1FJGE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1fjgE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1fjgE02
1IBLI 1BKNA 4B3TE 2EZ6A 4DV5E 2V8PA 3WU5A 3J7AG 2L2NA 1ZM2A 3C4BA 1H74A 2UXBE 4DR1E 2NA2A 2B7TA 1XHKA 4FN5A 2ZITA 1KTVA 4LFAE 2F4VE 1N34I 4FW9A 4JI0E 4M1KA 4R1FA 2N3HA 3WU3A 2HKEA 1XMOI 4DU7A 1D6TA 1WHQA 3T1YI 2X7IA 2A2DA 4OX9I 4DR4E 1HNXI 4DV3I 3QT5A 4ZVIA 4NXME 1DI2A 1STUA 2LJPA 4DR5I 2UUCI 2DIXA 1MG7A 4DPUA 3M6AA 1H7SA 3ZZUA 4YHHE 4DR2E 4DR3E 4DV4I 3HULA 4MYUA 4WUDA 4X62E 4DR6E 3PYFA 1UEKA 1HNZE 1XNQE 2YT4A 2UXDE 2LJHA 2R42A 4USKA 4DPWA 2DMYA 1KKHA 1PIEA 4DV1E 4JI6I 3B82A 3PYGA 1GQEA 1IBMI 4LF7E 2V2ZA 2R3VA 2HK2A 2E1RA 1N0UA 2NUFA 3OTOE 4B3TI 1VISA 1ZXNA 4DV5I 1KVKA 2UXBI 3GONA 4DR1I 2XEXA 4DPYA 4X8WA 3B78A 2VQEE 2HKJA 3PYDA 4X66E 1Z0BA 3J7AM 2AJ4A 4LFAI 2F4VI 2BM0A 4JI0I 2JVAA 4DUZE 1ZM4A 4PU9A 2ZBKB 1DARA 1Z0WA 4GKKE 1S16A 5GMDA 4LF4E 4DR4I 4WUBA 4GKJI 1NHIA 4B3SE 4NXMI 4K0KE 2HFSA 2L33A 1N33E 4HYMA 4B3RE 4NXNE 4LF8E 4DV2E 4WUCA 2RTXA 4JI7E 4HXZA 4JI3E 5LL6R 1RC7A 2B3TB 4B3ME 5A2QC 5LMUE 1T4NA 2WW4A 1ZBTA 2UXCE 4YHHI 4JI8E 1YYOA 4DR2I 4DR3I 1K47A 1YZ9A 4X62I 4DPTA 4DR6I 2GS8A 1FWLA 4HACA 1HNZI 5CFFE 1XNQI 2KHXA 4P7AA 3WU4A 2UXDI 1Z5CA 4JI1E 5IT9C 4I3HA 3T1HE 1X48A 4HACB 4P52A 1RR9A 4DV1I 1N32E 4GKJE 2L2MA 4LF7I 4X65E 4LF5E 3QT6A 1FJGE 3OTOI 1O0WA 1XNRE 3QT8A 1FI4A 5BR8E 1T4LB 3J7Yp 3ADGA 2LTSA 1HNWE 1QZRA 1Z0VA 2VQEI 2DEJA 3ZKBA 5A2QQ 4X66I 1B63A 4URLA 4WFTA 4OOGC 1ZXMA 3ADLA 1YYKA 2HK3A 2V2QA 3CWVA 4DUZI 2J7KA 3VYYA 4FWGA 1Z0TA 4LF9E 2UUBE 1EKZA 4GKKI 1XMQE 4WYQB 4DR7E 4LF4I 3LLHA 5IT9Q 4B3SI 4K0KI 1J5EE 2RSMA 1H7UA 1N33I 1X47A 4B3RI 4NXNI 4LF8I 4DV2I 2A2CA 4JI7I 4Z7YA 2VQFE 4JI5E 4JI3I 1FNMA 1HR0E 4LFBE 4B3MI 1UHZA 2V2VA 5LMUI 3WU6A 2JY9A 2CPNA 2UUAE 2UXCI 4YY3E 4MYTA 4JI8I 5L3JA 1OJ4A 5FLXQ 4X64E 5LMNE 4JG4A 4JYAE 1H72C 4FWHA 2CZ9A 1I94E 1IBKI 4DV0E 4PRXA 4JI1I 3T1HI 3LTOA 1WUUA 1ELOA 4DUYE 4AQYE 1N32I 4X65I 4DV7E 4LF5I 1FJGI 1NZ0A 1Z0CA 1ZM9A 4JV5E 1N0VC 1XNRI 4DPXA 3D4JA 3ZM7A 1B62A 4XTJA 3JAMC 5BR8I 2DB2A 1H73A 4DKKA 1EA6A 4LF6E 4DU8A 1HNWI 2NUEA 1S4EA 5GMEA 3J81C 4Z7CA 3F0NA 4DV6E 2RS6A 2ZM6E 1Z0EA 2LUPB 2LRSA 4UTGA 1N36E 1IBKE 1Z5AA 4LF9I 2UUBI 3J80C 4JI4E 1XMQI 4DR7I 5IWAE 2UU9E 4JI2E 3H4LA 2IHR1 1MX0A 2E5LE 2BV3A 4LFCE 2HHHE 1PVGA 3V5RA 4M2ZA 1J5EI 3C4TA 2V34A 3ADJA 4DXLA 2VQFI 4JI5I 3V2UC 4HY1A 1HR0I 4LFBI 4KHPE 1NHJA 2EFGA 3B8HA 5FLXC 2UUAI 3JAMQ 4YY3I 4ED4A 1A6FA 1UILA 2OI2A 2L3CA 1FWKA 3ADIA 2B7VA 4X64I 2NPFA 5LMNI 4JYAI 1IBLE 3ZZ0A 3J81Q 3ZZTA 1I94I 2HFUA 2VF3A 4DV0I 4USMA 1RREA 1Z5BA 3K17A 3HTXA 1ZM3A 4PRVA 1Z0GA 2NUGA 1X49A 2LUQA 3J80Q 4DUYI 4AQYI 1J26A 1MU5A 4DV7I 2Q2EB 1N34E 1WHNA 4JV5I 1RQ0A 4KQVA 2BM1A 1XMOE 1T4OA 3PYEA 4LF6I 4EMDA 3T1YE 4OX9E 4DV6I 4RPFA 1HNXE 4DV3E 2ZM6I 1Z59A 3K1JA 2X36A 2N3GA 3LNUA 4UT4A 4DR5E 1N36I 1U2RA 2UUCE 4FWDA 4JI4I 2L2KB 5IWAI 2MDRA 2UU9I 4JI2I 2L3JA 1KIJA 2E5LI 4LFCI 2HHHI 2LTRA 3QT7A 2DEIA 4DV4E 1YYWA 3P1XA 4M30A 1EI1A 3LPSA 3Q1QA 4KHPI 1QU6A 1PKPA 2RS7A 2LBSB 3ZKDA 1NHHA 4JI6E 3VYXA 1FKAE 1IBME
chains in the Genus database with same CATH superfamily
4R2PA 1IBLI 2Z5CB 2V85A 3CDJA 2BA0G 3M7NG 1BKNA 2LT7A 1KJKA 4B3TE 4O24A 4DV5E 4F9AB 2EZ6A 2V8PA 5DNLA 2JXPA 3WU5A 3J7AG 1A1FA 2L2NA 1ZM2A 2WBTA 3C4BA 2EMXA 1H74A 4NBQA 2J7JA 2K7IA 2UXBE 2C39A 2BBGA 1IBME 4DR1E 2NA2A 2EM5A 4BCAA 2B7TA 2DGCA 4F9CB 1PDAA 2C38B 5C0XD 2VESA 1MGTA 2EOZA 2CSHA 4WXCA 2R1FA 4Q35B 4IZJB 3M85G 1XHKA 4O43A 4IFDE 4FN5A 2Z5BA 2ZITA 2C37A 1AH5A 1KTVA 3ECRA 4LFAE 2F4VE 4FW5A 1N34I 4FW9A 2C39B 2V8QB 2IERA 1X6HA 4JI0E 2VE7C 2V88A 4M1KA 4R1FA 2N3HA 3WU3A 4MQYA 3L00A 3THNA 2YZTA 2D9HA 2YTOA 2HKEA 4LCGA 3GLLA 3EPKA 2VRDA 1XMOI 2YRHA 4DU7A 2Z5BB 1D6TA 1WHQA 2C37B 5K36D 2JOBA 3T1YI 2FTXB 2X7IA 2A2DA 2O3ZA 5JEAF 4F9BB 4OX9I 1PJSA 3HPSA 2MDGA 4L5NC 4DR4E 2V89A 5A6AA 2Q8UA 1L4SA 1HNXI 2E72A 4BBYA 3L7ZA 4DV3I 3QT5A 1A1KA 3P76A 4ZVIA 2YRMA 1BB8A 4NXME 1DI2A 4IFDC 1STUA 2LJPA 2DRPA 5TSEA 4DR5I 3UK3C 2UUCI 1LLMC 2EL4A 1Y4UA 2EMHA 3L7ZB 2DIXA 1MG7A 4BA1A 4DPUA 5A69A 3Q6NA 2RSIA 3M6AA 1IMUA 2EM7A 1H7SA 5C0XA 2L92A 2EOOA 3ZZUA 2EL5A 2EQ0A 4YHHE 4DR2E 2PNMA 2YTGA 4DR3E 4RHBB 4DV4I 2K4VA 3HULA 4MYUA 4WUDA 4X62E 4BA1B 3JU0A 4DR6E 3PYFA 2EMAA 2EMFA 1A1GA 1UEKA 1HNZE 2KOUA 