2UUBI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uubI00
4X62I 4FWGA 3JAMC 2UUBI 4NXMI 4LF4E 5BR8E 4DPXA 1PIEA 2VQEI 4DUYE 3LNUA 4DV2E 3ZZTA 2HHHI 2R3VA 3GONA 3QT7A 1ELOA 5GMEA 4LF8I 3T1HI 4JI7I 4DPYA 3T1YE 1Z0EA 4WUDA 4DUZI 4DV3I 4JI2E 4HYMA 3B78A 1QZRA 4DR4E 3ZKBA 4Z7YA 1FJGI 3PYEA 1Z0VA 5GMDA 2CZ9A 1IBLE 1B63A 4JG4A 4B3RI 3JAMQ 4JI6I 1IBKI 4DV1I 3J81C 1NHIA 2UUBE 4JI3I 1WUUA 2ZBKB 4B3MI 4DV0I 4JI4I 4LF5E 1DARA 1FWLA 1MG7A 2VQEE 4USMA 1A6FA 1H73A 3J80Q 4JI8I 3B82A 1XNQI 4USKA 1Z5BA 3WU3A 4LFCI 1ZM9A 4LF8E 4JI7E 4HY1A 5LL6R 4DV3E 4X65I 4DR2I 4DR1E 1FJGE 4PU9A 4M1KA 5FLXC 4YY3I 2E5LI 1KIJA 4DR5I 4DU8A 5A2QC 2HK2A 4B3RE 3WU5A 3J81Q 3OTOI 4JI6E 1IBKE 2F4VE 4GKJE 4HXZA 1Z0GA 3F0NA 4JI3E 4B3ME 4LFBI 1PVGA 5IWAE 4NXNI 2HK3A 4JI5E 2VQFE 4JI8E 4JV5I 1HNZE 3ZKDA 1N32I 1HNXE 4K0KI 3QT6A 4LF7E 2XEXA 1HR0I 5A2QQ 3WU4A 1N36E 4DPWA 1EA6A 4X66I 1XMQI 4DR3E 1Z5CA 3PYGA 3OTOE 4YHHI 1IBMI 4Z7CA 1FI4A 2UXBI 1H74A 2V2ZA 3J80C 4OX9I 2V34A 1S4EA 1FWKA 4MYTA 1H7SA 4DV6I 3ZZUA 2BV3A 1N32E 2BM1A 2GS8A 1ZXNA 4WUBA 1N0VC 4HACB 4FW9A 3H4LA 1XMOI 1HR0E 3QT5A 1ZM4A 4FWHA 1UEKA 3QT8A 2HFUA 4X66E 4X62E 1MX0A 4NXME 1J5EI 1D6TA 4DV7I 2X36A 4DV5I 1HNWI 1N33I 2DEIA 2A2DA 4GKKI 5L3JA 1IBME 1N34I 1Z59A 2VF3A 3ZM7A 4MYUA 1KVKA 2HHHE 4OX9E 4XTJA 3K1JA 4KQVA 3T1HE 1I94I 1H7UA 1Z0WA 4FWDA 5LMNI 4DUZE 4DPUA 4DR6I 2E1RA 4HACA 2HFSA 1U2RA 4WUCA 1VISA 2UU9I 1Z0TA 4R1FA 2LJPA 4DV4I 4P52A 1ZXMA 4JI0I 2UUAI 2Q2EB 2WW4A 4DV1E 3WU6A 2UXDI 4ZVIA 1RR9A 4DR7I 1S16A 2AJ4A 4LF9I 3PYFA 1J5EE 4DV0E 4DV5E 4JI4E 1HNWE 4GKKE 3B8HA 1ZM3A 1N34E 2A2CA 3CWVA 1XNQE 4LF4I 4LFCE 3ZZ0A 3LPSA 2EFGA 4LF6I 4DU7A 3PYDA 4DUYI 1PKPA 3Q1QA 2UUCI 4X65E 4DR2E 4YY3E 3J7AM 3M6AA 2E5LE 4DR5E 2UU9E 1NHHA 4URLA 1Z0CA 1NZ0A 2UUAE 1K47A 4PRXA 3V5RA 2UXCI 2UXDE 1IBLI 4LFAI 4LF9E 4LFBE 4UTGA 4NXNE 1FKAE 1MU5A 3HULA 1Z5AA 4JV5E 4K0KE 1B62A 4AQYI 4B3TI 4LF5I 4LF6E 2UUCE 4ED4A 4X64I 5LMUI 4PRVA 4FN5A 1BKNA 1XMQE 3LTOA 4DR1I 1XNRI 1FNMA 3D4JA 2UXCE 4YHHE 5IT9C 1ZM2A 2V8PA 4LFAE 2HKJA 2ZM6I 2UXBE 2V2VA 2OI2A 2ZITA 2F4VI 4GKJI 4DV6E 2DEJA 1NHJA 3V2UC 2R42A 4AQYE 4B3TE 4JI1I 4DXLA 4B3SI 4KHPI 5IWAI 4JI5I 4P7AA 2VQFI 4DPTA 4X64E 4EMDA 1HNZI 5LMUE 1XMOE 1HNXI 2V2QA 2X7IA 4JYAI 4LF7I 5IT9Q 1XNRE 4DV7E 1XHKA 1N33E 1EI1A 1OJ4A 1RREA 1N36I 3K17A 1KTVA 2ZM6E 3J7AG 4DR3I 5BR8I 2BM0A 1I94E 5LMNE 4DV2I 4DR6E 4RPFA 4JI1E 4B3SE 4KHPE 2HKEA 2J7KA 3T1YI 4JI2I 4DV4E 4DR4I 4JI0E 1H72C 2NPFA 4JYAE 4DR7E 1KKHA 5FLXQ 1Z0BA 1N0UA 4UT4A 4I3HA
chains in the Genus database with same CATH superfamily
