2UUBI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uubI00
2HK3A 2LJPA 1KKHA 1HNXI 4X66I 2F4VE 5IT9Q 4JI1I 2VQEI 4K0KI 1UEKA 4DR2E 1IBMI 2V2QA 1HNWE 1XHKA 1MG7A 5IWAE 3PYDA 4JI3E 4JI1E 1RREA 4JI8I 1Z0CA 1FI4A 4X66E 2F4VI 1H7SA 4DV7E 5LMNE 4KHPE 2VQFE 4DR2I 5IWAI 2R3VA 3ZZ0A 5GMEA 4DPUA 5L3JA 2XEXA 2UU9E 5IT9C 3T1YI 4LF4E 4JYAI 4DUZI 4DV2I 4HY1A 4LFBE 1Z0VA 1BKNA 4MYUA 4LFAE 4URLA 2HKJA 2E5LE 4JI6E 5BR8E 3B82A 4B3SE 3LTOA 4JV5E 2OI2A 1IBLE 1VISA 1PKPA 1XNRI 1NHHA 3J7AM 4P7AA 2HHHE 1Z0WA 4DV6E 4B3RE 1H72C 4DPTA 2UUCE 4DV1I 2UXCI 1HR0I 2CZ9A 2A2CA 4MYTA 2BV3A 2E1RA 1FJGE 4B3MI 3PYEA 1NHJA 2V34A 2GS8A 3J7AG 2ZM6E 1WUUA 4LFAI 4WUDA 3T1HI 4GKJE 5LMUI 3WU4A 3PYFA 1ZM3A 1Z5BA 1FJGI 4DV6I 3ZKDA 4B3TI 1I94I 3LPSA 4UT4A 4LF8I 4LF6E 4Z7YA 1H73A 3T1YE 4DV0E 3V5RA 4PRXA 2UXCE 4YHHE 4ED4A 4LF8E 2J7KA 1N36I 4USKA 4NXNI 4JI7E 4DV7I 2UUAI 1XMOI 2ZBKB 4R1FA 3J81C 4B3RI 4DR4I 2HKEA 1NZ0A 2V2VA 4LF7E 3D4JA 1OJ4A 2HFUA 5GMDA 3F0NA 4DR5E 1NHIA 4LF4I 4JYAE 4JI8E 2UU9I 4DR4E 1Z0GA 4DV1E 4X64E 3J80C 1J5EE 4YY3I 3CWVA 3Q1QA 2HHHI 2VQFI 4DPXA 4YHHI 4JG4A 1N33I 1ZM9A 1U2RA 4WUCA 1MU5A 1ZXMA 4PRVA 4AQYI 4JI4E 1S16A 3QT6A 2UXBI 2A2DA 2HK2A 5LL6R 4DR6E 1ZM4A 4DR3E 3QT7A 3M6AA 4JI5E 4X65E 1EA6A 4PU9A 3B78A 4DUYE 1N0VC 1ELOA 1IBME 4DR3I 5LMUE 1Z0EA 4DPWA 1HR0E 4DUYI 4DV5I 1HNZI 1FWKA 3ZZUA 4JI5I 1N34I 1KIJA 4JI3I 1Z59A 4OX9E 5FLXC 3LNUA 2V8PA 4JI4I 4LF9E 5A2QQ 4M1KA 2ZM6I 2UXDI 1MX0A 4JI0I 4RPFA 4LF5I 3GONA 1XNQI 3K17A 2AJ4A 4EMDA 1FKAE 4LF9I 4JI2I 2UUBE 1N36E 4FWHA 2Q2EB 5BR8I 4DPYA 1XMOE 3ZM7A 4DV5E 4DR7I 4XTJA 1IBKI 2WW4A 4NXME 1XMQE 1B63A 1I94E 1EI1A 3JAMQ 4B3ME 4DR5I 4AQYE 4HXZA 4K0KE 3J80Q 2ZITA 3T1HE 4DR7E 2HFSA 4DXLA 4X65I 4JI7I 4X64I 4DR6I 4FW9A 3V2UC 2BM1A 4WUBA 2NPFA 4B3TE 2V2ZA 4NXNE 4I3HA 4UTGA 2E5LI 4JI6I 1S4EA 1Z0BA 1PIEA 4DR1E 2DEJA 1HNZE 4GKJI 4OX9I 1Z5CA 1B62A 3WU6A 1D6TA 2UXBE 4HYMA 3K1JA 3PYGA 4YY3E 1H74A 4ZVIA 4LFCE 1Z5AA 4DV0I 4DR1I 1A6FA 5LMNI 4KHPI 4Z7CA 1KVKA 1Z0TA 3ZKBA 2X36A 2BM0A 3H4LA 1H7UA 1ZM2A 5A2QC 4P52A 4GKKE 4HACA 4LF5E 4JI0E 4FWDA 1IBKE 1ZXNA 3WU5A 1QZRA 2R42A 4FWGA 1N33E 1K47A 3J81Q 1N0UA 3OTOI 4FN5A 4B3SI 4X62E 1KTVA 2VF3A 4JI2E 4DV4E 4LF6I 1XNRE 4DU7A 1IBLI 4LF7I 4LFCI 3HULA 3B8HA 1FNMA 2EFGA 2UXDE 4HACB 3QT8A 3OTOE 3WU3A 1FWLA 1RR9A 2X7IA 1J5EI 2UUCI 4DV4I 1DARA 4LFBI 2UUAE 4DUZE 4DV2E 3ZZTA 4DV3E 1N32E 1HNXE 4USMA 1XNQE 2UUBI 4GKKI 4JV5I 3QT5A 4DU8A 1PVGA 3JAMC 2VQEE 1HNWI 5FLXQ 4NXMI 4DV3I 1XMQI 1N32I 4X62I 2DEIA 1N34E 4KQVA
chains in the Genus database with same CATH superfamily
