2HHHI

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2hhhI00
4JI8E 2AJ4A 1XMQE 3ZKDA 5LMUE 1NHIA 3QT6A 2UUAI 1IBMI 3JAMC 1N34I 4JI7I 4HXZA 2UU9I 4LFAI 1S16A 3WU4A 1XMQI 2V34A 1HNZE 2HHHE 1FKAE 3GONA 1FJGE 4RPFA 4DR6E 3PYEA 4DV1I 4DV6I 3OTOE 4DV5I 4DV3E 4LF4E 5L3JA 4DV2I 2BV3A 4UT4A 1FJGI 4DV0I 4LFCE 4UTGA 4LF5E 3LNUA 3PYFA 2ZM6E 4FW9A 3QT7A 4LFCI 4B3RE 3ZM7A 1Z0EA 1Z59A 2A2CA 2HFSA 4DR3I 4DU7A 4JI5I 1XNRI 3J80Q 2V2ZA 1ELOA 4NXNE 1IBME 4AQYE 2BM1A 4HYMA 1B62A 4DU8A 2ZM6I 4HY1A 4DPXA 1HNWE 4K0KE 2CZ9A 1I94E 4NXME 1ZM9A 2UUBE 4X64I 4JV5E 2F4VE 1NHHA 3Q1QA 5FLXQ 4JI6E 2LJPA 1MU5A 5A2QC 4LFBE 5GMEA 5GMDA 4B3SI 5IT9C 4JYAE 3J7AG 4DR4I 4DPYA 1EI1A 4LF7E 4JI6I 4KQVA 5LL6R 1Z5CA 4P52A 4LFBI 1XMOI 4DR5E 2UUCI 4I3HA 3J80C 1Z5BA 2UXDE 3QT5A 1HNXE 1Z5AA 1DARA 1FWKA 4JI5E 1IBKI 1ZXNA 1XNRE 3ZZTA 2UXBI 1KVKA 4AQYI 4GKKE 4FWDA 4ZVIA 2R3VA 2HKJA 4X64E 1QZRA 3B8HA 5IWAI 4DR7I 4JV5I 4DUYE 1RR9A 4MYTA 3LPSA 5BR8I 4X62I 1H74A 1K47A 1N34E 4LF6I 4HACA 4X65I 1MX0A 4B3ME 1N36I 4DXLA 3WU3A 3ZZUA 4DR1E 4GKJI 3B78A 4URLA 1XNQE 2HHHI 3WU5A 3D4JA 4LF6E 2EFGA 5IT9Q 1XMOE 2GS8A 4X65E 3ZZ0A 1MG7A 1NZ0A 5A2QQ 1FWLA 1XNQI 4KHPI 4MYUA 4DPTA 4XTJA 2VQFE 4JI0E 1XHKA 3K17A 2E5LI 4WUCA 1Z0CA 3T1HI 4WUDA 2ZBKB 2UUAE 1EA6A 1NHJA 1IBLE 2J7KA 5IWAE 1KKHA 3V2UC 1ZXMA 2BM0A 1HNZI 1A6FA 4FN5A 1HNWI 4DV1E 2A2DA 4DUZE 3OTOI 1ZM4A 4WUBA 1Z0BA 4DV5E 1N36E 4NXMI 4DR1I 4GKJE 1H7SA 2DEIA 3J7AM 2VQEI 4LF8E 1FNMA 5LMNI 1H72C 2R42A 3K1JA 4DUZI 1PVGA 4OX9I 2X36A 4LF5I 1KTVA 1D6TA 3T1YE 1S4EA 1Z0TA 4B3TI 1J5EI 2VF3A 3WU6A 4DV6E 4DR2E 4DR3E 4DV4E 4JI4E 1FI4A 4HACB 2HK2A 4JI2I 4YHHI 4B3TE 1J5EE 3J81C 4DV0E 2UXDI 1PIEA 4K0KI 3CWVA 4P7AA 4PU9A 3PYGA 4Z7YA 2F4VI 4ED4A 1ZM3A 3PYDA 4JI3E 4JI7E 2UU9E 4R1FA 1H73A 4PRXA 4NXNI 4EMDA 4DR4E 3B82A 4X66I 1N32E 1Z0GA 4OX9E 3V5RA 2UUCE 2Q2EB 1RREA 4DV2E 3HULA 1OJ4A 4X66E 4LF9I 1N32I 4DR2I 4DV4I 1H7UA 4JI4I 4JYAI 1Z0WA 2HK3A 4USKA 2V2VA 2UXBE 4YHHE 3LTOA 4JI1I 4FWGA 3JAMQ 4LF9E 4KHPE 4B3RI 2DEJA 2X7IA 2UXCI 2OI2A 2E5LE 4DR7E 4DR5I 4JI3I 4X62E 4JG4A 5FLXC 1Z0VA 1IBLI 3QT8A 1N33I 2UXCE 1I94I 2UUBI 2XEXA 4DV7I 1IBKE 4JI8I 4B3MI 4FWHA 4GKKI 5LMUI 1BKNA 4USMA 2NPFA 3F0NA 1PKPA 1N33E 4B3SE 4LFAE 4Z7CA 4DUYI 3H4LA 5BR8E 4LF7I 1WUUA 1N0VC 2VQEE 4LF8I 4M1KA 5LMNE 2VQFI 4JI0I 1UEKA 1N0UA 1ZM2A 4DR6I 4DV3I 2WW4A 4LF4I 3T1HE 4JI1E 2E1RA 4YY3I 1B63A 3T1YI 2V2QA 1HNXI 2V8PA 1VISA 1HR0I 3J81Q 4PRVA 2HKEA 3ZKBA 4DPUA 1KIJA 4YY3E 3M6AA 4JI2E 1U2RA 4DPWA 2HFUA 1HR0E 2ZITA 4DV7E
chains in the Genus database with same CATH superfamily
