2HHHI

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2hhhI00
1Z0VA 5FLXC 4DUYE 5L3JA 4DV0E 4LF7I 3T1YE 2UU9E 1UEKA 3WU4A 1S4EA 4LFCI 3ZM7A 2GS8A 2OI2A 4DPWA 1Z59A 2HFUA 4USMA 2VQFI 2CZ9A 4DR1I 1ZXMA 2WW4A 4JI2I 2E5LE 3PYGA 3ZKBA 5BR8E 4X64I 4UTGA 1XNQI 1Z5CA 3PYEA 4WUDA 1N33I 2UUAI 4B3SE 2XEXA 2BV3A 1NHHA 1Z0TA 3V2UC 1HR0I 1HNZI 2LJPA 4B3SI 4Z7YA 4DV2I 1RR9A 3OTOI 5IT9C 1ZM9A 5LMNE 1H7SA 1FJGI 3K17A 4UT4A 4DR4E 3LPSA 4LFBE 3J7AG 1QZRA 4X62I 4JI6E 4DUZI 4DU7A 5GMEA 4DV4E 5A2QC 2HHHE 1N32E 1Z0CA 3ZKDA 4GKKI 4DR5I 4JI6I 3J80Q 4DPTA 1IBLE 1PVGA 2HHHI 2DEIA 3T1HI 1N34E 3ZZUA 3QT6A 4GKJI 4PRVA 1IBMI 3Q1QA 4HY1A 4OX9I 4LF9I 2UXBE 4DV1I 4FN5A 4DPYA 4HACB 3LTOA 1FWLA 4JI1I 4M1KA 4X66I 5IWAE 4DV3E 4AQYI 3M6AA 4B3TI 4DR6I 4HACA 1MG7A 4YHHE 2VQEI 1N0VC 1U2RA 4JI0I 2UUCE 1RREA 3F0NA 4X65E 1B63A 3HULA 1FNMA 4JI8I 1ZM3A 2F4VE 4DUYI 1Z0BA 1KKHA 4HYMA 2UUBE 2UXDE 1NZ0A 2X36A 4DV0I 3T1YI 1J5EE 2UU9I 1HNXE 2UUBI 1XNRE 4JYAE 1Z0WA 4K0KE 2EFGA 4YY3E 2E5LI 4DU8A 5BR8I 3V5RA 2R42A 1N36E 4JI7E 1FKAE 4JI5E 1DARA 1H74A 4JI7I 2A2DA 5GMDA 4JI5I 5LMUE 4LFAE 1H7UA 4USKA 4DV6E 4LFAI 3J81Q 5LMNI 1BKNA 4KHPE 1N0UA 4DR4I 1MX0A 4DR7E 4LFBI 4MYUA 4Z7CA 2BM0A 1ZM4A 4NXNE 4DV4I 4DR7I 1N32I 1KTVA 1IBLI 4FW9A 2NPFA 1A6FA 4JV5E 1N34I 4LF6E 4I3HA 2X7IA 4XTJA 1H72C 2ZM6E 1H73A 4LF6I 1KVKA 1MU5A 4LF4E 3LNUA 2UXBI 2ZM6I 4JG4A 1ZM2A 1OJ4A 1IBKE 3JAMQ 3K1JA 4JI4E 4P7AA 1VISA 1S16A 2V2QA 1PKPA 5IWAI 4JI4I 4DV3I 3D4JA 4B3RE 2HFSA 3GONA 1FWKA 4YHHI 3CWVA 3PYFA 1NHIA 2UUCI 1WUUA 4URLA 4X65I 3B82A 4NXME 2HK2A 4DV5E 5FLXQ 4JI3E 2F4VI 3QT7A 2DEJA 2J7KA 4DV5I 2UXDI 4LF7E 4JI3I 4RPFA 2AJ4A 1J5EI 1ELOA 2HK3A 2V34A 4LF8E 4FWHA 3WU6A 1HNXI 2V2VA 1XNRI 4LFCE 1KIJA 4JYAI 4K0KI 4LF5E 4LF8I 4YY3I 1Z0GA 4B3ME 1HNWE 2VQFE 4DR1E 4LF5I 4JI2E 4R1FA 4B3MI 1HNWI 1Z5BA 2V8PA 4KQVA 4FWDA 4X64E 1N36I 3WU5A 3H4LA 1XNQE 4PRXA 4DR3E 4DXLA 4DV7E 4ZVIA 1NHJA 1N33E 2UUAE 4DR3I 4DV7I 4EMDA 4ED4A 1HNZE 1HR0E 5LMUI 5IT9Q 4FWGA 2E1RA 4DV6I 4DV2E 3OTOE 1XMQE 4WUBA 1Z0EA 1FJGE 3J81C 1XMOE 1XMQI 1EA6A 4KHPI 1ZXNA 1PIEA 3ZZ0A 1XMOI 5A2QQ 4X62E 4NXNI 4DUZE 1EI1A 3PYDA 3J80C 2HKEA 3QT5A 4GKKE 4DR5E 3T1HE 4JV5I 4GKJE 4DPXA 1Z5AA 1IBME 2HKJA 4DPUA 4OX9E 4LF9E 4LF4I 4MYTA 1I94E 1IBKI 4DV1E 3B8HA 5LL6R 2A2CA 3ZZTA 1B62A 2UXCE 3JAMC 2BM1A 1I94I 1FI4A 4JI1E 2ZITA 4X66E 2UXCI 1D6TA 4WUCA 4AQYE 4B3RI 1XHKA 3J7AM 4B3TE 4DR6E 4HXZA 3QT8A 2Q2EB 2VQEE 3B78A 4PU9A 2V2ZA 2VF3A 4JI0E 4P52A 4DR2E 4NXMI 2ZBKB 2R3VA 4DR2I 3WU3A 4JI8E 1K47A
chains in the Genus database with same CATH superfamily