1XNQE 3BGHA 4TUIA 1RHYA 4LTYA 2YT4A 2UXDE 2LJHA 2ELYA 1UDSA 2KONA 5K36A 3HXLA 2R42A 2WBUA 4USKA 5DRPA 5LLQA 2DMYA 5AE3A 1TF6A 3P3EA 2YRKA 5DROA 4OKGA 1KKHA 3NZKA 4KZSA 1PIEA 2EPNA 2I13A 4DV1E 4JI6I 3B82A 3PYGA 1GQEA 1N3GA 1A1JA 1IBMI 4LF7E 4MU0A 2F1DA 2V2ZA 2EPRA 2R3VA 5DRRA 2HK2A 2E1RA 1GTKA 1N0UA 5JEAB 2NUFA 3OTOE 4B3TI 5AE1A 1F2IG 1VISA 2NN6E 1ZXNA 4DV5I 1G2FC 1DGCA 2EPZA 2RPCA 3RMPA 1KVKA 2UXBI 3GONA 4FW3A 4DR1I 2XEXA 3BIDA 3IWBA 4DPYA 4X8WA 3B78A 3H09A 2EPCA 5KL4A 4R2AA 2VQEE 2EORA 4L8NA 2MC6A 4AIMA 2HKJA 1UDOA 3PYDA 2FGGA 4X66E 1Z0BA 3J7AM 1YHCA 2AJ4A 3BF2A 4LFAI 4IZKA 2F4VI 4OO1E 2BM0A 3GCMA 4JI0I 4QNKA 2JVAA 3HPZA 2L8TA 5A6BD 4DUZE 4WX9A 3F6GA 1ZM4A 2VF1A 2EPAA 4IFDA 2O1UA 4LOMA 4PU9A 2EPLX 4TUGA 1MEYC 1EH7A 1OYRA 2ZBKB 2YSOA 1DARA 1Z0WA 4GKKE 2NN6C 1JK1A 4IZKB 5KL2A 1S16A 1X5WA 5GMDA 4LF4E 4AQYI 3U1KA 2EN1A 1G2DC 2YSPA 5AASA 4DR4I 2EMYA 2I9IA 2M1SA 1IQOA 4WUBA 5ADZA 4GKJI 3DD6A 4IFDB 1NHIA 5K36C 4B3SE 3UHMA 4NXMI 2MKDA 4K0KE 2HFSA 2L33A 1N33E 2YU5A 1UBDC 1XXEA 4HYMA 3MHHC 4NXNE 4LF8E 4DV2E 4X9JA 4B3RE 2RTXA 4WUCA 4JI7E 4HXZA 4N3OA 4JI3E 5LL6R 1YPNA 2EE8A 4OO1C 1RC7A 4GZNC 2B3TB 5F3WA 3OMLA 5A2QC 4B3ME 1EH8A 3JTZA 2M4IA 5LMUE 2YTDA 1A1LA 1RMDA 1T4NA 4WPYA 2WW4A 1ZBTA 2NN6D 5IV8B 2UXCE 4YHHI 4JI8E 2EOJA 1YYOA 4DR2I 4DR3I 2ENAA 5C0XF 1K47A 2H36X 1YZ9A 2EMCA 4X62I 4DPTA 2YTNA 2YTIA 2JEAA 4DR6I 5AE2A 2GS8A 1FWLA 2LMZA 5EL9A 2CGEA 4HACA 1HNZI 5CFFE 1XNQI 2KHXA 3KRNA 1X6EA 1R6LA 4P7AA 1HK7A 3WU4A 1SFEA 2EOIA 2UXDI 4N4RB 2ODRD 1Z5CA 1WJPA 4GQUA 2EPOA 4JI1E 5IT9C 4OO1D 1TF3A 3EPJA 4I3HA 2JEAB 3T1HE 2EM6A 1X48A 4HACB 5K36F 4P52A 1RR9A 4DV1I 1N32E 4GKJE 2L2MA 4LU9A 2LCEA 1Y5YA 2BA0D 4LF7I 5KL7A 3M7ND 4X65E 4LF5E 3QT6A 1FJGE 3OTOI 2G7HA 1O0WA 2V87A 1XNRE 3QT8A 3H1CA 2MC5A 1FI4A 5KL6A 2BR2A 2O1WA 2JWOA 3QG5C 4FK5C 3HQ1A 5BR8E 1T4LB 2JE6A 3J7Yp 4MLVA 2NABA 3ADGA 2LTSA 1HNWE 3M85D 1E3HA 1QZRA 1ZR9A 1Z0VA 2VQEI 2DEJA 2EOFA 3LMLA 1X6FA 1UDNA 3ZKBA 2L6MA 4NZVA 2LVHA 5A2QQ 4X66I 1B63A 2BR2B 4F6NA 4URLA 4WFTA 4WXDA 4OOGC 1ZXMA 2ADRA 3ADLA 1USUA 1YYKA 2HK3A 2V2QA 3CWVA 4DUZI 2EN8A 5C0XB 2EMWA 3EPLA 2J7KA 3PS3A 3VYYA 1Z0TA 2PNLA 4LF9E 4BHBA 1PJQA 2EP3A 1EKZA 2UUBE 4FWGA 1XMQE 4WYQB 5EKWA 4GKKI 4IFDF 2EM3A 1YUIA 4DR7E 2AE8A 2J65A 4OO1A 4LF4I 3KZYA 4J8ZA 2JPAA 4MU1A 3LLHA 2YU8A 5IT9Q 4R2CA 4B3SI 2Z5EA 4ZYHA 4BC7A 1ZAAC 2ENHA 1J5EE 4K0KI 4BS9A 2EPKX 2EM0A 2RSMA 1H7UA 2PO2A 1N33I 1X47A 4B3RI 3PRYA 4NXNI 4DV2I 4R8OA 2PO0A 4LF8I 5K36B 2A2CA 2DLQA 4JI7I 2PRTA 4Z7YA 2VQFE 4JI5E 4JI3I 1YFHA 1FNMA 1VI7A 1Y4SA 2EL6A 2EMZA 1HR0E 4LFBE 4IS9A 1UHZA 2EN3A 4B3MI 2BA1G 2V2VA 4HEIA 5LMUI 3WU6A 2JY9A 4MLQA 2CPNA 2UUAE 4Q28A 4F54A 2PO2B 2EMBA 2UXCI 4YY3E 3AV0A 4MYTA 3P3CA 4JI8I 3PS1A 5L3JA 1OJ4A 4BHCA 5FLXQ 4X64E 3IWDA 2CT1A 4DUYI 3VHTB 5LMNE 4JG4A 4JYAE 2JYAA 1H72C 4FWHA 4IZJD 2EM2A 5KL5A 2CZ9A 5DRQA 2YTPA 1I94E 1IBKI 3IWCA 5DNYA 2HJJA 4DV0E 3EPHA 4PRXA 4ZYGA 1E3PA 4JI1I 1A1HA 3C6MA 3T1HI 2EOSA 2WNRA 3LTOA 2WBSA 2DLKA 1WUUA 1ELOA 4AIDA 3MSWA 4DUYE 4AQYE 1N32I 4LCFA 5JEAE 4X65I 4DV7E 2EQ1A 4U3DA 4LF5I 1T39A 1FJGI 1NZ0A 1Z0CA 3BBGA 1ZM9A 1NCSA 4JV5E 1N0VC 1NEIA 1R6MA 3U1YA 1XNRI 4DPXA 3F6HA 3D4JA 1JK2A 2ODRC 4FW6A 3ZM7A 1B62A 4XTJA 3JAMC 2HC5A 2LE2A 2GQ0A 5BR8I 2DSYA 1GZ6A 1H73A 2Z5CA 2IOPA 4IS1C 1Y6ZA 4DKKA 4M9VC 3MHSC 4LF6E 2B9DA 1BBGA 1EA6A 1ZU1A 4DU8A 2EMGA 1HNWI 3TQMA 2NUEA 1S4EA 5GMEA 2EN4A 1SR9A 2YTFA 3J81C 4Z7CA 3F0NA 4BC9A 1FKAE 4DV6E 2JT2A 4M0VA 4FW4A 2RS6A 3DJWA 4HTGA 2ZM6E 2NN6F 2EOEA 3VK6A 2C38A 1Z0EA 2EMKA 3B4TA 2LV2A 2EM8A 4R2RA 1DQ3A 2EQ3A 2LUPB 5A6BA 2IESA 3GMEA 4IZJA 2LRSA 4OZEA 4UTGA 1X3CA 5JEAC 1N36E 1IBKE 1YSAC 1Z5AA 4LF9I 2UUBI 3J80C 2GLIA 2JEBA 4JI4E 1Y60A 1XMQI 4MU4A 1Z1BA 4DR7I 2JOXA 5IWAE 1WRJA 2UU9E 4JI2E 3H4LA 4MDTA 1AAYA 2IHR1 4I8OA 4LPFA 4OO1F 3M99B 4WSPA 2E5LE 1MX0A 2BV3A 2GO4A 2EPPA 4LFCE 2HHHE 2DMIA 1PVGA 2EPMX 2GPIA 4DPWA 3V5RA 4M2ZA 1J5EI 2JEBB 3P06A 5AC4A 3C4TA 2EWLA 5A6KA 2V34A 2FV4B 3ADJA 3HJCA 2GHFA 4DXLA 2RQLA 4F6MA 4MU3A 3V2UC 2VQFI 4JI5I 4HY1A 2M7QA 4P78A 1HR0I 3ZOQB 4KHPE 1NHJA 2EFGA 3PS2A 3B8HA 4LFBI 5T6JA 5JEAD 1A1IA 1YH8A 4FW7A 5FLXC 2UUAI 2MKNA 1P42A 4DMIA 2E1MA 3JAMQ 4YY3I 1EH6A 2LJUA 2NN6A 4ED4A 1A6FA 1UILA 2OI2A 2L3CA 1QNTA 2WZOA 1FWKA 3ADIA 2B7VA 4X64I 2EMLA 2ENCA 2NPFA 5LMNI 