2HK3A 2C38B 2LJPA 1KKHA 1HNXI 4X66I 2F4VE 4OO1C 5EKWA 3M85G 5IT9Q 4JI1I 4GQUA 2C37B 2VQEI 4K0KI 2PO1B 1Y4SA 1UEKA 4IS9A 4DR2E 1IBMI 2NN6B 2Z5BB 2V2QA 1HNWE 2O1WA 1XHKA 1MG7A 1UDNA 5IWAE 2WP8B 3PYDA 4JI3E 4JI1E 4OKGA 1RREA 4JI8I 1Z0CA 1FI4A 4X66E 2F4VI 2CVEA 5JEAF 1H7SA 1Y4UA 4DV7E 5K36C 5LMNE 4LCFA 4KHPE 2VQFE 4DR2I 4BA1B 4IFDA 5IWAI 2R3VA 3ZZ0A 5DNLA 5GMEA 3M7ND 2JE6A 5C0XB 2JEAA 4QNKA 3U1KA 2Z5BA 2PNZA 4DPUA 5L3JA 2XEXA 2UU9E 5IT9C 2BA0G 5DNXA 3T1YI 4LF4E 4JYAI 4DUZI 4DV2I 4IFDE 4HY1A 4LFBE 4MYUA 1BKNA 1Z0VA 3HKMA 4URLA 4LFAE 2WNRB 2HKJA 2E5LE 4JI6E 5BR8E 5FWKA 3M85D 5DRRA 3B82A 2O1VA 3LTOA 4B3SE 4JV5E 2PO0B 2OI2A 1IBLE 1VISA 1PKPA 3KRNA 1XNRI 1NHHA 3J7AM 4P7AA 4LCHA 2JEBA 2HHHE 4IFDF 1Y5YA 1Z0WA 4DV6E 4B3RE 2PNZB 1H72C 2PNMA 2JEBB 4DPTA 5ELWA 2UUCE 1R6LA 4DV1I 2UXCI 1YH8A 1HR0I 5JEAE 5K36B 2CZ9A 2A2CA 4MYTA 2BV3A 2E1RA 1FJGE 5DRQA 5JEAC 4B3MI 3PYEA 1NHJA 4OO1B 2V34A 2GS8A 3J7AG 1WUUA 2ZM6E 2BA0D 4LFAI 3H1CA 2IERA 4WUDA 4BA1A 3T1HI 2CGEA 4GKJE 5LMUI 3WU4A 1HK7A 2JE6B 5C0XA 2NN6D 3PYFA 1ZM3A 1Z5BA 1FJGI 4DV6I 2WP8A 3ZKDA 3PS3A 4B3TI 1I94I 1XXEA 3LPSA 4UT4A 4LF8I 2BR2B 4BA2A 2NN6A 4LF6E 4MDTA 4Z7YA 4FW5A 4OO1D 1H73A 3T1YE 4DV0E 3V5RA 2WNRA 4PRXA 3P3GA 2UXCE 1YHCA 4YHHE 4ED4A 4LF8E 3K85A 2J7KA 1N36I 2PO1A 4USKA 4NXNI 4JI7E 4DV7I 2UUAI 3GMEA 1XMOI 2ZBKB 2O1TA 4R1FA 3J81C 1RHYA 4B3RI 4DR4I 2HKEA 4U3DA 1NZ0A 2V2VA 4IZJA 4LF7E 3D4JA 1OJ4A 2HFUA 5GMDA 4IFDC 3F0NA 4DR5E 1NHIA 4LF4I 4JYAE 4JI8E 2UU9I 4DR4E 1Z0GA 1UDOA 4MU1A 4DV1E 4IFDB 2PNLA 4X64E 4IZKB 3J80C 2BA1G 2F1DA 1J5EE 4YY3I 3CWVA 4N3OA 5C0XD 4IFDD 3Q1QA 2HHHI 4FW6A 4OZEA 2VQFI 4DPXA 4YHHI 4ISAA 4JG4A 5JEAB 1N33I 1ZM9A 1U2RA 4WUCA 1MU5A 4IZJD 1E3HA 1R6MA 2GO3A 1ZXMA 4PRVA 4AQYI 4JI4E 1S16A 3B4TA 3QT6A 2UXBI 2A2DA 2HK2A 3PRYA 5LL6R 4DR6E 2GQ0A 1ZM4A 4DR3E 3QT7A 3M6AA 4JI5E 4X65E 1EA6A 4PU9A 3B78A 4DUYE 4AIMA 1N0VC 1ELOA 1IBME 4DR3I 3CDIA 5LMUE 4LCGA 1Z0EA 3P3EA 4DPWA 2J65A 1HR0E 4DUYI 4DV5I 1HNZI 1FWKA 3ZZUA 2PO2A 4JI5I 3L7ZA 5K36D 1N34I 1KIJA 4JI3I 1Z59A 3CDJA 4OX9E 5FLXC 3LNUA 2V8PA 4JI4I 4LF9E 4AM3A 5A2QQ 2IOQA 4M1KA 2ZM6I 3UHMA 2UXDI 3P3CA 1MX0A 4JI0I 4RPFA 4LF5I 3GONA 3Q6NA 1XNQI 3K17A 2AJ4A 2GO4A 2VESA 4EMDA 3U1YA 1FKAE 1Y60A 4IZJB 4LF9I 4JI2I 2UUBE 1N36E 4BA2B 1UDQA 2Z5EA 4FWHA 3L7ZB 2Q2EB 5BR8I 1P42A 2PO0A 5C0XF 3P76A 4AIDA 4DPYA 1XMOE 3ZM7A 4DV5E 4DR7I 4XTJA 1IBKI 2WW4A 1XMQE 1B63A 1I94E 4NXME 1EI1A 3JAMQ 4B3ME 4DR5I 4AQYE 4HXZA 4K0KE 3J80Q 2ZITA 3T1HE 2JT2A 4DR7E 4J3DA 2HFSA 3P06A 3HJCA 4FW4A 4DXLA 4X65I 5K36F 2C37A 4JI7I 4X64I 4MU4A 3GLLA 4DR6I 4FW9A 3V2UC 2O3ZA 2BM1A 4WUBA 2NPFA 5JEAD 4LOMA 4B3TE 2V2ZA 4OO1A 4NXNE 4I3HA 4UTGA 2E5LI 2BR2A 5C0XC 4JI6I 1S4EA 1Z0BA 1PIEA 2C39A 5K36E 1E3PA 4DR1E 2IOPA 2DEJA 2NN6E 2C39B 2NN6C 1HNZE 2O1UA 4OX9I 4GKJI 1Z5CA 1B62A 5DRPA 3WU6A 1D6TA 2Z5CB 4MU3A 2UXBE 1VI7A 2C38A 3NZKA 4HYMA 2AE8A 4U3BA 3PS2A 5C0XE 3K1JA 5K36A 3PYGA 4YY3E 1H74A 4ZVIA 4LPFA 3GCMA 4LFCE 2BA1D 1Z5AA 4DV0I 4DR1I 1A6FA 5LMNI 4KHPI 4OO1E 4Z7CA 1USVA 1KVKA 1Z0TA 3ZKBA 2X36A 