2HHHI

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2hhhI00
1BKNA 1HNXE 1Z0WA 1Z5CA 2HK3A 4DR5E 2DEIA 4JV5I 4DR7I 2UXCE 3PYEA 4DV3I 4JI2I 1Z0CA 1Z5AA 2UXBI 4RPFA 3Q1QA 4DV5E 4LF5E 4FWGA 2VF3A 1B62A 1N0VC 1ZM9A 4B3TI 3B78A 1NHJA 2NPFA 1J5EI 3QT7A 3F0NA 1XMOE 4DV4I 4B3RE 1UEKA 1OJ4A 2UU9I 2BM1A 4DR2E 1HR0E 2ZM6I 4JI5I 4FWHA 4JI3I 2R3VA 3ZKBA 1FKAE 2ZITA 1MU5A 1XNRI 1WUUA 1D6TA 2UUBE 5GMDA 2HKEA 4DV2E 4PRVA 4NXNE 4DV6E 3ZKDA 4LFBI 4X66E 4KHPI 1IBME 1Z0BA 2HFUA 1NZ0A 3JAMQ 3JAMC 4DU8A 2E5LE 3CWVA 2A2DA 2VQFE 2HHHE 1PKPA 2HFSA 2V2ZA 4HYMA 2UUAI 4DU7A 4LFCE 4LF6I 3T1YE 1IBLI 4LF8E 4DV1I 1N33E 3WU5A 4Z7CA 5L3JA 4YHHI 4X62I 1U2RA 2UXDI 4PRXA 3J7AM 4JI4E 4DUYI 4NXME 1S4EA 2Q2EB 1EA6A 2V34A 3PYDA 4JI1I 4DR3E 4JI7I 2UUCI 1VISA 4DR6E 4UT4A 1N36E 4OX9I 4LF4E 4GKJE 3PYFA 4USKA 5LMNI 4JI6I 3K1JA 1K47A 1PIEA 1N34I 2V2QA 1Z5BA 5BR8I 1Z59A 1HNXI 1ZM4A 4DV0I 4JV5E 4DV3E 2J7KA 4DPTA 2UXBE 4WUCA 5LMUE 4DXLA 3H4LA 5LL6R 4B3TE 5IWAI 1XHKA 3ZM7A 3J7AG 2AJ4A 4WUBA 1I94E 1A6FA 2E1RA 4AQYI 4M1KA 1RR9A 2UU9E 1MX0A 1ZM2A 2X7IA 3T1HI 1MG7A 3WU4A 1NHHA 4B3RI 2ZM6E 4JI5E 4JI3E 4HY1A 4LF9E 2HKJA 4FN5A 1KTVA 1HR0I 4MYUA 4P52A 1H7SA 3B82A 4WUDA 4KQVA 3OTOI 1HNZE 3V2UC 3ZZ0A 3ZZTA 4K0KI 1ELOA 4X65E 1IBKI 4JI0I 4USMA 4KHPE 2F4VI 4JYAI 4LFAE 1DARA 4UTGA 1FNMA 4JI8I 4B3MI 4DUZI 4Z7YA 5FLXQ 5FLXC 2VQEI 1Z0VA 3PYGA 2HK2A 2WW4A 1FJGI 4JG4A 2HHHI 1Z0EA 4LF6E 1IBLE 3B8HA 4GKKI 4B3SI 2ZBKB 4YY3E 4DR1I 3LPSA 1QZRA 2EFGA 4LFCI 4ZVIA 3T1YI 4LF7I 4YHHE 3LNUA 4X62E 1XNQI 2UXDE 1PVGA 4X64I 4DUYE 4DPXA 4DR4I 1N32I 2OI2A 4MYTA 1XMQI 4HACA 4JI7E 2UUCE 3J81Q 3J81C 4NXMI 1HNWI 1ZXNA 4OX9E 1Z0GA 3J80Q 3QT8A 3J80C 4DV7I 4JI6E 4DR7E 1KKHA 1ZM3A 1N34E 4JI2E 5BR8E 3QT6A 4DV0E 1RREA 1N0UA 1KVKA 1EI1A 4DR5I 1H73A 2UXCI 3WU6A 2LJPA 3ZZUA 4DV5I 5IWAE 4LF5I 1J5EE 4DPUA 4DV4E 5LMUI 1H72C 4AQYE 5A2QQ 5A2QC 4P7AA 1FWLA 1XMOI 1I94I 3T1HE 3HULA 4DR2I 1H7UA 4I3HA 1NHIA 1XNRE 4DPWA 2V8PA 1FWKA 4EMDA 4LFBE 4LF9I 3OTOE 2BV3A 2X36A 2UUBI 3M6AA 3LTOA 4K0KE 1B63A 1IBKE 4DV2I 4JI0E 4NXNI 4DV6I 2F4VE 4JYAE 1HNZI 3GONA 2A2CA 4X66I 4FWDA 1IBMI 1KIJA 4JI8E 4B3ME 5IT9C 4DUZE 5IT9Q 4X65I 4XTJA 2VQEE 1Z0TA 4LFAI 2CZ9A 2BM0A 4URLA 2E5LI 3WU3A 2V2VA 2UUAE 3D4JA 2VQFI 1FJGE 2GS8A 3K17A 4DPYA 1S16A 4DV1E 4ED4A 4GKKE 4B3SE 4R1FA 1H74A 4DR1E 2XEXA 4LF7E 4LF8I 1N33I 2DEJA 1XNQE 4YY3I 4X64E 1FI4A 4JI1E 1N32E 4DR4E 4JI4I 2R42A 3QT5A 3V5RA 4HXZA 1XMQE 4FW9A 5LMNE 4DR3I 1HNWE 5GMEA 4HACB 4DR6I 4DV7E 1N36I 4GKJI 4LF4I 4PU9A 1ZXMA
chains in the Genus database with same CATH superfamily
