2UUBI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uubI00
2HFSA 4JYAI 3J7AM 4PU9A 1N34E 3M6AA 2UUAE 4DV6E 4GKJI 1XNRE 1K47A 2VQEE 1N32I 1FJGI 3ZKDA 2V34A 4UT4A 4DV2I 1FKAE 1WUUA 3ZZ0A 3B82A 4P52A 2F4VI 4DUYE 5A2QQ 2A2CA 4JYAE 4LF5I 4JI7E 4JI3E 2NPFA 1Z0WA 4NXNI 2UUBI 1RREA 1D6TA 2UXDE 4OX9I 4EMDA 4DR1I 2V2QA 4B3TE 4JI4I 4JI2I 4GKKE 1FWKA 2EFGA 4JI8I 4DR2I 4LF7I 1PVGA 2HHHE 2V2ZA 1I94E 1IBLE 4FWGA 5FLXC 3LPSA 4JI1I 4LFCI 4P7AA 4JI0I 3T1YE 4LF5E 3OTOI 3JAMC 1N0VC 1ZM3A 3LTOA 2UUCI 2UUBE 5IT9Q 4YHHE 4OX9E 4DR1E 4YY3E 4LFAE 4USMA 4WUCA 4DV4E 4Z7CA 1ZM4A 5BR8E 1HNZI 3PYEA 1HR0I 1N33E 4B3ME 4DR7E 1KKHA 1N36I 3WU6A 4DR5E 4XTJA 2ZITA 4I3HA 3T1HI 1H74A 4DV1I 2LJPA 4B3RE 4AQYI 2V8PA 3K1JA 1Z5BA 4X66I 1NHIA 4KHPE 1Z5CA 2VQFI 1ZXNA 1NHHA 4LF8E 2V2VA 1HNWE 1FI4A 2ZM6I 4DV0I 5IWAI 4URLA 2HKJA 2BM0A 4NXMI 1XMQE 4DV7I 4K0KE 3J81C 2DEJA 4DUZE 4RPFA 4B3SI 1A6FA 4HACA 3B8HA 3PYGA 2A2DA 4JI5E 4JV5I 3WU5A 2Q2EB 3ZKBA 4DR6I 2UU9I 4X64I 3QT8A 4GKJE 4NXME 1HNXI 2BM1A 1FJGE 1N32E 2X7IA 3J80Q 4DV2E 2E1RA 4R1FA 4JV5E 2UXBI 1ELOA 4LF9I 2F4VE 4FW9A 1PKPA 2X36A 3PYDA 4Z7YA 4DV5I 4UTGA 3D4JA 4NXNE 1H7SA 3QT7A 4JG4A 4DV3I 1Z0GA 1J5EI 4FN5A 1OJ4A 2ZBKB 4DR3I 4JI6I 1S16A 4JI4E 5A2QC 4ED4A 4JI2E 4LF6I 4JI8E 4DR2E 1XMOI 4LF7E 3V2UC 2J7KA 5LMNI 4JI1E 4LFCE 3CWVA 4JI0E 3OTOE 2UUCE 4LF4I 1BKNA 1ZXMA 5LMUI 3ZM7A 4PRXA 1H72C 4DR4I 1XNQI 1H73A 1N0UA 3WU4A 3QT6A 4DR3E 1Z0TA 1Z5AA 3Q1QA 3F0NA 1IBMI 1HNZE 1HR0E 5IT9C 4HYMA 1N34I 5GMDA 1B62A 1N36E 2UUAI 2XEXA 2VF3A 3WU3A 4HACB 1XNRI 3T1HE 2VQEI 1KIJA 4DV1E 2R42A 4HXZA 4AQYE 4DPTA 4X66E 2HKEA 2DEIA 2R3VA 2VQFE 4DUYI 1ZM2A 1IBKI 1NZ0A 2OI2A 4JI3I 4JI7I 1KTVA 1EI1A 2ZM6E 4LFBI 5FLXQ 4DV0E 2UXDI 3JAMQ 5IWAE 1B63A 5L3JA 4FWDA 4B3TI 1Z59A 