1FJGE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1fjgE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1fjgE02
4NXME 3HULA 4EMDA 1Z5CA 4B3SE 4USKA 1I94E 2NA2A 4LF8I 4YHHE 2L3JA 4JI3I 2RSMA 5IWAE 4DR2E 1IBKE 2B3TB 2GS8A 3C4TA 4DV0I 3B8HA 4B3TE 5LMNE 2Q2EB 1NHIA 1FNMA 4X64E 2L2MA 2ZM6E 4LF6I 4JI6E 1N32E 1IBME 1K47A 4X62E 5LMUI 1J5EI 3V2UC 2HHHI 1MU5A 4JG4A 4NXNI 3LPSA 4LF8E 1Z5BA 2F4VI 4JI3E 2X7IA 4DV0E 2BM1A 4DR4I 2UXDI 3PYEA 4M30A 1OJ4A 4LF6E 1RQ0A 3ZKBA 4LFAI 2L33A 3C4BA 4WUDA 3VYYA 4LFBI 4LF9I 2OI2A 3ADLA 1PKPA 4JI4I 2V2VA 3B82A 2WW4A 5LMUE 2HK3A 4P7AA 2HHHE 1XNRI 1N0UA 1S16A 3H4LA 4WUCA 4NXNE 1Z5AA 2F4VE 1RC7A 4JI0E 4X65I 2MDRA 2B7VA 1ZM4A 4JI1I 4LFAE 4LFBE 2DEJA 1UHZA 4JI4E 4PRVA 1T4NA 4LFCI 4YHHI 2UUBE 4JI2I 5IT9Q 2DB2A 3VYXA 1XNRE 2LTRA 5GMEA 1WHQA 4DR3I 4KQVA 1N34I 1NHHA 4X65E 4JI7I 1YZ9A 4UT4A 4JI6I 4LF7I 1GQEA 1XNQI 2UXCI 4USMA 3ADGA 4JI1E 4K0KI 1HR0I 2UXBI 4MYTA 1QU6A 1STUA 4LFCE 3JAMQ 4JV5I 2NUGA 4DU7A 4JI2E 2ZITA 2NUFA 2N3HA 4M1KA 2KHXA 3LLHA 4DR3E 1N34E 4JI7E 4DR5I 1N33I 2LUQA 3D4JA 4DUYI 4LF7E 3J7Yp 1ZXMA 2E1RA 2N3GA 1D6TA 1XNQE 1ELOA 4OOGC 3J7AM 2UXCE 4K0KE 4HYMA 3J80Q 1HR0E 2UXBE 1U2RA 2LRSA 3HTXA 1KTVA 3B78A 1FJGI 3ZZTA 4FWDA 3LTOA 4JI0I 4JV5E 1EKZA 1X49A 3ZZ0A 1H7UA 3ZZUA 5IT9C 4JI8I 4DR5E 1N33E 4DR1I 3P1XA 2J7KA 4HACA 1VISA 4DUZI 4DUYE 1H74A 4DPYA 4DV1I 3K17A 1MX0A 2DIXA 3WU3A 2RS6A 1T4OA 2UUBI 4GKJI 5L3JA 1FJGE 3K1JA 1UEKA 4GKKI 3ZKDA 1IBLI 3T1YI 4DV2I 4X8WA 1DI2A 3QT5A 3PYFA 3J81Q 2A2CA 3WU6A 1Z0EA 1KKHA 4JI8E 2YT4A 1Z59A 4DR1E 1Z0BA 2HKEA 4DUZE 4WYQB 1N36I 5GMDA 4DV1E 2CZ9A 2XEXA 1XHKA 1Z0TA 4GKJE 4DPTA 5A2QQ 4GKKE 1IBLE 4YY3I 3T1YE 4DV2E 3V5RA 4AQYI 2ZBKB 1A6FA 4DV7I 2UUCI 4Z7CA 3T1HI 1X48A 4DXLA 5FLXQ 1FWKA 2L2KB 1FI4A 2LUPB 2VQFI 3CWVA 4PRXA 4UTGA 1HNWI 1WUUA 3QT6A 3PYDA 4P52A 1J26A 3PYGA 1N36E 1B63A 3GONA 4DV5E 1H72C 2V34A 1Z0WA 4DV4I 1BKNA 1KVKA 4DKKA 4OX9I 1B62A 3WU5A 4DV6I 2R3VA 4KHPI 4YY3E 4JI5I 4FW9A 4AQYE 2E5LI 4DV7E 2UUCE 2V2QA 3F0NA 3T1HE 1FWLA 1ZBTA 2LTSA 2VQFE 2V2ZA 3ADIA 3J81C 1HNWE 1ZM3A 2DMYA 5CFFE 3QT7A 1T4LB 2BV3A 3QT8A 3J7AG 2AJ4A 4JYAI 4X66E 3M6AA 2EFGA 2RTXA 2VQEE 4DV3E 1QZRA 2IHR1 1RR9A 4LF5I 4DV4E 1PIEA 4I3HA 4M2ZA 4OX9E 2UUAI 4WFTA 2HKJA 4DV6E 4KHPE 1KIJA 2NUEA 4JI5E 1ZM2A 4HY1A 4WUBA 1ZXNA 1XMOI 2E5LE 5A2QC 3LNUA 1X47A 4B3MI 4DR7I 3ADJA 4HACB 5FLXC 4RPFA 1FKAE 4LF4I 2CPNA 1YYOA 2NPFA 1EI1A 4DPUA 4DU8A 1WHNA 4JYAE 4ED4A 4LF5E 4Z7YA 1Z0VA 1NHJA 4HXZA 2HFSA 1HNZI 2R42A 2JY9A 2L2NA 2UUAE 1UILA 4PU9A 3JAMC 1MG7A 2UU9I 1XMOE 1J5EE 4ZVIA 2B7TA 4DPXA 4B3ME 1Z0CA 1ZM9A 4DR7E 4DV5I 2LJHA 1DARA 2V8PA 1XMQI 1Z0GA 1YYKA 2EZ6A 4LF4E 4B3RI 3J80C 4DR4E 5LL6R 1H7SA 2LJPA 2X36A 3WU4A 3Q1QA 1YYWA 2UXDE 5BR8I 1HNXI 1RREA 4FWGA 3OTOI 1HNZE 4DR6I 4LF9E 4NXMI 2L3CA 1EA6A 1N0VC 4B3SI 1I94I 4FN5A 2RS7A 2UU9E 4URLA 5IWAI 4DR2I 1H73A 4R1FA 1IBKI 3ZM7A 4XTJA 2JVAA 4B3TI 1XMQE 4FWHA 5LMNI 4X66I 4MYUA 2LBSB 4X64I 1PVGA 2DEIA 2VQEI 4DV3I 1S4EA 4B3RE 2ZM6I 2A2DA 1N32I 2BM0A 1IBMI 1O0WA 5BR8E 1NZ0A 1HNXE 3OTOE 4DPWA 2HFUA 2VF3A 4X62I 4DR6E 2HK2A
chains in the Genus database with same CATH superfamily
2M4IA 4NXME 3HULA 4EMDA 2DMIA 1Z5CA 4B3SE 4USKA 3P3GA 1I94E 2NA2A 4LF8I 4YHHE 2L3JA 4FW7A 4JI3I 2RSMA 5IWAE 4DR2E 2LT7A 3C6MA 1IBKE 2B3TB 2GS8A 2BA1D 3RMPA 2NN6C 3KZZA 2YU8A 3C4TA 1P42A 1Y4SA 2EOIA 2BR2B 4DV0I 3B8HA 4B3TE 2GLIA 4LCGA 4NHRA 5LMNE 2J65A 1NHIA 2Q2EB 1SFEA 1FNMA 4X64E 2WNRB 4R2DA 2EMLA 2L2MA 2LJUA 2ZM6E 4LF6I 4FK5C 2PO1A 2I13A 4JI6E 2O3ZA 4BA2B 1A1LA 2V83A 1N32E 2ENCA 1AAYA 2EOHA 1IBME 2EN8A 1K47A 4GQUA 2EN4A 2LCEA 2C37A 4P78A 1WRJA 5C0XA 2EPLX 3BBGA 4X62E 4OO1C 3BGHA 3KRNA 5LMUI 4R8OA 1J5EI 3L7ZB 3V2UC 1YPNA 4U3BA 2HHHI 3KZYA 4N4RB 2R1FA 1MU5A 4JG4A 4NXNI 1Z1BA 3LPSA 3GCMA 4LF8E 1Z5BA 5DROA 2ADRA 2YU5A 2A25A 2L6MA 4WXDA 4JI3E 3B4TA 2F4VI 2EMFA 2MC5A 3P76A 2X7IA 2CT1A 4M9VC 4IZJB 4DV0E 2BM1A 4DR4I 5K36F 2UXDI 3PYEA 4M30A 3OMLA 3VK6A 1OJ4A 2IOPA 4F9BB 4IZKA 5KL6A 2EM0A 4LF6E 1RQ0A 3ZKBA 4LFAI 2L33A 3C4BA 1A1IA 4WUDA 2YRHA 3VYYA 3QG5C 4LFBI 4LF9I 1R6MA 3L00A 5F3WA 1WJPA 2OI2A 2PRTA 1PKPA 3ADLA 4JI4I 4IFDC 2V2VA 1LLMC 3JTZA 1A1JA 3B82A 2WW4A 1T38A 1USUA 5LMUE 1Y5YA 2JEBA 2HK3A 4P7AA 2JEAB 1EH8A 2ENAA 2GO3A 2HHHE 1XNRI 1N0UA 1S16A 3H4LA 1PDAA 4WUCA 1SR9A 4NXNE 