1BKNA 4GQUA 3Q6NA 1HNXE 2O1WA 3GLLA 3PRYA 1Z0WA 3M7ND 1Z5CA 4IFDE 4IFDC 1UDQA 2HK3A 5DROA 4DR5E 2DEIA 4JV5I 4DR7I 2UXCE 2IOQA 3PYEA 4DV3I 4OO1F 4JI2I 1Z0CA 1Z5AA 2UXBI 4RPFA 3Q1QA 3L7ZA 4DV5E 4MU4A 5JEAB 4LF5E 4FWGA 4AM3A 2VF3A 2WP8B 1B62A 1N0VC 2PNZA 1ZM9A 4B3TI 3B78A 2BA1G 1NHJA 2NPFA 5EKWA 1J5EI 3QT7A 2J65A 3F0NA 1XMOE 3U1KA 4DV4I 4B3RE 1UEKA 1OJ4A 2UU9I 4IFDF 5K36A 2BM1A 4DR2E 2Z5BB 4QNKA 2C39A 1HR0E 2ZM6I 4MU1A 4JI5I 4FWHA 4JI3I 2CG9A 2PO0B 2R3VA 3ZKBA 1FKAE 2ZITA 2VESA 1UDOA 1MU5A 5C0XE 5C0XC 1XXEA 2C39B 1YHCA 1XNRI 1WUUA 1D6TA 3PS1A 2UUBE 3B4TA 4BA1A 5GMDA 2HKEA 4DV2E 4PRVA 4NXNE 4DV6E 3ZKDA 4LFBI 4FW3A 4X66E 4KHPI 1IBME 1Z0BA 4MU3A 2HFUA 1NZ0A 3JAMQ 3JAMC 4IZJA 2Z5CA 4MQYA 4DU8A 2E5LE 4IZKA 4LCFA 3CWVA 2CVEA 2A2DA 2VQFE 2HHHE 5C0XF 5DRPA 1PKPA 2HFSA 4IZJB 2V2ZA 4HYMA 4LPFA 2UUAI 4DU7A 5DNLA 4LFCE 4LF6I 3T1YE 1IBLI 2JE6B 5K36D 4FW6A 4LF8E 4DV1I 2O3ZA 4OO1A 1N33E 3WU5A 4Z7CA 5L3JA 4YHHI 4LCHA 4X62I 1U2RA 2IESA 2UXDI 2PNLA 4J3DA 4PRXA 3J7AM 1R6MA 4JI4E 2PO1B 4DUYI 4NXME 1S4EA 2PO2A 4LCGA 2Q2EB 2NN6B 1EA6A 2V34A 3PYDA 4JI1I 4DR3E 4JI7I 2UUCI 4IFDA 1VISA 4DR6E 2F1DA 4IS9A 4UT4A 1N36E 4OX9I 4LF4E 4GKJE 3PYFA 4USKA 1Y5YA 5LMNI 4MDTA 2GQ0A 4JI6I 3K1JA 1K47A 1PIEA 4FW4A 4IZJD 2V2QA 1N34I 1Z5BA 5BR8I 1Z59A 1HNXI 1ZM4A 4DV0I 4JV5E 3CDJA 2JEBA 4DV3E 2J7KA 4DPTA 2UXBE 4WUCA 5LMUE 1R6LA 4DXLA 3H4LA 1E3PA 5LL6R 4B3TE 5IWAI 1XHKA 2C37A 3L7ZB 3ZM7A 3J7AG 2AJ4A 4WUBA 1USUA 1I94E 5JEAC 5JEAE 1A6FA 2PNZB 2E1RA 4AQYI 4M1KA 4OO1D 1RR9A 2UU9E 1MX0A 1ZM2A 2NN6D 2X7IA 3T1HI 1MG7A 5C0XA 1OYPA 4LOMA 3WU4A 5DNXA 3P3CA 1NHHA 4B3RI 2ZM6E 4JI5E 5K36B 3NZKA 4JI3E 4HY1A 3PS2A 4LF9E 2HKJA 4FN5A 1KTVA 2Z5EA 5ELWA 1HR0I 4MYUA 5C0XB 4IFDD 4P52A 1H7SA 2IOPA 1RHYA 3B82A 4WUDA 5JEAF 4KQVA 1Y60A 3OTOI 1HNZE 4AIDA 3V2UC 3ZZ0A 3ZZTA 4K0KI 1ELOA 4BA1B 4X65E 1IBKI 4JI0I 4USMA 2WNRA 4U3DA 4KHPE 2F4VI 4JYAI 4LFAE 2JT2A 1DARA 4QNJA 2BR2A 2AE8A 4UTGA 2JEAA 3DD6A 1FNMA 4JI8I 4B3MI 4DUZI 4Z7YA 5FLXQ 5FLXC 2VQEI 1Z0VA 1HK7A 3PYGA 2Z5CB 2HK2A 3M85G 4IZKB 1VI7A 2WW4A 1FJGI 4JG4A 3GCMA 2HHHI 1Z0EA 4BA2A 4N3OA 4LF6E 1IBLE 5DRQA 3B8HA 3GMEA 4GKKI 1P42A 4B3SI 2ZBKB 4YY3E 4DR1I 5C0XD 3LPSA 1QZRA 2BA1D 2EFGA 4LFCI 4ZVIA 3T1YI 4LF7I 1Y4SA 4YHHE 4BA2B 5EL9A 3LNUA 4X62E 1XNQI 4OO1B 2UXDE 1PVGA 4X64I 3P3EA 4DUYE 4DPXA 4DR4I 1N32I 2OI2A 4MYTA 1XMQI 3HJCA 4HACA 2C38A 4JI7E 2PO2B 2UUCE 3J81Q 3J81C 4NXMI 3KRNA 1HNWI 1ZXNA 4OX9E 2IERA 1Z0GA 4IFDB 3J80Q 3QT8A 3J80C 4DV7I 2C38B 4JI6E 1Y4UA 3UHMA 1OYSA 4DR7E 1KKHA 1ZM3A 1N34E 2O1UA 4JI2E 5BR8E 3QT6A 4DV0E 1RREA 1N0UA 1KVKA 1EI1A 4DR5I 1H73A 2UXCI 5JEAA 3WU6A 2WP8A 2JEBB 2LJPA 3HKMA 3ZZUA 4DV5I 3Q6MA 5IWAE 1J5EE 4LF5I 4DPUA 4FW7A 4DV4E 5LMUI 2NN6F 1H72C 5FWKA 2O1TA 4AQYE 2C37B 5A2QQ 5A2QC 4P7AA 1YH8A 1FWLA 4MU0A 1XMOI 1I94I 2Z5BA 3M85D 3T1HE 2BA0G 3HULA 4DR2I 1H7UA 2PO0A 4OZEA 4I3HA 1NHIA 1XNRE 3P3GA 4DPWA 2V8PA 1FWKA 5DRRA 3K85A 5K36E 5K36C 3M7NG 2GO3A 4EMDA 4ISAA 4LFBE 4LF9I 3OTOE 2BV3A 2X36A 2UUBI 3M6AA 3LTOA 4K0KE 1B63A 1IBKE 4DV2I 4JI0E 4NXNI 