1Z0VA 5FLXC 4DUYE 5L3JA 1YH8A 4DV0E 4LF7I 3T1YE 2UU9E 2PO0A 1UEKA 3WU4A 4OZEA 1S4EA 2PNLA 3M7ND 4FW6A 4LFCI 3ZM7A 2GS8A 3P76A 2OI2A 4LCFA 4DPWA 1Z59A 2HFUA 5C0XF 4USMA 2NN6B 2CZ9A 2VQFI 4DR1I 1ZXMA 2WW4A 4JI2I 2E5LE 3PYGA 3ZKBA 3GLLA 3U1YA 5BR8E 2C39B 4X64I 4UTGA 1XNQI 4MU3A 2WP8B 1Z5CA 1UDQA 2IESA 3PYEA 5DNXA 4WUDA 2NN6D 1N33I 2UUAI 4GQUA 4B3SE 3KRNA 1RHYA 2XEXA 2BV3A 1NHHA 1Z0TA 4IZKB 3V2UC 1HR0I 1HNZI 2LJPA 2C39A 4B3SI 2O1TA 4Z7YA 2WP8A 4FW5A 4DV2I 1RR9A 3OTOI 5IT9C 1ZM9A 5LMNE 1H7SA 1FJGI 3K17A 4UT4A 4IZKA 5K36A 4DR4E 3B4TA 3LPSA 4LFBE 1UDOA 3J7AG 4IFDD 1QZRA 2GO3A 4X62I 4JI6E 4DUZI 4DU7A 5GMEA 3P3GA 4DV4E 5DRPA 5A2QC 2HHHE 1N32E 1Z0CA 2Z5BB 3ZKDA 4GKKI 4DR5I 4JI6I 3PRYA 3J80Q 2VESA 4DPTA 1IBLE 1PVGA 2HHHI 4J3DA 2DEIA 2JEBB 3T1HI 2CVEA 5FWKA 1N34E 3ZZUA 3QT6A 4GKJI 4PRVA 2Z5BA 1IBMI 3Q1QA 2BR2A 4HY1A 4MU0A 1USVA 4OX9I 4LF9I 2UXBE 3M85D 5JEAE 2JEBA 2NN6C 4DV1I 4OO1F 4FN5A 2PNMA 4DPYA 4HACB 3LTOA 2AE8A 1FWLA 2JE6A 4JI1I 4M1KA 4X66I 5IWAE 4LCHA 4DV3E 4AQYI 2BA0D 3M6AA 4B3TI 4DR6I 4HACA 1MG7A 4YHHE 2VQEI 1N0VC 1U2RA 4JI0I 2UUCE 1RREA 3F0NA 4X65E 1B63A 3HULA 1FNMA 2GQ0A 4JI8I 1ZM3A 2O3ZA 4U3BA 2F4VE 4BA2B 4DUYI 5JEAF 1Z0BA 1KKHA 5C0XD 4HYMA 2UUBE 2UXDE 1NZ0A 2X36A 4MDTA 4DV0I 3T1YI 1J5EE 2UU9I 4OKGA 1HNXE 2IOPA 2UUBI 1XNRE 4JYAE 1Z0WA 4BA2A 4K0KE 2EFGA 1R6MA 4YY3E 5EKWA 2E5LI 4DU8A 5BR8I 3V5RA 2NN6A 2R42A 1N36E 3H1CA 4JI7E 2IERA 5DNLA 1FKAE 4JI5E 1DARA 2Z5EA 1H74A 5K36E 2CG9A 4JI7I 4IFDB 2A2DA 5GMDA 4JI5I 5LMUE 3PS1A 4LFAE 1H7UA 4OO1E 4USKA 4DV6E 4LFAI 3J81Q 4MU1A 5LMNI 4IFDA 1BKNA 4KHPE 2O1UA 1N0UA 4DR4I 2F1DA 1MX0A 4DR7E 4LFBI 4IZJB 4MYUA 4Z7CA 2BM0A 5DRQA 1ZM4A 4NXNE 4DV4I 4DR7I 1N32I 4BA1B 1Y60A 3Q6MA 3M7NG 1KTVA 1IBLI 4FW9A 2NPFA 1A6FA 4JV5E 4IZJD 4AIDA 4OO1D 1N34I 4LF6E 4I3HA 2X7IA 5K36F 4XTJA 1H72C 2ZM6E 2C37B 4BA1A 1H73A 4LF6I 1KVKA 1MU5A 4LF4E 3LNUA 4FW4A 5DROA 2UXBI 2ZM6I 4JG4A 1ZM2A 3P3CA 1OJ4A 3U1KA 1IBKE 4ISAA 3P06A 3JAMQ 2GO4A 1E3PA 3K1JA 4JI4E 2C37A 4P7AA 1E3HA 1VISA 5JEAB 1S16A 4FW7A 2V2QA 1PKPA 2PNZB 5IWAI 4JI4I 4DV3I 1P42A 3D4JA 4B3RE 2HFSA 4U3DA 3GONA 1VI7A 4AM3A 4IFDC 1FWKA 4LPFA 5C0XB 4YHHI 3CWVA 3PYFA 5JEAD 1NHIA 4NBQA 2UUCI 2PNZA 1WUUA 4URLA 4X65I 3B82A 4NXME 3K85A 2HK2A 3PS3A 5C0XA 4DV5E 5FLXQ 3NZKA 4JI3E 2F4VI 3QT7A 2DEJA 2J7KA 4DV5I 2UXDI 4MQYA 4LF7E 4JI3I 4RPFA 2AJ4A 1J5EI 1ELOA 2HK3A 2V34A 3P3EA 4FWHA 3WU6A 4LF8E 1HNXI 1Y5YA 2V2VA 2NN6E 1XNRI 4LFCE 1KIJA 1XXEA 4JYAI 4K0KI 4LF5E 4LF8I 1UDSA 3PS2A 4YY3I 1Z0GA 3M85G 4B3ME 2VQFE 4DR1E 4AIMA 4LF5I 1HNWE 4JI2E 4R1FA 4B3MI 1HNWI 1Z5BA 1Y4SA 2V8PA 4KQVA 4FWDA 4LOMA 3WU5A 3H4LA 4X64E 1N36I 1XNQE 2PO1B 2BA1D 4PRXA 4DR3E 4DXLA 4DV7E 4ZVIA 1NHJA 1OYSA 4IFDE 1N33E 2UUAE 2BA0G 5ELWA 4DR3I 4DV7I 4EMDA 5JEAC 1Y6ZA 2IOQA 3HKMA 4ED4A 2O1VA 3L7ZB 1HNZE 1HR0E 5LMUI 5IT9Q 4FWGA 2PO1A 3UHMA 2E1RA 2PO2B 4DV6I 4DV2E 3OTOE 5DRRA 1XMQE 5K36B 4WUBA 4IS9A 5C0XC 2NN6F 1Z0EA 1FJGE 1USUA 3GMEA 3J81C 1XMOE 1XMQI 1EA6A 3GCMA 4OO1B 4KHPI 3L7ZA 1ZXNA 1PIEA 3ZZ0A 1XMOI 2PO2A 4MU4A 5A2QQ 4X62E 