2M9AA 4F6NA 4NZVA 1A1KA 3F6HA 1UN6B 1Z5AA 2F4VE 1RC7A 4JI0E 5KL5A 4I8OA 4X65I 2YTFA 2YTJA 2MDRA 2E72A 2EOYA 4MU4A 2B7VA 2YPNA 2R76A 3THOB 1ZM4A 1USVA 4LPFA 2NN6B 2JR1A 4OO1F 4JI1I 1XXEA 4IS9A 4LFAE 5DRPA 4F6MA 2YSPA 1UDNA 5LLQA 4LFBE 4BHBA 2DEJA 2LVHA 1UHZA 4JI4E 3CDJA 4O24A 4MLVA 4PRVA 1T4NA 4WSPA 4LFCI 4YHHI 3GMEA 5DRQA 2UUBE 2EMGA 3EPJA 4M0VA 4JI2I 2DB2A 3VYXA 5IT9Q 3M99B 1XNRE 2EMHA 2LTRA 3AV0A 5GMEA 2KONA 2CVEA 1WHQA 4L8NA 4FW4A 2JXPA 4IFDD 4DR3I 4KQVA 1N34I 4MU1A 1NHHA 1UBDC 2EPCA 2YTDA 4X65E 4JI7I 2KOUA 4LU9A 2O1UA 1YZ9A 3GLLA 3IWDA 4UT4A 4JI6I 4BA1A 4QNKA 1D6TA 2EN3A 2JOBA 4LF7I 2EOEA 1GQEA 1XNQI 1KYQA 4F9AB 2UXCI 4X9JA 4USMA 2EL4A 3ADGA 4JI1E 4K0KI 4R2SA 1TF3A 1HR0I 1Y4UA 3U1KA 2M7QA 2CTDA 2UXBI 1ZAAC 2VF1A 1X6EA 4MYTA 1UDOA 2C38A 2H36X 1KJKA 4OKGA 2WBUA 2C39B 3DF6A 1NEIA 1QU6A 1STUA 2PNZA 4IFDB 2PO0B 5AC4A 4LFCE 2EOXA 2GO4A 3JAMQ 3THNA 2CG9A 2Z5BB 4JV5I 3IWBA 2YTQA 3EPKA 2NUGA 3Q6NA 2WCC3 4JI2E 4LCFA 4DU7A 4KWYA 1RHYA 4ZYEA 2Z5EA 2ELYA 3H09A 1OYRA 1YSAC 2NUFA 2ZITA 2I9IA 2WBTA 5JEAB 2J7JA 2B9DA 2N3HA 4WX9A 2KHXA 3LLHA 4M1KA 2EE8A 2EMWA 4DR3E 4R2EA 1N34E 5K36D 3UK3C 2EPPA 2EORA 4JI7E 4DR5I 1N33I 3PS3A 2LUQA 3D4JA 3AUZA 4R2PA 1EH6A 3K6QA 4Q35B 3VHTB 2RPCA 4DUYI 4LF7E 2EMAA 2FV4B 3J7Yp 4R2QA 1BB8A 2N3GA 1RMDA 1A1GA 1XNQE 1ELOA 1ZXMA 2E1RA 2L92A 4OOGC 2WP8B 1AH5A 2UXCE 3J7AM 4K0KE 4HYMA 3J80Q 2N8XA 5C0XD 5KL3A 1HR0E 2AE8A 2YRKA 2WNRA 2EN2A 2V8QB 4IJDA 2UXBE 1U2RA 2LRSA 3HTXA 2YTGA 1KTVA 3B78A 2EOFA 4TUGA 1UDQA 2DLKA 3ZZTA 1FJGI 4ZYDA 3EPHA 2EMBA 4FWDA 1MEYC 2EJ4A 3M7NG 1A1HA 2JE6B 3LTOA 5ELWA 4JI0I 4JV5E 1EKZA 2NN6E 2EMYA 1GZ6A 1X6FA 2MDGA 3MHHC 4MQYA 1X49A 1YHCA 4LOMA 1A1FA 2MKDA 3ZZ0A 2MC6A 1H7UA 2DGCA 3ZZUA 2GPIA 5IT9C 2BBGA 2Q8UA 1JK1A 4FW6A 4JI8I 4DR5E 2EN1A 1N33E 4DR1I 3P1XA 3BIDA 4QNJA 2J7KA 4HACA 4WSGA 4LTYA 1VISA 2PNLA 1BBOA 2BA0G 4DUYE 4DUZI 3EQ1A 2YWQA 1H74A 4DPYA 4R2CA 4DV1I 4J3DA 3K17A 4IZKB 4IZJD 4IZJA 5ADZA 1P47A 4Q28A 1MX0A 1PJSA 2YRMA 2DIXA 1X3CA 3WU3A 2RS6A 5K36B 1T4OA 2EOSA 1G2DC 2UUBI 4GKJI 3Q6MA 1YUIA 2BA0D 1R6LA 5C0XF 1FJGE 5L3JA 3K1JA 1UEKA 4GKKI 2JEBB 3ZKDA 1IBLI 4LCHA 3NZKA 2FGGA 4DV2I 4X8WA 3T1YI 4F9CB 4O5GA 3M85G 2VESA 1PJQA 1DI2A 3QT5A 3PYFA 2JEAA 2IOQA 2O1WA 3HPSA 3J81Q 3FIGA 1YUJA 4O4KA 1Z0EA 2A2CA 3WU6A 4IFDA 2F1DA 2EPKX 2G7HA 1KKHA 2EM9A 4MLQA 2HC5A 4JI8E 2JOXA 2YT4A 5DNYA 4R2AA 1Z59A 5FWKA 4DR1E 1Z0BA 2EOJA 3PRYA 2HKEA 3HJCA 5C0XC 2EPAA 4WYQB 4DUZE 5EL9A 5GMDA 1N36I 5TSEA 4DV1E 4IFDE 2CZ9A 2RSIA 2XEXA 5IXMB 1XHKA 2NN6D 2NN6A 5EKWA 2EPUA 5JEAE 1IMUA 1Z0TA 2EMXA 4GKJE 4OO1B 1DQ3A 2JWOA 4GEQB 1X6HA 3ZOQB 5AC5A 5AE1A 3K85A 4GKKE 2JP9A 1OYSA 3MSWA 3P3EA 4FW5A 1IBLE 4DPTA 4ISAA 4YY3I 3T1YE 4DV2E 3P3CA 2VRDA 2PO2B 3V5RA 4AQYI 2ZBKB 1A6FA 4DV7I 4F2JC 4Z7CA 2UUCI 1B69A 3T1HI 1X48A 2EP3A 1HK7A 1FWKA 2YTEA 4U3DA 4DXLA 2L2KB 1FI4A 5A2QQ 5FLXQ 4N3OA 2LUPB 5KL2A 2VQFI 2EMZA 3CWVA 4PRXA 4AIMA 4UTGA 3U1YA 1HNWI 3C6KA 5AE3A 1WUUA 1TF6A 4MU3A 3QT6A 3PYDA 4P52A 1J26A 2EM2A 1N36E 2V89A 5A6JA 1B63A 3GONA 2Z5CB 3PYGA 4BHCA 4GZNC 4DV5E 2EM5A 2EQ1A 2ELZA 2HGHA 1H72C 5KL4A 2V34A 4RHBB 2EPMX 1PJTA 1Z0WA 4DV4I 2BB8A 5A6BD 5A6BA 1BKNA 1IQOA 1KVKA 2C38B 2D9HA 4DKKA 2O1TA 3H1CA 4OX9I 3ECRA 2V87A 3MHSC 2IESA 1GTKA 3DJWA 1B62A 2PNZB 2EOQA 3WU5A 4DV6I 2EM4A 1DGCA 1X5WA 2R3VA 4BBYA 4KHPI 5DNXA 4YY3E 2EPNA 4JI5I 2RQLA 4R2RA 2C39A 4FW9A 4AQYE 2E5LI 2K4VA 5KL7A 4DV7E 2UUCE 1ZU1A 4R03A 2BA1G 2PO0A 4BC9A 2V2QA 2EM3A 3F0NA 4MDTA 3T1HE 2Z5BA 4AM3A 1FWLA 1N3GA 1ZBTA 2LTSA 2YSOA 2JPAA 2VQFE 2EM8A 5K36E 2M1SA 4BCAA 2DSYA 2LE2A 3TQMA 1JK2A 2DRPA 2V2ZA 5JEAD 3ADIA 2BR2A 5JEAA 2PO1B 3J81C 2EWLA 1HNWE 4J8ZA 1ZM3A 4BMJA 2DMYA 5CFFE 3J7AG 1T4LB 2BV3A 2C37B 3QT8A 2JYAA 2AJ4A 2GQ0A 3QT7A 5C0XB 3EPLA 2CSHA 5IV8B 4X66E 3M6AA 4BA2A 4JYAI 4HEIA 2EFGA 2RTXA 2VQEE 1BBGA 2EQ3A 4DV3E 2GHFA 2IHR1 4DMIA 1QZRA 5AE2A 4DV4E 1PIEA 1RR9A 1Y60A 2WP8A 4I3HA 4M2ZA 1G2FC 1WXRA 4OX9E 2WZOA 2UUAI 4WPYA 4WFTA 5A69A 2HKJA 4DV6E 3L7ZA 4KHPE 1KIJA 1OYPA 2L8TA 2NUEA 4JI5E 1YFHA 1ZM2A 2HJJA 4HY1A 3M7ND 4MU0A 4ZYHA 1E3PA 1ZXNA 4WUBA 2EM7A 5A2QC 2E5LE 1XMOI 3LNUA 1X47A 2EPZA 2JE6A 4B3MI 2EN7A 2CGEA 1T39A 3HPZA 4DR7I 3DD6A 2EM6A 2LV2A 4P7DA 1QNTA 3ADJA 5FLXC 4HACB 2WBSA 4RPFA 4OO1E 1FKAE 2ENHA 4BC7A 4LF4I 2O1VA 5DRRA 2CPNA 2LO3A 2YTNA 