4DV6I 2F4VE 4JYAE 1USVA 3GONA 1HNZI 2A2CA 3PS3A 4X66I 4FWDA 1IBMI 1KIJA 4JI8E 4B3ME 2WNRB 5IT9C 4DUZE 5IT9Q 4X65I 4XTJA 2VQEE 5JEAD 1Z0TA 2BR2B 2JEAB 4LFAI 2CGEA 2CZ9A 2BM0A 4URLA 2E5LI 3WU3A 4U3BA 5K36F 2V2VA 2UUAE 3D4JA 2VQFI 3H1CA 1FJGE 2GS8A 1E3HA 3K17A 4DPYA 2JE6A 1S16A 2GO4A 2O1VA 4DV1E 4ED4A 4GKKE 4B3SE 4R1FA 4NBQA 1UDNA 1H74A 3P06A 3P76A 4DR1E 3U1YA 2XEXA 4LF7E 4LF8I 1N33I 4OKGA 2DEJA 1XNQE 2PNMA 1Y6ZA 2PO1A 4YY3I 3CDIA 4X64E 1FI4A 4JI1E 1N32E 4DR4E 2NN6A 4JI4I 2R42A 4OO1C 4OO1E 3QT5A 3V5RA 4HXZA 1XMQE 4FW9A 2NN6C 2NN6E 2BA0D 5LMNE 4DR3I 1HNWE 5GMEA 4HACB 4DR6I 1OYRA 1UDSA 4AIMA 4FW5A 4DV7E 1N36I 4LF4I 4PU9A 4GKJI 1ZXMA
chains in the Genus database with same CATH topology
1BKNA 3Q6NA 1HNXE 2O1WA 3PRYA 1Z0WA 1Z5CA 2HK3A 4DR5E 2DEIA 4JV5I 4DR7I 2UXCE 2IOQA 3PYEA 4DV3I 4JI2I 1Z0CA 1Z5AA 2UXBI 4RPFA 3Q1QA 4DV5E 4LF5E 4FWGA 2VF3A 1B62A 1N0VC 1ZM9A 4B3TI 3B78A 1NHJA 2NPFA 1J5EI 3QT7A 3F0NA 1XMOE 4DV4I 4B3RE 1UEKA 1OJ4A 2UU9I 2BM1A 4DR2E 2Z5BB 1HR0E 2ZM6I 4JI5I 4FWHA 4JI3I 2CG9A 2R3VA 3ZKBA 1FKAE 2ZITA 1MU5A 1XNRI 1WUUA 1D6TA 2UUBE 5GMDA 2HKEA 4DV2E 4PRVA 4NXNE 4DV6E 3ZKDA 4LFBI 4X66E 4KHPI 1IBME 1Z0BA 2HFUA 1NZ0A 3JAMQ 3JAMC 4IZJA 2Z5CA 4DU8A 2E5LE 4IZKA 3CWVA 2A2DA 2VQFE 2HHHE 1PKPA 2HFSA 4IZJB 2V2ZA 4HYMA 2UUAI 4DU7A 4LFCE 4LF6I 3T1YE 1IBLI 4LF8E 4DV1I 1N33E 3WU5A 4Z7CA 5L3JA 4YHHI 4X62I 1U2RA 2UXDI 2PNLA 4PRXA 3J7AM 4JI4E 4DUYI 4NXME 1S4EA 2Q2EB 1EA6A 2V34A 3PYDA 4JI1I 4DR3E 4JI7I 2UUCI 1VISA 4DR6E 4UT4A 1N36E 4OX9I 4LF4E 4GKJE 3PYFA 4USKA 5LMNI 2GQ0A 4JI6I 3K1JA 1K47A 1PIEA 4IZJD 1N34I 2V2QA 1Z5BA 5BR8I 1Z59A 1HNXI 1ZM4A 4DV0I 4JV5E 4DV3E 2J7KA 4DPTA 2UXBE 4WUCA 5LMUE 4DXLA 3H4LA 5LL6R 4B3TE 5IWAI 1XHKA 3ZM7A 3J7AG 2AJ4A 4WUBA 1USUA 1I94E 1A6FA 2E1RA 4AQYI 4M1KA 1RR9A 2UU9E 1MX0A 1ZM2A 2X7IA 3T1HI 1MG7A 3WU4A 1NHHA 4B3RI 2ZM6E 4JI5E 4JI3E 4HY1A 4LF9E 2HKJA 4FN5A 1KTVA 2Z5EA 1HR0I 4MYUA 4P52A 1H7SA 2IOPA 3B82A 4WUDA 4KQVA 3OTOI 1HNZE 3V2UC 3ZZ0A 3ZZTA 4K0KI 1ELOA 4X65E 1IBKI 4JI0I 4USMA 4KHPE 2F4VI 4JYAI 4LFAE 1DARA 4UTGA 1FNMA 4JI8I 4B3MI 4DUZI 4Z7YA 5FLXQ 5FLXC 2VQEI 1Z0VA 1HK7A 3PYGA 2Z5CB 2HK2A 4IZKB 2WW4A 1FJGI 4JG4A 2HHHI 1Z0EA 4N3OA 4LF6E 1IBLE 3B8HA 4GKKI 4B3SI 2ZBKB 4YY3E 4DR1I 3LPSA 1QZRA 2EFGA 4LFCI 4ZVIA 3T1YI 4LF7I 1Y4SA 4YHHE 3LNUA 4X62E 1XNQI 2UXDE 1PVGA 4X64I 4DUYE 4DPXA 4DR4I 1N32I 2OI2A 4MYTA 1XMQI 3HJCA 4HACA 4JI7E 2UUCE 3J81Q 3J81C 4NXMI 1HNWI 1ZXNA 4OX9E 1Z0GA 3J80Q 3QT8A 3J80C 4DV7I 4JI6E 1Y4UA 4DR7E 1KKHA 1ZM3A 1N34E 2O1UA 4JI2E 5BR8E 3QT6A 4DV0E 1RREA 1N0UA 1KVKA 1EI1A 4DR5I 1H73A 2UXCI 3WU6A 2LJPA 3ZZUA 4DV5I 3Q6MA 5IWAE 1J5EE 4LF5I 4DPUA 4DV4E 5LMUI 1H72C 5FWKA 2O1TA 4AQYE 5A2QQ 5A2QC 4P7AA 1FWLA 1XMOI 1I94I 2Z5BA 3T1HE 3HULA 4DR2I 1H7UA 4I3HA 1NHIA 1XNRE 4DPWA 2V8PA 1FWKA 3K85A 