZNC 1UN6B 4DPTA 4MYTA 3BF2A 1RMDA 4F9CB 2C39A 1AH5A 5IWAE 1KVKA 2O1TA 3C6MA 1XHKA 4OO1D 3BGHA 2C38A 3H09A 3ADLA 2EOEA 1J5EI 4DR2E 5DRRA 3JU0A 4DR3I 2EM0A 4B3ME 1YSAC 5A6AA 4F54A 4DR7E 2NN6B 2PO0A 2UXDE 2HKJA 4WUCA 1Z1BA 2EM8A 1ELOA 1YPNA 4BHBA 4FWGA 1R6LA 2JEBB 4F6MA 3J7AG 1G2FC 2NABA 2YTOA 1N34E 1OYSA 2UU9E 3ADJA 2DIXA 1WUUA 1YYOA 1A1JA 2JT2A 3WU6A 2DSYA 4ZVIA 5K36D 4RHBB 2ELYA 3WU3A 4LFAI 2GQ0A 2R3VA 4HXZA 4X62E 1Z0CA 2UUCE 1Z5CA 4AQYE 2EPMX 4B3TI 2ADRA 2YTGA 2EORA 1XNQI 2ZITA 2LTRA
chains in the Genus database with same CATH topology
2LBSB 3P06A 2L2MA 2FGGA 3JTZA 4YHHI 4OOGC 1EA6A 3T1YE 2PNLA 1IBKI 1HNWI 4PRXA 3K85A 1QU6A 2H36X 4L5NC 3KWRA 1J26A 2UUBE 3PYDA 2LJPA 2LRSA 4I8OA 4LF6E 1Z0TA 3QT8A 2M7QA 5FLXQ 4FN5A 3PRYA 1N0UA 2CG9A 1XMOI 1RREA 4M0VA 4X64E 4URLA 3PYFA 1NHIA 4JI7I 4L8NA 2NA2A 3PYGA 2V87A 3ZKBA 2O1UA 2JOXA 2J7KA 4B3MI 4DR7I 4LFBE 2JWOA 3AV0A 2V2VA 2WW4A 2E1RA 2UU9I 1Z59A 2F8BA 4HACA 5FLXC 4JI3I 4DV1I 3VYYA 2L6MA 4WSPA 3C4TA 4DUYE 1PVGA 3J7AM 1FNMA 2OI2A 2UUCI 2KONA 4JI1E 4LF4E 3VK6A 4DV0E 1WHNA 3F6HA 4JI8E 1XMQE 3HPZA 4MYUA 4LF9E 4Q28A 1BKNA 4JI0I 4EMDA 3RMPA 2DEIA 1I94E 4KHPI 4BC7A 3GONA 1O0WA 2L3CA 3T1YI 2Z5CA 2DMYA 1RC7A 2CZ9A 2B3TB 4KZSA 4DUZE 3HULA 5AASA 2UUBI 4LFCE 1S4EA 2B7TA 1ZM2A 2L3JA 4JYAE 1WXRA 4LF6I 4M30A 2ZM6E 3Q6MA 4DXLA 4USMA 4I3HA 1IBLE 1Z5AA 4Z7CA 1HNZE 1STUA 3OMLA 4GKJE 4X64I 5BR8I 1DI2A 4JI6I 2UXBE 2VF1A 2LUQA 2X7IA 4LFBI 2NUEA 4DPYA 4P52A 2YT4A 1HNXE 2A2CA 1KKHA 2EFGA 4DR6E 1N33I 2LE2A 4DV7I 3ZZTA 2L2KB 2L33A 4R8OA 2NPFA 2N3HA 4DUYI 1Z0BA 3V5RA 4FWHA 2XEXA 1FKAE 2VE7C 4P7AA 4JI1I 4LF4I 2K4VA 4DV0I 4LF5E 4JI8I 1ZM9A 4B3RE 1U2RA 1ZBTA 5LL6R 2X36A 4DR4I 4WYQB 3ADIA 4DR5E 1USUA 4JI4E 1FJGE 2DEJA 5IT9C 4USKA 1X47A 4DV5E 1Z5BA 4DUZI 2MDRA 1Y6ZA 2B7VA 4NXNE 4LFCI 1S16A 3OTOI 2FV4B 3V2UC 4JI2E 3WU4A 3ZZ0A 2VQEI 4P7DA 2ZM6I 3H4LA 1ZM4A 3LMLA 1MG7A 1QZRA 2F4VE 2V86A 4GKJI 2LJHA 1HK7A 5LMUE 2R42A 4PRVA 1HR0I 2UXBI 4OX9E 1EKZA 4JG4A 1MU5A 4GKKE 2ZBKB 2BV3A 2Z5CB 4LU9A 2E5LE 2V85A 4DR6I 2GS8A 3CWVA 5IWAI 4LF8E 4DR2I 5LMNE 2JVAA 4DPWA 5L3JA 5A2QC 1UEKA 4NXME 1Z0WA 4R1FA 4HYMA 2UXDI 4HY1A 4BMJA 1VISA 3D4JA 5AE1A 1UHZA 2KHXA 1N34I 1H7UA 5DNYA 1WHQA 4R03A 4LF5I 3AUZA 4TUGA 4IZJD 4X62I 1N0VC 4AQYI 4F9BB 4JI4I 1FJGI 1X48A 4DR1E 4DV5I 5GMDA 1YZ9A 3WU5A 4NXNI 1XNRE 4JI2I 2HFSA 4YY3E 5F3WA 5ADZA 2V2QA 2AJ4A 4TUIA 3LNUA 3DJWA 1K47A 1KTVA 3LPSA 2IOPA 1MX0A 1H74A 2HFUA 2RS6A 4DMIA 1NHHA 5LMUI 3HPSA 5AE2A 3P1XA 4F9AB 4OX9I 2V88A 3HJCA 1KIJA 1OJ4A 4DKKA 3Q1QA 4DV2E 4GKKI 3JAMC 1FI4A 2RTXA 2UXCE 2O1VA 2E5LI 4LFAE 5T6JA 4X66E 4DV4E 4IZKA 4X65E 1B62A 4J8ZA 3IWCA 3T1HE 1Z0VA 2JY9A 4B3SE 2JR1A 4LF8I 1XNQE 3QT5A 3HQ1A 4BCAA 2E1MA 2A2DA 1IBME 4XTJA 4NXMI 5CFFE 3B78A 2PNMA 3K17A 2V8QB 4UT4A 2NUFA 4DV6E 2LMZA 1UILA 2LUPB 2UUAE 4JV5E 4FW9A 1NHJA 3HXLA 2V89A 4DV3E 5FWKA 5IT9Q 1DARA 2N3GA 1USVA 1FWLA 2IOQA 2RSMA 3ZM7A 2CGEA 4IZJA 4DR1I 3Q6NA 2FTXB 3IWBA 3ZOQB 2YZTA 3FIGA 1XMOE 2IHR1 1XMQI 3DF6A 4LF9I 4M2ZA 2L92A 1ZXNA 1FWKA 1T4NA 4JI7E 4K0KE 1XNRI 1I94I 4YY3I 2HK2A 4WUDA 4DU8A 3ZZUA 2WZOA 1T4OA 4N3OA 2KOUA 4BC9A 