4NXNI 4DUZE 5K36D 1EI1A 3PYDA 2Z5CB 3J80C 2HKEA 2JT2A 3QT5A 4IZJA 2O1WA 3HJCA 4GKKE 4OO1A 4DR5E 1R6LA 4LCGA 1YHCA 2C38B 4QNJA 3T1HE 2BR2B 2J65A 4JV5I 4IFDF 3DD6A 1OYRA 4QNKA 1UDNA 4GKJE 2Z5CA 4DPXA 1Z5AA 1IBME 2HKJA 4DPUA 4OX9E 4LF9E 2C38A 4LF4I 2JE6B 4MYTA 1I94E 1IBKI 4DV1E 4FW3A 3B8HA 5LL6R 2A2CA 3ZZTA 1B62A 1OYPA 2UXCE 3JAMC 2BM1A 3CDIA 1I94I 2BA1G 1FI4A 4JI1E 2ZITA 4X66E 2UXCI 1D6TA 4WUCA 1HK7A 4AQYE 4B3RI 1Y4UA 5C0XE 1XHKA 3J7AM 2WNRB 3Q6NA 5JEAA 2JEAB 4B3TE 4DR6E 4HXZA 3QT8A 2Q2EB 2CGEA 3B78A 2VQEE 4PU9A 2V2ZA 2VF3A 4JI0E 4P52A 4DR2E 5K36C 4NXMI 3CDJA 4N3OA 2WNRA 2ZBKB 5EL9A 2JEAA 2PO0B 2R3VA 4DR2I 3WU3A 4JI8E 4OO1C 1K47A
chains in the Genus database with same CATH topology
1Z0VA 5FLXC 4DUYE 5L3JA 4DV0E 4LF7I 3T1YE 2UU9E 1UEKA 3WU4A 1S4EA 2PNLA 4LFCI 3ZM7A 2GS8A 2OI2A 4DPWA 1Z59A 2HFUA 4USMA 2VQFI 2CZ9A 4DR1I 1ZXMA 2WW4A 4JI2I 2E5LE 3PYGA 3ZKBA 5BR8E 4X64I 4UTGA 1XNQI 1Z5CA 3PYEA 4WUDA 1N33I 2UUAI 4B3SE 2XEXA 2BV3A 1NHHA 1Z0TA 4IZKB 3V2UC 1HR0I 1HNZI 2LJPA 4B3SI 2O1TA 4Z7YA 4DV2I 1RR9A 3OTOI 5IT9C 1ZM9A 5LMNE 1H7SA 1FJGI 3K17A 4UT4A 4IZKA 4DR4E 3LPSA 4LFBE 3J7AG 1QZRA 4X62I 4JI6E 4DUZI 4DU7A 5GMEA 4DV4E 5A2QC 2HHHE 1N32E 1Z0CA 2Z5BB 3ZKDA 4GKKI 4DR5I 4JI6I 3PRYA 3J80Q 4DPTA 1IBLE 1PVGA 2HHHI 2DEIA 3T1HI 5FWKA 1N34E 3ZZUA 3QT6A 4GKJI 4PRVA 2Z5BA 1IBMI 3Q1QA 4HY1A 1USVA 4OX9I 4LF9I 2UXBE 4DV1I 4FN5A 2PNMA 4DPYA 4HACB 3LTOA 1FWLA 4JI1I 4M1KA 4X66I 5IWAE 4DV3E 4AQYI 3M6AA 4B3TI 4DR6I 4HACA 1MG7A 4YHHE 2VQEI 1N0VC 1U2RA 4JI0I 2UUCE 1RREA 3F0NA 4X65E 1B63A 3HULA 1FNMA 2GQ0A 4JI8I 1ZM3A 2F4VE 4DUYI 1Z0BA 1KKHA 4HYMA 2UUBE 2UXDE 1NZ0A 2X36A 4DV0I 3T1YI 1J5EE 2UU9I 1HNXE 2IOPA 2UUBI 1XNRE 4JYAE 1Z0WA 4K0KE 2EFGA 4YY3E 2E5LI 4DU8A 5BR8I 3V5RA 2R42A 1N36E 4JI7E 1FKAE 4JI5E 1DARA 2Z5EA 1H74A 2CG9A 4JI7I 2A2DA 5GMDA 4JI5I 5LMUE 4LFAE 1H7UA 4USKA 4DV6E 4LFAI 3J81Q 5LMNI 1BKNA 4KHPE 2O1UA 1N0UA 4DR4I 1MX0A 4DR7E 4LFBI 4IZJB 4MYUA 4Z7CA 2BM0A 1ZM4A 4NXNE 4DV4I 4DR7I 1N32I 3Q6MA 1KTVA 1IBLI 4FW9A 2NPFA 1A6FA 4JV5E 4IZJD 1N34I 4LF6E 4I3HA 2X7IA 4XTJA 1H72C 2ZM6E 1H73A 4LF6I 1KVKA 1MU5A 4LF4E 3LNUA 2UXBI 2ZM6I 4JG4A 1ZM2A 1OJ4A 1IBKE 3P06A 3JAMQ 3K1JA 4JI4E 4P7AA 1VISA 1S16A 2V2QA 1PKPA 5IWAI 4JI4I 4DV3I 3D4JA 4B3RE 2HFSA 3GONA 1FWKA 4YHHI 3CWVA 3PYFA 1NHIA 2UUCI 1WUUA 4URLA 4X65I 3B82A 4NXME 3K85A 2HK2A 4DV5E 5FLXQ 4JI3E 2F4VI 3QT7A 2DEJA 2J7KA 4DV5I 2UXDI 4LF7E 4JI3I 4RPFA 2AJ4A 1J5EI 1ELOA 2HK3A 2V34A 4LF8E 4FWHA 3WU6A 1HNXI 2V2VA 1XNRI 4LFCE 1KIJA 4JYAI 4K0KI 4LF5E 4LF8I 4YY3I 1Z0GA 4B3ME 1HNWE 2VQFE 4DR1E 4LF5I 4JI2E 4R1FA 4B3MI 1HNWI 1Z5BA 1Y4SA 2V8PA 4KQVA 4FWDA 4X64E 1N36I 3WU5A 3H4LA 1XNQE 4PRXA 4DR3E 4DXLA 4DV7E 4ZVIA 1NHJA 1N33E 2UUAE 4DR3I 4DV7I 4EMDA 1Y6ZA 2IOQA 4ED4A 2O1VA 1HNZE 1HR0E 5LMUI 5IT9Q 4FWGA 2E1RA 4DV6I 