4IZKB 2BA1D 4X62I 4FWGA 3JAMC 4QNJA 3Q6MA 2UUBI 4NXMI 4LF4E 2BR2A 3P06A 5BR8E 4DPXA 1UDOA 1E3HA 1PIEA 5K36F 2GQ0A 2VQEI 4IS9A 5DRQA 5C0XA 4DUYE 2O1UA 3LNUA 4DV2E 2NN6C 3ZZTA 2NN6E 2HHHI 2R3VA 3GONA 3QT7A 1ELOA 5GMEA 4LF8I 4BA2A 3T1HI 4JI7I 2C38B 4DPYA 3T1YE 2IERA 1Z0EA 4WUDA 4DUZI 4DV3I 4JI2E 4HYMA 3B78A 1QZRA 4U3DA 5C0XD 4DR4E 3ZKBA 4Z7YA 1FJGI 3PYEA 1Z0VA 5GMDA 2CZ9A 1IBLE 2PO2B 4AIMA 2AE8A 1B63A 3CDIA 4JG4A 4B3RI 3JAMQ 4JI6I 4GQUA 1IBKI 4IZKA 4DV1I 4IFDC 3J81C 4OO1B 1NHIA 4MDTA 4IFDE 5EL9A 2UUBE 4JI3I 1WUUA 2ZBKB 4B3MI 4DV0I 4JI4I 4LF5E 1DARA 1FWLA 1MG7A 2Z5BA 3B4TA 4USMA 2VQEE 1A6FA 2PO0B 1H73A 3J80Q 3L7ZB 4JI8I 3B82A 1XNQI 4USKA 1Z5BA 3WU3A 4LFCI 1ZM9A 4LF8E 1UDNA 4JI7E 2C38A 1E3PA 4HY1A 5LL6R 4DV3E 4X65I 3H1CA 4DR2I 4DR1E 1FJGE 2CGEA 4PU9A 4M1KA 5FLXC 4MQYA 4YY3I 4FW5A 2O1VA 2E5LI 1KIJA 4DR5I 4DU8A 5A2QC 4MU4A 2HK2A 4BA1B 5K36C 4B3RE 3WU5A 2NN6A 5K36E 3J81Q 3OTOI 4JI6E 1IBKE 2F4VE 4GKJE 4HXZA 2JEBA 1Z0GA 3F0NA 4JI3E 4B3ME 4LFBI 1Y60A 1PVGA 5IWAE 4NXNI 2HK3A 4JI5E 2NN6D 2VQFE 2PO0A 4JI8E 2IESA 4JV5I 3L7ZA 3ZKDA 1HNZE 1N32I 1HNXE 4K0KI 4IZJA 4LPFA 4FW7A 4MU3A 1RHYA 4QNKA 3QT6A 4LF7E 3UHMA 4IFDA 1HK7A 3HKMA 3M7ND 1Y4UA 2XEXA 1HR0I 5A2QQ 3M7NG 2C39B 3WU4A 1N36E 4DPWA 1EA6A 4IZJD 4X66I 2JEAA 2JE6B 5DRPA 1XMQI 5JEAD 4DR3E 1Z5CA 4J3DA 4MU1A 4BA1A 3PYGA 3OTOE 4YHHI 4IFDD 1IBMI 4Z7CA 1FI4A 2UXBI 1H74A 2JT2A 2V2ZA 3J80C 5ELWA 4OX9I 2V34A 1S4EA 1Y6ZA 1FWKA 4OO1C 4MYTA 1H7SA 4OO1E 4DV6I 3ZZUA 2C37A 2BV3A 1N32E 2BM1A 2GS8A 1ZXNA 2PNZB 4WUBA 1N0VC 5DNLA 4HACB 4FW9A 5K36A 3H4LA 3PS3A 1YH8A 1XMOI 2CVEA 1HR0E 3QT5A 4LCHA 1ZM4A 4FWHA 1UEKA 3QT8A 2HFUA 4X66E 4X62E 2O3ZA 4FW4A 1MX0A 1UDSA 4NXME 5K36D 1J5EI 1D6TA 4DV7I 2X36A 4DV5I 1Y5YA 1HNWI 1N33I 3PS1A 2DEIA 2A2DA 4LCFA 4GKKI 5L3JA 1IBME 1N34I 2VESA 1Z59A 2VF3A 3ZM7A 4MYUA 1KVKA 2HHHE 3HJCA 4OX9E 4XTJA 3K1JA 4KQVA 3T1HE 3DD6A 1I94I 1H7UA 1Z0WA 4FWDA 5LMNI 5DRRA 4OO1F 4DUZE 4DPUA 4DR6I 2E1RA 2Z5CB 4HACA 2HFSA 1U2RA 4WUCA 1VISA 3P3CA 2UU9I 1UDQA 1Z0TA 4R1FA 2LJPA 2PO2A 4LCGA 4DV4I 2WNRB 4P52A 1ZXMA 4JI0I 2UUAI 3KRNA 2Q2EB 2WW4A 4DV1E 3WU6A 1P42A 4ZVIA 1RR9A 4DR7I 2J65A 2UXDI 1S16A 2AJ4A 4OO1A 4LF9I 3PYFA 1J5EE 4DV0E 4DV5E 2Z5EA 4NBQA 4JI4E 1HNWE 1YHCA 4GKKE 3P3GA 3B8HA 1ZM3A 4MU0A 1N34E 2PO1B 2A2CA 3CWVA 2BR2B 1XNQE 4LF4I 4LFCE 3ZZ0A 4OO1D 3LPSA 2EFGA 4LF6I 5C0XB 2O1WA 4DU7A 3PYDA 4DUYI 1PKPA 3Q1QA 2UUCI 3PRYA 4X65E 4DR2E 2IOQA 2WP8B 4BA2B 4AIDA 4YY3E 3J7AM 3M6AA 1XXEA 2E5LE 4DR5E 2UU9E 1NHHA 4URLA 1Z0CA 1Y4SA 1R6MA 1NZ0A 2UUAE 1K47A 2WNRA 4PRXA 3V5RA 2UXCI 2O1TA 2UXDE 1IBLI 4LFAI 4LF9E 4LFBE 4UTGA 4OKGA 4NXNE 3M85D 1FKAE 1MU5A 3HULA 4N3OA 1Z5AA 3U1KA 2PO1A 3M85G 2BA1G 4JV5E 4K0KE 1B62A 3NZKA 4AQYI 2Z5BB 5EKWA 2PNMA 4B3TI 4LF5I 4LF6E 2UUCE 3K85A 4ED4A 4X64I 5FWKA 1OYSA 5LMUI 3PS2A 4PRVA 3GMEA 2WP8A 3GCMA 4FN5A 2C39A 1BKNA 3P3EA 1XMQE 3LTOA 2JE6A 4FW6A 5DROA 4DR1I 1XNRI 1FNMA 3D4JA 2UXCE 4YHHE 5IT9C 1ZM2A 2V8PA 4OZEA 4LFAE 1OYRA 2HKJA 2ZM6I 2UXBE 5JEAC 2NN6B 2V2VA 2OI2A 5JEAE 2PNLA 2ZITA 2F4VI 2JEBB 