1FJGE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1fjgE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1fjgE02
2L3JA 2EFGA 1GQEA 2ZBKB 2VQFI 4DU8A 3ZZUA 3T1HE 2CZ9A 1WHQA 1HNWE 2BM1A 3PYFA 3WU3A 3H4LA 2E5LI 4LF9I 2F4VI 4DR5E 2VQEE 2IHR1 4JI6I 1PKPA 4JI2I 1J26A 3JAMQ 1Z0EA 4GKJI 4MYUA 2UXCE 2L3CA 2KHXA 1ZXNA 4JI4I 2DB2A 1OJ4A 3LPSA 1T4NA 1K47A 2UU9I 4K0KE 3F0NA 2DEIA 4DPWA 1H7UA 1Z5CA 4X65I 1NZ0A 1YYWA 2L2KB 1YYOA 3J7AM 1HR0E 2WW4A 5FLXQ 4X62I 4WUDA 4DXLA 4MYTA 1ZM2A 1N34E 4YY3I 1X47A 1RREA 3PYDA 2V8PA 1EI1A 2X7IA 4FW9A 4LF9E 2F4VE 2LTSA 1WUUA 1WHNA 4DUYI 3P1XA 1VISA 1A6FA 3VYXA 1H7SA 3LLHA 3K1JA 1N0VC 1J5EI 4DR6I 2B7VA 4DV6I 4X66E 4DR4E 2EZ6A 2NUEA 1FKAE 4DKKA 5IT9C 1IBMI 4Z7CA 3ZM7A 4JI1E 3J80C 2DIXA 4LFCE 4DR3I 2N3GA 3PYGA 2L2NA 2OI2A 1KIJA 1XNRI 2A2CA 2UXBE 4WUCA 5LMNE 4WUBA 4DV4I 1N33I 2GS8A 1B63A 4HY1A 1N32I 1XMQE 1Z0CA 4DUZE 1Z0GA 4KHPI 4DV1I 1N36I 3PYEA 4JYAI 2NA2A 4GKKE 3OTOE 3V5RA 2HKJA 4LF6E 4NXMI 3J7Yp 4M1KA 4JI3I 4OOGC 1XNQI 1MG7A 4LFBI 1Z0TA 1HNXI 4B3SE 4PU9A 3WU4A 1D6TA 4JI7I 4LFAI 2MDRA 2UUCE 4KQVA 1NHJA 2Q2EB 3QT8A 1FWKA 4DPTA 4X64I 2HHHI 4P52A 4JI5I 2RS6A 3ZKDA 3ADLA 5IWAE 5LMUI 4LF8I 1X49A 4EMDA 4UT4A 5L3JA 1ELOA 4YHHI 2B7TA 2BM0A 1FJGI 2ZM6I 4DV7I 4DV5E 4X8WA 4DR1I 1I94I 3T1YE 2HK3A 1HNXE 4JI0I 1Z5AA 4DR2I 1EA6A 1NHIA 2UUBI 2VQFE 1XMOI 2UUAI 4FWDA 1O0WA 4B3RI 1Z0BA 5GMEA 2HFSA 1ZBTA 2E5LE 4JI6E 4HACA 1S16A 4JI2E 2ZITA 2RSMA 4OX9I 2XEXA 2LUQA 4B3TI 4GKJE 2AJ4A 4NXNI 4Z7YA 4DPUA 1FJGE 1B62A 4DV3I 4JI4E 3ADIA 3J81C 1UEKA 2YT4A 2UU9E 5A2QC 1Z0WA 4DR1E 3QT6A 2J7KA 1PVGA 4HYMA 2V2QA 4DV2I 5IT9Q 4X65E 3C4BA 3ADGA 1YZ9A 1S4EA 3J80Q 4M2ZA 4X62E 2R42A 1T4LB 1RC7A 4YY3E 2V2ZA 4FN5A 4FWGA 4B3MI 1H74A 3B82A 3J7AG 4DUYE 2JY9A 1FI4A 5BR8I 4WYQB 2VF3A 4LF4I 2X36A 1J5EE 4DR6E 4DV6E 1Z59A 3ZZTA 1YYKA 4DR7I 4LF7I 1IBKI 4DV3E 4USMA 2N3HA 1IBME 3QT5A 4ZVIA 2R3VA 4R1FA 3ADJA 4HXZA 3T1HI 1ZM9A 4DV2E 2LRSA 4DR3E 1UILA 1HNWI 4WFTA 2B3TB 1UHZA 4DR5I 2VQEI 4P7AA 2L33A 1XNRE 1NHHA 4DV4E 3B78A 3ZZ0A 1N33E 4DV0I 2LTRA 1N32E 3LTOA 1QZRA 2BV3A 4KHPE 4K0KI 4DV1E 1XHKA 4PRXA 1N36E 4USKA 4JYAE 1EKZA 4LF7E 3K17A 1HR0I 4NXME 4JI3E 5CFFE 4JI8I 1N34I 1XNQE 1QU6A 1IBLI 2A2DA 1FNMA 3B8HA 4DPYA 3JAMC 4LF5I 4LFBE 2NPFA 4AQYI 3WU5A 4JI7E 4LFAE 1H73A 1HNZI 4UTGA 1STUA 3ZKBA 1T4OA 4X64E 2HHHE 4X66I 2HKEA 4JI5E 1DI2A 4DR4I 4DV0E 2V2VA 5LMUE 1FWLA 2LJPA 4LF8E 1RQ0A 1X48A 4JI1I 1KTVA 3WU6A 1ZXMA 4LFCI 4PRVA 5FLXC 3C4TA 5GMDA 4URLA 1KVKA 2DEJA 2CPNA 4YHHE 2RTXA 2ZM6E 4JI8E 2UXBI 4DV7E 2DMYA 5LMNI 1IBLE 4I3HA 4M30A 1I94E 1Z5BA 4LF5E 1ZM3A 4AQYE 3VYYA 4JI0E 3J81Q 4DPXA 4DR2E 5A2QQ 1XMQI 4DUZI 1HNZE 2UUBE 4FWHA 3V2UC 4HACB 1ZM4A 4JG4A 1XMOE 2UUAE 1H72C 2UXDI 4B3RE 1MX0A 4GKKI 3OTOI 3HULA 4JV5I 4RPFA 4LF6I 1BKNA 2RS7A 2V34A 5LL6R 1U2RA 4OX9E 2HFUA 4B3TE 4B3SI 1KKHA 2LJHA 4NXNE 2UUCI 1MU5A 2JVAA 3HTXA 3QT7A 3M6AA 2HK2A 5IWAI 2LUPB 3CWVA 4ED4A 2L2MA 3LNUA 2UXDE 2LBSB 1RR9A 1DARA 2E1RA 1PIEA 4JV5E 3GONA 4B3ME 2NUGA 4DU7A 1Z0VA 2UXCI 3Q1QA 5BR8E 4DV5I 4LF4E 1N0UA 4XTJA 2NUFA 3T1YI 3D4JA 4DR7E 1IBKE
chains in the Genus database with same CATH superfamily
2L3JA 2EM4A 1GQEA 2EFGA 2EOHA 2FGGA 2ZBKB 4MLVA 4QNKA 4TUGA 2YWQA 2VQFI 2CSHA 4DU8A 3ZZUA 2EMCA 3T1HE 3DF6A 4WXCA 2CZ9A 2NABA 4ZYGA 1YUJA 1WHQA 1HNWE 1R6MA 2M1SA 2EMZA 2BM1A 1SR9A 3PYFA 3WU3A 2LV2A 5FWKA 3H4LA 2E5LI 2VRDA 5IV8B 2K7IA 4LF9I 2F4VI 3H09A 4DR5E 1RHYA 2VQEE 2IHR1 4JI6I 4NZVA 1PKPA 4JI2I 2V86A 2EL5A 2EORA 1J26A 3VHTB 2WNRA 3JAMQ 2NN6A 1Z0EA 3EPJA 1USVA 1EH7A 4GKJI 2EL4A 2YTDA 1TF6A 4MYUA 2UXCE 2EN3A 2EPXA 2L3CA 2YZTA 2IOQA 2PNZA 2KHXA 1ZXNA 1B69A 3GMEA 2DB2A 1OJ4A 3LPSA 4JI4I 4BMJA 2EMFA 2C39A 1T4NA 4O24A 4R2CA 1K47A 2PRTA 3Q6NA 2UU9I 2C37B 4IZJD 1AH5A 4K0KE 3F0NA 1ZAAC 2YTQA 1OYPA 3MHSC 1YSAC 2DEIA 2WP8B 4BA2B 4WPYA 2BA0D 2JEBB 4DPWA 1H7UA 1Z5CA 4NBQA 2BB8A 2EP3A 2KOUA 3IWCA 1NZ0A 1Y5YA 4X65I 1YPNA 1YYWA 2L2KB 1Z1BA 4IFDB 1YYOA 3J7AM 4WSPA 5LLQA 1HR0E 2WW4A 3TQMA 2CGEA 2LMZA 5FLXQ 4F9BB 4X62I 1NEIA 2EMIA 4N4RB 1UBDC 4WUDA 3P06A 4DXLA 4BCAA 2CG9A 1ZM2A 1N34E 4MYTA 1X47A 4YY3I 1RREA 3PYDA 1NCSA 2V8PA 1EI1A 4N3OA 2X7IA 4FW9A 5AE1A 4LF9E 2F4VE 2LTSA 1F2IG 2KONA 4RH8A 2H36X 1WUUA 1WHNA 2PO0A 4DUYI 3P1XA 3L7ZB 1VISA 1A6FA 3VYXA 1A1IA 1H7SA 3LLHA 2NN6F 3K1JA 2N8XA 