1EH7A 1YYOA 2EOZA 2YTIA 4LF5I 3F6GA 2EOMA 2NPFA 2VE7C 1EI1A 4DPUA 4DU8A 1WHNA 4JYAE 2V88A 2EOOA 1Y6ZA 4ED4A 2K7IA 4LF5E 4NBQA 4Z7YA 1Z0VA 2YTOA 5T6JA 1NHJA 5DNLA 4HXZA 2HFSA 1HNZI 3KWRA 2R42A 2JY9A 2L2NA 2UUAE 1UILA 5K36A 2ODRD 4PU9A 2MKNA 2EMKA 4BS9A 1E3HA 4OZEA 3JAMC 3UHMA 3JU0A 5AASA 3HXLA 3PS1A 2EMIA 4FW3A 1MG7A 2UU9I 1XMOE 1J5EE 2NN6F 4ZVIA 2B7TA 3M85D 5JEAC 4B3ME 4DPXA 1UDSA 1NCSA 4AIDA 1Z0CA 3CDIA 4DV3I 1ZM9A 5A6KA 4DR7E 4DV5I 5A6AA 2FTXB 2LJHA 1DARA 2F8BA 2YTPA 1Z0GA 2V8PA 1YYKA 2EZ6A 1XMQI 1ZR9A 4LF4E 4B3RI 2YZTA 2JT2A 4F54A 1L4SA 3J80C 5LL6R 4DR4E 1F2IG 1H7SA 2LJPA 2X36A 3WU4A 3Q1QA 1YYWA 2UXDE 2EL6A 2IERA 5BR8I 1TN9A 1HNXI 1IQSA 1RREA 4FWGA 2E1MA 3OTOI 2NABA 1MGTA 2DLQA 1HNZE 4DR6I 4O43A 4LF9E 4NXMI 2L3CA 1EA6A 3HQ1A 1N0VC 4RH8A 4OO1A 4B3SI 4OO1D 1I94I 2EPRA 2LMZA 1VI7A 4FN5A 4WXCA 2RS7A 2UU9E 1ZBQA 4IS1C 4URLA 5IWAI 4BA1B 4DR2I 1H73A 3PS2A 4R1FA 2PO2A 3P06A 3ZM7A 3IWCA 5C0XE 1IBKI 4XTJA 2JVAA 4B3TI 4ZYGA 2EPXA 1XMQE 4FWHA 5LMNI 4X66I 4MYUA 2LBSB 4X64I 1PVGA 3LMLA 2DEIA 2V85A 4HTGA 2VQEI 1S4EA 4B3RE 2ZM6I 2V86A 2A2DA 2EL5A 4L5NC 1YH8A 4KZSA 4TUIA 2PNMA 4IFDF 1N32I 2EMCA 2EN6A 2EQ0A 2BM0A 1IBMI 1O0WA 5BR8E 1NZ0A 1HNXE 2Z5CA 5K36C 2ODRC 3HKMA 3OTOE 4DPWA 2HFUA 3BF2A 2VF3A 5JEAF 4X62I 4DR6E 2EPOA 2HK2A
chains in the Genus database with same CATH topology
2M4IA 4NXME 3HULA 4EMDA 1Z5CA 4B3SE 4USKA 1I94E 2NA2A 4LF8I 4YHHE 2L3JA 4JI3I 2RSMA 5IWAE 4DR2E 1IBKE 2B3TB 2GS8A 3RMPA 3C4TA 4DV0I 1Y4SA 3B8HA 4B3TE 5LMNE 2Q2EB 1NHIA 1FNMA 4X64E 2L2MA 2ZM6E 4LF6I 4JI6E 2V83A 1N32E 1IBME 1K47A 4P78A 4X62E 5LMUI 4R8OA 1J5EI 3V2UC 2HHHI 1MU5A 4JG4A 4NXNI 3LPSA 4LF8E 1Z5BA 2F4VI 2L6MA 4JI3E 2MC5A 2X7IA 4IZJB 4DV0E 2BM1A 4DR4I 2UXDI 3PYEA 4M30A 3OMLA 3VK6A 1OJ4A 2IOPA 4F9BB 4IZKA 4LF6E 1RQ0A 3ZKBA 4LFAI 2L33A 3C4BA 4WUDA 3VYYA 4LFBI 4LF9I 5F3WA 2OI2A 3ADLA 1PKPA 4JI4I 2V2VA 3JTZA 3B82A 2WW4A 1USUA 5LMUE 2HK3A 4P7AA 2HHHE 1XNRI 1N0UA 1S16A 3H4LA 4WUCA 1SR9A 4NXNE 3F6HA 1Z5AA 2F4VE 1RC7A 4JI0E 4I8OA 4X65I 2MDRA 2B7VA 1ZM4A 1USVA 2JR1A 4JI1I 4LFAE 4LFBE 2DEJA 1UHZA 4JI4E 4PRVA 1T4NA 4WSPA 4LFCI 4YHHI 2UUBE 4M0VA 4JI2I 2DB2A 3VYXA 5IT9Q 1XNRE 2LTRA 3AV0A 5GMEA 2KONA 1WHQA 4L8NA 4DR3I 4KQVA 1N34I 1NHHA 4X65E 4JI7I 2KOUA 4LU9A 2O1UA 1YZ9A 3IWDA 4UT4A 4JI6I 4LF7I 2JOBA 1GQEA 1XNQI 4F9AB 2UXCI 4USMA 3ADGA 4JI1E 4K0KI 1HR0I 1Y4UA 2M7QA 2UXBI 2VF1A 4MYTA 2H36X 3DF6A 1QU6A 1STUA 4LFCE 3JAMQ 2Z5BB 2CG9A 4JV5I 3IWBA 2NUGA 3Q6NA 4DU7A 4JI2E 2Z5EA 3H09A 2ZITA 2NUFA 2B9DA 2N3HA 4M1KA 2KHXA 3LLHA 4DR3E 1N34E 4JI7E 4DR5I 1N33I 2LUQA 3D4JA 3AUZA 3K6QA 4DUYI 4LF7E 2FV4B 3J7Yp 1ZXMA 2E1RA 2N3GA 1D6TA 1XNQE 1ELOA 2L92A 4OOGC 3J7AM 2UXCE 4K0KE 4HYMA 3J80Q 1HR0E 2UXBE 2V8QB 1U2RA 2LRSA 3HTXA 1KTVA 3B78A 4TUGA 1FJGI 3ZZTA 4FWDA 3LTOA 4JI0I 4JV5E 1EKZA 1GZ6A 1X49A 3ZZ0A 2MC6A 1H7UA 3ZZUA 5IT9C 4JI8I 4DR5E 1N33E 4DR1I 3P1XA 2J7KA 4HACA 4LTYA 1VISA 2PNLA 4DUZI 4DUYE 1H74A 4DPYA 4DV1I 3K17A 4IZKB 4IZJD 4IZJA 5ADZA 4Q28A 1MX0A 2DIXA 3WU3A 2RS6A 1T4OA 2UUBI 4GKJI 3Q6MA 5L3JA 1FJGE 3K1JA 1UEKA 4GKKI 3ZKDA 1IBLI 2FGGA 4DV2I 4X8WA 3T1YI 4F9CB 1DI2A 3QT5A 3PYFA 2IOQA 2O1WA 3HPSA 3J81Q 3FIGA 2A2CA 3WU6A 1Z0EA 2G7HA 1KKHA 4JI8E 2JOXA 2YT4A 5DNYA 1Z59A 5FWKA 4DR1E 1Z0BA 3PRYA 2HKEA 3HJCA 4DUZE 4WYQB 1N36I 5GMDA 4DV1E 2CZ9A 2XEXA 1XHKA 1Z0TA 4GKJE 1DQ3A 2JWOA 4GEQB 3ZOQB 5AE1A 3K85A 4GKKE 4DPTA 5A2QQ 3MSWA 1IBLE 4YY3I 3T1YE 4DV2E 3V5RA 4AQYI 2ZBKB 1A6FA 4DV7I 2UUCI 4Z7CA 3T1HI 1X48A 1HK7A 4DXLA 1FWKA 5FLXQ 2L2KB 1FI4A 4N3OA 2LUPB 2VQFI 3CWVA 4PRXA 4UTGA 1HNWI 5AE3A 1WUUA 3QT6A 3PYDA 4P52A 1J26A 1N36E 2V89A 3PYGA 1B63A 3GONA 2Z5CB 4DV5E 1H72C 2V34A 1Z0WA 4DV4I 1BKNA 1KVKA 2O1TA 4DKKA 4OX9I 2V87A 3DJWA 1B62A 3WU5A 4DV6I 2R3VA 4KHPI 4BBYA 4YY3E 4JI5I 4FW9A 4AQYE 2E5LI 2K4VA 4DV7E 2UUCE 4R03A 4BC9A 2V2QA 3F0NA 3T1HE 2Z5BA 1FWLA 1ZBTA 2LTSA 2VQFE 2M1SA 4BCAA 2DSYA 2LE2A 2V2ZA 3ADIA 3J81C 2EWLA 1HNWE 4J8ZA 1ZM3A 4BMJA 2DMYA 5CFFE 3J7AG 1T4LB 2BV3A 3QT8A 3QT7A 2GQ0A 2AJ4A 4JYAI 4X66E 3M6AA 2EFGA 2RTXA 2VQEE 4DV3E 1QZRA 2IHR1 1RR9A 4DMIA 4LF5I 5AE2A 4DV4E 1PIEA 4I3HA 4M2ZA 1WXRA 4OX9E 2WZOA 2UUAI 4WPYA 4WFTA 2HKJA 4DV6E 4KHPE 1KIJA 2L8TA 2NUEA 4JI5E 1ZM2A 4HY1A 4WUBA 1ZXNA 1XMOI 2E5LE 5A2QC 3LNUA 1X47A 4B3MI 2CGEA 3HPZA 4DR7I 4P7DA 3ADJA 5FLXC 4HACB 