4GKJI 1VI7A 4ISAA 4FW3A 4DV6E 2DEJA 1NHJA 3V2UC 4LOMA 2R42A 3U1YA 4AQYE 4B3TE 2PNZA 4JI1I 4DXLA 4B3SI 4KHPI 5IWAI 4AM3A 4JI5I 4P7AA 2BA0D 2VQFI 4DPTA 4X64E 4EMDA 2F1DA 1HNZI 5LMUE 3P76A 4IZJB 1XMOE 2NN6F 1HNXI 5C0XC 2BA0G 2GO4A 5C0XE 5JEAB 2V2QA 1USVA 2X7IA 4JYAI 4U3BA 1OYPA 4LF7I 4IFDB 3CDJA 3Q6NA 5IT9Q 1XNRE 4DV7E 1XHKA 1N33E 1EI1A 1R6LA 1OJ4A 2IOPA 2JEAB 1RREA 1N36I 3GLLA 3K17A 1KTVA 2ZM6E 3J7AG 4DR3I 5BR8I 2BM0A 5JEAF 2CG9A 1I94E 1USUA 5LMNE 4DV2I 4IFDF 5DNXA 4DR6E 4RPFA 4JI1E 4B3SE 4KHPE 2HKEA 2J7KA 2Z5CA 3T1YI 2GO3A 2C37B 4JI2I 4DV4E 4DR4I 4JI0E 1H72C 5K36B 2NPFA 5JEAA 5C0XF 4JYAE 4DR7E 1KKHA 5FLXQ 1Z0BA 1N0UA 4UT4A 4I3HA
chains in the Genus database with same CATH topology
4IZKB 4X62I 4FWGA 3JAMC 3Q6MA 2UUBI 4NXMI 4LF4E 3P06A 5BR8E 4DPXA 1PIEA 2GQ0A 2VQEI 4DUYE 2O1UA 3LNUA 4DV2E 3ZZTA 2HHHI 2R3VA 3GONA 3QT7A 1ELOA 5GMEA 4LF8I 3T1HI 4JI7I 4DPYA 3T1YE 1Z0EA 4WUDA 4DUZI 4DV3I 4JI2E 4HYMA 3B78A 1QZRA 4DR4E 3ZKBA 4Z7YA 1FJGI 3PYEA 1Z0VA 5GMDA 2CZ9A 1IBLE 1B63A 4JG4A 4B3RI 3JAMQ 4JI6I 1IBKI 4IZKA 4DV1I 3J81C 1NHIA 2UUBE 4JI3I 1WUUA 2ZBKB 4B3MI 4DV0I 4JI4I 4LF5E 1DARA 1FWLA 1MG7A 2Z5BA 4USMA 2VQEE 1A6FA 1H73A 3J80Q 4JI8I 3B82A 1XNQI 4USKA 1Z5BA 3WU3A 4LFCI 1ZM9A 4LF8E 4JI7E 4HY1A 5LL6R 4DV3E 4X65I 4DR2I 4DR1E 1FJGE 2CGEA 4PU9A 4M1KA 5FLXC 4YY3I 2O1VA 2E5LI 1KIJA 4DR5I 4DU8A 5A2QC 2HK2A 4B3RE 3WU5A 3J81Q 3OTOI 4JI6E 1IBKE 2F4VE 4GKJE 4HXZA 1Z0GA 3F0NA 4JI3E 4B3ME 4LFBI 1PVGA 5IWAE 4NXNI 2HK3A 4JI5E 2VQFE 4JI8E 4JV5I 1HNZE 3ZKDA 1N32I 1HNXE 4K0KI 4IZJA 3QT6A 4LF7E 1HK7A 1Y4UA 2XEXA 1HR0I 5A2QQ 3WU4A 1N36E 4DPWA 1EA6A 4IZJD 4X66I 1XMQI 4DR3E 1Z5CA 3PYGA 3OTOE 4YHHI 1IBMI 4Z7CA 1FI4A 2UXBI 1H74A 2V2ZA 3J80C 4OX9I 2V34A 1S4EA 1Y6ZA 1FWKA 4MYTA 1H7SA 4DV6I 3ZZUA 2BV3A 1N32E 2BM1A 2GS8A 1ZXNA 4WUBA 1N0VC 4HACB 4FW9A 3H4LA 1XMOI 1HR0E 3QT5A 1ZM4A 4FWHA 1UEKA 3QT8A 2HFUA 4X66E 4X62E 1MX0A 4NXME 1J5EI 1D6TA 4DV7I 2X36A 4DV5I 1HNWI 1N33I 2DEIA 2A2DA 4GKKI 5L3JA 1IBME 1N34I 1Z59A 2VF3A 3ZM7A 4MYUA 1KVKA 2HHHE 3HJCA 4OX9E 4XTJA 3K1JA 4KQVA 3T1HE 1I94I 1H7UA 1Z0WA 4FWDA 5LMNI 4DUZE 4DPUA 4DR6I 2E1RA 2Z5CB 4HACA 2HFSA 1U2RA 4WUCA 1VISA 2UU9I 1Z0TA 4R1FA 2LJPA 4DV4I 4P52A 1ZXMA 4JI0I 2UUAI 2Q2EB 2WW4A 4DV1E 3WU6A 2UXDI 4ZVIA 1RR9A 4DR7I 1S16A 2AJ4A 4LF9I 3PYFA 1J5EE 4DV0E 4DV5E 2Z5EA 4JI4E 1HNWE 4GKKE 3B8HA 1ZM3A 1N34E 2A2CA 3CWVA 1XNQE 4LF4I 4LFCE 3ZZ0A 3LPSA 2EFGA 4LF6I 2O1WA 4DU7A 3PYDA 4DUYI 1PKPA 3Q1QA 2UUCI 3PRYA 4X65E 4DR2E 2IOQA 4YY3E 3J7AM 3M6AA 2E5LE 4DR5E 2UU9E 1NHHA 4URLA 1Z0CA 1Y4SA 1NZ0A 2UUAE 1K47A 4PRXA 3V5RA 2UXCI 2O1TA 2UXDE 1IBLI 4LFAI 4LF9E 4LFBE 4UTGA 4NXNE 1FKAE 1MU5A 3HULA 4N3OA 1Z5AA 4JV5E 4K0KE 1B62A 4AQYI 2Z5BB 4B3TI 2PNMA 4LF5I 4LF6E 2UUCE 3K85A 4ED4A 4X64I 5FWKA 5LMUI 4PRVA 4FN5A 1BKNA 1XMQE 3LTOA 4DR1I 