4DU8A 3H4LA 4GKKI 4DV7E 2HHHI 4KQVA 1I94I 1IBLI 4B3SE 2GS8A 1MU5A 4USKA 1Z0EA 1Z0VA 3T1YI 1IBKE 3K17A 4LFBE 4DPXA 4DPWA 4YHHI 2BV3A 5GMEA 3GONA 4DR6E 3HULA 2UU9E 4YY3I 4DPYA 1Z0CA 4X64E 4LFAI 1XHKA 4DV4I 4ZVIA 5BR8I 1HNXE 1H7UA 4DU7A 2E5LI 1PIEA 1N33I 4B3MI 4DR7I 1KVKA 1DARA 4X65I 1FNMA 4DR5I 2WW4A 3ZZTA 2UXBE 4LF9E 1MG7A 2CZ9A 2AJ4A 2HK2A 4MYTA 4B3RI 5LL6R 4DV5E 2UXCI 3J80C 4HY1A 4DPUA 4KHPI 4FWHA 1UEKA 4DV3E 1ZM9A 1J5EE 1VISA 2E5LE 1U2RA 3PYFA 4JI6E 4X62I 4LF8I 4DXLA 4X65E 4LF6E 3J81Q 4PRVA 1HNWI 1XMOE 5LMNE 2HK3A 1FWLA 3V5RA 3ZZUA 1Z0BA 3QT5A 1RR9A 4DV6I 3B78A 1QZRA 4LF4E 1XMQI 2UXCE 5LMUE 4DR4E 3LNUA 1XNQE 4K0KI 4WUDA 4DUZI 4M1KA 2HFUA 4MYUA 4JI5I 4X62E 1EA6A 1NHJA 3J7AG 1MX0A 4WUBA 1IBME 1S4EA
chains in the Genus database with same CATH superfamily
2HFSA 2VESA 4JYAI 4OO1C 3J7AM 4PU9A 1N34E 4IFDA 2CG9A 3M6AA 2UUAE 5JEAE 4DV6E 4GKJI 1XNRE 1E3PA 1K47A 2VQEE 1N32I 1FJGI 4FW7A 3UHMA 3ZKDA 2V34A 4FW6A 4UT4A 3K85A 4DV2I 4IZJB 1FKAE 2PNZA 3NZKA 4LOMA 1WUUA 3ZZ0A 2IOQA 3B82A 5DRRA 4P52A 4IFDC 4OO1D 2BA1G 2F4VI 4DUYE 2GO3A 5A2QQ 2Z5EA 2A2CA 3CDIA 4JYAE 5DNXA 4LF5I 4IZJA 4JI7E 2NPFA 1Z0WA 4NXNI 2UUBI 1RREA 4JI3E 5K36D 1D6TA 4MDTA 4AM3A 2UXDE 4OX9I 4EMDA 4DR1I 4IFDD 2V2QA 4B3TE 4JI4I 2O1UA 1OYSA 4JI2I 1UDSA 4GKKE 1FWKA 2EFGA 1Y5YA 4JI8I 4DR2I 4LF7I 5C0XF 1PVGA 2HHHE 4MU0A 2V2ZA 1I94E 3HKMA 1IBLE 4FWGA 5FLXC 3LPSA 4JI1I 4LFCI 4P7AA 2O1VA 2GQ0A 2O3ZA 1UDOA 4JI0I 3T1YE 4LF5E 3OTOI 3JAMC 1N0VC 1ZM3A 3LTOA 2UUCI 4OO1E 2UUBE 5IT9Q 4YHHE 2JT2A 4OX9E 2JEBA 4DR1E 4YY3E 4IZJD 4LFAE 4USMA 2BA0D 2C39B 4WUCA 3M7ND 2J65A 4DV4E 5K36E 4BA1A 4Z7CA 1ZM4A 5BR8E 2PO2A 4U3DA 4QNKA 1HNZI 3L7ZB 3PYEA 4IZKB 1HR0I 1N33E 5DROA 4B3ME 4DR7E 4IFDE 1KKHA 5DNLA 4MQYA 1N36I 3WU6A 4DR5E 