2HHHI

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2hhhI00
3PYFA 2E5LE 3WU5A 2ZBKB 4LF9I 5IT9Q 4JI2E 1XNRI 1ELOA 1XNQI 1HNZI 4DR3I 4WUBA 2GS8A 4B3RI 2HHHE 3PYGA 1IBKI 2OI2A 1XNRE 2VQEE 3JAMQ 4JI3E 4EMDA 1Z59A 4FN5A 3OTOI 3ZKBA 2UXDI 1D6TA 4DR1I 2R3VA 4HY1A 1HR0I 4OX9I 1DARA 4RPFA 4K0KE 4LF7E 1RR9A 4DUZI 3ZM7A 4DV7E 3J7AM 1MU5A 4B3RE 4DPYA 1BKNA 4DV2E 4DXLA 4DUYE 3B78A 1H73A 4DV0I 4AQYE 1N36I 4JI0I 3H4LA 2HFUA 4KQVA 4MYUA 3HULA 4LFAI 4LF9E 2UUAI 1HNXE 1MX0A 1N0VC 4DV2I 1Z0GA 4DR3E 4UTGA 1QZRA 1HNWI 3B82A 4JG4A 1NHHA 4ED4A 2V8PA 1I94E 3Q1QA 3F0NA 5LMUE 4M1KA 3V5RA 1S4EA 3ZZTA 5LMNE 1H74A 1ZM9A 2VF3A 4XTJA 4X64E 1FI4A 4B3SI 1K47A 4DV3I 2ZM6I 4DR4E 2VQFE 1B62A 4YHHI 2BM1A 3V2UC 4JYAI 4JI6E 4LFBE 4JI7E 1IBKE 4DUZE 4KHPE 2J7KA 4PRVA 1U2RA 2DEJA 2Q2EB 1KTVA 3WU3A 4YY3I 3PYDA 4DPWA 4P7AA 2XEXA 4LFCI 4GKJI 2X7IA 3J80C 1S16A 3QT7A 3QT8A 4JI0E 3J80Q 1VISA 1J5EI 1UEKA 2HK3A 5A2QC 3T1YI 4LF4I 4PU9A 4FWGA 1ZXNA 2ZM6E 4HYMA 4DPUA 2BM0A 4GKKE 4PRXA 4Z7CA 4X65E 1A6FA 4HACA 4DV6I 4AQYI 4LF8I 3ZZ0A 4DR7I 4FWDA 2DEIA 4X66E 2UXDE 4DR2I 5LL6R 5IWAE 1FKAE 4USKA 5LMNI 4I3HA 1OJ4A 4FW9A 4JI1E 3T1HE 1XNQE 2LJPA 1IBMI 1N32I 1PVGA 3ZKDA 4DV6E 1KKHA 4JI8I 2UU9I 4P52A 1IBLI 4MYTA 1FWKA 4DV7I 4FWHA 4B3ME 4JV5I 4URLA 2EFGA 2UUBI 1XMOI 4DR5E 3QT6A 1H72C 1ZM3A 4R1FA 4LFBI 2BV3A 4JI2I 3OTOE 1N34E 2UXCI 4DR1E 1HNZE 1N36E 4B3SE 4LF8E 3WU4A 4X62E 4DV5I 1FJGE 4OX9E 1KVKA 4JI4I 4DR4I 4LFAE 3PYEA 1RREA 2WW4A 5BR8E 4DV4I 4NXMI 5IT9C 4JI3I 2VQEI 4NXNI 2CZ9A 3T1YE 1N32E 3JAMC 3B8HA 1I94I 2HHHI 1MG7A 1EA6A 1HR0E 1Z0TA 4JI5E 4DR7E 4UT4A 3LTOA 1EI1A 4X64I 2UUCE 1Z5BA 2F4VE 3K17A 2UUAE 4DR2E 4DV3E 2E5LI 4DV1I 4DV5E 3LNUA 4JI1I 4ZVIA 4GKKI 4JYAE 4HXZA 1Z0VA 1Z0CA 1HNWE 4DUYI 2V34A 4DR6I 2V2ZA 4YY3E 2UUBE 2UXBE 1H7SA 4DPXA 1N34I 2UXCE 4LF5E 4DR6E 2X36A 4DV0E 4DU7A 1ZM4A 1Z5AA 4Z7YA 1Z5CA 4JI4E 1KIJA 1IBLE 2UU9E 2E1RA 1FJGI 3WU6A 3J81Q 2R42A 1Z0EA 1XMOE 4LF7I 2V2QA 3GONA 4DV4E 1ZXMA 1HNXI 4NXNE 2A2DA 4X65I 3CWVA 1XHKA 4LF5I 1NHJA 4USMA 2NPFA 1XMQI 2VQFI 4X62I 4YHHE 4B3TI 2HK2A 4DU8A 1PIEA 2HKJA 4JI6I 4JI5I 1ZM2A 4JI7I 2ZITA 1PKPA 5BR8I 3K1JA 4NXME 2F4VI 5FLXQ 3QT5A 2AJ4A 1XMQE 1H7UA 4DV1E 4WUCA 5FLXC 4B3MI 4JV5E 4B3TE 4GKJE 1NZ0A 3M6AA 2A2CA 1Z0WA 4KHPI 4X66I 1WUUA 3LPSA 2HFSA 5IWAI 1J5EE 1N0UA 5A2QQ 2UXBI 4LF6I 1IBME 1N33I 3J7AG 4DPTA 4K0KI 4LFCE 4JI8E 3D4JA 4WUDA 1B63A 3J81C 4DR5I 3ZZUA 1NHIA 4LF6E 4LF4E 1FNMA 1N33E 1Z0BA 2HKEA 5L3JA 3T1HI 1FWLA 5GMEA 2V2VA 2UUCI 5LMUI 4HACB 5GMDA
chains in the Genus database with same CATH superfamily
