2UUBI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uubI00
4NXME 4HYMA 4DUYE 4YHHI 2UUBI 4JG4A 4JI6E 4FWDA 4PU9A 4DV5I 1S4EA 5LMUE 1N0UA 3ZKDA 1PKPA 4JI4I 2HK2A 4X62I 4DUYI 4LFAE 4LF5I 1MU5A 4JI6I 1HNXE 4GKKE 4LFCE 2HHHI 3B8HA 1HNWI 1MG7A 4LFAI 4URLA 2F4VI 4JI1I 3T1YE 4DPYA 3WU5A 4JV5I 4DV1E 4DPXA 5GMDA 1FWKA 2DEIA 2BM0A 4LFBI 4OX9I 4P7AA 4X64I 3H4LA 4DPWA 4B3MI 3T1YI 1VISA 2BM1A 1N32I 2E5LI 4LF4I 1WUUA 2X36A 3Q1QA 1FNMA 2Q2EB 4B3RE 1B63A 4JI0I 1ZM4A 3F0NA 4B3SI 2HKJA 2A2CA 1XNRE 1FI4A 4B3TI 3T1HI 4DUZI 5A2QQ 2VQFE 4KHPE 4B3RI 4X65E 5IWAE 4LF7I 5IT9Q 1ZM3A 3CWVA 1J5EI 2GS8A 1Z0WA 1XHKA 4LF6E 4JI5E 4DR7I 2R42A 3J80Q 3M6AA 4Z7YA 3OTOI 4DR4I 4KQVA 4YHHE 2UUBE 1N34I 4DU8A 3JAMQ 4WUDA 4DV5E 4JI7I 3ZM7A 4YY3I 4DV7I 4PRVA 4JI4E 4X62E 1ZXMA 4X66I 4JI2I 4LF5E 1PIEA 2HFUA 2V2ZA 1Z0TA 2HHHE 1H73A 1IBKI 5L3JA 1HNWE 4HACB 2F4VE 1H7UA 4JI1E 2CZ9A 4M1KA 3WU4A 4JV5E 1FKAE 4GKJI 4LFBE 1B62A 2UXBI 4OX9E 4P52A 4DR2I 4X64E 1NZ0A 1Z59A 4B3ME 1Z0VA 1HR0I 1N32E 1QZRA 3V2UC 2E5LE 4DR3I 2UU9I 4LF4E 3LPSA 2V2QA 2ZITA 3D4JA 4MYUA 4JI0E 1FJGI 1H72C 4B3SE 2UUAI 4JI8I 1IBLI 2V8PA 1EI1A 4Z7CA 4B3TE 2VQEI 4LF8I 1N0VC 1H7SA 1RREA 1Z0GA 3T1HE 4DUZE 4DV2I 4JYAI 5BR8I 4XTJA 4LF7E 1ZM9A 3B78A 4JI3I 4AQYI 1NHHA 1ELOA 1J5EE 5FLXC 4DR7E 2OI2A 3OTOE 3QT7A 4LF9I 1N33I 4DV3I 4DR4E 2NPFA 1N34E 1S16A 2DEJA 4JI7E 1EA6A 4FWGA 1ZM2A 2UUCI 4YY3E 4DV7E 4WUBA 1BKNA 3QT6A 1I94E 2LJPA 1N36E 1OJ4A 3LTOA 2HK3A 4X66E 4JI2E 4USKA 5GMEA 1ZXNA 2UXCE 1Z5AA 3QT8A 1IBMI 3LNUA 1Z5CA 4DXLA 1I94I 1IBKE 4DR1I 2X7IA 1N36I 1HNZI 3J81C 3K17A 1XMOI 3QT5A 2UXDI 3J7AM 2UXCI 4GKJE 4NXNI 2ZBKB 4DR5I 4DPUA 2UXBE 2HKEA 4DV0I 4DV6I 1XMQI 1UEKA 3PYFA 4MYTA 4DR2E 4USMA 1H74A 1XNQI 1KKHA 4UTGA 2BV3A 1HR0E 1KTVA 4ED4A 1Z0EA 5LMNI 4FN5A 4DR3E 4K0KI 2UU9E 2ZM6I 4DR6I 2A2DA 5LL6R 3K1JA 3PYDA 3ZZUA 1FJGE 4NXMI 2UUAE 4JI8E 1IBLE 3V5RA 4DV4E 1Z5BA 2VQEE 4LF8E 1PVGA 2V34A 5LMUI 4DV2E 2VF3A 4JYAE 3GONA 4PRXA 2J7KA 3PYEA 5BR8E 3ZZ0A 4DV4I 3WU3A 4HY1A 1HNXI 4GKKI 2R3VA 4JI3E 1Z0BA 1MX0A 4AQYE 4LFCI 3ZKBA 2XEXA 4I3HA 4DU7A 4FW9A 4R1FA 1NHJA 2V2VA 4DV1I 4EMDA 4LF9E 1N33E 4DV3E 1FWLA 3B82A 2UUCE 5FLXQ 3J7AG 4HXZA 1KIJA 1NHIA 1IBME 2E1RA 5A2QC 1RR9A 3WU6A 3ZZTA 1DARA 4DR1E 4UT4A 1HNZE 4HACA 5IT9C 1A6FA 1XMOE 4ZVIA 3HULA 1XNRI 2UXDE 1K47A 2HFSA 4NXNE 4RPFA 2VQFI 4DR5E 4KHPI 4DV0E 4DV6E 4X65I 1XMQE 2EFGA 3J80C 2AJ4A 3PYGA 5IWAI 3J81Q 1XNQE 2WW4A 4WUCA 1Z0CA 5LMNE 1D6TA 4K0KE 1KVKA 2ZM6E 4DPTA 3JAMC 4DR6E 4FWHA 1U2RA 4LF6I 4JI5I
chains in the Genus database with same CATH superfamily
