2UUBI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uubI00
3QT8A 4DR7I 1FI4A 5A2QC 2OI2A 2ZBKB 4XTJA 4DR4E 4DR7E 3J81C 1MU5A 4JI5I 2ZM6E 4JI4I 4JI6E 3PYEA 3J7AM 1Z5AA 3WU6A 3V2UC 4DV4E 2VF3A 4WUBA 4GKJI 4YHHI 4Z7YA 4X66I 4DV6I 4DV0I 1HR0I 1ZM3A 1A6FA 1OJ4A 4DR2I 4DR1E 4NXNI 1NHHA 1UEKA 4NXME 4LF9E 4HACA 2VQFE 3F0NA 4DPWA 4JG4A 1N32I 4KQVA 3ZM7A 4DV5E 1XNRI 4ED4A 4X64I 4LF4I 2CZ9A 1I94E 1XMQE 4DR5I 2R3VA 1IBKE 4DR1I 2V2ZA 5IT9C 1Z0BA 4LF4E 4DPTA 4DV0E 4DV5I 1XNRE 1N0VC 4K0KI 3ZZTA 4DPUA 4GKJE 2Q2EB 2V2VA 1J5EI 5BR8E 5IWAI 1XMOE 4GKKI 1Z0EA 2E1RA 1N36E 3LPSA 3JAMQ 1N34E 4FWHA 3J81Q 2GS8A 1MG7A 1HR0E 4I3HA 4B3TI 4DV6E 2HFUA 4UTGA 1H72C 1FWLA 4LFCI 4JI3I 2DEJA 4MYTA 4X66E 4X62I 4YHHE 4JI0I 4LF7I 3PYGA 3WU4A 2X7IA 4B3SE 4URLA 4DU8A 4B3MI 3ZZUA 4X62E 2AJ4A 4JI4E 1B63A 3ZKBA 1Z0TA 2VQEI 3T1HI 3QT6A 2UXCE 4B3RE 4YY3E 1H73A 4FN5A 1Z59A 5GMEA 2HHHE 1ZM9A 4FW9A 2UXDI 4MYUA 1U2RA 1KTVA 1N36I 2UXBE 5BR8I 2NPFA 3OTOI 4X65E 1KKHA 4LF8E 3K1JA 4AQYE 4K0KE 1Z0CA 4DU7A 2BV3A 5LL6R 4LFBE 4LFAE 3QT7A 1IBLE 3PYDA 1FKAE 4AQYI 4DUYI 4DR5E 1Z0GA 4DV3E 3K17A 2UUAE 4JI1E 1H7UA 1RR9A 4DV2E 3V5RA 4DUZI 4OX9I 1N33E 3HULA 1HNXE 4JV5I 2UUBI 1FJGI 1ZXMA 1QZRA 4HYMA 2UXCI 3ZKDA 1HNZE 5FLXC 3J7AG 4DR3E 4DV1E 1XNQE 4ZVIA 1ZXNA 4KHPE 4FWDA 3LNUA 2X36A 4JI8E 4B3SI 3T1YI 4PRVA 2R42A 4DXLA 4R1FA 1KIJA 2BM1A 3LTOA 1K47A 4LFCE 1EA6A 1DARA 2WW4A 1S16A 1ZM2A 1PVGA 4DR6E 1PIEA 1HNXI 4JV5E 2UUCE 5FLXQ 4Z7CA 4JYAI 1S4EA 3T1YE 4PRXA 2ZITA 2V2QA 3WU5A 4P7AA 3CWVA 4JI2E 2HK3A 2J7KA 4DV1I 4DPYA 1XNQI 3QT5A 2F4VI 2UU9E 2A2DA 4DR3I 1IBKI 1HNWI 4LFAI 4X64E 3B8HA 2UUBE 1Z0VA 4JI2I 4HY1A 5IT9Q 1N32E 5LMNE 3J80C 4LF6I 4LF6E 5LMUE 1XHKA 4JI7I 1VISA 4JI1I 2UUAI 4DV3I 5L3JA 1H7SA 4DUYE 5LMUI 4NXMI 4NXNE 5LMNI 1NHIA 1HNWE 2HKJA 2UUCI 2UU9I 4YY3I 2F4VE 4PU9A 1B62A 4DR6I 3T1HE 1FNMA 4M1KA 3JAMC 2EFGA 4B3ME 2ZM6I 4JI5E 3D4JA 3ZZ0A 4JI3E 4B3RI 3H4LA 4DR4I 4JYAE 2E5LI 4HXZA 1N0UA 4JI8I 2XEXA 4KHPI 1IBME 4USKA 4USMA 1PKPA 2HFSA 1IBMI 3Q1QA 1NZ0A 2E5LE 1HNZI 2BM0A 5IWAE 4GKKE 1N34I 2A2CA 1Z0WA 4JI0E 1WUUA 2V34A 1J5EE 3B82A 4DV7E 1H74A 3M6AA 1Z5BA 4DPXA 1Z5CA 2DEIA 4B3TE 2HK2A 1MX0A 1I94I 3GONA 4LFBI 4WUDA 4LF5I 1FJGE 1EI1A 4P52A 4OX9E 1N33I 4EMDA 5GMDA 3B78A 1XMOI 1XMQI 1ZM4A 1ELOA 2LJPA 4HACB 4DV2I 2VQFI 2HKEA 4JI7E 4LF9I 4UT4A 4DUZE 3J80Q 4DR2E 1IBLI 4LF5E 4RPFA 2HHHI 1BKNA 1KVKA 1NHJA 1FWKA 2VQEE 1RREA 4DV4I 1D6TA 3WU3A 4X65I 2V8PA 4WUCA 3OTOE 4DV7I 5A2QQ 3PYFA 4FWGA 4JI6I 4LF8I 2UXDE 2UXBI 4LF7E
chains in the Genus database with same CATH superfamily