3PYFA 2E5LE 3WU5A 3M85G 2CGEA 2ZBKB 4LF9I 5IT9Q 4JI2E 2PO1A 2C38A 3U1YA 1XNRI 1Y60A 1ELOA 1XNQI 1HNZI 2BA0G 4GQUA 4DR3I 3NZKA 2O1VA 4WUBA 1Y6ZA 2GS8A 4B3RI 2O3ZA 2HHHE 4QNJA 3GMEA 1E3PA 5C0XD 3PS3A 3PYGA 3U1KA 1IBKI 2O1TA 5C0XB 2C37B 2WNRA 2OI2A 1XNRE 2VQEE 3JAMQ 4JI3E 4EMDA 1Z59A 4FN5A 3OTOI 3ZKBA 2UXDI 1D6TA 4DR1I 2R3VA 1OYSA 4HY1A 1HR0I 4OX9I 1DARA 4RPFA 4K0KE 1USVA 4LF7E 1RR9A 4DUZI 5JEAA 5DNLA 3ZM7A 4DV7E 1UDNA 3J7AM 4IZKB 1MU5A 5DNXA 4B3RE 4LCGA 4DPYA 1BKNA 4DV2E 4DXLA 4DUYE 3B78A 1H73A 4DV0I 4AQYE 4LPFA 3CDJA 1N36I 4MU1A 4JI0I 4FW7A 3H4LA 2HFUA 4KQVA 4MYUA 2PO2B 3HULA 4U3DA 4LFAI 2C39B 2GO4A 4LF9E 2UUAI 1HNXE 1MX0A 1N0VC 4DV2I 2PNMA 1Z0GA 4DR3E 4MU0A 3M7ND 2GO3A 2NN6C 4UTGA 1QZRA 4OZEA 1HNWI 3B82A 4JG4A 1NHHA 4ED4A 2V8PA 2JEBB 1I94E 2WNRB 3Q1QA 2IOQA 3F0NA 5LMUE 4M1KA 1UDSA 3V5RA 1S4EA 3ZZTA 4QNKA 5LMNE 2WP8A 1H74A 1ZM9A 1VI7A 2C39A 4IFDE 5C0XA 2VF3A 4IZJB 4XTJA 4X64E 2NN6A 4OO1E 1FI4A 4B3SI 1K47A 3PS2A 4DV3I 2ZM6I 4DR4E 2IESA 5EL9A 2VQFE 1B62A 4YHHI 2BM1A 3V2UC 4JYAI 4FW5A 4JI6E 4LFBE 4IFDA 4JI7E 1IBKE 4DUZE 4KHPE 2J7KA 2IERA 4PRVA 2C38B 1U2RA 2DEJA 2Q2EB 1KTVA 3WU3A 4YY3I 1UDQA 3PYDA 5C0XF 2BA1G 2PNZB 4DPWA 4J3DA 4P7AA 2XEXA 2C37A 4LFCI 4GKJI 3HJCA 4AM3A 3L7ZA 2X7IA 3J80C 1S16A 3QT7A 3QT8A 2Z5EA 4JI0E 3J80Q 4IFDB 4FW4A 1VISA 1J5EI 4BA1B 1UEKA 2HK3A 5A2QC 3T1YI 4LF4I 4OO1B 4PU9A 1R6LA 4FWGA 1ZXNA 2JEAB 2ZM6E 4HYMA 4DPUA 2BM0A 4GKKE 2CVEA 4PRXA 4Z7CA 3PRYA 4X65E 2JE6B 1HK7A 1A6FA 3KRNA 2Z5BA 4HACA 1OYPA 4DV6I 4AQYI 3B4TA 4LF8I 3ZZ0A 2WP8B 4DR7I 4FWDA 3L7ZB 2DEIA 4X66E 2JEAA 2NN6D 2UXDE 4MU3A 4DR2I 5LL6R 5IWAE 1FKAE 4USKA 5LMNI 4MDTA 4I3HA 1OJ4A 4FW9A 4JI1E 3T1HE 2BA1D 1XNQE 2LJPA 1IBMI 1N32I 1PVGA 3ZKDA 4DV6E 1KKHA 4JI8I 5K36F 1IBLI 4P52A 2UU9I 4MYTA 1FWKA 4DV7I 4FWHA 4B3ME 4JV5I 1XXEA 4URLA 2EFGA 5DRQA 2UUBI 1XMOI 3CDIA 4DR5E 4OO1C 3QT6A 1H72C 5DROA 1ZM3A 4R1FA 4LFBI 2BV3A 4JI2I 3OTOE 1N34E 2UXCI 4DR1E 4OO1D 3Q6MA 1HNZE 5JEAB 1N36E 4B3SE 4LF8E 3WU4A 4X62E 4DV5I 1FJGE 4OX9E 1KVKA 4JI4I 4DR4I 3Q6NA 4LFAE 2Z5CA 3PYEA 4IZJA 1RREA 2WW4A 5BR8E 4DV4I 4NXMI 5IT9C 2VQEI 4JI3I 4NXNI 2CZ9A 3T1YE 1N32E 4IS9A 3JAMC 4IZKA 5ELWA 3B8HA 4OO1A 1I94I 2HHHI 1YHCA 1MG7A 1EA6A 1HR0E 1Z0TA 4JI5E 2BR2A 1R6MA 4DR7E 4UT4A 3H1CA 3LTOA 1EI1A 4X64I 4IZJD 1Z5BA 2UUCE 2F1DA 2F4VE 3K17A 2UUAE 4DR2E 4DV3E 2E5LI 5JEAE 4DV1I 2PO2A 4DV5E 5K36D 3LNUA 4JI1I 2CG9A 4ZVIA 4GKKI 4LCFA 4JYAE 4HXZA 4OO1F 1Z0VA 3P06A 1Z0CA 1HNWE 4DUYI 5EKWA 2V34A 4ISAA 4DR6I 5K36C 2J65A 2BA0D 2V2ZA 5FWKA 4YY3E 2JT2A 2UUBE 2UXBE 2O1UA 1USUA 2PO1B 1H7SA 4DPXA 4BA1A 1N34I 2UXCE 4LF5E 4DR6E 2X36A 4DU7A 4DV0E 1ZM4A 1Z5AA 4Z7YA 4OKGA 1Z5CA 4JI4E 1KIJA 2AE8A 1IBLE 2UU9E 2E1RA 3GCMA 1FJGI 3WU6A 3UHMA 4LOMA 3J81Q 2R42A 1Z0EA 3P3EA 1XMOE 2Z5CB 4LF7I 2Z5BB 1YH8A 2V2QA 2PNZA 3GONA 4DV4E 1ZXMA 1HNXI 4NXNE 2A2DA 4X65I 3CWVA 1XHKA 3GLLA 4LF5I 1NHJA 4USMA 2PO0A 2JEBA 2NPFA 1XMQI 1UDOA 2VQFI 4X62I 4YHHE 4BA2B 4B3TI 5K36E 2HK2A 4DU8A 1PIEA 5DRPA 2HKJA 4JI6I 4JI5I 1ZM2A 4JI7I 2ZITA 2PNLA 1PKPA 4IFDF 3K1JA 