2HHHI

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2hhhI00
5FLXC 1Z59A 3ZM7A 3ZKBA 4P7AA 2F4VE 4DR6I 2HK3A 4JYAI 2Q2EB 4B3TI 2X36A 1XMQI 1HNZE 4JI6I 2BV3A 2HHHI 1A6FA 4JG4A 4FWGA 5A2QC 4MYUA 3V5RA 1XNRI 3OTOE 4XTJA 4LF8I 4LFCI 2WW4A 2VQFI 3JAMQ 4HACB 5FLXQ 3LNUA 4DV3E 5BR8E 4LFAI 2A2DA 4JI5I 1NHHA 2HFSA 1Z0BA 4DR2E 4FW9A 4DV7I 2V34A 4WUCA 2R3VA 4HACA 2E5LE 1QZRA 1B62A 1NHIA 1XMOI 4JI0I 4JI1E 3T1YE 4NXNI 4LF4I 4B3TE 1FNMA 5IT9C 2UU9E 1XMQE 5A2QQ 4DV2I 1HNXI 2UXDI 3F0NA 1ZM9A 3PYFA 2BM0A 3GONA 1MX0A 2A2CA 4DR7E 1S4EA 3K1JA 4DV1I 4X62I 1KVKA 1Z0CA 4LF9I 1XNRE 4JI4I 4LFCE 3T1HI 1Z0WA 2V2QA 1WUUA 4DV5I 1PIEA 2AJ4A 4K0KI 2VF3A 4EMDA 1XNQE 3ZZ0A 1IBMI 5IT9Q 4GKJI 1N32I 4JI0E 1N34E 3WU6A 5LMUI 4B3RI 1VISA 1EA6A 2ZITA 4FWHA 3B78A 1MG7A 2DEJA 4NXNE 4X66I 4PU9A 1FWKA 3J7AG 3ZZUA 1HNXE 3QT6A 4LF6I 1Z5CA 4ED4A 4DV4I 4I3HA 3J7AM 1Z5AA 1RREA 4YY3I 4DUZE 4X62E 3QT7A 4WUBA 4LF9E 2VQEE 4OX9I 1N36I 4UT4A 3J80C 4DPUA 2UXBE 4JI7I 1H72C 4DV5E 1J5EE 4K0KE 2ZM6I 4B3MI 1DARA 4JV5I 4JI3E 2UXCE 4DR4E 4LF7I 4LFBI 1HNWE 3B82A 4DXLA 4GKJE 1N32E 1Z0TA 4Z7YA 1UEKA 1N33I 4X64I 4HY1A 4DR6E 2HKEA 1ZXMA 4JYAE 3WU4A 4DR1I 1NHJA 1Z0VA 1FJGI 5GMDA 1H7SA 2CZ9A 4JI6E 2UUCI 4RPFA 4GKKI 1MU5A 4DPYA 4HXZA 4ZVIA 3J80Q 4DR5I 5LMNI 2UUBI 2HHHE 4R1FA 1B63A 1ELOA 4AQYI 3WU5A 3M6AA 2V2VA 4DUYI 2V8PA 3PYEA 3K17A 3PYDA 4LF8E 1EI1A 2VQFE 2ZM6E 4B3ME 4JV5E 1N0VC 2LJPA 1H73A 4LFAE 1OJ4A 4JI5E 4DV0I 1IBKI 4KHPI 2V2ZA 4LF7E 4MYTA 4DV6I 4DV7E 1NZ0A 1H74A 4PRVA 1XMOE 4DPXA 3PYGA 4X65I 4DPTA 4JI8I 3CWVA 4LF4E 1S16A 1FJGE 4JI2I 1BKNA 4DV2E 4YHHI 5L3JA 4GKKE 1ZM2A 5IWAI 3J81C 2UXDE 4USMA 2E5LI 4DR5E 2BM1A 3JAMC 2NPFA 4URLA 4FWDA 3H4LA 4JI1I 4AQYE 3LTOA 3T1YI 3V2UC 4LF5I 4DV1E 4DUYE 4USKA 2HK2A 1KKHA 2UU9I 4B3SI 4JI4E 4DU7A 3T1HE 1XHKA 2ZBKB 5GMEA 1PKPA 4DV0E 4P52A 1IBKE 4KHPE 4DR7I 1ZM4A 2X7IA 4DV6E 3ZZTA 5LL6R 1IBME 2UUAI 3QT5A 4DU8A 1K47A 5LMUE 4WUDA 4X65E 4B3RE 3J81Q 4JI8E 1FKAE 3ZKDA 1N0UA 4X66E 1FI4A 1IBLI 1KIJA 1HR0I 2EFGA 4KQVA 4JI2E 4YHHE 1XNQI 4NXMI 4LF6E 4DV4E 5IWAE 3HULA 2OI2A 4Z7CA 4DR3I 3B8HA 1N34I 1I94I 3LPSA 2HFUA 4LF5E 4YY3E 2F4VI 4DPWA 3Q1QA 4B3SE 4OX9E 1N36E 3D4JA 3WU3A 1Z5BA 1ZXNA 2GS8A 4JI7E 1HNZI 2R42A 1U2RA 1FWLA 1RR9A 1Z0GA 2XEXA 2UUAE 4LFBE 4DUZI 4UTGA 2VQEI 1N33E 4M1KA 4X64E 2UXBI 2DEIA 4HYMA 1H7UA 3OTOI 2HKJA 2E1RA 1J5EI 1IBLE 1HR0E 1ZM3A 2J7KA 4PRXA 4DR1E 4DV3I 5BR8I 1KTVA 1D6TA 4NXME 4FN5A 4JI3I 4DR2I 4DR4I 2UXCI 2UUCE 1Z0EA 1HNWI 1PVGA 4DR3E 5LMNE 2UUBE 3QT8A 1I94E
chains in the Genus database with same CATH superfamily