3QT8A 4DR7I 1FI4A 5A2QC 2Z5EA 3DD6A 5JEAF 2OI2A 2JEBA 4FW7A 2ZBKB 4LCGA 4XTJA 4DR4E 5DRPA 5FWKA 4IFDA 4DR7E 3J81C 1MU5A 1E3PA 4JI5I 2ZM6E 4JI4I 4JI6E 3HKMA 3PYEA 3H1CA 3J7AM 1Z5AA 3WU6A 1OYRA 3V2UC 4DV4E 2VF3A 4WUBA 4GKJI 4YHHI 4Z7YA 4X66I 4DV6I 4DV0I 1P42A 1UDSA 1HR0I 1ZM3A 2PNMA 1A6FA 1RHYA 1OJ4A 4DR2I 4DR1E 4NXNI 1NHHA 1UEKA 2PNZB 4NXME 5EKWA 4LF9E 4HACA 2CVEA 2VQFE 3F0NA 2GQ0A 4DPWA 4NBQA 4JG4A 1N32I 4N3OA 4KQVA 3ZM7A 4DV5E 1XNRI 4ED4A 4X64I 4LF4I 2CZ9A 1I94E 1XMQE 2Z5CB 4DR5I 2IESA 2NN6C 2R3VA 1IBKE 4DR1I 3UHMA 2F1DA 2V2ZA 5IT9C 1UDQA 2JEAB 1Z0BA 4LF4E 2PNZA 4DPTA 4DV0E 2PO1B 4DV5I 1XNRE 4IZJB 1N0VC 2J65A 4K0KI 3ZZTA 4LOMA 4DPUA 3M7NG 4GKJE 2Q2EB 1YH8A 2V2VA 1J5EI 5BR8E 5IWAI 1XMOE 4GKKI 1Z0EA 2E1RA 1N36E 3LPSA 2WNRA 3JAMQ 4IS9A 1N34E 4FWHA 2O1UA 3J81Q 2GS8A 1OYPA 1Y4UA 1Y6ZA 3U1KA 1MG7A 1HR0E 4I3HA 5C0XD 4B3TI 4DV6E 2HFUA 4UTGA 1H72C 1FWLA 4LFCI 4JI3I 2BA0G 1UDNA 2DEJA 4MYTA 4X66E 2O1VA 2JEAA 2O1WA 2WP8B 4X62I 4YHHE 4JI0I 4LF7I 3PYGA 3PRYA 3WU4A 2X7IA 4B3SE 4OO1F 4URLA 4DU8A 4B3MI 3ZZUA 4LCHA 2AJ4A 4X62E 4JI4E 1B63A 3ZKBA 4FW3A 2BR2B 1Z0TA 2VQEI 3T1HI 3QT6A 4IZKB 2UXCE 5K36C 4B3RE 4YY3E 1H73A 4FN5A 1Z59A 2WP8A 3CDJA 5GMEA 1ZM9A 2HHHE 3M7ND 4IFDD 4FW9A 2C38B 4OO1A 2UXDI 4MYUA 2C39B 1U2RA 4IFDE 1KTVA 1N36I 1R6MA 2UXBE 5BR8I 2NPFA 2Z5BA 3OTOI 5C0XE 4X65E 4OO1C 1KKHA 4LF8E 3K1JA 4AQYE 4K0KE 5JEAB 2PO2B 1Z0CA 4DU7A 2BV3A 4AM3A 5LL6R 4LFBE 2BA1G 4LFAE 3QT7A 1IBLE 3PYDA 1FKAE 4AQYI 4DUYI 2JE6B 4DR5E 1Z0GA 4DV3E 2PO0A 3K17A 2UUAE 4JI1E 1H7UA 1RR9A 4MDTA 4DV2E 3V5RA 4DUZI 3L7ZB 1HK7A 4OX9I 1N33E 3HULA 1HNXE 4JV5I 2UUBI 1FJGI 1ZXMA 3U1YA 1QZRA 4HYMA 2UXCI 3ZKDA 5DNXA 1HNZE 5FLXC 3J7AG 2BA0D 2C37A 4DR3E 2JEBB 4OO1E 4DV1E 1XNQE 4ZVIA 5JEAE 5ELWA 1ZXNA 4KHPE 4FWDA 2BR2A 4U3DA 3LNUA 2X36A 4JI8E 5DROA 4B3SI 3PS1A 4IFDF 3T1YI 4PRVA 2R42A 3B4TA 1Y5YA 4DXLA 3P76A 4R1FA 5C0XF 2O1TA 1KIJA 2BM1A 3LTOA 1K47A 4LFCE 1EA6A 1DARA 1R6LA 2WW4A 1S16A 2C37B 2C38A 1ZM2A 1PVGA 4DR6E 3PS2A 4ISAA 1PIEA 2AE8A 2NN6B 5C0XC 1HNXI 4OZEA 4JV5E 2UUCE 5K36D 5FLXQ 4OO1B 4Z7CA 4JYAI 1S4EA 3PS3A 3T1YE 2JT2A 4MU3A 1UDOA 3HJCA 4PRXA 2ZITA 2V2QA 3WU5A 4OO1D 4P7AA 5K36B 4BA2B 4QNJA 3CWVA 3L7ZA 4FW4A 2HK3A 2J7KA 4JI2E 4BA1A 4DPYA 4DV1I 3QT5A 1XNQI 2F4VI 2UU9E 2A2DA 4DR3I 4LPFA 1IBKI 4IZKA 1HNWI 4LFAI 3Q6MA 4BA2A 4X64E 2WNRB 3B8HA 4BA1B 2UUBE 1Z0VA 4JI2I 1USVA 2IOPA 3CDIA 4HY1A 3GMEA 5IT9Q 1N32E 5LMNE 3J80C 1Y60A 4LF6E 4LF6I 5LMUE 2PO2A 1XHKA 4JI7I 1VISA 4JI1I 2UUAI 2CG9A 4DV3I 5L3JA 1H7SA 4DUYE 4IFDB 5LMUI 4NXMI 4NXNE 5LMNI 1NHIA 1HNWE 2HKJA 2UUCI 1Y4SA 5C0XB 2UU9I 4YY3I 2F4VE 4PU9A 3P3GA 1B62A 4DR6I 4AIDA 5DRQA 3T1HE 1FNMA 4M1KA 4U3BA 3JAMC 2IERA 2EFGA 4IZJA 3P3EA 4B3ME 2JE6A 2NN6F 5EL9A 2ZM6I 4JI5E 3D4JA 2IOQA 3P3CA 3ZZ0A 2GO3A 1E3HA 1XXEA 4JI3E 3H4LA 4B3RI 4DR4I 4JYAE 2PO0B 2E5LI 4HXZA 1N0UA 5DNLA 4JI8I 2XEXA 4KHPI 1IBME 4USKA 1YHCA 4USMA 1PKPA 2HFSA 1IBMI 1USUA 5JEAD 2CGEA 3Q1QA 1NZ0A 2E5LE 2C39A 2BM0A 1HNZI 5IWAE 2Z5CA 4GKKE 5JEAA 1N34I 4MU4A 2A2CA 4MQYA 1Z0WA 4JI0E 1WUUA 