4RPFA 1FKAE 4BC7A 4LF4I 2O1VA 2CPNA 1YYOA 3F6GA 2NPFA 2VE7C 1EI1A 4DPUA 4DU8A 1WHNA 4JYAE 2V88A 1Y6ZA 4ED4A 4LF5E 4Z7YA 1Z0VA 5T6JA 1NHJA 4HXZA 2HFSA 1HNZI 3KWRA 2R42A 2JY9A 2L2NA 2UUAE 1UILA 2ODRD 4PU9A 4BS9A 3JAMC 3JU0A 5AASA 3HXLA 1MG7A 2UU9I 1XMOE 1J5EE 4ZVIA 2B7TA 4DPXA 4B3ME 1Z0CA 1ZM9A 4DR7E 4DV5I 2FTXB 2LJHA 1DARA 2F8BA 2V8PA 1Z0GA 1XMQI 1YYKA 2EZ6A 4LF4E 4B3RI 2YZTA 4F54A 3J80C 5LL6R 4DR4E 1H7SA 2LJPA 2X36A 3WU4A 3Q1QA 1YYWA 2UXDE 5BR8I 1HNXI 1RREA 4FWGA 2E1MA 3OTOI 1HNZE 4DR6I 4LF9E 4NXMI 2L3CA 1EA6A 3HQ1A 1N0VC 4B3SI 1I94I 2LMZA 4FN5A 2RS7A 2UU9E 1ZBQA 4URLA 5IWAI 4DR2I 1H73A 4R1FA 1IBKI 3ZM7A 3P06A 3IWCA 4XTJA 2JVAA 4B3TI 1XMQE 4FWHA 5LMNI 4X66I 4MYUA 2LBSB 4X64I 1PVGA 3LMLA 2DEIA 2V85A 2VQEI 4DV3I 1S4EA 4B3RE 2ZM6I 2V86A 2A2DA 4L5NC 4KZSA 4TUIA 2PNMA 1N32I 2BM0A 1IBMI 1O0WA 5BR8E 1NZ0A 1HNXE 2Z5CA 2ODRC 3OTOE 4DPWA 2HFUA 2VF3A 4X62I 4DR6E 2HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM E;  3HUL A;  4EMD A;  1Z5C A;  4B3S E;  4USK A;  1I94 E;  2NA2 A;  4LF8 I;  4YHH E;  2L3J A;  4JI3 I;  2RSM A;  5IWA E;  4DR2 E;  1IBK E;  2B3T B;  2GS8 A;  3C4T A;  4DV0 I;  3B8H A;  4B3T E;  5LMN E;  2Q2E B;  1NHI A;  1FNM A;  4X64 E;  2L2M A;  2ZM6 E;  4LF6 I;  4JI6 E;  1N32 E;  1IBM E;  1K47 A;  4X62 E;  5LMU I;  1J5E I;  3V2U C;  2HHH I;  1MU5 A;  4JG4 A;  4NXN I;  3LPS A;  4LF8 E;  1Z5B A;  2F4V I;  4JI3 E;  2X7I A;  4DV0 E;  2BM1 A;  4DR4 I;  2UXD I;  3PYE A;  4M30 A;  1OJ4 A;  4LF6 E;  1RQ0 A;  3ZKB A;  4LFA I;  2L33 A;  3C4B A;  4WUD A;  3VYY A;  4LFB I;  4LF9 I;  2OI2 A;  3ADL A;  1PKP A;  4JI4 I;  2V2V A;  3B82 A;  2WW4 A;  5LMU E;  2HK3 A;  4P7A A;  2HHH E;  1XNR I;  1N0U A;  1S16 A;  3H4L A;  4WUC A;  4NXN E;  1Z5A A;  2F4V E;  1RC7 A;  4JI0 E;  4X65 I;  2MDR A;  2B7V A;  1ZM4 A;  4JI1 I;  4LFA E;  4LFB E;  2DEJ A;  1UHZ A;  4JI4 E;  4PRV A;  1T4N A;  4LFC I;  4YHH I;  2UUB E;  4JI2 I;  5IT9 Q;  2DB2 A;  3VYX A;  1XNR E;  2LTR A;  5GME A;  1WHQ A;  4DR3 I;  4KQV A;  1N34 I;  1NHH A;  4X65 E;  4JI7 I;  1YZ9 A;  4UT4 A;  4JI6 I;  4LF7 I;  1GQE A;  1XNQ I;  2UXC I;  4USM A;  3ADG A;  4JI1 E;  4K0K I;  1HR0 I;  2UXB I;  4MYT A;  1QU6 A;  1STU A;  4LFC E;  3JAM Q;  4JV5 I;  2NUG A;  4DU7 A;  4JI2 E;  2ZIT A;  2NUF A;  2N3H A;  4M1K A;  2KHX A;  3LLH A;  4DR3 E;  1N34 E;  4JI7 E;  4DR5 I;  1N33 I;  2LUQ A;  3D4J A;  4DUY I;  4LF7 E;  3J7Y p;  1ZXM A;  2E1R A;  2N3G A;  1D6T A;  1XNQ E;  1ELO A;  4OOG C;  3J7A M;  2UXC E;  4K0K E;  4HYM A;  3J80 Q;  1HR0 E;  2UXB E;  1U2R A;  2LRS A;  3HTX A;  1KTV A;  3B78 A;  1FJG I;  3ZZT A;  4FWD A;  3LTO A;  4JI0 I;  4JV5 E;  1EKZ A;  1X49 A;  3ZZ0 A;  1H7U A;  3ZZU A;  5IT9 C;  4JI8 I;  4DR5 E;  1N33 E;  4DR1 I;  3P1X A;  2J7K A;  4HAC A;  1VIS A;  4DUZ I;  4DUY E;  1H74 A;  4DPY A;  4DV1 I;  3K17 A;  1MX0 A;  2DIX A;  3WU3 A;  2RS6 A;  1T4O A;  2UUB I;  4GKJ I;  5L3J A;  1FJG E;  3K1J A;  1UEK A;  4GKK I;  3ZKD A;  1IBL I;  3T1Y I;  4DV2 I;  4X8W A;  1DI2 A;  3QT5 A;  3PYF A;  3J81 Q;  2A2C A;  3WU6 A;  1Z0E A;  1KKH A;  4JI8 E;  2YT4 A;  1Z59 A;  4DR1 E;  1Z0B A;  2HKE A;  4DUZ E;  4WYQ B;  1N36 I;  5GMD A;  4DV1 E;  2CZ9 A;  2XEX A;  1XHK A;  1Z0T A;  4GKJ E;  4DPT A;  5A2Q Q;  4GKK E;  1IBL E;  4YY3 I;  3T1Y E;  4DV2 E;  3V5R A;  4AQY I;  2ZBK B;  1A6F A;  4DV7 I;  2UUC I;  4Z7C A;  3T1H I;  1X48 A;  4DXL A;  5FLX Q;  1FWK A;  2L2K B;  1FI4 A;  2LUP B;  2VQF I;  3CWV A;  4PRX A;  4UTG A;  1HNW I;  1WUU A;  3QT6 A;  3PYD A;  4P52 A;  1J26 A;  3PYG A;  1N36 E;  1B63 A;  3GON A;  4DV5 E;  1H72 C;  2V34 A;  1Z0W A;  4DV4 I;  1BKN A;  1KVK A;  4DKK A;  4OX9 I;  1B62 A;  3WU5 A;  4DV6 I;  2R3V A;  4KHP I;  4YY3 E;  4JI5 I;  4FW9 A;  4AQY E;  2E5L I;  4DV7 E;  2UUC E;  2V2Q A;  3F0N A;  3T1H E;  1FWL A;  1ZBT A;  2LTS A;  2VQF E;  2V2Z A;  3ADI A;  3J81 C;  1HNW E;  1ZM3 A;  2DMY A;  5CFF E;  3QT7 A;  1T4L B;  2BV3 A;  3QT8 A;  3J7A G;  2AJ4 A;  4JYA I;  4X66 E;  3M6A A;  2EFG A;  2RTX A;  2VQE E;  4DV3 E;  1QZR A;  2IHR 1;  1RR9 A;  4LF5 I;  4DV4 E;  1PIE A;  4I3H A;  4M2Z A;  4OX9 E;  2UUA I;  4WFT A;  2HKJ A;  4DV6 E;  4KHP E;  1KIJ A;  2NUE A;  4JI5 E;  1ZM2 A;  4HY1 A;  4WUB A;  1ZXN A;  1XMO I;  2E5L E;  5A2Q C;  3LNU A;  1X47 A;  4B3M I;  