3KZZA 4BMJA 2YTJA 1IBLE 2JE6B 4JYAI 3ZZ0A 3J81Q 2YTEA 3ZZTA 2YWQA 2BB8A 2HFUA 2VF3A 1I94I 2NN6B 4DV0I 4USMA 1RREA 1Z5BA 3K17A 1UDQA 3CDIA 3FIGA 3HTXA 2V86A 1ZM3A 3Q6MA 1Z0GA 1BBOA 4PRVA 2EPUA 1X49A 2LUQA 2NUGA 1ZBQA 4IJDA 4WSGA 1OYSA 1WXRA 1J26A 3J80Q 4RH8A 4KWYA 3C6KA 1MU5A 4DV7I 4O4KA 4NHRA 4U3BA 2Q2EB 2YPNA 1N34E 1WHNA 4JV5I 1RQ0A 4KQVA 2BM1A 4OO1B 2HGHA 2EN6A 1KYQA 1YUJA 4IFDD 3EQ1A 1XMOE 4R03A 2CG9A 1IQSA 2CVEA 1T4OA 5JEAA 3PYEA 4LF6I 4EMDA 2JP9A 3T1YE 2YTQA 4AM3A 4OX9E 2PO0B 1USVA 4DV6I 4LCHA 4BA2A 4RPFA 1HNXE 4DV3E 2EOYA 2ZM6I 1OYPA 2EOHA 2JR1A 1Z59A 3K1JA 2CTDA 3DF6A 2EJ4A 2X36A 5DNXA 5C0XE 2R76A 2N3GA 2O1TA 3LNUA 2EPXA 4R2DA 3P3GA 4UT4A 2EOMA 3HKMA 3KWRA 4O5GA 4DR5E 1N36I 1U2RA 4QNJA 2UUCE 4KHPI 4FWDA 4BA2B 2ELZA 4JI4I 2EN7A 4F2JC 4ZYDA 2L2KB 5IWAI 2MDRA 2PNZA 2UU9I 4JI2I 2L3JA 1KIJA 2F8BA 1UN6B 2E5LI 3THOB 1P47A 4LFCI 2O1VA 2HHHI 2LTRA 4ISAA 2EM9A 3QT7A 2PO1A 2DEIA 2N8XA 1T38A 4DV4E 1YYWA 5K36E 4J3DA 5IXMB 3K85A 4R2SA 5ELWA 2PNZB 4R2QA 5KL3A 3P1XA 2WP8A 4M30A 1EI1A 2WNRB 2A25A 3LPSA 2BA1D 2EM4A 2EOXA 3Q1QA 1QU6A 5A6JA 5AC5A 1PKPA 1TN9A 4ZYEA 2IOQA 2PO1B 2EOQA 2RS7A 2LBSB 2EMIA 2M9AA 3ZKDA 5C0XC 2LO3A 4P7DA 2WCC3 1PJTA 4R2EA 2EN2A 2V83A 1NHHA 2WP8B 1B69A 3K6QA 4GEQB 2GO3A 4JI6E 3VYXA 5FWKA 3AUZA 2DB2A
chains in the Genus database with same CATH topology
1IBLI 2Z5CB 2V85A 1BKNA 4B3TE 2EZ6A 4DV5E 4F9AB 2V8PA 3WU5A 3J7AG 2L2NA 1ZM2A 3C4BA 1H74A 2UXBE 4DR1E 2NA2A 4BCAA 2B7TA 4F9CB 4IZJB 1XHKA 4FN5A 2Z5BA 2ZITA 1KTVA 4LFAE 2F4VE 1N34I 4FW9A 2V8QB 4JI0E 2VE7C 2V88A 4M1KA 4R1FA 2N3HA 3WU3A 2YZTA 2HKEA 1XMOI 4DU7A 2Z5BB 1D6TA 1WHQA 2JOBA 3T1YI 2FTXB 2X7IA 2A2DA 4F9BB 4OX9I 3HPSA 4L5NC 4DR4E 2V89A 1HNXI 4DV3I 4BBYA 3QT5A 4ZVIA 4NXME 1DI2A 1STUA 2LJPA 4DR5I 2UUCI 1Y4UA 2DIXA 1MG7A 4DPUA 3Q6NA 3M6AA 1H7SA 2L92A 3ZZUA 4YHHE 4DR2E 2PNMA 4DR3E 4DV4I 2K4VA 3HULA 4MYUA 4WUDA 4X62E 3JU0A 4DR6E 3PYFA 1UEKA 1HNZE 2KOUA 1XNQE 4TUIA 4LTYA 2YT4A 2UXDE 2LJHA 2KONA 3HXLA 2R42A 4USKA 4DPWA 2DMYA 5AE3A 1KKHA 4KZSA 1PIEA 4DV1E 4JI6I 3B82A 3PYGA 1GQEA 3AUZA 1IBMI 4LF7E 2V2ZA 2R3VA 2HK2A 2E1RA 1N0UA 2NUFA 3OTOE 4B3TI 5AE1A 1VISA 1ZXNA 4DV5I 3RMPA 1KVKA 2UXBI 3GONA 4DR1I 2XEXA 3IWBA 4DPYA 4X8WA 3B78A 3H09A 2VQEE 4L8NA 2MC6A 2HKJA 3PYDA 2FGGA 4X66E 1Z0BA 3J7AM 2AJ4A 4LFAI 2F4VI 4IZKA 2BM0A 4JI0I 2JVAA 3HPZA 2L8TA 4DUZE 3F6GA 1ZM4A 2VF1A 2O1UA 4PU9A 4TUGA 2ZBKB 1DARA 4IZKB 1Z0WA 4GKKE 1S16A 5GMDA 4LF4E 4DR4I 5AASA 4WUBA 2M1SA 5ADZA 4GKJI 1NHIA 4B3SE 4NXMI 4K0KE 2HFSA 2L33A 1N33E 4HYMA 4B3RE 4NXNE 4LF8E 4DV2E 4WUCA 2RTXA 4JI7E 4HXZA 4N3OA 4JI3E 5LL6R 1RC7A 2B3TB 5F3WA 3OMLA 5A2QC 4B3ME 3JTZA 2M4IA 5LMUE 1T4NA 4WPYA 2WW4A 1ZBTA 2UXCE 4YHHI 4JI8E 1YYOA 4DR2I 4DR3I 1K47A 2H36X 1YZ9A 4X62I 4DPTA 4DR6I 5AE2A 2GS8A 1FWLA 2LMZA 2CGEA 4HACA 1HNZI 5CFFE 1XNQI 2KHXA 4P7AA 1HK7A 3WU4A 2UXDI 2ODRD 1Z5CA 4JI1E 5IT9C 4I3HA 3T1HE 1X48A 4HACB 4P52A 1RR9A 4DV1I 1N32E 4GKJE 2L2MA 4LU9A 4LF7I 4X65E 4LF5E 3QT6A 1FJGE 3OTOI 2G7HA 1O0WA 2V87A 1XNRE 3QT8A 2MC5A 1FI4A 2O1WA 2JWOA 3HQ1A 5BR8E 1T4LB 3J7Yp 3ADGA 2LTSA 1HNWE 1QZRA 1Z0VA 2VQEI 2DEJA 3LMLA 3ZKBA 2L6MA 5A2QQ 4X66I 1B63A 4URLA 4WFTA 4OOGC 1ZXMA 3ADLA 1USUA 1YYKA 2HK3A 2V2QA 3CWVA 4DUZI 2J7KA 3VYYA 1Z0TA 2PNLA 4LF9E 2UUBE 1EKZA 4FWGA 4GKKI 1XMQE 4WYQB 4DR7E 4LF4I 4J8ZA 3LLHA 5IT9Q 4B3SI 2Z5EA 4BC7A 4K0KI 1J5EE 4BS9A 2RSMA 1H7UA 1N33I 1X47A 4B3RI 3PRYA 4NXNI 4DV2I 4R8OA 4LF8I 2A2CA 4JI7I 4Z7YA 2VQFE 4JI5E 4JI3I 1FNMA 1Y4SA 1HR0E 4LFBE 4B3MI 1UHZA 2V2VA 5LMUI 3WU6A 2JY9A 2CPNA 2UUAE 4Q28A 4F54A 2UXCI 4YY3E 3AV0A 4MYTA 4JI8I 5L3JA 1OJ4A 5FLXQ 4X64E 3IWDA 5LMNE 4JG4A 4JYAE 1H72C 4FWHA 4IZJD 2CZ9A 1I94E 1IBKI 3IWCA 5DNYA 4DV0E 4PRXA 4JI1I 3T1HI 3LTOA 1WUUA 1ELOA 3MSWA 4DUYE 4AQYE 1N32I 4X65I 4DV7E 4LF5I 1FJGI 1NZ0A 1Z0CA 1ZM9A 4JV5E 1N0VC 1XNRI 4DPXA 3F6HA 3D4JA 2ODRC 3ZM7A 1B62A 4XTJA 3JAMC 5BR8I 2LE2A 2GQ0A 2DB2A 2DSYA 1GZ6A 1H73A 2Z5CA 2IOPA 1Y6ZA 4DKKA 1EA6A 4LF6E 2B9DA 4DU8A 1HNWI 2NUEA 1S4EA 5GMEA 1SR9A 3J81C 4Z7CA 3F0NA 4BC9A 4DV6E 4M0VA 2RS6A 3DJWA 2ZM6E 3VK6A 1Z0EA 2LUPB 1DQ3A 4IZJA 2LRSA 4UTGA 1N36E 1IBKE 1Z5AA 4LF9I 2UUBI 3J80C 4JI4E 1XMQI 4DR7I 2JOXA 5IWAE 2UU9E 4JI2E 3H4LA 2IHR1 4I8OA 1MX0A 4WSPA 2E5LE 2BV3A 4LFCE 2HHHE 1PVGA 3V5RA 4M2ZA 1J5EI 3P06A 3C4TA 2EWLA 2V34A 3ADJA 