5BR8I 5C0XC 2NN6B 4NXME 2F4VI 2PO0B 3HKMA 1Y4UA 5FLXQ 3QT5A 2AJ4A 1XMQE 1H7UA 4DV1E 4WUCA 5FLXC 4B3MI 4JV5E 4B3TE 4AIMA 4GKJE 1NZ0A 4NBQA 3M6AA 5JEAF 2A2CA 2GQ0A 3M7NG 3P3GA 4LCHA 1Z0WA 4KHPI 4X66I 1WUUA 3LPSA 2HFSA 5IWAI 1J5EE 1N0UA 4U3BA 5A2QQ 2UXBI 5JEAD 4LF6I 3M85D 4FW6A 3P76A 1IBME 1N33I 1E3HA 3J7AG 4DPTA 4K0KI 5K36B 4N3OA 4LFCE 3K85A 4JI8E 3D4JA 3PS1A 4WUDA 1B63A 5JEAC 4MQYA 4FW3A 4MU4A 4AIDA 3J81C 4DR5I 2IOPA 1Y5YA 3ZZUA 1NHIA 2NN6E 4LF6E 5C0XE 3DD6A 4LF4E 2BR2B 2NN6F 4BA2A 1FNMA 1N33E 4IFDC 5DRRA 2O1WA 5K36A 1Z0BA 2HKEA 5L3JA 2JE6A 3T1HI 2VESA 1FWLA 5GMEA 2V2VA 1Y4SA 1P42A 1RHYA 1OYRA 3P3CA 2UUCI 5LMUI 4IFDD 4HACB 5GMDA
chains in the Genus database with same CATH topology
3PYFA 2E5LE 3WU5A 2CGEA 2ZBKB 4LF9I 5IT9Q 4JI2E 1XNRI 1ELOA 1XNQI 1HNZI 4DR3I 2O1VA 4WUBA 1Y6ZA 2GS8A 4B3RI 2HHHE 3PYGA 1IBKI 2O1TA 2OI2A 1XNRE 2VQEE 3JAMQ 4JI3E 4EMDA 1Z59A 4FN5A 3OTOI 3ZKBA 2UXDI 1D6TA 4DR1I 2R3VA 4HY1A 1HR0I 4OX9I 1DARA 4RPFA 4K0KE 1USVA 4LF7E 1RR9A 4DUZI 3ZM7A 4DV7E 3J7AM 4IZKB 1MU5A 4B3RE 4DPYA 1BKNA 4DV2E 4DXLA 4DUYE 3B78A 1H73A 4DV0I 4AQYE 1N36I 4JI0I 3H4LA 2HFUA 4KQVA 4MYUA 3HULA 4LFAI 4LF9E 2UUAI 1HNXE 1MX0A 1N0VC 4DV2I 2PNMA 1Z0GA 4DR3E 4UTGA 1QZRA 1HNWI 3B82A 4JG4A 1NHHA 4ED4A 2V8PA 1I94E 3Q1QA 2IOQA 3F0NA 5LMUE 4M1KA 3V5RA 1S4EA 3ZZTA 5LMNE 1H74A 1ZM9A 2VF3A 4IZJB 4XTJA 4X64E 1FI4A 4B3SI 1K47A 4DV3I 2ZM6I 4DR4E 2VQFE 1B62A 4YHHI 2BM1A 3V2UC 4JYAI 4JI6E 4LFBE 4JI7E 1IBKE 4DUZE 4KHPE 2J7KA 4PRVA 1U2RA 2DEJA 2Q2EB 1KTVA 3WU3A 4YY3I 3PYDA 4DPWA 4P7AA 2XEXA 4LFCI 4GKJI 3HJCA 2X7IA 3J80C 1S16A 3QT7A 3QT8A 2Z5EA 4JI0E 3J80Q 1VISA 1J5EI 1UEKA 2HK3A 5A2QC 3T1YI 4LF4I 4PU9A 4FWGA 1ZXNA 2ZM6E 4HYMA 4DPUA 2BM0A 4GKKE 4PRXA 4Z7CA 3PRYA 4X65E 1HK7A 1A6FA 2Z5BA 4HACA 4DV6I 4AQYI 4LF8I 3ZZ0A 4DR7I 4FWDA 2DEIA 4X66E 2UXDE 4DR2I 5LL6R 5IWAE 1FKAE 4USKA 5LMNI 4I3HA 1OJ4A 4FW9A 4JI1E 3T1HE 1XNQE 2LJPA 1IBMI 1N32I 1PVGA 3ZKDA 4DV6E 1KKHA 4JI8I 2UU9I 4P52A 1IBLI 4MYTA 1FWKA 4DV7I 4FWHA 4B3ME 4JV5I 4URLA 2EFGA 2UUBI 1XMOI 4DR5E 3QT6A 1H72C 1ZM3A 4R1FA 4LFBI 2BV3A 4JI2I 3OTOE 1N34E 2UXCI 4DR1E 3Q6MA 1HNZE 1N36E 4B3SE 4LF8E 3WU4A 4X62E 4DV5I 1FJGE 4OX9E 1KVKA 4JI4I 4DR4I 3Q6NA 4LFAE 2Z5CA 3PYEA 4IZJA 1RREA 2WW4A 5BR8E 4DV4I 4NXMI 5IT9C 2VQEI 4JI3I 4NXNI 2CZ9A 3T1YE 1N32E 3JAMC 4IZKA 3B8HA 1I94I 2HHHI 1MG7A 1EA6A 1HR0E 1Z0TA 4JI5E 4DR7E 4UT4A 3LTOA 1EI1A 4X64I 4IZJD 1Z5BA 2UUCE 2F4VE 3K17A 2UUAE 4DR2E 4DV3E 2E5LI 4DV1I 4DV5E 3LNUA 4JI1I 2CG9A 4ZVIA 4GKKI 4JYAE 4HXZA 1Z0VA 3P06A 1Z0CA 1HNWE 4DUYI 2V34A 4DR6I 2V2ZA 5FWKA 4YY3E 2UUBE 2UXBE 2O1UA 1USUA 1H7SA 4DPXA 1N34I 2UXCE 4LF5E 4DR6E 2X36A 4DU7A 4DV0E 1ZM4A 1Z5AA 4Z7YA 1Z5CA 4JI4E 1KIJA 1IBLE 2UU9E 2E1RA 1FJGI 3WU6A 3J81Q 2R42A 1Z0EA 1XMOE 2Z5CB 4LF7I 2Z5BB 2V2QA 3GONA 4DV4E 1ZXMA 