2PO2B 2BM0A 4FW7A 3H4LA 1H7UA 1ZM2A 5A2QC 4P52A 2Z5CA 4GKKE 1OYSA 4HACA 1UDSA 4LF5E 4MU0A 4FWDA 4JI0E 1IBKE 4OO1F 3Q6MA 1ZXNA 3WU5A 2CG9A 1QZRA 2R42A 4FWGA 3PS1A 1N33E 1K47A 3J81Q 1N0UA 3OTOI 4FN5A 4B3SI 1OYPA 4X62E 2JEAB 3DD6A 1KTVA 2VF3A 4DV4E 4JI2E 4LF6I 1XNRE 4DU7A 2NN6F 1IBLI 4LF7I 4LFCI 3HULA 4NBQA 3B8HA 1FNMA 2EFGA 2IESA 2UXDE 4HACB 5EL9A 3QT8A 3OTOE 5JEAA 1USUA 1OYRA 3WU3A 1FWLA 1RR9A 2X7IA 1J5EI 1Y6ZA 2UUCI 4DV4I 1DARA 4LFBI 4MQYA 2UUAE 4DUZE 4DV2E 3ZZTA 4DV3E 1N32E 4FW3A 4USMA 1HNXE 1XNQE 2UUBI 4GKKI 4JV5I 3QT5A 4DU8A 3M7NG 5DROA 1PVGA 3JAMC 2VQEE 1HNWI 5FLXQ 1XMQI 4DV3I 4NXMI 1N32I 4QNJA 4X62I 2DEIA 1N34E 4IZKA 4KQVA
chains in the Genus database with same CATH topology
2HK3A 2LJPA 1KKHA 1HNXI 4X66I 2F4VE 5IT9Q 4JI1I 2VQEI 4K0KI 1Y4SA 1UEKA 4DR2E 1IBMI 2Z5BB 2V2QA 1HNWE 2O1WA 1XHKA 1MG7A 5IWAE 3PYDA 4JI3E 4JI1E 1RREA 4JI8I 1Z0CA 1FI4A 4X66E 2F4VI 1H7SA 1Y4UA 4DV7E 5LMNE 4KHPE 2VQFE 4DR2I 5IWAI 2R3VA 3ZZ0A 5GMEA 2Z5BA 4DPUA 5L3JA 2XEXA 2UU9E 5IT9C 3T1YI 4LF4E 4JYAI 4DUZI 4DV2I 4HY1A 4LFBE 1Z0VA 1BKNA 4MYUA 4URLA 4LFAE 2HKJA 2E5LE 4JI6E 5BR8E 5FWKA 3B82A 2O1VA 3LTOA 4B3SE 4JV5E 2OI2A 1IBLE 1VISA 1PKPA 1XNRI 1NHHA 3J7AM 4P7AA 2HHHE 1Z0WA 4DV6E 4B3RE 1H72C 2PNMA 4DPTA 2UUCE 4DV1I 2UXCI 1HR0I 2CZ9A 2A2CA 4MYTA 2BV3A 2E1RA 1FJGE 4B3MI 3PYEA 1NHJA 2V34A 2GS8A 3J7AG 2ZM6E 1WUUA 4LFAI 4WUDA 3T1HI 2CGEA 4GKJE 5LMUI 3WU4A 1HK7A 3PYFA 1ZM3A 1Z5BA 1FJGI 4DV6I 3ZKDA 4B3TI 1I94I 3LPSA 4UT4A 4LF8I 4LF6E 4Z7YA 1H73A 3T1YE 4DV0E 3V5RA 4PRXA 2UXCE 4YHHE 4ED4A 4LF8E 3K85A 2J7KA 1N36I 4USKA 4NXNI 4JI7E 4DV7I 2UUAI 1XMOI 2ZBKB 2O1TA 4R1FA 3J81C 4B3RI 4DR4I 2HKEA 1NZ0A 2V2VA 4IZJA 4LF7E 3D4JA 1OJ4A 2HFUA 5GMDA 3F0NA 4DR5E 1NHIA 4LF4I 4JYAE 4JI8E 2UU9I 4DR4E 1Z0GA 4DV1E 2PNLA 4X64E 4IZKB 3J80C 1J5EE 4YY3I 3CWVA 4N3OA 3Q1QA 2HHHI 2VQFI 4DPXA 4YHHI 4JG4A 1N33I 1ZM9A 1U2RA 4WUCA 1MU5A 4IZJD 1ZXMA 4PRVA 4AQYI 4JI4E 1S16A 3QT6A 2UXBI 2A2DA 2HK2A 3PRYA 5LL6R 4DR6E 2GQ0A 1ZM4A 4DR3E 3QT7A 3M6AA 4JI5E 4X65E 1EA6A 4PU9A 3B78A 4DUYE 1N0VC 1ELOA 1IBME 4DR3I 5LMUE 1Z0EA 4DPWA 1HR0E 4DUYI 4DV5I 1HNZI 1FWKA 3ZZUA 4JI5I 1N34I 1KIJA 4JI3I 1Z59A 4OX9E 5FLXC 3LNUA 2V8PA 4JI4I 4LF9E 5A2QQ 2IOQA 4M1KA 2ZM6I 2UXDI 1MX0A 4JI0I 4RPFA 4LF5I 3GONA 3Q6NA 1XNQI 3K17A 2AJ4A 4EMDA 1FKAE 4IZJB 4LF9I 4JI2I 2UUBE 1N36E 2Z5EA 4FWHA 2Q2EB 5BR8I 4DPYA 1XMOE 3ZM7A 4DV5E 4DR7I 4XTJA 1IBKI 2WW4A 1XMQE 1B63A 1I94E 4NXME 1EI1A 3JAMQ 4B3ME 4DR5I 4AQYE 4HXZA 4K0KE 3J80Q 2ZITA 3T1HE 4DR7E 2HFSA 3P06A 3HJCA 4DXLA 4X65I 4JI7I 4X64I 4DR6I 4FW9A 3V2UC 2BM1A 4WUBA 2NPFA 4B3TE 2V2ZA 4NXNE 4I3HA 4UTGA 2E5LI 4JI6I 1S4EA 1Z0BA 1PIEA 4DR1E 2IOPA 2DEJA 1HNZE 2O1UA 4OX9I 4GKJI 1Z5CA 1B62A 3WU6A 1D6TA 2Z5CB 2UXBE 4HYMA 3K1JA 3PYGA 4YY3E 1H74A 4ZVIA 4LFCE 1Z5AA 4DV0I 4DR1I 1A6FA 5LMNI 