4DV2E 3OTOE 1XMQE 4WUBA 1Z0EA 1FJGE 1USUA 3J81C 1XMOE 1XMQI 1EA6A 4KHPI 1ZXNA 1PIEA 3ZZ0A 1XMOI 5A2QQ 4X62E 4NXNI 4DUZE 1EI1A 3PYDA 2Z5CB 3J80C 2HKEA 3QT5A 4IZJA 2O1WA 3HJCA 4GKKE 4DR5E 3T1HE 4JV5I 4GKJE 2Z5CA 4DPXA 1Z5AA 1IBME 2HKJA 4DPUA 4OX9E 4LF9E 4LF4I 4MYTA 1I94E 1IBKI 4DV1E 3B8HA 5LL6R 2A2CA 3ZZTA 1B62A 2UXCE 3JAMC 2BM1A 1I94I 1FI4A 4JI1E 2ZITA 4X66E 2UXCI 1D6TA 4WUCA 1HK7A 4AQYE 4B3RI 1Y4UA 1XHKA 3J7AM 3Q6NA 4B3TE 4DR6E 4HXZA 3QT8A 2Q2EB 2CGEA 3B78A 2VQEE 4PU9A 2V2ZA 2VF3A 4JI0E 4P52A 4DR2E 4NXMI 4N3OA 2ZBKB 2R3VA 4DR2I 3WU3A 4JI8E 1K47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0V A;  5FLX C;  4DUY E;  5L3J A;  4DV0 E;  4LF7 I;  3T1Y E;  2UU9 E;  1UEK A;  3WU4 A;  1S4E A;  4LFC I;  3ZM7 A;  2GS8 A;  2OI2 A;  4DPW A;  1Z59 A;  2HFU A;  4USM A;  2VQF I;  2CZ9 A;  4DR1 I;  1ZXM A;  2WW4 A;  4JI2 I;  2E5L E;  3PYG A;  3ZKB A;  5BR8 E;  4X64 I;  4UTG A;  1XNQ I;  1Z5C A;  3PYE A;  4WUD A;  1N33 I;  2UUA I;  4B3S E;  2XEX A;  2BV3 A;  1NHH A;  1Z0T A;  3V2U C;  1HR0 I;  1HNZ I;  2LJP A;  4B3S I;  4Z7Y A;  4DV2 I;  1RR9 A;  3OTO I;  5IT9 C;  1ZM9 A;  5LMN E;  1H7S A;  1FJG I;  3K17 A;  4UT4 A;  4DR4 E;  3LPS A;  4LFB E;  3J7A G;  1QZR A;  4X62 I;  4JI6 E;  4DUZ I;  4DU7 A;  5GME A;  4DV4 E;  5A2Q C;  2HHH E;  1N32 E;  1Z0C A;  3ZKD A;  4GKK I;  4DR5 I;  4JI6 I;  3J80 Q;  4DPT A;  1IBL E;  1PVG A;  2HHH I;  2DEI A;  3T1H I;  1N34 E;  3ZZU A;  3QT6 A;  4GKJ I;  4PRV A;  1IBM I;  3Q1Q A;  4HY1 A;  4OX9 I;  4LF9 I;  2UXB E;  4DV1 I;  4FN5 A;  4DPY A;  4HAC B;  3LTO A;  1FWL A;  4JI1 I;  4M1K A;  4X66 I;  5IWA E;  4DV3 E;  4AQY I;  3M6A A;  4B3T I;  4DR6 I;  4HAC A;  1MG7 A;  4YHH E;  2VQE I;  1N0V C;  1U2R A;  4JI0 I;  2UUC E;  1RRE A;  3F0N A;  4X65 E;  1B63 A;  3HUL A;  1FNM A;  4JI8 I;  1ZM3 A;  2F4V E;  4DUY I;  1Z0B A;  1KKH A;  4HYM A;  2UUB E;  2UXD E;  1NZ0 A;  2X36 A;  4DV0 I;  3T1Y I;  1J5E E;  2UU9 I;  1HNX E;  2UUB I;  1XNR E;  4JYA E;  1Z0W A;  4K0K E;  2EFG A;  4YY3 E;  2E5L I;  4DU8 A;  5BR8 I;  3V5R A;  2R42 A;  1N36 E;  4JI7 E;  1FKA E;  4JI5 E;  1DAR A;  1H74 A;  4JI7 I;  2A2D A;  5GMD A;  4JI5 I;  5LMU E;  4LFA E;  1H7U A;  4USK A;  4DV6 E;  4LFA I;  3J81 Q;  5LMN I;  1BKN A;  4KHP E;  1N0U A;  4DR4 I;  1MX0 A;  4DR7 E;  4LFB I;  4MYU A;  4Z7C A;  2BM0 A;  1ZM4 A;  4NXN E;  4DV4 I;  4DR7 I;  1N32 I;  1KTV A;  1IBL I;  4FW9 A;  2NPF A;  1A6F A;  4JV5 E;  1N34 I;  4LF6 E;  4I3H A;  2X7I A;  4XTJ A;  1H72 C;  2ZM6 E;  1H73 A;  4LF6 I;  1KVK A;  1MU5 A;  4LF4 E;  3LNU A;  2UXB I;  2ZM6 I;  4JG4 A;  1ZM2 A;  1OJ4 A;  1IBK E;  3JAM Q;  3K1J A;  4JI4 E;  4P7A A;  1VIS A;  1S16 A;  2V2Q A;  1PKP A;  5IWA I;  4JI4 I;  4DV3 I;  3D4J A;  4B3R E;  2HFS A;  3GON A;  1FWK A;  4YHH I;  3CWV A;  3PYF