2V34A 4MU0A 1J5EE 3B82A 4MU1A 4DV7E 3KRNA 2PO1A 1H74A 3M6AA 2Z5BB 3GCMA 1Z5BA 2NN6E 3GLLA 3M85D 4DPXA 1Z5CA 2DEIA 4B3TE 2HK2A 2NN6D 1MX0A 1I94I 3GONA 4LFBI 4WUDA 4LF5I 4OKGA 1FJGE 1EI1A 4P52A 4OX9E 1N33I 5JEAC 4EMDA 5GMDA 5DRRA 3B78A 1XMOI 1XMQI 5K36A 1ZM4A 1ELOA 2LJPA 3Q6NA 4HACB 4DV2I 4J3DA 2VESA 3NZKA 2VQFI 2HKEA 4JI7E 2PNLA 4LF9I 4UT4A 4DUZE 3J80Q 3M85G 4DR2E 1OYSA 1IBLI 4LF5E 4RPFA 5C0XA 2HHHI 1BKNA 1KVKA 5K36E 1NHJA 1FWKA 5K36F 2VQEE 3P06A 1RREA 4DV4I 1D6TA 2GO4A 3K85A 3WU3A 4X65I 2V8PA 4WUCA 3OTOE 2BA1D 4QNKA 4DV7I 4IFDC 1VI7A 5A2QQ 4AIMA 3PYFA 4FWGA 4JI6I 4LF8I 2UXDE 4FW5A 2UXBI 4LF7E 4FW6A 2O3ZA 2NN6A 4GQUA 4LCFA 4IZJD
chains in the Genus database with same CATH topology
3QT8A 4DR7I 1FI4A 5A2QC 2Z5EA 2OI2A 2ZBKB 4XTJA 4DR4E 5FWKA 4DR7E 3J81C 1MU5A 4JI5I 2ZM6E 4JI4I 4JI6E 3PYEA 3J7AM 1Z5AA 3WU6A 3V2UC 4DV4E 2VF3A 4WUBA 4GKJI 4YHHI 4Z7YA 4X66I 4DV6I 4DV0I 1HR0I 1ZM3A 2PNMA 1A6FA 1OJ4A 4DR2I 4DR1E 4NXNI 1NHHA 1UEKA 4NXME 4LF9E 4HACA 2VQFE 3F0NA 2GQ0A 4DPWA 4JG4A 1N32I 4N3OA 4KQVA 3ZM7A 4DV5E 1XNRI 4ED4A 4X64I 4LF4I 2CZ9A 1I94E 1XMQE 2Z5CB 4DR5I 2R3VA 1IBKE 4DR1I 2V2ZA 5IT9C 1Z0BA 4LF4E 4DPTA 4DV0E 4DV5I 1XNRE 4IZJB 1N0VC 4K0KI 3ZZTA 4DPUA 4GKJE 2Q2EB 2V2VA 1J5EI 5BR8E 5IWAI 1XMOE 4GKKI 1Z0EA 2E1RA 1N36E 3LPSA 3JAMQ 1N34E 4FWHA 2O1UA 3J81Q 2GS8A 1Y4UA 1Y6ZA 1MG7A 1HR0E 4I3HA 4B3TI 4DV6E 2HFUA 4UTGA 1H72C 1FWLA 4LFCI 4JI3I 2DEJA 4MYTA 4X66E 2O1VA 2O1WA 4X62I 4YHHE 4JI0I 4LF7I 3PYGA 3PRYA 3WU4A 2X7IA 4B3SE 4URLA 4DU8A 4B3MI 3ZZUA 4X62E 2AJ4A 4JI4E 1B63A 3ZKBA 1Z0TA 2VQEI 3T1HI 3QT6A 4IZKB 2UXCE 4B3RE 4YY3E 1H73A 4FN5A 1Z59A 5GMEA 2HHHE 1ZM9A 4FW9A 2UXDI 4MYUA 1U2RA 1KTVA 1N36I 2UXBE 5BR8I 2NPFA 2Z5BA 3OTOI 4X65E 1KKHA 4LF8E 3K1JA 4AQYE 4K0KE 1Z0CA 4DU7A 2BV3A 5LL6R 4LFBE 4LFAE 3QT7A 1IBLE 3PYDA 1FKAE 4AQYI 4DUYI 4DR5E 1Z0GA 4DV3E 3K17A 2UUAE 4JI1E 1H7UA 1RR9A 4DV2E 3V5RA 4DUZI 1HK7A 4OX9I 1N33E 3HULA 1HNXE 4JV5I 2UUBI 1FJGI 1ZXMA 1QZRA 4HYMA 2UXCI 3ZKDA 1HNZE 5FLXC 3J7AG 4DR3E 4DV1E 1XNQE 4ZVIA 1ZXNA 4KHPE 4FWDA 3LNUA 2X36A 4JI8E 4B3SI 3T1YI 4PRVA 2R42A 4DXLA 4R1FA 2O1TA 1KIJA 2BM1A 3LTOA 1K47A 4LFCE 1EA6A 1DARA 2WW4A 1S16A 1ZM2A 1PVGA 4DR6E 1PIEA 1HNXI 4JV5E 2UUCE 5FLXQ 4Z7CA 4JYAI 1S4EA 3T1YE 3HJCA 4PRXA 2ZITA 2V2QA 3WU5A 4P7AA 3CWVA 2HK3A 2J7KA 4JI2E 4DV1I 4DPYA 1XNQI 3QT5A 2F4VI 2UU9E 2A2DA 4DR3I 1IBKI 4IZKA 1HNWI 4LFAI 3Q6MA 4X64E 3B8HA 2UUBE 1Z0VA 4JI2I 1USVA 2IOPA 4HY1A 5IT9Q 1N32E 5LMNE 3J80C 4LF6I 4LF6E 5LMUE 1XHKA 4JI7I 1VISA 4JI1I 2UUAI 2CG9A 4DV3I 5L3JA 1H7SA 4DUYE 5LMUI 4NXMI 4NXNE 5LMNI 1NHIA 1HNWE 2HKJA 2UUCI 1Y4SA 2UU9I 4YY3I 2F4VE 4PU9A 1B62A 4DR6I 3T1HE 1FNMA 4M1KA 3JAMC 2EFGA 4IZJA 4B3ME 2ZM6I 4JI5E 3D4JA 2IOQA 3ZZ0A 4JI3E 4B3RI 3H4LA 4DR4I 4JYAE 2E5LI 4HXZA 1N0UA 4JI8I 2XEXA 4KHPI 1IBME 4USKA 