3VYXA 2HHHE 4HACB 3QT7A 1NZ0A 4GEQB 3C4BA 4JYAI 4WPYA 4DV1E 4JI3E 4KQVA 4DV2I 3J81Q 1IBLI 1Y4UA 4FWDA 2CPNA 5A2QQ 1HNZI 2UXCI 4X66I 4DV4I 2V2ZA 4JI5E 4X65I 3T1HI 3M6AA 4B3SI 2BM0A 3LLHA 1GQEA 1IBMI 3F0NA 1GZ6A 4P78A 4BBYA 1HNXI 2G7HA 4JI0E 4DPUA 2M4IA 1ZBQA 4LF7E 4KHPE 2Z5BA 4DV6I 2UUAI 4JV5I 3K6QA 3J7Yp 1N36E 2VQFE 3J81C 2MC6A 4X8WA 1PIEA 4DV3I 4DU7A 2Z5EA 3K1JA 3ZKDA 2EWLA 1N32E 2BM1A 4IZKB 3MSWA 4PU9A 2DB2A 3F6GA 4B3RI 1YYWA 5BR8E 4JI6E 2ODRC 2O1WA 1ZXMA 2LTSA 4K0KI 4DR5I 5AE3A 1RR9A 4WUBA 2M1SA 4RPFA 4M1KA 2HHHI 3JAMQ 1N33E 4DV7E 1H73A 3QT6A 4LTYA 2L8TA 1J5EE 2EZ6A 2ODRD 4DR3E 5GMEA 4Z7YA 3J80Q 1EI1A 4IZJB 1B63A 1X49A 2V83A 2F4VI 1DQ3A 4JI5I 3PYEA 4BS9A 1T4LB 4UTGA 2MC5A 2HK3A 2V8PA 2RS7A 3B82A 2L2NA 2V34A 4DR4E 1H7SA 3LTOA 1H72C 1ZM3A 4LF7I 4DPXA 3ADGA 2JOBA 4B3TE 1SR9A 5LMNI 1N36I 2VQFI 3J80C 3HTXA 1D6TA 1Z0EA 1Z0GA 1RQ0A 2HKEA 3OTOE 1Y4SA 4YHHE 1N32I 2VQEE 1IBKE 1HNWE 4WFTA 1PKPA 2VF3A 3B8HA 3IWDA 2Q2EB 2B9DA 1HR0E 2NUGA 1A6FA 2Z5BB 4ED4A 1YYKA 4DPTA 4MYTA 4F9CB 5IWAE 1KVKA 2O1TA 1XHKA 3H09A 3ADLA 1J5EI 4DR2E 4DR3I 3JU0A 4B3ME 4F54A 4DR7E 2UXDE 2HKJA 4WUCA 1ELOA 4FWGA 3J7AG 1N34E 2UU9E 3ADJA 2DIXA 1WUUA 1YYOA 3WU6A 2DSYA 4ZVIA 3WU3A 4LFAI 2GQ0A 2R3VA 4HXZA 4X62E 1Z0CA 2UUCE 1Z5CA 4AQYE 4B3TI 1XNQI 2ZITA 2LTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBS B;  2L2M A;  4YHH I;  4OOG C;  1EA6 A;  3T1Y E;  1IBK I;  1HNW I;  4PRX A;  1QU6 A;  1J26 A;  2UUB E;  3PYD A;  2LJP A;  2LRS A;  1Z0T A;  4LF6 E;  3QT8 A;  5FLX Q;  4FN5 A;  1N0U A;  1XMO I;  1RRE A;  4X64 E;  4URL A;  3PYF A;  1NHI A;  4JI7 I;  2NA2 A;  3PYG A;  3ZKB A;  4B3M I;  2J7K A;  4DR7 I;  4LFB E;  2V2V A;  2WW4 A;  2E1R A;  2UU9 I;  1Z59 A;  4HAC A;  5FLX C;  4JI3 I;  4DV1 I;  3VYY A;  3C4T A;  4DUY E;  1PVG A;  3J7A M;  1FNM A;  2OI2 A;  2UUC I;  4JI1 E;  4LF4 E;  4DV0 E;  1WHN A;  4JI8 E;  1XMQ E;  4MYU A;  4LF9 E;  4JI0 I;  1BKN A;  4EMD A;  2DEI A;  1I94 E;  4KHP I;  3GON A;  1O0W A;  2L3C A;  3T1Y I;  2DMY A;  1RC7 A;  2CZ9 A;  2B3T B;  4DUZ E;  3HUL A;  2UUB I;  4LFC E;  1S4E A;  2B7T A;  1ZM2 A;  2L3J A;  4JYA E;  4LF6 I;  4M30 A;  2ZM6 E;  4DXL A;  4USM A;  4I3H A;  1IBL E;  1Z5A A;  4Z7C A;  1HNZ E;  1STU A;  4GKJ E;  4X64 I;  5BR8 I;  1DI2 A;  4JI6 I;  2UXB E;  2LUQ A;  2X7I A;  4LFB I;  2NUE A;  4DPY A;  4P52 A;  2YT4 A;  1HNX E;  2A2C A;  1KKH A;  2EFG A;  4DR6 E;  1N33 I;  4DV7 I;  3ZZT A;  2L2K B;  2L33 A;  2NPF A;  2N3H A;  4DUY I;  1Z0B A;  3V5R A;  4FWH A;  2XEX A;  1FKA E;  4P7A A;  4JI1 I;  4LF4 I;  4DV0 I;  4LF5 E;  4JI8 I;  1ZM9 A;  4B3R E;  1U2R A;  1ZBT A;  5LL6 R;  2X36 A;  4DR4 I;  4WYQ B;  3ADI A;  4DR5 E;  4JI4 E;  1FJG E;  2DEJ A;  5IT9 C;  4USK A;  1X47 A;  4DV5 E;  1Z5B A;  4DUZ I;  2MDR A;  2B7V A;  4NXN E;  4LFC I;  1S16 A;  3OTO I;  3V2U C;  4JI2 E;  3WU4 A;  3ZZ0 A;  2VQE I;  2ZM6 I;  3H4L A;  1ZM4 A;  1MG7 A;  1QZR A;  2F4V E;  4GKJ I;  2LJH A;  5LMU E;  2R42 A;  4PRV A;  1HR0 I;  2UXB I;  4OX9 E;  1EKZ A;  4JG4 A;  1MU5 A;  4GKK E;  2ZBK B;  2BV3 A;  2E5L E;  4DR6 I;  2GS8 A;  3CWV A;  5IWA