1N0VC 1J5EI 4DR6I 2B7VA 4BHCA 4DV6I 1BBGA 1T39A 1DGCA 1PDAA 2EPZA 4X66E 4DR4E 2EZ6A 2EJ4A 2NUEA 2Z5BA 5KL6A 5DRQA 1FKAE 4DKKA 5IT9C 1IBMI 2LE2A 2YTIA 4LU9A 2JXPA 1YHCA 1Y6ZA 3ZM7A 4Z7CA 4IZJA 3C6MA 3JU0A 4JI1E 3J80C 2DIXA 4FK5C 4LFCE 4DR3I 2N3GA 5DROA 5C0XD 2ELYA 2DLQA 2V88A 2YTFA 3ECRA 2L2NA 3PYGA 4BC7A 2L6MA 4L8NA 2AE8A 5AASA 2GQ0A 3M7ND 2OI2A 5K36B 4IZKB 2DGCA 2EM6A 1KIJA 1XXEA 3KWRA 2WCC3 1YH8A 2ELZA 2EMHA 1XNRI 2A2CA 2UXBE 4R2RA 5TSEA 4WUCA 5LMNE 5C0XC 4WUBA 3LMLA 5DNYA 4DV4I 1OYRA 5JEAB 2LO3A 4AM3A 2EOXA 1N33I 2GS8A 1B63A 4HY1A 1N32I 1XMQE 1Z0CA 3U1YA 4DUZE 2IERA 3DD6A 1P47A 1Z0GA 4KHPI 4QNJA 4DV1I 2GO4A 4MU1A 2JEAA 2EOQA 1TN9A 1N36I 2E72A 3PYEA 4JYAI 2GLIA 2EPOA 2NA2A 2VF1A 1OYSA 2R76A 4GKKE 3OTOE 3V5RA 3AV0A 4OO1D 2V87A 2HKJA 4LF6E 4KWYA 3NZKA 5AE2A 2EQ3A 2F8BA 4NXMI 3J7Yp 2V89A 4M1KA 4JI3I 2EPAA 4OOGC 4MU0A 5DNXA 3VK6A 2I9IA 4R2QA 5C0XA 1XNQI 2EMAA 5A6KA 1R6LA 1MG7A 2JE6B 2RSIA 4LFBI 1Z0TA 3H1CA 4B3SE 1HNXI 4OO1C 4PU9A 4BA1B 3WU4A 1D6TA 2EE8A 2EMGA 4JI7I 4LFAI 2MDRA 2UUCE 4IFDD 4KQVA 1NHJA 2Q2EB 1ZU1A 2JR1A 3QT8A 1FWKA 2EM0A 4DPTA 4IFDE 4F2JC 4X64I 2HHHI 5T6JA 4P52A 4JI5I 2PO1B 4TUIA 1A1JA 5DRRA 2RS6A 4O4KA 3ZKDA 4R2AA 1LLMC 3ADLA 1IQOA 3PRYA 5IWAE 5LMUI 2YTGA 4O5GA 4LF8I 2EOJA 3HJCA 1UDSA 2K4VA 2MDGA 1X49A 2G7HA 4L5NC 5IXMB 4EMDA 4UT4A 4U3DA 2E1MA 5L3JA 2BBGA 4OO1A 1HK7A 1ELOA 2IOPA 2O1TA 4YHHI 2B7TA 2DSYA 2BR2B 2EL6A 2YSOA 3CDIA 5KL3A 2BM0A 1GTKA 1FJGI 2LCEA 2MC6A 2JWOA 2GPIA 2C37A 2ZM6I 1X3CA 2M4IA 4GEQB 5C0XF 4DV7I 4F6NA 3THNA 4DV5E 2WP8A 3UK3C 4X8WA 4BA2A 4DR1I 4BBYA 2JEBA 3T1YE 2DRPA 2HK3A 1I94I 2EOFA 1HNXE 3IWDA 3GCMA 4JI0I 1Z5AA 4IFDA 2YU5A 4DR2I 1EA6A 1NHIA 2EM9A 4FW6A 2Z5CB 2YSPA 2JP9A 2UUBI 5EKWA 2VQFE 2YTPA 1XMOI 2UUAI 4FWDA 4M0VA 1UN6B 5K36E 1O0WA 5A6BD 2NN6B 4B3RI 4J8ZA 1BBOA 5JEAD 1Z0BA 5GMEA 3EQ1A 2HFSA 4ISAA 1ZBTA 2PNZB 1YUIA 2E5LE 3L7ZA 3ZOQB 4MU3A 1G2FC 3EPHA 3P3GA 5JEAE 4JI6E 4HACA 4OKGA 1S16A 4JI2E 4R03A 2J65A 2ZITA 2RSMA 4LCHA 2XEXA 4OX9I 2LUQA 4OO1F 3JTZA 2F1DA 4B3TI 2YTEA 3MSWA 4GKJE 2AJ4A 2C38A 3GLLA 4NXNI 2JOBA 4Z7YA 4DPUA 2EOSA 2EMYA 1FJGE 1B62A 4DV3I 4JI4E 3ADIA 3J81C 1UEKA 2YT4A 2EN6A 2M7QA 2JYAA 3BIDA 4BC9A 4Q28A 2WBUA 2UU9E 1IMUA 5A2QC 1Z0WA 2EM2A 4DR1E 3P76A 3QT6A 1A1LA 4LPFA 3M99B 2J7KA 1PVGA 4HYMA 3P3CA 2V2QA 4IFDF 2EMXA 4DV2I 2ENHA 5IT9Q 4X65E 3C4BA 4GQUA 3ADGA 4X9JA 1KJKA 1YZ9A 4R2SA 2PO0B 1PJSA 3F6GA 1T38A 1S4EA 3KRNA 2O3ZA 3J80Q 2RQLA 4M2ZA 2BA1D 2CT1A 4X62E 2R42A 3BGHA 5A6BA 1T4LB 1RC7A 2YRKA 2ODRD 4YY3E 2V2ZA 4FN5A 5JEAA 4BHBA 4FWGA 4B3MI 1H74A 4IJDA 4WXDA 2Z5BB 3B82A 3J7AG 1X6HA 2EOMA 2RPCA 4DUYE 2JY9A 1FI4A 5BR8I 1ZR9A 4WYQB 2VF3A 2EM8A 4LF4I 5KL4A 2X36A 2EM7A 1BB8A 1J5EE 1A1HA 4DR6E 2YPNA 4DV6E 3U1KA 1Z59A 2YRHA 2MC5A 2MKDA 3ZZTA 1YYKA 4DR7I 4LF7I 4ZYEA 4DV3E 2WBSA 2YRMA 4USMA 1IBKI 2EPNA 4WSGA 2N3HA 4MDTA 5ADZA 1IBME 3QT5A 4ZVIA 4M9VC 1GZ6A 1WRJA 2LT7A 3DJWA 2J7JA 2R3VA 3ADJA 4HXZA 4R1FA 5KL2A 2MKNA 3T1HI 1X5WA 3PS2A 1ZM9A 4GZNC 1P42A 2JE6A 4DV2E 2LRSA 4DR3E 1UILA 2EM5A 1HNWI 5K36F 4WFTA 2V8QB 2PO2A 2B3TB 1L4SA 2EWLA 3AUZA 1UHZA 2JPAA 3Q6MA 2EMKA 2VQEI 4DR5I 2EPPA 4P7AA 2L33A 1VI7A 2IESA 4Q35B 3PS3A 3THOB 1XNRE 3M85D 5JEAF 1PJQA 4OZEA 1X6FA 1NHHA 4DV4E 3B78A 2V85A 3ZZ0A 2DLKA 4IS9A 2EMBA 1IQSA 1N33E 2VESA 4DV0I 4IFDC 2NN6E 2LTRA 1AAYA 1N32E 2GHFA 3LTOA 1QZRA 2EPKX 2BV3A 2I13A 4KHPE 4K0KI 5C0XB 2D9HA 4NHRA 4DV1E 1XHKA 4PRXA 1G2DC 4BS9A 2EOIA 1N36E 4FW7A 1WXRA 4JYAE 1EKZA 4USKA 2PNLA 4LF7E 2BR2A 3CDJA 3K17A 4P78A 3HPSA 1HR0I 1EH8A 3PS1A 4HTGA 5EL9A 4NXME 2R1FA 2JT2A 4JI3E 3HKMA 2GO3A 5CFFE 4JI8I 5A6JA 3BF2A 4F9AB 1JK2A 2L92A 1N34I 5DNLA 1XNQE 1QU6A 5DRPA 4WX9A 1IBLI 2A2DA 3UHMA 5KL5A 1FNMA 3JAMC 3B8HA 4DPYA 2B9DA 2ENAA 4LFBE 3EPKA 2NPFA 5ELWA 2Z5CA 3WU5A 4AQYI 4LF5I 3HQ1A 4JI7E 2EMLA 4LFAE 1H73A 1Y4SA 2BA0G 3B4TA 5K36D 4RHBB 5AC4A 2EN4A 3QG5C 1HNZI 2JOXA 2CVEA 4UTGA 1STUA 3ZKBA 1T4OA 2WNRB 4DMIA 4X64E 2HHHE 4X66I 2HKEA 4JI5E 1DI2A 4OO1B 4MQYA 4DR4I 2EPUA 2VE7C 3HXLA 5A6AA 4DV0E 4AIMA 2YTJA 1Y60A 2V2VA 5K36C 2V83A 1UDQA 3MHHC 1A1GA 3BBGA 4J3DA 2ADRA 2FTXB 5LMUE 4LF8E 1FWLA 2LJPA 2WBTA 1RQ0A 1X48A 4FW3A 2C39B 4JI1I 1KTVA 3WU6A 1JK1A 1WJPA 1ZXMA 4LFCI 5KL7A 4PRVA 4ZYHA 5FLXC 2HGHA 1Y4UA 3C4TA 5GMDA 5JEAC 4URLA 1KVKA 2DEJA 2CPNA 4MLQA 2A25A 4YHHE 