1HNXI 4NXNE 2A2DA 4X65I 3CWVA 1XHKA 4LF5I 1NHJA 4USMA 2NPFA 1XMQI 2VQFI 4X62I 4YHHE 4B3TI 2HK2A 4DU8A 1PIEA 2HKJA 4JI6I 4JI5I 1ZM2A 4JI7I 2ZITA 2PNLA 1PKPA 5BR8I 3K1JA 4NXME 2F4VI 1Y4UA 5FLXQ 3QT5A 2AJ4A 1XMQE 1H7UA 4DV1E 4WUCA 5FLXC 4B3MI 4JV5E 4B3TE 4GKJE 1NZ0A 3M6AA 2A2CA 2GQ0A 1Z0WA 4KHPI 4X66I 1WUUA 3LPSA 2HFSA 5IWAI 1J5EE 1N0UA 5A2QQ 2UXBI 4LF6I 1IBME 1N33I 3J7AG 4DPTA 4K0KI 4N3OA 4LFCE 3K85A 4JI8E 3D4JA 4WUDA 1B63A 3J81C 4DR5I 2IOPA 3ZZUA 1NHIA 4LF6E 4LF4E 1FNMA 1N33E 2O1WA 1Z0BA 2HKEA 5L3JA 3T1HI 1FWLA 5GMEA 2V2VA 1Y4SA 2UUCI 5LMUI 4HACB 5GMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYF A;  2E5L E;  3WU5 A;  2ZBK B;  4LF9 I;  5IT9 Q;  4JI2 E;  1XNR I;  1ELO A;  1XNQ I;  1HNZ I;  4DR3 I;  4WUB A;  2GS8 A;  4B3R I;  2HHH E;  3PYG A;  1IBK I;  2OI2 A;  1XNR E;  2VQE E;  3JAM Q;  4JI3 E;  4EMD A;  1Z59 A;  4FN5 A;  3OTO I;  3ZKB A;  2UXD I;  1D6T A;  4DR1 I;  2R3V A;  4HY1 A;  1HR0 I;  4OX9 I;  1DAR A;  4RPF A;  4K0K E;  4LF7 E;  1RR9 A;  4DUZ I;  3ZM7 A;  4DV7 E;  3J7A M;  1MU5 A;  4B3R E;  4DPY A;  1BKN A;  4DV2 E;  4DXL A;  4DUY E;  3B78 A;  1H73 A;  4DV0 I;  4AQY E;  1N36 I;  4JI0 I;  3H4L A;  2HFU A;  4KQV A;  4MYU A;  3HUL A;  4LFA I;  4LF9 E;  2UUA I;  1HNX E;  1MX0 A;  1N0V C;  4DV2 I;  1Z0G A;  4DR3 E;  4UTG A;  1QZR A;  1HNW I;  3B82 A;  4JG4 A;  1NHH A;  4ED4 A;  2V8P A;  1I94 E;  3Q1Q A;  3F0N A;  5LMU E;  4M1K A;  3V5R A;  1S4E A;  3ZZT A;  5LMN E;  1H74 A;  1ZM9 A;  2VF3 A;  4XTJ A;  4X64 E;  1FI4 A;  4B3S I;  1K47 A;  4DV3 I;  2ZM6 I;  4DR4 E;  2VQF E;  1B62 A;  4YHH I;  2BM1 A;  3V2U C;  4JYA I;  4JI6 E;  4LFB E;  4JI7 E;  1IBK E;  4DUZ E;  4KHP E;  2J7K A;  4PRV A;  1U2R A;  2DEJ A;  2Q2E B;  1KTV A;  3WU3 A;  4YY3 I;  3PYD A;  4DPW A;  4P7A A;  2XEX A;  4LFC I;  4GKJ I;  2X7I A;  3J80 C;  1S16 A;  3QT7 A;  3QT8 A;  4JI0 E;  3J80 Q;  1VIS A;  1J5E I;  1UEK A;  2HK3 A;  5A2Q C;  3T1Y I;  4LF4 I;  4PU9 A;  4FWG A;  1ZXN A;  2ZM6 E;  4HYM A;  4DPU A;  2BM0 A;  4GKK E;  4PRX A;  4Z7C A;  4X65 E;  1A6F A;  4HAC A;  4DV6 I;  4AQY I;  4LF8 I;  3ZZ0 A;  4DR7 I;  4FWD A;  2DEI A;  4X66 E;  2UXD E;  4DR2 I;  5LL6 R;  5IWA E;  1FKA E;  4USK A;  5LMN I;  4I3H A;  1OJ4 A;  4FW9 A;  4JI1 E;  3T1H E;  1XNQ E;  2LJP A;  1IBM I;  1N32 I;  1PVG A;  3ZKD A;  4DV6 E;  1KKH A;  4JI8 I;  2UU9 I;  4P52 A;  1IBL I;  4MYT A;  1FWK A;  4DV7 I;  4FWH A;  4B3M E;  4JV5 I;  4URL A;  2EFG A;  2UUB I;  1XMO I;  4DR5 E;  3QT6 A;  1H72 C;  1ZM3 A;  4R1F A;  4LFB I;  2BV3 A;  4JI2 I;  3OTO E;  1N34 E;  2UXC I;  4DR1 E;  1HNZ E;  1N36 E;  4B3S E;  4LF8 E;  3WU4 A;  4X62 E;  4DV5 I;  1FJG E;  4OX9 E;  1KVK A;  4JI4 I;  4DR4 I;  4LFA E;  3PYE A;  1RRE A;  2WW4 A;  5BR8 E;  4DV4 I;  4NXM I;  5IT9 C;  4JI3 I;  2VQE I;  4NXN