4JI8E 2AJ4A 1XMQE 3ZKDA 5DNLA 5LMUE 1NHIA 3QT6A 2UUAI 5DRRA 1IBMI 3JAMC 2CGEA 4OO1A 1N34I 2IOQA 2C38B 4JI7I 4HXZA 2UU9I 2C37B 4LFAI 4OKGA 1S16A 3WU4A 1XMQI 2V34A 4OO1F 1HNZE 2WNRA 1YH8A 2HHHE 1FKAE 3GONA 1FJGE 4RPFA 4DR6E 3PYEA 4DV1I 4DV6I 3OTOE 4IFDA 2NN6E 4DV5I 4DV3E 4LF4E 1Y6ZA 5L3JA 5DNXA 4BA2A 4DV2I 2BV3A 4UT4A 1FJGI 1E3PA 2Z5EA 4MU1A 4MQYA 4DV0I 4LFCE 4UTGA 2GQ0A 4LCHA 1USUA 1XXEA 1Y4UA 3HJCA 4IFDC 3NZKA 3P3CA 4LF5E 1YHCA 3LNUA 3PYFA 2ZM6E 4IZKB 4FW9A 3QT7A 4LFCI 4B3RE 3ZM7A 1Z0EA 1Z59A 2A2CA 2HFSA 4DR3I 4DU7A 3K85A 4GQUA 4JI5I 1XNRI 3J80Q 2V2ZA 4J3DA 1ELOA 3CDJA 1IBME 4AQYE 2BM1A 4HYMA 4NXNE 1B62A 1Y5YA 4DU8A 2ZM6I 4OO1B 5JEAD 4HY1A 4DPXA 3HKMA 1HNWE 4K0KE 2CZ9A 1I94E 4NXME 1ZM9A 2UUBE 4X64I 4JV5E 2F4VE 1NHHA 5C0XD 3Q1QA 2BA0D 3Q6MA 4LOMA 5FLXQ 4FW6A 4JI6E 2LJPA 1MU5A 5A2QC 4OZEA 3M85G 4ISAA 4LFBE 1OYPA 5GMEA 5GMDA 4MU4A 1E3HA 4B3SI 2CVEA 5IT9C 1Y60A 4IS9A 3J7AG 4JYAE 4DR4I 2Z5CB 4DPYA 2BR2B 1EI1A 4NBQA 4JI6I 4LF7E 4OO1E 4KQVA 2PO1A 5LL6R 1Z5CA 4P52A 3PS2A 4LFBI 1XMOI 4DR5E 2UUCI 2PO0B 4I3HA 3PRYA 3J80C 1Z5BA 2BA1D 2UXDE 3QT5A 1HNXE 2CG9A 2PNZB 3P76A 2GO4A 1Z5AA 2Z5CA 1DARA 1FWKA 4JI5E 1IBKI 1ZXNA 1XNRE 3ZZTA 2UXBI 1KVKA 3H1CA 4AQYI 4GKKE 5K36B 2IERA 5JEAE 4FWDA 4ZVIA 1HK7A 2R3VA 2HKJA 4X64E 1QZRA 3B8HA 5IWAI 5C0XE 4DR7I 4JV5I 4DUYE 1RR9A 4MYTA 3LPSA 5BR8I 4X62I 1H74A 1K47A 1N34E 4OO1C 5DROA 4LF6I 4HACA 4X65I 1MX0A 2BR2A 4B3ME 4FW4A 1N36I 4DXLA 3WU3A 2AE8A 3ZZUA 4DR1E 4GKJI 5JEAB 3B78A 1UDNA 5DRQA 4URLA 1XNQE 2PO1B 2NN6F 2HHHI 3WU5A 3D4JA 3GCMA 4LF6E 2EFGA 5IT9Q 1XMOE 2GS8A 4X65E 3ZZ0A 5JEAF 2NN6C 1MG7A 1NZ0A 5A2QQ 3U1YA 2J65A 1FWLA 1XNQI 1OYSA 5JEAC 4KHPI 4MYUA 4DPTA 4N3OA 4IFDF 4XTJA 1R6LA 4IZKA 2VQFE 4JI0E 1XHKA 3K17A 2E5LI 4WUCA 2NN6A 1Z0CA 3GLLA 3T1HI 4IFDB 2WP8A 4QNKA 5C0XC 4WUDA 2ZBKB 2UUAE 2C38A 1EA6A 1NHJA 1IBLE 2GO3A 4OO1D 2J7KA 2O1WA 5IWAE 1KKHA 4AM3A 3V2UC 4IZJA 4BA1A 1ZXMA 2BM0A 4AIMA 1HNZI 1A6FA 2JE6A 4FN5A 3PS3A 1HNWI 4DV1E 2A2DA 4DUZE 3OTOI 1ZM4A 4WUBA 1Z0BA 4DV5E 1N36E 4NXMI 4DR1I 4GKJE 2JEAB 1H7SA 4LPFA 1OYRA 2DEIA 3J7AM 2VQEI 4LF8E 1FNMA 1RHYA 5K36A 5LMNI 1H72C 2R42A 3K1JA 3M7ND 2O1VA 4DUZI 2Z5BB 1PVGA 4OX9I 2X36A 4LF5I 1KTVA 5EL9A 3T1YE 1D6TA 1S4EA 1Z0TA 1R6MA 4B3TI 4FW3A 1J5EI 3UHMA 4IFDD 2VF3A 3WU6A 4DV6E 4DR2E 4DR3E 4DV4E 4JI4E 1FI4A 4HACB 2HK2A 2BA0G 4U3BA 4YHHI 4JI2I 4LCFA 4B3TE 1J5EE 3J81C 4DV0E 2UXDI 2WNRB 4MDTA 1PIEA 4K0KI 3Q6NA 1P42A 4P7AA 3CWVA 3DD6A 2PNLA 4PU9A 3GMEA 3PYGA 4Z7YA 5FWKA 4ED4A 2F4VI 1ZM3A 2PNMA 3PYDA 4JI3E 4LCGA 2IOPA 2O3ZA 2JE6B 2JEBB 3L7ZA 4JI7E 2UU9E 4R1FA 2JEAA 5K36F 1H73A 4PRXA 4U3DA 2NN6B 5K36E 4NXNI 4EMDA 4DR4E 3B82A 4X66I 3PS1A 1N32E 1Z0GA 2PO2A 5C0XA 4OX9E 2O1TA 3V5RA 3M7NG 2UUCE 2Q2EB 1RREA 3HULA 4DV2E 2PNZA 1OJ4A 4AIDA 1VI7A 4X66E 4LF9I 1N32I 2PO0A 4DR2I 4DV4I 1H7UA 4JI4I 4JYAI 1Z0WA 2HK3A 4USKA 5ELWA 2V2VA 3CDIA 2UXBE 4YHHE 3LTOA 4JI1I 4MU3A 3P3EA 4FWGA 3JAMQ 4LF9E 4KHPE 4B3RI 2DEJA 2X7IA 2UXCI 2OI2A 5JEAA 3B4TA 2E5LE 4DR7E 4DR5I 4IZJB 4JI3I 3M85D 5K36C 4X62E 4JG4A 2JEBA 