1FJGE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1fjgE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1fjgE02
4JI7E 5IWAI 2HFUA 4M1KA 2B3TB 2N3GA 4MYUA 4K0KI 5IT9C 4DPWA 4Z7YA 2DEJA 3HULA 1WHNA 2Q2EB 3B8HA 1H73A 1RC7A 1YYOA 4LF6I 2DEIA 3J81C 2DIXA 4JV5I 3WU5A 1KIJA 2JY9A 4X66E 3C4TA 4DR2I 3PYGA 3C4BA 1ELOA 1A6FA 3ZKDA 2L2MA 4JI8I 2HFSA 4WUDA 4HACA 1FWLA 3P1XA 1X48A 4GKKI 4FWDA 1XMQE 3ADLA 4JI7I 4LFCI 3CWVA 1Z0EA 3ADGA 3ADJA 3T1HI 1XHKA 1RQ0A 3B78A 4LF5I 4USMA 2R3VA 3V5RA 2UU9E 1UILA 2LTSA 2F4VI 4JI4E 4B3RE 3V2UC 3OTOI 2YT4A 1Z5AA 4DV2E 4DV4E 2LJPA 1XMOE 2VQEE 4DV0E 4DR5E 2UUBI 2ZM6I 4B3ME 1O0WA 1D6TA 3PYEA 2HKJA 4JI3I 1ZXNA 5LMNE 4X64E 3JAMC 4JI6E 4DU8A 1Z5BA 3J81Q 4LF8I 4B3SE 4PRVA 2BM0A 1HR0I 4DR6I 2N3HA 4NXME 1XMOI 5LMUE 2OI2A 1FWKA 3Q1QA 2UXCI 2HKEA 4KHPI 4B3RI 4X65E 1HNWE 4WUCA 2V8PA 4GKKE 3QT6A 4P7AA 4LFCE 4B3TI 4DKKA 2LBSB 4B3TE 4NXNE 3QT5A 1NHHA 1H7SA 1IBME 4X66I 3ZKBA 4PRXA 5FLXC 1XNRE 3VYYA 5A2QQ 4DR7I 1STUA 4DV6E 3H4LA 4DXLA 2NUFA 1XNQI 4DR1E 2HHHE 1KTVA 2ZBKB 4DV2I 5L3JA 4DV5I 2UXBI 1YYKA 2UUCI 4LF9I 1N33I 1PVGA 4JYAE 4DUYE 1EKZA 4XTJA 4YHHI 4I3HA 2VF3A 2WW4A 4FWHA 4P52A 3ZM7A 2X7IA 1IBLE 2L3CA 4LF4I 1FKAE 1MG7A 4LFBE 2RTXA 1H72C 1B63A 4KQVA 4JI1I 4M30A 2ZM6E 2NPFA 5FLXQ 2L2NA 1Z59A 1T4OA 4HXZA 4DR4E 4KHPE 3J7AG 4DR4I 1Z0VA 2V2ZA 4DR6E 2L3JA 3LNUA 3WU6A 4MYTA 4GKJE 2RSMA 1GQEA 1EI1A 2ZITA 2LUQA 2V34A 1I94E 3VYXA 2LRSA 1IBMI 3ZZ0A 3T1YE 4DUZE 1HNXE 4WYQB 1T4NA 1Z0GA 2LJHA 4JI8E 2VQFE 3J80C 2NA2A 1J5EE 4OX9I 3LPSA 4B3MI 1J26A 4DR1I 2DMYA 3T1YI 2HK2A 1IBKE 5GMDA 4JG4A 4NXMI 4LFAE 2JVAA 4FW9A 1N34E 4DV3I 4JV5E 4JI1E 4JI4I 1T4LB 1IBKI 1MX0A 3K1JA 4USKA 1N36I 1OJ4A 1ZBTA 4HY1A 5BR8I 4JI6I 1MU5A 4M2ZA 1Z0BA 3ZZTA 4DUYI 1U2RA 1ZM4A 4JI2E 1HNZE 5LL6R 4X65I 1HNWI 4LF4E 4DPTA 1ZM9A 4DR2E 1X47A 2A2CA 4DV4I 2NUGA 2EZ6A 5LMUI 2XEXA 1I94I 5A2QC 2RS7A 1Z5CA 4WUBA 2HHHI 4AQYE 4JI5E 1KVKA 3WU3A 4DR3I 1YZ9A 2AJ4A 2B7TA 2MDRA 1UEKA 2CZ9A 5GMEA 2HK3A 3B82A 3M6AA 4JI0E 4JI0I 1HNZI 2VQFI 4UT4A 1Z0TA 1ZM3A 1QZRA 1RR9A 4DV7I 5BR8E 4DUZI 2B7VA 1HNXI 3JAMQ 5IWAE 4LF7I 5IT9Q 2UUAE 1YYWA 3F0NA 3OTOE 2F4VE 1PKPA 2E5LI 2UXBE 1UHZA 1ZXMA 4DV6I 1ZM2A 1N32E 2A2DA 4PU9A 5CFFE 1PIEA 2X36A 4JI2I 1DI2A 1QU6A 1HR0E 1RREA 2DB2A 1NHIA 2J7KA 4X62I 4UTGA 1XNRI 4LF7E 2NUEA 3ZZUA 4DV1I 1B62A 1FJGI 3WU4A 4NXNI 3LLHA 2CPNA 3QT8A 2UUCE 1EA6A 3GONA 2UUBE 4DR5I 4LFAI 2UXDE 2R42A 2UXCE 4DPXA 1XNQE 2UXDI 1J5EI 4OX9E 4FWGA 2V2VA 3D4JA 2LTRA 4RPFA 4LFBI 1N0VC 1BKNA 4K0KE 2BV3A 1VISA 4R1FA 2GS8A 1FJGE 2UUAI 1S16A 4DV1E 1S4EA 3PYFA 3K17A 4JI3E 4FN5A 4URLA 1WHQA 1NZ0A 3J7Yp 4LF9E 1N33E 3J80Q 4DV5E 4ED4A 3HTXA 4YY3E 4DV3E 4EMDA 1N34I 4DV0I 2VQEI 4LF6E 2V2QA 1N32I 1DARA 2BM1A 4DPYA 4DR3E 4AQYI 4JI5I 4DPUA 2E5LE 2LUPB 4YY3I 4X8WA 1H74A 3T1HE 1FI4A 2UU9I 4B3SI 4LF5E 4YHHE 1Z0CA 1FNMA 1XMQI 4HACB 4OOGC 1Z0WA 4DV7E 3LTOA 4X62E 4X64I 5LMNI 1K47A 4Z7CA 4DU7A 2KHXA 4GKJI 2IHR1 4JYAI 1WUUA 1KKHA 4ZVIA 2EFGA 3PYDA 1H7UA 2L33A 4HYMA 4WFTA 1N36E 2L2KB 4DR7E 1X49A 2E1RA 1NHJA 3J7AM 3ADIA 1N0UA 4LF8E 2RS6A 1IBLI 3QT7A
chains in the Genus database with same CATH superfamily
2JEAA 2GO3A 4JI7E 5IWAI 2HFUA 4IZJA 4M1KA 5KL2A 2B3TB 2N3GA 2EM9A 4MYUA 5IT9C 4K0KI 2VF1A 4DPWA 2Z5BB 4O5GA 4R2SA 1BBOA 2BR2A 2L8TA 4LCGA 4IJDA 4Z7YA 4IS1C 1USVA 2DGCA 2Z5EA 2EOYA 2IESA 4ZYHA 5C0XD 2DEJA 5KL6A 3HULA 4MU0A 2PNZB 1WHNA 2JEBA 4R2EA 2Q2EB 1F2IG 2JOBA 1A1KA 2IERA 3B8HA 1H73A 2EN7A 2ENAA 2V89A 1YFHA 2MC5A 4FW4A 2MC6A 1RC7A 1YYOA 2EOXA 3KZYA 1NEIA 4RHBB 4LF6I 3J81C 2DEIA 2DIXA 4JV5I 1Y5YA 3WU5A 1KIJA 2LE2A 4NZVA 2HC5A 2ELZA 2DMIA 2JY9A 4X66E 3DD6A 3C4TA 4DR2I 4LOMA 2YTFA 4FW3A 2LCEA 3PYGA 3C4BA 4IFDE 2C37A 1ELOA 3VHTB 1A6FA 3ZKDA 4R2PA 2EQ1A 2L2MA 3MHHC 4JI8I 2HFSA 5DROA 1RHYA 4WUDA 4HACA 1FWLA 3P1XA 3Q6MA 1X48A 2JEBB 3K85A 4GKKI 4FWDA 1XMQE 4BBYA 1A1IA 4OKGA 3ADLA 2EPOA 4JI7I 4LCFA 4LFCI 1YH8A 2EPZA 3CWVA 4P78A 1LLMC 1Z0EA 3ADGA 3ADJA 3T1HI 2EN4A 5C0XE 2JWOA 1A1JA 4KWYA 1XHKA 1RQ0A 2YTDA 3B78A 4USMA 4LF5I 2R3VA 3V5RA 2UU9E 1UILA 2B9DA 2LTSA 2V88A 2J65A 2F4VI 2EORA 4JI4E 4B3RE 2RPCA 2YWQA 2CVEA 3V2UC 2YT4A 1Z5AA 3OTOI 1GTKA 4DV2E 4GZNC 4WSPA 3H09A 2WP8A 1AAYA 4DV4E 2LJPA 1XMOE 2VQEE 4DV0E 4DR5E 2O1TA 4WX9A 2UUBI 2YSPA 2ZM6I 1T38A 4HTGA 2N8XA 4B3ME 2JEAB 1BBGA 