4KHPI 4Z7CA 1USVA 1KVKA 1Z0TA 3ZKBA 2X36A 2BM0A 3H4LA 1H7UA 1ZM2A 5A2QC 4P52A 2Z5CA 4GKKE 4HACA 4LF5E 4JI0E 4FWDA 1IBKE 3Q6MA 1ZXNA 3WU5A 2CG9A 1QZRA 2R42A 4FWGA 1N33E 1K47A 3J81Q 1N0UA 3OTOI 4FN5A 4B3SI 4X62E 1KTVA 2VF3A 4DV4E 4JI2E 4LF6I 1XNRE 4DU7A 1IBLI 4LF7I 4LFCI 3HULA 3B8HA 1FNMA 2EFGA 2UXDE 4HACB 3QT8A 3OTOE 1USUA 3WU3A 1FWLA 1RR9A 2X7IA 1J5EI 1Y6ZA 2UUCI 4DV4I 1DARA 4LFBI 2UUAE 4DUZE 4DV2E 3ZZTA 4DV3E 1N32E 1HNXE 4USMA 1XNQE 2UUBI 4GKKI 4JV5I 3QT5A 4DU8A 1PVGA 3JAMC 2VQEE 1HNWI 5FLXQ 1XMQI 4DV3I 4NXMI 1N32I 4X62I 2DEIA 1N34E 4IZKA 4KQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK3 A;  2LJP A;  1KKH A;  1HNX I;  4X66 I;  2F4V E;  5IT9 Q;  4JI1 I;  2VQE I;  4K0K I;  1UEK A;  4DR2 E;  1IBM I;  2V2Q A;  1HNW E;  1XHK A;  1MG7 A;  5IWA E;  3PYD A;  4JI3 E;  4JI1 E;  1RRE A;  4JI8 I;  1Z0C A;  1FI4 A;  4X66 E;  2F4V I;  1H7S A;  4DV7 E;  5LMN E;  4KHP E;  2VQF E;  4DR2 I;  5IWA I;  2R3V A;  3ZZ0 A;  5GME A;  4DPU A;  5L3J A;  2XEX A;  2UU9 E;  5IT9 C;  3T1Y I;  4LF4 E;  4JYA I;  4DUZ I;  4DV2 I;  4HY1 A;  4LFB E;  1Z0V A;  1BKN A;  4MYU A;  4LFA E;  4URL A;  2HKJ A;  2E5L E;  4JI6 E;  5BR8 E;  3B82 A;  4B3S E;  3LTO A;  4JV5 E;  2OI2 A;  1IBL E;  1VIS A;  1PKP A;  1XNR I;  1NHH A;  3J7A M;  4P7A A;  2HHH E;  1Z0W A;  4DV6 E;  4B3R E;  1H72 C;  4DPT A;  2UUC E;  4DV1 I;  2UXC I;  1HR0 I;  2CZ9 A;  2A2C A;  4MYT A;  2BV3 A;  2E1R A;  1FJG E;  4B3M I;  3PYE A;  1NHJ A;  2V34 A;  2GS8 A;  3J7A G;  2ZM6 E;  1WUU A;  4LFA I;  4WUD A;  3T1H I;  4GKJ E;  5LMU I;  3WU4 A;  3PYF A;  1ZM3 A;  1Z5B A;  1FJG I;  4DV6 I;  3ZKD A;  4B3T I;  1I94 I;  3LPS A;  4UT4 A;  4LF8 I;  4LF6 E;  4Z7Y A;  1H73 A;  3T1Y E;  4DV0 E;  3V5R A;  4PRX A;  2UXC E;  4YHH E;  4ED4 A;  4LF8 E;  2J7K A;  1N36 I;  4USK A;  4NXN I;  4JI7 E;  4DV7 I;  2UUA I;  1XMO I;  2ZBK B;  4R1F A;  3J81 C;  4B3R I;  4DR4 I;  2HKE A;  1NZ0 A;  2V2V A;  4LF7 E;  3D4J A;  1OJ4 A;  2HFU A;  5GMD A;  3F0N A;  4DR5 E;  1NHI A;  4LF4 I;  4JYA E;  4JI8 E;  2UU9 I;  4DR4 E;  1Z0G A;  4DV1 E;  4X64 E;  3J80 C;  1J5E E;  4YY3 I;  3CWV A;  3Q1Q A;  2HHH I;  2VQF I;  4DPX A;  4YHH I;  4JG4 A;  1N33 I;  1ZM9 A;  1U2R A;  4WUC A;  1MU5 A;  1ZXM A;  4PRV A;  4AQY I;  4JI4 E;  1S16 A;  3QT6 A;  2UXB I;  2A2D A;  2HK2 A;  5LL6 R;  4DR6 E;  1ZM4 A;  4DR3 E;  3QT7 A;  3M6A A;  4JI5 E;  4X65 E;  1EA6 A;  4PU9 A;  3B78 A;  4DUY E;  1N0V C;  1ELO A;  1IBM E;  4DR3 I;  5LMU E;  1Z0E A;  4DPW A;  1HR0 E;  4DUY I;  4DV5 I;  1HNZ I;  1FWK A;  3ZZU A;  4JI5 I;  1N34 I;  1KIJ A;  4JI3 I;  1Z59 A;  4OX9 E;  5FLX C;  3LNU A;  2V8P A;  4JI4 I;  4LF9 E;  5A2Q Q;  4M1K A;  2ZM6 I;  2UXD I;  1MX0 A;  4JI0 I;  4RPF A;  4LF5 I;  3GON A;  1XNQ I;  3K17 A;  2AJ4 A;  4EMD A;  1FKA E;  4LF9 I;  