3L7ZB 5FLXC 1Z0VA 1IBLI 3P3GA 3QT8A 1N33I 2UXCE 2O1UA 1I94I 2UUBI 2XEXA 4DV7I 1IBKE 4JI8I 4IFDE 4B3MI 4FWHA 4GKKI 5LMUI 1BKNA 4USMA 2NPFA 3F0NA 1PKPA 1N33E 4B3SE 4BA2B 4IZJD 3U1KA 4LFAE 1Y4SA 4Z7CA 4DUYI 4MU0A 3H4LA 5BR8E 4LF7I 1UDOA 2F1DA 1WUUA 4FW7A 1N0VC 2VQEE 2IESA 2JT2A 4LF8I 4M1KA 2C39B 5LMNE 2WP8B 4JI0I 2VQFI 1UEKA 1N0UA 1ZM2A 4DR6I 4DV3I 2WW4A 4LF4I 3T1HE 2NN6D 4FW5A 4JI1E 2E1RA 2C37A 2PO2B 4YY3I 5K36D 1B63A 1UDQA 3P06A 3T1YI 2V2QA 1HNXI 2V8PA 5C0XF 1VISA 1HR0I 5EKWA 3J81Q 2VESA 4PRVA 2HKEA 3ZKBA 4DPUA 1KIJA 4BA1B 1UDSA 5C0XB 2Z5BA 3KRNA 4QNJA 2C39A 4YY3E 2BA1G 3M6AA 4JI2E 1U2RA 4DPWA 2HFUA 1USVA 1HR0E 5DRPA 2ZITA 4DV7E
chains in the Genus database with same CATH topology
4JI8E 2AJ4A 1XMQE 3ZKDA 5LMUE 1NHIA 3QT6A 2UUAI 1IBMI 3JAMC 2CGEA 1N34I 2IOQA 4JI7I 4HXZA 2UU9I 4LFAI 1S16A 3WU4A 1XMQI 2V34A 1HNZE 2HHHE 1FKAE 3GONA 1FJGE 4RPFA 4DR6E 3PYEA 4DV1I 4DV6I 3OTOE 4DV5I 4DV3E 4LF4E 1Y6ZA 5L3JA 4DV2I 2BV3A 4UT4A 1FJGI 2Z5EA 4DV0I 4LFCE 4UTGA 2GQ0A 1USUA 1Y4UA 3HJCA 4LF5E 3LNUA 3PYFA 2ZM6E 4IZKB 4FW9A 3QT7A 4LFCI 4B3RE 3ZM7A 1Z0EA 1Z59A 2A2CA 2HFSA 4DR3I 4DU7A 3K85A 4JI5I 1XNRI 3J80Q 2V2ZA 1ELOA 4NXNE 1IBME 4AQYE 2BM1A 4HYMA 1B62A 4DU8A 2ZM6I 4HY1A 4DPXA 1HNWE 4K0KE 2CZ9A 1I94E 4NXME 1ZM9A 2UUBE 4X64I 4JV5E 2F4VE 1NHHA 3Q1QA 3Q6MA 5FLXQ 4JI6E 2LJPA 1MU5A 5A2QC 4LFBE 5GMEA 5GMDA 4B3SI 5IT9C 4JYAE 3J7AG 4DR4I 2Z5CB 4DPYA 1EI1A 4LF7E 4JI6I 4KQVA 5LL6R 1Z5CA 4P52A 4LFBI 1XMOI 4DR5E 2UUCI 4I3HA 3PRYA 3J80C 1Z5BA 2UXDE 3QT5A 1HNXE 2CG9A 1Z5AA 2Z5CA 1DARA 1FWKA 4JI5E 1IBKI 1ZXNA 1XNRE 3ZZTA 2UXBI 1KVKA 4AQYI 4GKKE 4FWDA 4ZVIA 1HK7A 2R3VA 2HKJA 4X64E 1QZRA 3B8HA 5IWAI 4DR7I 4JV5I 4DUYE 1RR9A 4MYTA 3LPSA 5BR8I 4X62I 1H74A 1K47A 1N34E 4LF6I 4HACA 4X65I 1MX0A 4B3ME 1N36I 4DXLA 3WU3A 3ZZUA 4DR1E 4GKJI 3B78A 4URLA 1XNQE 2HHHI 3WU5A 3D4JA 4LF6E 2EFGA 5IT9Q 1XMOE 2GS8A 4X65E 3ZZ0A 1MG7A 1NZ0A 5A2QQ 1FWLA 1XNQI 4KHPI 4MYUA 4DPTA 4N3OA 4XTJA 4IZKA 2VQFE 4JI0E 1XHKA 3K17A 2E5LI 4WUCA 1Z0CA 3T1HI 4WUDA 2ZBKB 2UUAE 1EA6A 1NHJA 1IBLE 2J7KA 2O1WA 5IWAE 1KKHA 3V2UC 4IZJA 1ZXMA 2BM0A 1HNZI 1A6FA 4FN5A 1HNWI 4DV1E 2A2DA 4DUZE 3OTOI 1ZM4A 4WUBA 1Z0BA 4DV5E 1N36E 4NXMI 4DR1I 4GKJE 1H7SA 2DEIA 3J7AM 2VQEI 4LF8E 1FNMA 5LMNI 1H72C 2R42A 3K1JA 2O1VA 4DUZI 2Z5BB 1PVGA 4OX9I 2X36A 4LF5I 1KTVA 1D6TA 3T1YE 1S4EA 1Z0TA 4B3TI 1J5EI 2VF3A 3WU6A 4DV6E 4DR2E 4DR3E 4DV4E 4JI4E 1FI4A 4HACB 2HK2A 4JI2I 4YHHI 4B3TE 1J5EE 3J81C 4DV0E 2UXDI 1PIEA 4K0KI 3Q6NA 3CWVA 4P7AA 2PNLA 4PU9A 3PYGA 4Z7YA 5FWKA 4ED4A 2F4VI 1ZM3A 2PNMA 3PYDA 4JI3E 2IOPA 4JI7E 2UU9E 4R1FA 1H73A 4PRXA 4NXNI 4EMDA 4DR4E 3B82A 4X66I 1N32E 1Z0GA 4OX9E 2O1TA 3V5RA 2UUCE 2Q2EB 1RREA 4DV2E 3HULA 1OJ4A 4X66E 4LF9I 1N32I 4DR2I 4DV4I 1H7UA 4JI4I 4JYAI 1Z0WA 2HK3A 4USKA 2V2VA 2UXBE 4YHHE 3LTOA 