4EMDA 4LFBE 4LF9I 3OTOE 2BV3A 2X36A 2UUBI 3M6AA 3LTOA 4K0KE 1B63A 1IBKE 4DV2I 4JI0E 4NXNI 4DV6I 2F4VE 4JYAE 1USVA 3GONA 1HNZI 2A2CA 4X66I 4FWDA 1IBMI 1KIJA 4JI8E 4B3ME 5IT9C 4DUZE 5IT9Q 4X65I 4XTJA 2VQEE 1Z0TA 4LFAI 2CGEA 2CZ9A 2BM0A 4URLA 2E5LI 3WU3A 2V2VA 2UUAE 3D4JA 2VQFI 1FJGE 2GS8A 3K17A 4DPYA 1S16A 2O1VA 4DV1E 4ED4A 4GKKE 4B3SE 4R1FA 1H74A 3P06A 4DR1E 2XEXA 4LF7E 4LF8I 1N33I 2DEJA 1XNQE 2PNMA 1Y6ZA 4YY3I 4X64E 1FI4A 4JI1E 1N32E 4DR4E 4JI4I 2R42A 3QT5A 3V5RA 4HXZA 1XMQE 4FW9A 5LMNE 4DR3I 1HNWE 5GMEA 4HACB 4DR6I 4DV7E 1N36I 4GKJI 4LF4I 4PU9A 1ZXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKN A;  1HNX E;  1Z0W A;  1Z5C A;  2HK3 A;  4DR5 E;  2DEI A;  4JV5 I;  4DR7 I;  2UXC E;  3PYE A;  4DV3 I;  4JI2 I;  1Z0C A;  1Z5A A;  2UXB I;  4RPF A;  3Q1Q A;  4DV5 E;  4LF5 E;  4FWG A;  2VF3 A;  1B62 A;  1N0V C;  1ZM9 A;  4B3T I;  3B78 A;  1NHJ A;  2NPF A;  1J5E I;  3QT7 A;  3F0N A;  1XMO E;  4DV4 I;  4B3R E;  1UEK A;  1OJ4 A;  2UU9 I;  2BM1 A;  4DR2 E;  1HR0 E;  2ZM6 I;  4JI5 I;  4FWH A;  4JI3 I;  2R3V A;  3ZKB A;  1FKA E;  2ZIT A;  1MU5 A;  1XNR I;  1WUU A;  1D6T A;  2UUB E;  5GMD A;  2HKE A;  4DV2 E;  4PRV A;  4NXN E;  4DV6 E;  3ZKD A;  4LFB I;  4X66 E;  4KHP I;  1IBM E;  1Z0B A;  2HFU A;  1NZ0 A;  3JAM Q;  3JAM C;  4DU8 A;  2E5L E;  3CWV A;  2A2D A;  2VQF E;  2HHH E;  1PKP A;  2HFS A;  2V2Z A;  4HYM A;  2UUA I;  4DU7 A;  4LFC E;  4LF6 I;  3T1Y E;  1IBL I;  4LF8 E;  4DV1 I;  1N33 E;  3WU5 A;  4Z7C A;  5L3J A;  4YHH I;  4X62 I;  1U2R A;  2UXD I;  4PRX A;  3J7A M;  4JI4 E;  4DUY I;  4NXM E;  1S4E A;  2Q2E B;  1EA6 A;  2V34 A;  3PYD A;  4JI1 I;  4DR3 E;  4JI7 I;  2UUC I;  1VIS A;  4DR6 E;  4UT4 A;  1N36 E;  4OX9 I;  4LF4 E;  4GKJ E;  3PYF A;  4USK A;  5LMN I;  4JI6 I;  3K1J A;  1K47 A;  1PIE A;  1N34 I;  2V2Q A;  1Z5B A;  5BR8 I;  1Z59 A;  1HNX I;  1ZM4 A;  4DV0 I;  4JV5 E;  4DV3 E;  2J7K A;  4DPT A;  2UXB E;  4WUC A;  5LMU E;  4DXL A;  3H4L A;  5LL6 R;  4B3T E;  5IWA I;  1XHK A;  3ZM7 A;  3J7A G;  2AJ4 A;  4WUB A;  1I94 E;  1A6F A;  2E1R A;  4AQY I;  4M1K A;  1RR9 A;  2UU9 E;  1MX0 A;  1ZM2 A;  2X7I A;  3T1H I;  1MG7 A;  3WU4 A;  1NHH A;  4B3R I;  2ZM6 E;  4JI5 E;  4JI3 E;  4HY1 A;  4LF9 E;  2HKJ A;  4FN5 A;  1KTV A;  1HR0 I;  4MYU A;  4P52 A;  1H7S A;  3B82 A;  4WUD A;  4KQV A;  3OTO I;  1HNZ E;  3V2U C;  3ZZ0 A;  3ZZT A;  4K0K I;  1ELO A;  4X65 E;  1IBK I;  4JI0 I;  4USM A;  4KHP E;  2F4V I;  4JYA I;  4LFA E;  1DAR A;  4UTG A;  1FNM A;  4JI8 I;  4B3M I;  4DUZ I;  4Z7Y A;  5FLX Q;  5FLX C;  2VQE I;  1Z0V A;  3PYG A;  2HK2 A;  2WW4 A;  1FJG I;  4JG4 A;  2HHH I;  1Z0E A;  4LF6 E;  1IBL E;  3B8H A;  4GKK I;  4B3S I;  2ZBK B;  4YY3 E;  4DR1 I;  3LPS A;  1QZR A;  2EFG A;  4LFC I;  4ZVI A;  3T1Y I;  4LF7 I;  4YHH E;  3LNU