I;  2CZ9 A;  3T1Y E;  1N32 E;  3JAM C;  3B8H A;  1I94 I;  2HHH I;  1MG7 A;  1EA6 A;  1HR0 E;  1Z0T A;  4JI5 E;  4DR7 E;  4UT4 A;  3LTO A;  1EI1 A;  4X64 I;  2UUC E;  1Z5B A;  2F4V E;  3K17 A;  2UUA E;  4DR2 E;  4DV3 E;  2E5L I;  4DV1 I;  4DV5 E;  3LNU A;  4JI1 I;  4ZVI A;  4GKK I;  4JYA E;  4HXZ A;  1Z0V A;  1Z0C A;  1HNW E;  4DUY I;  2V34 A;  4DR6 I;  2V2Z A;  4YY3 E;  2UUB E;  2UXB E;  1H7S A;  4DPX A;  1N34 I;  2UXC E;  4LF5 E;  4DR6 E;  2X36 A;  4DV0 E;  4DU7 A;  1ZM4 A;  1Z5A A;  4Z7Y A;  1Z5C A;  4JI4 E;  1KIJ A;  1IBL E;  2UU9 E;  2E1R A;  1FJG I;  3WU6 A;  3J81 Q;  2R42 A;  1Z0E A;  1XMO E;  4LF7 I;  2V2Q A;  3GON A;  4DV4 E;  1ZXM A;  1HNX I;  4NXN E;  2A2D A;  4X65 I;  3CWV A;  1XHK A;  4LF5 I;  1NHJ A;  4USM A;  2NPF A;  1XMQ I;  2VQF I;  4X62 I;  4YHH E;  4B3T I;  2HK2 A;  4DU8 A;  1PIE A;  2HKJ A;  4JI6 I;  4JI5 I;  1ZM2 A;  4JI7 I;  2ZIT A;  1PKP A;  5BR8 I;  3K1J A;  4NXM E;  2F4V I;  5FLX Q;  3QT5 A;  2AJ4 A;  1XMQ E;  1H7U A;  4DV1 E;  4WUC A;  5FLX C;  4B3M I;  4JV5 E;  4B3T E;  4GKJ E;  1NZ0 A;  3M6A A;  2A2C A;  1Z0W A;  4KHP I;  4X66 I;  1WUU A;  3LPS A;  2HFS A;  5IWA I;  1J5E E;  1N0U A;  5A2Q Q;  2UXB I;  4LF6 I;  1IBM E;  1N33 I;  3J7A G;  4DPT A;  4K0K I;  4LFC E;  4JI8 E;  3D4J A;  4WUD A;  1B63 A;  3J81 C;  4DR5 I;  3ZZU A;  1NHI A;  4LF6 E;  4LF4 E;  1FNM A;  1N33 E;  1Z0B A;  2HKE A;  5L3J A;  3T1H I;  1FWL A;  5GME A;  2V2V A;  2UUC I;  5LMU I;  4HAC B;  5GMD A; 
#chains in the Genus database with same CATH topology
 3PYF A;  2E5L E;  3WU5 A;  3M85 G;  2CGE A;  2ZBK B;  4LF9 I;  5IT9 Q;  4JI2 E;  2PO1 A;  2C38 A;  3U1Y A;  1XNR I;  1Y60 A;  1ELO A;  1XNQ I;  1HNZ I;  2BA0 G;  4GQU A;  4DR3 I;  3NZK A;  2O1V A;  4WUB A;  1Y6Z A;  2GS8 A;  4B3R I;  2O3Z A;  2HHH E;  4QNJ A;  3GME A;  1E3P A;  5C0X D;  3PS3 A;  3PYG A;  3U1K A;  1IBK I;  2O1T A;  5C0X B;  2C37 B;  2WNR A;  2OI2 A;  1XNR E;  2VQE E;  3JAM Q;  4JI3 E;  4EMD A;  1Z59 A;  4FN5 A;  3OTO I;  3ZKB A;  2UXD I;  1D6T A;  4DR1 I;  2R3V A;  1OYS A;  4HY1 A;  1HR0 I;  4OX9 I;  1DAR A;  4RPF A;  4K0K E;  1USV A;  4LF7 E;  1RR9 A;  4DUZ I;  5JEA A;  5DNL A;  3ZM7 A;  4DV7 E;  1UDN A;  3J7A M;  4IZK B;  1MU5 A;  5DNX A;  4B3R E;  4LCG A;  4DPY A;  1BKN A;  4DV2 E;  4DXL A;  4DUY E;  3B78 A;  1H73 A;  4DV0 I;  4AQY E;  4LPF A;  3CDJ A;  1N36 I;  4MU1 A;  4JI0 I;  4FW7 A;  3H4L A;  2HFU A;  4KQV A;  4MYU A;  2PO2 B;  3HUL A;  4U3D A;  4LFA I;  2C39 B;  2GO4 A;  4LF9 E;  2UUA I;  1HNX E;  1MX0 A;  1N0V C;  4DV2 I;  2PNM A;  1Z0G A;  4DR3 E;  4MU0 A;  3M7N D;  2GO3 A;  2NN6 C;  4UTG A;  1QZR A;  4OZE A;  1HNW I;  3B82 A;  4JG4 A;  1NHH A;  4ED4 A;  2V8P A;  2JEB B;  1I94 E;  2WNR B;  3Q1Q A;  2IOQ A;  3F0N A;  5LMU E;  4M1K A;  1UDS A;  3V5R