2HHHI

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2hhhI00
4JI2E 1MU5A 1XNRE 4X65I 1Z0VA 4HACA 2UXCE 1KTVA 2V34A 2A2DA 3V5RA 4B3ME 3T1HI 1NHJA 4DUZI 1ZM3A 4JI2I 4X65E 4JV5E 5IWAI 1XMQE 2HK3A 4LFBE 4DR1I 4X64I 3LNUA 3D4JA 4ZVIA 3ZKDA 4LF7E 2LJPA 2UXCI 4FN5A 1XMOE 1IBLE 4DV7I 2GS8A 4DV3I 1B62A 2NPFA 4OX9E 1UEKA 1MX0A 1S16A 2UUBE 5L3JA 4DV1E 4LF9E 4DPWA 1BKNA 1K47A 1HNXE 4NXMI 4RPFA 1Z0CA 2A2CA 1S4EA 4LFCE 2ZM6I 1N36I 4DV2I 4LF8E 4DV1I 4LF9I 2HFSA 1H73A 2UUBI 1Z0WA 5IT9C 2UU9I 2VQFE 4DV2E 1H74A 2DEIA 2UXDE 2WW4A 1HR0E 1FWLA 4DU7A 5A2QQ 4DR4E 2V2VA 3WU6A 4OX9I 4P52A 1XMOI 4JI5E 3QT6A 4JI3I 2XEXA 1H7UA 2E5LE 5LMUE 3QT7A 1Z0TA 4DR6I 1ELOA 3T1HE 4JI6I 4KHPE 2HHHI 4DPYA 4JV5I 1ZM9A 3QT8A 4UT4A 4YY3E 4FW9A 4GKKI 4JI4I 2Q2EB 1XMQI 4XTJA 4LFAE 4DUYE 5BR8E 1DARA 1VISA 1ZM2A 1A6FA 2HHHE 4LF6I 2CZ9A 2V2ZA 1Z0EA 4WUBA 1PIEA 2BV3A 1XNQE 4GKKE 3T1YE 4DV5I 1FNMA 4HYMA 4Z7YA 3HULA 4B3TI 3K17A 2X36A 2UU9E 4LF8I 1NHIA 3J80C 4PRVA 4LFCI 3H4LA 2BM0A 1XHKA 1N33E 1N0VC 3OTOI 1H7SA 2HKJA 3J7AM 3J81C 4DV6I 2UXBI 3PYGA 5IWAE 1I94E 3ZM7A 4B3SI 1Z5BA 4DXLA 3T1YI 3F0NA 4K0KE 5LMNI 4X62E 4NXME 1Z0BA 3WU5A 2R3VA 1IBLI 4DUYI 4JI1E 4JI8I 4P7AA 4USMA 5BR8I 5FLXC 4MYUA 4LF4E 3JAMQ 4JI7I 4DU8A 4DV4I 4EMDA 3PYDA 4JI4E 2EFGA 4JI5I 1N0UA 4YHHE 4JI0E 4JYAI 4LFBI 4DV4E 2DEJA 4WUCA 4JI7E 2UXBE 1Z5CA 4FWDA 3B8HA 4JI6E 4JI8E 4HXZA 1QZRA 3K1JA 1J5EE 2UUAI 2X7IA 1HNWI 2UXDI 3V2UC 4X62I 3OTOE 1B63A 4X66I 5LMNE 2HK2A 1I94I 1FJGE 4B3SE 4JI1I 2F4VI 2VQEI 4DR2E 3CWVA 5LMUI 4AQYI 4DR7E 4JI3E 4K0KI 3Q1QA 1Z59A 3ZZTA 1N34E 4B3RI 5FLXQ 4GKJE 2ZM6E 2ZBKB 1NHHA 4HACB 4LF5I 4DPUA 2R42A 4GKJI 4DV0E 4LF7I 1FI4A 4URLA 1N33I 1PVGA 1FJGI 4DR7I 3LTOA 1HNXI 4R1FA 1N34I 4DUZE 3J7AG 1EA6A 1XNQI 1D6TA 3JAMC 2BM1A 1RREA 1HNZI 4X64E 1FKAE 4KHPI 2F4VE 4JI0I 3GONA 4UTGA 4DV7E 3J80Q 4JYAE 4LFAI 3PYFA 4LF4I 4DR5I 4JG4A 1FWKA 1NZ0A 4FWHA 1XNRI 1ZXMA 1IBKE 1WUUA 4YHHI 4M1KA 1HNWE 3PYEA 3B82A 2UUAE 3ZKBA 4DR5E 1HNZE 5GMEA 4DPXA 1ZXNA 4KQVA 3J81Q 2E5LI 2J7KA 1KKHA 4FWGA 4MYTA 4Z7CA 1EI1A 2UUCI 1ZM4A 3ZZUA 1IBME 4DR4I 4WUDA 4YY3I 5LL6R 2ZITA 4DPTA 4USKA 4DR3I 4LF5E 4NXNI 1U2RA 4DR6E 1N32I 1H72C 2E1RA 4PRXA 2AJ4A 2UUCE 4HY1A 4X66E 5A2QC 1IBMI 3LPSA 1N36E 4DV0I 3B78A 4PU9A 3WU3A 1HR0I 5GMDA 1KIJA 1PKPA 4DV6E 4DR2I 4AQYE 4NXNE 2V2QA 1OJ4A 4DR3E 2HKEA 1Z5AA 1MG7A 2VQFI 4B3TE 3QT5A 4ED4A 2HFUA 1IBKI 4B3RE 4I3HA 1N32E 2VF3A 4DV3E 2V8PA 2OI2A 1Z0GA 3M6AA 2VQEE 1J5EI 4DV5E 1KVKA 5IT9Q 3WU4A 4B3MI 4LF6E 1RR9A 4DR1E 3ZZ0A
chains in the Genus database with same CATH superfamily