1ZBQA 2RTXA 1MGTA 2CTDA 3C6KA 2EOOA 4JI8E 2ZM6E 2O1UA 4DV7E 4P7DA 2DMYA 2PNMA 1USUA 2WZOA 5LMNI 2UXBI 4LTYA 1IBLE 1A1KA 3RMPA 4I3HA 2Z5EA 4HEIA 4M30A 1I94E 1TF3A 1UDNA 2FV4B 3IWBA 4LF5E 1Z5BA 2LVHA 2EPLX 4AQYE 3VYYA 4ZYDA 4JI0E 1ZM3A 3J81Q 4DPXA 4DR2E 2EN8A 3L00A 1PJTA 2LJUA 5K36A 4IZKA 4O43A 5A2QQ 1XMQI 2O1VA 4DUZI 2EOYA 1HNZE 3KZYA 2UUBE 4FW4A 4FWHA 4HACB 3V2UC 3M7NG 1ZM4A 4JG4A 2YU8A 2BA1G 1XMOE 2L8TA 2UUAE 1H72C 2UXDI 1QNTA 2EN2A 1X6EA 4B3RE 4LOMA 3OMLA 1MX0A 2C38B 4GKKI 3OTOI 3HULA 4JV5I 4RPFA 2EM3A 4LF6I 1YFHA 2YTNA 2ENCA 2EPMX 2RS7A 1BKNA 2V34A 1KYQA 5LL6R 3P3EA 1U2RA 4IZJB 1EH6A 4OX9E 2HFUA 2ODRC 3HPZA 2EOEA 4B3TE 4B3SI 1KKHA 5AC5A 2LJHA 4NXNE 2UUCI 5C0XE 4F6MA 2EPRA 2O1WA 1MU5A 1DQ3A 5F3WA 1UDOA 3EPLA 4R2EA 1A1FA 3F6HA 2EQ0A 2JVAA 3HTXA 1MEYC 4I8OA 4KZSA 4FW5A 2HC5A 3QT7A 2EOZA 3M6AA 4F54A 4BA1A 1RMDA 2EQ1A 2HK2A 5IWAI 4R2PA 2LUPB 1SFEA 2M9AA 3CWVA 4MU4A 4IS1C 2L2MA 4ED4A 3LNUA 5A69A 2UXDE 2LBSB 1RR9A 1DARA 2E1RA 3K85A 2JEAB 3M85G 5AE3A 2EN1A 2NN6D 2PO1A 1PIEA 4JV5E 3K6QA 3GONA 4B3ME 2YTOA 2EN7A 1N3GA 4R2DA 3KZZA 2NUGA 2Q8UA 1Z0VA 4DU7A 2UXCI 3Q1QA 2EPCA 3FIGA 4OO1E 1E3HA 5BR8E 4DV5I 4LF4E 4LCFA 4LCGA 1N0UA 4XTJA 4R8OA 4AIDA 2HJJA 2NUFA 3T1YI 2NN6C 2EMWA 2DMIA 3D4JA 1E3PA 4F9CB 2PO2B 4DR7E 1IBKE 4U3BA
chains in the Genus database with same CATH topology
2L3JA 2EFGA 1GQEA 2FGGA 2ZBKB 4TUGA 2VQFI 4DU8A 3ZZUA 3T1HE 3DF6A 2CZ9A 1WHQA 1HNWE 2M1SA 2BM1A 1SR9A 3PYFA 3WU3A 5FWKA 3H4LA 2E5LI 4LF9I 2F4VI 3H09A 4DR5E 2VQEE 2IHR1 4JI6I 1PKPA 4JI2I 2V86A 1J26A 3JAMQ 1Z0EA 1USVA 4GKJI 4MYUA 2UXCE 2L3CA 2YZTA 2IOQA 2KHXA 1ZXNA 4JI4I 2DB2A 1OJ4A 3LPSA 4BMJA 1T4NA 1K47A 3Q6NA 2UU9I 4IZJD 4K0KE 3F0NA 2DEIA 4WPYA 4DPWA 1H7UA 1Z5CA 2KOUA 4X65I 3IWCA 1NZ0A 1YYWA 2L2KB 1YYOA 3J7AM 4WSPA 1HR0E 2WW4A 2CGEA 2LMZA 5FLXQ 4F9BB 4X62I 4WUDA 3P06A 4DXLA 4BCAA 2CG9A 1ZM2A 1N34E 4MYTA 1X47A 4YY3I 1RREA 3PYDA 2V8PA 1EI1A 4N3OA 2X7IA 4FW9A 5AE1A 4LF9E 2F4VE 2LTSA 1WUUA 2KONA 2H36X 1WHNA 4DUYI 3P1XA 1VISA 1A6FA 3VYXA 1H7SA 3LLHA 3K1JA 1N0VC 1J5EI 4DR6I 2B7VA 4DV6I 4X66E 4DR4E 2EZ6A 2NUEA 2Z5BA 1FKAE 4DKKA 5IT9C 1IBMI 2LE2A 4LU9A 4Z7CA 1Y6ZA 3ZM7A 4IZJA 3JU0A 4JI1E 3J80C 2DIXA 4LFCE 4DR3I 2N3GA 3PYGA 2V88A 2L2NA 4BC7A 2L6MA 4L8NA 5AASA 2GQ0A 2OI2A 4IZKB 1KIJA 3KWRA 1XNRI 2A2CA 2UXBE 4WUCA 5LMNE 4WUBA 3LMLA 5DNYA 4DV4I 1N33I 2GS8A 1B63A 4HY1A 1N32I 1XMQE 1Z0CA 4DUZE 1Z0GA 4KHPI 4DV1I 1N36I 3PYEA 4JYAI 2NA2A 2VF1A 4GKKE 3OTOE 3V5RA 3AV0A 2V87A 2HKJA 4LF6E 5AE2A 2F8BA 4NXMI 3J7Yp 2V89A 4M1KA 4JI3I 4OOGC 3VK6A 1XNQI 1MG7A 4LFBI 1Z0TA 1HNXI 4B3SE 4PU9A 3WU4A 1D6TA 4JI7I 4LFAI 2MDRA 2UUCE 4KQVA 1NHJA 2Q2EB 2JR1A 3QT8A 1FWKA 4DPTA 4X64I 2HHHI 5T6JA 4P52A 4JI5I 4TUIA 2RS6A 3ZKDA 3ADLA 5IWAE 5LMUI 4LF8I 3HJCA 2K4VA 1X49A 2G7HA 4L5NC 4EMDA 4UT4A 2E1MA 5L3JA 1HK7A 1ELOA 2IOPA 2O1TA 4YHHI 2B7TA 2DSYA 2BM0A 1FJGI 2MC6A 2JWOA 2ZM6I 2M4IA 4GEQB 4DV7I 4DV5E 4X8WA 4DR1I 4BBYA 1I94I 3T1YE 2HK3A 1HNXE 3IWDA 4JI0I 1Z5AA 4DR2I 1EA6A 1NHIA 2Z5CB 2UUBI 2VQFE 1XMOI 2UUAI 4FWDA 4M0VA 1O0WA 4B3RI 4J8ZA 1Z0BA 5GMEA 2HFSA 1ZBTA 2E5LE 3ZOQB 4JI6E 4HACA 1S16A 4JI2E 4R03A 2ZITA 2RSMA 4OX9I 2XEXA 2LUQA 3JTZA 4B3TI 3MSWA 4GKJE 2AJ4A 4NXNI 2JOBA 4Z7YA 4DPUA 1FJGE 1B62A 4DV3I 4JI4E 3ADIA 3J81C 1UEKA 2YT4A 2M7QA 4BC9A 4Q28A 2UU9E 5A2QC 1Z0WA 4DR1E 3QT6A 2J7KA 1PVGA 4HYMA 2V2QA 4DV2I 5IT9Q 4X65E 3C4BA 3ADGA 1YZ9A 3F6GA 1S4EA 3J80Q 4M2ZA 4X62E 2R42A 1T4LB 1RC7A 2ODRD 4YY3E 2V2ZA 4FN5A 4FWGA 4B3MI 1H74A 2Z5BB 3B82A 3J7AG 4DUYE 2JY9A 1FI4A 5BR8I 4WYQB 2VF3A 4LF4I 2X36A 1J5EE 4DR6E 4DV6E 1Z59A 2MC5A 3ZZTA 1YYKA 4DR7I 4LF7I 1IBKI 4DV3E 4USMA 2N3HA 5ADZA 1IBME 3QT5A 4ZVIA 1GZ6A 2R3VA 3DJWA 4R1FA 3ADJA 4HXZA 3T1HI 1ZM9A 4DV2E 2LRSA 4DR3E 1UILA 1HNWI 4WFTA 2V8QB 2B3TB 2EWLA 3AUZA 1UHZA 3Q6MA 4DR5I 2VQEI 4P7AA 2L33A 1XNRE 1NHHA 4DV4E 3B78A 2V85A 3ZZ0A 1N33E 4DV0I 2LTRA 1N32E 3LTOA 1QZRA 2BV3A 4KHPE 4K0KI 4DV1E 1XHKA 4PRXA 4BS9A 1N36E 4USKA 1WXRA 4JYAE 1EKZA 2PNLA 4LF7E 3K17A 4P78A 3HPSA 1HR0I 4NXME 4JI3E 5CFFE 4JI8I 1N34I 4F9AB 2L92A 1XNQE 1QU6A 1IBLI 2A2DA 1FNMA 3JAMC 3B8HA 4DPYA 2B9DA 4LFBE 2NPFA 4AQYI 4LF5I 3WU5A 2Z5CA 3HQ1A 4JI7E 4LFAE 1H73A 1Y4SA 1HNZI 2JOXA 4UTGA 1STUA 3ZKBA 1T4OA 4X64E 4DMIA 2HHHE 4X66I 2HKEA 4JI5E 1DI2A 4DR4I 3HXLA 2VE7C 4DV0E 2V2VA 2V83A 