2Z5CB 4XTJA 2Z5BB 2ZITA 4I3HA 3T1HI 3PRYA 1H74A 4DV1I 3L7ZA 2LJPA 4B3RE 4AQYI 2BA0G 5EKWA 3M7NG 2V8PA 3U1KA 3K1JA 1Z5BA 4X66I 1VI7A 1NHIA 2PNMA 4KHPE 1Y4SA 1Z5CA 2Z5CA 2VQFI 1ZXNA 3KRNA 1NHHA 4LF8E 3PS2A 2V2VA 2BA1D 1HNWE 3H1CA 1FI4A 2ZM6I 4DV0I 4OO1F 2PNZB 5IWAI 3M85G 4URLA 2HKJA 2BM0A 4NXMI 1XMQE 5K36F 2IERA 4DV7I 4K0KE 3J81C 2DEJA 4DUZE 4RPFA 4B3SI 1A6FA 4HACA 2C37A 3B8HA 3PYGA 2A2DA 4JI5E 4GQUA 4JV5I 1Y60A 3WU5A 2Q2EB 3GLLA 5FWKA 4LCFA 2JEAB 3ZKBA 4DR6I 2NN6F 2UU9I 4X64I 3P06A 3CDJA 3QT8A 1OYPA 4GKJE 4NXME 2IOPA 1HNXI 2BM1A 1FJGE 1N32E 2X7IA 3J80Q 4DV2E 2JEAA 2E1RA 3P3EA 4R1FA 4JV5E 4MU4A 2JEBB 2UXBI 1ELOA 4LF9I 4AIDA 4FW9A 2F4VE 1PKPA 2X36A 3PYDA 4BA1B 5C0XA 2BR2A 4IS9A 2CGEA 4Z7YA 2PO2B 4MU3A 4DV5I 4UTGA 3D4JA 4NXNE 1H7SA 5JEAF 3QT7A 4JG4A 1Z0GA 4DV3I 1J5EI 4FN5A 1OJ4A 2ZBKB 4DR3I 4JI6I 4ISAA 1S16A 4JI4E 5A2QC 2C38A 4ED4A 4JI2E 4LF6I 4JI8E 4DR2E 1XMOI 4LF7E 3V2UC 2J7KA 5LMNI 1UDNA 3PS3A 4JI1E 4LFCE 3CWVA 4BA2A 5ELWA 3GMEA 4JI0E 3OTOE 2UUCE 4LF4I 1BKNA 1ZXMA 5LMUI 3ZM7A 4PRXA 1H72C 4DR4I 1XNQI 1H73A 1N0UA 3M85D 3WU4A 3P3GA 1E3HA 4AIMA 3QT6A 4DR3E 2O1TA 1Z0TA 1Z5AA 3Q1QA 3F0NA 1IBMI 1HNZE 2IESA 1HR0E 1Y6ZA 5IT9C 3HJCA 4HYMA 4NBQA 4LCGA 3B4TA 1N34I 5GMDA 1B62A 1OYRA 1N36E 1R6LA 2UUAI 2XEXA 2VF3A 3WU3A 4HACB 1XNRI 2C37B 5K36B 3T1HE 2VQEI 1KIJA 4DV1E 2R42A 4HXZA 4OO1A 2F1DA 4AQYE 4OZEA 4DPTA 4X66E 2HKEA 2DEIA 2R3VA 4FW5A 2VQFE 5K36A 2PO0A 4DUYI 4IFDF 2NN6B 1ZM2A 1IBKI 1RHYA 1NZ0A 1R6MA 2OI2A 4JI3I 4JI7I 1KTVA 1EI1A 2ZM6E 4LFBI 5FLXQ 4DV0E 2UXDI 1USUA 5EL9A 5DRPA 5K36C 3JAMQ 5IWAE 1B63A 5L3JA 4FWDA 4FW3A 2NN6A 4FW4A 4B3TI 2CVEA 1Z59A 4DU8A 3H4LA 4GKKI 5C0XB 1Y4UA 4DV7E 2BR2B 2HHHI 3P76A 1P42A 4KQVA 1I94I 4OKGA 1IBLI 4B3SE 2GS8A 2WNRB 3Q6NA 1MU5A 