5FLXC 1Z59A 3ZM7A 3ZKBA 4P7AA 2F4VE 4DR6I 2HK3A 4JYAI 2Q2EB 3CDJA 4B3TI 2X36A 5C0XF 1XMQI 5JEAA 1HNZE 4JI6I 4OO1C 3H1CA 4FW5A 3P76A 4IZJB 2BV3A 5DNXA 4BA1A 2HHHI 1A6FA 2NN6F 2AE8A 5JEAC 4JG4A 4FWGA 2C38A 5ELWA 4LCFA 1USVA 4OZEA 5A2QC 4MYUA 3P3EA 3V5RA 1OYRA 3GCMA 1XNRI 3OTOE 4MU0A 4XTJA 4LF8I 2C39B 4LFCI 2WW4A 2VQFI 3JAMQ 2WP8B 4HACB 5FLXQ 3LNUA 4DV3E 5BR8E 4LFAI 2A2DA 4JI5I 1NHHA 2HFSA 1Z0BA 4DR2E 4ISAA 4FW9A 2O1WA 2C39A 4DV7I 2V34A 4WUCA 4IFDE 2R3VA 2WP8A 4HACA 2E5LE 1QZRA 3M7ND 1B62A 1NHIA 1XMOI 4JI0I 4JI1E 5K36D 1UDNA 4NBQA 3P3GA 3T1YE 1YHCA 4OKGA 4NXNI 4LF4I 4B3TE 1FNMA 2O1UA 5IT9C 3M85G 2UU9E 1XMQE 5A2QQ 4DV2I 1HNXI 4MU3A 1UDOA 4IFDB 5DNLA 2UXDI 3F0NA 1ZM9A 4IZKB 3PYFA 2BM0A 3GONA 3CDIA 1MX0A 2A2CA 4DR7E 4AM3A 1S4EA 3K1JA 2C37B 4IFDA 4J3DA 4DV1I 4X62I 1KVKA 2PNZB 1Y5YA 5K36C 1Z0CA 4LF9I 4IZKA 3NZKA 1XNRE 3GMEA 5C0XE 4JI4I 4LFCE 4IFDC 3UHMA 3T1HI 2C37A 1Z0WA 2V2QA 1WUUA 4DV5I 2PNZA 1PIEA 2AJ4A 4K0KI 2J65A 2NN6E 3K85A 2VF3A 4EMDA 1XNQE 3HKMA 1UDQA 2PO0A 3ZZ0A 2JE6B 1IBMI 4OO1B 5IT9Q 4GKJI 1N32I 4JI0E 2NN6D 4FW6A 1N34E 5C0XB 3WU6A 5LMUI 3Q6NA 2CG9A 4B3RI 1VISA 3KRNA 5JEAB 1EA6A 2O1VA 4AIDA 2JE6A 2ZITA 4FWHA 3B78A 1MG7A 4OO1A 2DEJA 4NXNE 4X66I 4PU9A 5FWKA 1FWKA 4QNJA 4BA1B 2BR2A 3J7AG 5C0XA 3ZZUA 1HNXE 3QT6A 4LF6I 1Z5CA 4ED4A 2Z5EA 4DV4I 3PRYA 2C38B 4I3HA 3DD6A 1Y6ZA 3J7AM 1Z5AA 2PNLA 5C0XC 2BA0D 2VESA 4MU4A 1Y4UA 1RREA 4YY3I 4DUZE 4X62E 3QT7A 2NN6C 4IZJD 4WUBA 4LF9E 2VQEE 4OX9I 1N36I 4GQUA 4UT4A 3J80C 4DPUA 2UXBE 4JI7I 1H72C 4DV5E 4LPFA 1J5EE 4K0KE 1UDSA 2ZM6I 1DARA 4B3MI 4JV5I 2WNRB 3B4TA 2JEAB 5K36E 4JI3E 2UXCE 4DR4E 4LF7I 4LFBI 1HNWE 3B82A 1YH8A 4DXLA 4GKJE 1N32E 2IERA 1Z0TA 2WNRA 4Z7YA 1UEKA 1N33I 4X64I 2JEAA 3GLLA 4HY1A 4DR6E 2HKEA 1ZXMA 4JYAE 3WU4A 3M7NG 4DR1I 1NHJA 5K36B 1Z0VA 1FJGI 5GMDA 1H7SA 2CZ9A 4JI6E 2UUCI 4RPFA 4GKKI 1MU5A 4DPYA 4HXZA 4ZVIA 3J80Q 4DR5I 5LMNI 2UUBI 4U3DA 2HHHE 4R1FA 1B63A 5K36A 1ELOA 1R6LA 2O1TA 4AQYI 3WU5A 3PS3A 3M6AA 2V2VA 4DUYI 4FW7A 2V8PA 3U1KA 3PYEA 3K17A 3PYDA 4LF8E 4MDTA 1EI1A 2PO0B 2VQFE 4LCGA 4U3BA 2ZM6E 4B3ME 4JV5E 1N0VC 2LJPA 1H73A 4LFAE 1OJ4A 3P3CA 4JI5E 4DV0I 1IBKI 4KHPI 2V2ZA 4LF7E 4MYTA 4DV6I 4FW3A 4DV7E 4IFDF 1E3PA 1NZ0A 2BA1D 2PO2B 1Y60A 4LCHA 3PS1A 4IS9A 1H74A 2Z5CB 4PRVA 1XMOE 2BR2B 4DPXA 3PYGA 4X65I 4DPTA 4JI8I 3CWVA 4MU1A 2PO2A 4LF4E 1S16A 2NN6B 1E3HA 2Z5CA 1FJGE 4AIMA 1BKNA 4JI2I 2GO3A 4QNKA 5JEAD 4YHHI 5L3JA 4DV2E 2JEBA 3Q6MA 4GKKE 2Z5BA 3L7ZB 1ZM2A 5IWAI 3J81C 4LOMA 2UXDE 4USMA 2E5LI 4DR5E 2BM1A 2JT2A 3JAMC 2NPFA 1P42A 4URLA 4FWDA 2NN6A 3H4LA 4JI1I 1XXEA 4AQYE 3LTOA 3T1YI 3V2UC 4LF5I 3L7ZA 4DV1E 4OO1F 4DUYE 1HK7A 4USKA 2HK2A 1KKHA 2UU9I 4B3SI 2BA0G 4JI4E 4DU7A 5JEAF 2IESA 3T1HE 1XHKA 2ZBKB 5GMEA 5DRPA 1PKPA 4DV0E 4P52A 1IBKE 4KHPE 4DR7I 1ZM4A 2X7IA 4DV6E 5DRQA 3P06A 3ZZTA 5LL6R 1IBME 2UUAI 4IZJA 5DRRA 3QT5A 4DU8A 1K47A 5LMUE 4WUDA 4X65E 4B3RE 3J81Q 2O3ZA 4JI8E 1FKAE 3ZKDA 4BA2B 1N0UA 5EKWA 1R6MA 2PO1B 4X66E 1FI4A 1IBLI 1KIJA 1HR0I 2EFGA 4KQVA 4JI2E 2IOQA 4YHHE 1XNQI 4NXMI 1Y4SA 