1O0WA 1D6TA 3PYEA 5ADZA 2HKJA 1TN9A 4JI3I 1ZXNA 1A1LA 1BB8A 4BHCA 5LMNE 2VE7C 4X64E 1X5WA 2A25A 2LT7A 2EMYA 3JAMC 4JI6E 4IFDB 4DU8A 2V87A 2EMBA 1Z5BA 2NN6E 1PJSA 1AH5A 3J81Q 4LF8I 4B3SE 3M7NG 5F3WA 1KJKA 4PRVA 2DRPA 4MDTA 2PNZA 5AE1A 2BM0A 1HR0I 3L00A 4WPYA 4DR6I 2N3HA 2PNLA 4NXME 3HQ1A 3P76A 1XMOI 5LMUE 1B69A 2OI2A 5EL9A 2CT1A 1FWKA 2PO2B 4NBQA 3Q1QA 2JE6B 5AASA 5DRQA 1NCSA 2UXCI 2HKEA 2EMHA 2O1VA 4B3RI 4X65E 1HNWE 4WUCA 4KHPI 3M7ND 3EQ1A 4LTYA 4BA1B 2V8PA 4GKKE 2E1MA 3GMEA 5JEAD 4FK5C 2GQ0A 3QT6A 4J8ZA 2R1FA 4P7AA 1EH7A 5A69A 2V83A 4AIMA 4AM3A 1ZR9A 4F6MA 4LFCE 2EM3A 1GZ6A 2IOPA 4B3TI 2D9HA 4R2AA 4GQUA 4DKKA 2LBSB 4B3TE 4NXNE 3QT5A 1NHHA 1RMDA 2LMZA 1H7SA 4MQYA 2ODRD 2YTJA 1IBME 2EQ0A 2FV4B 4WXDA 5A6KA 4X66I 4OO1C 2EPKX 1MGTA 1OYPA 3BF2A 3KWRA 2GLIA 2R76A 5FLXC 1XNRE 3HKMA 4PRXA 3VYYA 4U3DA 4U3BA 3EPJA 3ZKBA 5A2QQ 4DR7I 5K36E 3EPKA 4X9JA 2CGEA 2I9IA 5KL3A 1STUA 4OO1F 4DV6E 3H4LA 2EOFA 4DXLA 2WZOA 4IFDA 2NUFA 4LCHA 2LVHA 1XNQI 1SFEA 4DR1E 2C39B 2BA1G 2M7QA 2YRHA 2HHHE 2NN6D 4N3OA 1KTVA 2ZBKB 2YSOA 1Y60A 4DV2I 5L3JA 2K7IA 4DV5I 5LLQA 2PO0A 2UXBI 2EMCA 2YPNA 4LU9A 1YYKA 2UUCI 4LF9I 2EOIA 2M1SA 3BIDA 1TF6A 1PVGA 1N33I 4JYAE 2EOQA 2GO4A 2CG9A 2ELYA 3M85G 4DUYE 4ZYGA 3QT7A 2RQLA 2GHFA 2EM6A 1EKZA 1G2DC 4MU1A 4O24A 2BA0D 4XTJA 4I3HA 3M99B 2JE6A 2NN6A 4YHHI 2VF3A 2WW4A 4FWHA 4P52A 2M9AA 5TSEA 3ZM7A 2EPCA 2BBGA 2X7IA 2E72A 1IBLE 2L3CA 4LF4I 2BA1D 1FKAE 3THOB 1MG7A 2WCC3 4TUIA 2KOUA 2RTXA 4LFBE 5K36D 2EN6A 1H72C 1B63A 2YU8A 4KQVA 2LJUA 4JI1I 4M30A 2EMZA 2ZM6E 2NPFA 1WXRA 5FLXQ 4RH8A 3MHSC 2L2NA 1Z59A 4Q28A 1T4OA 4HXZA 3B4TA 4DR4E 4KHPE 2GPIA 2EPXA 3IWCA 3J7AG 3OMLA 4DR4I 4R2DA 1Z0VA 4KZSA 2FTXB 2DSYA 2V2ZA 2C39A 2ADRA 5A6BA 2L3JA 4DR6E 2YZTA 3LNUA 3WU6A 1EH8A 1X6FA 4MYTA 3P06A 5C0XC 4GKJE 2RSMA 3HJCA 1GQEA 1EI1A 2ZITA 2LUQA 2EPRA 2V34A 2YTQA 3IWDA 1I94E 2JOXA 2NABA 2LRSA 3HXLA 4R03A 3VYXA 5ELWA 1IBMI 5DRPA 2PO1B 1N3GA 1A1FA 3ZZ0A 3T1YE 4I8OA 2C37B 4OO1E 4DUZE 1HNXE 1UDNA 4WYQB 1L4SA 4BS9A 1USUA 1T4NA 5DNXA 1Z0GA 2LJHA 4JI8E 3QG5C 2VQFE 4BA1A 1OYRA 1UBDC 2RSIA 3J80C 2JP9A 2NA2A 1J5EE 1DGCA 4FW6A 5A6JA 3LPSA 4OO1A 1G2FC 4B3MI 2EL6A 2L92A 1J26A 2CTDA 3PS1A 1R6LA 4DR1I 2DMYA 3T1YI 2EOMA 2HK2A 4F9BB 1OYSA 1YPNA 1IBKE 2F1DA 4QNJA 2I13A 2ENHA 1T39A 2EMWA 2EN2A 2EOEA 2Z5CB 4MU4A 5GMDA 4JG4A 4NXMI 4LFAE 2JVAA 1X6EA 2EOSA 1N34E 1Y4SA 2EOOA 4FW9A 5DRRA 5FWKA 4DV3I 4IFDC 1SR9A 4JV5E 2EP3A 4JI1E 2EM0A 2PO2A 5JEAF 4JI4I 2EJ4A 4M0VA 2EPLX 1T4LB 3PS3A 1IBKI 2YTPA 3UK3C 1MX0A 3K1JA 4USKA 1N36I 1E3HA 1IQSA 2G7HA 1OJ4A 3KRNA 2EMGA 2YTGA 1ZBTA 4HY1A 4O4KA 5BR8I 4F9CB 4JI6I 1MU5A 5K36A 4M2ZA 1Z0BA 3ZZTA 3EPHA 2EMXA 1PDAA 2MKDA 2NN6B 1U2RA 4DUYI 1ZM4A 3TQMA 4JI2E 1HNZE 3FIGA 1P42A 1WJPA 5LL6R 4BCAA 5AE2A 3RMPA 2EM5A 4X65I 1HNWI 4LF4E 3PRYA 3L7ZB 4IZKA 4DPTA 4L5NC 1WRJA 4OO1B 1ZM9A 2EOHA 4DR2E 1X47A 3DF6A 4Q35B 2WBTA 2A2CA 4DV4I 2NUGA 5T6JA 2EZ6A 5LMUI 3Q6NA 2EM4A 5AC5A 2EMFA 1JK2A 2XEXA 4P7DA 1I94I 5A2QC 2EMLA 2RS7A 2EOZA 1Z5CA 3EPLA 1Y4UA 4IFDD 4WXCA 4WUBA 2EN8A 2HHHI 3HPZA 1ZBQA 2HGHA 4AQYE 3JTZA 4JI5E 1KVKA 4FW5A 3WU3A 4DR3I 1JK1A 1A1HA 1YZ9A 2AJ4A 2B7TA 2MDRA 1ZAAC 1UEKA 2CZ9A 2O3ZA 2HK3A 5GMEA 1ZU1A 2EPUA 2WBUA 3C6KA 2EN1A 3B82A 3M6AA 4IZJB 5C0XF 4JI0E 4JI0I 2EMKA 5A6BD 2VQFI 3AUZA 4UT4A 4ZYDA 1HNZI 2V85A 1Z0TA 4OX9I 1ZM3A 4ISAA 1QZRA 4DMIA 1RR9A 5K36F 4DV7I 5BR8E 4DUZI 2B7VA 1HNXI 1DQ3A 3M85D 3DJWA 3P3EA 3JAMQ 2V8QB 5IWAE 4LF7I 5IT9Q 2UUAE 5JEAA 1YYWA 3F0NA 4J3DA 4FW7A 3F6GA 3OTOE 4BA2A 4MU3A 2UXDI 2F4VE 1PKPA 1X6HA 2V86A 5KL5A 4L8NA 1HK7A 2E5LI 2EWLA 2YRKA 2UXBE 3P3CA 2J7JA 4OZEA 2EQ3A 2EM2A 1PJQA 1UHZA 2DLQA 4OO1D 1ZXMA 2JT2A 4DV6I 3BGHA 1ZM2A 2WNRB 1N32E 2A2DA 4PU9A 2BB8A 5CFFE 2IOQA 4QNKA 1PIEA 2X36A 4R2RA 4JI2I 3C6MA 4NHRA 1DI2A 1A1GA 4LPFA 3ECRA 1QU6A 2EN3A 1HR0E 5EKWA 1RREA 2DB2A 1NHIA 2J7KA 4X62I 2LO3A 3LMLA 4UTGA 5K36B 1XNRI 5JEAE 4LF7E 2NUEA 3ZZUA 4DV1I 2EPAA 1B62A 1FJGI 4ZYEA 4M9VC 4NXNI 3WU4A 4N4RB 1VI7A 1YSAC 3LLHA 2CPNA 3THNA 5KL4A 3KZZA 3QT8A 3IWBA 2DLKA 2UUCE 2KONA 1EA6A 1EH6A 3GONA 3GCMA 2UUBE 2BA0G 5C0XB 4DR5I 4LFAI 2UXDE 1UDQA 2AE8A 3F6HA 2R42A 2VESA 2UXCE 5A6AA 2MKNA 2JPAA 2JXPA 3VK6A 1XNQE 2WP8B 4OX9E 2YTNA 4IZJD 4DPXA 1J5EI 4FWGA 3U1YA 5DNLA 2V2VA 2EMIA 2EOJA 3D4JA 2LTRA 4RPFA 5AC4A 4LFBI 2Q8UA 