4JI2 I;  2UUB E;  1N36 E;  4FWH A;  2Q2E B;  5BR8 I;  4DPY A;  1XMO E;  3ZM7 A;  4DV5 E;  4DR7 I;  4XTJ A;  1IBK I;  2WW4 A;  4NXM E;  1XMQ E;  1B63 A;  1I94 E;  1EI1 A;  3JAM Q;  4B3M E;  4DR5 I;  4AQY E;  4HXZ A;  4K0K E;  3J80 Q;  2ZIT A;  3T1H E;  4DR7 E;  2HFS A;  4DXL A;  4X65 I;  4JI7 I;  4X64 I;  4DR6 I;  4FW9 A;  3V2U C;  2BM1 A;  4WUB A;  2NPF A;  4B3T E;  2V2Z A;  4NXN E;  4I3H A;  4UTG A;  2E5L I;  4JI6 I;  1S4E A;  1Z0B A;  1PIE A;  4DR1 E;  2DEJ A;  1HNZ E;  4GKJ I;  4OX9 I;  1Z5C A;  1B62 A;  3WU6 A;  1D6T A;  2UXB E;  4HYM A;  3K1J A;  3PYG A;  4YY3 E;  1H74 A;  4ZVI A;  4LFC E;  1Z5A A;  4DV0 I;  4DR1 I;  1A6F A;  5LMN I;  4KHP I;  4Z7C A;  1KVK A;  1Z0T A;  3ZKB A;  2X36 A;  2BM0 A;  3H4L A;  1H7U A;  1ZM2 A;  5A2Q C;  4P52 A;  4GKK E;  4HAC A;  4LF5 E;  4JI0 E;  4FWD A;  1IBK E;  1ZXN A;  3WU5 A;  1QZR A;  2R42 A;  4FWG A;  1N33 E;  1K47 A;  3J81 Q;  1N0U A;  3OTO I;  4FN5 A;  4B3S I;  4X62 E;  1KTV A;  2VF3 A;  4JI2 E;  4DV4 E;  4LF6 I;  1XNR E;  4DU7 A;  1IBL I;  4LF7 I;  4LFC I;  3HUL A;  3B8H A;  1FNM A;  2EFG A;  2UXD E;  4HAC B;  3QT8 A;  3OTO E;  3WU3 A;  1FWL A;  1RR9 A;  2X7I A;  1J5E I;  2UUC I;  4DV4 I;  1DAR A;  4LFB I;  2UUA E;  4DUZ E;  4DV2 E;  3ZZT A;  4DV3 E;  1N32 E;  1HNX E;  4USM A;  1XNQ E;  2UUB I;  4GKK I;  4JV5 I;  3QT5 A;  4DU8 A;  1PVG A;  3JAM C;  2VQE E;  1HNW I;  5FLX Q;  4NXM I;  4DV3 I;  1XMQ I;  1N32 I;  4X62 I;  2DEI A;  1N34 E;  4KQV A; 
#chains in the Genus database with same CATH topology
 2HK3 A;  2C38 B;  2LJP A;  1KKH A;  1HNX I;  4X66 I;  2F4V E;  4OO1 C;  5EKW A;  3M85 G;  5IT9 Q;  4JI1 I;  4GQU A;  2C37 B;  2VQE I;  4K0K I;  2PO1 B;  1Y4S A;  1UEK A;  4IS9 A;  4DR2 E;  1IBM I;  2NN6 B;  2Z5B B;  2V2Q A;  1HNW E;  2O1W A;  1XHK A;  1MG7 A;  1UDN A;  5IWA E;  2WP8 B;  3PYD A;  4JI3 E;  4JI1 E;  4OKG A;  1RRE A;  4JI8 I;  1Z0C A;  1FI4 A;  4X66 E;  2F4V I;  2CVE A;  5JEA F;  1H7S A;  1Y4U A;  4DV7 E;  5K36 C;  5LMN E;  4LCF A;  4KHP E;  2VQF E;  4DR2 I;  4BA1 B;  4IFD A;  5IWA I;  2R3V A;  3ZZ0 A;  5DNL A;  5GME A;  3M7N D;  2JE6 A;  5C0X B;  2JEA A;  4QNK A;  3U1K A;  2Z5B A;  2PNZ A;  4DPU A;  5L3J A;  2XEX A;  2UU9 E;  5IT9 C;  2BA0 G;  5DNX A;  3T1Y I;  4LF4 E;  4JYA I;  4DUZ I;  4DV2 I;  4IFD E;  4HY1 A;  4LFB E;  4MYU A;  1BKN A;  1Z0V A;  3HKM A;  4URL A;  4LFA E;  2WNR B;  2HKJ A;  2E5L E;  4JI6 E;  5BR8 E;  5FWK A;  3M85 D;  5DRR A;  3B82 A;  2O1V A;  3LTO A;  4B3S E;  4JV5 E;  2PO0 B;  2OI2 A;  1IBL E;  1VIS A;  1PKP A;  3KRN A;  1XNR I;  1NHH A;  3J7A M;  4P7A A;  4LCH A;  2JEB A;  2HHH E;  4IFD F;  1Y5Y A;  1Z0W A;  4DV6 E;  4B3R E;  2PNZ B;  1H72 C;  2PNM A;  2JEB B;  4DPT A;  5ELW A;  2UUC E;  1R6L A;  4DV1 I;  2UXC I;  1YH8 A;  1HR0 I;  5JEA