4JI1I 4FWGA 3JAMQ 4LF9E 4KHPE 4B3RI 2DEJA 2X7IA 2UXCI 2OI2A 2E5LE 4DR7E 4DR5I 4IZJB 4JI3I 4X62E 4JG4A 5FLXC 1Z0VA 1IBLI 3QT8A 1N33I 2UXCE 2O1UA 1I94I 2UUBI 2XEXA 4DV7I 1IBKE 4JI8I 4B3MI 4FWHA 4GKKI 5LMUI 1BKNA 4USMA 2NPFA 3F0NA 1PKPA 1N33E 4B3SE 4IZJD 4LFAE 1Y4SA 4Z7CA 4DUYI 3H4LA 5BR8E 4LF7I 1WUUA 1N0VC 2VQEE 4LF8I 4M1KA 5LMNE 2VQFI 4JI0I 1UEKA 1N0UA 1ZM2A 4DR6I 4DV3I 2WW4A 4LF4I 3T1HE 4JI1E 2E1RA 4YY3I 1B63A 3P06A 3T1YI 2V2QA 1HNXI 2V8PA 1VISA 1HR0I 3J81Q 4PRVA 2HKEA 3ZKBA 4DPUA 1KIJA 2Z5BA 4YY3E 3M6AA 4JI2E 1U2RA 4DPWA 2HFUA 1USVA 1HR0E 2ZITA 4DV7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 E;  2AJ4 A;  1XMQ E;  3ZKD A;  5LMU E;  1NHI A;  3QT6 A;  2UUA I;  1IBM I;  3JAM C;  1N34 I;  4JI7 I;  4HXZ A;  2UU9 I;  4LFA I;  1S16 A;  3WU4 A;  1XMQ I;  2V34 A;  1HNZ E;  2HHH E;  1FKA E;  3GON A;  1FJG E;  4RPF A;  4DR6 E;  3PYE A;  4DV1 I;  4DV6 I;  3OTO E;  4DV5 I;  4DV3 E;  4LF4 E;  5L3J A;  4DV2 I;  2BV3 A;  4UT4 A;  1FJG I;  4DV0 I;  4LFC E;  4UTG A;  4LF5 E;  3LNU A;  3PYF A;  2ZM6 E;  4FW9 A;  3QT7 A;  4LFC I;  4B3R E;  3ZM7 A;  1Z0E A;  1Z59 A;  2A2C A;  2HFS A;  4DR3 I;  4DU7 A;  4JI5 I;  1XNR I;  3J80 Q;  2V2Z A;  1ELO A;  4NXN E;  1IBM E;  4AQY E;  2BM1 A;  4HYM A;  1B62 A;  4DU8 A;  2ZM6 I;  4HY1 A;  4DPX A;  1HNW E;  4K0K E;  2CZ9 A;  1I94 E;  4NXM E;  1ZM9 A;  2UUB E;  4X64 I;  4JV5 E;  2F4V E;  1NHH A;  3Q1Q A;  5FLX Q;  4JI6 E;  2LJP A;  1MU5 A;  5A2Q C;  4LFB E;  5GME A;  5GMD A;  4B3S I;  5IT9 C;  4JYA E;  3J7A G;  4DR4 I;  4DPY A;  1EI1 A;  4LF7 E;  4JI6 I;  4KQV A;  5LL6 R;  1Z5C A;  4P52 A;  4LFB I;  1XMO I;  4DR5 E;  2UUC I;  4I3H A;  3J80 C;  1Z5B A;  2UXD E;  3QT5 A;  1HNX E;  1Z5A A;  1DAR A;  1FWK A;  4JI5 E;  1IBK I;  1ZXN A;  1XNR E;  3ZZT A;  2UXB I;  1KVK A;  4AQY I;  4GKK E;  4FWD A;  4ZVI A;  2R3V A;  2HKJ A;  4X64 E;  1QZR A;  3B8H A;  5IWA I;  4DR7 I;  4JV5 I;  4DUY E;  1RR9 A;  4MYT A;  3LPS A;  5BR8 I;  4X62 I;  1H74 A;  1K47 A;  1N34 E;  4LF6 I;  4HAC A;  4X65 I;  1MX0 A;  4B3M E;  1N36 I;  4DXL A;  3WU3 A;  3ZZU A;  4DR1 E;  4GKJ I;  3B78 A;  4URL A;  1XNQ E;  2HHH I;  3WU5 A;  3D4J A;  4LF6 E;  2EFG A;  5IT9 Q;  1XMO E;  2GS8 A;  4X65 E;  3ZZ0 A;  1MG7 A;  1NZ0 A;  5A2Q Q;  1FWL A;  1XNQ I;  4KHP I;  4MYU A;  4DPT A;  4XTJ A;  2VQF E;  4JI0 E;  1XHK A;  3K17 A;  2E5L I;  4WUC A;  1Z0C A;  3T1H I;  4WUD A;  2ZBK B;  2UUA E;  1EA6 A;  1NHJ A;  1IBL E;  2J7K A;  5IWA E;  1KKH A;  3V2U C;  1ZXM A;  2BM0 A;  1HNZ I;  1A6F A;  4FN5 A;  1HNW I;  4DV1 E;  2A2D A;  4DUZ E;  3OTO I;  1ZM4 A;  4WUB A;  1Z0B A;  4DV5 E;  1N36 E;  4NXM I;  4DR1 I;  4GKJ E;  1H7S A;  2DEI A;  3J7A M;  2VQE I;  4LF8 E;  1FNM A;  5LMN I;  1H72 C;  2R42 A;  3K1J A;  4DUZ I;  1PVG A;  4OX9 I;  2X36 A;  4LF5 I;  