3AV0A 1N0VC 2YTOA 1BKNA 4K0KE 2BV3A 5KL7A 2EPNA 3PS2A 2PO1A 1VISA 4R1FA 2GS8A 1FJGE 3CDJA 2NN6F 1S16A 2UUAI 4DV1E 2YRMA 2EPPA 1S4EA 3PYFA 5AE3A 2PRTA 2WNRA 4TUGA 2EE8A 3H1CA 4R2CA 3K17A 4JI3E 4FN5A 4BMJA 4URLA 1WHQA 1NZ0A 3J7Yp 4LF9E 1N33E 3L7ZA 2YTEA 2EM7A 3J80Q 4DV5E 4ED4A 3GLLA 3HTXA 1UN6B 4YY3E 5JEAB 4BC9A 4DV3E 4EMDA 4DV0I 4IS9A 5JEAC 2VQEI 4LF6E 1N34I 5IXMB 2V2QA 4AIDA 1N32I 4F9AB 1Z1BA 1DARA 2C38A 2ENCA 2JR1A 2VRDA 4IFDF 5C0XA 1UDOA 1PJTA 2Z5CA 3P3GA 3HPSA 2BM1A 4DPYA 2EL4A 2EL5A 5IV8B 4DR3E 4AQYI 4JI5I 1QNTA 4DPUA 2E5LE 4O43A 3NZKA 1E3PA 2LUPB 4YY3I 2O1UA 2ODRC 1TF3A 3ZOQB 4X8WA 2BR2B 4BA2B 2C38B 3T1HE 2CSHA 1FI4A 3BBGA 2UU9I 4MLVA 4LF5E 4YHHE 4B3SI 1Z0CA 1R6MA 2EMAA 1FNMA 2YTIA 1MEYC 4HACB 1XXEA 2FGGA 1XMQI 4OOGC 4BHBA 1Z0WA 4DV7E 5DNYA 3LTOA 4X62E 1UDSA 1YUJA 3U1KA 1IQOA 4X64I 5LMNI 2YU5A 3UHMA 1K47A 4Z7CA 2HJJA 4DU7A 2EPMX 2KHXA 3MSWA 2JYAA 2IHR1 4F6NA 1P47A 1Y6ZA 2NN6C 4GKJI 2PNMA 4JYAI 4GEQB 1WUUA 4IZKB 1X3CA 4F2JC 1KKHA 2F8BA 1YUIA 2MDGA 4ZVIA 2EFGA 3PYDA 1H7UA 2L33A 4HYMA 4R8OA 4WFTA 2EM8A 4R2QA 1KYQA 1N36E 2O1WA 3K6QA 4MLQA 4BC7A 2L2KB 4DR7E 1X49A 2E1RA 3JU0A 1NHJA 3J7AM 2LV2A 1YHCA 3ADIA 2L6MA 2PO0B 4F54A 1N0UA 2M4IA 3CDIA 2WBSA 4HEIA 4LF8E 2RS6A 5K36C 2H36X 4WSGA 1IMUA 2Z5BA 2K4VA 1IBLI 1H74A
chains in the Genus database with same CATH topology
4JI7E 5IWAI 2HFUA 4IZJA 4M1KA 2B3TB 2N3GA 4MYUA 4K0KI 5IT9C 2VF1A 4DPWA 2Z5BB 2L8TA 4Z7YA 1USVA 2Z5EA 2DEJA 3HULA 1WHNA 2Q2EB 2JOBA 3B8HA 1H73A 2V89A 2MC5A 2MC6A 1RC7A 1YYOA 4LF6I 3J81C 2DEIA 2DIXA 4JV5I 3WU5A 1KIJA 2LE2A 2JY9A 4X66E 3C4TA 4DR2I 3PYGA 3C4BA 1ELOA 1A6FA 3ZKDA 2L2MA 4JI8I 2HFSA 4WUDA 4HACA 1FWLA 3P1XA 3Q6MA 1X48A 3K85A 4GKKI 4FWDA 1XMQE 4BBYA 3ADLA 4JI7I 4LFCI 3CWVA 4P78A 1Z0EA 3ADGA 3ADJA 3T1HI 2JWOA 1XHKA 1RQ0A 3B78A 4LF5I 4USMA 2R3VA 3V5RA 2UU9E 1UILA 2B9DA 2LTSA 2V88A 2F4VI 4JI4E 4B3RE 3V2UC 3OTOI 2YT4A 1Z5AA 4DV2E 4WSPA 3H09A 4DV4E 2LJPA 1XMOE 2VQEE 4DV0E 4DR5E 2O1TA 2UUBI 2ZM6I 4B3ME 1O0WA 1D6TA 3PYEA 5ADZA 2HKJA 4JI3I 1ZXNA 5LMNE 2VE7C 4X64E 3JAMC 4JI6E 4DU8A 2V87A 1Z5BA 3J81Q 4LF8I 4B3SE 5F3WA 4PRVA 5AE1A 2BM0A 1HR0I 4WPYA 4DR6I 2N3HA 2PNLA 4NXME 3HQ1A 1XMOI 5LMUE 2OI2A 1FWKA 3Q1QA 5AASA 2UXCI 2HKEA 2O1VA 4KHPI 4B3RI 4X65E 1HNWE 4WUCA 4LTYA 2V8PA 4GKKE 2E1MA 2GQ0A 3QT6A 4J8ZA 4P7AA 2V83A 4LFCE 1GZ6A 2IOPA 4B3TI 4DKKA 2LBSB 4B3TE 4NXNE 3QT5A 1NHHA 1H7SA 2LMZA 2ODRD 1IBME 2FV4B 4X66I 3KWRA 3ZKBA 4PRXA 5FLXC 1XNRE 3VYYA 5A2QQ 4DR7I 2CGEA 1STUA 4DV6E 3H4LA 4DXLA 2WZOA 2NUFA 1XNQI 4DR1E 2M7QA 2HHHE 4N3OA 1KTVA 2ZBKB 4DV2I 5L3JA 4DV5I 2UXBI 4LU9A 1YYKA 2UUCI 4LF9I 2M1SA 1N33I 1PVGA 4JYAE 2CG9A 4DUYE 3QT7A 1EKZA 4XTJA 4YHHI 4I3HA 2VF3A 2WW4A 4FWHA 4P52A 3ZM7A 2X7IA 1IBLE 2L3CA 4LF4I 1FKAE 1MG7A 4TUIA 2KOUA 2RTXA 4LFBE 1H72C 1B63A 4KQVA 4JI1I 4M30A 2ZM6E 2NPFA 1WXRA 5FLXQ 2L2NA 1Z59A 4Q28A 1T4OA 4HXZA 4DR4E 4KHPE 3IWCA 3J7AG 3OMLA 4DR4I 1Z0VA 4KZSA 2FTXB 2DSYA 2V2ZA 4DR6E 2L3JA 2YZTA 3LNUA 3WU6A 4MYTA 3P06A 4GKJE 2RSMA 3HJCA 1GQEA 1EI1A 2ZITA 2LUQA 2V34A 3IWDA 1I94E 2JOXA 3VYXA 2LRSA 3HXLA 4R03A 1IBMI 3ZZ0A 3T1YE 4I8OA 4DUZE 1HNXE 4WYQB 4BS9A 1USUA 1T4NA 1Z0GA 2LJHA 4JI8E 2VQFE 3J80C 2NA2A 1J5EE 4OX9I 3LPSA 4B3MI 2L92A 1J26A 4DR1I 2DMYA 3T1YI 2HK2A 4F9BB 1IBKE 5GMDA 2Z5CB 4JG4A 4NXMI 4LFAE 2JVAA 4FW9A 5FWKA 1N34E 1Y4SA 4DV3I 1SR9A 4JV5E 4JI1E 4JI4I 4M0VA 1T4LB 1IBKI 1MX0A 3K1JA 4USKA 1N36I 2G7HA 1OJ4A 1ZBTA 4HY1A 5BR8I 4F9CB 4JI6I 1MU5A 4M2ZA 1Z0BA 3ZZTA 4DUYI 1U2RA 1ZM4A 4JI2E 1HNZE 3FIGA 5LL6R 4BCAA 5AE2A 3RMPA 4X65I 1HNWI 4LF4E 3PRYA 4IZKA 4DPTA 4L5NC 1ZM9A 4DR2E 1X47A 3DF6A 2A2CA 4DV4I 2NUGA 5T6JA 2EZ6A 5LMUI 3Q6NA 2XEXA 4P7DA 1I94I 5A2QC 2RS7A 1Z5CA 1Y4UA 4WUBA 2HHHI 3HPZA 1ZBQA 4AQYE 3JTZA 4JI5E 1KVKA 3WU3A 4DR3I 1YZ9A 2AJ4A 2B7TA 2MDRA 1UEKA 2CZ9A 5GMEA 2HK3A 4IZJB 3B82A 3M6AA 4JI0E 4JI0I 1HNZI 2VQFI 3AUZA 4UT4A 2V85A 1Z0TA 1ZM3A 1QZRA 4DMIA 1RR9A 4DV7I 5BR8E 4DUZI 2B7VA 1HNXI 1DQ3A 3DJWA 3JAMQ 2V8QB 5IWAE 4LF7I 5IT9Q 2UUAE 1YYWA 3F0NA 3F6GA 3OTOE 2F4VE 1PKPA 2V86A 4L8NA 1HK7A 2E5LI 2EWLA 2UXBE 1UHZA 1ZXMA 4DV6I 1ZM2A 1N32E 2A2DA 4PU9A 5CFFE 2IOQA 1PIEA 2X36A 4JI2I 1DI2A 1QU6A 1HR0E 1RREA 2DB2A 1NHIA 2J7KA 4X62I 3LMLA 4UTGA 1XNRI 4LF7E 2NUEA 3ZZUA 4DV1I 1B62A 1FJGI 3WU4A 4NXNI 3LLHA 2CPNA 3QT8A 3IWBA 2UUCE 2KONA 