4DR7 I;  3ADJ A;  4HAC B;  5FLX C;  4RPF A;  1FKA E;  4LF4 I;  2CPN A;  1YYO A;  2NPF A;  1EI1 A;  4DPU A;  4DU8 A;  1WHN A;  4JYA E;  4ED4 A;  4LF5 E;  4Z7Y A;  1Z0V A;  1NHJ A;  4HXZ A;  2HFS A;  1HNZ I;  2R42 A;  2JY9 A;  2L2N A;  2UUA E;  1UIL A;  4PU9 A;  3JAM C;  1MG7 A;  2UU9 I;  1XMO E;  1J5E E;  4ZVI A;  2B7T A;  4DPX A;  4B3M E;  1Z0C A;  1ZM9 A;  4DR7 E;  4DV5 I;  2LJH A;  1DAR A;  2V8P A;  1XMQ I;  1Z0G A;  1YYK A;  2EZ6 A;  4LF4 E;  4B3R I;  3J80 C;  4DR4 E;  5LL6 R;  1H7S A;  2LJP A;  2X36 A;  3WU4 A;  3Q1Q A;  1YYW A;  2UXD E;  5BR8 I;  1HNX I;  1RRE A;  4FWG A;  3OTO I;  1HNZ E;  4DR6 I;  4LF9 E;  4NXM I;  2L3C A;  1EA6 A;  1N0V C;  4B3S I;  1I94 I;  4FN5 A;  2RS7 A;  2UU9 E;  4URL A;  5IWA I;  4DR2 I;  1H73 A;  4R1F A;  1IBK I;  3ZM7 A;  4XTJ A;  2JVA A;  4B3T I;  1XMQ E;  4FWH A;  5LMN I;  4X66 I;  4MYU A;  2LBS B;  4X64 I;  1PVG A;  2DEI A;  2VQE I;  4DV3 I;  1S4E A;  4B3R E;  2ZM6 I;  2A2D A;  1N32 I;  2BM0 A;  1IBM I;  1O0W A;  5BR8 E;  1NZ0 A;  1HNX E;  3OTO E;  4DPW A;  2HFU A;  2VF3 A;  4X62 I;  4DR6 E;  2HK2 A; 
#chains in the Genus database with same CATH topology
 2M4I A;  4NXM E;  3HUL A;  4EMD A;  2DMI A;  1Z5C A;  4B3S E;  4USK A;  3P3G A;  1I94 E;  2NA2 A;  4LF8 I;  4YHH E;  2L3J A;  4FW7 A;  4JI3 I;  2RSM A;  5IWA E;  4DR2 E;  2LT7 A;  3C6M A;  1IBK E;  2B3T B;  2GS8 A;  2BA1 D;  3RMP A;  2NN6 C;  3KZZ A;  2YU8 A;  3C4T A;  1P42 A;  1Y4S A;  2EOI A;  2BR2 B;  4DV0 I;  3B8H A;  4B3T E;  2GLI A;  4LCG A;  4NHR A;  5LMN E;  2J65 A;  1NHI A;  2Q2E B;  1SFE A;  1FNM A;  4X64 E;  2WNR B;  4R2D A;  2EML A;  2L2M A;  2LJU A;  2ZM6 E;  4LF6 I;  4FK5 C;  2PO1 A;  2I13 A;  4JI6 E;  2O3Z A;  4BA2 B;  1A1L A;  2V83 A;  1N32 E;  2ENC A;  1AAY A;  2EOH A;  1IBM E;  2EN8 A;  1K47 A;  4GQU A;  2EN4 A;  2LCE A;  2C37 A;  4P78 A;  1WRJ A;  5C0X A;  2EPL X;  3BBG A;  4X62 E;  4OO1 C;  3BGH A;  3KRN A;  5LMU I;  4R8O A;  1J5E I;  3L7Z B;  3V2U C;  1YPN A;  4U3B A;  2HHH I;  3KZY A;  4N4R B;  2R1F A;  1MU5 A;  4JG4 A;  4NXN I;  1Z1B A;  3LPS A;  3GCM A;  4LF8 E;  1Z5B A;  5DRO A;  2ADR A;  2YU5 A;  2A25 A;  2L6M A;  4WXD A;  4JI3 E;  3B4T A;  2F4V I;  2EMF A;  2MC5 A;  3P76 A;  2X7I A;  2CT1 A;  4M9V C;  4IZJ B;  4DV0 E;  2BM1 A;  4DR4 I;  5K36 F;  2UXD I;  3PYE A;  4M30 A;  3OML A;  3VK6 A;  1OJ4 A;  2IOP A;  4F9B B;  4IZK A;  5KL6 A;  2EM0 A;  4LF6 E;  1RQ0 A;  3ZKB A;  4LFA I;  2L33 A;  3C4B A;  1A1I A;  4WUD A;  2YRH A;  3VYY A;  3QG5 C;  4LFB I;  4LF9 I;  1R6M A;  3L00 A;  5F3W A;  1WJP A;  2OI2 A;  2PRT A;  1PKP A;  3ADL A;  4JI4 I;  4IFD C;  2V2V A;  1LLM C;  3JTZ A;  1A1J A;  3B82 A;  2WW4 A;  1T38 A;  1USU A;  5LMU E;  1Y5Y A;  2JEB A;  2HK3 A;  4P7A A;  2JEA B;  1EH8 A;  2ENA A;  2GO3 A;  2HHH E;  1XNR I;  1N0U A;  1S16 A;  3H4L A;  1PDA A;  4WUC A;  1SR9 A;  4NXN E;  2M9A A;  4F6N A;  4NZV A;  1A1K A;  3F6H A;  1UN6 B;  1Z5A A;  2F4V E;  1RC7 A;  4JI0 E;  5KL5 A;  4I8O A;  4X65 I;  2YTF A;  2YTJ A;  2MDR A;  2E72 A;  2EOY A;  4MU4 A;  2B7V A;  2YPN A;  2R76 A;  3THO B;  1ZM4 A;  1USV A;  4LPF A;  2NN6 B;  2JR1 A;  4OO1 F;  4JI1 I;  1XXE A;  4IS9 A;  4LFA E;  5DRP A;  4F6M A;  2YSP A;  1UDN A;  5LLQ A;  4LFB E;  4BHB A;  2DEJ A;  2LVH A;  1UHZ A;  4JI4 E;  3CDJ A;  4O24 A;  4MLV A;  4PRV A;  1T4N A;  4WSP A;  4LFC I;  4YHH I;  3GME A;  5DRQ A;  2UUB E;  2EMG A;  3EPJ A;  4M0V A;  4JI2 I;  2DB2 A;  3VYX A;  5IT9 Q;  3M99 B;  1XNR E;  2EMH A;  2LTR A;  3AV0 A;  5GME A;  2KON A;  2CVE A;  1WHQ A;  4L8N A;  4FW4 A;  2JXP A;  4IFD D;  4DR3 I;  4KQV A;  1N34 I;  4MU1 A;  1NHH A;  1UBD C;  2EPC A;  2YTD A;  4X65 E;  4JI7 I;  2KOU A;  4LU9 A;  2O1U A;  1YZ9 A;  3GLL A;  3IWD A;  4UT4 A;  4JI6 I;  4BA1 A;  4QNK A;  1D6T A;  2EN3 A;  2JOB A;  4LF7 I;  2EOE A;  1GQE A;  1XNQ I;  1KYQ A;  4F9A B;  2UXC I;  4X9J A;  4USM A;  2EL4 A;  3ADG A;  4JI1 E;  4K0K I;  4R2S A;  1TF3 A;  1HR0 I;  1Y4U A;  3U1K A;  2M7Q A;  2CTD A;  2UXB I;  1ZAA C;  2VF1 A;  1X6E A;  4MYT A;  1UDO A;  2C38 A;  2H36 X;  1KJK A;  4OKG A;  2WBU A;  2C39 B;  3DF6 A;  1NEI A;  1QU6 A;  1STU A;  2PNZ A;  4IFD B;  2PO0 B;  5AC4 A;  4LFC E;  2EOX A;  2GO4 A;  3JAM Q;  3THN A;  2CG9 A;  2Z5B B;  4JV5 I;  3IWB A;  2YTQ A;  