2FV4B 3HJCA 4DXLA 2VQFI 4JI5I 3V2UC 4HY1A 2M7QA 4P78A 1HR0I 3ZOQB 4KHPE 1NHJA 2EFGA 4LFBI 3B8HA 5T6JA 5FLXC 2UUAI 4DMIA 2E1MA 3JAMQ 4YY3I 4ED4A 1A6FA 1UILA 2OI2A 2L3CA 2WZOA 1FWKA 3ADIA 2B7VA 4X64I 2NPFA 5LMNI 4BMJA 4JYAI 1IBLE 3ZZ0A 3J81Q 3ZZTA 1I94I 2HFUA 2VF3A 4DV0I 4USMA 1RREA 1Z5BA 3K17A 3FIGA 3HTXA 2V86A 1ZM3A 3Q6MA 1Z0GA 4PRVA 2NUGA 1X49A 2LUQA 3J80Q 1ZBQA 4DUYI 4AQYI 1WXRA 1J26A 1MU5A 4DV7I 2Q2EB 1N34E 1WHNA 4JV5I 1RQ0A 4KQVA 2BM1A 1XMOE 4R03A 2CG9A 1T4OA 3PYEA 4LF6I 4EMDA 3T1YE 4OX9E 1USVA 4DV6I 4RPFA 1HNXE 4DV3E 2ZM6I 2JR1A 1Z59A 3K1JA 3DF6A 2X36A 2N3GA 2O1TA 3LNUA 4UT4A 3KWRA 4DR5E 1N36I 1U2RA 2UUCE 4FWDA 4JI4I 2L2KB 5IWAI 2MDRA 2UU9I 4JI2I 2L3JA 1KIJA 2F8BA 2E5LI 4LFCI 2O1VA 2HHHI 2LTRA 3QT7A 2DEIA 4DV4E 1YYWA 3K85A 3P1XA 4M30A 1EI1A 3LPSA 3Q1QA 4KHPI 1QU6A 2IOQA 1PKPA 2RS7A 2LBSB 3ZKDA 4P7DA 2V83A 1NHHA 3K6QA 4GEQB 4JI6E 3VYXA 5FWKA 1FKAE 1IBME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL I;  1BKN A;  4B3T E;  2EZ6 A;  4DV5 E;  2V8P A;  3WU5 A;  3J7A G;  2L2N A;  1ZM2 A;  3C4B A;  1H74 A;  2UXB E;  4DR1 E;  2NA2 A;  2B7T A;  1XHK A;  4FN5 A;  2ZIT A;  1KTV A;  4LFA E;  2F4V E;  1N34 I;  4FW9 A;  4JI0 E;  4M1K A;  4R1F A;  2N3H A;  3WU3 A;  2HKE A;  1XMO I;  4DU7 A;  1D6T A;  1WHQ A;  3T1Y I;  2X7I A;  2A2D A;  4OX9 I;  4DR4 E;  1HNX I;  4DV3 I;  3QT5 A;  4ZVI A;  4NXM E;  1DI2 A;  1STU A;  2LJP A;  4DR5 I;  2UUC I;  2DIX A;  1MG7 A;  4DPU A;  3M6A A;  1H7S A;  3ZZU A;  4YHH E;  4DR2 E;  4DR3 E;  4DV4 I;  3HUL A;  4MYU A;  4WUD A;  4X62 E;  4DR6 E;  3PYF A;  1UEK A;  1HNZ E;  1XNQ E;  2YT4 A;  2UXD E;  2LJH A;  2R42 A;  4USK A;  4DPW A;  2DMY A;  1KKH A;  1PIE A;  4DV1 E;  4JI6 I;  3B82 A;  3PYG A;  1GQE A;  1IBM I;  4LF7 E;  2V2Z A;  2R3V A;  2HK2 A;  2E1R A;  1N0U A;  2NUF A;  3OTO E;  4B3T I;  1VIS A;  1ZXN A;  4DV5 I;  1KVK A;  2UXB I;  3GON A;  4DR1 I;  2XEX A;  4DPY A;  4X8W A;  3B78 A;  2VQE E;  2HKJ A;  3PYD A;  4X66 E;  1Z0B A;  3J7A M;  2AJ4 A;  4LFA I;  2F4V I;  2BM0 A;  4JI0 I;  2JVA A;  4DUZ E;  1ZM4 A;  4PU9 A;  2ZBK B;  1DAR A;  1Z0W A;  4GKK E;  1S16 A;  5GMD A;  4LF4 E;  4DR4 I;  4WUB A;  4GKJ I;  1NHI A;  4B3S E;  4NXM I;  4K0K E;  2HFS A;  2L33 A;  1N33 E;  4HYM A;  4B3R E;  4NXN E;  4LF8 E;  4DV2 E;  4WUC A;  2RTX A;  4JI7 E;  4HXZ A;  4JI3 E;  5LL6 R;  1RC7 A;  2B3T B;  4B3M E;  5A2Q C;  5LMU E;  1T4N A;  2WW4 A;  1ZBT A;  2UXC E;  4YHH I;  4JI8 E;  1YYO A;  4DR2 I;  4DR3 I;  1K47 A;  1YZ9 A;  4X62 I;  4DPT A;  4DR6 I;  2GS8 A;  1FWL A;  4HAC A;  1HNZ I;  5CFF E;  1XNQ I;  2KHX A;  4P7A A;  3WU4 A;  2UXD I;  1Z5C A;  4JI1 E;  5IT9 C;  4I3H A;  3T1H E;  1X48 A;  4HAC B;  4P52 A;  1RR9 A;  4DV1 I;  1N32 E;  4GKJ E;  2L2M A;  4LF7 I;  4X65 E;  4LF5 E;  3QT6 A;  1FJG E;  3OTO I;  1O0W A;  1XNR E;  3QT8 A;  1FI4 A;  5BR8 E;  1T4L B;  3J7Y p;  3ADG A;  2LTS A;  1HNW E;  1QZR A;  1Z0V A;  2VQE I;  2DEJ A;  3ZKB A;  5A2Q Q;  4X66 I;  1B63 A;  4URL A;  4WFT A;  4OOG C;  1ZXM A;  3ADL A;  1YYK A;  2HK3 A;  2V2Q A;  3CWV A;  4DUZ I;  2J7K A;  3VYY A;  4FWG A;  1Z0T A;  4LF9 E;  2UUB E;  1EKZ A;  4GKK I;  1XMQ E;  4WYQ B;  4DR7 E;  4LF4 I;  3LLH A;  5IT9 Q;  4B3S I;  4K0K I;  1J5E E;  2RSM A;  1H7U A;  1N33 I;  1X47 A;  4B3R I;  4NXN I;  4LF8 I;  4DV2 I;  2A2C A;  4JI7 I;  4Z7Y A;  2VQF E;  4JI5 E;  4JI3 I;  1FNM A;  1HR0 E;  4LFB E;  4B3M I;  1UHZ A;  2V2V A;  5LMU I;  3WU6 A;  2JY9 A;  2CPN A;  2UUA E;  2UXC I;  4YY3 E;  4MYT A;  4JI8 I;  5L3J A;  1OJ4 A;  5FLX Q;  4X64 E;  5LMN E;  4JG4 A;  4JYA E;  1H72 C;  4FWH A;  2CZ9 A;  1I94 E;  1IBK I;  4DV0 E;  4PRX A;  4JI1 I;  3T1H I;  3LTO A;  1WUU A;  1ELO A;  4DUY E;  4AQY E;  1N32 I;  4X65 I;  4DV7 E;  4LF5 I;  1FJG I;  1NZ0 A;  1Z0C A;  1ZM9 A;  4JV5 E;  1N0V C;  1XNR I;  4DPX A;  3D4J A;  3ZM7 A;  1B62 A;  4XTJ A;  3JAM C;  5BR8 I;  2DB2 A;  1H73 A;  4DKK A;  1EA6 A;  4LF6 E;  4DU8 A;  1HNW I;  2NUE A;  1S4E A;  5GME A;  3J81 C;  4Z7C A;  3F0N A;  4DV6 E;  2RS6 A;  2ZM6 E;  1Z0E A;  2LUP B;  2LRS A;  4UTG A;  1N36 E;  1IBK E;  1Z5A A;  4LF9 I;  2UUB I;  3J80 C;  4JI4 E;  1XMQ I;  4DR7 I;  5IWA E;  2UU9 E;  4JI2 E;  3H4L A;  2IHR 1;  1MX0 A;  2E5L E;  2BV3 A;  4LFC E;  2HHH E;  1PVG A;  3V5R A;  4M2Z A;  1J5E I;  