2FTXB 5LMUE 1FWLA 4LF8E 2LJPA 1RQ0A 1X48A 4JI1I 1KTVA 3WU6A 1ZXMA 4LFCI 4PRVA 5FLXC 1Y4UA 3C4TA 5GMDA 4URLA 1KVKA 2DEJA 2CPNA 4YHHE 1ZBQA 2RTXA 2ZM6E 2O1UA 4JI8E 2UXBI 4DV7E 4P7DA 2DMYA 2PNMA 1USUA 2WZOA 5LMNI 4LTYA 1IBLE 3RMPA 4I3HA 2Z5EA 4M30A 1I94E 2FV4B 3IWBA 4LF5E 1Z5BA 1ZM3A 4AQYE 3VYYA 4JI0E 3J81Q 4DPXA 4DR2E 4IZKA 5A2QQ 1XMQI 2O1VA 4DUZI 1HNZE 2UUBE 4FWHA 3V2UC 4HACB 1ZM4A 4JG4A 1XMOE 2L8TA 2UUAE 1H72C 2UXDI 4B3RE 3OMLA 1MX0A 4GKKI 3OTOI 3HULA 4JV5I 4RPFA 4LF6I 1BKNA 2RS7A 2V34A 5LL6R 1U2RA 4IZJB 4OX9E 2HFUA 2ODRC 3HPZA 4B3TE 4B3SI 1KKHA 2LJHA 4NXNE 2UUCI 2O1WA 1MU5A 1DQ3A 5F3WA 3F6HA 2JVAA 3HTXA 4I8OA 4KZSA 3QT7A 3M6AA 4F54A 2HK2A 5IWAI 2LUPB 3CWVA 4ED4A 2L2MA 3LNUA 2UXDE 2LBSB 1RR9A 1DARA 2E1RA 3K85A 5AE3A 1PIEA 4JV5E 3K6QA 3GONA 4B3ME 3PRYA 2NUGA 4DU7A 1Z0VA 2UXCI 3Q1QA 3FIGA 5BR8E 4DV5I 4LF4E 1N0UA 4XTJA 4R8OA 2NUFA 3T1YI 3D4JA 4F9CB 4DR7E 1IBKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3J A;  2EFG A;  1GQE A;  2ZBK B;  2VQF I;  4DU8 A;  3ZZU A;  3T1H E;  2CZ9 A;  1WHQ A;  1HNW E;  2BM1 A;  3PYF A;  3WU3 A;  3H4L A;  2E5L I;  4LF9 I;  2F4V I;  4DR5 E;  2VQE E;  2IHR 1;  4JI6 I;  1PKP A;  4JI2 I;  1J26 A;  3JAM Q;  1Z0E A;  4GKJ I;  4MYU A;  2UXC E;  2L3C A;  2KHX A;  1ZXN A;  4JI4 I;  2DB2 A;  1OJ4 A;  3LPS A;  1T4N A;  1K47 A;  2UU9 I;  4K0K E;  3F0N A;  2DEI A;  4DPW A;  1H7U A;  1Z5C A;  4X65 I;  1NZ0 A;  1YYW A;  2L2K B;  1YYO A;  3J7A M;  1HR0 E;  2WW4 A;  5FLX Q;  4X62 I;  4WUD A;  4DXL A;  4MYT A;  1ZM2 A;  1N34 E;  4YY3 I;  1X47 A;  1RRE A;  3PYD A;  2V8P A;  1EI1 A;  2X7I A;  4FW9 A;  4LF9 E;  2F4V E;  2LTS A;  1WUU A;  1WHN A;  4DUY I;  3P1X A;  1VIS A;  1A6F A;  3VYX A;  1H7S A;  3LLH A;  3K1J A;  1N0V C;  1J5E I;  4DR6 I;  2B7V A;  4DV6 I;  4X66 E;  4DR4 E;  2EZ6 A;  2NUE A;  1FKA E;  4DKK A;  5IT9 C;  1IBM I;  4Z7C A;  3ZM7 A;  4JI1 E;  3J80 C;  2DIX A;  4LFC E;  4DR3 I;  2N3G A;  3PYG A;  2L2N A;  2OI2 A;  1KIJ A;  1XNR I;  2A2C A;  2UXB E;  4WUC A;  5LMN E;  4WUB A;  4DV4 I;  1N33 I;  2GS8 A;  1B63 A;  4HY1 A;  1N32 I;  1XMQ E;  1Z0C A;  4DUZ E;  1Z0G A;  4KHP I;  4DV1 I;  1N36 I;  3PYE A;  4JYA I;  2NA2 A;  4GKK E;  3OTO E;  3V5R A;  2HKJ A;  4LF6 E;  4NXM I;  3J7Y p;  4M1K A;  4JI3 I;  4OOG C;  1XNQ I;  1MG7 A;  4LFB I;  1Z0T A;  1HNX I;  4B3S E;  4PU9 A;  3WU4 A;  1D6T A;  4JI7 I;  4LFA I;  2MDR A;  2UUC E;  4KQV A;  1NHJ A;  2Q2E B;  3QT8 A;  1FWK A;  4DPT A;  4X64 I;  2HHH I;  4P52 A;  4JI5 I;  2RS6 A;  3ZKD A;  3ADL A;  5IWA E;  5LMU I;  4LF8 I;  1X49 A;  4EMD A;  4UT4 A;  5L3J A;  1ELO A;  4YHH I;  2B7T A;  2BM0 A;  1FJG I;  2ZM6 I;  4DV7 I;  4DV5 E;  4X8W A;  4DR1 I;  1I94 I;  3T1Y E;  2HK3 A;  1HNX E;  4JI0 I;  1Z5A A;  4DR2 I;  1EA6 A;  1NHI A;  2UUB I;  2VQF E;  1XMO I;  2UUA I;  4FWD A;  1O0W A;  4B3R I;  1Z0B A;  5GME A;  2HFS A;  1ZBT A;  2E5L E;  4JI6 E;  4HAC A;  1S16 A;  4JI2 E;  2ZIT A;  2RSM A;  4OX9 I;  2XEX A;  2LUQ A;  4B3T I;  4GKJ E;  2AJ4 A;  4NXN I;  4Z7Y A;  4DPU A;  1FJG E;  1B62 A;  4DV3 I;  4JI4 E;  3ADI A;  3J81 C;  1UEK A;  2YT4 A;  2UU9 E;  5A2Q C;  1Z0W A;  4DR1 E;  3QT6 A;  2J7K A;  1PVG A;  4HYM A;  2V2Q A;  4DV2 I;  5IT9 Q;  4X65 E;  3C4B A;  3ADG A;  1YZ9 A;  1S4E A;  3J80 Q;  4M2Z A;  4X62 E;  2R42 A;  1T4L B;  1RC7 A;  4YY3 E;  2V2Z A;  4FN5 A;  4FWG A;  4B3M I;  1H74 A;  3B82 A;  3J7A G;  4DUY E;  2JY9 A;  1FI4 A;  5BR8 I;  4WYQ B;  2VF3 A;  4LF4 I;  2X36 A;  1J5E E;  4DR6 E;  4DV6 E;  1Z59 A;  3ZZT A;  1YYK A;  4DR7 I;  4LF7 I;  1IBK I;  4DV3 E;  4USM A;  2N3H A;  1IBM E;  3QT5 A;  4ZVI A;  2R3V A;  4R1F A;  3ADJ A;  4HXZ A;  3T1H I;  1ZM9 A;  4DV2 E;  2LRS A;  4DR3 E;  1UIL A;  1HNW I;  4WFT A;  2B3T B;  1UHZ A;  4DR5 I;  2VQE I;  4P7A A;  2L33 A;  1XNR E;  1NHH A;  4DV4 E;  3B78 A;  3ZZ0 A;  1N33 E;  4DV0 I;  2LTR A;  1N32 E;  3LTO A;  1QZR A;  2BV3 A;  4KHP E;  4K0K I;  4DV1 E;  1XHK A;  4PRX A;  1N36 E;  4USK A;  4JYA E;  1EKZ A;  4LF7 E;  3K17 A;  1HR0 I;  4NXM E;  4JI3 E;  5CFF E;  4JI8 I;  1N34 I;  1XNQ E;  1QU6 A;  1IBL I;  2A2D A;  1FNM A;  3B8H A;  4DPY A;  3JAM C;  4LF5 I;  4LFB E;  2NPF A;  4AQY I;  3WU5 A;  4JI7 E;  4LFA E;  1H73 A;  1HNZ I;  4UTG A;  1STU A;  3ZKB A;  1T4O A;  4X64 E;  2HHH E;  4X66 I;  