5JEAB 4NXME 4HYMA 4DUYE 2C37A 4YHHI 2UUBI 4AM3A 2NN6A 4JG4A 4JI6E 4IFDA 4FWDA 4BA1B 4PU9A 4DV5I 5JEAF 1R6MA 1S4EA 5LMUE 1N0UA 3ZKDA 2JE6B 1PKPA 3P3CA 4JI4I 2HK2A 4X62I 4DUYI 4LFAE 4LF5I 1MU5A 2Z5BA 4JI6I 4IS9A 1HNXE 4GKKE 3PS1A 3M85D 4LFCE 2HHHI 3B8HA 1HNWI 1MG7A 2VESA 4LFAI 4URLA 2F4VI 4JI1I 3T1YE 4DPYA 3WU5A 4JV5I 4DV1E 4DPXA 5GMDA 4MQYA 1FWKA 2DEIA 4OO1A 2BM0A 2GO3A 2WP8A 3PS2A 3P3EA 4LFBI 5K36A 4OX9I 4FW4A 5C0XB 4P7AA 4X64I 3H4LA 4DPWA 5FWKA 4B3MI 3T1YI 1VISA 2BM1A 1N32I 2BR2B 2E5LI 5JEAE 4LF4I 2PO2B 4IFDB 3L7ZB 1WUUA 5C0XD 1OYSA 2X36A 5DRPA 3Q1QA 1FNMA 5EL9A 2Q2EB 2JEAB 4B3RE 4LCGA 1B63A 2F1DA 4JI0I 1ZM4A 3F0NA 4B3SI 2HKJA 2NN6F 4IFDF 2A2CA 2Z5BB 2O1WA 1XNRE 1FI4A 4B3TI 3T1HI 4DUZI 5A2QQ 2VQFE 4KHPE 4B3RI 1Y4SA 3U1YA 2PNZA 4X65E 4MU4A 5IWAE 4LF7I 5IT9Q 4MU0A 1ZM3A 1Y5YA 2IOQA 5C0XC 3CWVA 5K36B 1J5EI 2GS8A 2GQ0A 1Z0WA 3HJCA 1XHKA 3GCMA 4BA2B 4LF6E 4JI5E 4DR7I 5DROA 2R42A 3J80Q 3M85G 3M6AA 4Z7YA 4OO1F 3OTOI 4ISAA 1E3PA 4DR4I 4KQVA 2WNRB 4OZEA 4QNKA 4YHHE 2UUBE 5K36F 1N34I 4DU8A 3P06A 3JAMQ 4WUDA 4FW6A 4QNJA 4DV5E 4JI7I 3ZM7A 4IFDE 4YY3I 4DV7I 4PRVA 1E3HA 4JI4E 4X62E 1ZXMA 4X66I 4JI2I 4U3BA 4LF5E 2PO1A 1PIEA 2HFUA 2AE8A 4J3DA 4MU1A 2V2ZA 1Z0TA 5JEAD 5DRQA 2HHHE 1H73A 1IBKI 5L3JA 1HNWE 4HACB 3DD6A 1UDNA 1RHYA 2F4VE 1H7UA 4MU3A 4JI1E 2CZ9A 4M1KA 3WU4A 4JV5E 1FKAE 3PS3A 4GKJI 1OYRA 1XXEA 4LFBE 1B62A 2UXBI 4IZJA 3K85A 4LOMA 4OX9E 4P52A 2BA1G 4DR2I 4FW5A 4X64E 5K36E 2PO0B 4AIMA 1NZ0A 1Z59A 4B3ME 1Z0VA 2C39A 1HR0I 1N32E 1QZRA 3V2UC 2E5LE 4DR3I 3NZKA 2UU9I 4LF4E 3LPSA 2J65A 2PNMA 2V2QA 2ZITA 5JEAC 4IZKA 5DRRA 3D4JA 4U3DA 4MYUA 4JI0E 1FJGI 1H72C 4B3SE 2UUAI 4JI8I 1IBLI 2C37B 2V8PA 1EI1A 2NN6B 3KRNA 4FW7A 4Z7CA 3B4TA 4B3TE 2VQEI 4LF8I 1N0VC 1H7SA 4LCHA 1RREA 1Z0GA 3T1HE 4DUZE 4DV2I 4JYAI 2JEBA 5BR8I 2NN6D 4IFDD 4XTJA 4LF7E 2C38A 1ZM9A 3B78A 2O1TA 4JI3I 2BA1D 4N3OA 4AQYI 1NHHA 1ELOA 4IZJB 3GMEA 1J5EE 5FLXC 2Z5EA 3Q6NA 4DR7E 2OI2A 2PNLA 3OTOE 3QT7A 4LF9I 1N33I 4DV3I 4DR4E 2NPFA 1UDSA 4OO1B 1N34E 1S16A 1P42A 2WP8B 3H1CA 3M7ND 2DEJA 2IERA 4JI7E 1EA6A 4FWGA 1ZM2A 2UUCI 4YY3E 4DV7E 4WUBA 3P3GA 1BKNA 3QT6A 2JE6A 1I94E 2LJPA 1Y4UA 2NN6C 3PRYA 2O1UA 1N36E 1OJ4A 3LTOA 4IFDC 2IOPA 4OO1D 2HK3A 4X66E 4JI2E 4USKA 1YH8A 5K36D 5GMEA 1ZXNA 4FW3A 2UXCE 1Z5AA 3QT8A 1IBMI 2NN6E 3LNUA 1Z5CA 5DNXA 1UDOA 4DXLA 2BA0G 1R6LA 1I94I 1IBKE 4DR1I 2X7IA 1N36I 1HNZI 3J81C 3K17A 1XMOI 3U1KA 3QT5A 2UXDI 2C38B 3J7AM 4AIDA 2UXCI 4GKJE 4NXNI 2ZBKB 4DR5I 4DPUA 2UXBE 5EKWA 2HKEA 2PNZB 4DV0I 4DV6I 4GQUA 3PYFA 1UEKA 4MYTA 1XMQI 4DR2E 4MDTA 5C0XA 1USVA 4USMA 1H74A 1XNQI 1KKHA 4OO1C 4UTGA 2BV3A 1HR0E 4NBQA 1KTVA 2BR2A 1Z0EA 4ED4A 5LMNI 4FN5A 5K36C 4DR3E 4K0KI 2UU9E 2ZM6I 5ELWA 2PO2A 3L7ZA 4DR6I 4OO1E 2A2DA 5LL6R 3K1JA 3PYDA 2JEAA 3ZZUA 1FJGE 4NXMI 2UUAE 4JI8E 1IBLE 3V5RA 4DV4E 1Z5BA 2BA0D 2VQEE 4LF8E 1PVGA 2V34A 5LMUI 4DV2E 2VF3A 4JYAE 3GONA 4PRXA 2J7KA 3M7NG 2JT2A 3PYEA 5BR8E 2GO4A 3HKMA 3ZZ0A 4DV4I 2PO1B 4LCFA 3WU3A 4HY1A 1HNXI 4GKKI 2R3VA 4JI3E 1Z0BA 1MX0A 4AQYE 4LFCI 3ZKBA 4LPFA 