3C4T A;  2V34 A;  3ADJ A;  4DXL A;  2VQF I;  4JI5 I;  3V2U C;  4HY1 A;  1HR0 I;  4LFB I;  4KHP E;  1NHJ A;  2EFG A;  3B8H A;  5FLX C;  2UUA I;  3JAM Q;  4YY3 I;  4ED4 A;  1A6F A;  1UIL A;  2OI2 A;  2L3C A;  1FWK A;  3ADI A;  2B7V A;  4X64 I;  2NPF A;  5LMN I;  4JYA I;  1IBL E;  3ZZ0 A;  3J81 Q;  3ZZT A;  1I94 I;  2HFU A;  2VF3 A;  4DV0 I;  4USM A;  1RRE A;  1Z5B A;  3K17 A;  3HTX A;  1ZM3 A;  4PRV A;  1Z0G A;  2NUG A;  1X49 A;  2LUQ A;  3J80 Q;  4DUY I;  4AQY I;  1J26 A;  1MU5 A;  4DV7 I;  2Q2E B;  1N34 E;  1WHN A;  4JV5 I;  1RQ0 A;  4KQV A;  2BM1 A;  1XMO E;  1T4O A;  3PYE A;  4LF6 I;  4EMD A;  3T1Y E;  4OX9 E;  4DV6 I;  4RPF A;  1HNX E;  4DV3 E;  2ZM6 I;  1Z59 A;  3K1J A;  2X36 A;  2N3G A;  3LNU A;  4UT4 A;  4DR5 E;  1N36 I;  1U2R A;  2UUC E;  4FWD A;  4JI4 I;  2L2K B;  5IWA I;  2MDR A;  2UU9 I;  4JI2 I;  2L3J A;  1KIJ A;  2E5L I;  4LFC I;  2HHH I;  2LTR A;  3QT7 A;  2DEI A;  4DV4 E;  1YYW A;  3P1X A;  4M30 A;  1EI1 A;  3LPS A;  3Q1Q A;  4KHP I;  1QU6 A;  1PKP A;  2RS7 A;  2LBS B;  3ZKD A;  1NHH A;  4JI6 E;  3VYX A;  1FKA E;  1IBM E; 
#chains in the Genus database with same CATH topology
 4R2P A;  1IBL I;  2Z5C B;  2V85 A;  3CDJ A;  2BA0 G;  3M7N G;  1BKN A;  2LT7 A;  1KJK A;  4B3T E;  4O24 A;  4DV5 E;  4F9A B;  2EZ6 A;  2V8P A;  5DNL A;  2JXP A;  3WU5 A;  3J7A G;  1A1F A;  2L2N A;  1ZM2 A;  2WBT A;  3C4B A;  2EMX A;  1H74 A;  4NBQ A;  2J7J A;  2K7I A;  2UXB E;  2C39 A;  2BBG A;  1IBM E;  4DR1 E;  2NA2 A;  2EM5 A;  4BCA A;  2B7T A;  2DGC A;  4F9C B;  1PDA A;  2C38 B;  5C0X D;  2VES A;  1MGT A;  2EOZ A;  2CSH A;  4WXC A;  2R1F A;  4Q35 B;  4IZJ B;  3M85 G;  1XHK A;  4O43 A;  4IFD E;  4FN5 A;  2Z5B A;  2ZIT A;  2C37 A;  1AH5 A;  1KTV A;  3ECR A;  4LFA E;  2F4V E;  4FW5 A;  1N34 I;  4FW9 A;  2C39 B;  2V8Q B;  2IER A;  1X6H A;  4JI0 E;  2VE7 C;  2V88 A;  4M1K A;  4R1F A;  2N3H A;  3WU3 A;  4MQY A;  3L00 A;  3THN A;  2YZT A;  2D9H A;  2YTO A;  2HKE A;  4LCG A;  3GLL A;  3EPK A;  2VRD A;  1XMO I;  2YRH A;  4DU7 A;  2Z5B B;  1D6T A;  1WHQ A;  2C37 B;  5K36 D;  2JOB A;  3T1Y I;  2FTX B;  2X7I A;  2A2D A;  2O3Z A;  5JEA F;  4F9B B;  4OX9 I;  1PJS A;  3HPS A;  2MDG A;  4L5N C;  4DR4 E;  2V89 A;  5A6A A;  2Q8U A;  1L4S A;  1HNX I;  2E72 A;  4BBY A;  3L7Z A;  4DV3 I;  3QT5 A;  1A1K A;  3P76 A;  4ZVI A;  2YRM A;  1BB8 A;  4NXM E;  1DI2 A;  4IFD C;  1STU A;  2LJP A;  2DRP A;  5TSE A;  4DR5 I;  3UK3 C;  2UUC I;  1LLM C;  2EL4 A;  1Y4U A;  2EMH A;  3L7Z B;  2DIX A;  1MG7 A;  4BA1 A;  4DPU A;  5A69 A;  3Q6N A;  2RSI A;  3M6A A;  1IMU A;  2EM7 A;  1H7S A;  5C0X A;  2L92 A;  2EOO A;  3ZZU A;  2EL5 A;  2EQ0 A;  4YHH E;  4DR2 E;  2PNM A;  2YTG A;  4DR3 E;  4RHB B;  4DV4 I;  2K4V A;  3HUL A;  4MYU A;  4WUD A;  4X62 E;  4BA1 B;  3JU0 A;  4DR6 E;  3PYF A;  2EMA A;  2EMF A;  1A1G A;  1UEK A;  1HNZ E;  2KOU A;  1XNQ E;  3BGH A;  4TUI A;  1RHY A;  4LTY A;  2YT4 A;  2UXD E;  2LJH A;  2ELY A;  1UDS A;  2KON A;  5K36 A;  3HXL A;  2R42 A;  2WBU A;  4USK A;  5DRP A;  5LLQ A;  2DMY A;  5AE3 A;  1TF6 A;  3P3E A;  2YRK A;  5DRO A;  4OKG A;  1KKH A;  3NZK A;  4KZS A;  1PIE A;  2EPN A;  2I13 A;  4DV1 E;  4JI6 I;  3B82 A;  3PYG A;  1GQE A;  1N3G A;  1A1J A;  1IBM I;  4LF7 E;  4MU0 A;  2F1D A;  2V2Z A;  2EPR A;  2R3V A;  5DRR A;  2HK2 A;  2E1R A;  1GTK A;  1N0U A;  5JEA B;  2NUF A;  3OTO E;  4B3T I;  5AE1 A;  1F2I G;  1VIS A;  2NN6 E;  1ZXN A;  4DV5 I;  1G2F C;  1DGC A;  2EPZ A;  2RPC A;  3RMP A;  1KVK A;  2UXB I;  3GON A;  4FW3 A;  4DR1 I;  2XEX A;  3BID A;  3IWB A;  4DPY A;  4X8W A;  3B78 A;  3H09 A;  2EPC A;  5KL4 A;  4R2A A;  2VQE E;  2EOR A;  4L8N A;  2MC6 A;  4AIM A;  2HKJ A;  1UDO A;  3PYD A;  2FGG A;  4X66 E;  1Z0B A;  3J7A M;  1YHC A;  2AJ4 A;  3BF2 A;  4LFA I;  4IZK A;  2F4V I;  4OO1 E;  2BM0 A;  3GCM A;  4JI0 I;  4QNK A;  2JVA A;  3HPZ A;  2L8T A;  5A6B D;  4DUZ E;  4WX9 A;  3F6G A;  1ZM4 A;  2VF1 A;  2EPA A;  4IFD A;  2O1U A;  4LOM A;  4PU9 A;  2EPL X;  4TUG A;  1MEY C;  1EH7 A;  1OYR A;  2ZBK B;  2YSO A;  1DAR A;  1Z0W A;  4GKK E;  2NN6 C;  1JK1 A;  4IZK B;  5KL2 A;  1S16 A;  1X5W A;  5GMD A;  4LF4 E;  4AQY I;  3U1K A;  2EN1 A;  1G2D C;  2YSP A;  5AAS A;  4DR4 I;  2EMY A;  2I9I A;  2M1S A;  1IQO A;  4WUB A;  5ADZ A;  