4FW5A 4JI2E 4LCGA 1MU5A 1XNRE 4X65I 1Z0VA 5C0XB 2PO2B 4HACA 2UXCE 1KTVA 2V34A 2A2DA 3V5RA 4B3ME 3T1HI 1NHJA 2NN6C 4DUZI 1ZM3A 4JI2I 3NZKA 2PNZA 4X65E 4JV5E 2WNRA 5IWAI 3M85G 3GMEA 1XMQE 2HK3A 4LFBE 3GCMA 5K36A 4DR1I 4X64I 2JE6A 3LNUA 5JEAD 3D4JA 4ZVIA 3ZKDA 4LF7E 2LJPA 2PO0A 2UXCI 4FN5A 1XMOE 1IBLE 4DV7I 2GS8A 4BA1B 4DV3I 1B62A 2NPFA 4OX9E 2BA1D 1UEKA 1MX0A 1S16A 2UUBE 5L3JA 4DV1E 4LF9E 4DPWA 1BKNA 1HK7A 1K47A 1HNXE 5C0XC 4NXMI 5K36C 4RPFA 1Z0CA 2A2CA 1S4EA 4LFCE 2ZM6I 3L7ZA 1N36I 4LOMA 4DV2I 4LF8E 4DV1I 4LF9I 2HFSA 1H73A 5DRRA 2UUBI 1Z0WA 5IT9C 2UU9I 2F1DA 2VQFE 1Y4SA 3PRYA 4DV2E 1H74A 2DEIA 2NN6A 2UXDE 4OO1A 5C0XD 2WW4A 2Z5CB 1FWLA 1HR0E 4DU7A 5A2QQ 4DR4E 2V2VA 3WU6A 2CGEA 2O1TA 2JEBA 4P52A 1XMOI 4OX9I 4JI5E 4IFDA 3QT6A 4MDTA 2CG9A 1H7UA 2XEXA 4JI3I 2E5LE 1P42A 5LMUE 3QT7A 3P76A 1Z0TA 4DR6I 1ELOA 3T1HE 4JI6I 2GO4A 3HJCA 4KHPE 2HHHI 4DPYA 4JV5I 1ZM9A 2O3ZA 3QT8A 4UT4A 4AIDA 4YY3E 4FW9A 4MU0A 4GKKI 4JI4I 2Q2EB 1XMQI 4XTJA 1UDSA 4LFAE 4IFDF 1UDNA 5EL9A 2IESA 4DUYE 5BR8E 5FWKA 1DARA 3L7ZB 1VISA 1ZM2A 4J3DA 1A6FA 2HHHE 4LF6I 2CZ9A 2V2ZA 1Z0EA 3Q6MA 4WUBA 1PIEA 2PNMA 2BV3A 2Z5BB 3PS2A 1XNQE 4GKKE 3T1YE 5K36D 4DV5I 1FNMA 5JEAA 4HYMA 2O1UA 4Z7YA 2Z5CA 3HULA 4MU1A 4OO1E 4B3TI 4BA2A 3CDJA 2X36A 2Z5BA 3K17A 2UU9E 2C39B 2AE8A 4LF8I 1NHIA 2JE6B 3J80C 4IFDE 4FW3A 3K85A 4PRVA 4LFCI 3H4LA 1OYRA 2WNRB 2BM0A 4U3BA 1R6LA 4LCHA 1XHKA 1N33E 1N0VC 5JEAB 3OTOI 1H7SA 2HKJA 3J7AM 3J81C 4DV6I 4IFDD 2UXBI 3PYGA 3UHMA 5IWAE 1I94E 3ZM7A 3M85D 4B3SI 1Z5BA 4IZKA 4DXLA 3T1YI 2GO3A 5DNLA 4BA2B 3F0NA 4OO1D 4K0KE 5LMNI 4X62E 2VESA 4NXME 3WU5A 1Z0BA 5C0XE 3M7NG 2R3VA 1IBLI 5K36E 5DRQA 2BA1G 4DUYI 1RHYA 4JI1E 4JI8I 4P7AA 2PNZB 4LPFA 4USMA 5BR8I 4OKGA 2NN6B 3PS1A 5FLXC 4FW6A 3M7ND 4MYUA 4LF4E 4MU4A 3JAMQ 4JI7I 4DU8A 4DV4I 4EMDA 3PYDA 4IFDC 4JI4E 2EFGA 4JI5I 2JT2A 1N0UA 4YHHE 4JI0E 2C39A 3U1KA 4JYAI 4LFBI 4DV4E 4OZEA 2DEJA 4WUCA 4JI7E 3CDIA 2UXBE 4OO1F 1Z5CA 4FWDA 3B8HA 4JI6E 4JI8E 4HXZA 3U1YA 5EKWA 1QZRA 3K1JA 1J5EE 5DROA 5DRPA 2UUAI 1OYSA 2X7IA 1HNWI 3P06A 2UXDI 2PNLA 3V2UC 4X62I 3OTOE 5DNXA 1E3HA 1B63A 4X66I 5LMNE 1USUA 4BA1A 2HK2A 4IFDB 3GLLA 1Y6ZA 1I94I 1FJGE 2JEBB 2C37B 4JI1I 4B3SE 1Y5YA 2F4VI 4QNJA 2VQEI 4DR2E 3CWVA 5LMUI 4AQYI 4DR7E 4JI3E 4K0KI 3Q1QA 1Z59A 3ZZTA 1N34E 4OO1B 4B3RI 5FLXQ 1R6MA 4GKJE 2ZM6E 2ZBKB 1NHHA 5JEAC 2PO2A 1YH8A 4HACB 5C0XA 4DPUA 4LF5I 3P3EA 4IS9A 2R42A 4GKJI 4DV0E 4LF7I 4IZJD 1FI4A 4U3DA 4URLA 2GQ0A 2O1VA 1N33I 1PVGA 1FJGI 4NBQA 4DR7I 2PO0B 1Y60A 3LTOA 4AM3A 1Y4UA 4ISAA 5JEAE 1HNXI 3Q6NA 4R1FA 1N34I 2C38A 2NN6D 2IOPA 4DUZE 3J7AG 1EA6A 1E3PA 1XNQI 1D6TA 1OYPA 2IOQA 3JAMC 2BM1A 1RREA 2C38B 3B4TA 1HNZI 4LCFA 4X64E 1FKAE 4KHPI 2F4VE 5ELWA 4GQUA 4JI0I 3GONA 4UTGA 4DV7E 3J80Q 4JYAE 5K36B 4LFAI 3PYFA 4LF4I 4DR5I 4JG4A 2NN6F 1FWKA 2PO1A 1YHCA 1NZ0A 4FWHA 1XNRI 1ZXMA 1IBKE 1WUUA 4YHHI 3P3CA 4M1KA 3PYEA 1HNWE 2BR2A 3B82A 2UUAE 3ZKBA 4DR5E 4AIMA 1HNZE 5GMEA 4OO1C 4DPXA 1ZXNA 4KQVA 3J81Q 2PO1B 2E5LI 2J7KA 1KKHA 3HKMA 2C37A 2BA0D 4FWGA 4MYTA 2BA0G 1EI1A 