1KTV A;  1D6T A;  3T1Y E;  1S4E A;  1Z0T A;  4B3T I;  1J5E I;  2VF3 A;  3WU6 A;  4DV6 E;  4DR2 E;  4DR3 E;  4DV4 E;  4JI4 E;  1FI4 A;  4HAC B;  2HK2 A;  4JI2 I;  4YHH I;  4B3T E;  1J5E E;  3J81 C;  4DV0 E;  2UXD I;  1PIE A;  4K0K I;  3CWV A;  4P7A A;  4PU9 A;  3PYG A;  4Z7Y A;  2F4V I;  4ED4 A;  1ZM3 A;  3PYD A;  4JI3 E;  4JI7 E;  2UU9 E;  4R1F A;  1H73 A;  4PRX A;  4NXN I;  4EMD A;  4DR4 E;  3B82 A;  4X66 I;  1N32 E;  1Z0G A;  4OX9 E;  3V5R A;  2UUC E;  2Q2E B;  1RRE A;  4DV2 E;  3HUL A;  1OJ4 A;  4X66 E;  4LF9 I;  1N32 I;  4DR2 I;  4DV4 I;  1H7U A;  4JI4 I;  4JYA I;  1Z0W A;  2HK3 A;  4USK A;  2V2V A;  2UXB E;  4YHH E;  3LTO A;  4JI1 I;  4FWG A;  3JAM Q;  4LF9 E;  4KHP E;  4B3R I;  2DEJ A;  2X7I A;  2UXC I;  2OI2 A;  2E5L E;  4DR7 E;  4DR5 I;  4JI3 I;  4X62 E;  4JG4 A;  5FLX C;  1Z0V A;  1IBL I;  3QT8 A;  1N33 I;  2UXC E;  1I94 I;  2UUB I;  2XEX A;  4DV7 I;  1IBK E;  4JI8 I;  4B3M I;  4FWH A;  4GKK I;  5LMU I;  1BKN A;  4USM A;  2NPF A;  3F0N A;  1PKP A;  1N33 E;  4B3S E;  4LFA E;  4Z7C A;  4DUY I;  3H4L A;  5BR8 E;  4LF7 I;  1WUU A;  1N0V C;  2VQE E;  4LF8 I;  4M1K A;  5LMN E;  2VQF I;  4JI0 I;  1UEK A;  1N0U A;  1ZM2 A;  4DR6 I;  4DV3 I;  2WW4 A;  4LF4 I;  3T1H E;  4JI1 E;  2E1R A;  4YY3 I;  1B63 A;  3T1Y I;  2V2Q A;  1HNX I;  2V8P A;  1VIS A;  1HR0 I;  3J81 Q;  4PRV A;  2HKE A;  3ZKB A;  4DPU A;  1KIJ A;  4YY3 E;  3M6A A;  4JI2 E;  1U2R A;  4DPW A;  2HFU A;  1HR0 E;  2ZIT A;  4DV7 E; 
#chains in the Genus database with same CATH topology
 4JI8 E;  2AJ4 A;  1XMQ E;  3ZKD A;  5DNL A;  5LMU E;  1NHI A;  3QT6 A;  2UUA I;  5DRR A;  1IBM I;  3JAM C;  2CGE A;  4OO1 A;  1N34 I;  2IOQ A;  2C38 B;  4JI7 I;  4HXZ A;  2UU9 I;  2C37 B;  4LFA I;  4OKG A;  1S16 A;  3WU4 A;  1XMQ I;  2V34 A;  4OO1 F;  1HNZ E;  2WNR A;  1YH8 A;  2HHH E;  1FKA E;  3GON A;  1FJG E;  4RPF A;  4DR6 E;  3PYE A;  4DV1 I;  4DV6 I;  3OTO E;  4IFD A;  2NN6 E;  4DV5 I;  4DV3 E;  4LF4 E;  1Y6Z A;  5L3J A;  5DNX A;  4BA2 A;  4DV2 I;  2BV3 A;  4UT4 A;  1FJG I;  1E3P A;  2Z5E A;  4MU1 A;  4MQY A;  4DV0 I;  4LFC E;  4UTG A;  2GQ0 A;  4LCH A;  1USU A;  1XXE A;  1Y4U A;  3HJC A;  4IFD C;  3NZK A;  3P3C A;  4LF5 E;  1YHC A;  3LNU A;  3PYF A;  2ZM6 E;  4IZK B;  4FW9 A;  3QT7 A;  4LFC I;  4B3R E;  3ZM7 A;  1Z0E A;  1Z59 A;  2A2C A;  2HFS A;  4DR3 I;  4DU7 A;  3K85 A;  4GQU A;  4JI5 I;  1XNR I;  3J80 Q;  2V2Z A;  4J3D A;  1ELO A;  3CDJ A;  1IBM E;  4AQY E;  2BM1 A;  4HYM A;  4NXN E;  1B62 A;  1Y5Y A;  4DU8 A;  2ZM6 I;  4OO1 B;  5JEA D;  4HY1 A;  4DPX A;  3HKM A;  1HNW E;  4K0K E;  2CZ9 A;  1I94 E;  4NXM E;  1ZM9 A;  2UUB E;  4X64 I;  4JV5 E;  2F4V E;  1NHH A;  5C0X D;  3Q1Q A;  2BA0 D;  3Q6M A;  4LOM A;  5FLX Q;  4FW6 A;  4JI6 E;  2LJP A;  1MU5 A;  5A2Q C;  4OZE