2HKE A;  4JI5 E;  1DI2 A;  4DR4 I;  4DV0 E;  2V2V A;  5LMU E;  1FWL A;  2LJP A;  4LF8 E;  1RQ0 A;  1X48 A;  4JI1 I;  1KTV A;  3WU6 A;  1ZXM A;  4LFC I;  4PRV A;  5FLX C;  3C4T A;  5GMD A;  4URL A;  1KVK A;  2DEJ A;  2CPN A;  4YHH E;  2RTX A;  2ZM6 E;  4JI8 E;  2UXB I;  4DV7 E;  2DMY A;  5LMN I;  1IBL E;  4I3H A;  4M30 A;  1I94 E;  1Z5B A;  4LF5 E;  1ZM3 A;  4AQY E;  3VYY A;  4JI0 E;  3J81 Q;  4DPX A;  4DR2 E;  5A2Q Q;  1XMQ I;  4DUZ I;  1HNZ E;  2UUB E;  4FWH A;  3V2U C;  4HAC B;  1ZM4 A;  4JG4 A;  1XMO E;  2UUA E;  1H72 C;  2UXD I;  4B3R E;  1MX0 A;  4GKK I;  3OTO I;  3HUL A;  4JV5 I;  4RPF A;  4LF6 I;  1BKN A;  2RS7 A;  2V34 A;  5LL6 R;  1U2R A;  4OX9 E;  2HFU A;  4B3T E;  4B3S I;  1KKH A;  2LJH A;  4NXN E;  2UUC I;  1MU5 A;  2JVA A;  3HTX A;  3QT7 A;  3M6A A;  2HK2 A;  5IWA I;  2LUP B;  3CWV A;  4ED4 A;  2L2M A;  3LNU A;  2UXD E;  2LBS B;  1RR9 A;  1DAR A;  2E1R A;  1PIE A;  4JV5 E;  3GON A;  4B3M E;  2NUG A;  4DU7 A;  1Z0V A;  2UXC I;  3Q1Q A;  5BR8 E;  4DV5 I;  4LF4 E;  1N0U A;  4XTJ A;  2NUF A;  3T1Y I;  3D4J A;  4DR7 E;  1IBK E; 
#chains in the Genus database with same CATH topology
 2L3J A;  2EM4 A;  1GQE A;  2EFG A;  2EOH A;  2FGG A;  2ZBK B;  4MLV A;  4QNK A;  4TUG A;  2YWQ A;  2VQF I;  2CSH A;  4DU8 A;  3ZZU A;  2EMC A;  3T1H E;  3DF6 A;  4WXC A;  2CZ9 A;  2NAB A;  4ZYG A;  1YUJ A;  1WHQ A;  1HNW E;  1R6M A;  2M1S A;  2EMZ A;  2BM1 A;  1SR9 A;  3PYF A;  3WU3 A;  2LV2 A;  5FWK A;  3H4L A;  2E5L I;  2VRD A;  5IV8 B;  2K7I A;  4LF9 I;  2F4V I;  3H09 A;  4DR5 E;  1RHY A;  2VQE E;  2IHR 1;  4JI6 I;  4NZV A;  1PKP A;  4JI2 I;  2V86 A;  2EL5 A;  2EOR A;  1J26 A;  3VHT B;  2WNR A;  3JAM Q;  2NN6 A;  1Z0E A;  3EPJ A;  1USV A;  1EH7 A;  4GKJ I;  2EL4 A;  2YTD A;  1TF6 A;  4MYU A;  2UXC E;  2EN3 A;  2EPX A;  2L3C A;  2YZT A;  2IOQ A;  2PNZ A;  2KHX A;  1ZXN A;  1B69 A;  3GME A;  2DB2 A;  1OJ4 A;  3LPS A;  4JI4 I;  4BMJ A;  2EMF A;  2C39 A;  1T4N A;  4O24 A;  4R2C A;  1K47 A;  2PRT A;  3Q6N A;  2UU9 I;  2C37 B;  4IZJ D;  1AH5 A;  4K0K E;  3F0N A;  1ZAA C;  2YTQ A;  1OYP A;  3MHS C;  1YSA C;  2DEI A;  2WP8 B;  4BA2 B;  4WPY A;  2BA0 D;  2JEB B;  4DPW A;  1H7U A;  1Z5C A;  4NBQ A;  2BB8 A;  2EP3 A;  2KOU A;  3IWC A;  1NZ0 A;  1Y5Y A;  4X65 I;  1YPN A;  1YYW A;  2L2K B;  1Z1B A;  4IFD B;  1YYO A;  3J7A M;  4WSP A;  5LLQ A;  1HR0 E;  2WW4 A;  3TQM A;  2CGE A;  2LMZ A;  5FLX Q;  4F9B B;  4X62 I;  1NEI A;  2EMI A;  4N4R B;  1UBD C;  4WUD A;  3P06 A;  4DXL A;  4BCA A;  2CG9 A;  1ZM2 A;  1N34 E;  4MYT A;  1X47 A;  4YY3 I;  1RRE A;  3PYD A;  1NCS A;  2V8P A;  1EI1 A;  4N3O A;  2X7I A;  4FW9 A;  5AE1 A;  4LF9 E;  2F4V E;  2LTS A;  1F2I G;  2KON A;  4RH8 A;  2H36 X;  1WUU A;  1WHN A;  2PO0 A;  4DUY I;  3P1X A;  3L7Z B;  1VIS A;  1A6F A;  3VYX A;  1A1I A;  1H7S A;  3LLH A;  2NN6 F;  3K1J A;  2N8X A;  1N0V C;  1J5E I;  4DR6 I;  2B7V A;  4BHC A;  4DV6 I;  1BBG A;  1T39 A;  1DGC A;  1PDA A;  2EPZ A;  4X66 E;  4DR4 E;  2EZ6 A;  2EJ4 A;  2NUE A;  2Z5B A;  5KL6 A;  5DRQ A;  1FKA E;  4DKK A;  5IT9 C;  1IBM I;  2LE2 A;  2YTI A;  4LU9 A;  2JXP A;  1YHC A;  1Y6Z A;  3ZM7 A;  4Z7C A;  4IZJ A;  3C6M A;  3JU0 A;  4JI1 E;  3J80 C;  2DIX A;  4FK5 C;  4LFC E;  4DR3 I;  2N3G A;  5DRO A;  5C0X D;  2ELY A;  2DLQ A;  2V88 A;  2YTF A;  3ECR A;  2L2N A;  3PYG A;  4BC7 A;  2L6M A;  4L8N A;  2AE8 A;  5AAS A;  2GQ0 A;  3M7N D;  2OI2 A;  5K36 B;  4IZK B;  2DGC A;  2EM6 A;  1KIJ A;  1XXE A;  3KWR A;  2WCC 3;  1YH8 A;  2ELZ A;  2EMH A;  1XNR I;  2A2C A;  2UXB E;  4R2R A;  5TSE A;  4WUC A;  5LMN E;  5C0X C;  4WUB A;  3LML A;  5DNY A;  4DV4 I;  1OYR A;  5JEA B;  2LO3 A;  4AM3 A;  2EOX A;  1N33 I;  2GS8 A;  1B63 A;  4HY1 A;  1N32 I;  1XMQ E;  1Z0C A;  3U1Y A;  4DUZ E;  2IER A;  3DD6 A;  1P47 A;  1Z0G A;  4KHP I;  4QNJ A;  4DV1 I;  2GO4 A;  4MU1 A;  2JEA A;  2EOQ A;  1TN9 A;  1N36 I;  2E72 A;  3PYE A;  4JYA I;  2GLI A;  2EPO A;  2NA2 A;  2VF1 A;  1OYS A;  2R76 A;  4GKK E;  3OTO E;  3V5R A;  3AV0 A;  4OO1 D;  2V87 A;  2HKJ A;  4LF6 E;  4KWY A;  3NZK A;  5AE2 A;  2EQ3 A;  2F8B A;  4NXM I;  3J7Y p;  2V89 A;  4M1K A;  4JI3 I;  2EPA A;  4OOG C;  4MU0 A;  5DNX A;  3VK6 A;  2I9I A;  4R2Q A;  5C0X A;  1XNQ I;  2EMA A;  5A6K A;  1R6L A;  1MG7 A;  