1XNRI 1FNMA 3D4JA 2UXCE 4YHHE 5IT9C 1ZM2A 2V8PA 4LFAE 2HKJA 2ZM6I 2UXBE 2V2VA 2OI2A 2PNLA 2ZITA 2F4VI 4GKJI 4DV6E 2DEJA 1NHJA 3V2UC 2R42A 4AQYE 4B3TE 4JI1I 4DXLA 4B3SI 4KHPI 5IWAI 4JI5I 4P7AA 2VQFI 4DPTA 4X64E 4EMDA 1HNZI 5LMUE 4IZJB 1XMOE 1HNXI 2V2QA 1USVA 2X7IA 4JYAI 4LF7I 3Q6NA 5IT9Q 1XNRE 4DV7E 1XHKA 1N33E 1EI1A 1OJ4A 2IOPA 1RREA 1N36I 3K17A 1KTVA 2ZM6E 3J7AG 4DR3I 5BR8I 2BM0A 2CG9A 1I94E 1USUA 5LMNE 4DV2I 4DR6E 4RPFA 4JI1E 4B3SE 4KHPE 2HKEA 2J7KA 2Z5CA 3T1YI 4JI2I 4DV4E 4DR4I 4JI0E 1H72C 2NPFA 4JYAE 4DR7E 1KKHA 5FLXQ 1Z0BA 1N0UA 4UT4A 4I3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 I;  4FWG A;  3JAM C;  2UUB I;  4NXM I;  4LF4 E;  5BR8 E;  4DPX A;  1PIE A;  2VQE I;  4DUY E;  3LNU A;  4DV2 E;  3ZZT A;  2HHH I;  2R3V A;  3GON A;  3QT7 A;  1ELO A;  5GME A;  4LF8 I;  3T1H I;  4JI7 I;  4DPY A;  3T1Y E;  1Z0E A;  4WUD A;  4DUZ I;  4DV3 I;  4JI2 E;  4HYM A;  3B78 A;  1QZR A;  4DR4 E;  3ZKB A;  4Z7Y A;  1FJG I;  3PYE A;  1Z0V A;  5GMD A;  2CZ9 A;  1IBL E;  1B63 A;  4JG4 A;  4B3R I;  3JAM Q;  4JI6 I;  1IBK I;  4DV1 I;  3J81 C;  1NHI A;  2UUB E;  4JI3 I;  1WUU A;  2ZBK B;  4B3M I;  4DV0 I;  4JI4 I;  4LF5 E;  1DAR A;  1FWL A;  1MG7 A;  2VQE E;  4USM A;  1A6F A;  1H73 A;  3J80 Q;  4JI8 I;  3B82 A;  1XNQ I;  4USK A;  1Z5B A;  3WU3 A;  4LFC I;  1ZM9 A;  4LF8 E;  4JI7 E;  4HY1 A;  5LL6 R;  4DV3 E;  4X65 I;  4DR2 I;  4DR1 E;  1FJG E;  4PU9 A;  4M1K A;  5FLX C;  4YY3 I;  2E5L I;  1KIJ A;  4DR5 I;  4DU8 A;  5A2Q C;  2HK2 A;  4B3R E;  3WU5 A;  3J81 Q;  3OTO I;  4JI6 E;  1IBK E;  2F4V E;  4GKJ E;  4HXZ A;  1Z0G A;  3F0N A;  4JI3 E;  4B3M E;  4LFB I;  1PVG A;  5IWA E;  4NXN I;  2HK3 A;  4JI5 E;  2VQF E;  4JI8 E;  4JV5 I;  1HNZ E;  3ZKD A;  1N32 I;  1HNX E;  4K0K I;  3QT6 A;  4LF7 E;  2XEX A;  1HR0 I;  5A2Q Q;  3WU4 A;  1N36 E;  4DPW A;  1EA6 A;  4X66 I;  1XMQ I;  4DR3 E;  1Z5C A;  3PYG A;  3OTO E;  4YHH I;  1IBM I;  4Z7C A;  1FI4 A;  2UXB I;  1H74 A;  2V2Z A;  3J80 C;  4OX9 I;  2V34 A;  1S4E A;  1FWK A;  4MYT A;  1H7S A;  4DV6 I;  3ZZU A;  2BV3 A;  1N32 E;  2BM1 A;  2GS8 A;  1ZXN A;  4WUB A;  1N0V C;  4HAC B;  4FW9 A;  3H4L A;  1XMO I;  1HR0 E;  3QT5 A;  1ZM4 A;  4FWH A;  1UEK A;  3QT8 A;  2HFU A;  4X66 E;  4X62 E;  1MX0 A;  4NXM E;  1J5E I;  1D6T A;  4DV7 I;  2X36 A;  4DV5 I;  1HNW I;  1N33 I;  2DEI A;  2A2D A;  4GKK I;  5L3J A;  1IBM E;  1N34 I;  1Z59 A;  2VF3 A;  3ZM7 A;  4MYU A;  1KVK A;  2HHH E;  4OX9 E;  4XTJ A;  3K1J A;  4KQV A;  3T1H E;  1I94 I;  1H7U A;  1Z0W A;  4FWD A;  5LMN I;  4DUZ E;  4DPU A;  4DR6 I;  2E1R A;  4HAC A;  2HFS A;  1U2R A;  4WUC A;  1VIS A;  2UU9 I;  1Z0T A;  4R1F A;  2LJP A;  4DV4 I;  4P52 A;  1ZXM A;  4JI0 I;  2UUA I;  2Q2E B;  2WW4 A;  4DV1 E;  3WU6 A;  2UXD I;  4ZVI A;  1RR9 A;  4DR7 I;  