4LF6E 2CVEA 4DV4E 5IWAE 3HULA 4BA2A 2OI2A 4Z7CA 4DR3I 2PO1A 3B8HA 3M85D 1N34I 1I94I 3LPSA 3HJCA 2HFUA 1OYPA 2CGEA 4LF5E 4YY3E 4IFDD 2F4VI 4DPWA 3Q1QA 1RHYA 4B3SE 4OX9E 1N36E 3D4JA 3WU3A 1Z5BA 1ZXNA 2GS8A 4JI7E 1HNZI 2R42A 1U2RA 1FWLA 1RR9A 5K36F 1Z0GA 1VI7A 2XEXA 2UUAE 4LFBE 4DUZI 4OO1E 2GQ0A 3PS2A 4UTGA 2VQEI 1N33E 4M1KA 4X64E 2F1DA 5DROA 2UXBI 2DEIA 4HYMA 1H7UA 4FW4A 5JEAE 3OTOI 2JEBB 2HKJA 2E1RA 1OYSA 2Z5BB 1J5EI 1IBLE 1HR0E 4OO1D 1ZM3A 2J7KA 2BA1G 2GO4A 4PRXA 4DR1E 4DV3I 5BR8I 5C0XD 1KTVA 1D6TA 4NXME 2IOPA 4FN5A 4MQYA 3U1YA 4JI3I 4DR2I 4DR4I 1USUA 2UUCE 2UXCI 1Z0EA 1HNWI 1PVGA 4DR3E 5EL9A 2PNMA 4N3OA 5LMNE 2UUBE 3QT8A 1I94E
chains in the Genus database with same CATH topology
5FLXC 1Z59A 3ZM7A 3ZKBA 4P7AA 2F4VE 4DR6I 2HK3A 4JYAI 2Q2EB 4B3TI 2X36A 1XMQI 1HNZE 4JI6I 4IZJB 2BV3A 2HHHI 1A6FA 4JG4A 4FWGA 1USVA 5A2QC 4MYUA 3V5RA 1XNRI 3OTOE 4XTJA 4LF8I 4LFCI 2WW4A 2VQFI 3JAMQ 4HACB 5FLXQ 3LNUA 4DV3E 5BR8E 4LFAI 2A2DA 4JI5I 1NHHA 2HFSA 1Z0BA 4DR2E 4FW9A 2O1WA 4DV7I 2V34A 4WUCA 2R3VA 4HACA 2E5LE 1QZRA 1B62A 1NHIA 1XMOI 4JI0I 4JI1E 3T1YE 4NXNI 4LF4I 4B3TE 1FNMA 2O1UA 5IT9C 2UU9E 1XMQE 5A2QQ 4DV2I 1HNXI 2UXDI 3F0NA 1ZM9A 4IZKB 3PYFA 2BM0A 3GONA 1MX0A 2A2CA 4DR7E 1S4EA 3K1JA 4DV1I 4X62I 1KVKA 1Z0CA 4LF9I 4IZKA 1XNRE 4JI4I 4LFCE 3T1HI 1Z0WA 2V2QA 1WUUA 4DV5I 1PIEA 2AJ4A 4K0KI 3K85A 2VF3A 4EMDA 1XNQE 3ZZ0A 1IBMI 5IT9Q 4GKJI 1N32I 4JI0E 1N34E 3WU6A 5LMUI 3Q6NA 2CG9A 4B3RI 1VISA 1EA6A 2O1VA 2ZITA 4FWHA 3B78A 1MG7A 2DEJA 4NXNE 4X66I 4PU9A 5FWKA 1FWKA 3J7AG 3ZZUA 1HNXE 3QT6A 4LF6I 1Z5CA 4DV4I 2Z5EA 4ED4A 3PRYA 4I3HA 1Y6ZA 3J7AM 1Z5AA 2PNLA 1Y4UA 1RREA 4YY3I 4DUZE 4X62E 3QT7A 4WUBA 4IZJD 4LF9E 2VQEE 4OX9I 1N36I 4UT4A 3J80C 4DPUA 2UXBE 4JI7I 1H72C 4DV5E 1J5EE 4K0KE 2ZM6I 4B3MI 1DARA 4JV5I 4JI3E 2UXCE 4DR4E 4LF7I 4LFBI 1HNWE 3B82A 4DXLA 4GKJE 1N32E 1Z0TA 4Z7YA 1UEKA 1N33I 4X64I 4HY1A 4DR6E 2HKEA 1ZXMA 4JYAE 3WU4A 4DR1I 1NHJA 1Z0VA 1FJGI 5GMDA 1H7SA 2CZ9A 4JI6E 2UUCI 4RPFA 4GKKI 1MU5A 4DPYA 4HXZA 4ZVIA 3J80Q 4DR5I 5LMNI 2UUBI 2HHHE 4R1FA 1B63A 1ELOA 2O1TA 4AQYI 3WU5A 3M6AA 2V2VA 4DUYI 2V8PA 3PYEA 3K17A 3PYDA 4LF8E 1EI1A 2VQFE 2ZM6E 4B3ME 4JV5E 1N0VC 2LJPA 1H73A 4LFAE 1OJ4A 4JI5E 4DV0I 1IBKI 4KHPI 2V2ZA 4LF7E 4MYTA 4DV6I 4DV7E 1NZ0A 1H74A 2Z5CB 4PRVA 1XMOE 4DPXA 3PYGA 4X65I 4DPTA 4JI8I 3CWVA 4LF4E 1S16A 2Z5CA 1FJGE 4JI2I 1BKNA 4DV2E 4YHHI 5L3JA 3Q6MA 4GKKE 2Z5BA 1ZM2A 5IWAI 3J81C 2UXDE 4USMA 2E5LI 4DR5E 2BM1A 3JAMC 2NPFA 4URLA 4FWDA 3H4LA 4JI1I 4AQYE 3LTOA 3T1YI 3V2UC 4LF5I 4DV1E 4DUYE 1HK7A 4USKA 2HK2A 1KKHA 2UU9I 4B3SI 4JI4E 4DU7A 3T1HE 1XHKA 2ZBKB 5GMEA 1PKPA 4DV0E 4P52A 1IBKE 4KHPE 4DR7I 1ZM4A 2X7IA 4DV6E 3P06A 3ZZTA 5LL6R 1IBME 2UUAI 4IZJA 3QT5A 4DU8A 1K47A 5LMUE 4WUDA 4X65E 4B3RE 3J81Q 4JI8E 1FKAE 3ZKDA 1N0UA 4X66E 1FI4A 1IBLI 