A;  1NHI A;  2UUC I;  1WUU A;  4URL A;  4X65 I;  3B82 A;  4NXM E;  2HK2 A;  4DV5 E;  5FLX Q;  4JI3 E;  2F4V I;  3QT7 A;  2DEJ A;  2J7K A;  4DV5 I;  2UXD I;  4LF7 E;  4JI3 I;  4RPF A;  2AJ4 A;  1J5E I;  1ELO A;  2HK3 A;  2V34 A;  4LF8 E;  4FWH A;  3WU6 A;  1HNX I;  2V2V A;  1XNR I;  4LFC E;  1KIJ A;  4JYA I;  4K0K I;  4LF5 E;  4LF8 I;  4YY3 I;  1Z0G A;  4B3M E;  1HNW E;  2VQF E;  4DR1 E;  4LF5 I;  4JI2 E;  4R1F A;  4B3M I;  1HNW I;  1Z5B A;  2V8P A;  4KQV A;  4FWD A;  4X64 E;  1N36 I;  3WU5 A;  3H4L A;  1XNQ E;  4PRX A;  4DR3 E;  4DXL A;  4DV7 E;  4ZVI A;  1NHJ A;  1N33 E;  2UUA E;  4DR3 I;  4DV7 I;  4EMD A;  4ED4 A;  1HNZ E;  1HR0 E;  5LMU I;  5IT9 Q;  4FWG A;  2E1R A;  4DV6 I;  4DV2 E;  3OTO E;  1XMQ E;  4WUB A;  1Z0E A;  1FJG E;  3J81 C;  1XMO E;  1XMQ I;  1EA6 A;  4KHP I;  1ZXN A;  1PIE A;  3ZZ0 A;  1XMO I;  5A2Q Q;  4X62 E;  4NXN I;  4DUZ E;  1EI1 A;  3PYD A;  3J80 C;  2HKE A;  3QT5 A;  4GKK E;  4DR5 E;  3T1H E;  4JV5 I;  4GKJ E;  4DPX A;  1Z5A A;  1IBM E;  2HKJ A;  4DPU A;  4OX9 E;  4LF9 E;  4LF4 I;  4MYT A;  1I94 E;  1IBK I;  4DV1 E;  3B8H A;  5LL6 R;  2A2C A;  3ZZT A;  1B62 A;  2UXC E;  3JAM C;  2BM1 A;  1I94 I;  1FI4 A;  4JI1 E;  2ZIT A;  4X66 E;  2UXC I;  1D6T A;  4WUC A;  4AQY E;  4B3R I;  1XHK A;  3J7A M;  4B3T E;  4DR6 E;  4HXZ A;  3QT8 A;  2Q2E B;  2VQE E;  3B78 A;  4PU9 A;  2V2Z A;  2VF3 A;  4JI0 E;  4P52 A;  4DR2 E;  4NXM I;  2ZBK B;  2R3V A;  4DR2 I;  3WU3 A;  4JI8 E;  1K47 A; 
#chains in the Genus database with same CATH topology
 1Z0V A;  5FLX C;  4DUY E;  5L3J A;  1YH8 A;  4DV0 E;  4LF7 I;  3T1Y E;  2UU9 E;  2PO0 A;  1UEK A;  3WU4 A;  4OZE A;  1S4E A;  2PNL A;  3M7N D;  4FW6 A;  4LFC I;  3ZM7 A;  2GS8 A;  3P76 A;  2OI2 A;  4LCF A;  4DPW A;  1Z59 A;  2HFU A;  5C0X F;  4USM A;  2NN6 B;  2CZ9 A;  2VQF I;  4DR1 I;  1ZXM A;  2WW4 A;  4JI2 I;  2E5L E;  3PYG A;  3ZKB A;  3GLL A;  3U1Y A;  5BR8 E;  2C39 B;  4X64 I;  4UTG A;  1XNQ I;  4MU3 A;  2WP8 B;  1Z5C A;  1UDQ A;  2IES A;  3PYE A;  5DNX A;  4WUD A;  2NN6 D;  1N33 I;  2UUA I;  4GQU A;  4B3S E;  3KRN A;  1RHY A;  2XEX A;  2BV3 A;  1NHH A;  1Z0T A;  4IZK B;  3V2U C;  1HR0 I;  1HNZ I;  2LJP A;  2C39 A;  4B3S I;  2O1T A;  4Z7Y A;  2WP8 A;  4FW5 A;  4DV2 I;  1RR9 A;  3OTO I;  5IT9 C;  1ZM9 A;  5LMN E;  1H7S A;  1FJG I;  3K17 A;  4UT4 A;  4IZK A;  5K36 A;  4DR4 E;  3B4T A;  3LPS A;  4LFB E;  1UDO A;  3J7A G;  4IFD D;  1QZR A;  2GO3 A;  4X62 I;  4JI6 E;  4DUZ I;  4DU7 A;  5GME A;  3P3G A;  4DV4 E;  5DRP A;  5A2Q C;  2HHH E;  1N32 E;  1Z0C A;  2Z5B B;  3ZKD A;  4GKK I;  4DR5 I;  4JI6 I;  3PRY A;  3J80 Q;  2VES A;  4DPT A;  1IBL E;  1PVG A;  2HHH I;  4J3D A;  2DEI A;  2JEB B;  3T1H I;  2CVE A;  5FWK A;  1N34 E;  3ZZU A;  3QT6 A;  4GKJ I;  4PRV A;  2Z5B A;  1IBM