E;  5K36 B;  2CZ9 A;  2A2C A;  4MYT A;  2BV3 A;  2E1R A;  1FJG E;  5DRQ A;  5JEA C;  4B3M I;  3PYE A;  1NHJ A;  4OO1 B;  2V34 A;  2GS8 A;  3J7A G;  1WUU A;  2ZM6 E;  2BA0 D;  4LFA I;  3H1C A;  2IER A;  4WUD A;  4BA1 A;  3T1H I;  2CGE A;  4GKJ E;  5LMU I;  3WU4 A;  1HK7 A;  2JE6 B;  5C0X A;  2NN6 D;  3PYF A;  1ZM3 A;  1Z5B A;  1FJG I;  4DV6 I;  2WP8 A;  3ZKD A;  3PS3 A;  4B3T I;  1I94 I;  1XXE A;  3LPS A;  4UT4 A;  4LF8 I;  2BR2 B;  4BA2 A;  2NN6 A;  4LF6 E;  4MDT A;  4Z7Y A;  4FW5 A;  4OO1 D;  1H73 A;  3T1Y E;  4DV0 E;  3V5R A;  2WNR A;  4PRX A;  3P3G A;  2UXC E;  1YHC A;  4YHH E;  4ED4 A;  4LF8 E;  3K85 A;  2J7K A;  1N36 I;  2PO1 A;  4USK A;  4NXN I;  4JI7 E;  4DV7 I;  2UUA I;  3GME A;  1XMO I;  2ZBK B;  2O1T A;  4R1F A;  3J81 C;  1RHY A;  4B3R I;  4DR4 I;  2HKE A;  4U3D A;  1NZ0 A;  2V2V A;  4IZJ A;  4LF7 E;  3D4J A;  1OJ4 A;  2HFU A;  5GMD A;  4IFD C;  3F0N A;  4DR5 E;  1NHI A;  4LF4 I;  4JYA E;  4JI8 E;  2UU9 I;  4DR4 E;  1Z0G A;  1UDO A;  4MU1 A;  4DV1 E;  4IFD B;  2PNL A;  4X64 E;  4IZK B;  3J80 C;  2BA1 G;  2F1D A;  1J5E E;  4YY3 I;  3CWV A;  4N3O A;  5C0X D;  4IFD D;  3Q1Q A;  2HHH I;  4FW6 A;  4OZE A;  2VQF I;  4DPX A;  4YHH I;  4ISA A;  4JG4 A;  5JEA B;  1N33 I;  1ZM9 A;  1U2R A;  4WUC A;  1MU5 A;  4IZJ D;  1E3H A;  1R6M A;  2GO3 A;  1ZXM A;  4PRV A;  4AQY I;  4JI4 E;  1S16 A;  3B4T A;  3QT6 A;  2UXB I;  2A2D A;  2HK2 A;  3PRY A;  5LL6 R;  4DR6 E;  2GQ0 A;  1ZM4 A;  4DR3 E;  3QT7 A;  3M6A A;  4JI5 E;  4X65 E;  1EA6 A;  4PU9 A;  3B78 A;  4DUY E;  4AIM A;  1N0V C;  1ELO A;  1IBM E;  4DR3 I;  3CDI A;  5LMU E;  4LCG A;  1Z0E A;  3P3E A;  4DPW A;  2J65 A;  1HR0 E;  4DUY I;  4DV5 I;  1HNZ I;  1FWK A;  3ZZU A;  2PO2 A;  4JI5 I;  3L7Z A;  5K36 D;  1N34 I;  1KIJ A;  4JI3 I;  1Z59 A;  3CDJ A;  4OX9 E;  5FLX C;  3LNU A;  2V8P A;  4JI4 I;  4LF9 E;  4AM3 A;  5A2Q Q;  2IOQ A;  4M1K A;  2ZM6 I;  3UHM A;  2UXD I;  3P3C A;  1MX0 A;  4JI0 I;  4RPF A;  4LF5 I;  3GON A;  3Q6N A;  1XNQ I;  3K17 A;  2AJ4 A;  2GO4 A;  2VES A;  4EMD A;  3U1Y A;  1FKA E;  1Y60 A;  4IZJ B;  4LF9 I;  4JI2 I;  2UUB E;  1N36 E;  4BA2 B;  1UDQ A;  2Z5E A;  4FWH A;  3L7Z B;  2Q2E B;  5BR8 I;  1P42 A;  2PO0 A;  5C0X F;  3P76 A;  4AID A;  4DPY A;  1XMO E;  3ZM7 A;  4DV5 E;  4DR7 I;  4XTJ A;  1IBK I;  2WW4 A;  1XMQ E;  1B63 A;  1I94 E;  4NXM E;  1EI1 A;  3JAM Q;  4B3M E;  4DR5 I;  4AQY E;  4HXZ A;  4K0K E;  3J80 Q;  2ZIT A;  3T1H E;  2JT2 A;  4DR7 E;  4J3D A;  2HFS A;  3P06 A;  3HJC A;  4FW4 A;  4DXL A;  4X65 I;  5K36 F;  2C37 A;  4JI7 I;  4X64 I;  4MU4 A;  3GLL A;  4DR6 I;  4FW9 A;  3V2U C;  2O3Z A;  2BM1 A;  4WUB A;  2NPF A;  5JEA D;  4LOM A;  4B3T E;  2V2Z A;  4OO1 A;  4NXN E;  4I3H A;  4UTG A;  2E5L I;  2BR2 A;  5C0X C;  4JI6 I;  1S4E A;  1Z0B A;  