1EA6A 3GONA 2UUBE 4DR5I 4LFAI 2UXDE 3F6HA 2R42A 2UXCE 4DPXA 3VK6A 1XNQE 4IZJD 4OX9E 1J5EI 2UXDI 4FWGA 2V2VA 3D4JA 2LTRA 4RPFA 4LFBI 3AV0A 1N0VC 1BKNA 4K0KE 2BV3A 1VISA 4R1FA 2GS8A 1FJGE 2UUAI 1S16A 4DV1E 1S4EA 3PYFA 5AE3A 4TUGA 3K17A 4JI3E 4FN5A 4BMJA 4URLA 1WHQA 1NZ0A 3J7Yp 4LF9E 1N33E 3J80Q 4DV5E 4ED4A 3HTXA 4YY3E 4BC9A 4DV3E 4EMDA 4DV0I 2VQEI 1N34I 4LF6E 2V2QA 1N32I 4F9AB 1DARA 2JR1A 2Z5CA 3HPSA 2BM1A 4DPYA 4DR3E 4AQYI 4JI5I 4DPUA 2E5LE 2LUPB 4YY3I 2O1UA 2ODRC 3ZOQB 4X8WA 3T1HE 1FI4A 2UU9I 4B3SI 4LF5E 4YHHE 1Z0CA 1FNMA 1XMQI 4HACB 2FGGA 4OOGC 1Z0WA 4DV7E 5DNYA 3LTOA 4X62E 4X64I 5LMNI 1K47A 4Z7CA 4DU7A 3MSWA 2KHXA 4GKJI 2IHR1 4JYAI 1Y6ZA 2PNMA 4GEQB 1WUUA 4IZKB 1KKHA 2F8BA 4ZVIA 2EFGA 3PYDA 1H7UA 2L33A 4HYMA 4R8OA 4WFTA 1N36E 2O1WA 3K6QA 4BC7A 2L2KB 4DR7E 1X49A 2E1RA 3JU0A 1NHJA 3J7AM 3ADIA 2L6MA 4F54A 1N0UA 2M4IA 4LF8E 2RS6A 2H36X 2Z5BA 2K4VA 1IBLI 1H74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 E;  5IWA I;  2HFU A;  4M1K A;  2B3T B;  2N3G A;  4MYU A;  4K0K I;  5IT9 C;  4DPW A;  4Z7Y A;  2DEJ A;  3HUL A;  1WHN A;  2Q2E B;  3B8H A;  1H73 A;  1RC7 A;  1YYO A;  4LF6 I;  2DEI A;  3J81 C;  2DIX A;  4JV5 I;  3WU5 A;  1KIJ A;  2JY9 A;  4X66 E;  3C4T A;  4DR2 I;  3PYG A;  3C4B A;  1ELO A;  1A6F A;  3ZKD A;  2L2M A;  4JI8 I;  2HFS A;  4WUD A;  4HAC A;  1FWL A;  3P1X A;  1X48 A;  4GKK I;  4FWD A;  1XMQ E;  3ADL A;  4JI7 I;  4LFC I;  3CWV A;  1Z0E A;  3ADG A;  3ADJ A;  3T1H I;  1XHK A;  1RQ0 A;  3B78 A;  4LF5 I;  4USM A;  2R3V A;  3V5R A;  2UU9 E;  1UIL A;  2LTS A;  2F4V I;  4JI4 E;  4B3R E;  3V2U C;  3OTO I;  2YT4 A;  1Z5A A;  4DV2 E;  4DV4 E;  2LJP A;  1XMO E;  2VQE E;  4DV0 E;  4DR5 E;  2UUB I;  2ZM6 I;  4B3M E;  1O0W A;  1D6T A;  3PYE A;  2HKJ A;  4JI3 I;  1ZXN A;  5LMN E;  4X64 E;  3JAM C;  4JI6 E;  4DU8 A;  1Z5B A;  3J81 Q;  4LF8 I;  4B3S E;  4PRV A;  2BM0 A;  1HR0 I;  4DR6 I;  2N3H A;  4NXM E;  1XMO I;  5LMU E;  2OI2 A;  1FWK A;  3Q1Q A;  2UXC I;  2HKE A;  4KHP I;  4B3R I;  4X65 E;  1HNW E;  4WUC A;  2V8P A;  4GKK E;  3QT6 A;  4P7A A;  4LFC E;  4B3T I;  4DKK A;  2LBS B;  4B3T E;  4NXN E;  3QT5 A;  1NHH A;  1H7S A;  1IBM E;  4X66 I;  3ZKB A;  4PRX A;  5FLX C;  1XNR E;  3VYY A;  5A2Q Q;  4DR7 I;  1STU A;  4DV6 E;  3H4L A;  4DXL A;  2NUF A;  1XNQ I;  4DR1 E;  2HHH E;  1KTV A;  2ZBK B;  4DV2 I;  5L3J A;  4DV5 I;  2UXB I;  1YYK A;  2UUC I;  4LF9 I;  1N33 I;  1PVG A;  4JYA E;  4DUY E;  1EKZ A;  4XTJ A;  4YHH I;  4I3H A;  2VF3 A;  2WW4 A;  4FWH A;  4P52 A;  3ZM7 A;  2X7I A;  1IBL E;  2L3C A;  4LF4 I;  1FKA E;  1MG7 A;  4LFB E;  2RTX A;  1H72 C;  1B63 A;  4KQV A;  4JI1 I;  4M30 A;  2ZM6 E;  2NPF A;  5FLX Q;  2L2N A;  1Z59 A;  1T4O A;  4HXZ A;  4DR4 E;  4KHP E;  3J7A G;  4DR4 I;  1Z0V A;  2V2Z A;  4DR6 E;  2L3J A;  3LNU A;  3WU6 A;  4MYT A;  4GKJ E;  2RSM A;  1GQE A;  1EI1 A;  2ZIT A;  2LUQ A;  2V34 A;  1I94 E;  3VYX A;  2LRS A;  1IBM I;  3ZZ0 A;  3T1Y E;  4DUZ E;  1HNX E;  4WYQ B;  1T4N A;  1Z0G A;  2LJH A;  4JI8 E;  2VQF E;  3J80 C;  2NA2 A;  1J5E E;  4OX9 I;  3LPS A;  4B3M I;  1J26 A;  4DR1 I;  2DMY A;  3T1Y I;  2HK2 A;  1IBK E;  5GMD A;  4JG4 A;  4NXM I;  4LFA E;  2JVA A;  4FW9 A;  1N34 E;  4DV3 I;  4JV5 E;  4JI1 E;  4JI4 I;  1T4L B;  1IBK I;  1MX0 A;  3K1J A;  4USK A;  1N36 I;  1OJ4 A;  1ZBT A;  4HY1 A;  5BR8 I;  4JI6 I;  1MU5 A;  4M2Z A;  1Z0B A;  3ZZT A;  4DUY I;  1U2R A;  1ZM4 A;  4JI2 E;  1HNZ E;  5LL6 R;  4X65 I;  1HNW I;  4LF4 E;  4DPT A;  1ZM9 A;  4DR2 E;  1X47 A;  2A2C A;  4DV4 I;  2NUG A;  2EZ6 A;  5LMU I;  2XEX A;  1I94 I;  5A2Q C;  2RS7 A;  1Z5C A;  4WUB A;  2HHH I;  4AQY E;  4JI5 E;  1KVK A;  3WU3 A;  4DR3 I;  1YZ9 A;  2AJ4 A;  2B7T A;  2MDR A;  1UEK A;  2CZ9 A;  5GME A;  2HK3 A;  3B82 A;  3M6A A;  4JI0 E;  4JI0 I;  1HNZ I;  2VQF I;  4UT4 A;  1Z0T A;  1ZM3 A;  1QZR A;  1RR9 A;  4DV7 I;  5BR8 E;  4DUZ I;  2B7V A;  1HNX I;  3JAM Q;  5IWA E;  4LF7 I;  5IT9 Q;  2UUA E;  1YYW A;  3F0N A;  3OTO E;  2F4V E;  1PKP A;  2E5L I;  2UXB E;  1UHZ A;  1ZXM A;  4DV6 I;  1ZM2 A;  1N32 E;  2A2D A;  4PU9 A;  5CFF E;  1PIE A;  2X36 A;  4JI2 I;  1DI2 A;  1QU6 A;  1HR0 E;  1RRE A;  2DB2 A;  1NHI A;  2J7K A;  4X62 I;  4UTG A;  1XNR I;  4LF7 E;  2NUE A;  3ZZU A;  4DV1 I;  1B62 A;  1FJG I;  3WU4 A;  