I;  4LF8 E;  4DR2 I;  5LMN E;  2JVA A;  4DPW A;  5L3J A;  1UEK A;  1Z0W A;  4NXM E;  4R1F A;  5A2Q C;  4HYM A;  2UXD I;  4HY1 A;  1VIS A;  3D4J A;  1UHZ A;  2KHX A;  1N34 I;  1H7U A;  1WHQ A;  4LF5 I;  4X62 I;  1N0V C;  4AQY I;  4JI4 I;  1FJG I;  1X48 A;  4DR1 E;  4DV5 I;  5GMD A;  1YZ9 A;  3WU5 A;  4NXN I;  1XNR E;  4JI2 I;  2HFS A;  4YY3 E;  2V2Q A;  2AJ4 A;  3LNU A;  1K47 A;  1KTV A;  3LPS A;  1MX0 A;  1H74 A;  2HFU A;  2RS6 A;  1NHH A;  5LMU I;  3P1X A;  4OX9 I;  1KIJ A;  1OJ4 A;  4DKK A;  3Q1Q A;  4DV2 E;  4GKK I;  3JAM C;  1FI4 A;  2RTX A;  2UXC E;  2E5L I;  4LFA E;  4X66 E;  4DV4 E;  4X65 E;  1B62 A;  3T1H E;  1Z0V A;  2JY9 A;  4B3S E;  4LF8 I;  1XNQ E;  3QT5 A;  2A2D A;  1IBM E;  4XTJ A;  4NXM I;  5CFF E;  3B78 A;  3K17 A;  4UT4 A;  2NUF A;  4DV6 E;  1UIL A;  2UUA E;  2LUP B;  4JV5 E;  4FW9 A;  1NHJ A;  4DV3 E;  5IT9 Q;  1DAR A;  2N3G A;  1FWL A;  2RSM A;  3ZM7 A;  4DR1 I;  1XMO E;  2IHR 1;  1XMQ I;  4LF9 I;  4M2Z A;  1ZXN A;  1FWK A;  1T4N A;  4JI7 E;  4K0K E;  1XNR I;  1I94 I;  4YY3 I;  2HK2 A;  4WUD A;  4DU8 A;  3ZZU A;  1T4O A;  3VYX A;  4HAC B;  2HHH E;  3QT7 A;  1NZ0 A;  3C4B A;  4JYA I;  4JI3 E;  4DV1 E;  4KQV A;  4DV2 I;  3J81 Q;  1IBL I;  4FWD A;  2CPN A;  5A2Q Q;  1HNZ I;  2UXC I;  4X66 I;  4DV4 I;  2V2Z A;  4JI5 E;  4X65 I;  3T1H I;  3M6A A;  4B3S I;  2BM0 A;  3LLH A;  1GQE A;  1IBM I;  3F0N A;  1HNX I;  4JI0 E;  4DPU A;  4LF7 E;  4KHP E;  4DV6 I;  2UUA I;  4JV5 I;  3J7Y p;  1N36 E;  2VQF E;  3J81 C;  4X8W A;  1PIE A;  4DV3 I;  4DU7 A;  3K1J A;  3ZKD A;  1N32 E;  2BM1 A;  4PU9 A;  2DB2 A;  4B3R I;  1YYW A;  5BR8 E;  4JI6 E;  1ZXM A;  2LTS A;  4K0K I;  4DR5 I;  1RR9 A;  4WUB A;  4RPF A;  4M1K A;  2HHH I;  3JAM Q;  1N33 E;  4DV7 E;  1H73 A;  3QT6 A;  1J5E E;  2EZ6 A;  4DR3 E;  5GME A;  4Z7Y A;  3J80 Q;  1EI1 A;  1B63 A;  1X49 A;  2F4V I;  4JI5 I;  3PYE A;  1T4L B;  4UTG A;  2HK3 A;  2V8P A;  2RS7 A;  3B82 A;  2L2N A;  2V34 A;  4DR4 E;  1H7S A;  3LTO A;  1H72 C;  1ZM3 A;  4LF7 I;  4DPX A;  3ADG A;  4B3T E;  5LMN I;  1N36 I;  2VQF I;  3J80 C;  3HTX A;  1D6T A;  1Z0E A;  1Z0G A;  1RQ0 A;  2HKE A;  3OTO E;  4YHH E;  1N32 I;  2VQE E;  1IBK E;  1HNW E;  4WFT A;  1PKP A;  2VF3 A;  3B8H A;  2Q2E B;  1HR0 E;  2NUG A;  1A6F A;  4ED4 A;  1YYK A;  4DPT A;  4MYT A;  5IWA E;  1KVK A;  1XHK A;  3ADL A;  1J5E I;  4DR2 E;  4DR3 I;  4B3M E;  4DR7 E;  2UXD E;  2HKJ A;  4WUC A;  1ELO A;  4FWG A;  3J7A G;  1N34 E;  2UU9 E;  3ADJ A;  2DIX A;  1WUU A;  1YYO A;  3WU6 A;  4ZVI A;  3WU3 A;  4LFA I;  2R3V A;  4HXZ A;  4X62 E;  1Z0C A;  2UUC E;  1Z5C A;  4AQY E;  4B3T I;  1XNQ I;  2ZIT A;  2LTR A; 
#chains in the Genus database with same CATH topology