1KIJA 1HR0I 2EFGA 4KQVA 4JI2E 2IOQA 4YHHE 1XNQI 4NXMI 1Y4SA 4LF6E 4DV4E 5IWAE 3HULA 2OI2A 4Z7CA 4DR3I 3B8HA 1N34I 1I94I 3LPSA 3HJCA 2HFUA 2CGEA 4LF5E 4YY3E 2F4VI 4DPWA 3Q1QA 4B3SE 4OX9E 1N36E 3D4JA 3WU3A 1Z5BA 1ZXNA 2GS8A 4JI7E 1HNZI 2R42A 1U2RA 1FWLA 1RR9A 1Z0GA 2XEXA 2UUAE 4LFBE 4DUZI 2GQ0A 4UTGA 2VQEI 1N33E 4M1KA 4X64E 2UXBI 2DEIA 4HYMA 1H7UA 3OTOI 2HKJA 2E1RA 2Z5BB 1J5EI 1IBLE 1HR0E 1ZM3A 2J7KA 4PRXA 4DR1E 4DV3I 5BR8I 1KTVA 1D6TA 4NXME 2IOPA 4FN5A 4JI3I 4DR2I 4DR4I 1USUA 2UUCE 2UXCI 1Z0EA 1HNWI 1PVGA 4DR3E 2PNMA 4N3OA 5LMNE 2UUBE 3QT8A 1I94E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX C;  1Z59 A;  3ZM7 A;  3ZKB A;  4P7A A;  2F4V E;  4DR6 I;  2HK3 A;  4JYA I;  2Q2E B;  4B3T I;  2X36 A;  1XMQ I;  1HNZ E;  4JI6 I;  2BV3 A;  2HHH I;  1A6F A;  4JG4 A;  4FWG A;  5A2Q C;  4MYU A;  3V5R A;  1XNR I;  3OTO E;  4XTJ A;  4LF8 I;  4LFC I;  2WW4 A;  2VQF I;  3JAM Q;  4HAC B;  5FLX Q;  3LNU A;  4DV3 E;  5BR8 E;  4LFA I;  2A2D A;  4JI5 I;  1NHH A;  2HFS A;  1Z0B A;  4DR2 E;  4FW9 A;  4DV7 I;  2V34 A;  4WUC A;  2R3V A;  4HAC A;  2E5L E;  1QZR A;  1B62 A;  1NHI A;  1XMO I;  4JI0 I;  4JI1 E;  3T1Y E;  4NXN I;  4LF4 I;  4B3T E;  1FNM A;  5IT9 C;  2UU9 E;  1XMQ E;  5A2Q Q;  4DV2 I;  1HNX I;  2UXD I;  3F0N A;  1ZM9 A;  3PYF A;  2BM0 A;  3GON A;  1MX0 A;  2A2C A;  4DR7 E;  1S4E A;  3K1J A;  4DV1 I;  4X62 I;  1KVK A;  1Z0C A;  4LF9 I;  1XNR E;  4JI4 I;  4LFC E;  3T1H I;  1Z0W A;  2V2Q A;  1WUU A;  4DV5 I;  1PIE A;  2AJ4 A;  4K0K I;  2VF3 A;  4EMD A;  1XNQ E;  3ZZ0 A;  1IBM I;  5IT9 Q;  4GKJ I;  1N32 I;  4JI0 E;  1N34 E;  3WU6 A;  5LMU I;  4B3R I;  1VIS A;  1EA6 A;  2ZIT A;  4FWH A;  3B78 A;  1MG7 A;  2DEJ A;  4NXN E;  4X66 I;  4PU9 A;  1FWK A;  3J7A G;  3ZZU A;  1HNX E;  3QT6 A;  4LF6 I;  1Z5C A;  4ED4 A;  4DV4 I;  4I3H A;  3J7A M;  1Z5A A;  1RRE A;  4YY3 I;  4DUZ E;  4X62 E;  3QT7 A;  4WUB A;  4LF9 E;  2VQE E;  4OX9 I;  1N36 I;  4UT4 A;  3J80 C;  4DPU A;  2UXB E;  4JI7 I;  1H72 C;  4DV5 E;  1J5E E;  4K0K E;  2ZM6 I;  4B3M I;  1DAR A;  4JV5 I;  4JI3 E;  2UXC E;  4DR4 E;  4LF7 I;  4LFB I;  1HNW E;  3B82 A;  4DXL A;  4GKJ E;  1N32 E;  1Z0T A;  4Z7Y A;  1UEK A;  1N33 I;  4X64 I;  4HY1 A;  4DR6 E;  2HKE A;  1ZXM A;  4JYA E;  3WU4 A;  4DR1 I;  1NHJ A;  1Z0V A;  1FJG I;  5GMD A;  1H7S A;  2CZ9 A;  4JI6 E;  2UUC I;  4RPF A;  4GKK I;  1MU5 A;  4DPY A;  4HXZ A;  4ZVI A;  3J80 Q;  4DR5 I;  5LMN I;  2UUB I;  2HHH E;  4R1F A;  1B63 A;  1ELO A;  4AQY I;  3WU5 A;  3M6A A;  2V2V A;  4DUY I;  2V8P A;  3PYE A;  3K17 A;  3PYD A;  4LF8 E;  1EI1 A;  2VQF E;  2ZM6 E;  4B3M E;  4JV5 E;  1N0V C;  2LJP A;  1H73 A;  4LFA E;  1OJ4 A;  4JI5 E;  4DV0 I;  1IBK I;  4KHP I;  2V2Z A;  4LF7 E;  4MYT A;  4DV6 I;  4DV7 E;  1NZ0 A;  1H74 A;  4PRV A;  1XMO