A;  1S4E A;  3ZZT A;  4QNK A;  5LMN E;  2WP8 A;  1H74 A;  1ZM9 A;  1VI7 A;  2C39 A;  4IFD E;  5C0X A;  2VF3 A;  4IZJ B;  4XTJ A;  4X64 E;  2NN6 A;  4OO1 E;  1FI4 A;  4B3S I;  1K47 A;  3PS2 A;  4DV3 I;  2ZM6 I;  4DR4 E;  2IES A;  5EL9 A;  2VQF E;  1B62 A;  4YHH I;  2BM1 A;  3V2U C;  4JYA I;  4FW5 A;  4JI6 E;  4LFB E;  4IFD A;  4JI7 E;  1IBK E;  4DUZ E;  4KHP E;  2J7K A;  2IER A;  4PRV A;  2C38 B;  1U2R A;  2DEJ A;  2Q2E B;  1KTV A;  3WU3 A;  4YY3 I;  1UDQ A;  3PYD A;  5C0X F;  2BA1 G;  2PNZ B;  4DPW A;  4J3D A;  4P7A A;  2XEX A;  2C37 A;  4LFC I;  4GKJ I;  3HJC A;  4AM3 A;  3L7Z A;  2X7I A;  3J80 C;  1S16 A;  3QT7 A;  3QT8 A;  2Z5E A;  4JI0 E;  3J80 Q;  4IFD B;  4FW4 A;  1VIS A;  1J5E I;  4BA1 B;  1UEK A;  2HK3 A;  5A2Q C;  3T1Y I;  4LF4 I;  4OO1 B;  4PU9 A;  1R6L A;  4FWG A;  1ZXN A;  2JEA B;  2ZM6 E;  4HYM A;  4DPU A;  2BM0 A;  4GKK E;  2CVE A;  4PRX A;  4Z7C A;  3PRY A;  4X65 E;  2JE6 B;  1HK7 A;  1A6F A;  3KRN A;  2Z5B A;  4HAC A;  1OYP A;  4DV6 I;  4AQY I;  3B4T A;  4LF8 I;  3ZZ0 A;  2WP8 B;  4DR7 I;  4FWD A;  3L7Z B;  2DEI A;  4X66 E;  2JEA A;  2NN6 D;  2UXD E;  4MU3 A;  4DR2 I;  5LL6 R;  5IWA E;  1FKA E;  4USK A;  5LMN I;  4MDT A;  4I3H A;  1OJ4 A;  4FW9 A;  4JI1 E;  3T1H E;  2BA1 D;  1XNQ E;  2LJP A;  1IBM I;  1N32 I;  1PVG A;  3ZKD A;  4DV6 E;  1KKH A;  4JI8 I;  5K36 F;  1IBL I;  4P52 A;  2UU9 I;  4MYT A;  1FWK A;  4DV7 I;  4FWH A;  4B3M E;  4JV5 I;  1XXE A;  4URL A;  2EFG A;  5DRQ A;  2UUB I;  1XMO I;  3CDI A;  4DR5 E;  4OO1 C;  3QT6 A;  1H72 C;  5DRO A;  1ZM3 A;  4R1F A;  4LFB I;  2BV3 A;  4JI2 I;  3OTO E;  1N34 E;  2UXC I;  4DR1 E;  4OO1 D;  3Q6M A;  1HNZ E;  5JEA B;  1N36 E;  4B3S E;  4LF8 E;  3WU4 A;  4X62 E;  4DV5 I;  1FJG E;  4OX9 E;  1KVK A;  4JI4 I;  4DR4 I;  3Q6N A;  4LFA E;  2Z5C A;  3PYE A;  4IZJ A;  1RRE A;  2WW4 A;  5BR8 E;  4DV4 I;  4NXM I;  5IT9 C;  2VQE I;  4JI3 I;  4NXN I;  2CZ9 A;  3T1Y E;  1N32 E;  4IS9 A;  3JAM C;  4IZK A;  5ELW A;  3B8H A;  4OO1 A;  1I94 I;  2HHH I;  1YHC A;  1MG7 A;  1EA6 A;  1HR0 E;  1Z0T A;  4JI5 E;  2BR2 A;  1R6M A;  4DR7 E;  4UT4 A;  3H1C A;  3LTO A;  1EI1 A;  4X64 I;  4IZJ D;  1Z5B A;  2UUC E;  2F1D A;  2F4V E;  3K17 A;  2UUA E;  4DR2 E;  4DV3 E;  2E5L I;  5JEA E;  4DV1 I;  2PO2 A;  4DV5 E;  5K36 D;  3LNU A;  4JI1 I;  2CG9 A;  4ZVI A;  4GKK I;  4LCF A;  4JYA E;  4HXZ A;  4OO1 F;  1Z0V A;  3P06 A;  1Z0C A;  1HNW E;  4DUY I;  5EKW A;  2V34 A;  4ISA A;  4DR6 I;  5K36 C;  2J65 A;  2BA0 D;  2V2Z A;  5FWK A;  4YY3 E;  2JT2 A;  2UUB E;  2UXB E;  2O1U A;  1USU A;  2PO1 B;  1H7S A;  4DPX A;  4BA1 A;  1N34 I;  2UXC E;  4LF5 E;  4DR6 E;  2X36 A;  4DU7 A;  4DV0 E;  1ZM4 A;  1Z5A A;  4Z7Y A;  4OKG A;  1Z5C A;  4JI4 E;  1KIJ A;  2AE8 A;  1IBL E;  2UU9 E;  2E1R A;  3GCM A;  