 2LBS B;  2EL6 A;  2EPA A;  3P06 A;  2L2M A;  2FGG A;  3JTZ A;  2ELZ A;  1ZU1 A;  1P42 A;  4YHH I;  4OOG C;  1EA6 A;  3T1Y E;  2PNL A;  1IBK I;  4BA2 B;  1YUJ A;  1HNW I;  5KL7 A;  2HJJ A;  4PRX A;  2VRD A;  2BA0 G;  1QU6 A;  2H36 X;  4L5N C;  3K85 A;  3KWR A;  1J26 A;  1EH6 A;  1BB8 A;  4MLV A;  1TF3 A;  2UUB E;  3PYD A;  2LJP A;  3C6K A;  2EE8 A;  2EP3 A;  2LRS A;  4I8O A;  4LF6 E;  1Z0T A;  1PDA A;  3QT8 A;  4OO1 F;  2M7Q A;  5FLX Q;  4FN5 A;  3TQM A;  1Y60 A;  3PRY A;  1N0U A;  2CG9 A;  3QG5 C;  2ENA A;  2EM9 A;  4R2D A;  1RRE A;  1XMO I;  4M0V A;  4X64 E;  4ZYE A;  2ENH A;  3PYF A;  4URL A;  3GME A;  1NHI A;  4JI7 I;  4L8N A;  2NA2 A;  4Q35 B;  3PYG A;  3KZZ A;  4MU3 A;  2V87 A;  3ZKB A;  2O1U A;  4OO1 A;  2JOX A;  2J7K A;  4B3M I;  4DR7 I;  4LFB E;  3M7N D;  2JWO A;  3AV0 A;  2V2V A;  2WW4 A;  1NEI A;  3M85 G;  3MHH C;  5K36 F;  2JP9 A;  1LLM C;  4O43 A;  3BBG A;  2E1R A;  1IQS A;  1X3C A;  2UU9 I;  1Z59 A;  2F8B A;  2Q8U A;  4HAC A;  5FLX C;  4JI3 I;  4DV1 I;  3VYY A;  2EMA A;  2L6M A;  4WSP A;  1BBO A;  1MEY C;  2C37 A;  3C4T A;  4DUY E;  1PVG A;  3J7A M;  1FNM A;  2OI2 A;  2DLK A;  2EN6 A;  2I9I A;  5K36 A;  4BA1 A;  2UUC I;  5JEA C;  2KON A;  2C39 B;  2EPX A;  4JI1 E;  4LF4 E;  2N8X A;  3VK6 A;  4DV0 E;  1WHN A;  4IS9 A;  3F6H A;  2C38 B;  2EMF A;  4JI8 E;  2CTD A;  3GLL A;  2WBS A;  1XMQ E;  3HPZ A;  1WRJ A;  4LF9 E;  4MYU A;  4Q28 A;  1BKN A;  4JI0 I;  4EMD A;  3RMP A;  2DEI A;  2PO0 B;  4QNJ A;  5C0X C;  1I94 E;  4KHP I;  4BC7 A;  2EPP A;  3GON A;  1O0W A;  2L3C A;  2EN7 A;  3T1Y I;  2Z5C A;  2DMY A;  1RC7 A;  3EPJ A;  1UDN A;  5JEA D;  4GQU A;  2CZ9 A;  2B3T B;  4KZS A;  4DUZ E;  3HUL A;  5AAS A;  4IFD A;  2UUB I;  4LFC E;  2EM7 A;  1S4E A;  2B7T A;  3BID A;  1ZM2 A;  2L3J A;  2YTQ A;  1WXR A;  1N3G A;  4JYA E;  4LF6 I;  3MHS C;  4M30 A;  2ZM6 E;  3Q6M A;  4DXL A;  2LVH A;  4I3H A;  4USM A;  5C0X D;  1IBL E;  1Z5A A;  4Z7C A;  2RQL A;  4R2C A;  1HNZ E;  1STU A;  3OML A;  4GKJ E;  1A1I A;  4X64 I;  5BR8 I;  1DI2 A;  4JI6 I;  3DD6 A;  2UXB E;  1A1L A;  2VF1 A;  2LUQ A;  2EMC A;  2X7I A;  1ZR9 A;  2EMH A;  4LFB I;  1QNT A;  2NUE A;  4DPY A;  4P52 A;  2YT4 A;  2EPO A;  1HNX E;  2A2C A;  2GO4 A;  2DMI A;  1KKH A;  2EFG A;  4DR6 E;  1N33 I;  2LE2 A;  4DV7 I;  3ZZT A;  4FW3 A;  2D9H A;  2L2K B;  2PO1 A;  2L33 A;  4R8O A;  4OO1 E;  2IER A;  2GO3 A;  3KRN A;  2EPL X;  2PNZ A;  2NPF A;  5IXM B;  2N3H A;  1BBG A;  4DUY I;  2BBG A;  1Z0B A;  4WXD A;  3V5R A;  2EMY A;  1R6M A;  2XEX A;  2LJU A;  1FKA E;  4FWH A;  2VE7 C;  2BA1 D;  4P7A A;  4JI1 I;  4LF4 I;  2K4V A;  4DV0 I;  2YSP A;  2YSO A;  2WP8 A;  5TSE A;  4LF5 E;  4JI8 I;  1ZM9 A;  4B3R E;  1U2R A;  3M7N G;  1UDO A;  5K36 E;  5JEA F;  1ZBT A;  5LL6 R;  4OO1 B;  2BR2 A;  2X36 A;  4DR4 I;  4NHR A;  4WYQ B;  1EH7 A;  5KL6 A;  3ADI A;  1JK1 A;  4DR5 E;  1USU A;  1F2I G;  4JI4 E;  1FJG E;  2DEJ A;  2CVE A;  4U3B A;  5IT9 C;  4USK A;  4MQY A;  1EH8 A;  1X47 A;  4DV5 E;  1WJP A;  1Z5B A;  4DUZ I;  5C0X F;  4FW4 A;  5A6K A;  2MDR A;  1Y6Z A;  2B7V A;  5JEA A;  4NXN E;  2EMI A;  3EPH A;  1S16 A;  4LFC I;  3OTO I;  2C37 B;  2FV4 B;  3CDJ A;  3V2U C;  4JI2 E;  2JE6 A;  4IS1 C;  3VHT B;  2EPR A;  2K7I A;  4MU1 A;  1A1K A;  3WU4 A;  3ZZ0 A;  2VQE I;  5K36 B;  4P7D A;  2ZM6 I;  3H4L A;  1ZM4 A;  4BA1 B;  2PO2 A;  3LML A;  2PRT A;  2EM5 A;  4IFD E;  2YU8 A;  4NBQ A;  1MG7 A;  2YRM A;  1QZR A;  5C0X A;  2F4V E;  2V86 A;  4GKJ I;  