E;  4DPX A;  3PYG A;  4X65 I;  4DPT A;  4JI8 I;  3CWV A;  4LF4 E;  1S16 A;  1FJG E;  4JI2 I;  1BKN A;  4DV2 E;  4YHH I;  5L3J A;  4GKK E;  1ZM2 A;  5IWA I;  3J81 C;  2UXD E;  4USM A;  2E5L I;  4DR5 E;  2BM1 A;  3JAM C;  2NPF A;  4URL A;  4FWD A;  3H4L A;  4JI1 I;  4AQY E;  3LTO A;  3T1Y I;  3V2U C;  4LF5 I;  4DV1 E;  4DUY E;  4USK A;  2HK2 A;  1KKH A;  2UU9 I;  4B3S I;  4JI4 E;  4DU7 A;  3T1H E;  1XHK A;  2ZBK B;  5GME A;  1PKP A;  4DV0 E;  4P52 A;  1IBK E;  4KHP E;  4DR7 I;  1ZM4 A;  2X7I A;  4DV6 E;  3ZZT A;  5LL6 R;  1IBM E;  2UUA I;  3QT5 A;  4DU8 A;  1K47 A;  5LMU E;  4WUD A;  4X65 E;  4B3R E;  3J81 Q;  4JI8 E;  1FKA E;  3ZKD A;  1N0U A;  4X66 E;  1FI4 A;  1IBL I;  1KIJ A;  1HR0 I;  2EFG A;  4KQV A;  4JI2 E;  4YHH E;  1XNQ I;  4NXM I;  4LF6 E;  4DV4 E;  5IWA E;  3HUL A;  2OI2 A;  4Z7C A;  4DR3 I;  3B8H A;  1N34 I;  1I94 I;  3LPS A;  2HFU A;  4LF5 E;  4YY3 E;  2F4V I;  4DPW A;  3Q1Q A;  4B3S E;  4OX9 E;  1N36 E;  3D4J A;  3WU3 A;  1Z5B A;  1ZXN A;  2GS8 A;  4JI7 E;  1HNZ I;  2R42 A;  1U2R A;  1FWL A;  1RR9 A;  1Z0G A;  2XEX A;  2UUA E;  4LFB E;  4DUZ I;  4UTG A;  2VQE I;  1N33 E;  4M1K A;  4X64 E;  2UXB I;  2DEI A;  4HYM A;  1H7U A;  3OTO I;  2HKJ A;  2E1R A;  1J5E I;  1IBL E;  1HR0 E;  1ZM3 A;  2J7K A;  4PRX A;  4DR1 E;  4DV3 I;  5BR8 I;  1KTV A;  1D6T A;  4NXM E;  4FN5 A;  4JI3 I;  4DR2 I;  4DR4 I;  2UXC I;  2UUC E;  1Z0E A;  1HNW I;  1PVG A;  4DR3 E;  5LMN E;  2UUB E;  3QT8 A;  1I94 E; 
#chains in the Genus database with same CATH topology
 5FLX C;  1Z59 A;  3ZM7 A;  3ZKB A;  4P7A A;  2F4V E;  4DR6 I;  2HK3 A;  4JYA I;  2Q2E B;  3CDJ A;  4B3T I;  2X36 A;  5C0X F;  1XMQ I;  5JEA A;  1HNZ E;  4JI6 I;  4OO1 C;  3H1C A;  4FW5 A;  3P76 A;  4IZJ B;  2BV3 A;  5DNX A;  4BA1 A;  2HHH I;  1A6F A;  2NN6 F;  2AE8 A;  5JEA C;  4JG4 A;  4FWG A;  2C38 A;  5ELW A;  4LCF A;  1USV A;  4OZE A;  5A2Q C;  4MYU A;  3P3E A;  3V5R A;  1OYR A;  3GCM A;  1XNR I;  3OTO E;  4MU0 A;  4XTJ A;  4LF8 I;  2C39 B;  4LFC I;  2WW4 A;  2VQF I;  3JAM Q;  2WP8 B;  4HAC B;  5FLX Q;  3LNU A;  4DV3 E;  5BR8 E;  4LFA I;  2A2D A;  4JI5 I;  1NHH A;  2HFS A;  1Z0B A;  4DR2 E;  4ISA A;  4FW9 A;  2O1W A;  2C39 A;  4DV7 I;  2V34 A;  4WUC A;  4IFD E;  2R3V A;  2WP8 A;  4HAC A;  2E5L E;  1QZR A;  3M7N D;  1B62 A;  1NHI A;  1XMO I;  4JI0 I;  4JI1 E;  5K36 D;  1UDN A;  4NBQ A;  3P3G A;  3T1Y E;  1YHC A;  4OKG A;  4NXN I;  4LF4 I;  4B3T E;  1FNM A;  2O1U A;  5IT9 C;  3M85 G;  2UU9 E;  1XMQ E;  5A2Q Q;  4DV2 I;  1HNX I;  4MU3 A;  1UDO A;  4IFD B;  5DNL A;  2UXD I;  3F0N A;  1ZM9 A;  4IZK B;  3PYF A;  2BM0 A;  3GON A;  3CDI A;  1MX0 A;  2A2C A;  4DR7 E;  4AM3 A;  1S4E A;  3K1J A;  2C37 B;  4IFD A;  4J3D A;  4DV1 I;  4X62 I;  1KVK A;  2PNZ B;  1Y5Y A;  5K36 C;  1Z0C