4NXN I;  3LLH A;  2CPN A;  3QT8 A;  2UUC E;  1EA6 A;  3GON A;  2UUB E;  4DR5 I;  4LFA I;  2UXD E;  2R42 A;  2UXC E;  4DPX A;  1XNQ E;  2UXD I;  1J5E I;  4OX9 E;  4FWG A;  2V2V A;  3D4J A;  2LTR A;  4RPF A;  4LFB I;  1N0V C;  1BKN A;  4K0K E;  2BV3 A;  1VIS A;  4R1F A;  2GS8 A;  1FJG E;  2UUA I;  1S16 A;  4DV1 E;  1S4E A;  3PYF A;  3K17 A;  4JI3 E;  4FN5 A;  4URL A;  1WHQ A;  1NZ0 A;  3J7Y p;  4LF9 E;  1N33 E;  3J80 Q;  4DV5 E;  4ED4 A;  3HTX A;  4YY3 E;  4DV3 E;  4EMD A;  1N34 I;  4DV0 I;  2VQE I;  4LF6 E;  2V2Q A;  1N32 I;  1DAR A;  2BM1 A;  4DPY A;  4DR3 E;  4AQY I;  4JI5 I;  4DPU A;  2E5L E;  2LUP B;  4YY3 I;  4X8W A;  1H74 A;  3T1H E;  1FI4 A;  2UU9 I;  4B3S I;  4LF5 E;  4YHH E;  1Z0C A;  1FNM A;  1XMQ I;  4HAC B;  4OOG C;  1Z0W A;  4DV7 E;  3LTO A;  4X62 E;  4X64 I;  5LMN I;  1K47 A;  4Z7C A;  4DU7 A;  2KHX A;  4GKJ I;  2IHR 1;  4JYA I;  1WUU A;  1KKH A;  4ZVI A;  2EFG A;  3PYD A;  1H7U A;  2L33 A;  4HYM A;  4WFT A;  1N36 E;  2L2K B;  4DR7 E;  1X49 A;  2E1R A;  1NHJ A;  3J7A M;  3ADI A;  1N0U A;  4LF8 E;  2RS6 A;  1IBL I;  3QT7 A; 
#chains in the Genus database with same CATH topology
 2JEA A;  2GO3 A;  4JI7 E;  5IWA I;  2HFU A;  4IZJ A;  4M1K A;  5KL2 A;  2B3T B;  2N3G A;  2EM9 A;  4MYU A;  5IT9 C;  4K0K I;  2VF1 A;  4DPW A;  2Z5B B;  4O5G A;  4R2S A;  1BBO A;  2BR2 A;  2L8T A;  4LCG A;  4IJD A;  4Z7Y A;  4IS1 C;  1USV A;  2DGC A;  2Z5E A;  2EOY A;  2IES A;  4ZYH A;  5C0X D;  2DEJ A;  5KL6 A;  3HUL A;  4MU0 A;  2PNZ B;  1WHN A;  2JEB A;  4R2E A;  2Q2E B;  1F2I G;  2JOB A;  1A1K A;  2IER A;  3B8H A;  1H73 A;  2EN7 A;  2ENA A;  2V89 A;  1YFH A;  2MC5 A;  4FW4 A;  2MC6 A;  1RC7 A;  1YYO A;  2EOX A;  3KZY A;  1NEI A;  4RHB B;  4LF6 I;  3J81 C;  2DEI A;  2DIX A;  4JV5 I;  1Y5Y A;  3WU5 A;  1KIJ A;  2LE2 A;  4NZV A;  2HC5 A;  2ELZ A;  2DMI A;  2JY9 A;  4X66 E;  3DD6 A;  3C4T A;  4DR2 I;  4LOM A;  2YTF A;  4FW3 A;  2LCE A;  3PYG A;  3C4B A;  4IFD E;  2C37 A;  1ELO A;  3VHT B;  1A6F A;  3ZKD A;  4R2P A;  2EQ1 A;  2L2M A;  3MHH C;  4JI8 I;  2HFS A;  5DRO A;  1RHY A;  4WUD A;  4HAC A;  1FWL A;  3P1X A;  3Q6M A;  1X48 A;  2JEB B;  3K85 A;  4GKK I;  4FWD A;  1XMQ E;  4BBY A;  1A1I A;  4OKG A;  3ADL A;  2EPO A;  4JI7 I;  4LCF A;  4LFC I;  1YH8 A;  2EPZ A;  3CWV A;  4P78 A;  1LLM C;  1Z0E A;  3ADG A;  3ADJ A;  3T1H I;  2EN4 A;  5C0X E;  2JWO A;  1A1J A;  4KWY A;  1XHK A;  1RQ0 A;  2YTD A;  3B78 A;  4USM A;  4LF5 I;  2R3V A;  3V5R A;  2UU9 E;  1UIL A;  2B9D A;  2LTS A;  2V88 A;  2J65 A;  2F4V I;  2EOR A;  4JI4 E;  4B3R E;  2RPC A;  2YWQ A;  2CVE A;  3V2U C;  2YT4 A;  1Z5A A;  3OTO I;  1GTK A;  4DV2 E;  4GZN C;  4WSP A;  3H09 A;  2WP8 A;  1AAY A;  4DV4 E;  2LJP A;  1XMO E;  2VQE E;  4DV0 E;  4DR5 E;  2O1T A;  4WX9 A;  2UUB I;  2YSP A;  2ZM6 I;  1T38 A;  4HTG A;  2N8X A;  4B3M E;  2JEA B;  1BBG A;  1O0W A;  1D6T A;  3PYE A;  5ADZ A;  2HKJ A;  1TN9 A;  4JI3 I;  1ZXN A;  1A1L A;  1BB8 A;  4BHC A;  5LMN E;  2VE7 C;  4X64 E;  1X5W A;  2A25 A;  2LT7 A;  2EMY A;  3JAM C;  4JI6 E;  4IFD B;  4DU8 A;  2V87 A;  2EMB A;  1Z5B A;  2NN6 E;  1PJS A;  1AH5 A;  3J81 Q;  4LF8 I;  4B3S E;  3M7N G;  5F3W A;  1KJK A;  4PRV A;  2DRP A;  4MDT A;  2PNZ A;  5AE1 A;  2BM0 A;  1HR0 I;  3L00 A;  4WPY A;  4DR6 I;  2N3H A;  2PNL A;  4NXM E;  3HQ1 A;  3P76 A;  1XMO I;  5LMU E;  1B69 A;  2OI2 A;  5EL9 A;  2CT1 A;  1FWK A;  2PO2 B;  4NBQ A;  3Q1Q A;  2JE6 B;  5AAS A;  5DRQ A;  1NCS A;  2UXC I;  2HKE A;  2EMH A;  2O1V A;  4B3R I;  4X65 E;  1HNW E;  4WUC A;  4KHP I;  3M7N D;  3EQ1 A;  4LTY A;  4BA1 B;  2V8P A;  4GKK E;  2E1M A;  3GME A;  5JEA D;  4FK5 C;  2GQ0 A;  3QT6 A;  4J8Z A;  2R1F A;  4P7A A;  1EH7 A;  5A69 A;  2V83 A;  4AIM A;  4AM3 A;  1ZR9 A;  4F6M A;  4LFC E;  2EM3 A;  1GZ6 A;  2IOP A;  4B3T I;  2D9H A;  4R2A A;  4GQU A;  4DKK A;  2LBS B;  4B3T E;  4NXN E;  3QT5 A;  1NHH A;  1RMD A;  2LMZ A;  1H7S A;  4MQY A;  2ODR D;  2YTJ A;  1IBM E;  2EQ0 A;  2FV4 B;  4WXD A;  5A6K A;  4X66 I;  4OO1 C;  2EPK X;  1MGT A;  1OYP A;  3BF2 A;  3KWR A;  2GLI A;  2R76 A;  5FLX C;  1XNR E;  3HKM A;  4PRX A;  3VYY A;  4U3D A;  4U3B A;  3EPJ A;  3ZKB A;  5A2Q Q;  4DR7 I;  5K36 E;  3EPK A;  4X9J A;  2CGE A;  2I9I A;  5KL3 A;  1STU A;  4OO1 F;  4DV6 E;  