2ENC A;  2LJH A;  1HK7 A;  5LMU E;  2R42 A;  4PRV A;  1HR0 I;  2EOI A;  2UXB I;  2WBU A;  3THO B;  4OX9 E;  1NCS A;  1EKZ A;  4JG4 A;  1MU5 A;  4GKK E;  2ZBK B;  2BV3 A;  2Z5C B;  4LU9 A;  2YWQ A;  2E5L E;  1X6H A;  2V85 A;  4DR6 I;  2GS8 A;  3CWV A;  5DNL A;  5IWA I;  2JEA A;  4IFD B;  2EN2 A;  4LF8 E;  4DR2 I;  5LMN E;  2JVA A;  2YPN A;  1G2D C;  1IMU A;  2WNR B;  4LCH A;  4DPW A;  2YTJ A;  5L3J A;  5A2Q C;  1UEK A;  4NXM E;  1Z0W A;  4R1F A;  4HYM A;  2UXD I;  4HY1 A;  4O24 A;  4BMJ A;  2EOJ A;  1VIS A;  3D4J A;  4O4K A;  2EL4 A;  5AE1 A;  4F2J C;  1UHZ A;  2KHX A;  2LO3 A;  2EPZ A;  1A1G A;  1H7U A;  5DNY A;  1N34 I;  1WHQ A;  5DRO A;  4R03 A;  4MDT A;  5EL9 A;  4LF5 I;  2GHF A;  3HKM A;  3AUZ A;  4TUG A;  1X6E A;  2EPU A;  4IZJ D;  4X62 I;  2A25 A;  2EOO A;  1X6F A;  3EQ1 A;  1N0V C;  4AQY I;  4F9B B;  3U1K A;  4JI4 I;  2EPK X;  1FJG I;  1SFE A;  2PO1 B;  1X48 A;  3UK3 C;  4DR1 E;  4DV5 I;  5GMD A;  1YZ9 A;  4MLQ A;  3WU5 A;  4AIM A;  4NXN I;  4AM3 A;  2EOZ A;  2EL5 A;  1KYQ A;  2EQ0 A;  1XNR E;  2BA1 G;  5DNX A;  2HFS A;  4YY3 E;  4JI2 I;  5F3W A;  5ADZ A;  2V2Q A;  2AJ4 A;  4TUI A;  3LNU A;  4MU4 A;  3DJW A;  1K47 A;  1KTV A;  3LPS A;  2IOP A;  4N4R B;  1MX0 A;  2YTP A;  3B4T A;  2DLQ A;  2J7J A;  1H74 A;  1RHY A;  5A69 A;  2WP8 B;  2HFU A;  3PS1 A;  2RS6 A;  4DMI A;  1NHH A;  5LMU I;  3HPS A;  2BR2 B;  3EPK A;  5AE2 A;  3P1X A;  4F9A B;  3P76 A;  4OX9 I;  2V88 A;  3HJC A;  2EOQ A;  1KIJ A;  4WSG A;  4DKK A;  1OJ4 A;  3L7Z A;  4DV2 E;  3Q1Q A;  3JAM C;  2EM4 A;  4OZE A;  1FI4 A;  2RTX A;  4GKK I;  2AE8 A;  4F6N A;  2UXC E;  3ECR A;  2O1V A;  4LFA E;  2E5L I;  5T6J A;  4X66 E;  4DV4 E;  4IZK A;  4X65 E;  1B62 A;  4J8Z A;  2YTD A;  3IWC A;  3T1H E;  1Z0V A;  2JY9 A;  4B3S E;  2JR1 A;  2WBT A;  4LF8 I;  1XNQ E;  2JE6 B;  4HEI A;  2GPI A;  3L00 A;  2NN6 C;  3HQ1 A;  3P3E A;  3QT5 A;  4BCA A;  2E1M A;  2A2D A;  2HC5 A;  3KZY A;  1IBM E;  1E3H A;  4XTJ A;  4NXM I;  2RPC A;  4ZYH A;  2HGH A;  2PO2 B;  5CFF E;  1L4S A;  3B78 A;  2PNM A;  3K17 A;  4IJD A;  2V8Q B;  3UHM A;  3THN A;  2NUF A;  4DV6 E;  1UIL A;  2LMZ A;  2LUP B;  2UUA E;  4JV5 E;  4FW9 A;  4R2E A;  1GTK A;  2JXP A;  5EKW A;  1NHJ A;  1AAY A;  3HXL A;  4R2A A;  4LCG A;  2V89 A;  4DV3 E;  2YU5 A;  5FWK A;  5IT9 Q;  2EQ3 A;  2J65 A;  4KWY A;  2NN6 D;  2CSH A;  1DAR A;  2N3G A;  5KL2 A;  1FWL A;  1USV A;  2LT7 A;  2IOQ A;  2RSM A;  3ZM7 A;  2CGE A;  2EM2 A;  4IZJ A;  2JEA B;  4DR1 I;  3Q6N A;  2FTX B;  3IWB A;  3ZOQ B;  2YZT A;  2MKN A;  3FIG A;  1XMO E;  2EN4 A;  2IHR 1;  1XMQ I;  2EOH A;  3DF6 A;  4LF9 I;  2EMG A;  4M2Z A;  2L92 A;  1ZXN A;  1FWK A;  1T4N A;  4JI7 E;  5AC5 A;  4K0K E;  1XNR I;  1I94 I;  4YY3 I;  1PJQ A;  4BHC A;  2HK2 A;  4WUD A;  4DU8 A;  3ZZU A;  5K36 C;  2WZO A;  1T4O A;  1UDS A;  4N3O A;  4ZYG A;  2EOS A;  2KOU A;  4BC9 A;  3VYX A;  2HHH E;  4HAC B;  3QT7 A;  1NZ0 A;  3H1C A;  2F1D A;  4GEQ B;  2GLI A;  4M9V C;  3C4B A;  4JYA I;  1T38 A;  2EM3 A;  4WPY A;  2LCE A;  2EQ1 A;  2YTE A;  5KL4 A;  4WX9 A;  4DV1 E;  4JI3 E;  4KQV