4USMA 1PKPA 2HFSA 1IBMI 1USUA 2CGEA 3Q1QA 1NZ0A 2E5LE 1HNZI 2BM0A 5IWAE 2Z5CA 4GKKE 1N34I 2A2CA 1Z0WA 4JI0E 1WUUA 2V34A 1J5EE 3B82A 4DV7E 1H74A 3M6AA 2Z5BB 1Z5BA 4DPXA 1Z5CA 2DEIA 4B3TE 2HK2A 1MX0A 1I94I 3GONA 4LFBI 4WUDA 4LF5I 1FJGE 1EI1A 4P52A 4OX9E 1N33I 4EMDA 5GMDA 3B78A 1XMOI 1XMQI 1ZM4A 1ELOA 2LJPA 3Q6NA 4HACB 4DV2I 2VQFI 2HKEA 4JI7E 2PNLA 4LF9I 4UT4A 4DUZE 3J80Q 4DR2E 1IBLI 4LF5E 4RPFA 2HHHI 1BKNA 1KVKA 1NHJA 1FWKA 2VQEE 3P06A 1RREA 4DV4I 1D6TA 3K85A 3WU3A 4X65I 2V8PA 4WUCA 3OTOE 4DV7I 5A2QQ 3PYFA 4FWGA 4JI6I 4LF8I 2UXDE 2UXBI 4LF7E 4IZJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT8 A;  4DR7 I;  1FI4 A;  5A2Q C;  2OI2 A;  2ZBK B;  4XTJ A;  4DR4 E;  4DR7 E;  3J81 C;  1MU5 A;  4JI5 I;  2ZM6 E;  4JI4 I;  4JI6 E;  3PYE A;  3J7A M;  1Z5A A;  3WU6 A;  3V2U C;  4DV4 E;  2VF3 A;  4WUB A;  4GKJ I;  4YHH I;  4Z7Y A;  4X66 I;  4DV6 I;  4DV0 I;  1HR0 I;  1ZM3 A;  1A6F A;  1OJ4 A;  4DR2 I;  4DR1 E;  4NXN I;  1NHH A;  1UEK A;  4NXM E;  4LF9 E;  4HAC A;  2VQF E;  3F0N A;  4DPW A;  4JG4 A;  1N32 I;  4KQV A;  3ZM7 A;  4DV5 E;  1XNR I;  4ED4 A;  4X64 I;  4LF4 I;  2CZ9 A;  1I94 E;  1XMQ E;  4DR5 I;  2R3V A;  1IBK E;  4DR1 I;  2V2Z A;  5IT9 C;  1Z0B A;  4LF4 E;  4DPT A;  4DV0 E;  4DV5 I;  1XNR E;  1N0V C;  4K0K I;  3ZZT A;  4DPU A;  4GKJ E;  2Q2E B;  2V2V A;  1J5E I;  5BR8 E;  5IWA I;  1XMO E;  4GKK I;  1Z0E A;  2E1R A;  1N36 E;  3LPS A;  3JAM Q;  1N34 E;  4FWH A;  3J81 Q;  2GS8 A;  1MG7 A;  1HR0 E;  4I3H A;  4B3T I;  4DV6 E;  2HFU A;  4UTG A;  1H72 C;  1FWL A;  4LFC I;  4JI3 I;  2DEJ A;  4MYT A;  4X66 E;  4X62 I;  4YHH E;  4JI0 I;  4LF7 I;  3PYG A;  3WU4 A;  2X7I A;  4B3S E;  4URL A;  4DU8 A;  4B3M I;  3ZZU A;  4X62 E;  2AJ4 A;  4JI4 E;  1B63 A;  3ZKB A;  1Z0T A;  2VQE I;  3T1H I;  3QT6 A;  2UXC E;  4B3R E;  4YY3 E;  1H73 A;  4FN5 A;  1Z59 A;  5GME A;  2HHH E;  1ZM9 A;  4FW9 A;  2UXD I;  4MYU A;  1U2R A;  1KTV A;  1N36 I;  2UXB E;  5BR8 I;  2NPF A;  3OTO I;  4X65 E;  1KKH A;  4LF8 E;  3K1J A;  4AQY E;  4K0K E;  1Z0C A;  4DU7 A;  2BV3 A;  5LL6 R;  4LFB E;  4LFA E;  3QT7 A;  1IBL E;  3PYD A;  1FKA E;  4AQY I;  4DUY I;  4DR5 E;  1Z0G A;  4DV3 E;  3K17 A;  2UUA E;  4JI1 E;  1H7U A;  1RR9 A;  4DV2 E;  3V5R A;  4DUZ I;  4OX9 I;  1N33 E;  3HUL A;  1HNX E;  4JV5 I;  2UUB I;  1FJG I;  1ZXM A;  1QZR A;  4HYM A;  2UXC I;  3ZKD A;  1HNZ E;  5FLX C;  3J7A G;  4DR3 E;  4DV1 E;  1XNQ E;  4ZVI A;  1ZXN A;  4KHP E;  4FWD A;  3LNU A;  2X36 A;  4JI8 E;  4B3S I;  3T1Y I;  4PRV A;  2R42 A;  4DXL A;  4R1F A;  1KIJ A;  2BM1 A;  3LTO A;  1K47 A;  4LFC E;  1EA6 A;  1DAR A;  2WW4 A;  1S16 A;  1ZM2 A;  1PVG A;  4DR6 E;  1PIE A;  1HNX I;  4JV5 E;  2UUC E;  5FLX Q;  4Z7C A;  4JYA I;  1S4E A;  3T1Y E;  4PRX A;  2ZIT A;  2V2Q A;  3WU5 A;  4P7A A;  