A;  4LF9 I;  4IZK A;  3NZK A;  1XNR E;  3GME A;  5C0X E;  4JI4 I;  4LFC E;  4IFD C;  3UHM A;  3T1H I;  2C37 A;  1Z0W A;  2V2Q A;  1WUU A;  4DV5 I;  2PNZ A;  1PIE A;  2AJ4 A;  4K0K I;  2J65 A;  2NN6 E;  3K85 A;  2VF3 A;  4EMD A;  1XNQ E;  3HKM A;  1UDQ A;  2PO0 A;  3ZZ0 A;  2JE6 B;  1IBM I;  4OO1 B;  5IT9 Q;  4GKJ I;  1N32 I;  4JI0 E;  2NN6 D;  4FW6 A;  1N34 E;  5C0X B;  3WU6 A;  5LMU I;  3Q6N A;  2CG9 A;  4B3R I;  1VIS A;  3KRN A;  5JEA B;  1EA6 A;  2O1V A;  4AID A;  2JE6 A;  2ZIT A;  4FWH A;  3B78 A;  1MG7 A;  4OO1 A;  2DEJ A;  4NXN E;  4X66 I;  4PU9 A;  5FWK A;  1FWK A;  4QNJ A;  4BA1 B;  2BR2 A;  3J7A G;  5C0X A;  3ZZU A;  1HNX E;  3QT6 A;  4LF6 I;  1Z5C A;  4ED4 A;  2Z5E A;  4DV4 I;  3PRY A;  2C38 B;  4I3H A;  3DD6 A;  1Y6Z A;  3J7A M;  1Z5A A;  2PNL A;  5C0X C;  2BA0 D;  2VES A;  4MU4 A;  1Y4U A;  1RRE A;  4YY3 I;  4DUZ E;  4X62 E;  3QT7 A;  2NN6 C;  4IZJ D;  4WUB A;  4LF9 E;  2VQE E;  4OX9 I;  1N36 I;  4GQU A;  4UT4 A;  3J80 C;  4DPU A;  2UXB E;  4JI7 I;  1H72 C;  4DV5 E;  4LPF A;  1J5E E;  4K0K E;  1UDS A;  2ZM6 I;  1DAR A;  4B3M I;  4JV5 I;  2WNR B;  3B4T A;  2JEA B;  5K36 E;  4JI3 E;  2UXC E;  4DR4 E;  4LF7 I;  4LFB I;  1HNW E;  3B82 A;  1YH8 A;  4DXL A;  4GKJ E;  1N32 E;  2IER A;  1Z0T A;  2WNR A;  4Z7Y A;  1UEK A;  1N33 I;  4X64 I;  2JEA A;  3GLL A;  4HY1 A;  4DR6 E;  2HKE A;  1ZXM A;  4JYA E;  3WU4 A;  3M7N G;  4DR1 I;  1NHJ A;  5K36 B;  1Z0V A;  1FJG I;  5GMD A;  1H7S A;  2CZ9 A;  4JI6 E;  2UUC I;  4RPF A;  4GKK I;  1MU5 A;  4DPY A;  4HXZ A;  4ZVI A;  3J80 Q;  4DR5 I;  5LMN I;  2UUB I;  4U3D A;  2HHH E;  4R1F A;  1B63 A;  5K36 A;  1ELO A;  1R6L A;  2O1T A;  4AQY I;  3WU5 A;  3PS3 A;  3M6A A;  2V2V A;  4DUY I;  4FW7 A;  2V8P A;  3U1K A;  3PYE A;  3K17 A;  3PYD A;  4LF8 E;  4MDT A;  1EI1 A;  2PO0 B;  2VQF E;  4LCG A;  4U3B A;  2ZM6 E;  4B3M E;  4JV5 E;  1N0V C;  2LJP A;  1H73 A;  4LFA E;  1OJ4 A;  3P3C A;  4JI5 E;  4DV0 I;  1IBK I;  4KHP I;  2V2Z A;  4LF7 E;  4MYT A;  4DV6 I;  4FW3 A;  4DV7 E;  4IFD F;  1E3P A;  1NZ0 A;  2BA1 D;  2PO2 B;  1Y60 A;  4LCH A;  3PS1 A;  4IS9 A;  1H74 A;  2Z5C B;  4PRV A;  1XMO E;  2BR2 B;  4DPX A;  3PYG A;  4X65 I;  4DPT A;  4JI8 I;  3CWV A;  4MU1 A;  2PO2 A;  4LF4 E;  1S16 A;  2NN6 B;  1E3H A;  2Z5C A;  1FJG E;  4AIM A;  1BKN A;  4JI2 I;  2GO3 A;  4QNK A;  5JEA D;  4YHH I;  5L3J A;  4DV2 E;  2JEB A;  3Q6M A;  4GKK E;  2Z5B A;  3L7Z B;  1ZM2 A;  5IWA I;  3J81 C;  4LOM A;  2UXD E;  4USM A;  2E5L I;  4DR5 E;  2BM1 A;  2JT2 A;  3JAM C;  2NPF A;  1P42 A;  4URL A;  4FWD A;  2NN6 A;  3H4L A;  4JI1 I;  1XXE A;  4AQY E;  3LTO A;  3T1Y I;  3V2U C;  4LF5 I;  3L7Z A;  4DV1 E;  4OO1 F;  4DUY E;  1HK7 A;  4USK A;  2HK2 A;  1KKH A;  2UU9 I;  4B3S I;  2BA0 G;  4JI4 E;  4DU7 A;  5JEA F;  