A;  4DV2 I;  3J81 Q;  2EN3 A;  1IBL I;  1Y4U A;  1YHC A;  4LCF A;  4FWD A;  2CPN A;  5A2Q Q;  1HNZ I;  1OYR A;  2UXC I;  4X66 I;  4NZV A;  4FW7 A;  4DV4 I;  2V2Z A;  4JI5 E;  4X65 I;  3EPL A;  4IFD C;  3T1H I;  1DGC A;  4FK5 C;  1YUI A;  3M6A A;  4B3S I;  2BM0 A;  2EJ4 A;  4R2P A;  3LLH A;  1GQE A;  2WCC 3;  1IBM I;  2YTN A;  3F0N A;  3M99 B;  1GZ6 A;  3PS2 A;  4P78 A;  2LV2 A;  4BBY A;  4ZYD A;  1HNX I;  2G7H A;  4JI0 E;  4DPU A;  2M4I A;  1ZBQ A;  4LF7 E;  4KHP E;  1MGT A;  2Z5B A;  2NN6 F;  3PS3 A;  1UBD C;  4DV6 I;  2UUA I;  1KJK A;  3K6Q A;  4JV5 I;  4IFD D;  3J7Y p;  1N36 E;  2VQF E;  3J81 C;  2MC6 A;  4X8W A;  1A1H A;  2O3Z A;  1PIE A;  4OKG A;  4R2R A;  4DV3 I;  4DU7 A;  2R76 A;  5KL3 A;  3L7Z B;  2Z5E A;  1E3P A;  3K1J A;  4ISA A;  3ZKD A;  1XXE A;  4HTG A;  2EWL A;  1N32 E;  2BM1 A;  3P3C A;  5AC4 A;  2NN6 A;  2EML A;  4IZK B;  3MSW A;  1B69 A;  4PU9 A;  2DB2 A;  1IQO A;  4LOM A;  3F6G A;  5A6B D;  3U1Y A;  2EN1 A;  2JEB A;  4B3R I;  1X5W A;  1YYW A;  2EOY A;  2EPN A;  5BR8 E;  2EMB A;  1PJS A;  2BB8 A;  2ODR C;  4JI6 E;  1OYP A;  1ZXM A;  2LTS A;  2IES A;  2O1W A;  4K0K I;  2YTF A;  5AE3 A;  4R2S A;  3CDI A;  1RR9 A;  4LPF A;  4DR5 I;  4WUB A;  1JK2 A;  2M1S A;  1A1F A;  2MDG A;  2DRP A;  4RPF A;  4MU0 A;  4M1K A;  1ZAA C;  2HHH I;  3JAM Q;  4QNK A;  1N33 E;  4X9J A;  4DV7 E;  2PNZ B;  1H73 A;  3QT6 A;  4LTY A;  2L8T A;  1J5E E;  2EZ6 A;  2ODR D;  4DR3 E;  2CT1 A;  5GME A;  4Z7Y A;  2YTI A;  3J80 Q;  3GCM A;  1EI1 A;  5JEA E;  1UDQ A;  2EMZ A;  4IZJ B;  1B63 A;  1X49 A;  2V83 A;  2F4V I;  1DQ3 A;  5A6J A;  4JI5 I;  3PYE A;  4BA2 A;  1TN9 A;  4U3D A;  4BS9 A;  1TF6 A;  2YRH A;  4UT4 A;  1T4L B;  4UTG A;  2MC5 A;  2JPA A;  2BA0 D;  2HK3 A;  2V8P A;  2RS7 A;  3B82 A;  5C0X E;  1PJT A;  5KL5 A;  4IFD F;  2L2N A;  2V34 A;  2EMW A;  4DR4 E;  1H7S A;  3LTO A;  1H72 C;  1ZM3 A;  4LF7 I;  1T39 A;  5DRP A;  4DPX A;  3ADG A;  1YH8 A;  4FW5 A;  2JOB A;  5JEA B;  4B3T E;  4R2Q A;  1VI7 A;  1SR9 A;  5LMN I;  1N36 I;  2VQF I;  3J80 C;  2I13 A;  3HTX A;  2JYA A;  5ELW A;  1D6T A;  2MKD A;  1Z0E A;  4O5G A;  1Z0G A;  2YRK A;  1RQ0 A;  1Y5Y A;  3OTO E;  2HKE A;  1Y4S A;  2RSI A;  4YHH E;  1P47 A;  2WNR A;  1N32 I;  2EMK A;  2VQE E;  5C0X B;  2EMX A;  1IBK E;  2E72 A;  4RH8 A;  1HNW E;  4WFT A;  5IV8 B;  2EN8 A;  2EPC A;  1PKP A;  5LLQ A;  2EM6 A;  2VF3 A;  3IWD A;  2DGC A;  3B8H A;  3M85 D;  3P3G A;  2Q2E B;  4OO1 C;  2B9D A;  4J3D A;  5DRQ A;  2VES A;  5A6B A;  2NN6 E;  1HR0 E;  2M9A A;  2EOM A;  4WXC A;  1YFH A;  4AID A;  3NZK A;  2EOF A;  2EOX A;  2NUG A;  1A6F A;  2Z5B B;  4ED4 A;  4FW6 A;  1YYK A;  2R1F A;  4GZN C;  1UN6 B;  4DPT A;  4MYT A;  3BF2 A;  1RMD A;  4F9C B;  2C39 A;  1AH5 A;  5IWA E;  1KVK A;  2O1T A;  3C6M A;  1XHK A;  4OO1 D;  3BGH A;  2C38 A;  3H09 A;  3ADL A;  2EOE A;  1J5E I;  4DR2 E;  5DRR A;  3JU0 A;  4DR3 I;  2EM0 A;  4B3M E;  1YSA C;  5A6A A;  4F54 A;  4DR7 E;  2NN6 B;  2PO0 A;  2UXD E;  2HKJ A;  4WUC A;  1Z1B A;  2EM8 A;  1ELO A;  1YPN A;  4BHB A;  4FWG A;  1R6L A;  2JEB B;  4F6M A;  3J7A G;  1G2F C;  2NAB A;  2YTO A;  1N34 E;  1OYS A;  2UU9 E;  3ADJ A;  2DIX A;  1WUU A;  1YYO A;  1A1J A;  2JT2 A;  3WU6 A;  2DSY A;  4ZVI A;  5K36 D;  4RHB B;  2ELY A;  3WU3 A;  4LFA I;  2GQ0 A;  2R3V A;  4HXZ A;  4X62 E;  1Z0C A;  2UUC E;  1Z5C A;  4AQY E;  2EPM X;  4B3T I;  2ADR A;  2YTG A;  2EOR A;  1XNQ I;  2ZIT A;  2LTR A; 