1PIE A;  2C39 A;  5K36 E;  1E3P A;  4DR1 E;  2IOP A;  2DEJ A;  2NN6 E;  2C39 B;  2NN6 C;  1HNZ E;  2O1U A;  4OX9 I;  4GKJ I;  1Z5C A;  1B62 A;  5DRP A;  3WU6 A;  1D6T A;  2Z5C B;  4MU3 A;  2UXB E;  1VI7 A;  2C38 A;  3NZK A;  4HYM A;  2AE8 A;  4U3B A;  3PS2 A;  5C0X E;  3K1J A;  5K36 A;  3PYG A;  4YY3 E;  1H74 A;  4ZVI A;  4LPF A;  3GCM A;  4LFC E;  2BA1 D;  1Z5A A;  4DV0 I;  4DR1 I;  1A6F A;  5LMN I;  4KHP I;  4OO1 E;  4Z7C A;  1USV A;  1KVK A;  1Z0T A;  3ZKB A;  2X36 A;  2PO2 B;  2BM0 A;  4FW7 A;  3H4L A;  1H7U A;  1ZM2 A;  5A2Q C;  4P52 A;  2Z5C A;  4GKK E;  1OYS A;  4HAC A;  1UDS A;  4LF5 E;  4MU0 A;  4FWD A;  4JI0 E;  1IBK E;  4OO1 F;  3Q6M A;  1ZXN A;  3WU5 A;  2CG9 A;  1QZR A;  2R42 A;  4FWG A;  3PS1 A;  1N33 E;  1K47 A;  3J81 Q;  1N0U A;  3OTO I;  4FN5 A;  4B3S I;  1OYP A;  4X62 E;  2JEA B;  3DD6 A;  1KTV A;  2VF3 A;  4DV4 E;  4JI2 E;  4LF6 I;  1XNR E;  4DU7 A;  2NN6 F;  1IBL I;  4LF7 I;  4LFC I;  3HUL A;  4NBQ A;  3B8H A;  1FNM A;  2EFG A;  2IES A;  2UXD E;  4HAC B;  5EL9 A;  3QT8 A;  3OTO E;  5JEA A;  1USU A;  1OYR A;  3WU3 A;  1FWL A;  1RR9 A;  2X7I A;  1J5E I;  1Y6Z A;  2UUC I;  4DV4 I;  1DAR A;  4LFB I;  4MQY A;  2UUA E;  4DUZ E;  4DV2 E;  3ZZT A;  4DV3 E;  1N32 E;  4FW3 A;  4USM A;  1HNX E;  1XNQ E;  2UUB I;  4GKK I;  4JV5 I;  3QT5 A;  4DU8 A;  3M7N G;  5DRO A;  1PVG A;  3JAM C;  2VQE E;  1HNW I;  5FLX Q;  1XMQ I;  4DV3 I;  4NXM I;  1N32 I;  4QNJ A;  4X62 I;  2DEI A;  1N34 E;  4IZK A;  4KQV A; 
#chains in the Genus database with same CATH homology
 2HK3 A;  2LJP A;  1KKH A;  1HNX I;  4X66 I;  2F4V E;  5IT9 Q;  4JI1 I;  2VQE I;  4K0K I;  1Y4S A;  1UEK A;  4DR2 E;  1IBM I;  2Z5B B;  2V2Q A;  1HNW E;  2O1W A;  1XHK A;  1MG7 A;  5IWA E;  3PYD A;  4JI3 E;  4JI1 E;  1RRE A;  4JI8 I;  1Z0C A;  1FI4 A;  4X66 E;  2F4V I;  1H7S A;  1Y4U A;  4DV7 E;  5LMN E;  4KHP E;  2VQF E;  4DR2 I;  5IWA I;  2R3V A;  3ZZ0 A;  5GME A;  2Z5B A;  4DPU A;  5L3J A;  2XEX A;  2UU9 E;  5IT9 C;  3T1Y I;  4LF4 E;  4JYA I;  4DUZ I;  4DV2 I;  4HY1 A;  4LFB E;  1Z0V A;  1BKN A;  4MYU A;  4URL A;  4LFA E;  2HKJ A;  2E5L E;  4JI6 E;  5BR8 E;  5FWK A;  3B82 A;  2O1V A;  3LTO A;  4B3S E;  4JV5 E;  2OI2 A;  1IBL E;  1VIS A;  1PKP A;  1XNR I;  1NHH A;  3J7A M;  4P7A A;  2HHH E;  1Z0W A;  4DV6 E;  4B3R E;  1H72 C;  2PNM A;  4DPT A;  2UUC E;  4DV1 I;  2UXC I;  1HR0 I;  2CZ9 A;  2A2C A;  4MYT A;  2BV3 A;  2E1R A;  1FJG E;  4B3M I;  3PYE A;  1NHJ A;  2V34 A;  2GS8 A;  3J7A G;  2ZM6 E;  1WUU A;  4LFA I;  4WUD A;  3T1H I;  2CGE A;  4GKJ E;  5LMU I;  3WU4 A;  1HK7 A;  3PYF A;  1ZM3 A;  1Z5B A;  1FJG I;  4DV6 I;  3ZKD A;  4B3T I;  1I94 I;  3LPS A;  4UT4 A;  4LF8 I;  4LF6 E;  4Z7Y A;  1H73 A;  3T1Y E;  4DV0 E;  3V5R A;  4PRX A;  2UXC E;  4YHH E;  4ED4 A;  