A;  4X62 E;  1XNQ I;  2UXD E;  1PVG A;  4X64 I;  4DUY E;  4DPX A;  4DR4 I;  1N32 I;  2OI2 A;  4MYT A;  1XMQ I;  4HAC A;  4JI7 E;  2UUC E;  3J81 Q;  3J81 C;  4NXM I;  1HNW I;  1ZXN A;  4OX9 E;  1Z0G A;  3J80 Q;  3QT8 A;  3J80 C;  4DV7 I;  4JI6 E;  4DR7 E;  1KKH A;  1ZM3 A;  1N34 E;  4JI2 E;  5BR8 E;  3QT6 A;  4DV0 E;  1RRE A;  1N0U A;  1KVK A;  1EI1 A;  4DR5 I;  1H73 A;  2UXC I;  3WU6 A;  2LJP A;  3ZZU A;  4DV5 I;  5IWA E;  4LF5 I;  1J5E E;  4DPU A;  4DV4 E;  5LMU I;  1H72 C;  4AQY E;  5A2Q Q;  5A2Q C;  4P7A A;  1FWL A;  1XMO I;  1I94 I;  3T1H E;  3HUL A;  4DR2 I;  1H7U A;  4I3H A;  1NHI A;  1XNR E;  4DPW A;  2V8P A;  1FWK A;  4EMD A;  4LFB E;  4LF9 I;  3OTO E;  2BV3 A;  2X36 A;  2UUB I;  3M6A A;  3LTO A;  4K0K E;  1B63 A;  1IBK E;  4DV2 I;  4JI0 E;  4NXN I;  4DV6 I;  2F4V E;  4JYA E;  1HNZ I;  3GON A;  2A2C A;  4X66 I;  4FWD A;  1IBM I;  1KIJ A;  4JI8 E;  4B3M E;  5IT9 C;  4DUZ E;  5IT9 Q;  4X65 I;  4XTJ A;  2VQE E;  1Z0T A;  4LFA I;  2CZ9 A;  2BM0 A;  4URL A;  2E5L I;  3WU3 A;  2V2V A;  2UUA E;  3D4J A;  2VQF I;  1FJG E;  2GS8 A;  3K17 A;  4DPY A;  1S16 A;  4DV1 E;  4ED4 A;  4GKK E;  4B3S E;  4R1F A;  1H74 A;  4DR1 E;  2XEX A;  4LF7 E;  4LF8 I;  1N33 I;  2DEJ A;  1XNQ E;  4YY3 I;  4X64 E;  1FI4 A;  4JI1 E;  1N32 E;  4DR4 E;  4JI4 I;  2R42 A;  3QT5 A;  3V5R A;  4HXZ A;  1XMQ E;  4FW9 A;  5LMN E;  4DR3 I;  1HNW E;  5GME A;  4HAC B;  4DR6 I;  4DV7 E;  1N36 I;  4GKJ I;  4LF4 I;  4PU9 A;  1ZXM A; 
#chains in the Genus database with same CATH topology
 1BKN A;  4GQU A;  3Q6N A;  1HNX E;  2O1W A;  3GLL A;  3PRY A;  1Z0W A;  3M7N D;  1Z5C A;  4IFD E;  4IFD C;  1UDQ A;  2HK3 A;  5DRO A;  4DR5 E;  2DEI A;  4JV5 I;  4DR7 I;  2UXC E;  2IOQ A;  3PYE A;  4DV3 I;  4OO1 F;  4JI2 I;  1Z0C A;  1Z5A A;  2UXB I;  4RPF A;  3Q1Q A;  3L7Z A;  4DV5 E;  4MU4 A;  5JEA B;  4LF5 E;  4FWG A;  4AM3 A;  2VF3 A;  2WP8 B;  1B62 A;  1N0V C;  2PNZ A;  1ZM9 A;  4B3T I;  3B78 A;  2BA1 G;  1NHJ A;  2NPF A;  5EKW A;  1J5E I;  3QT7 A;  2J65 A;  3F0N A;  1XMO E;  3U1K A;  4DV4 I;  4B3R E;  1UEK A;  1OJ4 A;  2UU9 I;  4IFD F;  5K36 A;  2BM1 A;  4DR2 E;  2Z5B B;  4QNK A;  2C39 A;  1HR0 E;  2ZM6 I;  4MU1 A;  4JI5 I;  4FWH A;  4JI3 I;  2CG9 A;  2PO0 B;  2R3V A;  3ZKB A;  1FKA E;  2ZIT A;  2VES A;  1UDO A;  1MU5 A;  5C0X E;  5C0X C;  1XXE A;  2C39 B;  1YHC A;  1XNR I;  1WUU A;  1D6T A;  3PS1 A;  2UUB E;  3B4T A;  4BA1 A;  5GMD A;  2HKE A;  4DV2 E;  4PRV A;  4NXN E;  4DV6 E;  3ZKD A;  4LFB I;  4FW3 A;  4X66 E;  4KHP I;  1IBM E;  1Z0B A;  4MU3 A;  2HFU A;  1NZ0 A;  3JAM Q;  3JAM C;  4IZJ A;  2Z5C A;  4MQY A;  4DU8 A;  2E5L E;  4IZK A;  4LCF A;  3CWV A;  2CVE A;  2A2D A;  2VQF E;  2HHH E;  5C0X F;  5DRP A;  1PKP A;  2HFS A;  4IZJ B;  2V2Z A;  4HYM A;  4LPF A;  2UUA