3EPK A;  2NUG A;  3Q6N A;  2WCC 3;  4JI2 E;  4LCF A;  4DU7 A;  4KWY A;  1RHY A;  4ZYE A;  2Z5E A;  2ELY A;  3H09 A;  1OYR A;  1YSA C;  2NUF A;  2ZIT A;  2I9I A;  2WBT A;  5JEA B;  2J7J A;  2B9D A;  2N3H A;  4WX9 A;  2KHX A;  3LLH A;  4M1K A;  2EE8 A;  2EMW A;  4DR3 E;  4R2E A;  1N34 E;  5K36 D;  3UK3 C;  2EPP A;  2EOR A;  4JI7 E;  4DR5 I;  1N33 I;  3PS3 A;  2LUQ A;  3D4J A;  3AUZ A;  4R2P A;  1EH6 A;  3K6Q A;  4Q35 B;  3VHT B;  2RPC A;  4DUY I;  4LF7 E;  2EMA A;  2FV4 B;  3J7Y p;  4R2Q A;  1BB8 A;  2N3G A;  1RMD A;  1A1G A;  1XNQ E;  1ELO A;  1ZXM A;  2E1R A;  2L92 A;  4OOG C;  2WP8 B;  1AH5 A;  2UXC E;  3J7A M;  4K0K E;  4HYM A;  3J80 Q;  2N8X A;  5C0X D;  5KL3 A;  1HR0 E;  2AE8 A;  2YRK A;  2WNR A;  2EN2 A;  2V8Q B;  4IJD A;  2UXB E;  1U2R A;  2LRS A;  3HTX A;  2YTG A;  1KTV A;  3B78 A;  2EOF A;  4TUG A;  1UDQ A;  2DLK A;  3ZZT A;  1FJG I;  4ZYD A;  3EPH A;  2EMB A;  4FWD A;  1MEY C;  2EJ4 A;  3M7N G;  1A1H A;  2JE6 B;  3LTO A;  5ELW A;  4JI0 I;  4JV5 E;  1EKZ A;  2NN6 E;  2EMY A;  1GZ6 A;  1X6F A;  2MDG A;  3MHH C;  4MQY A;  1X49 A;  1YHC A;  4LOM A;  1A1F A;  2MKD A;  3ZZ0 A;  2MC6 A;  1H7U A;  2DGC A;  3ZZU A;  2GPI A;  5IT9 C;  2BBG A;  2Q8U A;  1JK1 A;  4FW6 A;  4JI8 I;  4DR5 E;  2EN1 A;  1N33 E;  4DR1 I;  3P1X A;  3BID A;  4QNJ A;  2J7K A;  4HAC A;  4WSG A;  4LTY A;  1VIS A;  2PNL A;  1BBO A;  2BA0 G;  4DUY E;  4DUZ I;  3EQ1 A;  2YWQ A;  1H74 A;  4DPY A;  4R2C A;  4DV1 I;  4J3D A;  3K17 A;  4IZK B;  4IZJ D;  4IZJ A;  5ADZ A;  1P47 A;  4Q28 A;  1MX0 A;  1PJS A;  2YRM A;  2DIX A;  1X3C A;  3WU3 A;  2RS6 A;  5K36 B;  1T4O A;  2EOS A;  1G2D C;  2UUB I;  4GKJ I;  3Q6M A;  1YUI A;  2BA0 D;  1R6L A;  5C0X F;  1FJG E;  5L3J A;  3K1J A;  1UEK A;  4GKK I;  2JEB B;  3ZKD A;  1IBL I;  4LCH A;  3NZK A;  2FGG A;  4DV2 I;  4X8W A;  3T1Y I;  4F9C B;  4O5G A;  3M85 G;  2VES A;  1PJQ A;  1DI2 A;  3QT5 A;  3PYF A;  2JEA A;  2IOQ A;  2O1W A;  3HPS A;  3J81 Q;  3FIG A;  1YUJ A;  4O4K A;  1Z0E A;  2A2C A;  3WU6 A;  4IFD A;  2F1D A;  2EPK X;  2G7H A;  1KKH A;  2EM9 A;  4MLQ A;  2HC5 A;  4JI8 E;  2JOX A;  2YT4 A;  5DNY A;  4R2A A;  1Z59 A;  5FWK A;  4DR1 E;  1Z0B A;  2EOJ A;  3PRY A;  2HKE A;  3HJC A;  5C0X C;  2EPA A;  4WYQ B;  4DUZ E;  5EL9 A;  5GMD A;  1N36 I;  5TSE A;  4DV1 E;  4IFD E;  2CZ9 A;  2RSI A;  2XEX A;  5IXM B;  1XHK A;  2NN6 D;  2NN6 A;  5EKW A;  2EPU A;  5JEA E;  1IMU A;  1Z0T A;  2EMX A;  4GKJ E;  4OO1 B;  1DQ3 A;  2JWO A;  4GEQ B;  1X6H A;  3ZOQ B;  5AC5 A;  5AE1 A;  3K85 A;  4GKK E;  2JP9 A;  1OYS A;  3MSW A;  3P3E A;  4FW5 A;  1IBL E;  4DPT A;  4ISA A;  4YY3 I;  3T1Y E;  4DV2 E;  3P3C A;  2VRD A;  2PO2 B;  3V5R A;  4AQY I;  2ZBK B;  1A6F A;  4DV7 I;  4F2J C;  4Z7C A;  2UUC I;  1B69 A;  3T1H I;  1X48 A;  2EP3 A;  1HK7 A;  1FWK A;  2YTE A;  4U3D A;  4DXL A;  2L2K B;  1FI4 A;  5A2Q Q;  5FLX Q;  4N3O A;  2LUP B;  5KL2 A;  2VQF I;  2EMZ A;  3CWV A;  4PRX A;  4AIM A;  4UTG A;  3U1Y A;  1HNW I;  3C6K A;  5AE3 A;  1WUU A;  1TF6 A;  4MU3 A;  3QT6 A;  3PYD A;  4P52 A;  1J26 A;  2EM2 A;  1N36 E;  2V89 A;  5A6J A;  1B63 A;  3GON A;  2Z5C B;  3PYG A;  4BHC A;  4GZN C;  4DV5 E;  2EM5 A;  2EQ1 A;  2ELZ A;  2HGH A;  1H72 C;  5KL4 A;  2V34 A;  4RHB B;  2EPM X;  1PJT A;  1Z0W A;  4DV4 I;  2BB8 A;  5A6B D;  5A6B A;  1BKN A;  1IQO A;  1KVK A;  2C38 B;  2D9H A;  4DKK A;  2O1T A;  3H1C A;  4OX9 I;  3ECR A;  2V87 A;  3MHS C;  2IES A;  1GTK A;  3DJW A;  1B62 A;  2PNZ B;  2EOQ A;  3WU5 A;  4DV6 I;  2EM4 A;  1DGC A;  1X5W A;  2R3V A;  4BBY A;  4KHP I;  5DNX A;  4YY3 E;  2EPN A;  4JI5 I;  2RQL A;  4R2R A;  2C39 A;  4FW9 A;  4AQY E;  2E5L I;  2K4V A;  5KL7 A;  4DV7 E;  2UUC E;  1ZU1 A;  4R03 A;  2BA1 G;  2PO0 A;  4BC9 A;  2V2Q A;  2EM3 A;  3F0N A;  4MDT A;  3T1H E;  2Z5B A;  4AM3 A;  1FWL A;  1N3G A;  1ZBT A;  2LTS A;  2YSO A;  2JPA A;  2VQF E;  2EM8 A;  5K36 E;  2M1S A;  4BCA A;  2DSY A;  2LE2 A;  3TQM A;  1JK2 A;  2DRP A;  2V2Z A;  5JEA D;  3ADI A;  2BR2 A;  5JEA A;  2PO1 B;  3J81 C;  2EWL A;  1HNW E;  4J8Z A;  1ZM3 A;  4BMJ A;  2DMY A;  5CFF E;  3J7A G;  1T4L B;  2BV3 A;  2C37 B;  3QT8 A;  2JYA A;  2AJ4 A;  2GQ0 A;  3QT7 A;  5C0X B;  3EPL A;  2CSH A;  5IV8 B;  4X66 E;  3M6A A;  4BA2 A;  4JYA I;  4HEI A;  2EFG A;  