A;  3M85 G;  4ISA A;  4LFB E;  1OYP A;  5GME A;  5GMD A;  4MU4 A;  1E3H A;  4B3S I;  2CVE A;  5IT9 C;  1Y60 A;  4IS9 A;  3J7A G;  4JYA E;  4DR4 I;  2Z5C B;  4DPY A;  2BR2 B;  1EI1 A;  4NBQ A;  4JI6 I;  4LF7 E;  4OO1 E;  4KQV A;  2PO1 A;  5LL6 R;  1Z5C A;  4P52 A;  3PS2 A;  4LFB I;  1XMO I;  4DR5 E;  2UUC I;  2PO0 B;  4I3H A;  3PRY A;  3J80 C;  1Z5B A;  2BA1 D;  2UXD E;  3QT5 A;  1HNX E;  2CG9 A;  2PNZ B;  3P76 A;  2GO4 A;  1Z5A A;  2Z5C A;  1DAR A;  1FWK A;  4JI5 E;  1IBK I;  1ZXN A;  1XNR E;  3ZZT A;  2UXB I;  1KVK A;  3H1C A;  4AQY I;  4GKK E;  5K36 B;  2IER A;  5JEA E;  4FWD A;  4ZVI A;  1HK7 A;  2R3V A;  2HKJ A;  4X64 E;  1QZR A;  3B8H A;  5IWA I;  5C0X E;  4DR7 I;  4JV5 I;  4DUY E;  1RR9 A;  4MYT A;  3LPS A;  5BR8 I;  4X62 I;  1H74 A;  1K47 A;  1N34 E;  4OO1 C;  5DRO A;  4LF6 I;  4HAC A;  4X65 I;  1MX0 A;  2BR2 A;  4B3M E;  4FW4 A;  1N36 I;  4DXL A;  3WU3 A;  2AE8 A;  3ZZU A;  4DR1 E;  4GKJ I;  5JEA B;  3B78 A;  1UDN A;  5DRQ A;  4URL A;  1XNQ E;  2PO1 B;  2NN6 F;  2HHH I;  3WU5 A;  3D4J A;  3GCM A;  4LF6 E;  2EFG A;  5IT9 Q;  1XMO E;  2GS8 A;  4X65 E;  3ZZ0 A;  5JEA F;  2NN6 C;  1MG7 A;  1NZ0 A;  5A2Q Q;  3U1Y A;  2J65 A;  1FWL A;  1XNQ I;  1OYS A;  5JEA C;  4KHP I;  4MYU A;  4DPT A;  4N3O A;  4IFD F;  4XTJ A;  1R6L A;  4IZK A;  2VQF E;  4JI0 E;  1XHK A;  3K17 A;  2E5L I;  4WUC A;  2NN6 A;  1Z0C A;  3GLL A;  3T1H I;  4IFD B;  2WP8 A;  4QNK A;  5C0X C;  4WUD A;  2ZBK B;  2UUA E;  2C38 A;  1EA6 A;  1NHJ A;  1IBL E;  2GO3 A;  4OO1 D;  2J7K A;  2O1W A;  5IWA E;  1KKH A;  4AM3 A;  3V2U C;  4IZJ A;  4BA1 A;  1ZXM A;  2BM0 A;  4AIM A;  1HNZ I;  1A6F A;  2JE6 A;  4FN5 A;  3PS3 A;  1HNW I;  4DV1 E;  2A2D A;  4DUZ E;  3OTO I;  1ZM4 A;  4WUB A;  1Z0B A;  4DV5 E;  1N36 E;  4NXM I;  4DR1 I;  4GKJ E;  2JEA B;  1H7S A;  4LPF A;  1OYR A;  2DEI A;  3J7A M;  2VQE I;  4LF8 E;  1FNM A;  1RHY A;  5K36 A;  5LMN I;  1H72 C;  2R42 A;  3K1J A;  3M7N D;  2O1V A;  4DUZ I;  2Z5B B;  1PVG A;  4OX9 I;  2X36 A;  4LF5 I;  1KTV A;  5EL9 A;  3T1Y E;  1D6T A;  1S4E A;  1Z0T A;  1R6M A;  4B3T I;  4FW3 A;  1J5E I;  3UHM A;  4IFD D;  2VF3 A;  3WU6 A;  4DV6 E;  4DR2 E;  4DR3 E;  4DV4 E;  4JI4 E;  1FI4 A;  4HAC B;  2HK2 A;  2BA0 G;  4U3B A;  4YHH I;  4JI2 I;  4LCF A;  4B3T E;  1J5E E;  3J81 C;  4DV0 E;  2UXD I;  2WNR B;  4MDT A;  1PIE A;  4K0K I;  3Q6N A;  1P42 A;  4P7A A;  3CWV A;  3DD6 A;  2PNL A;  4PU9 A;  3GME A;  3PYG A;  4Z7Y A;  5FWK A;  4ED4 A;  2F4V I;  1ZM3 A;  2PNM A;  3PYD A;  4JI3 E;  4LCG A;  2IOP A;  2O3Z A;  2JE6 B;  2JEB B;  3L7Z A;  4JI7 E;  2UU9 E;  4R1F A;  2JEA A;  5K36 F;  1H73 A;  4PRX A;  4U3D A;  2NN6 B;  5K36 E;  4NXN I;  4EMD A;  4DR4 E;  3B82 A;  4X66 I;  3PS1 A;  1N32 E;  1Z0G A;  2PO2 A;  5C0X A;  4OX9 E;  2O1T A;  