4Z7CA 2UUCI 1ZM4A 2O1WA 3ZZUA 1IBME 4DR4I 4FW7A 4WUDA 1USVA 4YY3I 5LL6R 2ZITA 4MU3A 3H1CA 4DPTA 4USKA 5C0XF 4DR3I 4IZJB 5K36F 2BR2B 4LF5E 4NXNI 1U2RA 3DD6A 4DR6E 1VI7A 1N32I 3P3GA 1H72C 4N3OA 2JEAA 2E1RA 4PRXA 5JEAF 2AJ4A 2UUCE 4FW4A 2Z5EA 4HY1A 4X66E 5A2QC 1IBMI 4MQYA 3LPSA 2J65A 1N36E 4DV0I 3B78A 4PU9A 3WU3A 2JEAB 1HR0I 5GMDA 1KIJA 1PKPA 4DV6E 2CVEA 4DR2I 2WP8B 2V2QA 1OJ4A 4DR3E 4AQYE 1UDOA 4NXNE 2HKEA 1Z5AA 1MG7A 2VQFI 1UDQA 4IZJA 4B3TE 3QT5A 3KRNA 2HFUA 4ED4A 1IBKI 4B3RE 4I3HA 1N32E 2VF3A 4DV3E 2V8PA 2OI2A 1Z0GA 3M6AA 2VQEE 4QNKA 2WP8A 1J5EI 2NN6E 4DV5E 1KVKA 2IERA 5IT9Q 4IZKB 3WU4A 4B3MI 4LF6E 1RR9A 4DR1E 3ZZ0A 3PS3A 1XXEA
chains in the Genus database with same CATH topology
4JI2E 1MU5A 1XNRE 4X65I 1Z0VA 4HACA 2UXCE 1KTVA 2V34A 2A2DA 3V5RA 4B3ME 3T1HI 1NHJA 4DUZI 1ZM3A 4JI2I 4X65E 4JV5E 5IWAI 1XMQE 2HK3A 4LFBE 4DR1I 4X64I 3LNUA 3D4JA 4ZVIA 3ZKDA 4LF7E 2LJPA 2UXCI 4FN5A 1XMOE 1IBLE 4DV7I 2GS8A 4DV3I 1B62A 2NPFA 4OX9E 1UEKA 1MX0A 1S16A 2UUBE 5L3JA 4DV1E 4LF9E 4DPWA 1BKNA 1HK7A 1K47A 1HNXE 4NXMI 4RPFA 1Z0CA 2A2CA 1S4EA 4LFCE 2ZM6I 1N36I 4DV2I 4LF8E 4DV1I 4LF9I 2HFSA 1H73A 2UUBI 1Z0WA 5IT9C 2UU9I 2VQFE 1Y4SA 3PRYA 4DV2E 1H74A 2DEIA 2UXDE 2WW4A 2Z5CB 1FWLA 1HR0E 4DU7A 5A2QQ 4DR4E 2V2VA 3WU6A 2CGEA 2O1TA 4OX9I 4P52A 1XMOI 4JI5E 3QT6A 4JI3I 2CG9A 1H7UA 2XEXA 2E5LE 5LMUE 3QT7A 1Z0TA 4DR6I 1ELOA 3T1HE 4JI6I 3HJCA 4KHPE 2HHHI 4DPYA 4JV5I 1ZM9A 3QT8A 4UT4A 4YY3E 4FW9A 4GKKI 4JI4I 2Q2EB 1XMQI 4XTJA 4LFAE 4DUYE 5BR8E 5FWKA 1DARA 1VISA 1ZM2A 1A6FA 2HHHE 4LF6I 2CZ9A 2V2ZA 1Z0EA 3Q6MA 4WUBA 1PIEA 2PNMA 2BV3A 2Z5BB 1XNQE 4GKKE 3T1YE 4DV5I 1FNMA 4HYMA 2O1UA 4Z7YA 2Z5CA 3HULA 4B3TI 3K17A 2X36A 2Z5BA 2UU9E 4LF8I 1NHIA 3J80C 3K85A 4PRVA 4LFCI 3H4LA 2BM0A 1XHKA 1N33E 1N0VC 3OTOI 1H7SA 2HKJA 3J7AM 3J81C 4DV6I 2UXBI 3PYGA 5IWAE 1I94E 3ZM7A 4B3SI 1Z5BA 4IZKA 4DXLA 3T1YI 3F0NA 4K0KE 5LMNI 4X62E 4NXME 1Z0BA 3WU5A 2R3VA 1IBLI 4DUYI 4JI1E 4JI8I 4P7AA 4USMA 5BR8I 5FLXC 4MYUA 4LF4E 3JAMQ 4JI7I 4DU8A 4DV4I 4EMDA 3PYDA 4JI4E 2EFGA 4JI5I 1N0UA 4YHHE 4JI0E 4JYAI 4LFBI 4DV4E 2DEJA 4WUCA 4JI7E 2UXBE 1Z5CA 4FWDA 3B8HA 4JI6E 4JI8E 4HXZA 1QZRA 3K1JA 1J5EE 2UUAI 2X7IA 1HNWI 3P06A 2UXDI 2PNLA 3V2UC 4X62I 3OTOE 1B63A 4X66I 5LMNE 1USUA 2HK2A 1Y6ZA 1I94I 1FJGE 4B3SE 4JI1I 2F4VI 2VQEI 4DR2E 3CWVA 5LMUI 4AQYI 4DR7E 4JI3E 4K0KI 3Q1QA 1Z59A 3ZZTA 1N34E 4B3RI 5FLXQ 4GKJE 2ZM6E 2ZBKB 1NHHA 4HACB 4LF5I 4DPUA 2R42A 4GKJI 4DV0E 4LF7I 4IZJD 1FI4A 4URLA 2GQ0A 2O1VA 1N33I 1PVGA 1FJGI 4DR7I 3LTOA 1Y4UA 1HNXI 3Q6NA 4R1FA 1N34I 2IOPA 4DUZE 3J7AG 1EA6A 1XNQI 1D6TA 2IOQA 3JAMC 2BM1A 1RREA 1HNZI 4X64E 1FKAE 4KHPI 2F4VE 4JI0I 3GONA 4UTGA 4DV7E 3J80Q 4JYAE 4LFAI 3PYFA 4LF4I 4DR5I 4JG4A 1FWKA 1NZ0A 4FWHA 1XNRI 1ZXMA 1IBKE 1WUUA 4YHHI 4M1KA 1HNWE 3PYEA 3B82A 2UUAE 3ZKBA 