I;  3Q1Q A;  2BR2 A;  4HY1 A;  4MU0 A;  1USV A;  4OX9 I;  4LF9 I;  2UXB E;  3M85 D;  5JEA E;  2JEB A;  2NN6 C;  4DV1 I;  4OO1 F;  4FN5 A;  2PNM A;  4DPY A;  4HAC B;  3LTO A;  2AE8 A;  1FWL A;  2JE6 A;  4JI1 I;  4M1K A;  4X66 I;  5IWA E;  4LCH A;  4DV3 E;  4AQY I;  2BA0 D;  3M6A A;  4B3T I;  4DR6 I;  4HAC A;  1MG7 A;  4YHH E;  2VQE I;  1N0V C;  1U2R A;  4JI0 I;  2UUC E;  1RRE A;  3F0N A;  4X65 E;  1B63 A;  3HUL A;  1FNM A;  2GQ0 A;  4JI8 I;  1ZM3 A;  2O3Z A;  4U3B A;  2F4V E;  4BA2 B;  4DUY I;  5JEA F;  1Z0B A;  1KKH A;  5C0X D;  4HYM A;  2UUB E;  2UXD E;  1NZ0 A;  2X36 A;  4MDT A;  4DV0 I;  3T1Y I;  1J5E E;  2UU9 I;  4OKG A;  1HNX E;  2IOP A;  2UUB I;  1XNR E;  4JYA E;  1Z0W A;  4BA2 A;  4K0K E;  2EFG A;  1R6M A;  4YY3 E;  5EKW A;  2E5L I;  4DU8 A;  5BR8 I;  3V5R A;  2NN6 A;  2R42 A;  1N36 E;  3H1C A;  4JI7 E;  2IER A;  5DNL A;  1FKA E;  4JI5 E;  1DAR A;  2Z5E A;  1H74 A;  5K36 E;  2CG9 A;  4JI7 I;  4IFD B;  2A2D A;  5GMD A;  4JI5 I;  5LMU E;  3PS1 A;  4LFA E;  1H7U A;  4OO1 E;  4USK A;  4DV6 E;  4LFA I;  3J81 Q;  4MU1 A;  5LMN I;  4IFD A;  1BKN A;  4KHP E;  2O1U A;  1N0U A;  4DR4 I;  2F1D A;  1MX0 A;  4DR7 E;  4LFB I;  4IZJ B;  4MYU A;  4Z7C A;  2BM0 A;  5DRQ A;  1ZM4 A;  4NXN E;  4DV4 I;  4DR7 I;  1N32 I;  4BA1 B;  1Y60 A;  3Q6M A;  3M7N G;  1KTV A;  1IBL I;  4FW9 A;  2NPF A;  1A6F A;  4JV5 E;  4IZJ D;  4AID A;  4OO1 D;  1N34 I;  4LF6 E;  4I3H A;  2X7I A;  5K36 F;  4XTJ A;  1H72 C;  2ZM6 E;  2C37 B;  4BA1 A;  1H73 A;  4LF6 I;  1KVK A;  1MU5 A;  4LF4 E;  3LNU A;  4FW4 A;  5DRO A;  2UXB I;  2ZM6 I;  4JG4 A;  1ZM2 A;  3P3C A;  1OJ4 A;  3U1K A;  1IBK E;  4ISA A;  3P06 A;  3JAM Q;  2GO4 A;  1E3P A;  3K1J A;  4JI4 E;  2C37 A;  4P7A A;  1E3H A;  1VIS A;  5JEA B;  1S16 A;  4FW7 A;  2V2Q A;  1PKP A;  2PNZ B;  5IWA I;  4JI4 I;  4DV3 I;  1P42 A;  3D4J A;  4B3R E;  2HFS A;  4U3D A;  3GON A;  1VI7 A;  4AM3 A;  4IFD C;  1FWK A;  4LPF A;  5C0X B;  4YHH I;  3CWV A;  3PYF A;  5JEA D;  1NHI A;  4NBQ A;  2UUC I;  2PNZ A;  1WUU A;  4URL A;  4X65 I;  3B82 A;  4NXM E;  3K85 A;  2HK2 A;  3PS3 A;  5C0X A;  4DV5 E;  5FLX Q;  3NZK A;  4JI3 E;  2F4V I;  3QT7 A;  2DEJ A;  2J7K A;  4DV5 I;  2UXD I;  4MQY A;  4LF7 E;  4JI3 I;  4RPF A;  2AJ4 A;  1J5E I;  1ELO A;  2HK3 A;  2V34 A;  3P3E A;  4FWH A;  3WU6 A;  4LF8 E;  1HNX I;  1Y5Y A;  2V2V A;  2NN6 E;  1XNR I;  4LFC E;  1KIJ A;  1XXE A;  4JYA I;  4K0K I;  4LF5 E;  4LF8 I;  1UDS A;  3PS2 A;  4YY3 I;  1Z0G A;  3M85 G;  4B3M E;  2VQF E;  4DR1 E;  4AIM A;  4LF5 I;  1HNW E;  4JI2 E;  4R1F A;  4B3M I;  1HNW I;  1Z5B A;  1Y4S A;  2V8P A;  4KQV A;  4FWD A;  4LOM A;  3WU5 A;  3H4L A;  4X64 E;  1N36 I;  1XNQ E;  2PO1 B;  2BA1 D;  4PRX A;  4DR3 E;  4DXL A;  4DV7 E;  4ZVI A;  1NHJ A;  1OYS A;  4IFD E;  