2JE6 B;  2RSI A;  4LFB I;  1Z0T A;  3H1C A;  4B3S E;  1HNX I;  4OO1 C;  4PU9 A;  4BA1 B;  3WU4 A;  1D6T A;  2EE8 A;  2EMG A;  4JI7 I;  4LFA I;  2MDR A;  2UUC E;  4IFD D;  4KQV A;  1NHJ A;  2Q2E B;  1ZU1 A;  2JR1 A;  3QT8 A;  1FWK A;  2EM0 A;  4DPT A;  4IFD E;  4F2J C;  4X64 I;  2HHH I;  5T6J A;  4P52 A;  4JI5 I;  2PO1 B;  4TUI A;  1A1J A;  5DRR A;  2RS6 A;  4O4K A;  3ZKD A;  4R2A A;  1LLM C;  3ADL A;  1IQO A;  3PRY A;  5IWA E;  5LMU I;  2YTG A;  4O5G A;  4LF8 I;  2EOJ A;  3HJC A;  1UDS A;  2K4V A;  2MDG A;  1X49 A;  2G7H A;  4L5N C;  5IXM B;  4EMD A;  4UT4 A;  4U3D A;  2E1M A;  5L3J A;  2BBG A;  4OO1 A;  1HK7 A;  1ELO A;  2IOP A;  2O1T A;  4YHH I;  2B7T A;  2DSY A;  2BR2 B;  2EL6 A;  2YSO A;  3CDI A;  5KL3 A;  2BM0 A;  1GTK A;  1FJG I;  2LCE A;  2MC6 A;  2JWO A;  2GPI A;  2C37 A;  2ZM6 I;  1X3C A;  2M4I A;  4GEQ B;  5C0X F;  4DV7 I;  4F6N A;  3THN A;  4DV5 E;  2WP8 A;  3UK3 C;  4X8W A;  4BA2 A;  4DR1 I;  4BBY A;  2JEB A;  3T1Y E;  2DRP A;  2HK3 A;  1I94 I;  2EOF A;  1HNX E;  3IWD A;  3GCM A;  4JI0 I;  1Z5A A;  4IFD A;  2YU5 A;  4DR2 I;  1EA6 A;  1NHI A;  2EM9 A;  4FW6 A;  2Z5C B;  2YSP A;  2JP9 A;  2UUB I;  5EKW A;  2VQF E;  2YTP A;  1XMO I;  2UUA I;  4FWD A;  4M0V A;  1UN6 B;  5K36 E;  1O0W A;  5A6B D;  2NN6 B;  4B3R I;  4J8Z A;  1BBO A;  5JEA D;  1Z0B A;  5GME A;  3EQ1 A;  2HFS A;  4ISA A;  1ZBT A;  2PNZ B;  1YUI A;  2E5L E;  3L7Z A;  3ZOQ B;  4MU3 A;  1G2F C;  3EPH A;  3P3G A;  5JEA E;  4JI6 E;  4HAC A;  4OKG A;  1S16 A;  4JI2 E;  4R03 A;  2J65 A;  2ZIT A;  2RSM A;  4LCH A;  2XEX A;  4OX9 I;  2LUQ A;  4OO1 F;  3JTZ A;  2F1D A;  4B3T I;  2YTE A;  3MSW A;  4GKJ E;  2AJ4 A;  2C38 A;  3GLL A;  4NXN I;  2JOB A;  4Z7Y A;  4DPU A;  2EOS A;  2EMY A;  1FJG E;  1B62 A;  4DV3 I;  4JI4 E;  3ADI A;  3J81 C;  1UEK A;  2YT4 A;  2EN6 A;  2M7Q A;  2JYA A;  3BID A;  4BC9 A;  4Q28 A;  2WBU A;  2UU9 E;  1IMU A;  5A2Q C;  1Z0W A;  2EM2 A;  4DR1 E;  3P76 A;  3QT6 A;  1A1L A;  4LPF A;  3M99 B;  2J7K A;  1PVG A;  4HYM A;  3P3C A;  2V2Q A;  4IFD F;  2EMX A;  4DV2 I;  2ENH A;  5IT9 Q;  4X65 E;  3C4B A;  4GQU A;  3ADG A;  4X9J A;  1KJK A;  1YZ9 A;  4R2S A;  2PO0 B;  1PJS A;  3F6G A;  1T38 A;  1S4E A;  3KRN A;  2O3Z A;  3J80 Q;  2RQL A;  4M2Z A;  2BA1 D;  2CT1 A;  4X62 E;  2R42 A;  3BGH A;  5A6B A;  1T4L B;  1RC7 A;  2YRK A;  2ODR D;  4YY3 E;  2V2Z A;  4FN5 A;  5JEA A;  4BHB A;  4FWG A;  4B3M I;  1H74 A;  4IJD A;  4WXD A;  2Z5B B;  3B82 A;  3J7A G;  1X6H A;  2EOM A;  2RPC A;  4DUY E;  2JY9 A;  1FI4 A;  5BR8 I;  1ZR9 A;  4WYQ B;  2VF3 A;  2EM8 A;  4LF4 I;  5KL4 A;  2X36 A;  2EM7 A;  1BB8 A;  1J5E E;  1A1H A;  4DR6 E;  2YPN A;  4DV6 E;  3U1K A;  1Z59 A;  2YRH A;  2MC5 A;  2MKD A;  3ZZT A;  1YYK A;  4DR7 I;  4LF7 I;  4ZYE A;  4DV3 E;  2WBS A;  2YRM A;  4USM A;  1IBK I;  2EPN A;  4WSG A;  2N3H A;  4MDT A;  5ADZ A;  1IBM E;  3QT5 A;  4ZVI A;  4M9V C;  1GZ6 A;  1WRJ A;  2LT7 A;  3DJW A;  2J7J A;  2R3V A;  3ADJ A;  4HXZ A;  4R1F A;  5KL2 A;  2MKN A;  3T1H I;  1X5W A;  3PS2 A;  1ZM9 A;  4GZN C;  1P42 A;  2JE6 A;  4DV2 E;  2LRS A;  4DR3 E;  1UIL A;  2EM5 A;  1HNW I;  5K36 F;  4WFT A;  2V8Q B;  2PO2 A;  2B3T B;  1L4S A;  2EWL A;  3AUZ A;  1UHZ A;  2JPA A;  3Q6M A;  2EMK A;  2VQE I;  4DR5 I;  2EPP A;  4P7A A;  2L33 A;  1VI7 A;  2IES A;  4Q35 B;  3PS3 A;  3THO B;  1XNR E;  3M85 D;  5JEA F;  1PJQ A;  4OZE A;  1X6F A;  1NHH A;  4DV4 E;  3B78 A;  2V85 A;  3ZZ0 A;  2DLK A;  4IS9 A;  2EMB A;  1IQS A;  1N33 E;  2VES A;  4DV0 I;  4IFD C;  2NN6 E;  2LTR A;  1AAY A;  1N32 E;  2GHF A;  3LTO A;  1QZR A;  2EPK X;  2BV3 A;  2I13 A;  4KHP E;  4K0K I;  5C0X B;  2D9H A;  4NHR A;  4DV1 E;  1XHK A;  4PRX A;  1G2D C;  4BS9 A;  2EOI A;  1N36 E;  4FW7 A;  1WXR A;  4JYA E;  1EKZ A;  4USK A;  2PNL A;  4LF7 E;  2BR2 A;  3CDJ A;  3K17 A;  4P78 A;  3HPS A;  1HR0 I;  1EH8 A;  3PS1 A;  4HTG A;  5EL9 A;  4NXM E;  2R1F A;  2JT2 A;  4JI3 E;  3HKM A;  2GO3 A;  5CFF E;  4JI8 I;  5A6J A;  3BF2 A;  4F9A B;  1JK2 A;  2L92 A;  1N34 I;  5DNL A;  1XNQ E;  1QU6 A;  5DRP A;  4WX9 A;  1IBL I;  2A2D A;  3UHM A;  5KL5 A;  1FNM A;  3JAM C;  3B8H A;  4DPY A;  2B9D A;  2ENA A;  4LFB E;  3EPK A;  2NPF A;  5ELW A;  2Z5C A;  3WU5 A;  4AQY I;  4LF5 I;  3HQ1 A;  4JI7 E;  2EML A;  