3GLLA 2XEXA 4I3HA 4DU7A 3CDIA 4FW9A 4BA2A 4R1FA 2Z5CA 2CG9A 1NHJA 2V2VA 4DV1I 4EMDA 4LF9E 1N33E 4DV3E 3CDJA 2WNRA 4OKGA 5C0XF 1FWLA 3B82A 2UUCE 5FLXQ 3J7AG 1OYPA 4HXZA 2C39B 5JEAA 3UHMA 1KIJA 1NHIA 1VI7A 2CGEA 4IZJD 1HK7A 1USUA 1Y6ZA 4BA1A 1IBME 4IZKB 2E1RA 5A2QC 1RR9A 3WU6A 3ZZTA 1DARA 4DR1E 4UT4A 1HNZE 4HACA 5IT9C 1A6FA 1XMOE 3P76A 4ZVIA 3HULA 1XNRI 2UXDE 1K47A 2HFSA 1Y60A 4NXNE 4RPFA 2VQFI 4DR5E 4KHPI 2O3ZA 2IESA 2CVEA 4DV0E 2JEBB 4DV6E 4X65I 1UDQA 1XMQE 2EFGA 3J80C 2AJ4A 3PYGA 2Z5CB 5IWAI 3J81Q 1XNQE 2WW4A 4WUCA 2PO0A 5C0XE 1YHCA 1Z0CA 5LMNE 1D6TA 4K0KE 1KVKA 2ZM6E 4DPTA 3JAMC 4DR6E 3Q6MA 4FWHA 5DNLA 2O1VA 1U2RA 4LF6I 4JI5I
chains in the Genus database with same CATH topology
4NXME 4HYMA 4DUYE 4YHHI 2UUBI 4JG4A 4JI6E 4FWDA 4PU9A 4DV5I 1S4EA 5LMUE 1N0UA 3ZKDA 1PKPA 4JI4I 2HK2A 4X62I 4DUYI 4LFAE 4LF5I 1MU5A 2Z5BA 4JI6I 1HNXE 4GKKE 4LFCE 2HHHI 3B8HA 1HNWI 1MG7A 4LFAI 4URLA 2F4VI 4JI1I 3T1YE 4DPYA 3WU5A 4JV5I 4DV1E 4DPXA 5GMDA 1FWKA 2DEIA 2BM0A 4LFBI 4OX9I 4P7AA 4X64I 3H4LA 4DPWA 5FWKA 4B3MI 3T1YI 1VISA 2BM1A 1N32I 2E5LI 4LF4I 1WUUA 2X36A 3Q1QA 1FNMA 2Q2EB 4B3RE 1B63A 4JI0I 1ZM4A 3F0NA 4B3SI 2HKJA 2A2CA 2Z5BB 2O1WA 1XNRE 1FI4A 4B3TI 3T1HI 4DUZI 5A2QQ 2VQFE 4KHPE 4B3RI 1Y4SA 4X65E 5IWAE 4LF7I 5IT9Q 1ZM3A 2IOQA 3CWVA 1J5EI 2GS8A 2GQ0A 1Z0WA 3HJCA 1XHKA 4LF6E 4JI5E 4DR7I 2R42A 3J80Q 3M6AA 4Z7YA 3OTOI 4DR4I 4KQVA 4YHHE 2UUBE 1N34I 4DU8A 3P06A 3JAMQ 4WUDA 4DV5E 4JI7I 3ZM7A 4YY3I 4DV7I 4PRVA 4JI4E 4X62E 1ZXMA 4X66I 4JI2I 4LF5E 1PIEA 2HFUA 2V2ZA 1Z0TA 2HHHE 1H73A 1IBKI 5L3JA 1HNWE 4HACB 2F4VE 1H7UA 4JI1E 2CZ9A 4M1KA 3WU4A 4JV5E 1FKAE 4GKJI 4LFBE 1B62A 2UXBI 4IZJA 3K85A 4OX9E 4P52A 4DR2I 4X64E 1NZ0A 1Z59A 4B3ME 1Z0VA 1HR0I 1N32E 1QZRA 3V2UC 2E5LE 4DR3I 2UU9I 4LF4E 3LPSA 2PNMA 2V2QA 2ZITA 4IZKA 3D4JA 4MYUA 4JI0E 1FJGI 1H72C 4B3SE 2UUAI 4JI8I 1IBLI 2V8PA 1EI1A 4Z7CA 4B3TE 2VQEI 4LF8I 1N0VC 1H7SA 1RREA 1Z0GA 3T1HE 4DUZE 4DV2I 4JYAI 5BR8I 4XTJA 4LF7E 1ZM9A 3B78A 2O1TA 4JI3I 4N3OA 4AQYI 1NHHA 1ELOA 4IZJB 1J5EE 5FLXC 2Z5EA 3Q6NA 4DR7E 2OI2A 2PNLA 3OTOE 3QT7A 4LF9I 1N33I 4DV3I 4DR4E 2NPFA 1N34E 1S16A 2DEJA 4JI7E 1EA6A 4FWGA 1ZM2A 2UUCI 4YY3E 4DV7E 4WUBA 1BKNA 3QT6A 1I94E 2LJPA 1Y4UA 3PRYA 2O1UA 1N36E 1OJ4A 3LTOA 2IOPA 2HK3A 4X66E 4JI2E 4USKA 5GMEA 1ZXNA 2UXCE 1Z5AA 3QT8A 1IBMI 3LNUA 1Z5CA 4DXLA 1I94I 1IBKE 4DR1I 2X7IA 1N36I 1HNZI 3J81C 3K17A 1XMOI 3QT5A 2UXDI 3J7AM 2UXCI 4GKJE 4NXNI 2ZBKB 4DR5I 4DPUA 2UXBE 2HKEA 4DV0I 4DV6I 1XMQI 1UEKA 3PYFA 4MYTA 4DR2E 1USVA 4USMA 1H74A 1XNQI 1KKHA 4UTGA 2BV3A 1HR0E 1KTVA 4ED4A 1Z0EA 5LMNI 4FN5A 4DR3E 4K0KI 2UU9E 2ZM6I 4DR6I 2A2DA 5LL6R 3K1JA 3PYDA 3ZZUA 1FJGE 4NXMI 2UUAE 4JI8E 1IBLE 3V5RA 4DV4E 1Z5BA 2VQEE 4LF8E 1PVGA 2V34A 5LMUI 4DV2E 2VF3A 4JYAE 3GONA 4PRXA 2J7KA 3PYEA 5BR8E 3ZZ0A 4DV4I 3WU3A 