2RTX A;  2VQE E;  1BBG A;  2EQ3 A;  4DV3 E;  2GHF A;  2IHR 1;  4DMI A;  1QZR A;  5AE2 A;  4DV4 E;  1PIE A;  1RR9 A;  1Y60 A;  2WP8 A;  4I3H A;  4M2Z A;  1G2F C;  1WXR A;  4OX9 E;  2WZO A;  2UUA I;  4WPY A;  4WFT A;  5A69 A;  2HKJ A;  4DV6 E;  3L7Z A;  4KHP E;  1KIJ A;  1OYP A;  2L8T A;  2NUE A;  4JI5 E;  1YFH A;  1ZM2 A;  2HJJ A;  4HY1 A;  3M7N D;  4MU0 A;  4ZYH A;  1E3P A;  1ZXN A;  4WUB A;  2EM7 A;  5A2Q C;  2E5L E;  1XMO I;  3LNU A;  1X47 A;  2EPZ A;  2JE6 A;  4B3M I;  2EN7 A;  2CGE A;  1T39 A;  3HPZ A;  4DR7 I;  3DD6 A;  2EM6 A;  2LV2 A;  4P7D A;  1QNT A;  3ADJ A;  5FLX C;  4HAC B;  2WBS A;  4RPF A;  4OO1 E;  1FKA E;  2ENH A;  4BC7 A;  4LF4 I;  2O1V A;  5DRR A;  2CPN A;  2LO3 A;  2YTN A;  1EH7 A;  1YYO A;  2EOZ A;  2YTI A;  4LF5 I;  3F6G A;  2EOM A;  2NPF A;  2VE7 C;  1EI1 A;  4DPU A;  4DU8 A;  1WHN A;  4JYA E;  2V88 A;  2EOO A;  1Y6Z A;  4ED4 A;  2K7I A;  4LF5 E;  4NBQ A;  4Z7Y A;  1Z0V A;  2YTO A;  5T6J A;  1NHJ A;  5DNL A;  4HXZ A;  2HFS A;  1HNZ I;  3KWR A;  2R42 A;  2JY9 A;  2L2N A;  2UUA E;  1UIL A;  5K36 A;  2ODR D;  4PU9 A;  2MKN A;  2EMK A;  4BS9 A;  1E3H A;  4OZE A;  3JAM C;  3UHM A;  3JU0 A;  5AAS A;  3HXL A;  3PS1 A;  2EMI A;  4FW3 A;  1MG7 A;  2UU9 I;  1XMO E;  1J5E E;  2NN6 F;  4ZVI A;  2B7T A;  3M85 D;  5JEA C;  4B3M E;  4DPX A;  1UDS A;  1NCS A;  4AID A;  1Z0C A;  3CDI A;  4DV3 I;  1ZM9 A;  5A6K A;  4DR7 E;  4DV5 I;  5A6A A;  2FTX B;  2LJH A;  1DAR A;  2F8B A;  2YTP A;  1Z0G A;  2V8P A;  1YYK A;  2EZ6 A;  1XMQ I;  1ZR9 A;  4LF4 E;  4B3R I;  2YZT A;  2JT2 A;  4F54 A;  1L4S A;  3J80 C;  5LL6 R;  4DR4 E;  1F2I G;  1H7S A;  2LJP A;  2X36 A;  3WU4 A;  3Q1Q A;  1YYW A;  2UXD E;  2EL6 A;  2IER A;  5BR8 I;  1TN9 A;  1HNX I;  1IQS A;  1RRE A;  4FWG A;  2E1M A;  3OTO I;  2NAB A;  1MGT A;  2DLQ A;  1HNZ E;  4DR6 I;  4O43 A;  4LF9 E;  4NXM I;  2L3C A;  1EA6 A;  3HQ1 A;  1N0V C;  4RH8 A;  4OO1 A;  4B3S I;  4OO1 D;  1I94 I;  2EPR A;  2LMZ A;  1VI7 A;  4FN5 A;  4WXC A;  2RS7 A;  2UU9 E;  1ZBQ A;  4IS1 C;  4URL A;  5IWA I;  4BA1 B;  4DR2 I;  1H73 A;  3PS2 A;  4R1F A;  2PO2 A;  3P06 A;  3ZM7 A;  3IWC A;  5C0X E;  1IBK I;  4XTJ A;  2JVA A;  4B3T I;  4ZYG A;  2EPX A;  1XMQ E;  4FWH A;  5LMN I;  4X66 I;  4MYU A;  2LBS B;  4X64 I;  1PVG A;  3LML A;  2DEI A;  2V85 A;  4HTG A;  2VQE I;  1S4E A;  4B3R E;  2ZM6 I;  2V86 A;  2A2D A;  2EL5 A;  4L5N C;  1YH8 A;  4KZS A;  4TUI A;  2PNM A;  4IFD F;  1N32 I;  2EMC A;  2EN6 A;  2EQ0 A;  2BM0 A;  1IBM I;  1O0W A;  5BR8 E;  1NZ0 A;  1HNX E;  2Z5C A;  5K36 C;  2ODR C;  3HKM A;  3OTO E;  4DPW A;  2HFU A;  3BF2 A;  2VF3 A;  5JEA F;  4X62 I;  4DR6 E;  2EPO A;  2HK2 A; 
#chains in the Genus database with same CATH homology
 2M4I A;  4NXM E;  3HUL A;  4EMD A;  1Z5C A;  4B3S E;  4USK A;  1I94 E;  2NA2 A;  4LF8 I;  4YHH E;  2L3J A;  4JI3 I;  2RSM A;  5IWA E;  4DR2 E;  1IBK E;  2B3T B;  2GS8 A;  3RMP A;  3C4T A;  4DV0 I;  1Y4S A;  3B8H A;  4B3T E;  5LMN E;  2Q2E B;  1NHI A;  1FNM A;  4X64 E;  2L2M A;  2ZM6 E;  4LF6 I;  4JI6 E;  2V83 A;  1N32 E;  1IBM E;  1K47 A;  4P78 A;  4X62 E;  5LMU I;  4R8O A;  1J5E I;  3V2U C;  2HHH I;  1MU5 A;  4JG4 A;  4NXN I;  3LPS A;  4LF8 E;  1Z5B A;  2F4V I;  2L6M A;  4JI3 E;  2MC5 A;  2X7I A;  4IZJ B;  4DV0 E;  2BM1 A;  4DR4 I;  2UXD I;  3PYE A;  4M30 A;  3OML A;  3VK6 A;  1OJ4 A;  2IOP A;  4F9B B;  4IZK A;  4LF6 E;  1RQ0 A;  3ZKB A;  4LFA I;  2L33 A;  3C4B A;  4WUD A;  3VYY A;  4LFB I;  4LF9 I;  5F3W A;  2OI2 A;  3ADL A;  1PKP A;  4JI4 I;  2V2V A;  3JTZ A;  3B82 A;  2WW4 A;  1USU A;  5LMU E;  2HK3 A;  4P7A A;  2HHH E;  1XNR I;  1N0U A;  1S16 A;  3H4L A;  4WUC A;  1SR9 A;  4NXN E;  3F6H A;  1Z5A A;  2F4V E;  1RC7 A;  4JI0 E;  4I8O A;  4X65 I;  2MDR A;  2B7V A;  1ZM4 A;  1USV A;  2JR1 A;  4JI1 I;  4LFA E;  4LFB E;  2DEJ A;  1UHZ A;  4JI4 E;  4PRV A;  1T4N A;  4WSP A;  4LFC I;  4YHH I;  2UUB E;  4M0V A;  4JI2 I;  2DB2 A;  3VYX A;  5IT9 Q;  1XNR E;  2LTR A;  3AV0 A;  5GME A;  2KON A;  1WHQ A;  4L8N A;  4DR3 I;  4KQV A;  1N34 I;  1NHH A;  4X65 E;  4JI7 I;  2KOU A;  4LU9 A;  2O1U A;  1YZ9 A;  3IWD A;  4UT4 A;  4JI6 I;  4LF7 I;  2JOB A;  1GQE A;  1XNQ I;  4F9A B;  2UXC I;  4USM A;  3ADG A;  4JI1 E;  4K0K I;  1HR0 I;  1Y4U A;  2M7Q A;  2UXB