1FJG I;  3WU6 A;  3UHM A;  4LOM A;  3J81 Q;  2R42 A;  1Z0E A;  3P3E A;  1XMO E;  2Z5C B;  4LF7 I;  2Z5B B;  1YH8 A;  2V2Q A;  2PNZ A;  3GON A;  4DV4 E;  1ZXM A;  1HNX I;  4NXN E;  2A2D A;  4X65 I;  3CWV A;  1XHK A;  3GLL A;  4LF5 I;  1NHJ A;  4USM A;  2PO0 A;  2JEB A;  2NPF A;  1XMQ I;  1UDO A;  2VQF I;  4X62 I;  4YHH E;  4BA2 B;  4B3T I;  5K36 E;  2HK2 A;  4DU8 A;  1PIE A;  5DRP A;  2HKJ A;  4JI6 I;  4JI5 I;  1ZM2 A;  4JI7 I;  2ZIT A;  2PNL A;  1PKP A;  4IFD F;  3K1J A;  5BR8 I;  5C0X C;  2NN6 B;  4NXM E;  2F4V I;  2PO0 B;  3HKM A;  1Y4U A;  5FLX Q;  3QT5 A;  2AJ4 A;  1XMQ E;  1H7U A;  4DV1 E;  4WUC A;  5FLX C;  4B3M I;  4JV5 E;  4B3T E;  4AIM A;  4GKJ E;  1NZ0 A;  4NBQ A;  3M6A A;  5JEA F;  2A2C A;  2GQ0 A;  3M7N G;  3P3G A;  4LCH A;  1Z0W A;  4KHP I;  4X66 I;  1WUU A;  3LPS A;  2HFS A;  5IWA I;  1J5E E;  1N0U A;  4U3B A;  5A2Q Q;  2UXB I;  5JEA D;  4LF6 I;  3M85 D;  4FW6 A;  3P76 A;  1IBM E;  1N33 I;  1E3H A;  3J7A G;  4DPT A;  4K0K I;  5K36 B;  4N3O A;  4LFC E;  3K85 A;  4JI8 E;  3D4J A;  3PS1 A;  4WUD A;  1B63 A;  5JEA C;  4MQY A;  4FW3 A;  4MU4 A;  4AID A;  3J81 C;  4DR5 I;  2IOP A;  1Y5Y A;  3ZZU A;  1NHI A;  2NN6 E;  4LF6 E;  5C0X E;  3DD6 A;  4LF4 E;  2BR2 B;  2NN6 F;  4BA2 A;  1FNM A;  1N33 E;  4IFD C;  5DRR A;  2O1W A;  5K36 A;  1Z0B A;  2HKE A;  5L3J A;  2JE6 A;  3T1H I;  2VES A;  1FWL A;  5GME A;  2V2V A;  1Y4S A;  1P42 A;  1RHY A;  1OYR A;  3P3C A;  2UUC I;  5LMU I;  4IFD D;  4HAC B;  5GMD A; 
#chains in the Genus database with same CATH homology
 3PYF A;  2E5L E;  3WU5 A;  2CGE A;  2ZBK B;  4LF9 I;  5IT9 Q;  4JI2 E;  1XNR I;  1ELO A;  1XNQ I;  1HNZ I;  4DR3 I;  2O1V A;  4WUB A;  1Y6Z A;  2GS8 A;  4B3R I;  2HHH E;  3PYG A;  1IBK I;  2O1T A;  2OI2 A;  1XNR E;  2VQE E;  3JAM Q;  4JI3 E;  4EMD A;  1Z59 A;  4FN5 A;  3OTO I;  3ZKB A;  2UXD I;  1D6T A;  4DR1 I;  2R3V A;  4HY1 A;  1HR0 I;  4OX9 I;  1DAR A;  4RPF A;  4K0K E;  1USV A;  4LF7 E;  1RR9 A;  4DUZ I;  3ZM7 A;  4DV7 E;  3J7A M;  4IZK B;  1MU5 A;  4B3R E;  4DPY A;  1BKN A;  4DV2 E;  4DXL A;  4DUY E;  3B78 A;  1H73 A;  4DV0 I;  4AQY E;  1N36 I;  4JI0 I;  3H4L A;  2HFU A;  4KQV A;  4MYU A;  3HUL A;  4LFA I;  4LF9 E;  2UUA I;  1HNX E;  1MX0 A;  1N0V C;  4DV2 I;  2PNM A;  1Z0G A;  4DR3 E;  4UTG A;  1QZR A;  1HNW I;  3B82 A;  4JG4 A;  1NHH A;  4ED4 A;  2V8P A;  1I94 E;  3Q1Q A;  2IOQ A;  3F0N A;  5LMU E;  4M1K A;  3V5R A;  1S4E A;  3ZZT A;  5LMN E;  1H74 A;  1ZM9 A;  2VF3 A;  4IZJ B;  4XTJ A;  4X64 E;  1FI4 A;  4B3S I;  1K47 A;  4DV3 I;  2ZM6 I;  4DR4 E;  2VQF E;  1B62 A;  4YHH I;  2BM1 A;  3V2U C;  4JYA I;  4JI6 E;  4LFB E;  4JI7 E;  1IBK E;  4DUZ E;  4KHP E;  2J7K A;  4PRV A;  1U2R A;  2DEJ A;  2Q2E B;  1KTV A;  3WU3 A;  4YY3 I;  3PYD A;  4DPW A;  4P7A A;  