1S16 A;  2AJ4 A;  4LF9 I;  3PYF A;  1J5E E;  4DV0 E;  4DV5 E;  4JI4 E;  1HNW E;  4GKK E;  3B8H A;  1ZM3 A;  1N34 E;  2A2C A;  3CWV A;  1XNQ E;  4LF4 I;  4LFC E;  3ZZ0 A;  3LPS A;  2EFG A;  4LF6 I;  4DU7 A;  3PYD A;  4DUY I;  1PKP A;  3Q1Q A;  2UUC I;  4X65 E;  4DR2 E;  4YY3 E;  3J7A M;  3M6A A;  2E5L E;  4DR5 E;  2UU9 E;  1NHH A;  4URL A;  1Z0C A;  1NZ0 A;  2UUA E;  1K47 A;  4PRX A;  3V5R A;  2UXC I;  2UXD E;  1IBL I;  4LFA I;  4LF9 E;  4LFB E;  4UTG A;  4NXN E;  1FKA E;  1MU5 A;  3HUL A;  1Z5A A;  4JV5 E;  4K0K E;  1B62 A;  4AQY I;  4B3T I;  4LF5 I;  4LF6 E;  2UUC E;  4ED4 A;  4X64 I;  5LMU I;  4PRV A;  4FN5 A;  1BKN A;  1XMQ E;  3LTO A;  4DR1 I;  1XNR I;  1FNM A;  3D4J A;  2UXC E;  4YHH E;  5IT9 C;  1ZM2 A;  2V8P A;  4LFA E;  2HKJ A;  2ZM6 I;  2UXB E;  2V2V A;  2OI2 A;  2ZIT A;  2F4V I;  4GKJ I;  4DV6 E;  2DEJ A;  1NHJ A;  3V2U C;  2R42 A;  4AQY E;  4B3T E;  4JI1 I;  4DXL A;  4B3S I;  4KHP I;  5IWA I;  4JI5 I;  4P7A A;  2VQF I;  4DPT A;  4X64 E;  4EMD A;  1HNZ I;  5LMU E;  1XMO E;  1HNX I;  2V2Q A;  2X7I A;  4JYA I;  4LF7 I;  5IT9 Q;  1XNR E;  4DV7 E;  1XHK A;  1N33 E;  1EI1 A;  1OJ4 A;  1RRE A;  1N36 I;  3K17 A;  1KTV A;  2ZM6 E;  3J7A G;  4DR3 I;  5BR8 I;  2BM0 A;  1I94 E;  5LMN E;  4DV2 I;  4DR6 E;  4RPF A;  4JI1 E;  4B3S E;  4KHP E;  2HKE A;  2J7K A;  3T1Y I;  4JI2 I;  4DV4 E;  4DR4 I;  4JI0 E;  1H72 C;  2NPF A;  4JYA E;  4DR7 E;  1KKH A;  5FLX Q;  1Z0B A;  1N0U A;  4UT4 A;  4I3H A; 
#chains in the Genus database with same CATH topology
 4IZK B;  2BA1 D;  4X62 I;  4FWG A;  3JAM C;  4QNJ A;  3Q6M A;  2UUB I;  4NXM I;  4LF4 E;  2BR2 A;  3P06 A;  5BR8 E;  4DPX A;  1UDO A;  1E3H A;  1PIE A;  5K36 F;  2GQ0 A;  2VQE I;  4IS9 A;  5DRQ A;  5C0X A;  4DUY E;  2O1U A;  3LNU A;  4DV2 E;  2NN6 C;  3ZZT A;  2NN6 E;  2HHH I;  2R3V A;  3GON A;  3QT7 A;  1ELO A;  5GME A;  4LF8 I;  4BA2 A;  3T1H I;  4JI7 I;  2C38 B;  4DPY A;  3T1Y E;  2IER A;  1Z0E A;  4WUD A;  4DUZ I;  4DV3 I;  4JI2 E;  4HYM A;  3B78 A;  1QZR A;  4U3D A;  5C0X D;  4DR4 E;  3ZKB A;  4Z7Y A;  1FJG I;  3PYE A;  1Z0V A;  5GMD A;  2CZ9 A;  1IBL E;  2PO2 B;  4AIM A;  2AE8 A;  1B63 A;  3CDI A;  4JG4 A;  4B3R I;  3JAM Q;  4JI6 I;  4GQU A;  1IBK I;  4IZK A;  4DV1 I;  4IFD C;  3J81 C;  4OO1 B;  1NHI A;  4MDT A;  4IFD E;  5EL9 A;  2UUB E;  4JI3 I;  1WUU A;  2ZBK B;  4B3M I;  4DV0 I;  4JI4 I;  4LF5 E;  1DAR A;  1FWL A;  1MG7 A;  2Z5B A;  3B4T A;  4USM A;  2VQE E;  1A6F A;  2PO0 B;  1H73 A;  3J80 Q;  3L7Z B;  4JI8 I;  3B82 A;  1XNQ I;  4USK A;  1Z5B A;  3WU3 A;  4LFC I;  1ZM9 A;  4LF8 E;  1UDN A;  4JI7 E;  2C38 A;  1E3P A;  4HY1 A;  5LL6 R;  4DV3 E;  4X65 I;  3H1C A;  4DR2 I;  4DR1 E;  1FJG E;  2CGE A;  4PU9 A;  4M1K A;  5FLX C;  4MQY A;  4YY3 I;  4FW5 A;  2O1V A;  2E5L