3V5R A;  3M7N G;  2UUC E;  2Q2E B;  1RRE A;  3HUL A;  4DV2 E;  2PNZ A;  1OJ4 A;  4AID A;  1VI7 A;  4X66 E;  4LF9 I;  1N32 I;  2PO0 A;  4DR2 I;  4DV4 I;  1H7U A;  4JI4 I;  4JYA I;  1Z0W A;  2HK3 A;  4USK A;  5ELW A;  2V2V A;  3CDI A;  2UXB E;  4YHH E;  3LTO A;  4JI1 I;  4MU3 A;  3P3E A;  4FWG A;  3JAM Q;  4LF9 E;  4KHP E;  4B3R I;  2DEJ A;  2X7I A;  2UXC I;  2OI2 A;  5JEA A;  3B4T A;  2E5L E;  4DR7 E;  4DR5 I;  4IZJ B;  4JI3 I;  3M85 D;  5K36 C;  4X62 E;  4JG4 A;  2JEB A;  3L7Z B;  5FLX C;  1Z0V A;  1IBL I;  3P3G A;  3QT8 A;  1N33 I;  2UXC E;  2O1U A;  1I94 I;  2UUB I;  2XEX A;  4DV7 I;  1IBK E;  4JI8 I;  4IFD E;  4B3M I;  4FWH A;  4GKK I;  5LMU I;  1BKN A;  4USM A;  2NPF A;  3F0N A;  1PKP A;  1N33 E;  4B3S E;  4BA2 B;  4IZJ D;  3U1K A;  4LFA E;  1Y4S A;  4Z7C A;  4DUY I;  4MU0 A;  3H4L A;  5BR8 E;  4LF7 I;  1UDO A;  2F1D A;  1WUU A;  4FW7 A;  1N0V C;  2VQE E;  2IES A;  2JT2 A;  4LF8 I;  4M1K A;  2C39 B;  5LMN E;  2WP8 B;  4JI0 I;  2VQF I;  1UEK A;  1N0U A;  1ZM2 A;  4DR6 I;  4DV3 I;  2WW4 A;  4LF4 I;  3T1H E;  2NN6 D;  4FW5 A;  4JI1 E;  2E1R A;  2C37 A;  2PO2 B;  4YY3 I;  5K36 D;  1B63 A;  1UDQ A;  3P06 A;  3T1Y I;  2V2Q A;  1HNX I;  2V8P A;  5C0X F;  1VIS A;  1HR0 I;  5EKW A;  3J81 Q;  2VES A;  4PRV A;  2HKE A;  3ZKB A;  4DPU A;  1KIJ A;  4BA1 B;  1UDS A;  5C0X B;  2Z5B A;  3KRN A;  4QNJ A;  2C39 A;  4YY3 E;  2BA1 G;  3M6A A;  4JI2 E;  1U2R A;  4DPW A;  2HFU A;  1USV A;  1HR0 E;  5DRP A;  2ZIT A;  4DV7 E; 
#chains in the Genus database with same CATH homology
 4JI8 E;  2AJ4 A;  1XMQ E;  3ZKD A;  5LMU E;  1NHI A;  3QT6 A;  2UUA I;  1IBM I;  3JAM C;  2CGE A;  1N34 I;  2IOQ A;  4JI7 I;  4HXZ A;  2UU9 I;  4LFA I;  1S16 A;  3WU4 A;  1XMQ I;  2V34 A;  1HNZ E;  2HHH E;  1FKA E;  3GON A;  1FJG E;  4RPF A;  4DR6 E;  3PYE A;  4DV1 I;  4DV6 I;  3OTO E;  4DV5 I;  4DV3 E;  4LF4 E;  1Y6Z A;  5L3J A;  4DV2 I;  2BV3 A;  4UT4 A;  1FJG I;  2Z5E A;  4DV0 I;  4LFC E;  4UTG A;  2GQ0 A;  1USU A;  1Y4U A;  3HJC A;  4LF5 E;  3LNU A;  3PYF A;  2ZM6 E;  4IZK B;  4FW9 A;  3QT7 A;  4LFC I;  4B3R E;  3ZM7 A;  1Z0E A;  1Z59 A;  2A2C A;  2HFS A;  4DR3 I;  4DU7 A;  3K85 A;  4JI5 I;  1XNR I;  3J80 Q;  2V2Z A;  1ELO A;  4NXN E;  1IBM E;  4AQY E;  2BM1 A;  4HYM A;  1B62 A;  4DU8 A;  2ZM6 I;  4HY1 A;  4DPX A;  1HNW E;  4K0K E;  2CZ9 A;  1I94 E;  4NXM E;  1ZM9 A;  2UUB E;  4X64 I;  4JV5 E;  2F4V E;  1NHH A;  3Q1Q A;  3Q6M A;  5FLX Q;  4JI6 E;  2LJP A;  1MU5 A;  5A2Q C;  4LFB E;  5GME A;  5GMD A;  4B3S I;  5IT9 C;  4JYA E;  3J7A G;  4DR4 I;  2Z5C B;  4DPY A;  1EI1 A;  4LF7 E;  4JI6 I;  4KQV A;  5LL6 R;  1Z5C A;  4P52 A;  4LFB I;  1XMO I;  4DR5 E;  2UUC I;  4I3H A;  3PRY A;  3J80 C;  1Z5B A;  2UXD E;  3QT5 A;  1HNX E;  2CG9 A;  1Z5A A;  2Z5C A;  1DAR A;  