#chains in the Genus database with same CATH homology
 2LBS B;  3P06 A;  2L2M A;  2FGG A;  3JTZ A;  4YHH I;  4OOG C;  1EA6 A;  3T1Y E;  2PNL A;  1IBK I;  1HNW I;  4PRX A;  3K85 A;  1QU6 A;  2H36 X;  4L5N C;  3KWR A;  1J26 A;  2UUB E;  3PYD A;  2LJP A;  2LRS A;  4I8O A;  4LF6 E;  1Z0T A;  3QT8 A;  2M7Q A;  5FLX Q;  4FN5 A;  3PRY A;  1N0U A;  2CG9 A;  1XMO I;  1RRE A;  4M0V A;  4X64 E;  4URL A;  3PYF A;  1NHI A;  4JI7 I;  4L8N A;  2NA2 A;  3PYG A;  2V87 A;  3ZKB A;  2O1U A;  2JOX A;  2J7K A;  4B3M I;  4DR7 I;  4LFB E;  2JWO A;  3AV0 A;  2V2V A;  2WW4 A;  2E1R A;  2UU9 I;  1Z59 A;  2F8B A;  4HAC A;  5FLX C;  4JI3 I;  4DV1 I;  3VYY A;  2L6M A;  4WSP A;  3C4T A;  4DUY E;  1PVG A;  3J7A M;  1FNM A;  2OI2 A;  2UUC I;  2KON A;  4JI1 E;  4LF4 E;  3VK6 A;  4DV0 E;  1WHN A;  3F6H A;  4JI8 E;  1XMQ E;  3HPZ A;  4MYU A;  4LF9 E;  4Q28 A;  1BKN A;  4JI0 I;  4EMD A;  3RMP A;  2DEI A;  1I94 E;  4KHP I;  4BC7 A;  3GON A;  1O0W A;  2L3C A;  3T1Y I;  2Z5C A;  2DMY A;  1RC7 A;  2CZ9 A;  2B3T B;  4KZS A;  4DUZ E;  3HUL A;  5AAS A;  2UUB I;  4LFC E;  1S4E A;  2B7T A;  1ZM2 A;  2L3J A;  4JYA E;  1WXR A;  4LF6 I;  4M30 A;  2ZM6 E;  3Q6M A;  4DXL A;  4USM A;  4I3H A;  1IBL E;  1Z5A A;  4Z7C A;  1HNZ E;  1STU A;  3OML A;  4GKJ E;  4X64 I;  5BR8 I;  1DI2 A;  4JI6 I;  2UXB E;  2VF1 A;  2LUQ A;  2X7I A;  4LFB I;  2NUE A;  4DPY A;  4P52 A;  2YT4 A;  1HNX E;  2A2C A;  1KKH A;  2EFG A;  4DR6 E;  1N33 I;  2LE2 A;  4DV7 I;  3ZZT A;  2L2K B;  2L33 A;  4R8O A;  2NPF A;  2N3H A;  4DUY I;  1Z0B A;  3V5R A;  4FWH A;  2XEX A;  1FKA E;  2VE7 C;  4P7A A;  4JI1 I;  4LF4 I;  2K4V A;  4DV0 I;  4LF5 E;  4JI8 I;  1ZM9 A;  4B3R E;  1U2R A;  1ZBT A;  5LL6 R;  2X36 A;  4DR4 I;  4WYQ B;  3ADI A;  4DR5 E;  1USU A;  4JI4 E;  1FJG E;  2DEJ A;  5IT9 C;  4USK A;  1X47 A;  4DV5 E;  1Z5B A;  4DUZ I;  2MDR A;  1Y6Z A;  2B7V A;  4NXN E;  4LFC I;  1S16 A;  3OTO I;  2FV4 B;  3V2U C;  4JI2 E;  3WU4 A;  3ZZ0 A;  2VQE I;  4P7D A;  2ZM6 I;  3H4L A;  1ZM4 A;  3LML A;  1MG7 A;  1QZR A;  2F4V E;  2V86 A;  4GKJ I;  2LJH A;  1HK7 A;  5LMU E;  2R42 A;  4PRV A;  1HR0 I;  2UXB I;  4OX9 E;  1EKZ A;  4JG4 A;  1MU5 A;  4GKK E;  2ZBK B;  2BV3 A;  2Z5C B;  4LU9 A;  2E5L E;  2V85 A;  4DR6 I;  2GS8 A;  3CWV A;  5IWA I;  4LF8 E;  4DR2 I;  5LMN E;  2JVA A;  4DPW A;  5L3J A;  5A2Q C;  1UEK A;  4NXM E;  1Z0W A;  4R1F A;  4HYM A;  2UXD I;  4HY1 A;  4BMJ A;  1VIS A;  3D4J A;  5AE1 A;  1UHZ A;  2KHX A;  1N34 I;  1H7U A;  5DNY A;  1WHQ A;  4R03 A;  4LF5 I;  3AUZ A;  4TUG A;  4IZJ D;  4X62 I;  1N0V C;  4AQY I;  4F9B B;  4JI4 I;  1FJG I;  1X48 A;  4DR1 E;  4DV5 I;  5GMD A;  1YZ9 A;  3WU5 A;  4NXN I;  1XNR E;  4JI2 I;  2HFS A;  4YY3 E;  5F3W A;  5ADZ A;  2V2Q A;  2AJ4 A;  