I;  4DU7 A;  5DNL A;  4LFC E;  4LF6 I;  3T1Y E;  1IBL I;  2JE6 B;  5K36 D;  4FW6 A;  4LF8 E;  4DV1 I;  2O3Z A;  4OO1 A;  1N33 E;  3WU5 A;  4Z7C A;  5L3J A;  4YHH I;  4LCH A;  4X62 I;  1U2R A;  2IES A;  2UXD I;  2PNL A;  4J3D A;  4PRX A;  3J7A M;  1R6M A;  4JI4 E;  2PO1 B;  4DUY I;  4NXM E;  1S4E A;  2PO2 A;  4LCG A;  2Q2E B;  2NN6 B;  1EA6 A;  2V34 A;  3PYD A;  4JI1 I;  4DR3 E;  4JI7 I;  2UUC I;  4IFD A;  1VIS A;  4DR6 E;  2F1D A;  4IS9 A;  4UT4 A;  1N36 E;  4OX9 I;  4LF4 E;  4GKJ E;  3PYF A;  4USK A;  1Y5Y A;  5LMN I;  4MDT A;  2GQ0 A;  4JI6 I;  3K1J A;  1K47 A;  1PIE A;  4FW4 A;  4IZJ D;  2V2Q A;  1N34 I;  1Z5B A;  5BR8 I;  1Z59 A;  1HNX I;  1ZM4 A;  4DV0 I;  4JV5 E;  3CDJ A;  2JEB A;  4DV3 E;  2J7K A;  4DPT A;  2UXB E;  4WUC A;  5LMU E;  1R6L A;  4DXL A;  3H4L A;  1E3P A;  5LL6 R;  4B3T E;  5IWA I;  1XHK A;  2C37 A;  3L7Z B;  3ZM7 A;  3J7A G;  2AJ4 A;  4WUB A;  1USU A;  1I94 E;  5JEA C;  5JEA E;  1A6F A;  2PNZ B;  2E1R A;  4AQY I;  4M1K A;  4OO1 D;  1RR9 A;  2UU9 E;  1MX0 A;  1ZM2 A;  2NN6 D;  2X7I A;  3T1H I;  1MG7 A;  5C0X A;  1OYP A;  4LOM A;  3WU4 A;  5DNX A;  3P3C A;  1NHH A;  4B3R I;  2ZM6 E;  4JI5 E;  5K36 B;  3NZK A;  4JI3 E;  4HY1 A;  3PS2 A;  4LF9 E;  2HKJ A;  4FN5 A;  1KTV A;  2Z5E A;  5ELW A;  1HR0 I;  4MYU A;  5C0X B;  4IFD D;  4P52 A;  1H7S A;  2IOP A;  1RHY A;  3B82 A;  4WUD A;  5JEA F;  4KQV A;  1Y60 A;  3OTO I;  1HNZ E;  4AID A;  3V2U C;  3ZZ0 A;  3ZZT A;  4K0K I;  1ELO A;  4BA1 B;  4X65 E;  1IBK I;  4JI0 I;  4USM A;  2WNR A;  4U3D A;  4KHP E;  2F4V I;  4JYA I;  4LFA E;  2JT2 A;  1DAR A;  4QNJ A;  2BR2 A;  2AE8 A;  4UTG A;  2JEA A;  3DD6 A;  1FNM A;  4JI8 I;  4B3M I;  4DUZ I;  4Z7Y A;  5FLX Q;  5FLX C;  2VQE I;  1Z0V A;  1HK7 A;  3PYG A;  2Z5C B;  2HK2 A;  3M85 G;  4IZK B;  1VI7 A;  2WW4 A;  1FJG I;  4JG4 A;  3GCM A;  2HHH I;  1Z0E A;  4BA2 A;  4N3O A;  4LF6 E;  1IBL E;  5DRQ A;  3B8H A;  3GME A;  4GKK I;  1P42 A;  4B3S I;  2ZBK B;  4YY3 E;  4DR1 I;  5C0X D;  3LPS A;  1QZR A;  2BA1 D;  2EFG A;  4LFC I;  4ZVI A;  3T1Y I;  4LF7 I;  1Y4S A;  4YHH E;  4BA2 B;  5EL9 A;  3LNU A;  4X62 E;  1XNQ I;  4OO1 B;  2UXD E;  1PVG A;  4X64 I;  3P3E A;  4DUY E;  4DPX A;  4DR4 I;  1N32 I;  2OI2 A;  4MYT A;  1XMQ I;  3HJC A;  4HAC A;  2C38 A;  4JI7 E;  2PO2 B;  2UUC E;  3J81 Q;  3J81 C;  4NXM I;  3KRN A;  1HNW I;  1ZXN A;  4OX9 E;  2IER A;  1Z0G A;  4IFD B;  3J80 Q;  3QT8 A;  3J80 C;  4DV7 I;  2C38 B;  4JI6 E;  1Y4U A;  3UHM A;  1OYS A;  4DR7 E;  1KKH A;  1ZM3 A;  1N34 E;  2O1U A;  4JI2 E;  5BR8 E;  3QT6 A;  4DV0 E;  1RRE A;  1N0U A;  1KVK A;  1EI1 A;  4DR5 I;  1H73 A;  2UXC I;  5JEA A;  3WU6 A;  2WP8 A;  2JEB B;  2LJP A;  3HKM A;  3ZZU A;  4DV5 I;  3Q6M A;  5IWA E;  1J5E E;  4LF5 I;  4DPU A;  4FW7 A;  4DV4 E;  