I;  1KIJ A;  4DR5 I;  4DU8 A;  5A2Q C;  4MU4 A;  2HK2 A;  4BA1 B;  5K36 C;  4B3R E;  3WU5 A;  2NN6 A;  5K36 E;  3J81 Q;  3OTO I;  4JI6 E;  1IBK E;  2F4V E;  4GKJ E;  4HXZ A;  2JEB A;  1Z0G A;  3F0N A;  4JI3 E;  4B3M E;  4LFB I;  1Y60 A;  1PVG A;  5IWA E;  4NXN I;  2HK3 A;  4JI5 E;  2NN6 D;  2VQF E;  2PO0 A;  4JI8 E;  2IES A;  4JV5 I;  3L7Z A;  3ZKD A;  1HNZ E;  1N32 I;  1HNX E;  4K0K I;  4IZJ A;  4LPF A;  4FW7 A;  4MU3 A;  1RHY A;  4QNK A;  3QT6 A;  4LF7 E;  3UHM A;  4IFD A;  1HK7 A;  3HKM A;  3M7N D;  1Y4U A;  2XEX A;  1HR0 I;  5A2Q Q;  3M7N G;  2C39 B;  3WU4 A;  1N36 E;  4DPW A;  1EA6 A;  4IZJ D;  4X66 I;  2JEA A;  2JE6 B;  5DRP A;  1XMQ I;  5JEA D;  4DR3 E;  1Z5C A;  4J3D A;  4MU1 A;  4BA1 A;  3PYG A;  3OTO E;  4YHH I;  4IFD D;  1IBM I;  4Z7C A;  1FI4 A;  2UXB I;  1H74 A;  2JT2 A;  2V2Z A;  3J80 C;  5ELW A;  4OX9 I;  2V34 A;  1S4E A;  1Y6Z A;  1FWK A;  4OO1 C;  4MYT A;  1H7S A;  4OO1 E;  4DV6 I;  3ZZU A;  2C37 A;  2BV3 A;  1N32 E;  2BM1 A;  2GS8 A;  1ZXN A;  2PNZ B;  4WUB A;  1N0V C;  5DNL A;  4HAC B;  4FW9 A;  5K36 A;  3H4L A;  3PS3 A;  1YH8 A;  1XMO I;  2CVE A;  1HR0 E;  3QT5 A;  4LCH A;  1ZM4 A;  4FWH A;  1UEK A;  3QT8 A;  2HFU A;  4X66 E;  4X62 E;  2O3Z A;  4FW4 A;  1MX0 A;  1UDS A;  4NXM E;  5K36 D;  1J5E I;  1D6T A;  4DV7 I;  2X36 A;  4DV5 I;  1Y5Y A;  1HNW I;  1N33 I;  3PS1 A;  2DEI A;  2A2D A;  4LCF A;  4GKK I;  5L3J A;  1IBM E;  1N34 I;  2VES A;  1Z59 A;  2VF3 A;  3ZM7 A;  4MYU A;  1KVK A;  2HHH E;  3HJC A;  4OX9 E;  4XTJ A;  3K1J A;  4KQV A;  3T1H E;  3DD6 A;  1I94 I;  1H7U A;  1Z0W A;  4FWD A;  5LMN I;  5DRR A;  4OO1 F;  4DUZ E;  4DPU A;  4DR6 I;  2E1R A;  2Z5C B;  4HAC A;  2HFS A;  1U2R A;  4WUC A;  1VIS A;  3P3C A;  2UU9 I;  1UDQ A;  1Z0T A;  4R1F A;  2LJP A;  2PO2 A;  4LCG A;  4DV4 I;  2WNR B;  4P52 A;  1ZXM A;  4JI0 I;  2UUA I;  3KRN A;  2Q2E B;  2WW4 A;  4DV1 E;  3WU6 A;  1P42 A;  4ZVI A;  1RR9 A;  4DR7 I;  2J65 A;  2UXD I;  1S16 A;  2AJ4 A;  4OO1 A;  4LF9 I;  3PYF A;  1J5E E;  4DV0 E;  4DV5 E;  2Z5E A;  4NBQ A;  4JI4 E;  1HNW E;  1YHC A;  4GKK E;  3P3G A;  3B8H A;  1ZM3 A;  4MU0 A;  1N34 E;  2PO1 B;  2A2C A;  3CWV A;  2BR2 B;  1XNQ E;  4LF4 I;  4LFC E;  3ZZ0 A;  4OO1 D;  3LPS A;  2EFG A;  4LF6 I;  5C0X B;  2O1W A;  4DU7 A;  3PYD A;  4DUY I;  1PKP A;  3Q1Q A;  2UUC I;  3PRY A;  4X65 E;  4DR2 E;  2IOQ A;  2WP8 B;  4BA2 B;  4AID A;  4YY3 E;  3J7A M;  3M6A A;  1XXE A;  2E5L E;  4DR5 E;  2UU9 E;  1NHH A;  4URL A;  1Z0C A;  1Y4S A;  1R6M A;  1NZ0 A;  2UUA E;  1K47 A;  2WNR A;  4PRX A;  3V5R A;  2UXC I;  2O1T A;  2UXD E;  1IBL I;  4LFA I;  4LF9 E;  4LFB E;  4UTG A;  4OKG A;  4NXN E;  3M85 D;  1FKA E;  1MU5 A;  3HUL A;  4N3O A;  1Z5A A;  3U1K A;  2PO1 A;  3M85 G;  2BA1 G;  4JV5 E;  4K0K E;  1B62 A;  