2XEX A;  4LFC I;  4GKJ I;  3HJC A;  2X7I A;  3J80 C;  1S16 A;  3QT7 A;  3QT8 A;  2Z5E A;  4JI0 E;  3J80 Q;  1VIS A;  1J5E I;  1UEK A;  2HK3 A;  5A2Q C;  3T1Y I;  4LF4 I;  4PU9 A;  4FWG A;  1ZXN A;  2ZM6 E;  4HYM A;  4DPU A;  2BM0 A;  4GKK E;  4PRX A;  4Z7C A;  3PRY A;  4X65 E;  1HK7 A;  1A6F A;  2Z5B A;  4HAC A;  4DV6 I;  4AQY I;  4LF8 I;  3ZZ0 A;  4DR7 I;  4FWD A;  2DEI A;  4X66 E;  2UXD E;  4DR2 I;  5LL6 R;  5IWA E;  1FKA E;  4USK A;  5LMN I;  4I3H A;  1OJ4 A;  4FW9 A;  4JI1 E;  3T1H E;  1XNQ E;  2LJP A;  1IBM I;  1N32 I;  1PVG A;  3ZKD A;  4DV6 E;  1KKH A;  4JI8 I;  2UU9 I;  4P52 A;  1IBL I;  4MYT A;  1FWK A;  4DV7 I;  4FWH A;  4B3M E;  4JV5 I;  4URL A;  2EFG A;  2UUB I;  1XMO I;  4DR5 E;  3QT6 A;  1H72 C;  1ZM3 A;  4R1F A;  4LFB I;  2BV3 A;  4JI2 I;  3OTO E;  1N34 E;  2UXC I;  4DR1 E;  3Q6M A;  1HNZ E;  1N36 E;  4B3S E;  4LF8 E;  3WU4 A;  4X62 E;  4DV5 I;  1FJG E;  4OX9 E;  1KVK A;  4JI4 I;  4DR4 I;  3Q6N A;  4LFA E;  2Z5C A;  3PYE A;  4IZJ A;  1RRE A;  2WW4 A;  5BR8 E;  4DV4 I;  4NXM I;  5IT9 C;  2VQE I;  4JI3 I;  4NXN I;  2CZ9 A;  3T1Y E;  1N32 E;  3JAM C;  4IZK A;  3B8H A;  1I94 I;  2HHH I;  1MG7 A;  1EA6 A;  1HR0 E;  1Z0T A;  4JI5 E;  4DR7 E;  4UT4 A;  3LTO A;  1EI1 A;  4X64 I;  4IZJ D;  1Z5B A;  2UUC E;  2F4V E;  3K17 A;  2UUA E;  4DR2 E;  4DV3 E;  2E5L I;  4DV1 I;  4DV5 E;  3LNU A;  4JI1 I;  2CG9 A;  4ZVI A;  4GKK I;  4JYA E;  4HXZ A;  1Z0V A;  3P06 A;  1Z0C A;  1HNW E;  4DUY I;  2V34 A;  4DR6 I;  2V2Z A;  5FWK A;  4YY3 E;  2UUB E;  2UXB E;  2O1U A;  1USU A;  1H7S A;  4DPX A;  1N34 I;  2UXC E;  4LF5 E;  4DR6 E;  2X36 A;  4DU7 A;  4DV0 E;  1ZM4 A;  1Z5A A;  4Z7Y A;  1Z5C A;  4JI4 E;  1KIJ A;  1IBL E;  2UU9 E;  2E1R A;  1FJG I;  3WU6 A;  3J81 Q;  2R42 A;  1Z0E A;  1XMO E;  2Z5C B;  4LF7 I;  2Z5B B;  2V2Q A;  3GON A;  4DV4 E;  1ZXM A;  1HNX I;  4NXN E;  2A2D A;  4X65 I;  3CWV A;  1XHK A;  4LF5 I;  1NHJ A;  4USM A;  2NPF A;  1XMQ I;  2VQF I;  4X62 I;  4YHH E;  4B3T I;  2HK2 A;  4DU8 A;  1PIE A;  2HKJ A;  4JI6 I;  4JI5 I;  1ZM2 A;  4JI7 I;  2ZIT A;  2PNL A;  1PKP A;  5BR8 I;  3K1J A;  4NXM E;  2F4V I;  1Y4U A;  5FLX Q;  3QT5 A;  2AJ4 A;  1XMQ E;  1H7U A;  4DV1 E;  4WUC A;  5FLX C;  4B3M I;  4JV5 E;  4B3T E;  4GKJ E;  1NZ0 A;  3M6A A;  2A2C A;  2GQ0 A;  1Z0W A;  4KHP I;  4X66 I;  1WUU A;  3LPS A;  2HFS A;  5IWA I;  1J5E E;  1N0U A;  5A2Q Q;  2UXB I;  4LF6 I;  1IBM E;  1N33 I;  3J7A G;  4DPT A;  4K0K I;  4N3O A;  4LFC E;  3K85 A;  4JI8 E;  3D4J A;  4WUD A;  1B63 A;  3J81 C;  4DR5 I;  2IOP A;  3ZZU A;  1NHI A;  4LF6 E;  4LF4 E;  1FNM A;  1N33 E;  2O1W A;  1Z0B A;  2HKE A;  5L3J A;  3T1H I;  1FWL A;  5GME A;  2V2V A;  1Y4S A;  2UUC I;  5LMU I;  4HAC B;  5GMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...