4DR5E 1HNZE 5GMEA 4DPXA 1ZXNA 4KQVA 3J81Q 2E5LI 2J7KA 1KKHA 4FWGA 4MYTA 4Z7CA 1EI1A 2UUCI 1ZM4A 2O1WA 3ZZUA 1IBME 4DR4I 4WUDA 1USVA 4YY3I 5LL6R 2ZITA 4DPTA 4USKA 4DR3I 4IZJB 4LF5E 4NXNI 1U2RA 4DR6E 1N32I 1H72C 4N3OA 2E1RA 4PRXA 2AJ4A 2UUCE 2Z5EA 4HY1A 4X66E 5A2QC 1IBMI 3LPSA 1N36E 4DV0I 3B78A 4PU9A 3WU3A 1HR0I 5GMDA 1KIJA 1PKPA 4DV6E 4DR2I 4AQYE 4NXNE 2V2QA 1OJ4A 4DR3E 2HKEA 1Z5AA 1MG7A 2VQFI 4IZJA 4B3TE 3QT5A 4ED4A 2HFUA 1IBKI 4B3RE 4I3HA 1N32E 2VF3A 4DV3E 2V8PA 2OI2A 1Z0GA 3M6AA 2VQEE 1J5EI 4DV5E 1KVKA 5IT9Q 4IZKB 3WU4A 4B3MI 4LF6E 1RR9A 4DR1E 3ZZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 E;  1MU5 A;  1XNR E;  4X65 I;  1Z0V A;  4HAC A;  2UXC E;  1KTV A;  2V34 A;  2A2D A;  3V5R A;  4B3M E;  3T1H I;  1NHJ A;  4DUZ I;  1ZM3 A;  4JI2 I;  4X65 E;  4JV5 E;  5IWA I;  1XMQ E;  2HK3 A;  4LFB E;  4DR1 I;  4X64 I;  3LNU A;  3D4J A;  4ZVI A;  3ZKD A;  4LF7 E;  2LJP A;  2UXC I;  4FN5 A;  1XMO E;  1IBL E;  4DV7 I;  2GS8 A;  4DV3 I;  1B62 A;  2NPF A;  4OX9 E;  1UEK A;  1MX0 A;  1S16 A;  2UUB E;  5L3J A;  4DV1 E;  4LF9 E;  4DPW A;  1BKN A;  1K47 A;  1HNX E;  4NXM I;  4RPF A;  1Z0C A;  2A2C A;  1S4E A;  4LFC E;  2ZM6 I;  1N36 I;  4DV2 I;  4LF8 E;  4DV1 I;  4LF9 I;  2HFS A;  1H73 A;  2UUB I;  1Z0W A;  5IT9 C;  2UU9 I;  2VQF E;  4DV2 E;  1H74 A;  2DEI A;  2UXD E;  2WW4 A;  1HR0 E;  1FWL A;  4DU7 A;  5A2Q Q;  4DR4 E;  2V2V A;  3WU6 A;  4OX9 I;  4P52 A;  1XMO I;  4JI5 E;  3QT6 A;  4JI3 I;  2XEX A;  1H7U A;  2E5L E;  5LMU E;  3QT7 A;  1Z0T A;  4DR6 I;  1ELO A;  3T1H E;  4JI6 I;  4KHP E;  2HHH I;  4DPY A;  4JV5 I;  1ZM9 A;  3QT8 A;  4UT4 A;  4YY3 E;  4FW9 A;  4GKK I;  4JI4 I;  2Q2E B;  1XMQ I;  4XTJ A;  4LFA E;  4DUY E;  5BR8 E;  1DAR A;  1VIS A;  1ZM2 A;  1A6F A;  2HHH E;  4LF6 I;  2CZ9 A;  2V2Z A;  1Z0E A;  4WUB A;  1PIE A;  2BV3 A;  1XNQ E;  4GKK E;  3T1Y E;  4DV5 I;  1FNM A;  4HYM A;  4Z7Y A;  3HUL A;  4B3T I;  3K17 A;  2X36 A;  2UU9 E;  4LF8 I;  1NHI A;  3J80 C;  4PRV A;  4LFC I;  3H4L A;  2BM0 A;  1XHK A;  1N33 E;  1N0V C;  3OTO I;  1H7S A;  2HKJ A;  3J7A M;  3J81 C;  4DV6 I;  2UXB I;  3PYG A;  5IWA E;  1I94 E;  3ZM7 A;  4B3S I;  1Z5B A;  4DXL A;  3T1Y I;  3F0N A;  4K0K E;  5LMN I;  4X62 E;  4NXM E;  1Z0B A;  3WU5 A;  2R3V A;  1IBL I;  4DUY I;  4JI1 E;  4JI8 I;  4P7A A;  4USM A;  5BR8 I;  5FLX C;  4MYU A;  4LF4 E;  3JAM Q;  4JI7 I;  4DU8 A;  4DV4 I;  4EMD A;  3PYD A;  4JI4 E;  2EFG A;  4JI5 I;  1N0U A;  4YHH E;  4JI0 E;  4JYA I;  4LFB I;  4DV4 E;  2DEJ A;  4WUC A;  4JI7 E;  2UXB E;  1Z5C A;  4FWD A;  3B8H A;  4JI6 E;  4JI8 E;  4HXZ A;  1QZR A;  3K1J A;  1J5E E;  2UUA I;  2X7I A;  1HNW I;  2UXD I;  3V2U C;  4X62 I;  3OTO E;  1B63 A;  4X66 I;  5LMN E;  2HK2 A;  1I94 I;  1FJG E;  4B3S E;  4JI1 I;  2F4V I;  2VQE I;  4DR2 E;  