3CWV A;  4JI2 E;  2HK3 A;  2J7K A;  4DV1 I;  4DPY A;  1XNQ I;  3QT5 A;  2F4V I;  2UU9 E;  2A2D A;  4DR3 I;  1IBK I;  1HNW I;  4LFA I;  4X64 E;  3B8H A;  2UUB E;  1Z0V A;  4JI2 I;  4HY1 A;  5IT9 Q;  1N32 E;  5LMN E;  3J80 C;  4LF6 I;  4LF6 E;  5LMU E;  1XHK A;  4JI7 I;  1VIS A;  4JI1 I;  2UUA I;  4DV3 I;  5L3J A;  1H7S A;  4DUY E;  5LMU I;  4NXM I;  4NXN E;  5LMN I;  1NHI A;  1HNW E;  2HKJ A;  2UUC I;  2UU9 I;  4YY3 I;  2F4V E;  4PU9 A;  1B62 A;  4DR6 I;  3T1H E;  1FNM A;  4M1K A;  3JAM C;  2EFG A;  4B3M E;  2ZM6 I;  4JI5 E;  3D4J A;  3ZZ0 A;  4JI3 E;  4B3R I;  3H4L A;  4DR4 I;  4JYA E;  2E5L I;  4HXZ A;  1N0U A;  4JI8 I;  2XEX A;  4KHP I;  1IBM E;  4USK A;  4USM A;  1PKP A;  2HFS A;  1IBM I;  3Q1Q A;  1NZ0 A;  2E5L E;  1HNZ I;  2BM0 A;  5IWA E;  4GKK E;  1N34 I;  2A2C A;  1Z0W A;  4JI0 E;  1WUU A;  2V34 A;  1J5E E;  3B82 A;  4DV7 E;  1H74 A;  3M6A A;  1Z5B A;  4DPX A;  1Z5C A;  2DEI A;  4B3T E;  2HK2 A;  1MX0 A;  1I94 I;  3GON A;  4LFB I;  4WUD A;  4LF5 I;  1FJG E;  1EI1 A;  4P52 A;  4OX9 E;  1N33 I;  4EMD A;  5GMD A;  3B78 A;  1XMO I;  1XMQ I;  1ZM4 A;  1ELO A;  2LJP A;  4HAC B;  4DV2 I;  2VQF I;  2HKE A;  4JI7 E;  4LF9 I;  4UT4 A;  4DUZ E;  3J80 Q;  4DR2 E;  1IBL I;  4LF5 E;  4RPF A;  2HHH I;  1BKN A;  1KVK A;  1NHJ A;  1FWK A;  2VQE E;  1RRE A;  4DV4 I;  1D6T A;  3WU3 A;  4X65 I;  2V8P A;  4WUC A;  3OTO E;  4DV7 I;  5A2Q Q;  3PYF A;  4FWG A;  4JI6 I;  4LF8 I;  2UXD E;  2UXB I;  4LF7 E; 
#chains in the Genus database with same CATH topology
 3QT8 A;  4DR7 I;  1FI4 A;  5A2Q C;  2Z5E A;  3DD6 A;  5JEA F;  2OI2 A;  2JEB A;  4FW7 A;  2ZBK B;  4LCG A;  4XTJ A;  4DR4 E;  5DRP A;  5FWK A;  4IFD A;  4DR7 E;  3J81 C;  1MU5 A;  1E3P A;  4JI5 I;  2ZM6 E;  4JI4 I;  4JI6 E;  3HKM A;  3PYE A;  3H1C A;  3J7A M;  1Z5A A;  3WU6 A;  1OYR A;  3V2U C;  4DV4 E;  2VF3 A;  4WUB A;  4GKJ I;  4YHH I;  4Z7Y A;  4X66 I;  4DV6 I;  4DV0 I;  1P42 A;  1UDS A;  1HR0 I;  1ZM3 A;  2PNM A;  1A6F A;  1RHY A;  1OJ4 A;  4DR2 I;  4DR1 E;  4NXN I;  1NHH A;  1UEK A;  2PNZ B;  4NXM E;  5EKW A;  4LF9 E;  4HAC A;  2CVE A;  2VQF E;  3F0N A;  2GQ0 A;  4DPW A;  4NBQ A;  4JG4 A;  1N32 I;  4N3O A;  4KQV A;  3ZM7 A;  4DV5 E;  1XNR I;  4ED4 A;  4X64 I;  4LF4 I;  2CZ9 A;  1I94 E;  1XMQ E;  2Z5C B;  4DR5 I;  2IES A;  2NN6 C;  2R3V A;  1IBK E;  4DR1 I;  3UHM A;  2F1D A;  2V2Z A;  5IT9 C;  1UDQ A;  2JEA B;  1Z0B A;  4LF4 E;  2PNZ A;  4DPT A;  4DV0 E;  2PO1 B;  4DV5 I;  1XNR E;  4IZJ B;  1N0V C;  2J65 A;  4K0K I;  3ZZT A;  4LOM A;  4DPU A;  3M7N G;  4GKJ E;  2Q2E B;  1YH8 A;  2V2V A;  1J5E I;  5BR8 E;  5IWA I;  1XMO E;  4GKK I;  1Z0E A;  2E1R A;  1N36 E;  3LPS A;  2WNR A;  3JAM Q;  4IS9 A;  1N34 E;  4FWH A;  2O1U A;  3J81 Q;  2GS8 A;  1OYP A;  1Y4U A;  1Y6Z A;  3U1K