4HY1A 1HNXI 4GKKI 2R3VA 4JI3E 1Z0BA 1MX0A 4AQYE 4LFCI 3ZKBA 2XEXA 4I3HA 4DU7A 4FW9A 4R1FA 2Z5CA 2CG9A 1NHJA 2V2VA 4DV1I 4EMDA 4LF9E 1N33E 4DV3E 1FWLA 3B82A 2UUCE 5FLXQ 3J7AG 4HXZA 1KIJA 1NHIA 2CGEA 4IZJD 1HK7A 1USUA 1Y6ZA 1IBME 4IZKB 2E1RA 5A2QC 1RR9A 3WU6A 3ZZTA 1DARA 4DR1E 4UT4A 1HNZE 4HACA 5IT9C 1A6FA 1XMOE 4ZVIA 3HULA 1XNRI 2UXDE 1K47A 2HFSA 4NXNE 4RPFA 2VQFI 4DR5E 4KHPI 4DV0E 4DV6E 4X65I 1XMQE 2EFGA 3J80C 2AJ4A 3PYGA 2Z5CB 5IWAI 3J81Q 1XNQE 2WW4A 4WUCA 1Z0CA 5LMNE 1D6TA 4K0KE 1KVKA 2ZM6E 4DPTA 3JAMC 4DR6E 3Q6MA 4FWHA 2O1VA 1U2RA 4LF6I 4JI5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM E;  4HYM A;  4DUY E;  4YHH I;  2UUB I;  4JG4 A;  4JI6 E;  4FWD A;  4PU9 A;  4DV5 I;  1S4E A;  5LMU E;  1N0U A;  3ZKD A;  1PKP A;  4JI4 I;  2HK2 A;  4X62 I;  4DUY I;  4LFA E;  4LF5 I;  1MU5 A;  4JI6 I;  1HNX E;  4GKK E;  4LFC E;  2HHH I;  3B8H A;  1HNW I;  1MG7 A;  4LFA I;  4URL A;  2F4V I;  4JI1 I;  3T1Y E;  4DPY A;  3WU5 A;  4JV5 I;  4DV1 E;  4DPX A;  5GMD A;  1FWK A;  2DEI A;  2BM0 A;  4LFB I;  4OX9 I;  4P7A A;  4X64 I;  3H4L A;  4DPW A;  4B3M I;  3T1Y I;  1VIS A;  2BM1 A;  1N32 I;  2E5L I;  4LF4 I;  1WUU A;  2X36 A;  3Q1Q A;  1FNM A;  2Q2E B;  4B3R E;  1B63 A;  4JI0 I;  1ZM4 A;  3F0N A;  4B3S I;  2HKJ A;  2A2C A;  1XNR E;  1FI4 A;  4B3T I;  3T1H I;  4DUZ I;  5A2Q Q;  2VQF E;  4KHP E;  4B3R I;  4X65 E;  5IWA E;  4LF7 I;  5IT9 Q;  1ZM3 A;  3CWV A;  1J5E I;  2GS8 A;  1Z0W A;  1XHK A;  4LF6 E;  4JI5 E;  4DR7 I;  2R42 A;  3J80 Q;  3M6A A;  4Z7Y A;  3OTO I;  4DR4 I;  4KQV A;  4YHH E;  2UUB E;  1N34 I;  4DU8 A;  3JAM Q;  4WUD A;  4DV5 E;  4JI7 I;  3ZM7 A;  4YY3 I;  4DV7 I;  4PRV A;  4JI4 E;  4X62 E;  1ZXM A;  4X66 I;  4JI2 I;  4LF5 E;  1PIE A;  2HFU A;  2V2Z A;  1Z0T A;  2HHH E;  1H73 A;  1IBK I;  5L3J A;  1HNW E;  4HAC B;  2F4V E;  1H7U A;  4JI1 E;  2CZ9 A;  4M1K A;  3WU4 A;  4JV5 E;  1FKA E;  4GKJ I;  4LFB E;  1B62 A;  2UXB I;  4OX9 E;  4P52 A;  4DR2 I;  4X64 E;  1NZ0 A;  1Z59 A;  4B3M E;  1Z0V A;  1HR0 I;  1N32 E;  1QZR A;  3V2U C;  2E5L E;  4DR3 I;  2UU9 I;  4LF4 E;  3LPS A;  2V2Q A;  2ZIT A;  3D4J A;  4MYU A;  4JI0 E;  1FJG I;  1H72 C;  4B3S E;  2UUA I;  4JI8 I;  1IBL I;  2V8P A;  1EI1 A;  4Z7C A;  4B3T E;  2VQE I;  4LF8 I;  1N0V C;  1H7S A;  1RRE A;  1Z0G A;  3T1H E;  4DUZ E;  4DV2 I;  4JYA I;  5BR8 I;  4XTJ A;  4LF7 E;  1ZM9 A;  3B78 A;  4JI3 I;  4AQY I;  1NHH A;  1ELO A;  1J5E E;  5FLX C;  4DR7 E;  2OI2 A;  3OTO E;  3QT7 A;  4LF9 I;  1N33 I;  4DV3 I;  4DR4 E;  2NPF A;  1N34 E;  1S16 A;  2DEJ A;  4JI7 E;  1EA6 A;  4FWG A;  1ZM2 A;  2UUC I;  4YY3 E;  4DV7 E;  4WUB A;  1BKN A;  3QT6 A;  1I94 E;  2LJP A;  1N36 E;  1OJ4 A;  3LTO A;  2HK3 A;  4X66 E;  4JI2 E;  4USK A;  5GME A;  1ZXN A;  2UXC E;  1Z5A A;  3QT8 A;  1IBM I;  