2IES A;  3T1H E;  1XHK A;  2ZBK B;  5GME A;  5DRP A;  1PKP A;  4DV0 E;  4P52 A;  1IBK E;  4KHP E;  4DR7 I;  1ZM4 A;  2X7I A;  4DV6 E;  5DRQ A;  3P06 A;  3ZZT A;  5LL6 R;  1IBM E;  2UUA I;  4IZJ A;  5DRR A;  3QT5 A;  4DU8 A;  1K47 A;  5LMU E;  4WUD A;  4X65 E;  4B3R E;  3J81 Q;  2O3Z A;  4JI8 E;  1FKA E;  3ZKD A;  4BA2 B;  1N0U A;  5EKW A;  1R6M A;  2PO1 B;  4X66 E;  1FI4 A;  1IBL I;  1KIJ A;  1HR0 I;  2EFG A;  4KQV A;  4JI2 E;  2IOQ A;  4YHH E;  1XNQ I;  4NXM I;  1Y4S A;  4LF6 E;  2CVE A;  4DV4 E;  5IWA E;  3HUL A;  4BA2 A;  2OI2 A;  4Z7C A;  4DR3 I;  2PO1 A;  3B8H A;  3M85 D;  1N34 I;  1I94 I;  3LPS A;  3HJC A;  2HFU A;  1OYP A;  2CGE A;  4LF5 E;  4YY3 E;  4IFD D;  2F4V I;  4DPW A;  3Q1Q A;  1RHY A;  4B3S E;  4OX9 E;  1N36 E;  3D4J A;  3WU3 A;  1Z5B A;  1ZXN A;  2GS8 A;  4JI7 E;  1HNZ I;  2R42 A;  1U2R A;  1FWL A;  1RR9 A;  5K36 F;  1Z0G A;  1VI7 A;  2XEX A;  2UUA E;  4LFB E;  4DUZ I;  4OO1 E;  2GQ0 A;  3PS2 A;  4UTG A;  2VQE I;  1N33 E;  4M1K A;  4X64 E;  2F1D A;  5DRO A;  2UXB I;  2DEI A;  4HYM A;  1H7U A;  4FW4 A;  5JEA E;  3OTO I;  2JEB B;  2HKJ A;  2E1R A;  1OYS A;  2Z5B B;  1J5E I;  1IBL E;  1HR0 E;  4OO1 D;  1ZM3 A;  2J7K A;  2BA1 G;  2GO4 A;  4PRX A;  4DR1 E;  4DV3 I;  5BR8 I;  5C0X D;  1KTV A;  1D6T A;  4NXM E;  2IOP A;  4FN5 A;  4MQY A;  3U1Y A;  4JI3 I;  4DR2 I;  4DR4 I;  1USU A;  2UUC E;  2UXC I;  1Z0E A;  1HNW I;  1PVG A;  4DR3 E;  5EL9 A;  2PNM A;  4N3O A;  5LMN E;  2UUB E;  3QT8 A;  1I94 E; 
#chains in the Genus database with same CATH homology
 5FLX C;  1Z59 A;  3ZM7 A;  3ZKB A;  4P7A A;  2F4V E;  4DR6 I;  2HK3 A;  4JYA I;  2Q2E B;  4B3T I;  2X36 A;  1XMQ I;  1HNZ E;  4JI6 I;  4IZJ B;  2BV3 A;  2HHH I;  1A6F A;  4JG4 A;  4FWG A;  1USV A;  5A2Q C;  4MYU A;  3V5R A;  1XNR I;  3OTO E;  4XTJ A;  4LF8 I;  4LFC I;  2WW4 A;  2VQF I;  3JAM Q;  4HAC B;  5FLX Q;  3LNU A;  4DV3 E;  5BR8 E;  4LFA I;  2A2D A;  4JI5 I;  1NHH A;  2HFS A;  1Z0B A;  4DR2 E;  4FW9 A;  2O1W A;  4DV7 I;  2V34 A;  4WUC A;  2R3V A;  4HAC A;  2E5L E;  1QZR A;  1B62 A;  1NHI A;  1XMO I;  4JI0 I;  4JI1 E;  3T1Y E;  4NXN I;  4LF4 I;  4B3T E;  1FNM A;  2O1U A;  5IT9 C;  2UU9 E;  1XMQ E;  5A2Q Q;  4DV2 I;  1HNX I;  2UXD I;  3F0N A;  1ZM9 A;  4IZK B;  3PYF A;  2BM0 A;  3GON A;  1MX0 A;  2A2C A;  4DR7 E;  1S4E A;  3K1J A;  4DV1 I;  4X62 I;  1KVK A;  1Z0C A;  4LF9 I;  4IZK A;  1XNR E;  4JI4 I;  4LFC E;  3T1H I;  1Z0W A;  2V2Q A;  1WUU A;  4DV5 I;  1PIE A;  2AJ4 A;  4K0K I;  3K85 A;  2VF3 A;  4EMD A;  1XNQ E;  3ZZ0 A;  1IBM I;  5IT9 Q;  4GKJ I;  1N32 I;  4JI0 E;  1N34 E;  3WU6 A;  5LMU I;  3Q6N A;  2CG9 A;  4B3R I;  1VIS A;  1EA6 A;  2O1V A;  2ZIT A;  4FWH A;  3B78 A;  1MG7 A;  2DEJ A;  4NXN E;  4X66 I;  4PU9 A;  5FWK A;  1FWK A;  3J7A G;  3ZZU A;  