4LF8 E;  3K85 A;  2J7K A;  1N36 I;  4USK A;  4NXN I;  4JI7 E;  4DV7 I;  2UUA I;  1XMO I;  2ZBK B;  2O1T A;  4R1F A;  3J81 C;  4B3R I;  4DR4 I;  2HKE A;  1NZ0 A;  2V2V A;  4IZJ A;  4LF7 E;  3D4J A;  1OJ4 A;  2HFU A;  5GMD A;  3F0N A;  4DR5 E;  1NHI A;  4LF4 I;  4JYA E;  4JI8 E;  2UU9 I;  4DR4 E;  1Z0G A;  4DV1 E;  2PNL A;  4X64 E;  4IZK B;  3J80 C;  1J5E E;  4YY3 I;  3CWV A;  4N3O A;  3Q1Q A;  2HHH I;  2VQF I;  4DPX A;  4YHH I;  4JG4 A;  1N33 I;  1ZM9 A;  1U2R A;  4WUC A;  1MU5 A;  4IZJ D;  1ZXM A;  4PRV A;  4AQY I;  4JI4 E;  1S16 A;  3QT6 A;  2UXB I;  2A2D A;  2HK2 A;  3PRY A;  5LL6 R;  4DR6 E;  2GQ0 A;  1ZM4 A;  4DR3 E;  3QT7 A;  3M6A A;  4JI5 E;  4X65 E;  1EA6 A;  4PU9 A;  3B78 A;  4DUY E;  1N0V C;  1ELO A;  1IBM E;  4DR3 I;  5LMU E;  1Z0E A;  4DPW A;  1HR0 E;  4DUY I;  4DV5 I;  1HNZ I;  1FWK A;  3ZZU A;  4JI5 I;  1N34 I;  1KIJ A;  4JI3 I;  1Z59 A;  4OX9 E;  5FLX C;  3LNU A;  2V8P A;  4JI4 I;  4LF9 E;  5A2Q Q;  2IOQ A;  4M1K A;  2ZM6 I;  2UXD I;  1MX0 A;  4JI0 I;  4RPF A;  4LF5 I;  3GON A;  3Q6N A;  1XNQ I;  3K17 A;  2AJ4 A;  4EMD A;  1FKA E;  4IZJ B;  4LF9 I;  4JI2 I;  2UUB E;  1N36 E;  2Z5E A;  4FWH A;  2Q2E B;  5BR8 I;  4DPY A;  1XMO E;  3ZM7 A;  4DV5 E;  4DR7 I;  4XTJ A;  1IBK I;  2WW4 A;  1XMQ E;  1B63 A;  1I94 E;  4NXM E;  1EI1 A;  3JAM Q;  4B3M E;  4DR5 I;  4AQY E;  4HXZ A;  4K0K E;  3J80 Q;  2ZIT A;  3T1H E;  4DR7 E;  2HFS A;  3P06 A;  3HJC A;  4DXL A;  4X65 I;  4JI7 I;  4X64 I;  4DR6 I;  4FW9 A;  3V2U C;  2BM1 A;  4WUB A;  2NPF A;  4B3T E;  2V2Z A;  4NXN E;  4I3H A;  4UTG A;  2E5L I;  4JI6 I;  1S4E A;  1Z0B A;  1PIE A;  4DR1 E;  2IOP A;  2DEJ A;  1HNZ E;  2O1U A;  4OX9 I;  4GKJ I;  1Z5C A;  1B62 A;  3WU6 A;  1D6T A;  2Z5C B;  2UXB E;  4HYM A;  3K1J A;  3PYG A;  4YY3 E;  1H74 A;  4ZVI A;  4LFC E;  1Z5A A;  4DV0 I;  4DR1 I;  1A6F A;  5LMN I;  4KHP I;  4Z7C A;  1USV A;  1KVK A;  1Z0T A;  3ZKB A;  2X36 A;  2BM0 A;  3H4L A;  1H7U A;  1ZM2 A;  5A2Q C;  4P52 A;  2Z5C A;  4GKK E;  4HAC A;  4LF5 E;  4JI0 E;  4FWD A;  1IBK E;  3Q6M A;  1ZXN A;  3WU5 A;  2CG9 A;  1QZR A;  2R42 A;  4FWG A;  1N33 E;  1K47 A;  3J81 Q;  1N0U A;  3OTO I;  4FN5 A;  4B3S I;  4X62 E;  1KTV A;  2VF3 A;  4DV4 E;  4JI2 E;  4LF6 I;  1XNR E;  4DU7 A;  1IBL I;  4LF7 I;  4LFC I;  3HUL A;  3B8H A;  1FNM A;  2EFG A;  2UXD E;  4HAC B;  3QT8 A;  3OTO E;  1USU A;  3WU3 A;  1FWL A;  1RR9 A;  2X7I A;  1J5E I;  1Y6Z A;  2UUC I;  4DV4 I;  1DAR A;  4LFB I;  2UUA E;  4DUZ E;  4DV2 E;  3ZZT A;  4DV3 E;  1N32 E;  1HNX E;  4USM A;  1XNQ E;  2UUB I;  4GKK I;  4JV5 I;  3QT5 A;  4DU8 A;  1PVG A;  3JAM C;  2VQE E;  1HNW I;  5FLX Q;  1XMQ I;  4DV3 I;  4NXM I;  1N32 I;  4X62 I;  2DEI A;  1N34 E;  4IZK A;  4KQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...