4GKJ I;  3DD6 A;  4IFD B;  1NHI A;  5K36 C;  4B3S E;  3UHM A;  4NXM I;  2MKD A;  4K0K E;  2HFS A;  2L33 A;  1N33 E;  2YU5 A;  1UBD C;  1XXE A;  4HYM A;  3MHH C;  4NXN E;  4LF8 E;  4DV2 E;  4X9J A;  4B3R E;  2RTX A;  4WUC A;  4JI7 E;  4HXZ A;  4N3O A;  4JI3 E;  5LL6 R;  1YPN A;  2EE8 A;  4OO1 C;  1RC7 A;  4GZN C;  2B3T B;  5F3W A;  3OML A;  5A2Q C;  4B3M E;  1EH8 A;  3JTZ A;  2M4I A;  5LMU E;  2YTD A;  1A1L A;  1RMD A;  1T4N A;  4WPY A;  2WW4 A;  1ZBT A;  2NN6 D;  5IV8 B;  2UXC E;  4YHH I;  4JI8 E;  2EOJ A;  1YYO A;  4DR2 I;  4DR3 I;  2ENA A;  5C0X F;  1K47 A;  2H36 X;  1YZ9 A;  2EMC A;  4X62 I;  4DPT A;  2YTN A;  2YTI A;  2JEA A;  4DR6 I;  5AE2 A;  2GS8 A;  1FWL A;  2LMZ A;  5EL9 A;  2CGE A;  4HAC A;  1HNZ I;  5CFF E;  1XNQ I;  2KHX A;  3KRN A;  1X6E A;  1R6L A;  4P7A A;  1HK7 A;  3WU4 A;  1SFE A;  2EOI A;  2UXD I;  4N4R B;  2ODR D;  1Z5C A;  1WJP A;  4GQU A;  2EPO A;  4JI1 E;  5IT9 C;  4OO1 D;  1TF3 A;  3EPJ A;  4I3H A;  2JEA B;  3T1H E;  2EM6 A;  1X48 A;  4HAC B;  5K36 F;  4P52 A;  1RR9 A;  4DV1 I;  1N32 E;  4GKJ E;  2L2M A;  4LU9 A;  2LCE A;  1Y5Y A;  2BA0 D;  4LF7 I;  5KL7 A;  3M7N D;  4X65 E;  4LF5 E;  3QT6 A;  1FJG E;  3OTO I;  2G7H A;  1O0W A;  2V87 A;  1XNR E;  3QT8 A;  3H1C A;  2MC5 A;  1FI4 A;  5KL6 A;  2BR2 A;  2O1W A;  2JWO A;  3QG5 C;  4FK5 C;  3HQ1 A;  5BR8 E;  1T4L B;  2JE6 A;  3J7Y p;  4MLV A;  2NAB A;  3ADG A;  2LTS A;  1HNW E;  3M85 D;  1E3H A;  1QZR A;  1ZR9 A;  1Z0V A;  2VQE I;  2DEJ A;  2EOF A;  3LML A;  1X6F A;  1UDN A;  3ZKB A;  2L6M A;  4NZV A;  2LVH A;  5A2Q Q;  4X66 I;  1B63 A;  2BR2 B;  4F6N A;  4URL A;  4WFT A;  4WXD A;  4OOG C;  1ZXM A;  2ADR A;  3ADL A;  1USU A;  1YYK A;  2HK3 A;  2V2Q A;  3CWV A;  4DUZ I;  2EN8 A;  5C0X B;  2EMW A;  3EPL A;  2J7K A;  3PS3 A;  3VYY A;  1Z0T A;  2PNL A;  4LF9 E;  4BHB A;  1PJQ A;  2EP3 A;  1EKZ A;  2UUB E;  4FWG A;  1XMQ E;  4WYQ B;  5EKW A;  4GKK I;  4IFD F;  2EM3 A;  1YUI A;  4DR7 E;  2AE8 A;  2J65 A;  4OO1 A;  4LF4 I;  3KZY A;  4J8Z A;  2JPA A;  4MU1 A;  3LLH A;  2YU8 A;  5IT9 Q;  4R2C A;  4B3S I;  2Z5E A;  4ZYH A;  4BC7 A;  1ZAA C;  2ENH A;  1J5E E;  4K0K I;  4BS9 A;  2EPK X;  2EM0 A;  2RSM A;  1H7U A;  2PO2 A;  1N33 I;  1X47 A;  4B3R I;  3PRY A;  4NXN I;  4DV2 I;  4R8O A;  2PO0 A;  4LF8 I;  5K36 B;  2A2C A;  2DLQ A;  4JI7 I;  2PRT A;  4Z7Y A;  2VQF E;  4JI5 E;  4JI3 I;  1YFH A;  1FNM A;  1VI7 A;  1Y4S A;  2EL6 A;  2EMZ A;  1HR0 E;  4LFB E;  4IS9 A;  1UHZ A;  2EN3 A;  4B3M I;  2BA1 G;  2V2V A;  4HEI A;  5LMU I;  3WU6 A;  2JY9 A;  4MLQ A;  2CPN A;  2UUA E;  4Q28 A;  4F54 A;  2PO2 B;  2EMB A;  2UXC I;  4YY3 E;  3AV0 A;  4MYT A;  3P3C A;  4JI8 I;  3PS1 A;  5L3J A;  1OJ4 A;  4BHC A;  5FLX Q;  4X64 E;  3IWD A;  2CT1 A;  4DUY I;  3VHT B;  5LMN E;  4JG4 A;  4JYA E;  2JYA A;  1H72 C;  4FWH A;  4IZJ D;  2EM2 A;  5KL5 A;  2CZ9 A;  5DRQ A;  2YTP A;  1I94 E;  1IBK I;  3IWC A;  5DNY A;  2HJJ A;  4DV0 E;  3EPH A;  4PRX A;  4ZYG A;  1E3P A;  4JI1 I;  1A1H A;  3C6M A;  3T1H I;  2EOS A;  2WNR A;  3LTO A;  2WBS A;  2DLK A;  1WUU A;  1ELO A;  4AID A;  3MSW A;  4DUY E;  4AQY E;  1N32 I;  4LCF A;  5JEA E;  4X65 I;  4DV7 E;  2EQ1 A;  4U3D A;  4LF5 I;  1T39 A;  1FJG I;  1NZ0 A;  1Z0C A;  3BBG A;  1ZM9 A;  1NCS A;  4JV5 E;  1N0V C;  1NEI A;  1R6M A;  3U1Y A;  1XNR I;  4DPX A;  3F6H A;  3D4J A;  1JK2 A;  2ODR C;  4FW6 A;  3ZM7 A;  1B62 A;  4XTJ A;  3JAM C;  2HC5 A;  2LE2 A;  2GQ0 A;  5BR8 I;  2DSY A;  1GZ6 A;  1H73 A;  2Z5C A;  2IOP A;  4IS1 C;  1Y6Z A;  4DKK A;  4M9V C;  3MHS C;  4LF6 E;  2B9D A;  1BBG A;  1EA6 A;  1ZU1 A;  4DU8 A;  2EMG A;  1HNW I;  3TQM A;  2NUE A;  1S4E A;  5GME A;  2EN4 A;  1SR9 A;  2YTF A;  3J81 C;  4Z7C A;  3F0N A;  4BC9 A;  1FKA E;  4DV6 E;  2JT2 A;  4M0V A;  4FW4 A;  2RS6 A;  3DJW A;  4HTG A;  2ZM6 E;  2NN6 F;  2EOE A;  3VK6 A;  2C38 A;  1Z0E A;  2EMK A;  3B4T A;  2LV2 A;  2EM8 A;  4R2R A;  1DQ3 A;  2EQ3 A;  2LUP B;  5A6B A;  2IES A;  3GME A;  4IZJ A;  2LRS A;  4OZE A;  4UTG A;  1X3C A;  5JEA C;  1N36 E;  1IBK E;  1YSA C;  1Z5A A;  4LF9 I;  2UUB I;  3J80 C;  2GLI A;  2JEB A;  4JI4 E;  1Y60 A;  1XMQ I;  4MU4 A;  1Z1B A;  4DR7 I;  2JOX A;  5IWA E;  1WRJ A;  2UU9 E;  4JI2 E;  3H4L A;  4MDT A;  1AAY A;  2IHR 1;  4I8O A;  4LPF A;  