3LNU A;  1Z5C A;  4DXL A;  1I94 I;  1IBK E;  4DR1 I;  2X7I A;  1N36 I;  1HNZ I;  3J81 C;  3K17 A;  1XMO I;  3QT5 A;  2UXD I;  3J7A M;  2UXC I;  4GKJ E;  4NXN I;  2ZBK B;  4DR5 I;  4DPU A;  2UXB E;  2HKE A;  4DV0 I;  4DV6 I;  1XMQ I;  1UEK A;  3PYF A;  4MYT A;  4DR2 E;  4USM A;  1H74 A;  1XNQ I;  1KKH A;  4UTG A;  2BV3 A;  1HR0 E;  1KTV A;  4ED4 A;  1Z0E A;  5LMN I;  4FN5 A;  4DR3 E;  4K0K I;  2UU9 E;  2ZM6 I;  4DR6 I;  2A2D A;  5LL6 R;  3K1J A;  3PYD A;  3ZZU A;  1FJG E;  4NXM I;  2UUA E;  4JI8 E;  1IBL E;  3V5R A;  4DV4 E;  1Z5B A;  2VQE E;  4LF8 E;  1PVG A;  2V34 A;  5LMU I;  4DV2 E;  2VF3 A;  4JYA E;  3GON A;  4PRX A;  2J7K A;  3PYE A;  5BR8 E;  3ZZ0 A;  4DV4 I;  3WU3 A;  4HY1 A;  1HNX I;  4GKK I;  2R3V A;  4JI3 E;  1Z0B A;  1MX0 A;  4AQY E;  4LFC I;  3ZKB A;  2XEX A;  4I3H A;  4DU7 A;  4FW9 A;  4R1F A;  1NHJ A;  2V2V A;  4DV1 I;  4EMD A;  4LF9 E;  1N33 E;  4DV3 E;  1FWL A;  3B82 A;  2UUC E;  5FLX Q;  3J7A G;  4HXZ A;  1KIJ A;  1NHI A;  1IBM E;  2E1R A;  5A2Q C;  1RR9 A;  3WU6 A;  3ZZT A;  1DAR A;  4DR1 E;  4UT4 A;  1HNZ E;  4HAC A;  5IT9 C;  1A6F A;  1XMO E;  4ZVI A;  3HUL A;  1XNR I;  2UXD E;  1K47 A;  2HFS A;  4NXN E;  4RPF A;  2VQF I;  4DR5 E;  4KHP I;  4DV0 E;  4DV6 E;  4X65 I;  1XMQ E;  2EFG A;  3J80 C;  2AJ4 A;  3PYG A;  5IWA I;  3J81 Q;  1XNQ E;  2WW4 A;  4WUC A;  1Z0C A;  5LMN E;  1D6T A;  4K0K E;  1KVK A;  2ZM6 E;  4DPT A;  3JAM C;  4DR6 E;  4FWH A;  1U2R A;  4LF6 I;  4JI5 I; 
#chains in the Genus database with same CATH topology
 5JEA B;  4NXM E;  4HYM A;  4DUY E;  2C37 A;  4YHH I;  2UUB I;  4AM3 A;  2NN6 A;  4JG4 A;  4JI6 E;  4IFD A;  4FWD A;  4BA1 B;  4PU9 A;  4DV5 I;  5JEA F;  1R6M A;  1S4E A;  5LMU E;  1N0U A;  3ZKD A;  2JE6 B;  1PKP A;  3P3C A;  4JI4 I;  2HK2 A;  4X62 I;  4DUY I;  4LFA E;  4LF5 I;  1MU5 A;  2Z5B A;  4JI6 I;  4IS9 A;  1HNX E;  4GKK E;  3PS1 A;  3M85 D;  4LFC E;  2HHH I;  3B8H A;  1HNW I;  1MG7 A;  2VES A;  4LFA I;  4URL A;  2F4V I;  4JI1 I;  3T1Y E;  4DPY A;  3WU5 A;  4JV5 I;  4DV1 E;  4DPX A;  5GMD A;  4MQY A;  1FWK A;  2DEI A;  4OO1 A;  2BM0 A;  2GO3 A;  2WP8 A;  3PS2 A;  3P3E A;  4LFB I;  5K36 A;  4OX9 I;  4FW4 A;  5C0X B;  4P7A A;  4X64 I;  3H4L A;  4DPW A;  5FWK A;  4B3M I;  3T1Y I;  1VIS A;  2BM1 A;  1N32 I;  2BR2 B;  2E5L I;  5JEA E;  4LF4 I;  2PO2 B;  4IFD B;  3L7Z B;  1WUU A;  5C0X D;  1OYS A;  2X36 A;  5DRP A;  3Q1Q A;  1FNM A;  5EL9 A;  2Q2E B;  2JEA B;  4B3R E;  4LCG A;  1B63 A;  2F1D A;  4JI0 I;  1ZM4 A;  3F0N A;  4B3S I;  2HKJ A;  2NN6 F;  4IFD F;  2A2C A;  2Z5B B;  2O1W A;  1XNR E;  1FI4 A;  4B3T I;  3T1H I;  4DUZ I;  5A2Q Q;  2VQF E;  4KHP E;  4B3R I;  1Y4S A;  3U1Y A;  2PNZ A;  4X65 E;  4MU4 A;  5IWA E;  4LF7 I;  5IT9 Q;  4MU0 A;  1ZM3 A;  1Y5Y A;  2IOQ A;  5C0X