A;  1MG7 A;  1HR0 E;  4I3H A;  5C0X D;  4B3T I;  4DV6 E;  2HFU A;  4UTG A;  1H72 C;  1FWL A;  4LFC I;  4JI3 I;  2BA0 G;  1UDN A;  2DEJ A;  4MYT A;  4X66 E;  2O1V A;  2JEA A;  2O1W A;  2WP8 B;  4X62 I;  4YHH E;  4JI0 I;  4LF7 I;  3PYG A;  3PRY A;  3WU4 A;  2X7I A;  4B3S E;  4OO1 F;  4URL A;  4DU8 A;  4B3M I;  3ZZU A;  4LCH A;  2AJ4 A;  4X62 E;  4JI4 E;  1B63 A;  3ZKB A;  4FW3 A;  2BR2 B;  1Z0T A;  2VQE I;  3T1H I;  3QT6 A;  4IZK B;  2UXC E;  5K36 C;  4B3R E;  4YY3 E;  1H73 A;  4FN5 A;  1Z59 A;  2WP8 A;  3CDJ A;  5GME A;  1ZM9 A;  2HHH E;  3M7N D;  4IFD D;  4FW9 A;  2C38 B;  4OO1 A;  2UXD I;  4MYU A;  2C39 B;  1U2R A;  4IFD E;  1KTV A;  1N36 I;  1R6M A;  2UXB E;  5BR8 I;  2NPF A;  2Z5B A;  3OTO I;  5C0X E;  4X65 E;  4OO1 C;  1KKH A;  4LF8 E;  3K1J A;  4AQY E;  4K0K E;  5JEA B;  2PO2 B;  1Z0C A;  4DU7 A;  2BV3 A;  4AM3 A;  5LL6 R;  4LFB E;  2BA1 G;  4LFA E;  3QT7 A;  1IBL E;  3PYD A;  1FKA E;  4AQY I;  4DUY I;  2JE6 B;  4DR5 E;  1Z0G A;  4DV3 E;  2PO0 A;  3K17 A;  2UUA E;  4JI1 E;  1H7U A;  1RR9 A;  4MDT A;  4DV2 E;  3V5R A;  4DUZ I;  3L7Z B;  1HK7 A;  4OX9 I;  1N33 E;  3HUL A;  1HNX E;  4JV5 I;  2UUB I;  1FJG I;  1ZXM A;  3U1Y A;  1QZR A;  4HYM A;  2UXC I;  3ZKD A;  5DNX A;  1HNZ E;  5FLX C;  3J7A G;  2BA0 D;  2C37 A;  4DR3 E;  2JEB B;  4OO1 E;  4DV1 E;  1XNQ E;  4ZVI A;  5JEA E;  5ELW A;  1ZXN A;  4KHP E;  4FWD A;  2BR2 A;  4U3D A;  3LNU A;  2X36 A;  4JI8 E;  5DRO A;  4B3S I;  3PS1 A;  4IFD F;  3T1Y I;  4PRV A;  2R42 A;  3B4T A;  1Y5Y A;  4DXL A;  3P76 A;  4R1F A;  5C0X F;  2O1T A;  1KIJ A;  2BM1 A;  3LTO A;  1K47 A;  4LFC E;  1EA6 A;  1DAR A;  1R6L A;  2WW4 A;  1S16 A;  2C37 B;  2C38 A;  1ZM2 A;  1PVG A;  4DR6 E;  3PS2 A;  4ISA A;  1PIE A;  2AE8 A;  2NN6 B;  5C0X C;  1HNX I;  4OZE A;  4JV5 E;  2UUC E;  5K36 D;  5FLX Q;  4OO1 B;  4Z7C A;  4JYA I;  1S4E A;  3PS3 A;  3T1Y E;  2JT2 A;  4MU3 A;  1UDO A;  3HJC A;  4PRX A;  2ZIT A;  2V2Q A;  3WU5 A;  4OO1 D;  4P7A A;  5K36 B;  4BA2 B;  4QNJ A;  3CWV A;  3L7Z A;  4FW4 A;  2HK3 A;  2J7K A;  4JI2 E;  4BA1 A;  4DPY A;  4DV1 I;  3QT5 A;  1XNQ I;  2F4V I;  2UU9 E;  2A2D A;  4DR3 I;  4LPF A;  1IBK I;  4IZK A;  1HNW I;  4LFA I;  3Q6M A;  4BA2 A;  4X64 E;  2WNR B;  3B8H A;  4BA1 B;  2UUB E;  1Z0V A;  4JI2 I;  1USV A;  2IOP A;  3CDI A;  4HY1 A;  3GME A;  5IT9 Q;  1N32 E;  5LMN E;  3J80 C;  1Y60 A;  4LF6 E;  4LF6 I;  5LMU E;  2PO2 A;  1XHK A;  4JI7 I;  1VIS A;  4JI1 I;  2UUA I;  2CG9 A;  4DV3 I;  5L3J A;  1H7S A;  4DUY E;  4IFD B;  5LMU I;  4NXM I;  4NXN E;  5LMN I;  1NHI A;  1HNW E;  2HKJ A;  2UUC I;  1Y4S A;  5C0X B;  2UU9 I;  4YY3 I;  2F4V E;  4PU9 A;  3P3G A;  1B62 A;  4DR6 I;  4AID A;  5DRQ A;  3T1H E;  1FNM A;  4M1K A;  4U3B A;  3JAM C;  2IER A;  2EFG A;  4IZJ A;  3P3E A;  