1N33 E;  2UUA E;  2BA0 G;  5ELW A;  4DR3 I;  4DV7 I;  4EMD A;  5JEA C;  1Y6Z A;  2IOQ A;  3HKM A;  4ED4 A;  2O1V A;  3L7Z B;  1HNZ E;  1HR0 E;  5LMU I;  5IT9 Q;  4FWG A;  2PO1 A;  3UHM A;  2E1R A;  2PO2 B;  4DV6 I;  4DV2 E;  3OTO E;  5DRR A;  1XMQ E;  5K36 B;  4WUB A;  4IS9 A;  5C0X C;  2NN6 F;  1Z0E A;  1FJG E;  1USU A;  3GME A;  3J81 C;  1XMO E;  1XMQ I;  1EA6 A;  3GCM A;  4OO1 B;  4KHP I;  3L7Z A;  1ZXN A;  1PIE A;  3ZZ0 A;  1XMO I;  2PO2 A;  4MU4 A;  5A2Q Q;  4X62 E;  4NXN I;  4DUZ E;  5K36 D;  1EI1 A;  3PYD A;  2Z5C B;  3J80 C;  2HKE A;  2JT2 A;  3QT5 A;  4IZJ A;  2O1W A;  3HJC A;  4GKK E;  4OO1 A;  4DR5 E;  1R6L A;  4LCG A;  1YHC A;  2C38 B;  4QNJ A;  3T1H E;  2BR2 B;  2J65 A;  4JV5 I;  4IFD F;  3DD6 A;  1OYR A;  4QNK A;  1UDN A;  4GKJ E;  2Z5C A;  4DPX A;  1Z5A A;  1IBM E;  2HKJ A;  4DPU A;  4OX9 E;  4LF9 E;  2C38 A;  4LF4 I;  2JE6 B;  4MYT A;  1I94 E;  1IBK I;  4DV1 E;  4FW3 A;  3B8H A;  5LL6 R;  2A2C A;  3ZZT A;  1B62 A;  1OYP A;  2UXC E;  3JAM C;  2BM1 A;  3CDI A;  1I94 I;  2BA1 G;  1FI4 A;  4JI1 E;  2ZIT A;  4X66 E;  2UXC I;  1D6T A;  4WUC A;  1HK7 A;  4AQY E;  4B3R I;  1Y4U A;  5C0X E;  1XHK A;  3J7A M;  2WNR B;  3Q6N A;  5JEA A;  2JEA B;  4B3T E;  4DR6 E;  4HXZ A;  3QT8 A;  2Q2E B;  2CGE A;  3B78 A;  2VQE E;  4PU9 A;  2V2Z A;  2VF3 A;  4JI0 E;  4P52 A;  4DR2 E;  5K36 C;  4NXM I;  3CDJ A;  4N3O A;  2WNR A;  2ZBK B;  5EL9 A;  2JEA A;  2PO0 B;  2R3V A;  4DR2 I;  3WU3 A;  4JI8 E;  4OO1 C;  1K47 A; 
#chains in the Genus database with same CATH homology
 1Z0V A;  5FLX C;  4DUY E;  5L3J A;  4DV0 E;  4LF7 I;  3T1Y E;  2UU9 E;  1UEK A;  3WU4 A;  1S4E A;  2PNL A;  4LFC I;  3ZM7 A;  2GS8 A;  2OI2 A;  4DPW A;  1Z59 A;  2HFU A;  4USM A;  2VQF I;  2CZ9 A;  4DR1 I;  1ZXM A;  2WW4 A;  4JI2 I;  2E5L E;  3PYG A;  3ZKB A;  5BR8 E;  4X64 I;  4UTG A;  1XNQ I;  1Z5C A;  3PYE A;  4WUD A;  1N33 I;  2UUA I;  4B3S E;  2XEX A;  2BV3 A;  1NHH A;  1Z0T A;  4IZK B;  3V2U C;  1HR0 I;  1HNZ I;  2LJP A;  4B3S I;  2O1T A;  4Z7Y A;  4DV2 I;  1RR9 A;  3OTO I;  5IT9 C;  1ZM9 A;  5LMN E;  1H7S A;  1FJG I;  3K17 A;  4UT4 A;  4IZK A;  4DR4 E;  3LPS A;  4LFB E;  3J7A G;  1QZR A;  4X62 I;  4JI6 E;  4DUZ I;  4DU7 A;  5GME A;  4DV4 E;  5A2Q C;  2HHH E;  1N32 E;  1Z0C A;  2Z5B B;  3ZKD A;  4GKK I;  4DR5 I;  4JI6 I;  3PRY A;  3J80 Q;  4DPT A;  1IBL E;  1PVG A;  2HHH I;  2DEI A;  3T1H I;  5FWK A;  1N34 E;  3ZZU A;  3QT6 A;  4GKJ I;  4PRV A;  2Z5B A;  1IBM I;  3Q1Q A;  4HY1 A;  1USV A;  4OX9 I;  4LF9 I;  2UXB E;  4DV1 I;  4FN5 A;  2PNM A;  4DPY A;  4HAC B;  3LTO A;  1FWL A;  4JI1 I;  4M1K A;  4X66 I;  5IWA E;  4DV3 E;  4AQY I;  3M6A A;  4B3T I;  4DR6 I;  4HAC A;  1MG7 A;  4YHH E;  2VQE I;  1N0V C;  1U2R A;  4JI0 I;  2UUC E;  1RRE A;  3F0N A;  4X65 E;  