C;  3CWV A;  5K36 B;  1J5E I;  2GS8 A;  2GQ0 A;  1Z0W A;  3HJC A;  1XHK A;  3GCM A;  4BA2 B;  4LF6 E;  4JI5 E;  4DR7 I;  5DRO A;  2R42 A;  3J80 Q;  3M85 G;  3M6A A;  4Z7Y A;  4OO1 F;  3OTO I;  4ISA A;  1E3P A;  4DR4 I;  4KQV A;  2WNR B;  4OZE A;  4QNK A;  4YHH E;  2UUB E;  5K36 F;  1N34 I;  4DU8 A;  3P06 A;  3JAM Q;  4WUD A;  4FW6 A;  4QNJ A;  4DV5 E;  4JI7 I;  3ZM7 A;  4IFD E;  4YY3 I;  4DV7 I;  4PRV A;  1E3H A;  4JI4 E;  4X62 E;  1ZXM A;  4X66 I;  4JI2 I;  4U3B A;  4LF5 E;  2PO1 A;  1PIE A;  2HFU A;  2AE8 A;  4J3D A;  4MU1 A;  2V2Z A;  1Z0T A;  5JEA D;  5DRQ A;  2HHH E;  1H73 A;  1IBK I;  5L3J A;  1HNW E;  4HAC B;  3DD6 A;  1UDN A;  1RHY A;  2F4V E;  1H7U A;  4MU3 A;  4JI1 E;  2CZ9 A;  4M1K A;  3WU4 A;  4JV5 E;  1FKA E;  3PS3 A;  4GKJ I;  1OYR A;  1XXE A;  4LFB E;  1B62 A;  2UXB I;  4IZJ A;  3K85 A;  4LOM A;  4OX9 E;  4P52 A;  2BA1 G;  4DR2 I;  4FW5 A;  4X64 E;  5K36 E;  2PO0 B;  4AIM A;  1NZ0 A;  1Z59 A;  4B3M E;  1Z0V A;  2C39 A;  1HR0 I;  1N32 E;  1QZR A;  3V2U C;  2E5L E;  4DR3 I;  3NZK A;  2UU9 I;  4LF4 E;  3LPS A;  2J65 A;  2PNM A;  2V2Q A;  2ZIT A;  5JEA C;  4IZK A;  5DRR A;  3D4J A;  4U3D A;  4MYU A;  4JI0 E;  1FJG I;  1H72 C;  4B3S E;  2UUA I;  4JI8 I;  1IBL I;  2C37 B;  2V8P A;  1EI1 A;  2NN6 B;  3KRN A;  4FW7 A;  4Z7C A;  3B4T A;  4B3T E;  2VQE I;  4LF8 I;  1N0V C;  1H7S A;  4LCH A;  1RRE A;  1Z0G A;  3T1H E;  4DUZ E;  4DV2 I;  4JYA I;  2JEB A;  5BR8 I;  2NN6 D;  4IFD D;  4XTJ A;  4LF7 E;  2C38 A;  1ZM9 A;  3B78 A;  2O1T A;  4JI3 I;  2BA1 D;  4N3O A;  4AQY I;  1NHH A;  1ELO A;  4IZJ B;  3GME A;  1J5E E;  5FLX C;  2Z5E A;  3Q6N A;  4DR7 E;  2OI2 A;  2PNL A;  3OTO E;  3QT7 A;  4LF9 I;  1N33 I;  4DV3 I;  4DR4 E;  2NPF A;  1UDS A;  4OO1 B;  1N34 E;  1S16 A;  1P42 A;  2WP8 B;  3H1C A;  3M7N D;  2DEJ A;  2IER A;  4JI7 E;  1EA6 A;  4FWG A;  1ZM2 A;  2UUC I;  4YY3 E;  4DV7 E;  4WUB A;  3P3G A;  1BKN A;  3QT6 A;  2JE6 A;  1I94 E;  2LJP A;  1Y4U A;  2NN6 C;  3PRY A;  2O1U A;  1N36 E;  1OJ4 A;  3LTO A;  4IFD C;  2IOP A;  4OO1 D;  2HK3 A;  4X66 E;  4JI2 E;  4USK A;  1YH8 A;  5K36 D;  5GME A;  1ZXN A;  4FW3 A;  2UXC E;  1Z5A A;  3QT8 A;  1IBM I;  2NN6 E;  3LNU A;  1Z5C A;  5DNX A;  1UDO A;  4DXL A;  2BA0 G;  1R6L A;  1I94 I;  1IBK E;  4DR1 I;  2X7I A;  1N36 I;  1HNZ I;  3J81 C;  3K17 A;  1XMO I;  3U1K A;  3QT5 A;  2UXD I;  2C38 B;  3J7A M;  4AID A;  2UXC I;  4GKJ E;  4NXN I;  2ZBK B;  4DR5 I;  4DPU A;  2UXB E;  5EKW A;  2HKE A;  2PNZ B;  4DV0 I;  4DV6 I;  4GQU A;  3PYF A;  1UEK A;  4MYT A;  1XMQ I;  4DR2 E;  4MDT A;  5C0X A;  1USV A;  4USM A;  1H74 A;  1XNQ I;  1KKH A;  4OO1 C;  4UTG A;  2BV3 A;  1HR0 E;  4NBQ A;  1KTV A;  2BR2 A;  1Z0E A;  4ED4 A;  5LMN I;  4FN5 A;  5K36 C;  4DR3 E;  4K0K I;  2UU9 E;  2ZM6 I;  5ELW