3H4L A;  2EOF A;  4DXL A;  2WZO A;  4IFD A;  2NUF A;  4LCH A;  2LVH A;  1XNQ I;  1SFE A;  4DR1 E;  2C39 B;  2BA1 G;  2M7Q A;  2YRH A;  2HHH E;  2NN6 D;  4N3O A;  1KTV A;  2ZBK B;  2YSO A;  1Y60 A;  4DV2 I;  5L3J A;  2K7I A;  4DV5 I;  5LLQ A;  2PO0 A;  2UXB I;  2EMC A;  2YPN A;  4LU9 A;  1YYK A;  2UUC I;  4LF9 I;  2EOI A;  2M1S A;  3BID A;  1TF6 A;  1PVG A;  1N33 I;  4JYA E;  2EOQ A;  2GO4 A;  2CG9 A;  2ELY A;  3M85 G;  4DUY E;  4ZYG A;  3QT7 A;  2RQL A;  2GHF A;  2EM6 A;  1EKZ A;  1G2D C;  4MU1 A;  4O24 A;  2BA0 D;  4XTJ A;  4I3H A;  3M99 B;  2JE6 A;  2NN6 A;  4YHH I;  2VF3 A;  2WW4 A;  4FWH A;  4P52 A;  2M9A A;  5TSE A;  3ZM7 A;  2EPC A;  2BBG A;  2X7I A;  2E72 A;  1IBL E;  2L3C A;  4LF4 I;  2BA1 D;  1FKA E;  3THO B;  1MG7 A;  2WCC 3;  4TUI A;  2KOU A;  2RTX A;  4LFB E;  5K36 D;  2EN6 A;  1H72 C;  1B63 A;  2YU8 A;  4KQV A;  2LJU A;  4JI1 I;  4M30 A;  2EMZ A;  2ZM6 E;  2NPF A;  1WXR A;  5FLX Q;  4RH8 A;  3MHS C;  2L2N A;  1Z59 A;  4Q28 A;  1T4O A;  4HXZ A;  3B4T A;  4DR4 E;  4KHP E;  2GPI A;  2EPX A;  3IWC A;  3J7A G;  3OML A;  4DR4 I;  4R2D A;  1Z0V A;  4KZS A;  2FTX B;  2DSY A;  2V2Z A;  2C39 A;  2ADR A;  5A6B A;  2L3J A;  4DR6 E;  2YZT A;  3LNU A;  3WU6 A;  1EH8 A;  1X6F A;  4MYT A;  3P06 A;  5C0X C;  4GKJ E;  2RSM A;  3HJC A;  1GQE A;  1EI1 A;  2ZIT A;  2LUQ A;  2EPR A;  2V34 A;  2YTQ A;  3IWD A;  1I94 E;  2JOX A;  2NAB A;  2LRS A;  3HXL A;  4R03 A;  3VYX A;  5ELW A;  1IBM I;  5DRP A;  2PO1 B;  1N3G A;  1A1F A;  3ZZ0 A;  3T1Y E;  4I8O A;  2C37 B;  4OO1 E;  4DUZ E;  1HNX E;  1UDN A;  4WYQ B;  1L4S A;  4BS9 A;  1USU A;  1T4N A;  5DNX A;  1Z0G A;  2LJH A;  4JI8 E;  3QG5 C;  2VQF E;  4BA1 A;  1OYR A;  1UBD C;  2RSI A;  3J80 C;  2JP9 A;  2NA2 A;  1J5E E;  1DGC A;  4FW6 A;  5A6J A;  3LPS A;  4OO1 A;  1G2F C;  4B3M I;  2EL6 A;  2L92 A;  1J26 A;  2CTD A;  3PS1 A;  1R6L A;  4DR1 I;  2DMY A;  3T1Y I;  2EOM A;  2HK2 A;  4F9B B;  1OYS A;  1YPN A;  1IBK E;  2F1D A;  4QNJ A;  2I13 A;  2ENH A;  1T39 A;  2EMW A;  2EN2 A;  2EOE A;  2Z5C B;  4MU4 A;  5GMD A;  4JG4 A;  4NXM I;  4LFA E;  2JVA A;  1X6E A;  2EOS A;  1N34 E;  1Y4S A;  2EOO A;  4FW9 A;  5DRR A;  5FWK A;  4DV3 I;  4IFD C;  1SR9 A;  4JV5 E;  2EP3 A;  4JI1 E;  2EM0 A;  2PO2 A;  5JEA F;  4JI4 I;  2EJ4 A;  4M0V A;  2EPL X;  1T4L B;  3PS3 A;  1IBK I;  2YTP A;  3UK3 C;  1MX0 A;  3K1J A;  4USK A;  1N36 I;  1E3H A;  1IQS A;  2G7H A;  1OJ4 A;  3KRN A;  2EMG A;  2YTG A;  1ZBT A;  4HY1 A;  4O4K A;  5BR8 I;  4F9C B;  4JI6 I;  1MU5 A;  5K36 A;  4M2Z A;  1Z0B A;  3ZZT A;  3EPH A;  2EMX A;  1PDA A;  2MKD A;  2NN6 B;  1U2R A;  4DUY I;  1ZM4 A;  3TQM A;  4JI2 E;  1HNZ E;  3FIG A;  1P42 A;  1WJP A;  5LL6 R;  4BCA A;  5AE2 A;  3RMP A;  2EM5 A;  4X65 I;  1HNW I;  4LF4 E;  3PRY A;  3L7Z B;  4IZK A;  4DPT A;  4L5N C;  1WRJ A;  4OO1 B;  1ZM9 A;  2EOH A;  4DR2 E;  1X47 A;  3DF6 A;  4Q35 B;  2WBT A;  2A2C A;  4DV4 I;  2NUG A;  5T6J A;  2EZ6 A;  5LMU I;  3Q6N A;  2EM4 A;  5AC5 A;  2EMF A;  1JK2 A;  2XEX A;  4P7D A;  1I94 I;  5A2Q C;  2EML A;  2RS7 A;  2EOZ A;  1Z5C A;  3EPL A;  1Y4U A;  4IFD D;  4WXC A;  4WUB A;  2EN8 A;  2HHH I;  3HPZ A;  1ZBQ A;  2HGH A;  4AQY E;  3JTZ A;  4JI5 E;  1KVK A;  4FW5 A;  3WU3 A;  4DR3 I;  1JK1 A;  1A1H A;  1YZ9 A;  2AJ4 A;  2B7T A;  2MDR A;  1ZAA C;  1UEK A;  2CZ9 A;  2O3Z A;  2HK3 A;  5GME A;  1ZU1 A;  2EPU A;  2WBU A;  3C6K A;  2EN1 A;  3B82 A;  3M6A A;  4IZJ B;  5C0X F;  4JI0 E;  4JI0 I;  2EMK A;  5A6B D;  2VQF I;  3AUZ A;  4UT4 A;  4ZYD A;  1HNZ I;  2V85 A;  1Z0T A;  4OX9 I;  1ZM3 A;  4ISA A;  1QZR A;  4DMI A;  1RR9 A;  5K36 F;  4DV7 I;  5BR8 E;  4DUZ I;  2B7V A;  1HNX I;  1DQ3 A;  3M85 D;  3DJW A;  3P3E A;  3JAM Q;  2V8Q B;  5IWA E;  4LF7 I;  5IT9 Q;  2UUA E;  5JEA A;  1YYW A;  3F0N A;  4J3D A;  4FW7 A;  3F6G A;  3OTO E;  4BA2 A;  4MU3 A;  2UXD I;  2F4V E;  1PKP A;  1X6H A;  2V86 A;  5KL5 A;  4L8N A;  1HK7 A;  2E5L I;  2EWL A;  2YRK A;  2UXB E;  3P3C A;  2J7J A;  4OZE A;  2EQ3 A;  2EM2 A;  1PJQ A;  1UHZ A;  2DLQ A;  4OO1 D;  1ZXM A;  2JT2 A;  4DV6 I;  3BGH A;  1ZM2 A;  2WNR B;  1N32 E;  2A2D A;  4PU9 A;  2BB8 A;  5CFF E;  2IOQ A;  4QNK A;  1PIE A;  2X36 A;  4R2R A;  4JI2 I;  3C6M A;  4NHR A;  1DI2 A;  1A1G A;  4LPF A;  3ECR A;  1QU6 A;  