4TUI A;  3LNU A;  3DJW A;  1K47 A;  1KTV A;  3LPS A;  2IOP A;  1MX0 A;  1H74 A;  2HFU A;  2RS6 A;  4DMI A;  1NHH A;  5LMU I;  3HPS A;  5AE2 A;  3P1X A;  4F9A B;  4OX9 I;  2V88 A;  3HJC A;  1KIJ A;  1OJ4 A;  4DKK A;  3Q1Q A;  4DV2 E;  4GKK I;  3JAM C;  1FI4 A;  2RTX A;  2UXC E;  2O1V A;  2E5L I;  4LFA E;  5T6J A;  4X66 E;  4DV4 E;  4IZK A;  4X65 E;  1B62 A;  4J8Z A;  3IWC A;  3T1H E;  1Z0V A;  2JY9 A;  4B3S E;  2JR1 A;  4LF8 I;  1XNQ E;  3QT5 A;  3HQ1 A;  4BCA A;  2E1M A;  2A2D A;  1IBM E;  4XTJ A;  4NXM I;  5CFF E;  3B78 A;  2PNM A;  3K17 A;  2V8Q B;  4UT4 A;  2NUF A;  4DV6 E;  2LMZ A;  1UIL A;  2LUP B;  2UUA E;  4JV5 E;  4FW9 A;  1NHJ A;  3HXL A;  2V89 A;  4DV3 E;  5FWK A;  5IT9 Q;  1DAR A;  2N3G A;  1USV A;  1FWL A;  2IOQ A;  2RSM A;  3ZM7 A;  2CGE A;  4IZJ A;  4DR1 I;  3Q6N A;  2FTX B;  3IWB A;  3ZOQ B;  2YZT A;  3FIG A;  1XMO E;  2IHR 1;  1XMQ I;  3DF6 A;  4LF9 I;  4M2Z A;  2L92 A;  1ZXN A;  1FWK A;  1T4N A;  4JI7 E;  4K0K E;  1XNR I;  1I94 I;  4YY3 I;  2HK2 A;  4WUD A;  4DU8 A;  3ZZU A;  2WZO A;  1T4O A;  4N3O A;  2KOU A;  4BC9 A;  3VYX A;  2HHH E;  4HAC B;  3QT7 A;  1NZ0 A;  4GEQ B;  3C4B A;  4JYA I;  4WPY A;  4DV1 E;  4JI3 E;  4KQV A;  4DV2 I;  3J81 Q;  1IBL I;  1Y4U A;  4FWD A;  2CPN A;  5A2Q Q;  1HNZ I;  2UXC I;  4X66 I;  4DV4 I;  2V2Z A;  4JI5 E;  4X65 I;  3T1H I;  3M6A A;  4B3S I;  2BM0 A;  3LLH A;  1GQE A;  1IBM I;  3F0N A;  1GZ6 A;  4P78 A;  4BBY A;  1HNX I;  2G7H A;  4JI0 E;  4DPU A;  2M4I A;  1ZBQ A;  4LF7 E;  4KHP E;  2Z5B A;  4DV6 I;  2UUA I;  4JV5 I;  3K6Q A;  3J7Y p;  1N36 E;  2VQF E;  3J81 C;  2MC6 A;  4X8W A;  1PIE A;  4DV3 I;  4DU7 A;  2Z5E A;  3K1J A;  3ZKD A;  2EWL A;  1N32 E;  2BM1 A;  4IZK B;  3MSW A;  4PU9 A;  2DB2 A;  3F6G A;  4B3R I;  1YYW A;  5BR8 E;  4JI6 E;  2ODR C;  2O1W A;  1ZXM A;  2LTS A;  4K0K I;  4DR5 I;  5AE3 A;  1RR9 A;  4WUB A;  2M1S A;  4RPF A;  4M1K A;  2HHH I;  3JAM Q;  1N33 E;  4DV7 E;  1H73 A;  3QT6 A;  4LTY A;  2L8T A;  1J5E E;  2EZ6 A;  2ODR D;  4DR3 E;  5GME A;  4Z7Y A;  3J80 Q;  1EI1 A;  4IZJ B;  1B63 A;  1X49 A;  2V83 A;  2F4V I;  1DQ3 A;  4JI5 I;  3PYE A;  4BS9 A;  1T4L B;  4UTG A;  2MC5 A;  2HK3 A;  2V8P A;  2RS7 A;  3B82 A;  2L2N A;  2V34 A;  4DR4 E;  1H7S A;  3LTO A;  1H72 C;  1ZM3 A;  4LF7 I;  4DPX A;  3ADG A;  2JOB A;  4B3T E;  1SR9 A;  5LMN I;  1N36 I;  2VQF I;  3J80 C;  3HTX A;  1D6T A;  1Z0E A;  1Z0G A;  1RQ0 A;  2HKE A;  3OTO E;  1Y4S A;  4YHH E;  1N32 I;  2VQE E;  1IBK E;  1HNW E;  4WFT A;  1PKP A;  2VF3 A;  3B8H A;  3IWD A;  2Q2E B;  2B9D A;  1HR0 E;  2NUG A;  1A6F A;  2Z5B B;  4ED4 A;  1YYK A;  4DPT A;  4MYT A;  4F9C B;  5IWA E;  1KVK A;  2O1T A;  1XHK A;  3H09 A;  3ADL A;  1J5E I;  4DR2 E;  4DR3 I;  3JU0 A;  4B3M E;  4F54 A;  4DR7 E;  2UXD E;  2HKJ A;  4WUC A;  1ELO A;  4FWG A;  3J7A G;  1N34 E;  2UU9 E;  3ADJ A;  2DIX A;  1WUU A;  1YYO A;  3WU6 A;  2DSY A;  4ZVI A;  3WU3 A;  4LFA I;  2GQ0 A;  2R3V A;  4HXZ A;  4X62 E;  1Z0C A;  2UUC E;  1Z5C A;  4AQY E;  4B3T I;  1XNQ I;  2ZIT A;  2LTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...