4OO1 F;  3M99 B;  4WSP A;  2E5L E;  1MX0 A;  2BV3 A;  2GO4 A;  2EPP A;  4LFC E;  2HHH E;  2DMI A;  1PVG A;  2EPM X;  2GPI A;  4DPW A;  3V5R A;  4M2Z A;  1J5E I;  2JEB B;  3P06 A;  5AC4 A;  3C4T A;  2EWL A;  5A6K A;  2V34 A;  2FV4 B;  3ADJ A;  3HJC A;  2GHF A;  4DXL A;  2RQL A;  4F6M A;  4MU3 A;  3V2U C;  2VQF I;  4JI5 I;  4HY1 A;  2M7Q A;  4P78 A;  1HR0 I;  3ZOQ B;  4KHP E;  1NHJ A;  2EFG A;  3PS2 A;  3B8H A;  4LFB I;  5T6J A;  5JEA D;  1A1I A;  1YH8 A;  4FW7 A;  5FLX C;  2UUA I;  2MKN A;  1P42 A;  4DMI A;  2E1M A;  3JAM Q;  4YY3 I;  1EH6 A;  2LJU A;  2NN6 A;  4ED4 A;  1A6F A;  1UIL A;  2OI2 A;  2L3C A;  1QNT A;  2WZO A;  1FWK A;  3ADI A;  2B7V A;  4X64 I;  2EML A;  2ENC A;  2NPF A;  5LMN I;  3KZZ A;  4BMJ A;  2YTJ A;  1IBL E;  2JE6 B;  4JYA I;  3ZZ0 A;  3J81 Q;  2YTE A;  3ZZT A;  2YWQ A;  2BB8 A;  2HFU A;  2VF3 A;  1I94 I;  2NN6 B;  4DV0 I;  4USM A;  1RRE A;  1Z5B A;  3K17 A;  1UDQ A;  3CDI A;  3FIG A;  3HTX A;  2V86 A;  1ZM3 A;  3Q6M A;  1Z0G A;  1BBO A;  4PRV A;  2EPU A;  1X49 A;  2LUQ A;  2NUG A;  1ZBQ A;  4IJD A;  4WSG A;  1OYS A;  1WXR A;  1J26 A;  3J80 Q;  4RH8 A;  4KWY A;  3C6K A;  1MU5 A;  4DV7 I;  4O4K A;  4NHR A;  4U3B A;  2Q2E B;  2YPN A;  1N34 E;  1WHN A;  4JV5 I;  1RQ0 A;  4KQV A;  2BM1 A;  4OO1 B;  2HGH A;  2EN6 A;  1KYQ A;  1YUJ A;  4IFD D;  3EQ1 A;  1XMO E;  4R03 A;  2CG9 A;  1IQS A;  2CVE A;  1T4O A;  5JEA A;  3PYE A;  4LF6 I;  4EMD A;  2JP9 A;  3T1Y E;  2YTQ A;  4AM3 A;  4OX9 E;  2PO0 B;  1USV A;  4DV6 I;  4LCH A;  4BA2 A;  4RPF A;  1HNX E;  4DV3 E;  2EOY A;  2ZM6 I;  1OYP A;  2EOH A;  2JR1 A;  1Z59 A;  3K1J A;  2CTD A;  3DF6 A;  2EJ4 A;  2X36 A;  5DNX A;  5C0X E;  2R76 A;  2N3G A;  2O1T A;  3LNU A;  2EPX A;  4R2D A;  3P3G A;  4UT4 A;  2EOM A;  3HKM A;  3KWR A;  4O5G A;  4DR5 E;  1N36 I;  1U2R A;  4QNJ A;  2UUC E;  4KHP I;  4FWD A;  4BA2 B;  2ELZ A;  4JI4 I;  2EN7 A;  4F2J C;  4ZYD A;  2L2K B;  5IWA I;  2MDR A;  2PNZ A;  2UU9 I;  4JI2 I;  2L3J A;  1KIJ A;  2F8B A;  1UN6 B;  2E5L I;  3THO B;  1P47 A;  4LFC I;  2O1V A;  2HHH I;  2LTR A;  4ISA A;  2EM9 A;  3QT7 A;  2PO1 A;  2DEI A;  2N8X A;  1T38 A;  4DV4 E;  1YYW A;  5K36 E;  4J3D A;  5IXM B;  3K85 A;  4R2S A;  5ELW A;  2PNZ B;  4R2Q A;  5KL3 A;  3P1X A;  2WP8 A;  4M30 A;  1EI1 A;  2WNR B;  2A25 A;  3LPS A;  2BA1 D;  2EM4 A;  2EOX A;  3Q1Q A;  1QU6 A;  5A6J A;  5AC5 A;  1PKP A;  1TN9 A;  4ZYE A;  2IOQ A;  2PO1 B;  2EOQ A;  2RS7 A;  2LBS B;  2EMI A;  2M9A A;  3ZKD A;  5C0X C;  2LO3 A;  4P7D A;  2WCC 3;  1PJT A;  4R2E A;  2EN2 A;  2V83 A;  1NHH A;  2WP8 B;  1B69 A;  3K6Q A;  4GEQ B;  2GO3 A;  4JI6 E;  3VYX A;  5FWK A;  3AUZ A;  2DB2 A; 
#chains in the Genus database with same CATH homology
 1IBL I;  2Z5C B;  2V85 A;  1BKN A;  4B3T E;  2EZ6 A;  4DV5 E;  4F9A B;  2V8P A;  3WU5 A;  3J7A G;  2L2N A;  1ZM2 A;  3C4B A;  1H74 A;  2UXB E;  4DR1 E;  2NA2 A;  4BCA A;  2B7T A;  4F9C B;  4IZJ B;  1XHK A;  4FN5 A;  2Z5B A;  2ZIT A;  1KTV A;  4LFA E;  2F4V E;  1N34 I;  4FW9 A;  2V8Q B;  4JI0 E;  2VE7 C;  2V88 A;  4M1K A;  4R1F A;  2N3H A;  3WU3 A;  2YZT A;  2HKE A;  1XMO I;  4DU7 A;  2Z5B B;  1D6T A;  1WHQ A;  2JOB A;  3T1Y I;  2FTX B;  2X7I A;  2A2D A;  4F9B B;  4OX9 I;  3HPS A;  4L5N C;  4DR4 E;  2V89 A;  1HNX I;  4DV3 I;  4BBY A;  3QT5 A;  4ZVI A;  4NXM E;  1DI2 A;  1STU A;  2LJP A;  4DR5 I;  2UUC I;  1Y4U A;  2DIX A;  1MG7 A;  4DPU A;  3Q6N A;  3M6A A;  1H7S A;  2L92 A;  3ZZU A;  4YHH E;  4DR2 E;  2PNM A;  4DR3 E;  4DV4 I;  2K4V A;  3HUL A;  4MYU A;  4WUD A;  4X62 E;  3JU0 A;  4DR6 E;  3PYF A;  1UEK A;  1HNZ E;  2KOU A;  1XNQ E;  4TUI A;  4LTY A;  2YT4 A;  2UXD E;  2LJH A;  2KON A;  3HXL A;  2R42 A;  4USK A;  4DPW A;  2DMY A;  5AE3 A;  1KKH A;  4KZS A;  1PIE A;  4DV1 E;  4JI6 I;  3B82 A;  3PYG A;  1GQE A;  3AUZ A;  1IBM I;  4LF7 E;  2V2Z A;  2R3V A;  2HK2 A;  2E1R A;  1N0U A;  2NUF A;  3OTO E;  4B3T I;  5AE1 A;  1VIS A;  1ZXN A;  4DV5 I;  3RMP A;  1KVK A;  2UXB I;  3GON A;  4DR1 I;  2XEX A;  3IWB A;  4DPY A;  4X8W A;  3B78 A;  3H09 A;  2VQE E;  4L8N A;  2MC6 A;  2HKJ A;  3PYD A;  2FGG A;  4X66 E;  1Z0B A;  3J7A M;  2AJ4 A;  4LFA I;  2F4V I;  4IZK A;  2BM0 A;  4JI0 I;  2JVA A;  3HPZ A;  2L8T A;  4DUZ E;  3F6G A;  1ZM4 A;  2VF1 A;  2O1U