A;  2PO2 A;  3L7Z A;  4DR6 I;  4OO1 E;  2A2D A;  5LL6 R;  3K1J A;  3PYD A;  2JEA A;  3ZZU A;  1FJG E;  4NXM I;  2UUA E;  4JI8 E;  1IBL E;  3V5R A;  4DV4 E;  1Z5B A;  2BA0 D;  2VQE E;  4LF8 E;  1PVG A;  2V34 A;  5LMU I;  4DV2 E;  2VF3 A;  4JYA E;  3GON A;  4PRX A;  2J7K A;  3M7N G;  2JT2 A;  3PYE A;  5BR8 E;  2GO4 A;  3HKM A;  3ZZ0 A;  4DV4 I;  2PO1 B;  4LCF A;  3WU3 A;  4HY1 A;  1HNX I;  4GKK I;  2R3V A;  4JI3 E;  1Z0B A;  1MX0 A;  4AQY E;  4LFC I;  3ZKB A;  4LPF A;  3GLL A;  2XEX A;  4I3H A;  4DU7 A;  3CDI A;  4FW9 A;  4BA2 A;  4R1F A;  2Z5C A;  2CG9 A;  1NHJ A;  2V2V A;  4DV1 I;  4EMD A;  4LF9 E;  1N33 E;  4DV3 E;  3CDJ A;  2WNR A;  4OKG A;  5C0X F;  1FWL A;  3B82 A;  2UUC E;  5FLX Q;  3J7A G;  1OYP A;  4HXZ A;  2C39 B;  5JEA A;  3UHM A;  1KIJ A;  1NHI A;  1VI7 A;  2CGE A;  4IZJ D;  1HK7 A;  1USU A;  1Y6Z A;  4BA1 A;  1IBM E;  4IZK B;  2E1R A;  5A2Q C;  1RR9 A;  3WU6 A;  3ZZT A;  1DAR A;  4DR1 E;  4UT4 A;  1HNZ E;  4HAC A;  5IT9 C;  1A6F A;  1XMO E;  3P76 A;  4ZVI A;  3HUL A;  1XNR I;  2UXD E;  1K47 A;  2HFS A;  1Y60 A;  4NXN E;  4RPF A;  2VQF I;  4DR5 E;  4KHP I;  2O3Z A;  2IES A;  2CVE A;  4DV0 E;  2JEB B;  4DV6 E;  4X65 I;  1UDQ A;  1XMQ E;  2EFG A;  3J80 C;  2AJ4 A;  3PYG A;  2Z5C B;  5IWA I;  3J81 Q;  1XNQ E;  2WW4 A;  4WUC A;  2PO0 A;  5C0X E;  1YHC A;  1Z0C A;  5LMN E;  1D6T A;  4K0K E;  1KVK A;  2ZM6 E;  4DPT A;  3JAM C;  4DR6 E;  3Q6M A;  4FWH A;  5DNL A;  2O1V A;  1U2R A;  4LF6 I;  4JI5 I; 
#chains in the Genus database with same CATH homology
 4NXM E;  4HYM A;  4DUY E;  4YHH I;  2UUB I;  4JG4 A;  4JI6 E;  4FWD A;  4PU9 A;  4DV5 I;  1S4E A;  5LMU E;  1N0U A;  3ZKD A;  1PKP A;  4JI4 I;  2HK2 A;  4X62 I;  4DUY I;  4LFA E;  4LF5 I;  1MU5 A;  2Z5B A;  4JI6 I;  1HNX E;  4GKK E;  4LFC E;  2HHH I;  3B8H A;  1HNW I;  1MG7 A;  4LFA I;  4URL A;  2F4V I;  4JI1 I;  3T1Y E;  4DPY A;  3WU5 A;  4JV5 I;  4DV1 E;  4DPX A;  5GMD A;  1FWK A;  2DEI A;  2BM0 A;  4LFB I;  4OX9 I;  4P7A A;  4X64 I;  3H4L A;  4DPW A;  5FWK A;  4B3M I;  3T1Y I;  1VIS A;  2BM1 A;  1N32 I;  2E5L I;  4LF4 I;  1WUU A;  2X36 A;  3Q1Q A;  1FNM A;  2Q2E B;  4B3R E;  1B63 A;  4JI0 I;  1ZM4 A;  3F0N A;  4B3S I;  2HKJ A;  2A2C A;  2Z5B B;  2O1W A;  1XNR E;  1FI4 A;  4B3T I;  3T1H I;  4DUZ I;  5A2Q Q;  2VQF E;  4KHP E;  4B3R I;  1Y4S A;  4X65 E;  5IWA E;  4LF7 I;  5IT9 Q;  1ZM3 A;  2IOQ A;  3CWV A;  1J5E I;  2GS8 A;  2GQ0 A;  1Z0W A;  3HJC A;  1XHK A;  4LF6 E;  4JI5 E;  4DR7 I;  2R42 A;  3J80 Q;  3M6A A;  4Z7Y A;  3OTO I;  4DR4 I;  4KQV A;  4YHH E;  2UUB E;  1N34 I;  4DU8 A;  3P06 A;  3JAM Q;  4WUD A;  4DV5 E;  4JI7 I;  3ZM7 A;  4YY3 I;  4DV7 I;  4PRV A;  4JI4 E;  4X62 E;  1ZXM A;  4X66 I;  4JI2 I;  4LF5 E;  1PIE A;  2HFU A;  2V2Z A;  1Z0T A;  2HHH E;  