I;  2VF1 A;  4MYT A;  2H36 X;  3DF6 A;  1QU6 A;  1STU A;  4LFC E;  3JAM Q;  2Z5B B;  2CG9 A;  4JV5 I;  3IWB A;  2NUG A;  3Q6N A;  4DU7 A;  4JI2 E;  2Z5E A;  3H09 A;  2ZIT A;  2NUF A;  2B9D A;  2N3H A;  4M1K A;  2KHX A;  3LLH A;  4DR3 E;  1N34 E;  4JI7 E;  4DR5 I;  1N33 I;  2LUQ A;  3D4J A;  3AUZ A;  3K6Q A;  4DUY I;  4LF7 E;  2FV4 B;  3J7Y p;  1ZXM A;  2E1R A;  2N3G A;  1D6T A;  1XNQ E;  1ELO A;  2L92 A;  4OOG C;  3J7A M;  2UXC E;  4K0K E;  4HYM A;  3J80 Q;  1HR0 E;  2UXB E;  2V8Q B;  1U2R A;  2LRS A;  3HTX A;  1KTV A;  3B78 A;  4TUG A;  1FJG I;  3ZZT A;  4FWD A;  3LTO A;  4JI0 I;  4JV5 E;  1EKZ A;  1GZ6 A;  1X49 A;  3ZZ0 A;  2MC6 A;  1H7U A;  3ZZU A;  5IT9 C;  4JI8 I;  4DR5 E;  1N33 E;  4DR1 I;  3P1X A;  2J7K A;  4HAC A;  4LTY A;  1VIS A;  2PNL A;  4DUZ I;  4DUY E;  1H74 A;  4DPY A;  4DV1 I;  3K17 A;  4IZK B;  4IZJ D;  4IZJ A;  5ADZ A;  4Q28 A;  1MX0 A;  2DIX A;  3WU3 A;  2RS6 A;  1T4O A;  2UUB I;  4GKJ I;  3Q6M A;  5L3J A;  1FJG E;  3K1J A;  1UEK A;  4GKK I;  3ZKD A;  1IBL I;  2FGG A;  4DV2 I;  4X8W A;  3T1Y I;  4F9C B;  1DI2 A;  3QT5 A;  3PYF A;  2IOQ A;  2O1W A;  3HPS A;  3J81 Q;  3FIG A;  2A2C A;  3WU6 A;  1Z0E A;  2G7H A;  1KKH A;  4JI8 E;  2JOX A;  2YT4 A;  5DNY A;  1Z59 A;  5FWK A;  4DR1 E;  1Z0B A;  3PRY A;  2HKE A;  3HJC A;  4DUZ E;  4WYQ B;  1N36 I;  5GMD A;  4DV1 E;  2CZ9 A;  2XEX A;  1XHK A;  1Z0T A;  4GKJ E;  1DQ3 A;  2JWO A;  4GEQ B;  3ZOQ B;  5AE1 A;  3K85 A;  4GKK E;  4DPT A;  5A2Q Q;  3MSW A;  1IBL E;  4YY3 I;  3T1Y E;  4DV2 E;  3V5R A;  4AQY I;  2ZBK B;  1A6F A;  4DV7 I;  2UUC I;  4Z7C A;  3T1H I;  1X48 A;  1HK7 A;  4DXL A;  1FWK A;  5FLX Q;  2L2K B;  1FI4 A;  4N3O A;  2LUP B;  2VQF I;  3CWV A;  4PRX A;  4UTG A;  1HNW I;  5AE3 A;  1WUU A;  3QT6 A;  3PYD A;  4P52 A;  1J26 A;  1N36 E;  2V89 A;  3PYG A;  1B63 A;  3GON A;  2Z5C B;  4DV5 E;  1H72 C;  2V34 A;  1Z0W A;  4DV4 I;  1BKN A;  1KVK A;  2O1T A;  4DKK A;  4OX9 I;  2V87 A;  3DJW A;  1B62 A;  3WU5 A;  4DV6 I;  2R3V A;  4KHP I;  4BBY A;  4YY3 E;  4JI5 I;  4FW9 A;  4AQY E;  2E5L I;  2K4V A;  4DV7 E;  2UUC E;  4R03 A;  4BC9 A;  2V2Q A;  3F0N A;  3T1H E;  2Z5B A;  1FWL A;  1ZBT A;  2LTS A;  2VQF E;  2M1S A;  4BCA A;  2DSY A;  2LE2 A;  2V2Z A;  3ADI A;  3J81 C;  2EWL A;  1HNW E;  4J8Z A;  1ZM3 A;  4BMJ A;  2DMY A;  5CFF E;  3J7A G;  1T4L B;  2BV3 A;  3QT8 A;  3QT7 A;  2GQ0 A;  2AJ4 A;  4JYA I;  4X66 E;  3M6A A;  2EFG A;  2RTX A;  2VQE E;  4DV3 E;  1QZR A;  2IHR 1;  1RR9 A;  4DMI A;  4LF5 I;  5AE2 A;  4DV4 E;  1PIE A;  4I3H A;  4M2Z A;  1WXR A;  4OX9 E;  2WZO A;  2UUA I;  4WPY A;  4WFT A;  2HKJ A;  4DV6 E;  4KHP E;  1KIJ A;  2L8T A;  2NUE A;  4JI5 E;  1ZM2 A;  4HY1 A;  4WUB A;  1ZXN A;  1XMO I;  2E5L E;  5A2Q C;  3LNU A;  1X47 A;  4B3M I;  2CGE A;  3HPZ A;  4DR7 I;  4P7D A;  3ADJ A;  5FLX C;  4HAC B;  4RPF A;  1FKA E;  4BC7 A;  4LF4 I;  2O1V A;  2CPN A;  1YYO A;  3F6G A;  2NPF A;  2VE7 C;  1EI1 A;  4DPU A;  4DU8 A;  1WHN A;  4JYA E;  2V88 A;  1Y6Z A;  4ED4 A;  4LF5 E;  4Z7Y A;  1Z0V A;  5T6J A;  1NHJ A;  4HXZ A;  2HFS A;  1HNZ I;  3KWR A;  2R42 A;  2JY9 A;  2L2N A;  2UUA E;  1UIL A;  2ODR D;  4PU9 A;  4BS9 A;  3JAM C;  3JU0 A;  5AAS A;  3HXL A;  1MG7 A;  2UU9 I;  1XMO E;  1J5E E;  4ZVI A;  2B7T A;  4DPX A;  4B3M E;  1Z0C A;  1ZM9 A;  4DR7 E;  4DV5 I;  2FTX B;  2LJH A;  1DAR A;  2F8B A;  2V8P A;  1Z0G A;  1XMQ I;  1YYK A;  2EZ6 A;  4LF4 E;  4B3R I;  2YZT A;  4F54 A;  3J80 C;  5LL6 R;  4DR4 E;  1H7S A;  2LJP A;  2X36 A;  3WU4 A;  3Q1Q A;  1YYW A;  2UXD E;  5BR8 I;  1HNX I;  1RRE A;  4FWG A;  2E1M A;  3OTO I;  1HNZ E;  4DR6 I;  4LF9 E;  4NXM I;  2L3C A;  1EA6 A;  3HQ1 A;  1N0V C;  4B3S I;  1I94 I;  2LMZ A;  4FN5 A;  2RS7 A;  2UU9 E;  1ZBQ A;  4URL A;  5IWA I;  4DR2 I;  1H73 A;  4R1F A;  1IBK I;  3ZM7 A;  3P06 A;  3IWC A;  4XTJ A;  2JVA A;  4B3T I;  1XMQ E;  4FWH A;  5LMN I;  4X66 I;  4MYU A;  2LBS B;  4X64 I;  1PVG A;  3LML A;  2DEI A;  2V85 A;  2VQE I;  4DV3 I;  1S4E A;  4B3R E;  2ZM6 I;  2V86 A;  2A2D A;  4L5N C;  4KZS A;  4TUI A;  2PNM A;  1N32 I;  2BM0 A;  1IBM I;  1O0W A;  5BR8 E;  1NZ0 A;  1HNX E;  2Z5C A;  2ODR C;  3OTO E;  4DPW A;  2HFU A;  2VF3 A;  4X62 I;  4DR6 E;  2HK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...