4LFA E;  1H73 A;  1Y4S A;  2BA0 G;  3B4T A;  5K36 D;  4RHB B;  5AC4 A;  2EN4 A;  3QG5 C;  1HNZ I;  2JOX A;  2CVE A;  4UTG A;  1STU A;  3ZKB A;  1T4O A;  2WNR B;  4DMI A;  4X64 E;  2HHH E;  4X66 I;  2HKE A;  4JI5 E;  1DI2 A;  4OO1 B;  4MQY A;  4DR4 I;  2EPU A;  2VE7 C;  3HXL A;  5A6A A;  4DV0 E;  4AIM A;  2YTJ A;  1Y60 A;  2V2V A;  5K36 C;  2V83 A;  1UDQ A;  3MHH C;  1A1G A;  3BBG A;  4J3D A;  2ADR A;  2FTX B;  5LMU E;  4LF8 E;  1FWL A;  2LJP A;  2WBT A;  1RQ0 A;  1X48 A;  4FW3 A;  2C39 B;  4JI1 I;  1KTV A;  3WU6 A;  1JK1 A;  1WJP A;  1ZXM A;  4LFC I;  5KL7 A;  4PRV A;  4ZYH A;  5FLX C;  2HGH A;  1Y4U A;  3C4T A;  5GMD A;  5JEA C;  4URL A;  1KVK A;  2DEJ A;  2CPN A;  4MLQ A;  2A25 A;  4YHH E;  1ZBQ A;  2RTX A;  1MGT A;  2CTD A;  3C6K A;  2EOO A;  4JI8 E;  2ZM6 E;  2O1U A;  4DV7 E;  4P7D A;  2DMY A;  2PNM A;  1USU A;  2WZO A;  5LMN I;  2UXB I;  4LTY A;  1IBL E;  1A1K A;  3RMP A;  4I3H A;  2Z5E A;  4HEI A;  4M30 A;  1I94 E;  1TF3 A;  1UDN A;  2FV4 B;  3IWB A;  4LF5 E;  1Z5B A;  2LVH A;  2EPL X;  4AQY E;  3VYY A;  4ZYD A;  4JI0 E;  1ZM3 A;  3J81 Q;  4DPX A;  4DR2 E;  2EN8 A;  3L00 A;  1PJT A;  2LJU A;  5K36 A;  4IZK A;  4O43 A;  5A2Q Q;  1XMQ I;  2O1V A;  4DUZ I;  2EOY A;  1HNZ E;  3KZY A;  2UUB E;  4FW4 A;  4FWH A;  4HAC B;  3V2U C;  3M7N G;  1ZM4 A;  4JG4 A;  2YU8 A;  2BA1 G;  1XMO E;  2L8T A;  2UUA E;  1H72 C;  2UXD I;  1QNT A;  2EN2 A;  1X6E A;  4B3R E;  4LOM A;  3OML A;  1MX0 A;  2C38 B;  4GKK I;  3OTO I;  3HUL A;  4JV5 I;  4RPF A;  2EM3 A;  4LF6 I;  1YFH A;  2YTN A;  2ENC A;  2EPM X;  2RS7 A;  1BKN A;  2V34 A;  1KYQ A;  5LL6 R;  3P3E A;  1U2R A;  4IZJ B;  1EH6 A;  4OX9 E;  2HFU A;  2ODR C;  3HPZ A;  2EOE A;  4B3T E;  4B3S I;  1KKH A;  5AC5 A;  2LJH A;  4NXN E;  2UUC I;  5C0X E;  4F6M A;  2EPR A;  2O1W A;  1MU5 A;  1DQ3 A;  5F3W A;  1UDO A;  3EPL A;  4R2E A;  1A1F A;  3F6H A;  2EQ0 A;  2JVA A;  3HTX A;  1MEY C;  4I8O A;  4KZS A;  4FW5 A;  2HC5 A;  3QT7 A;  2EOZ A;  3M6A A;  4F54 A;  4BA1 A;  1RMD A;  2EQ1 A;  2HK2 A;  5IWA I;  4R2P A;  2LUP B;  1SFE A;  2M9A A;  3CWV A;  4MU4 A;  4IS1 C;  2L2M A;  4ED4 A;  3LNU A;  5A69 A;  2UXD E;  2LBS B;  1RR9 A;  1DAR A;  2E1R A;  3K85 A;  2JEA B;  3M85 G;  5AE3 A;  2EN1 A;  2NN6 D;  2PO1 A;  1PIE A;  4JV5 E;  3K6Q A;  3GON A;  4B3M E;  2YTO A;  2EN7 A;  1N3G A;  4R2D A;  3KZZ A;  2NUG A;  2Q8U A;  1Z0V A;  4DU7 A;  2UXC I;  3Q1Q A;  2EPC A;  3FIG A;  4OO1 E;  1E3H A;  5BR8 E;  4DV5 I;  4LF4 E;  4LCF A;  4LCG A;  1N0U A;  4XTJ A;  4R8O A;  4AID A;  2HJJ A;  2NUF A;  3T1Y I;  2NN6 C;  2EMW A;  2DMI A;  3D4J A;  1E3P A;  4F9C B;  2PO2 B;  4DR7 E;  1IBK E;  4U3B A; 
#chains in the Genus database with same CATH homology
 2L3J A;  2EFG A;  1GQE A;  2FGG A;  2ZBK B;  4TUG A;  2VQF I;  4DU8 A;  3ZZU A;  3T1H E;  3DF6 A;  2CZ9 A;  1WHQ A;  1HNW E;  2M1S A;  2BM1 A;  1SR9 A;  3PYF A;  3WU3 A;  5FWK A;  3H4L A;  2E5L I;  4LF9 I;  2F4V I;  3H09 A;  4DR5 E;  2VQE E;  2IHR 1;  4JI6 I;  1PKP A;  4JI2 I;  2V86 A;  1J26 A;  3JAM Q;  1Z0E A;  1USV A;  4GKJ I;  4MYU A;  2UXC E;  2L3C A;  2YZT A;  2IOQ A;  2KHX A;  1ZXN A;  4JI4 I;  2DB2 A;  1OJ4 A;  3LPS A;  4BMJ A;  1T4N A;  1K47 A;  3Q6N A;  2UU9 I;  4IZJ D;  4K0K E;  3F0N A;  2DEI A;  4WPY A;  4DPW A;  1H7U A;  1Z5C A;  2KOU A;  4X65 I;  3IWC A;  1NZ0 A;  1YYW A;  2L2K B;  1YYO A;  3J7A M;  4WSP A;  1HR0 E;  2WW4 A;  2CGE A;  2LMZ A;  5FLX Q;  4F9B B;  4X62 I;  4WUD A;  3P06 A;  4DXL A;  4BCA A;  2CG9 A;  1ZM2 A;  1N34 E;  4MYT A;  1X47 A;  4YY3 I;  1RRE A;  3PYD A;  2V8P A;  1EI1 A;  4N3O A;  2X7I A;  4FW9 A;  5AE1 A;  4LF9 E;  2F4V E;  2LTS A;  1WUU A;  2KON A;  2H36 X;  1WHN A;  4DUY I;  3P1X A;  1VIS A;  1A6F A;  3VYX A;  1H7S A;  3LLH A;  3K1J A;  1N0V C;  1J5E I;  4DR6 I;  2B7V A;  4DV6 I;  4X66 E;  4DR4 E;  2EZ6 A;  2NUE A;  2Z5B A;  1FKA E;  4DKK A;  5IT9 C;  1IBM I;  2LE2 A;  4LU9 A;  4Z7C A;  1Y6Z A;  3ZM7 A;  4IZJ A;  3JU0 A;  4JI1 E;  3J80 C;  2DIX A;  4LFC E;  4DR3 I;  2N3G A;  3PYG A;  2V88 A;  2L2N A;  4BC7 A;  2L6M A;  4L8N A;  5AAS A;  2GQ0 A;  2OI2 A;  4IZK B;  1KIJ A;  3KWR A;  1XNR I;  2A2C A;  2UXB E;  4WUC A;  5LMN E;  4WUB A;  3LML A;  5DNY A;  4DV4 I;  1N33 I;  2GS8 A;  1B63 A;  4HY1 A;  1N32 