4B3M E;  2JE6 A;  2NN6 F;  5EL9 A;  2ZM6 I;  4JI5 E;  3D4J A;  2IOQ A;  3P3C A;  3ZZ0 A;  2GO3 A;  1E3H A;  1XXE A;  4JI3 E;  3H4L A;  4B3R I;  4DR4 I;  4JYA E;  2PO0 B;  2E5L I;  4HXZ A;  1N0U A;  5DNL A;  4JI8 I;  2XEX A;  4KHP I;  1IBM E;  4USK A;  1YHC A;  4USM A;  1PKP A;  2HFS A;  1IBM I;  1USU A;  5JEA D;  2CGE A;  3Q1Q A;  1NZ0 A;  2E5L E;  2C39 A;  2BM0 A;  1HNZ I;  5IWA E;  2Z5C A;  4GKK E;  5JEA A;  1N34 I;  4MU4 A;  2A2C A;  4MQY A;  1Z0W A;  4JI0 E;  1WUU A;  2V34 A;  4MU0 A;  1J5E E;  3B82 A;  4MU1 A;  4DV7 E;  3KRN A;  2PO1 A;  1H74 A;  3M6A A;  2Z5B B;  3GCM A;  1Z5B A;  2NN6 E;  3GLL A;  3M85 D;  4DPX A;  1Z5C A;  2DEI A;  4B3T E;  2HK2 A;  2NN6 D;  1MX0 A;  1I94 I;  3GON A;  4LFB I;  4WUD A;  4LF5 I;  4OKG A;  1FJG E;  1EI1 A;  4P52 A;  4OX9 E;  1N33 I;  5JEA C;  4EMD A;  5GMD A;  5DRR A;  3B78 A;  1XMO I;  1XMQ I;  5K36 A;  1ZM4 A;  1ELO A;  2LJP A;  3Q6N A;  4HAC B;  4DV2 I;  4J3D A;  2VES A;  3NZK A;  2VQF I;  2HKE A;  4JI7 E;  2PNL A;  4LF9 I;  4UT4 A;  4DUZ E;  3J80 Q;  3M85 G;  4DR2 E;  1OYS A;  1IBL I;  4LF5 E;  4RPF A;  5C0X A;  2HHH I;  1BKN A;  1KVK A;  5K36 E;  1NHJ A;  1FWK A;  5K36 F;  2VQE E;  3P06 A;  1RRE A;  4DV4 I;  1D6T A;  2GO4 A;  3K85 A;  3WU3 A;  4X65 I;  2V8P A;  4WUC A;  3OTO E;  2BA1 D;  4QNK A;  4DV7 I;  4IFD C;  1VI7 A;  5A2Q Q;  4AIM A;  3PYF A;  4FWG A;  4JI6 I;  4LF8 I;  2UXD E;  4FW5 A;  2UXB I;  4LF7 E;  4FW6 A;  2O3Z A;  2NN6 A;  4GQU A;  4LCF A;  4IZJ D; 
#chains in the Genus database with same CATH homology
 3QT8 A;  4DR7 I;  1FI4 A;  5A2Q C;  2Z5E A;  2OI2 A;  2ZBK B;  4XTJ A;  4DR4 E;  5FWK A;  4DR7 E;  3J81 C;  1MU5 A;  4JI5 I;  2ZM6 E;  4JI4 I;  4JI6 E;  3PYE A;  3J7A M;  1Z5A A;  3WU6 A;  3V2U C;  4DV4 E;  2VF3 A;  4WUB A;  4GKJ I;  4YHH I;  4Z7Y A;  4X66 I;  4DV6 I;  4DV0 I;  1HR0 I;  1ZM3 A;  2PNM A;  1A6F A;  1OJ4 A;  4DR2 I;  4DR1 E;  4NXN I;  1NHH A;  1UEK A;  4NXM E;  4LF9 E;  4HAC A;  2VQF E;  3F0N A;  2GQ0 A;  4DPW A;  4JG4 A;  1N32 I;  4N3O A;  4KQV A;  3ZM7 A;  4DV5 E;  1XNR I;  4ED4 A;  4X64 I;  4LF4 I;  2CZ9 A;  1I94 E;  1XMQ E;  2Z5C B;  4DR5 I;  2R3V A;  1IBK E;  4DR1 I;  2V2Z A;  5IT9 C;  1Z0B A;  4LF4 E;  4DPT A;  4DV0 E;  4DV5 I;  1XNR E;  4IZJ B;  1N0V C;  4K0K I;  3ZZT A;  4DPU A;  4GKJ E;  2Q2E B;  2V2V A;  1J5E I;  5BR8 E;  5IWA I;  1XMO E;  4GKK I;  1Z0E A;  2E1R A;  1N36 E;  3LPS A;  3JAM Q;  1N34 E;  4FWH A;  2O1U A;  3J81 Q;  2GS8 A;  1Y4U A;  1Y6Z A;  1MG7 A;  1HR0 E;  4I3H A;  4B3T I;  4DV6 E;  2HFU A;  4UTG A;  1H72 C;  1FWL A;  4LFC I;  4JI3 I;  2DEJ A;  4MYT A;  4X66 E;  2O1V A;  2O1W A;  4X62 I;  4YHH E;  4JI0 I;  4LF7 I;  3PYG A;  3PRY A;  3WU4 A;  2X7I A;  4B3S E;  4URL A;  4DU8 A;  4B3M I;  3ZZU A;  4X62 E;  2AJ4 A;  4JI4 E;  