1H73 A;  1IBK I;  5L3J A;  1HNW E;  4HAC B;  2F4V E;  1H7U A;  4JI1 E;  2CZ9 A;  4M1K A;  3WU4 A;  4JV5 E;  1FKA E;  4GKJ I;  4LFB E;  1B62 A;  2UXB I;  4IZJ A;  3K85 A;  4OX9 E;  4P52 A;  4DR2 I;  4X64 E;  1NZ0 A;  1Z59 A;  4B3M E;  1Z0V A;  1HR0 I;  1N32 E;  1QZR A;  3V2U C;  2E5L E;  4DR3 I;  2UU9 I;  4LF4 E;  3LPS A;  2PNM A;  2V2Q A;  2ZIT A;  4IZK A;  3D4J A;  4MYU A;  4JI0 E;  1FJG I;  1H72 C;  4B3S E;  2UUA I;  4JI8 I;  1IBL I;  2V8P A;  1EI1 A;  4Z7C A;  4B3T E;  2VQE I;  4LF8 I;  1N0V C;  1H7S A;  1RRE A;  1Z0G A;  3T1H E;  4DUZ E;  4DV2 I;  4JYA I;  5BR8 I;  4XTJ A;  4LF7 E;  1ZM9 A;  3B78 A;  2O1T A;  4JI3 I;  4N3O A;  4AQY I;  1NHH A;  1ELO A;  4IZJ B;  1J5E E;  5FLX C;  2Z5E A;  3Q6N A;  4DR7 E;  2OI2 A;  2PNL A;  3OTO E;  3QT7 A;  4LF9 I;  1N33 I;  4DV3 I;  4DR4 E;  2NPF A;  1N34 E;  1S16 A;  2DEJ A;  4JI7 E;  1EA6 A;  4FWG A;  1ZM2 A;  2UUC I;  4YY3 E;  4DV7 E;  4WUB A;  1BKN A;  3QT6 A;  1I94 E;  2LJP A;  1Y4U A;  3PRY A;  2O1U A;  1N36 E;  1OJ4 A;  3LTO A;  2IOP A;  2HK3 A;  4X66 E;  4JI2 E;  4USK A;  5GME A;  1ZXN A;  2UXC E;  1Z5A A;  3QT8 A;  1IBM I;  3LNU A;  1Z5C A;  4DXL A;  1I94 I;  1IBK E;  4DR1 I;  2X7I A;  1N36 I;  1HNZ I;  3J81 C;  3K17 A;  1XMO I;  3QT5 A;  2UXD I;  3J7A M;  2UXC I;  4GKJ E;  4NXN I;  2ZBK B;  4DR5 I;  4DPU A;  2UXB E;  2HKE A;  4DV0 I;  4DV6 I;  1XMQ I;  1UEK A;  3PYF A;  4MYT A;  4DR2 E;  1USV A;  4USM A;  1H74 A;  1XNQ I;  1KKH A;  4UTG A;  2BV3 A;  1HR0 E;  1KTV A;  4ED4 A;  1Z0E A;  5LMN I;  4FN5 A;  4DR3 E;  4K0K I;  2UU9 E;  2ZM6 I;  4DR6 I;  2A2D A;  5LL6 R;  3K1J A;  3PYD A;  3ZZU A;  1FJG E;  4NXM I;  2UUA E;  4JI8 E;  1IBL E;  3V5R A;  4DV4 E;  1Z5B A;  2VQE E;  4LF8 E;  1PVG A;  2V34 A;  5LMU I;  4DV2 E;  2VF3 A;  4JYA E;  3GON A;  4PRX A;  2J7K A;  3PYE A;  5BR8 E;  3ZZ0 A;  4DV4 I;  3WU3 A;  4HY1 A;  1HNX I;  4GKK I;  2R3V A;  4JI3 E;  1Z0B A;  1MX0 A;  4AQY E;  4LFC I;  3ZKB A;  2XEX A;  4I3H A;  4DU7 A;  4FW9 A;  4R1F A;  2Z5C A;  2CG9 A;  1NHJ A;  2V2V A;  4DV1 I;  4EMD A;  4LF9 E;  1N33 E;  4DV3 E;  1FWL A;  3B82 A;  2UUC E;  5FLX Q;  3J7A G;  4HXZ A;  1KIJ A;  1NHI A;  2CGE A;  4IZJ D;  1HK7 A;  1USU A;  1Y6Z A;  1IBM E;  4IZK B;  2E1R A;  5A2Q C;  1RR9 A;  3WU6 A;  3ZZT A;  1DAR A;  4DR1 E;  4UT4 A;  1HNZ E;  4HAC A;  5IT9 C;  1A6F A;  1XMO E;  4ZVI A;  3HUL A;  1XNR I;  2UXD E;  1K47 A;  2HFS A;  4NXN E;  4RPF A;  2VQF I;  4DR5 E;  4KHP I;  4DV0 E;  4DV6 E;  4X65 I;  1XMQ E;  2EFG A;  3J80 C;  2AJ4 A;  3PYG A;  2Z5C B;  5IWA I;  3J81 Q;  1XNQ E;  2WW4 A;  4WUC A;  1Z0C A;  5LMN E;  1D6T A;  4K0K E;  1KVK A;  2ZM6 E;  4DPT A;  3JAM C;  4DR6 E;  3Q6M A;  4FWH A;  2O1V A;  1U2R A;  4LF6 I;  4JI5 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...