1HNX E;  3QT6 A;  4LF6 I;  1Z5C A;  4DV4 I;  2Z5E A;  4ED4 A;  3PRY A;  4I3H A;  1Y6Z A;  3J7A M;  1Z5A A;  2PNL A;  1Y4U A;  1RRE A;  4YY3 I;  4DUZ E;  4X62 E;  3QT7 A;  4WUB A;  4IZJ D;  4LF9 E;  2VQE E;  4OX9 I;  1N36 I;  4UT4 A;  3J80 C;  4DPU A;  2UXB E;  4JI7 I;  1H72 C;  4DV5 E;  1J5E E;  4K0K E;  2ZM6 I;  4B3M I;  1DAR A;  4JV5 I;  4JI3 E;  2UXC E;  4DR4 E;  4LF7 I;  4LFB I;  1HNW E;  3B82 A;  4DXL A;  4GKJ E;  1N32 E;  1Z0T A;  4Z7Y A;  1UEK A;  1N33 I;  4X64 I;  4HY1 A;  4DR6 E;  2HKE A;  1ZXM A;  4JYA E;  3WU4 A;  4DR1 I;  1NHJ A;  1Z0V A;  1FJG I;  5GMD A;  1H7S A;  2CZ9 A;  4JI6 E;  2UUC I;  4RPF A;  4GKK I;  1MU5 A;  4DPY A;  4HXZ A;  4ZVI A;  3J80 Q;  4DR5 I;  5LMN I;  2UUB I;  2HHH E;  4R1F A;  1B63 A;  1ELO A;  2O1T A;  4AQY I;  3WU5 A;  3M6A A;  2V2V A;  4DUY I;  2V8P A;  3PYE A;  3K17 A;  3PYD A;  4LF8 E;  1EI1 A;  2VQF E;  2ZM6 E;  4B3M E;  4JV5 E;  1N0V C;  2LJP A;  1H73 A;  4LFA E;  1OJ4 A;  4JI5 E;  4DV0 I;  1IBK I;  4KHP I;  2V2Z A;  4LF7 E;  4MYT A;  4DV6 I;  4DV7 E;  1NZ0 A;  1H74 A;  2Z5C B;  4PRV A;  1XMO E;  4DPX A;  3PYG A;  4X65 I;  4DPT A;  4JI8 I;  3CWV A;  4LF4 E;  1S16 A;  2Z5C A;  1FJG E;  4JI2 I;  1BKN A;  4DV2 E;  4YHH I;  5L3J A;  3Q6M A;  4GKK E;  2Z5B A;  1ZM2 A;  5IWA I;  3J81 C;  2UXD E;  4USM A;  2E5L I;  4DR5 E;  2BM1 A;  3JAM C;  2NPF A;  4URL A;  4FWD A;  3H4L A;  4JI1 I;  4AQY E;  3LTO A;  3T1Y I;  3V2U C;  4LF5 I;  4DV1 E;  4DUY E;  1HK7 A;  4USK A;  2HK2 A;  1KKH A;  2UU9 I;  4B3S I;  4JI4 E;  4DU7 A;  3T1H E;  1XHK A;  2ZBK B;  5GME A;  1PKP A;  4DV0 E;  4P52 A;  1IBK E;  4KHP E;  4DR7 I;  1ZM4 A;  2X7I A;  4DV6 E;  3P06 A;  3ZZT A;  5LL6 R;  1IBM E;  2UUA I;  4IZJ A;  3QT5 A;  4DU8 A;  1K47 A;  5LMU E;  4WUD A;  4X65 E;  4B3R E;  3J81 Q;  4JI8 E;  1FKA E;  3ZKD A;  1N0U A;  4X66 E;  1FI4 A;  1IBL I;  1KIJ A;  1HR0 I;  2EFG A;  4KQV A;  4JI2 E;  2IOQ A;  4YHH E;  1XNQ I;  4NXM I;  1Y4S A;  4LF6 E;  4DV4 E;  5IWA E;  3HUL A;  2OI2 A;  4Z7C A;  4DR3 I;  3B8H A;  1N34 I;  1I94 I;  3LPS A;  3HJC A;  2HFU A;  2CGE A;  4LF5 E;  4YY3 E;  2F4V I;  4DPW A;  3Q1Q A;  4B3S E;  4OX9 E;  1N36 E;  3D4J A;  3WU3 A;  1Z5B A;  1ZXN A;  2GS8 A;  4JI7 E;  1HNZ I;  2R42 A;  1U2R A;  1FWL A;  1RR9 A;  1Z0G A;  2XEX A;  2UUA E;  4LFB E;  4DUZ I;  2GQ0 A;  4UTG A;  2VQE I;  1N33 E;  4M1K A;  4X64 E;  2UXB I;  2DEI A;  4HYM A;  1H7U A;  3OTO I;  2HKJ A;  2E1R A;  2Z5B B;  1J5E I;  1IBL E;  1HR0 E;  1ZM3 A;  2J7K A;  4PRX A;  4DR1 E;  4DV3 I;  5BR8 I;  1KTV A;  1D6T A;  4NXM E;  2IOP A;  4FN5 A;  4JI3 I;  4DR2 I;  4DR4 I;  1USU A;  2UUC E;  2UXC I;  1Z0E A;  1HNW I;  1PVG A;  4DR3 E;  2PNM A;  4N3O A;  5LMN E;  2UUB E;  3QT8 A;  1I94 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...