3CWV A;  5LMU I;  4AQY I;  4DR7 E;  4JI3 E;  4K0K I;  3Q1Q A;  1Z59 A;  3ZZT A;  1N34 E;  4B3R I;  5FLX Q;  4GKJ E;  2ZM6 E;  2ZBK B;  1NHH A;  4HAC B;  4LF5 I;  4DPU A;  2R42 A;  4GKJ I;  4DV0 E;  4LF7 I;  1FI4 A;  4URL A;  1N33 I;  1PVG A;  1FJG I;  4DR7 I;  3LTO A;  1HNX I;  4R1F A;  1N34 I;  4DUZ E;  3J7A G;  1EA6 A;  1XNQ I;  1D6T A;  3JAM C;  2BM1 A;  1RRE A;  1HNZ I;  4X64 E;  1FKA E;  4KHP I;  2F4V E;  4JI0 I;  3GON A;  4UTG A;  4DV7 E;  3J80 Q;  4JYA E;  4LFA I;  3PYF A;  4LF4 I;  4DR5 I;  4JG4 A;  1FWK A;  1NZ0 A;  4FWH A;  1XNR I;  1ZXM A;  1IBK E;  1WUU A;  4YHH I;  4M1K A;  1HNW E;  3PYE A;  3B82 A;  2UUA E;  3ZKB A;  4DR5 E;  1HNZ E;  5GME A;  4DPX A;  1ZXN A;  4KQV A;  3J81 Q;  2E5L I;  2J7K A;  1KKH A;  4FWG A;  4MYT A;  4Z7C A;  1EI1 A;  2UUC I;  1ZM4 A;  3ZZU A;  1IBM E;  4DR4 I;  4WUD A;  4YY3 I;  5LL6 R;  2ZIT A;  4DPT A;  4USK A;  4DR3 I;  4LF5 E;  4NXN I;  1U2R A;  4DR6 E;  1N32 I;  1H72 C;  2E1R A;  4PRX A;  2AJ4 A;  2UUC E;  4HY1 A;  4X66 E;  5A2Q C;  1IBM I;  3LPS A;  1N36 E;  4DV0 I;  3B78 A;  4PU9 A;  3WU3 A;  1HR0 I;  5GMD A;  1KIJ A;  1PKP A;  4DV6 E;  4DR2 I;  4AQY E;  4NXN E;  2V2Q A;  1OJ4 A;  4DR3 E;  2HKE A;  1Z5A A;  1MG7 A;  2VQF I;  4B3T E;  3QT5 A;  4ED4 A;  2HFU A;  1IBK I;  4B3R E;  4I3H A;  1N32 E;  2VF3 A;  4DV3 E;  2V8P A;  2OI2 A;  1Z0G A;  3M6A A;  2VQE E;  1J5E I;  4DV5 E;  1KVK A;  5IT9 Q;  3WU4 A;  4B3M I;  4LF6 E;  1RR9 A;  4DR1 E;  3ZZ0 A; 
#chains in the Genus database with same CATH topology
 4FW5 A;  4JI2 E;  4LCG A;  1MU5 A;  1XNR E;  4X65 I;  1Z0V A;  5C0X B;  2PO2 B;  4HAC A;  2UXC E;  1KTV A;  2V34 A;  2A2D A;  3V5R A;  4B3M E;  3T1H I;  1NHJ A;  2NN6 C;  4DUZ I;  1ZM3 A;  4JI2 I;  3NZK A;  2PNZ A;  4X65 E;  4JV5 E;  2WNR A;  5IWA I;  3M85 G;  3GME A;  1XMQ E;  2HK3 A;  4LFB E;  3GCM A;  5K36 A;  4DR1 I;  4X64 I;  2JE6 A;  3LNU A;  5JEA D;  3D4J A;  4ZVI A;  3ZKD A;  4LF7 E;  2LJP A;  2PO0 A;  2UXC I;  4FN5 A;  1XMO E;  1IBL E;  4DV7 I;  2GS8 A;  4BA1 B;  4DV3 I;  1B62 A;  2NPF A;  4OX9 E;  2BA1 D;  1UEK A;  1MX0 A;  1S16 A;  2UUB E;  5L3J A;  4DV1 E;  4LF9 E;  4DPW A;  1BKN A;  1HK7 A;  1K47 A;  1HNX E;  5C0X C;  4NXM I;  5K36 C;  4RPF A;  1Z0C A;  2A2C A;  1S4E A;  4LFC E;  2ZM6 I;  3L7Z A;  1N36 I;  4LOM A;  4DV2 I;  4LF8 E;  4DV1 I;  4LF9 I;  2HFS A;  1H73 A;  5DRR A;  2UUB I;  1Z0W A;  5IT9 C;  2UU9 I;  2F1D A;  2VQF E;  1Y4S A;  3PRY A;  4DV2 E;  1H74 A;  2DEI A;  2NN6 A;  2UXD E;  4OO1 A;  5C0X D;  2WW4 A;  2Z5C B;  1FWL A;  1HR0 E;  4DU7 A;  5A2Q Q;  4DR4 E;  2V2V A;  3WU6 A;  2CGE A;  2O1T A;  2JEB A;  4P52 A;  1XMO I;  4OX9 I;  4JI5 E;  4IFD A;  3QT6 A;  4MDT A;  2CG9 A;  1H7U A;  2XEX A;  4JI3 I;  2E5L E;  1P42 A;  5LMU E;  3QT7 A;  3P76 A;  1Z0T