A;  4PU9 A;  4TUG A;  2ZBK B;  1DAR A;  4IZK B;  1Z0W A;  4GKK E;  1S16 A;  5GMD A;  4LF4 E;  4DR4 I;  5AAS A;  4WUB A;  2M1S A;  5ADZ A;  4GKJ I;  1NHI A;  4B3S E;  4NXM I;  4K0K E;  2HFS A;  2L33 A;  1N33 E;  4HYM A;  4B3R E;  4NXN E;  4LF8 E;  4DV2 E;  4WUC A;  2RTX A;  4JI7 E;  4HXZ A;  4N3O A;  4JI3 E;  5LL6 R;  1RC7 A;  2B3T B;  5F3W A;  3OML A;  5A2Q C;  4B3M E;  3JTZ A;  2M4I A;  5LMU E;  1T4N A;  4WPY A;  2WW4 A;  1ZBT A;  2UXC E;  4YHH I;  4JI8 E;  1YYO A;  4DR2 I;  4DR3 I;  1K47 A;  2H36 X;  1YZ9 A;  4X62 I;  4DPT A;  4DR6 I;  5AE2 A;  2GS8 A;  1FWL A;  2LMZ A;  2CGE A;  4HAC A;  1HNZ I;  5CFF E;  1XNQ I;  2KHX A;  4P7A A;  1HK7 A;  3WU4 A;  2UXD I;  2ODR D;  1Z5C A;  4JI1 E;  5IT9 C;  4I3H A;  3T1H E;  1X48 A;  4HAC B;  4P52 A;  1RR9 A;  4DV1 I;  1N32 E;  4GKJ E;  2L2M A;  4LU9 A;  4LF7 I;  4X65 E;  4LF5 E;  3QT6 A;  1FJG E;  3OTO I;  2G7H A;  1O0W A;  2V87 A;  1XNR E;  3QT8 A;  2MC5 A;  1FI4 A;  2O1W A;  2JWO A;  3HQ1 A;  5BR8 E;  1T4L B;  3J7Y p;  3ADG A;  2LTS A;  1HNW E;  1QZR A;  1Z0V A;  2VQE I;  2DEJ A;  3LML A;  3ZKB A;  2L6M A;  5A2Q Q;  4X66 I;  1B63 A;  4URL A;  4WFT A;  4OOG C;  1ZXM A;  3ADL A;  1USU A;  1YYK A;  2HK3 A;  2V2Q A;  3CWV A;  4DUZ I;  2J7K A;  3VYY A;  1Z0T A;  2PNL A;  4LF9 E;  2UUB E;  1EKZ A;  4FWG A;  4GKK I;  1XMQ E;  4WYQ B;  4DR7 E;  4LF4 I;  4J8Z A;  3LLH A;  5IT9 Q;  4B3S I;  2Z5E A;  4BC7 A;  4K0K I;  1J5E E;  4BS9 A;  2RSM A;  1H7U A;  1N33 I;  1X47 A;  4B3R I;  3PRY A;  4NXN I;  4DV2 I;  4R8O A;  4LF8 I;  2A2C A;  4JI7 I;  4Z7Y A;  2VQF E;  4JI5 E;  4JI3 I;  1FNM A;  1Y4S A;  1HR0 E;  4LFB E;  4B3M I;  1UHZ A;  2V2V A;  5LMU I;  3WU6 A;  2JY9 A;  2CPN A;  2UUA E;  4Q28 A;  4F54 A;  2UXC I;  4YY3 E;  3AV0 A;  4MYT A;  4JI8 I;  5L3J A;  1OJ4 A;  5FLX Q;  4X64 E;  3IWD A;  5LMN E;  4JG4 A;  4JYA E;  1H72 C;  4FWH A;  4IZJ D;  2CZ9 A;  1I94 E;  1IBK I;  3IWC A;  5DNY A;  4DV0 E;  4PRX A;  4JI1 I;  3T1H I;  3LTO A;  1WUU A;  1ELO A;  3MSW A;  4DUY E;  4AQY E;  1N32 I;  4X65 I;  4DV7 E;  4LF5 I;  1FJG I;  1NZ0 A;  1Z0C A;  1ZM9 A;  4JV5 E;  1N0V C;  1XNR I;  4DPX A;  3F6H A;  3D4J A;  2ODR C;  3ZM7 A;  1B62 A;  4XTJ A;  3JAM C;  5BR8 I;  2LE2 A;  2GQ0 A;  2DB2 A;  2DSY A;  1GZ6 A;  1H73 A;  2Z5C A;  2IOP A;  1Y6Z A;  4DKK A;  1EA6 A;  4LF6 E;  2B9D A;  4DU8 A;  1HNW I;  2NUE A;  1S4E A;  5GME A;  1SR9 A;  3J81 C;  4Z7C A;  3F0N A;  4BC9 A;  4DV6 E;  4M0V A;  2RS6 A;  3DJW A;  2ZM6 E;  3VK6 A;  1Z0E A;  2LUP B;  1DQ3 A;  4IZJ A;  2LRS A;  4UTG A;  1N36 E;  1IBK E;  1Z5A A;  4LF9 I;  2UUB I;  3J80 C;  4JI4 E;  1XMQ I;  4DR7 I;  2JOX A;  5IWA E;  2UU9 E;  4JI2 E;  3H4L A;  2IHR 1;  4I8O A;  1MX0 A;  4WSP A;  2E5L E;  2BV3 A;  4LFC E;  2HHH E;  1PVG A;  3V5R A;  4M2Z A;  1J5E I;  3P06 A;  3C4T A;  2EWL A;  2V34 A;  3ADJ A;  2FV4 B;  3HJC A;  4DXL A;  2VQF I;  4JI5 I;  3V2U C;  4HY1 A;  2M7Q A;  4P78 A;  1HR0 I;  3ZOQ B;  4KHP E;  1NHJ A;  2EFG A;  4LFB I;  3B8H A;  5T6J A;  5FLX C;  2UUA I;  4DMI A;  2E1M A;  3JAM Q;  4YY3 I;  4ED4 A;  1A6F A;  1UIL A;  2OI2 A;  2L3C A;  2WZO A;  1FWK A;  3ADI A;  2B7V A;  4X64 I;  2NPF A;  5LMN I;  4BMJ A;  4JYA I;  1IBL E;  3ZZ0 A;  3J81 Q;  3ZZT A;  1I94 I;  2HFU A;  2VF3 A;  4DV0 I;  4USM A;  1RRE A;  1Z5B A;  3K17 A;  3FIG A;  3HTX A;  2V86 A;  1ZM3 A;  3Q6M A;  1Z0G A;  4PRV A;  2NUG A;  1X49 A;  2LUQ A;  3J80 Q;  1ZBQ A;  4DUY I;  4AQY I;  1WXR A;  1J26 A;  1MU5 A;  4DV7 I;  2Q2E B;  1N34 E;  1WHN A;  4JV5 I;  1RQ0 A;  4KQV A;  2BM1 A;  1XMO E;  4R03 A;  2CG9 A;  1T4O A;  3PYE A;  4LF6 I;  4EMD A;  3T1Y E;  4OX9 E;  1USV A;  4DV6 I;  4RPF A;  1HNX E;  4DV3 E;  2ZM6 I;  2JR1 A;  1Z59 A;  3K1J A;  3DF6 A;  2X36 A;  2N3G A;  2O1T A;  3LNU A;  4UT4 A;  3KWR A;  4DR5 E;  1N36 I;  1U2R A;  2UUC E;  4FWD A;  4JI4 I;  2L2K B;  5IWA I;  2MDR A;  2UU9 I;  4JI2 I;  2L3J A;  1KIJ A;  2F8B A;  2E5L I;  4LFC I;  2O1V A;  2HHH I;  2LTR A;  3QT7 A;  2DEI A;  4DV4 E;  1YYW A;  3K85 A;  3P1X A;  4M30 A;  1EI1 A;  3LPS A;  3Q1Q A;  4KHP I;  1QU6 A;  2IOQ A;  1PKP A;  2RS7 A;  2LBS B;  3ZKD A;  4P7D A;  2V83 A;  1NHH A;  3K6Q A;  4GEQ B;  4JI6 E;  3VYX A;  5FWK A;  1FKA E;  1IBM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...