2EN3 A;  1HR0 E;  5EKW A;  1RRE A;  2DB2 A;  1NHI A;  2J7K A;  4X62 I;  2LO3 A;  3LML A;  4UTG A;  5K36 B;  1XNR I;  5JEA E;  4LF7 E;  2NUE A;  3ZZU A;  4DV1 I;  2EPA A;  1B62 A;  1FJG I;  4ZYE A;  4M9V C;  4NXN I;  3WU4 A;  4N4R B;  1VI7 A;  1YSA C;  3LLH A;  2CPN A;  3THN A;  5KL4 A;  3KZZ A;  3QT8 A;  3IWB A;  2DLK A;  2UUC E;  2KON A;  1EA6 A;  1EH6 A;  3GON A;  3GCM A;  2UUB E;  2BA0 G;  5C0X B;  4DR5 I;  4LFA I;  2UXD E;  1UDQ A;  2AE8 A;  3F6H A;  2R42 A;  2VES A;  2UXC E;  5A6A A;  2MKN A;  2JPA A;  2JXP A;  3VK6 A;  1XNQ E;  2WP8 B;  4OX9 E;  2YTN A;  4IZJ D;  4DPX A;  1J5E I;  4FWG A;  3U1Y A;  5DNL A;  2V2V A;  2EMI A;  2EOJ A;  3D4J A;  2LTR A;  4RPF A;  5AC4 A;  4LFB I;  2Q8U A;  3AV0 A;  1N0V C;  2YTO A;  1BKN A;  4K0K E;  2BV3 A;  5KL7 A;  2EPN A;  3PS2 A;  2PO1 A;  1VIS A;  4R1F A;  2GS8 A;  1FJG E;  3CDJ A;  2NN6 F;  1S16 A;  2UUA I;  4DV1 E;  2YRM A;  2EPP A;  1S4E A;  3PYF A;  5AE3 A;  2PRT A;  2WNR A;  4TUG A;  2EE8 A;  3H1C A;  4R2C A;  3K17 A;  4JI3 E;  4FN5 A;  4BMJ A;  4URL A;  1WHQ A;  1NZ0 A;  3J7Y p;  4LF9 E;  1N33 E;  3L7Z A;  2YTE A;  2EM7 A;  3J80 Q;  4DV5 E;  4ED4 A;  3GLL A;  3HTX A;  1UN6 B;  4YY3 E;  5JEA B;  4BC9 A;  4DV3 E;  4EMD A;  4DV0 I;  4IS9 A;  5JEA C;  2VQE I;  4LF6 E;  1N34 I;  5IXM B;  2V2Q A;  4AID A;  1N32 I;  4F9A B;  1Z1B A;  1DAR A;  2C38 A;  2ENC A;  2JR1 A;  2VRD A;  4IFD F;  5C0X A;  1UDO A;  1PJT A;  2Z5C A;  3P3G A;  3HPS A;  2BM1 A;  4DPY A;  2EL4 A;  2EL5 A;  5IV8 B;  4DR3 E;  4AQY I;  4JI5 I;  1QNT A;  4DPU A;  2E5L E;  4O43 A;  3NZK A;  1E3P A;  2LUP B;  4YY3 I;  2O1U A;  2ODR C;  1TF3 A;  3ZOQ B;  4X8W A;  2BR2 B;  4BA2 B;  2C38 B;  3T1H E;  2CSH A;  1FI4 A;  3BBG A;  2UU9 I;  4MLV A;  4LF5 E;  4YHH E;  4B3S I;  1Z0C A;  1R6M A;  2EMA A;  1FNM A;  2YTI A;  1MEY C;  4HAC B;  1XXE A;  2FGG A;  1XMQ I;  4OOG C;  4BHB A;  1Z0W A;  4DV7 E;  5DNY A;  3LTO A;  4X62 E;  1UDS A;  1YUJ A;  3U1K A;  1IQO A;  4X64 I;  5LMN I;  2YU5 A;  3UHM A;  1K47 A;  4Z7C A;  2HJJ A;  4DU7 A;  2EPM X;  2KHX A;  3MSW A;  2JYA A;  2IHR 1;  4F6N A;  1P47 A;  1Y6Z A;  2NN6 C;  4GKJ I;  2PNM A;  4JYA I;  4GEQ B;  1WUU A;  4IZK B;  1X3C A;  4F2J C;  1KKH A;  2F8B A;  1YUI A;  2MDG A;  4ZVI A;  2EFG A;  3PYD A;  1H7U A;  2L33 A;  4HYM A;  4R8O A;  4WFT A;  2EM8 A;  4R2Q A;  1KYQ A;  1N36 E;  2O1W A;  3K6Q A;  4MLQ A;  4BC7 A;  2L2K B;  4DR7 E;  1X49 A;  2E1R A;  3JU0 A;  1NHJ A;  3J7A M;  2LV2 A;  1YHC A;  3ADI A;  2L6M A;  2PO0 B;  4F54 A;  1N0U A;  2M4I A;  3CDI A;  2WBS A;  4HEI A;  4LF8 E;  2RS6 A;  5K36 C;  2H36 X;  4WSG A;  1IMU A;  2Z5B A;  2K4V A;  1IBL I;  1H74 A; 
#chains in the Genus database with same CATH homology
 4JI7 E;  5IWA I;  2HFU A;  4IZJ A;  4M1K A;  2B3T B;  2N3G A;  4MYU A;  4K0K I;  5IT9 C;  2VF1 A;  4DPW A;  2Z5B B;  2L8T A;  4Z7Y A;  1USV A;  2Z5E A;  2DEJ A;  3HUL A;  1WHN A;  2Q2E B;  2JOB A;  3B8H A;  1H73 A;  2V89 A;  2MC5 A;  2MC6 A;  1RC7 A;  1YYO A;  4LF6 I;  3J81 C;  2DEI A;  2DIX A;  4JV5 I;  3WU5 A;  1KIJ A;  2LE2 A;  2JY9 A;  4X66 E;  3C4T A;  4DR2 I;  3PYG A;  3C4B A;  1ELO A;  1A6F A;  3ZKD A;  2L2M A;  4JI8 I;  2HFS A;  4WUD A;  4HAC A;  1FWL A;  3P1X A;  3Q6M A;  1X48 A;  3K85 A;  4GKK I;  4FWD A;  1XMQ E;  4BBY A;  3ADL A;  4JI7 I;  4LFC I;  3CWV A;  4P78 A;  1Z0E A;  3ADG A;  3ADJ A;  3T1H I;  2JWO A;  1XHK A;  1RQ0 A;  3B78 A;  4LF5 I;  4USM A;  2R3V A;  3V5R A;  2UU9 E;  1UIL A;  2B9D A;  2LTS A;  2V88 A;  2F4V I;  4JI4 E;  4B3R E;  3V2U C;  3OTO I;  2YT4 A;  1Z5A A;  4DV2 E;  4WSP A;  3H09 A;  4DV4 E;  2LJP A;  1XMO E;  2VQE E;  4DV0 E;  4DR5 E;  2O1T A;  2UUB I;  2ZM6 I;  4B3M E;  1O0W A;  1D6T A;  3PYE A;  5ADZ A;  2HKJ A;  4JI3 I;  1ZXN A;  5LMN E;  2VE7 C;  4X64 E;  3JAM C;  4JI6 E;  4DU8 A;  2V87 A;  1Z5B A;  3J81 Q;  4LF8 I;  4B3S E;  5F3W A;  4PRV A;  5AE1 A;  2BM0 A;  1HR0 I;  4WPY A;  4DR6 I;  2N3H A;  2PNL A;  4NXM E;  3HQ1 A;  1XMO I;  5LMU E;  2OI2 A;  1FWK A;  3Q1Q A;  5AAS A;  2UXC I;  2HKE A;  2O1V A;  4KHP I;  4B3R I;  4X65 E;  1HNW E;  4WUC A;  4LTY A;  2V8P A;  4GKK E;  2E1M A;  2GQ0 A;  3QT6 A;  4J8Z A;  4P7A A;  2V83 A;  4LFC E;  1GZ6 A;  2IOP A;  4B3T I;  4DKK A;  2LBS B;  4B3T E;  4NXN E;  3QT5 