1FWK A;  4JI5 E;  1IBK I;  1ZXN A;  1XNR E;  3ZZT A;  2UXB I;  1KVK A;  4AQY I;  4GKK E;  4FWD A;  4ZVI A;  1HK7 A;  2R3V A;  2HKJ A;  4X64 E;  1QZR A;  3B8H A;  5IWA I;  4DR7 I;  4JV5 I;  4DUY E;  1RR9 A;  4MYT A;  3LPS A;  5BR8 I;  4X62 I;  1H74 A;  1K47 A;  1N34 E;  4LF6 I;  4HAC A;  4X65 I;  1MX0 A;  4B3M E;  1N36 I;  4DXL A;  3WU3 A;  3ZZU A;  4DR1 E;  4GKJ I;  3B78 A;  4URL A;  1XNQ E;  2HHH I;  3WU5 A;  3D4J A;  4LF6 E;  2EFG A;  5IT9 Q;  1XMO E;  2GS8 A;  4X65 E;  3ZZ0 A;  1MG7 A;  1NZ0 A;  5A2Q Q;  1FWL A;  1XNQ I;  4KHP I;  4MYU A;  4DPT A;  4N3O A;  4XTJ A;  4IZK A;  2VQF E;  4JI0 E;  1XHK A;  3K17 A;  2E5L I;  4WUC A;  1Z0C A;  3T1H I;  4WUD A;  2ZBK B;  2UUA E;  1EA6 A;  1NHJ A;  1IBL E;  2J7K A;  2O1W A;  5IWA E;  1KKH A;  3V2U C;  4IZJ A;  1ZXM A;  2BM0 A;  1HNZ I;  1A6F A;  4FN5 A;  1HNW I;  4DV1 E;  2A2D A;  4DUZ E;  3OTO I;  1ZM4 A;  4WUB A;  1Z0B A;  4DV5 E;  1N36 E;  4NXM I;  4DR1 I;  4GKJ E;  1H7S A;  2DEI A;  3J7A M;  2VQE I;  4LF8 E;  1FNM A;  5LMN I;  1H72 C;  2R42 A;  3K1J A;  2O1V A;  4DUZ I;  2Z5B B;  1PVG A;  4OX9 I;  2X36 A;  4LF5 I;  1KTV A;  1D6T A;  3T1Y E;  1S4E A;  1Z0T A;  4B3T I;  1J5E I;  2VF3 A;  3WU6 A;  4DV6 E;  4DR2 E;  4DR3 E;  4DV4 E;  4JI4 E;  1FI4 A;  4HAC B;  2HK2 A;  4JI2 I;  4YHH I;  4B3T E;  1J5E E;  3J81 C;  4DV0 E;  2UXD I;  1PIE A;  4K0K I;  3Q6N A;  3CWV A;  4P7A A;  2PNL A;  4PU9 A;  3PYG A;  4Z7Y A;  5FWK A;  4ED4 A;  2F4V I;  1ZM3 A;  2PNM A;  3PYD A;  4JI3 E;  2IOP A;  4JI7 E;  2UU9 E;  4R1F A;  1H73 A;  4PRX A;  4NXN I;  4EMD A;  4DR4 E;  3B82 A;  4X66 I;  1N32 E;  1Z0G A;  4OX9 E;  2O1T A;  3V5R A;  2UUC E;  2Q2E B;  1RRE A;  4DV2 E;  3HUL A;  1OJ4 A;  4X66 E;  4LF9 I;  1N32 I;  4DR2 I;  4DV4 I;  1H7U A;  4JI4 I;  4JYA I;  1Z0W A;  2HK3 A;  4USK A;  2V2V A;  2UXB E;  4YHH E;  3LTO A;  4JI1 I;  4FWG A;  3JAM Q;  4LF9 E;  4KHP E;  4B3R I;  2DEJ A;  2X7I A;  2UXC I;  2OI2 A;  2E5L E;  4DR7 E;  4DR5 I;  4IZJ B;  4JI3 I;  4X62 E;  4JG4 A;  5FLX C;  1Z0V A;  1IBL I;  3QT8 A;  1N33 I;  2UXC E;  2O1U A;  1I94 I;  2UUB I;  2XEX A;  4DV7 I;  1IBK E;  4JI8 I;  4B3M I;  4FWH A;  4GKK I;  5LMU I;  1BKN A;  4USM A;  2NPF A;  3F0N A;  1PKP A;  1N33 E;  4B3S E;  4IZJ D;  4LFA E;  1Y4S A;  4Z7C A;  4DUY I;  3H4L A;  5BR8 E;  4LF7 I;  1WUU A;  1N0V C;  2VQE E;  4LF8 I;  4M1K A;  5LMN E;  2VQF I;  4JI0 I;  1UEK A;  1N0U A;  1ZM2 A;  4DR6 I;  4DV3 I;  2WW4 A;  4LF4 I;  3T1H E;  4JI1 E;  2E1R A;  4YY3 I;  1B63 A;  3P06 A;  3T1Y I;  2V2Q A;  1HNX I;  2V8P A;  1VIS A;  1HR0 I;  3J81 Q;  4PRV A;  2HKE A;  3ZKB A;  4DPU A;  1KIJ A;  2Z5B A;  4YY3 E;  3M6A A;  4JI2 E;  1U2R A;  4DPW A;  2HFU A;  1USV A;  1HR0 E;  2ZIT A;  4DV7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...