A;  4DR6 I;  1ELO A;  3T1H E;  4JI6 I;  2GO4 A;  3HJC A;  4KHP E;  2HHH I;  4DPY A;  4JV5 I;  1ZM9 A;  2O3Z A;  3QT8 A;  4UT4 A;  4AID A;  4YY3 E;  4FW9 A;  4MU0 A;  4GKK I;  4JI4 I;  2Q2E B;  1XMQ I;  4XTJ A;  1UDS A;  4LFA E;  4IFD F;  1UDN A;  5EL9 A;  2IES A;  4DUY E;  5BR8 E;  5FWK A;  1DAR A;  3L7Z B;  1VIS A;  1ZM2 A;  4J3D A;  1A6F A;  2HHH E;  4LF6 I;  2CZ9 A;  2V2Z A;  1Z0E A;  3Q6M A;  4WUB A;  1PIE A;  2PNM A;  2BV3 A;  2Z5B B;  3PS2 A;  1XNQ E;  4GKK E;  3T1Y E;  5K36 D;  4DV5 I;  1FNM A;  5JEA A;  4HYM A;  2O1U A;  4Z7Y A;  2Z5C A;  3HUL A;  4MU1 A;  4OO1 E;  4B3T I;  4BA2 A;  3CDJ A;  2X36 A;  2Z5B A;  3K17 A;  2UU9 E;  2C39 B;  2AE8 A;  4LF8 I;  1NHI A;  2JE6 B;  3J80 C;  4IFD E;  4FW3 A;  3K85 A;  4PRV A;  4LFC I;  3H4L A;  1OYR A;  2WNR B;  2BM0 A;  4U3B A;  1R6L A;  4LCH A;  1XHK A;  1N33 E;  1N0V C;  5JEA B;  3OTO I;  1H7S A;  2HKJ A;  3J7A M;  3J81 C;  4DV6 I;  4IFD D;  2UXB I;  3PYG A;  3UHM A;  5IWA E;  1I94 E;  3ZM7 A;  3M85 D;  4B3S I;  1Z5B A;  4IZK A;  4DXL A;  3T1Y I;  2GO3 A;  5DNL A;  4BA2 B;  3F0N A;  4OO1 D;  4K0K E;  5LMN I;  4X62 E;  2VES A;  4NXM E;  3WU5 A;  1Z0B A;  5C0X E;  3M7N G;  2R3V A;  1IBL I;  5K36 E;  5DRQ A;  2BA1 G;  4DUY I;  1RHY A;  4JI1 E;  4JI8 I;  4P7A A;  2PNZ B;  4LPF A;  4USM A;  5BR8 I;  4OKG A;  2NN6 B;  3PS1 A;  5FLX C;  4FW6 A;  3M7N D;  4MYU A;  4LF4 E;  4MU4 A;  3JAM Q;  4JI7 I;  4DU8 A;  4DV4 I;  4EMD A;  3PYD A;  4IFD C;  4JI4 E;  2EFG A;  4JI5 I;  2JT2 A;  1N0U A;  4YHH E;  4JI0 E;  2C39 A;  3U1K A;  4JYA I;  4LFB I;  4DV4 E;  4OZE A;  2DEJ A;  4WUC A;  4JI7 E;  3CDI A;  2UXB E;  4OO1 F;  1Z5C A;  4FWD A;  3B8H A;  4JI6 E;  4JI8 E;  4HXZ A;  3U1Y A;  5EKW A;  1QZR A;  3K1J A;  1J5E E;  5DRO A;  5DRP A;  2UUA I;  1OYS A;  2X7I A;  1HNW I;  3P06 A;  2UXD I;  2PNL A;  3V2U C;  4X62 I;  3OTO E;  5DNX A;  1E3H A;  1B63 A;  4X66 I;  5LMN E;  1USU A;  4BA1 A;  2HK2 A;  4IFD B;  3GLL A;  1Y6Z A;  1I94 I;  1FJG E;  2JEB B;  2C37 B;  4JI1 I;  4B3S E;  1Y5Y A;  2F4V I;  4QNJ A;  2VQE I;  4DR2 E;  3CWV A;  5LMU I;  4AQY I;  4DR7 E;  4JI3 E;  4K0K I;  3Q1Q A;  1Z59 A;  3ZZT A;  1N34 E;  4OO1 B;  4B3R I;  5FLX Q;  1R6M A;  4GKJ E;  2ZM6 E;  2ZBK B;  1NHH A;  5JEA C;  2PO2 A;  1YH8 A;  4HAC B;  5C0X A;  4DPU A;  4LF5 I;  3P3E A;  4IS9 A;  2R42 A;  4GKJ I;  4DV0 E;  4LF7 I;  4IZJ D;  1FI4 A;  4U3D A;  4URL A;  2GQ0 A;  2O1V A;  1N33 I;  1PVG A;  1FJG I;  4NBQ A;  4DR7 I;  2PO0 B;  1Y60 A;  3LTO A;  4AM3 A;  1Y4U A;  4ISA A;  5JEA E;  1HNX I;  3Q6N A;  4R1F A;  1N34 I;  2C38 A;  2NN6 D;  2IOP A;  4DUZ E;  3J7A G;  1EA6 A;  1E3P A;  1XNQ I;  1D6T A;  1OYP A;  2IOQ A;  3JAM C;  2BM1 A;  1RRE A;  2C38 B;  3B4T A;  1HNZ I;  4LCF A;  4X64 E;  1FKA E;  4KHP I;  2F4V E;  