I;  1XMQ E;  1Z0C A;  4DUZ E;  1Z0G A;  4KHP I;  4DV1 I;  1N36 I;  3PYE A;  4JYA I;  2NA2 A;  2VF1 A;  4GKK E;  3OTO E;  3V5R A;  3AV0 A;  2V87 A;  2HKJ A;  4LF6 E;  5AE2 A;  2F8B A;  4NXM I;  3J7Y p;  2V89 A;  4M1K A;  4JI3 I;  4OOG C;  3VK6 A;  1XNQ I;  1MG7 A;  4LFB I;  1Z0T A;  1HNX I;  4B3S E;  4PU9 A;  3WU4 A;  1D6T A;  4JI7 I;  4LFA I;  2MDR A;  2UUC E;  4KQV A;  1NHJ A;  2Q2E B;  2JR1 A;  3QT8 A;  1FWK A;  4DPT A;  4X64 I;  2HHH I;  5T6J A;  4P52 A;  4JI5 I;  4TUI A;  2RS6 A;  3ZKD A;  3ADL A;  5IWA E;  5LMU I;  4LF8 I;  3HJC A;  2K4V A;  1X49 A;  2G7H A;  4L5N C;  4EMD A;  4UT4 A;  2E1M A;  5L3J A;  1HK7 A;  1ELO A;  2IOP A;  2O1T A;  4YHH I;  2B7T A;  2DSY A;  2BM0 A;  1FJG I;  2MC6 A;  2JWO A;  2ZM6 I;  2M4I A;  4GEQ B;  4DV7 I;  4DV5 E;  4X8W A;  4DR1 I;  4BBY A;  1I94 I;  3T1Y E;  2HK3 A;  1HNX E;  3IWD A;  4JI0 I;  1Z5A A;  4DR2 I;  1EA6 A;  1NHI A;  2Z5C B;  2UUB I;  2VQF E;  1XMO I;  2UUA I;  4FWD A;  4M0V A;  1O0W A;  4B3R I;  4J8Z A;  1Z0B A;  5GME A;  2HFS A;  1ZBT A;  2E5L E;  3ZOQ B;  4JI6 E;  4HAC A;  1S16 A;  4JI2 E;  4R03 A;  2ZIT A;  2RSM A;  4OX9 I;  2XEX A;  2LUQ A;  3JTZ A;  4B3T I;  3MSW A;  4GKJ E;  2AJ4 A;  4NXN I;  2JOB A;  4Z7Y A;  4DPU A;  1FJG E;  1B62 A;  4DV3 I;  4JI4 E;  3ADI A;  3J81 C;  1UEK A;  2YT4 A;  2M7Q A;  4BC9 A;  4Q28 A;  2UU9 E;  5A2Q C;  1Z0W A;  4DR1 E;  3QT6 A;  2J7K A;  1PVG A;  4HYM A;  2V2Q A;  4DV2 I;  5IT9 Q;  4X65 E;  3C4B A;  3ADG A;  1YZ9 A;  3F6G A;  1S4E A;  3J80 Q;  4M2Z A;  4X62 E;  2R42 A;  1T4L B;  1RC7 A;  2ODR D;  4YY3 E;  2V2Z A;  4FN5 A;  4FWG A;  4B3M I;  1H74 A;  2Z5B B;  3B82 A;  3J7A G;  4DUY E;  2JY9 A;  1FI4 A;  5BR8 I;  4WYQ B;  2VF3 A;  4LF4 I;  2X36 A;  1J5E E;  4DR6 E;  4DV6 E;  1Z59 A;  2MC5 A;  3ZZT A;  1YYK A;  4DR7 I;  4LF7 I;  1IBK I;  4DV3 E;  4USM A;  2N3H A;  5ADZ A;  1IBM E;  3QT5 A;  4ZVI A;  1GZ6 A;  2R3V A;  3DJW A;  4R1F A;  3ADJ A;  4HXZ A;  3T1H I;  1ZM9 A;  4DV2 E;  2LRS A;  4DR3 E;  1UIL A;  1HNW I;  4WFT A;  2V8Q B;  2B3T B;  2EWL A;  3AUZ A;  1UHZ A;  3Q6M A;  4DR5 I;  2VQE I;  4P7A A;  2L33 A;  1XNR E;  1NHH A;  4DV4 E;  3B78 A;  2V85 A;  3ZZ0 A;  1N33 E;  4DV0 I;  2LTR A;  1N32 E;  3LTO A;  1QZR A;  2BV3 A;  4KHP E;  4K0K I;  4DV1 E;  1XHK A;  4PRX A;  4BS9 A;  1N36 E;  4USK A;  1WXR A;  4JYA E;  1EKZ A;  2PNL A;  4LF7 E;  3K17 A;  4P78 A;  3HPS A;  1HR0 I;  4NXM E;  4JI3 E;  5CFF E;  4JI8 I;  1N34 I;  4F9A B;  2L92 A;  1XNQ E;  1QU6 A;  1IBL I;  2A2D A;  1FNM A;  3JAM C;  3B8H A;  4DPY A;  2B9D A;  4LFB E;  2NPF A;  4AQY I;  4LF5 I;  3WU5 A;  2Z5C A;  3HQ1 A;  4JI7 E;  4LFA E;  1H73 A;  1Y4S A;  1HNZ I;  2JOX A;  4UTG A;  1STU A;  3ZKB A;  1T4O A;  4X64 E;  4DMI A;  2HHH E;  4X66 I;  2HKE A;  4JI5 E;  1DI2 A;  4DR4 I;  3HXL A;  2VE7 C;  4DV0 E;  2V2V A;  2V83 A;  2FTX B;  5LMU E;  1FWL A;  4LF8 E;  2LJP A;  1RQ0 A;  1X48 A;  4JI1 I;  1KTV A;  3WU6 A;  1ZXM A;  4LFC I;  4PRV A;  5FLX C;  1Y4U A;  3C4T A;  5GMD A;  4URL A;  1KVK A;  2DEJ A;  2CPN A;  4YHH E;  1ZBQ A;  2RTX A;  2ZM6 E;  2O1U A;  4JI8 E;  2UXB I;  4DV7 E;  4P7D A;  2DMY A;  2PNM A;  1USU A;  2WZO A;  5LMN I;  4LTY A;  1IBL E;  3RMP A;  4I3H A;  2Z5E A;  4M30 A;  1I94 E;  2FV4 B;  3IWB A;  4LF5 E;  1Z5B A;  1ZM3 A;  4AQY E;  3VYY A;  4JI0 E;  3J81 Q;  4DPX A;  4DR2 E;  4IZK A;  5A2Q Q;  1XMQ I;  2O1V A;  4DUZ I;  1HNZ E;  2UUB E;  4FWH A;  3V2U C;  4HAC B;  1ZM4 A;  4JG4 A;  1XMO E;  2L8T A;  2UUA E;  1H72 C;  2UXD I;  4B3R E;  3OML A;  1MX0 A;  4GKK I;  3OTO I;  3HUL A;  4JV5 I;  4RPF A;  4LF6 I;  1BKN A;  2RS7 A;  2V34 A;  5LL6 R;  1U2R A;  4IZJ B;  4OX9 E;  2HFU A;  2ODR C;  3HPZ A;  4B3T E;  4B3S I;  1KKH A;  2LJH A;  4NXN E;  2UUC I;  2O1W A;  1MU5 A;  1DQ3 A;  5F3W A;  3F6H A;  2JVA A;  3HTX A;  4I8O A;  4KZS A;  3QT7 A;  3M6A A;  4F54 A;  2HK2 A;  5IWA I;  2LUP B;  3CWV A;  4ED4 A;  2L2M A;  3LNU A;  2UXD E;  2LBS B;  1RR9 A;  1DAR A;  2E1R A;  3K85 A;  5AE3 A;  1PIE A;  4JV5 E;  3K6Q A;  3GON A;  4B3M E;  3PRY A;  2NUG A;  4DU7 A;  1Z0V A;  2UXC I;  3Q1Q A;  3FIG A;  5BR8 E;  4DV5 I;  4LF4 E;  1N0U A;  4XTJ A;  4R8O A;  2NUF A;  3T1Y I;  3D4J A;  4F9C B;  4DR7 E;  1IBK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...