5LMU I;  2NN6 F;  1H72 C;  5FWK A;  2O1T A;  4AQY E;  2C37 B;  5A2Q Q;  5A2Q C;  4P7A A;  1YH8 A;  1FWL A;  4MU0 A;  1XMO I;  1I94 I;  2Z5B A;  3M85 D;  3T1H E;  2BA0 G;  3HUL A;  4DR2 I;  1H7U A;  2PO0 A;  4OZE A;  4I3H A;  1NHI A;  1XNR E;  3P3G A;  4DPW A;  2V8P A;  1FWK A;  5DRR A;  3K85 A;  5K36 E;  5K36 C;  3M7N G;  2GO3 A;  4EMD A;  4ISA A;  4LFB E;  4LF9 I;  3OTO E;  2BV3 A;  2X36 A;  2UUB I;  3M6A A;  3LTO A;  4K0K E;  1B63 A;  1IBK E;  4DV2 I;  4JI0 E;  4NXN I;  4DV6 I;  2F4V E;  4JYA E;  1USV A;  3GON A;  1HNZ I;  2A2C A;  3PS3 A;  4X66 I;  4FWD A;  1IBM I;  1KIJ A;  4JI8 E;  4B3M E;  2WNR B;  5IT9 C;  4DUZ E;  5IT9 Q;  4X65 I;  4XTJ A;  2VQE E;  5JEA D;  1Z0T A;  2BR2 B;  2JEA B;  4LFA I;  2CGE A;  2CZ9 A;  2BM0 A;  4URL A;  2E5L I;  3WU3 A;  4U3B A;  5K36 F;  2V2V A;  2UUA E;  3D4J A;  2VQF I;  3H1C A;  1FJG E;  2GS8 A;  1E3H A;  3K17 A;  4DPY A;  2JE6 A;  1S16 A;  2GO4 A;  2O1V A;  4DV1 E;  4ED4 A;  4GKK E;  4B3S E;  4R1F A;  4NBQ A;  1UDN A;  1H74 A;  3P06 A;  3P76 A;  4DR1 E;  3U1Y A;  2XEX A;  4LF7 E;  4LF8 I;  1N33 I;  4OKG A;  2DEJ A;  1XNQ E;  2PNM A;  1Y6Z A;  2PO1 A;  4YY3 I;  3CDI A;  4X64 E;  1FI4 A;  4JI1 E;  1N32 E;  4DR4 E;  2NN6 A;  4JI4 I;  2R42 A;  4OO1 C;  4OO1 E;  3QT5 A;  3V5R A;  4HXZ A;  1XMQ E;  4FW9 A;  2NN6 C;  2NN6 E;  2BA0 D;  5LMN E;  4DR3 I;  1HNW E;  5GME A;  4HAC B;  4DR6 I;  1OYR A;  1UDS A;  4AIM A;  4FW5 A;  4DV7 E;  1N36 I;  4LF4 I;  4PU9 A;  4GKJ I;  1ZXM A; 
#chains in the Genus database with same CATH homology
 1BKN A;  3Q6N A;  1HNX E;  2O1W A;  3PRY A;  1Z0W A;  1Z5C A;  2HK3 A;  4DR5 E;  2DEI A;  4JV5 I;  4DR7 I;  2UXC E;  2IOQ A;  3PYE A;  4DV3 I;  4JI2 I;  1Z0C A;  1Z5A A;  2UXB I;  4RPF A;  3Q1Q A;  4DV5 E;  4LF5 E;  4FWG A;  2VF3 A;  1B62 A;  1N0V C;  1ZM9 A;  4B3T I;  3B78 A;  1NHJ A;  2NPF A;  1J5E I;  3QT7 A;  3F0N A;  1XMO E;  4DV4 I;  4B3R E;  1UEK A;  1OJ4 A;  2UU9 I;  2BM1 A;  4DR2 E;  2Z5B B;  1HR0 E;  2ZM6 I;  4JI5 I;  4FWH A;  4JI3 I;  2CG9 A;  2R3V A;  3ZKB A;  1FKA E;  2ZIT A;  1MU5 A;  1XNR I;  1WUU A;  1D6T A;  2UUB E;  5GMD A;  2HKE A;  4DV2 E;  4PRV A;  4NXN E;  4DV6 E;  3ZKD A;  4LFB I;  4X66 E;  4KHP I;  1IBM E;  1Z0B A;  2HFU A;  1NZ0 A;  3JAM Q;  3JAM C;  4IZJ A;  2Z5C A;  4DU8 A;  2E5L E;  4IZK A;  3CWV A;  2A2D A;  2VQF E;  2HHH E;  1PKP A;  2HFS A;  4IZJ B;  2V2Z A;  4HYM A;  2UUA I;  4DU7 A;  4LFC E;  4LF6 I;  3T1Y E;  1IBL I;  4LF8 E;  4DV1 I;  1N33 E;  3WU5 A;  4Z7C A;  5L3J A;  4YHH I;  4X62 I;  1U2R A;  2UXD I;  2PNL A;  4PRX A;  3J7A M;  4JI4 E;  4DUY I;  4NXM E;  1S4E A;  2Q2E B;  1EA6 A;  2V34 A;  3PYD A;  4JI1 I;  4DR3 E;  4JI7 I;  2UUC I;  1VIS A;  4DR6 E;  4UT4 A;  1N36 E;  4OX9 I;  4LF4 E;  4GKJ E;  3PYF A;  4USK A;  5LMN I;  