5ELW A;  4GQU A;  4JI0 I;  3GON A;  4UTG A;  4DV7 E;  3J80 Q;  4JYA E;  5K36 B;  4LFA I;  3PYF A;  4LF4 I;  4DR5 I;  4JG4 A;  2NN6 F;  1FWK A;  2PO1 A;  1YHC A;  1NZ0 A;  4FWH A;  1XNR I;  1ZXM A;  1IBK E;  1WUU A;  4YHH I;  3P3C A;  4M1K A;  3PYE A;  1HNW E;  2BR2 A;  3B82 A;  2UUA E;  3ZKB A;  4DR5 E;  4AIM A;  1HNZ E;  5GME A;  4OO1 C;  4DPX A;  1ZXN A;  4KQV A;  3J81 Q;  2PO1 B;  2E5L I;  2J7K A;  1KKH A;  3HKM A;  2C37 A;  2BA0 D;  4FWG A;  4MYT A;  2BA0 G;  1EI1 A;  4Z7C A;  2UUC I;  1ZM4 A;  2O1W A;  3ZZU A;  1IBM E;  4DR4 I;  4FW7 A;  4WUD A;  1USV A;  4YY3 I;  5LL6 R;  2ZIT A;  4MU3 A;  3H1C A;  4DPT A;  4USK A;  5C0X F;  4DR3 I;  4IZJ B;  5K36 F;  2BR2 B;  4LF5 E;  4NXN I;  1U2R A;  3DD6 A;  4DR6 E;  1VI7 A;  1N32 I;  3P3G A;  1H72 C;  4N3O A;  2JEA A;  2E1R A;  4PRX A;  5JEA F;  2AJ4 A;  2UUC E;  4FW4 A;  2Z5E A;  4HY1 A;  4X66 E;  5A2Q C;  1IBM I;  4MQY A;  3LPS A;  2J65 A;  1N36 E;  4DV0 I;  3B78 A;  4PU9 A;  3WU3 A;  2JEA B;  1HR0 I;  5GMD A;  1KIJ A;  1PKP A;  4DV6 E;  2CVE A;  4DR2 I;  2WP8 B;  2V2Q A;  1OJ4 A;  4DR3 E;  4AQY E;  1UDO A;  4NXN E;  2HKE A;  1Z5A A;  1MG7 A;  2VQF I;  1UDQ A;  4IZJ A;  4B3T E;  3QT5 A;  3KRN A;  2HFU A;  4ED4 A;  1IBK I;  4B3R E;  4I3H A;  1N32 E;  2VF3 A;  4DV3 E;  2V8P A;  2OI2 A;  1Z0G A;  3M6A A;  2VQE E;  4QNK A;  2WP8 A;  1J5E I;  2NN6 E;  4DV5 E;  1KVK A;  2IER A;  5IT9 Q;  4IZK B;  3WU4 A;  4B3M I;  4LF6 E;  1RR9 A;  4DR1 E;  3ZZ0 A;  3PS3 A;  1XXE A; 
#chains in the Genus database with same CATH homology
 4JI2 E;  1MU5 A;  1XNR E;  4X65 I;  1Z0V A;  4HAC A;  2UXC E;  1KTV A;  2V34 A;  2A2D A;  3V5R A;  4B3M E;  3T1H I;  1NHJ A;  4DUZ I;  1ZM3 A;  4JI2 I;  4X65 E;  4JV5 E;  5IWA I;  1XMQ E;  2HK3 A;  4LFB E;  4DR1 I;  4X64 I;  3LNU A;  3D4J A;  4ZVI A;  3ZKD A;  4LF7 E;  2LJP A;  2UXC I;  4FN5 A;  1XMO E;  1IBL E;  4DV7 I;  2GS8 A;  4DV3 I;  1B62 A;  2NPF A;  4OX9 E;  1UEK A;  1MX0 A;  1S16 A;  2UUB E;  5L3J A;  4DV1 E;  4LF9 E;  4DPW A;  1BKN A;  1HK7 A;  1K47 A;  1HNX E;  4NXM I;  4RPF A;  1Z0C A;  2A2C A;  1S4E A;  4LFC E;  2ZM6 I;  1N36 I;  4DV2 I;  4LF8 E;  4DV1 I;  4LF9 I;  2HFS A;  1H73 A;  2UUB I;  1Z0W A;  5IT9 C;  2UU9 I;  2VQF E;  1Y4S A;  3PRY A;  4DV2 E;  1H74 A;  2DEI A;  2UXD E;  2WW4 A;  2Z5C B;  1FWL A;  1HR0 E;  4DU7 A;  5A2Q Q;  4DR4 E;  2V2V A;  3WU6 A;  2CGE A;  2O1T A;  4OX9 I;  4P52 A;  1XMO I;  4JI5 E;  3QT6 A;  4JI3 I;  2CG9 A;  1H7U A;  2XEX A;  2E5L E;  5LMU E;  3QT7 A;  1Z0T A;  4DR6 I;  1ELO A;  3T1H E;  4JI6 I;  3HJC A;  4KHP E;  2HHH I;  4DPY A;  4JV5 I;  1ZM9 A;  3QT8 A;  4UT4 A;  4YY3 E;  4FW9 A;  4GKK I;  4JI4 I;  2Q2E B;  1XMQ I;  4XTJ A;  4LFA E;  4DUY E;  5BR8 E;  5FWK A;  1DAR A;  1VIS A;  1ZM2 A;  1A6F A;  2HHH E;  4LF6 I;  