3NZK A;  4AQY I;  2Z5B B;  5EKW A;  2PNM A;  4B3T I;  4LF5 I;  4LF6 E;  2UUC E;  3K85 A;  4ED4 A;  4X64 I;  5FWK A;  1OYS A;  5LMU I;  3PS2 A;  4PRV A;  3GME A;  2WP8 A;  3GCM A;  4FN5 A;  2C39 A;  1BKN A;  3P3E A;  1XMQ E;  3LTO A;  2JE6 A;  4FW6 A;  5DRO A;  4DR1 I;  1XNR I;  1FNM A;  3D4J A;  2UXC E;  4YHH E;  5IT9 C;  1ZM2 A;  2V8P A;  4OZE A;  4LFA E;  1OYR A;  2HKJ A;  2ZM6 I;  2UXB E;  5JEA C;  2NN6 B;  2V2V A;  2OI2 A;  5JEA E;  2PNL A;  2ZIT A;  2F4V I;  2JEB B;  4GKJ I;  1VI7 A;  4ISA A;  4FW3 A;  4DV6 E;  2DEJ A;  1NHJ A;  3V2U C;  4LOM A;  2R42 A;  3U1Y A;  4AQY E;  4B3T E;  2PNZ A;  4JI1 I;  4DXL A;  4B3S I;  4KHP I;  5IWA I;  4AM3 A;  4JI5 I;  4P7A A;  2BA0 D;  2VQF I;  4DPT A;  4X64 E;  4EMD A;  2F1D A;  1HNZ I;  5LMU E;  3P76 A;  4IZJ B;  1XMO E;  2NN6 F;  1HNX I;  5C0X C;  2BA0 G;  2GO4 A;  5C0X E;  5JEA B;  2V2Q A;  1USV A;  2X7I A;  4JYA I;  4U3B A;  1OYP A;  4LF7 I;  4IFD B;  3CDJ A;  3Q6N A;  5IT9 Q;  1XNR E;  4DV7 E;  1XHK A;  1N33 E;  1EI1 A;  1R6L A;  1OJ4 A;  2IOP A;  2JEA B;  1RRE A;  1N36 I;  3GLL A;  3K17 A;  1KTV A;  2ZM6 E;  3J7A G;  4DR3 I;  5BR8 I;  2BM0 A;  5JEA F;  2CG9 A;  1I94 E;  1USU A;  5LMN E;  4DV2 I;  4IFD F;  5DNX A;  4DR6 E;  4RPF A;  4JI1 E;  4B3S E;  4KHP E;  2HKE A;  2J7K A;  2Z5C A;  3T1Y I;  2GO3 A;  2C37 B;  4JI2 I;  4DV4 E;  4DR4 I;  4JI0 E;  1H72 C;  5K36 B;  2NPF A;  5JEA A;  5C0X F;  4JYA E;  4DR7 E;  1KKH A;  5FLX Q;  1Z0B A;  1N0U A;  4UT4 A;  4I3H A; 
#chains in the Genus database with same CATH homology
 4IZK B;  4X62 I;  4FWG A;  3JAM C;  3Q6M A;  2UUB I;  4NXM I;  4LF4 E;  3P06 A;  5BR8 E;  4DPX A;  1PIE A;  2GQ0 A;  2VQE I;  4DUY E;  2O1U A;  3LNU A;  4DV2 E;  3ZZT A;  2HHH I;  2R3V A;  3GON A;  3QT7 A;  1ELO A;  5GME A;  4LF8 I;  3T1H I;  4JI7 I;  4DPY A;  3T1Y E;  1Z0E A;  4WUD A;  4DUZ I;  4DV3 I;  4JI2 E;  4HYM A;  3B78 A;  1QZR A;  4DR4 E;  3ZKB A;  4Z7Y A;  1FJG I;  3PYE A;  1Z0V A;  5GMD A;  2CZ9 A;  1IBL E;  1B63 A;  4JG4 A;  4B3R I;  3JAM Q;  4JI6 I;  1IBK I;  4IZK A;  4DV1 I;  3J81 C;  1NHI A;  2UUB E;  4JI3 I;  1WUU A;  2ZBK B;  4B3M I;  4DV0 I;  4JI4 I;  4LF5 E;  1DAR A;  1FWL A;  1MG7 A;  2Z5B A;  4USM A;  2VQE E;  1A6F A;  1H73 A;  3J80 Q;  4JI8 I;  3B82 A;  1XNQ I;  4USK A;  1Z5B A;  3WU3 A;  4LFC I;  1ZM9 A;  4LF8 E;  4JI7 E;  4HY1 A;  5LL6 R;  4DV3 E;  4X65 I;  4DR2 I;  4DR1 E;  1FJG E;  2CGE A;  4PU9 A;  4M1K A;  5FLX C;  4YY3 I;  2O1V A;  2E5L I;  1KIJ A;  4DR5 I;  4DU8 A;  5A2Q C;  2HK2 A;  4B3R E;  3WU5 A;  3J81 Q;  3OTO I;  4JI6 E;  1IBK E;  2F4V E;  4GKJ E;  4HXZ A;  1Z0G A;  3F0N A;  4JI3 E;  4B3M E;  4LFB I;  1PVG A;  5IWA E;  4NXN I;  2HK3 A;  4JI5 E;  2VQF E;  4JI8 E;  4JV5 I;  1HNZ E;  3ZKD A;  1N32 I;  1HNX E;  4K0K I;  4IZJ A;  