2GQ0 A;  4JI6 I;  3K1J A;  1K47 A;  1PIE A;  4IZJ D;  1N34 I;  2V2Q A;  1Z5B A;  5BR8 I;  1Z59 A;  1HNX I;  1ZM4 A;  4DV0 I;  4JV5 E;  4DV3 E;  2J7K A;  4DPT A;  2UXB E;  4WUC A;  5LMU E;  4DXL A;  3H4L A;  5LL6 R;  4B3T E;  5IWA I;  1XHK A;  3ZM7 A;  3J7A G;  2AJ4 A;  4WUB A;  1USU A;  1I94 E;  1A6F A;  2E1R A;  4AQY I;  4M1K A;  1RR9 A;  2UU9 E;  1MX0 A;  1ZM2 A;  2X7I A;  3T1H I;  1MG7 A;  3WU4 A;  1NHH A;  4B3R I;  2ZM6 E;  4JI5 E;  4JI3 E;  4HY1 A;  4LF9 E;  2HKJ A;  4FN5 A;  1KTV A;  2Z5E A;  1HR0 I;  4MYU A;  4P52 A;  1H7S A;  2IOP A;  3B82 A;  4WUD A;  4KQV A;  3OTO I;  1HNZ E;  3V2U C;  3ZZ0 A;  3ZZT A;  4K0K I;  1ELO A;  4X65 E;  1IBK I;  4JI0 I;  4USM A;  4KHP E;  2F4V I;  4JYA I;  4LFA E;  1DAR A;  4UTG A;  1FNM A;  4JI8 I;  4B3M I;  4DUZ I;  4Z7Y A;  5FLX Q;  5FLX C;  2VQE I;  1Z0V A;  1HK7 A;  3PYG A;  2Z5C B;  2HK2 A;  4IZK B;  2WW4 A;  1FJG I;  4JG4 A;  2HHH I;  1Z0E A;  4N3O A;  4LF6 E;  1IBL E;  3B8H A;  4GKK I;  4B3S I;  2ZBK B;  4YY3 E;  4DR1 I;  3LPS A;  1QZR A;  2EFG A;  4LFC I;  4ZVI A;  3T1Y I;  4LF7 I;  1Y4S A;  4YHH E;  3LNU A;  4X62 E;  1XNQ I;  2UXD E;  1PVG A;  4X64 I;  4DUY E;  4DPX A;  4DR4 I;  1N32 I;  2OI2 A;  4MYT A;  1XMQ I;  3HJC A;  4HAC A;  4JI7 E;  2UUC E;  3J81 Q;  3J81 C;  4NXM I;  1HNW I;  1ZXN A;  4OX9 E;  1Z0G A;  3J80 Q;  3QT8 A;  3J80 C;  4DV7 I;  4JI6 E;  1Y4U A;  4DR7 E;  1KKH A;  1ZM3 A;  1N34 E;  2O1U A;  4JI2 E;  5BR8 E;  3QT6 A;  4DV0 E;  1RRE A;  1N0U A;  1KVK A;  1EI1 A;  4DR5 I;  1H73 A;  2UXC I;  3WU6 A;  2LJP A;  3ZZU A;  4DV5 I;  3Q6M A;  5IWA E;  1J5E E;  4LF5 I;  4DPU A;  4DV4 E;  5LMU I;  1H72 C;  5FWK A;  2O1T A;  4AQY E;  5A2Q Q;  5A2Q C;  4P7A A;  1FWL A;  1XMO I;  1I94 I;  2Z5B A;  3T1H E;  3HUL A;  4DR2 I;  1H7U A;  4I3H A;  1NHI A;  1XNR E;  4DPW A;  2V8P A;  1FWK A;  3K85 A;  4EMD A;  4LFB E;  4LF9 I;  3OTO E;  2BV3 A;  2X36 A;  2UUB I;  3M6A A;  3LTO A;  4K0K E;  1B63 A;  1IBK E;  4DV2 I;  4JI0 E;  4NXN I;  4DV6 I;  2F4V E;  4JYA E;  1USV A;  3GON A;  1HNZ I;  2A2C A;  4X66 I;  4FWD A;  1IBM I;  1KIJ A;  4JI8 E;  4B3M E;  5IT9 C;  4DUZ E;  5IT9 Q;  4X65 I;  4XTJ A;  2VQE E;  1Z0T A;  4LFA I;  2CGE A;  2CZ9 A;  2BM0 A;  4URL A;  2E5L I;  3WU3 A;  2V2V A;  2UUA E;  3D4J A;  2VQF I;  1FJG E;  2GS8 A;  3K17 A;  4DPY A;  1S16 A;  2O1V A;  4DV1 E;  4ED4 A;  4GKK E;  4B3S E;  4R1F A;  1H74 A;  3P06 A;  4DR1 E;  2XEX A;  4LF7 E;  4LF8 I;  1N33 I;  2DEJ A;  1XNQ E;  2PNM A;  1Y6Z A;  4YY3 I;  4X64 E;  1FI4 A;  4JI1 E;  1N32 E;  4DR4 E;  4JI4 I;  2R42 A;  3QT5 A;  3V5R A;  4HXZ A;  1XMQ E;  4FW9 A;  5LMN E;  4DR3 I;  1HNW E;  5GME A;  4HAC B;  4DR6 I;  4DV7 E;  1N36 I;  4GKJ I;  4LF4 I;  4PU9 A;  1ZXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...