2CZ9 A;  2V2Z A;  1Z0E A;  3Q6M A;  4WUB A;  1PIE A;  2PNM A;  2BV3 A;  2Z5B B;  1XNQ E;  4GKK E;  3T1Y E;  4DV5 I;  1FNM A;  4HYM A;  2O1U A;  4Z7Y A;  2Z5C A;  3HUL A;  4B3T I;  3K17 A;  2X36 A;  2Z5B A;  2UU9 E;  4LF8 I;  1NHI A;  3J80 C;  3K85 A;  4PRV A;  4LFC I;  3H4L A;  2BM0 A;  1XHK A;  1N33 E;  1N0V C;  3OTO I;  1H7S A;  2HKJ A;  3J7A M;  3J81 C;  4DV6 I;  2UXB I;  3PYG A;  5IWA E;  1I94 E;  3ZM7 A;  4B3S I;  1Z5B A;  4IZK A;  4DXL A;  3T1Y I;  3F0N A;  4K0K E;  5LMN I;  4X62 E;  4NXM E;  1Z0B A;  3WU5 A;  2R3V A;  1IBL I;  4DUY I;  4JI1 E;  4JI8 I;  4P7A A;  4USM A;  5BR8 I;  5FLX C;  4MYU A;  4LF4 E;  3JAM Q;  4JI7 I;  4DU8 A;  4DV4 I;  4EMD A;  3PYD A;  4JI4 E;  2EFG A;  4JI5 I;  1N0U A;  4YHH E;  4JI0 E;  4JYA I;  4LFB I;  4DV4 E;  2DEJ A;  4WUC A;  4JI7 E;  2UXB E;  1Z5C A;  4FWD A;  3B8H A;  4JI6 E;  4JI8 E;  4HXZ A;  1QZR A;  3K1J A;  1J5E E;  2UUA I;  2X7I A;  1HNW I;  3P06 A;  2UXD I;  2PNL A;  3V2U C;  4X62 I;  3OTO E;  1B63 A;  4X66 I;  5LMN E;  1USU A;  2HK2 A;  1Y6Z A;  1I94 I;  1FJG E;  4B3S E;  4JI1 I;  2F4V I;  2VQE I;  4DR2 E;  3CWV A;  5LMU I;  4AQY I;  4DR7 E;  4JI3 E;  4K0K I;  3Q1Q A;  1Z59 A;  3ZZT A;  1N34 E;  4B3R I;  5FLX Q;  4GKJ E;  2ZM6 E;  2ZBK B;  1NHH A;  4HAC B;  4LF5 I;  4DPU A;  2R42 A;  4GKJ I;  4DV0 E;  4LF7 I;  4IZJ D;  1FI4 A;  4URL A;  2GQ0 A;  2O1V A;  1N33 I;  1PVG A;  1FJG I;  4DR7 I;  3LTO A;  1Y4U A;  1HNX I;  3Q6N A;  4R1F A;  1N34 I;  2IOP A;  4DUZ E;  3J7A G;  1EA6 A;  1XNQ I;  1D6T A;  2IOQ A;  3JAM C;  2BM1 A;  1RRE A;  1HNZ I;  4X64 E;  1FKA E;  4KHP I;  2F4V E;  4JI0 I;  3GON A;  4UTG A;  4DV7 E;  3J80 Q;  4JYA E;  4LFA I;  3PYF A;  4LF4 I;  4DR5 I;  4JG4 A;  1FWK A;  1NZ0 A;  4FWH A;  1XNR I;  1ZXM A;  1IBK E;  1WUU A;  4YHH I;  4M1K A;  1HNW E;  3PYE A;  3B82 A;  2UUA E;  3ZKB A;  4DR5 E;  1HNZ E;  5GME A;  4DPX A;  1ZXN A;  4KQV A;  3J81 Q;  2E5L I;  2J7K A;  1KKH A;  4FWG A;  4MYT A;  4Z7C A;  1EI1 A;  2UUC I;  1ZM4 A;  2O1W A;  3ZZU A;  1IBM E;  4DR4 I;  4WUD A;  1USV A;  4YY3 I;  5LL6 R;  2ZIT A;  4DPT A;  4USK A;  4DR3 I;  4IZJ B;  4LF5 E;  4NXN I;  1U2R A;  4DR6 E;  1N32 I;  1H72 C;  4N3O A;  2E1R A;  4PRX A;  2AJ4 A;  2UUC E;  2Z5E A;  4HY1 A;  4X66 E;  5A2Q C;  1IBM I;  3LPS A;  1N36 E;  4DV0 I;  3B78 A;  4PU9 A;  3WU3 A;  1HR0 I;  5GMD A;  1KIJ A;  1PKP A;  4DV6 E;  4DR2 I;  4AQY E;  4NXN E;  2V2Q A;  1OJ4 A;  4DR3 E;  2HKE A;  1Z5A A;  1MG7 A;  2VQF I;  4IZJ A;  4B3T E;  3QT5 A;  4ED4 A;  2HFU A;  1IBK I;  4B3R E;  4I3H A;  1N32 E;  2VF3 A;  4DV3 E;  2V8P A;  2OI2 A;  1Z0G A;  3M6A A;  2VQE E;  1J5E I;  4DV5 E;  1KVK A;  5IT9 Q;  4IZK B;  3WU4 A;  4B3M I;  4LF6 E;  1RR9 A;  4DR1 E;  3ZZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...