3QT6 A;  4LF7 E;  1HK7 A;  1Y4U A;  2XEX A;  1HR0 I;  5A2Q Q;  3WU4 A;  1N36 E;  4DPW A;  1EA6 A;  4IZJ D;  4X66 I;  1XMQ I;  4DR3 E;  1Z5C A;  3PYG A;  3OTO E;  4YHH I;  1IBM I;  4Z7C A;  1FI4 A;  2UXB I;  1H74 A;  2V2Z A;  3J80 C;  4OX9 I;  2V34 A;  1S4E A;  1Y6Z A;  1FWK A;  4MYT A;  1H7S A;  4DV6 I;  3ZZU A;  2BV3 A;  1N32 E;  2BM1 A;  2GS8 A;  1ZXN A;  4WUB A;  1N0V C;  4HAC B;  4FW9 A;  3H4L A;  1XMO I;  1HR0 E;  3QT5 A;  1ZM4 A;  4FWH A;  1UEK A;  3QT8 A;  2HFU A;  4X66 E;  4X62 E;  1MX0 A;  4NXM E;  1J5E I;  1D6T A;  4DV7 I;  2X36 A;  4DV5 I;  1HNW I;  1N33 I;  2DEI A;  2A2D A;  4GKK I;  5L3J A;  1IBM E;  1N34 I;  1Z59 A;  2VF3 A;  3ZM7 A;  4MYU A;  1KVK A;  2HHH E;  3HJC A;  4OX9 E;  4XTJ A;  3K1J A;  4KQV A;  3T1H E;  1I94 I;  1H7U A;  1Z0W A;  4FWD A;  5LMN I;  4DUZ E;  4DPU A;  4DR6 I;  2E1R A;  2Z5C B;  4HAC A;  2HFS A;  1U2R A;  4WUC A;  1VIS A;  2UU9 I;  1Z0T A;  4R1F A;  2LJP A;  4DV4 I;  4P52 A;  1ZXM A;  4JI0 I;  2UUA I;  2Q2E B;  2WW4 A;  4DV1 E;  3WU6 A;  2UXD I;  4ZVI A;  1RR9 A;  4DR7 I;  1S16 A;  2AJ4 A;  4LF9 I;  3PYF A;  1J5E E;  4DV0 E;  4DV5 E;  2Z5E A;  4JI4 E;  1HNW E;  4GKK E;  3B8H A;  1ZM3 A;  1N34 E;  2A2C A;  3CWV A;  1XNQ E;  4LF4 I;  4LFC E;  3ZZ0 A;  3LPS A;  2EFG A;  4LF6 I;  2O1W A;  4DU7 A;  3PYD A;  4DUY I;  1PKP A;  3Q1Q A;  2UUC I;  3PRY A;  4X65 E;  4DR2 E;  2IOQ A;  4YY3 E;  3J7A M;  3M6A A;  2E5L E;  4DR5 E;  2UU9 E;  1NHH A;  4URL A;  1Z0C A;  1Y4S A;  1NZ0 A;  2UUA E;  1K47 A;  4PRX A;  3V5R A;  2UXC I;  2O1T A;  2UXD E;  1IBL I;  4LFA I;  4LF9 E;  4LFB E;  4UTG A;  4NXN E;  1FKA E;  1MU5 A;  3HUL A;  4N3O A;  1Z5A A;  4JV5 E;  4K0K E;  1B62 A;  4AQY I;  2Z5B B;  4B3T I;  2PNM A;  4LF5 I;  4LF6 E;  2UUC E;  3K85 A;  4ED4 A;  4X64 I;  5FWK A;  5LMU I;  4PRV A;  4FN5 A;  1BKN A;  1XMQ E;  3LTO A;  4DR1 I;  1XNR I;  1FNM A;  3D4J A;  2UXC E;  4YHH E;  5IT9 C;  1ZM2 A;  2V8P A;  4LFA E;  2HKJ A;  2ZM6 I;  2UXB E;  2V2V A;  2OI2 A;  2PNL A;  2ZIT A;  2F4V I;  4GKJ I;  4DV6 E;  2DEJ A;  1NHJ A;  3V2U C;  2R42 A;  4AQY E;  4B3T E;  4JI1 I;  4DXL A;  4B3S I;  4KHP I;  5IWA I;  4JI5 I;  4P7A A;  2VQF I;  4DPT A;  4X64 E;  4EMD A;  1HNZ I;  5LMU E;  4IZJ B;  1XMO E;  1HNX I;  2V2Q A;  1USV A;  2X7I A;  4JYA I;  4LF7 I;  3Q6N A;  5IT9 Q;  1XNR E;  4DV7 E;  1XHK A;  1N33 E;  1EI1 A;  1OJ4 A;  2IOP A;  1RRE A;  1N36 I;  3K17 A;  1KTV A;  2ZM6 E;  3J7A G;  4DR3 I;  5BR8 I;  2BM0 A;  2CG9 A;  1I94 E;  1USU A;  5LMN E;  4DV2 I;  4DR6 E;  4RPF A;  4JI1 E;  4B3S E;  4KHP E;  2HKE A;  2J7K A;  2Z5C A;  3T1Y I;  4JI2 I;  4DV4 E;  4DR4 I;  4JI0 E;  1H72 C;  2NPF A;  4JYA E;  4DR7 E;  1KKH A;  5FLX Q;  1Z0B A;  1N0U A;  4UT4 A;  4I3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...