1B63 A;  3HUL A;  1FNM A;  2GQ0 A;  4JI8 I;  1ZM3 A;  2F4V E;  4DUY I;  1Z0B A;  1KKH A;  4HYM A;  2UUB E;  2UXD E;  1NZ0 A;  2X36 A;  4DV0 I;  3T1Y I;  1J5E E;  2UU9 I;  1HNX E;  2IOP A;  2UUB I;  1XNR E;  4JYA E;  1Z0W A;  4K0K E;  2EFG A;  4YY3 E;  2E5L I;  4DU8 A;  5BR8 I;  3V5R A;  2R42 A;  1N36 E;  4JI7 E;  1FKA E;  4JI5 E;  1DAR A;  2Z5E A;  1H74 A;  2CG9 A;  4JI7 I;  2A2D A;  5GMD A;  4JI5 I;  5LMU E;  4LFA E;  1H7U A;  4USK A;  4DV6 E;  4LFA I;  3J81 Q;  5LMN I;  1BKN A;  4KHP E;  2O1U A;  1N0U A;  4DR4 I;  1MX0 A;  4DR7 E;  4LFB I;  4IZJ B;  4MYU A;  4Z7C A;  2BM0 A;  1ZM4 A;  4NXN E;  4DV4 I;  4DR7 I;  1N32 I;  3Q6M A;  1KTV A;  1IBL I;  4FW9 A;  2NPF A;  1A6F A;  4JV5 E;  4IZJ D;  1N34 I;  4LF6 E;  4I3H A;  2X7I A;  4XTJ A;  1H72 C;  2ZM6 E;  1H73 A;  4LF6 I;  1KVK A;  1MU5 A;  4LF4 E;  3LNU A;  2UXB I;  2ZM6 I;  4JG4 A;  1ZM2 A;  1OJ4 A;  1IBK E;  3P06 A;  3JAM Q;  3K1J A;  4JI4 E;  4P7A A;  1VIS A;  1S16 A;  2V2Q A;  1PKP A;  5IWA I;  4JI4 I;  4DV3 I;  3D4J A;  4B3R E;  2HFS A;  3GON A;  1FWK A;  4YHH I;  3CWV A;  3PYF A;  1NHI A;  2UUC I;  1WUU A;  4URL A;  4X65 I;  3B82 A;  4NXM E;  3K85 A;  2HK2 A;  4DV5 E;  5FLX Q;  4JI3 E;  2F4V I;  3QT7 A;  2DEJ A;  2J7K A;  4DV5 I;  2UXD I;  4LF7 E;  4JI3 I;  4RPF A;  2AJ4 A;  1J5E I;  1ELO A;  2HK3 A;  2V34 A;  4LF8 E;  4FWH A;  3WU6 A;  1HNX I;  2V2V A;  1XNR I;  4LFC E;  1KIJ A;  4JYA I;  4K0K I;  4LF5 E;  4LF8 I;  4YY3 I;  1Z0G A;  4B3M E;  1HNW E;  2VQF E;  4DR1 E;  4LF5 I;  4JI2 E;  4R1F A;  4B3M I;  1HNW I;  1Z5B A;  1Y4S A;  2V8P A;  4KQV A;  4FWD A;  4X64 E;  1N36 I;  3WU5 A;  3H4L A;  1XNQ E;  4PRX A;  4DR3 E;  4DXL A;  4DV7 E;  4ZVI A;  1NHJ A;  1N33 E;  2UUA E;  4DR3 I;  4DV7 I;  4EMD A;  1Y6Z A;  2IOQ A;  4ED4 A;  2O1V A;  1HNZ E;  1HR0 E;  5LMU I;  5IT9 Q;  4FWG A;  2E1R A;  4DV6 I;  4DV2 E;  3OTO E;  1XMQ E;  4WUB A;  1Z0E A;  1FJG E;  1USU A;  3J81 C;  1XMO E;  1XMQ I;  1EA6 A;  4KHP I;  1ZXN A;  1PIE A;  3ZZ0 A;  1XMO I;  5A2Q Q;  4X62 E;  4NXN I;  4DUZ E;  1EI1 A;  3PYD A;  2Z5C B;  3J80 C;  2HKE A;  3QT5 A;  4IZJ A;  2O1W A;  3HJC A;  4GKK E;  4DR5 E;  3T1H E;  4JV5 I;  4GKJ E;  2Z5C A;  4DPX A;  1Z5A A;  1IBM E;  2HKJ A;  4DPU A;  4OX9 E;  4LF9 E;  4LF4 I;  4MYT A;  1I94 E;  1IBK I;  4DV1 E;  3B8H A;  5LL6 R;  2A2C A;  3ZZT A;  1B62 A;  2UXC E;  3JAM C;  2BM1 A;  1I94 I;  1FI4 A;  4JI1 E;  2ZIT A;  4X66 E;  2UXC I;  1D6T A;  4WUC A;  1HK7 A;  4AQY E;  4B3R I;  1Y4U A;  1XHK A;  3J7A M;  3Q6N A;  4B3T E;  4DR6 E;  4HXZ A;  3QT8 A;  2Q2E B;  2CGE A;  3B78 A;  2VQE E;  4PU9 A;  2V2Z A;  2VF3 A;  4JI0 E;  4P52 A;  4DR2 E;  4NXM I;  4N3O A;  2ZBK B;  2R3V A;  4DR2 I;  3WU3 A;  4JI8 E;  1K47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...