A;  1NHH A;  1H7S A;  2LMZ A;  2ODR D;  1IBM E;  2FV4 B;  4X66 I;  3KWR A;  3ZKB A;  4PRX A;  5FLX C;  1XNR E;  3VYY A;  5A2Q Q;  4DR7 I;  2CGE A;  1STU A;  4DV6 E;  3H4L A;  4DXL A;  2WZO A;  2NUF A;  1XNQ I;  4DR1 E;  2M7Q A;  2HHH E;  4N3O A;  1KTV A;  2ZBK B;  4DV2 I;  5L3J A;  4DV5 I;  2UXB I;  4LU9 A;  1YYK A;  2UUC I;  4LF9 I;  2M1S A;  1N33 I;  1PVG A;  4JYA E;  2CG9 A;  4DUY E;  3QT7 A;  1EKZ A;  4XTJ A;  4YHH I;  4I3H A;  2VF3 A;  2WW4 A;  4FWH A;  4P52 A;  3ZM7 A;  2X7I A;  1IBL E;  2L3C A;  4LF4 I;  1FKA E;  1MG7 A;  4TUI A;  2KOU A;  2RTX A;  4LFB E;  1H72 C;  1B63 A;  4KQV A;  4JI1 I;  4M30 A;  2ZM6 E;  2NPF A;  1WXR A;  5FLX Q;  2L2N A;  1Z59 A;  4Q28 A;  1T4O A;  4HXZ A;  4DR4 E;  4KHP E;  3IWC A;  3J7A G;  3OML A;  4DR4 I;  1Z0V A;  4KZS A;  2FTX B;  2DSY A;  2V2Z A;  4DR6 E;  2L3J A;  2YZT A;  3LNU A;  3WU6 A;  4MYT A;  3P06 A;  4GKJ E;  2RSM A;  3HJC A;  1GQE A;  1EI1 A;  2ZIT A;  2LUQ A;  2V34 A;  3IWD A;  1I94 E;  2JOX A;  3VYX A;  2LRS A;  3HXL A;  4R03 A;  1IBM I;  3ZZ0 A;  3T1Y E;  4I8O A;  4DUZ E;  1HNX E;  4WYQ B;  4BS9 A;  1USU A;  1T4N A;  1Z0G A;  2LJH A;  4JI8 E;  2VQF E;  3J80 C;  2NA2 A;  1J5E E;  4OX9 I;  3LPS A;  4B3M I;  2L92 A;  1J26 A;  4DR1 I;  2DMY A;  3T1Y I;  2HK2 A;  4F9B B;  1IBK E;  5GMD A;  2Z5C B;  4JG4 A;  4NXM I;  4LFA E;  2JVA A;  4FW9 A;  5FWK A;  1N34 E;  1Y4S A;  4DV3 I;  1SR9 A;  4JV5 E;  4JI1 E;  4JI4 I;  4M0V A;  1T4L B;  1IBK I;  1MX0 A;  3K1J A;  4USK A;  1N36 I;  2G7H A;  1OJ4 A;  1ZBT A;  4HY1 A;  5BR8 I;  4F9C B;  4JI6 I;  1MU5 A;  4M2Z A;  1Z0B A;  3ZZT A;  4DUY I;  1U2R A;  1ZM4 A;  4JI2 E;  1HNZ E;  3FIG A;  5LL6 R;  4BCA A;  5AE2 A;  3RMP A;  4X65 I;  1HNW I;  4LF4 E;  3PRY A;  4IZK A;  4DPT A;  4L5N C;  1ZM9 A;  4DR2 E;  1X47 A;  3DF6 A;  2A2C A;  4DV4 I;  2NUG A;  5T6J A;  2EZ6 A;  5LMU I;  3Q6N A;  2XEX A;  4P7D A;  1I94 I;  5A2Q C;  2RS7 A;  1Z5C A;  1Y4U A;  4WUB A;  2HHH I;  3HPZ A;  1ZBQ A;  4AQY E;  3JTZ A;  4JI5 E;  1KVK A;  3WU3 A;  4DR3 I;  1YZ9 A;  2AJ4 A;  2B7T A;  2MDR A;  1UEK A;  2CZ9 A;  5GME A;  2HK3 A;  4IZJ B;  3B82 A;  3M6A A;  4JI0 E;  4JI0 I;  1HNZ I;  2VQF I;  3AUZ A;  4UT4 A;  2V85 A;  1Z0T A;  1ZM3 A;  1QZR A;  4DMI A;  1RR9 A;  4DV7 I;  5BR8 E;  4DUZ I;  2B7V A;  1HNX I;  1DQ3 A;  3DJW A;  3JAM Q;  2V8Q B;  5IWA E;  4LF7 I;  5IT9 Q;  2UUA E;  1YYW A;  3F0N A;  3F6G A;  3OTO E;  2F4V E;  1PKP A;  2V86 A;  4L8N A;  1HK7 A;  2E5L I;  2EWL A;  2UXB E;  1UHZ A;  1ZXM A;  4DV6 I;  1ZM2 A;  1N32 E;  2A2D A;  4PU9 A;  5CFF E;  2IOQ A;  1PIE A;  2X36 A;  4JI2 I;  1DI2 A;  1QU6 A;  1HR0 E;  1RRE A;  2DB2 A;  1NHI A;  2J7K A;  4X62 I;  3LML A;  4UTG A;  1XNR I;  4LF7 E;  2NUE A;  3ZZU A;  4DV1 I;  1B62 A;  1FJG I;  3WU4 A;  4NXN I;  3LLH A;  2CPN A;  3QT8 A;  3IWB A;  2UUC E;  2KON A;  1EA6 A;  3GON A;  2UUB E;  4DR5 I;  4LFA I;  2UXD E;  3F6H A;  2R42 A;  2UXC E;  4DPX A;  3VK6 A;  1XNQ E;  4IZJ D;  4OX9 E;  1J5E I;  2UXD I;  4FWG A;  2V2V A;  3D4J A;  2LTR A;  4RPF A;  4LFB I;  3AV0 A;  1N0V C;  1BKN A;  4K0K E;  2BV3 A;  1VIS A;  4R1F A;  2GS8 A;  1FJG E;  2UUA I;  1S16 A;  4DV1 E;  1S4E A;  3PYF A;  5AE3 A;  4TUG A;  3K17 A;  4JI3 E;  4FN5 A;  4BMJ A;  4URL A;  1WHQ A;  1NZ0 A;  3J7Y p;  4LF9 E;  1N33 E;  3J80 Q;  4DV5 E;  4ED4 A;  3HTX A;  4YY3 E;  4BC9 A;  4DV3 E;  4EMD A;  4DV0 I;  2VQE I;  1N34 I;  4LF6 E;  2V2Q A;  1N32 I;  4F9A B;  1DAR A;  2JR1 A;  2Z5C A;  3HPS A;  2BM1 A;  4DPY A;  4DR3 E;  4AQY I;  4JI5 I;  4DPU A;  2E5L E;  2LUP B;  4YY3 I;  2O1U A;  2ODR C;  3ZOQ B;  4X8W A;  3T1H E;  1FI4 A;  2UU9 I;  4B3S I;  4LF5 E;  4YHH E;  1Z0C A;  1FNM A;  1XMQ I;  4HAC B;  2FGG A;  4OOG C;  1Z0W A;  4DV7 E;  5DNY A;  3LTO A;  4X62 E;  4X64 I;  5LMN I;  1K47 A;  4Z7C A;  4DU7 A;  3MSW A;  2KHX A;  4GKJ I;  2IHR 1;  4JYA I;  1Y6Z A;  2PNM A;  4GEQ B;  1WUU A;  4IZK B;  1KKH A;  2F8B A;  4ZVI A;  2EFG A;  3PYD A;  1H7U A;  2L33 A;  4HYM A;  4R8O A;  4WFT A;  1N36 E;  2O1W A;  3K6Q A;  4BC7 A;  2L2K B;  4DR7 E;  1X49 A;  2E1R A;  3JU0 A;  1NHJ A;  3J7A M;  3ADI A;  2L6M A;  4F54 A;  1N0U A;  2M4I A;  4LF8 E;  2RS6 A;  2H36 X;  2Z5B A;  2K4V A;  1IBL I;  1H74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...