1B63 A;  3ZKB A;  1Z0T A;  2VQE I;  3T1H I;  3QT6 A;  4IZK B;  2UXC E;  4B3R E;  4YY3 E;  1H73 A;  4FN5 A;  1Z59 A;  5GME A;  2HHH E;  1ZM9 A;  4FW9 A;  2UXD I;  4MYU A;  1U2R A;  1KTV A;  1N36 I;  2UXB E;  5BR8 I;  2NPF A;  2Z5B A;  3OTO I;  4X65 E;  1KKH A;  4LF8 E;  3K1J A;  4AQY E;  4K0K E;  1Z0C A;  4DU7 A;  2BV3 A;  5LL6 R;  4LFB E;  4LFA E;  3QT7 A;  1IBL E;  3PYD A;  1FKA E;  4AQY I;  4DUY I;  4DR5 E;  1Z0G A;  4DV3 E;  3K17 A;  2UUA E;  4JI1 E;  1H7U A;  1RR9 A;  4DV2 E;  3V5R A;  4DUZ I;  1HK7 A;  4OX9 I;  1N33 E;  3HUL A;  1HNX E;  4JV5 I;  2UUB I;  1FJG I;  1ZXM A;  1QZR A;  4HYM A;  2UXC I;  3ZKD A;  1HNZ E;  5FLX C;  3J7A G;  4DR3 E;  4DV1 E;  1XNQ E;  4ZVI A;  1ZXN A;  4KHP E;  4FWD A;  3LNU A;  2X36 A;  4JI8 E;  4B3S I;  3T1Y I;  4PRV A;  2R42 A;  4DXL A;  4R1F A;  2O1T A;  1KIJ A;  2BM1 A;  3LTO A;  1K47 A;  4LFC E;  1EA6 A;  1DAR A;  2WW4 A;  1S16 A;  1ZM2 A;  1PVG A;  4DR6 E;  1PIE A;  1HNX I;  4JV5 E;  2UUC E;  5FLX Q;  4Z7C A;  4JYA I;  1S4E A;  3T1Y E;  3HJC A;  4PRX A;  2ZIT A;  2V2Q A;  3WU5 A;  4P7A A;  3CWV A;  2HK3 A;  2J7K A;  4JI2 E;  4DV1 I;  4DPY A;  1XNQ I;  3QT5 A;  2F4V I;  2UU9 E;  2A2D A;  4DR3 I;  1IBK I;  4IZK A;  1HNW I;  4LFA I;  3Q6M A;  4X64 E;  3B8H A;  2UUB E;  1Z0V A;  4JI2 I;  1USV A;  2IOP A;  4HY1 A;  5IT9 Q;  1N32 E;  5LMN E;  3J80 C;  4LF6 I;  4LF6 E;  5LMU E;  1XHK A;  4JI7 I;  1VIS A;  4JI1 I;  2UUA I;  2CG9 A;  4DV3 I;  5L3J A;  1H7S A;  4DUY E;  5LMU I;  4NXM I;  4NXN E;  5LMN I;  1NHI A;  1HNW E;  2HKJ A;  2UUC I;  1Y4S A;  2UU9 I;  4YY3 I;  2F4V E;  4PU9 A;  1B62 A;  4DR6 I;  3T1H E;  1FNM A;  4M1K A;  3JAM C;  2EFG A;  4IZJ A;  4B3M E;  2ZM6 I;  4JI5 E;  3D4J A;  2IOQ A;  3ZZ0 A;  4JI3 E;  4B3R I;  3H4L A;  4DR4 I;  4JYA E;  2E5L I;  4HXZ A;  1N0U A;  4JI8 I;  2XEX A;  4KHP I;  1IBM E;  4USK A;  4USM A;  1PKP A;  2HFS A;  1IBM I;  1USU A;  2CGE A;  3Q1Q A;  1NZ0 A;  2E5L E;  1HNZ I;  2BM0 A;  5IWA E;  2Z5C A;  4GKK E;  1N34 I;  2A2C A;  1Z0W A;  4JI0 E;  1WUU A;  2V34 A;  1J5E E;  3B82 A;  4DV7 E;  1H74 A;  3M6A A;  2Z5B B;  1Z5B A;  4DPX A;  1Z5C A;  2DEI A;  4B3T E;  2HK2 A;  1MX0 A;  1I94 I;  3GON A;  4LFB I;  4WUD A;  4LF5 I;  1FJG E;  1EI1 A;  4P52 A;  4OX9 E;  1N33 I;  4EMD A;  5GMD A;  3B78 A;  1XMO I;  1XMQ I;  1ZM4 A;  1ELO A;  2LJP A;  3Q6N A;  4HAC B;  4DV2 I;  2VQF I;  2HKE A;  4JI7 E;  2PNL A;  4LF9 I;  4UT4 A;  4DUZ E;  3J80 Q;  4DR2 E;  1IBL I;  4LF5 E;  4RPF A;  2HHH I;  1BKN A;  1KVK A;  1NHJ A;  1FWK A;  2VQE E;  3P06 A;  1RRE A;  4DV4 I;  1D6T A;  3K85 A;  3WU3 A;  4X65 I;  2V8P A;  4WUC A;  3OTO E;  4DV7 I;  5A2Q Q;  3PYF A;  4FWG A;  4JI6 I;  4LF8 I;  2UXD E;  2UXB I;  4LF7 E;  4IZJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...