4LPFA 4USKA 1Z0EA 1Z0VA 3T1YI 1IBKE 2NN6C 2JE6B 5JEAB 3K17A 4LFBE 4DPXA 4DPWA 4YHHI 2BV3A 2C38B 5GMEA 3GONA 4DR6E 3DD6A 3HULA 2UU9E 4YY3I 4DPYA 1Z0CA 4X64E 1XXEA 4LFAI 2WNRA 2WP8B 1XHKA 4DV4I 4ZVIA 5BR8I 1HNXE 1H7UA 4DU7A 4BA2B 2E5LI 5JEAA 1PIEA 2JE6A 4MU1A 1N33I 5C0XC 4B3MI 1KVKA 2O1WA 4DR7I 1DARA 2NN6D 2PO1B 4X65I 1FNMA 4DR5I 2WP8A 2WW4A 3ZZTA 2UXBE 4LF9E 1USVA 3U1YA 1MG7A 1YH8A 2CZ9A 2AJ4A 5JEAC 2PNLA 2HK2A 4MYTA 5DRQA 4B3RI 5LL6R 4DV5E 3PS1A 2PO1A 2UXCI 3J80C 4HY1A 5C0XD 4DPUA 4LCHA 4KHPI 4FWHA 1UEKA 4DV3E 1ZM9A 2AE8A 1J5EE 1VISA 2E5LE 1U2RA 3PYFA 3P3CA 4JI6E 4X62I 4LF8I 4DXLA 2GO4A 4U3BA 4X65E 4LF6E 3J81Q 4PRVA 3Q6MA 5JEAD 1UDQA 1HNWI 2C39A 1XMOE 4OO1B 5LMNE 2HK3A 1FWLA 2NN6E 3V5RA 3ZZUA 1Z0BA 3QT5A 1RR9A 4IZKA 4DV6I 3B78A 2PO0B 1QZRA 4LF4E 1XMQI 2UXCE 5LMUE 4DR4E 3LNUA 1XNQE 4K0KI 4WUDA 4DUZI 2Z5BA 4QNJA 3GCMA 4J3DA 4M1KA 4IFDB 4N3OA 2HFUA 4MYUA 4JI5I 4X62E 1HK7A 1EA6A 5C0XE 1NHJA 3J7AG 1YHCA 1MX0A 4WUBA 1IBME 1S4EA
chains in the Genus database with same CATH topology
2HFSA 4JYAI 3J7AM 4PU9A 1N34E 2CG9A 3M6AA 2UUAE 4DV6E 4GKJI 1XNRE 1K47A 2VQEE 1N32I 1FJGI 3ZKDA 2V34A 4UT4A 3K85A 4DV2I 4IZJB 1FKAE 1WUUA 3ZZ0A 2IOQA 3B82A 4P52A 2F4VI 4DUYE 5A2QQ 2Z5EA 2A2CA 4JYAE 4LF5I 4IZJA 4JI7E 2NPFA 1Z0WA 4NXNI 2UUBI 1RREA 4JI3E 1D6TA 2UXDE 4OX9I 4EMDA 4DR1I 2V2QA 4B3TE 4JI4I 2O1UA 4JI2I 4GKKE 1FWKA 2EFGA 4JI8I 4DR2I 4LF7I 1PVGA 2HHHE 2V2ZA 1I94E 1IBLE 4FWGA 5FLXC 3LPSA 4JI1I 4LFCI 4P7AA 2O1VA 2GQ0A 4JI0I 3T1YE 4LF5E 3OTOI 3JAMC 1N0VC 1ZM3A 3LTOA 2UUCI 2UUBE 5IT9Q 4YHHE 4OX9E 4DR1E 4YY3E 4IZJD 4LFAE 4USMA 4WUCA 4DV4E 4Z7CA 1ZM4A 5BR8E 1HNZI 3PYEA 4IZKB 1HR0I 1N33E 4B3ME 4DR7E 1KKHA 1N36I 3WU6A 4DR5E 2Z5CB 4XTJA 2Z5BB 2ZITA 4I3HA 3T1HI 3PRYA 1H74A 4DV1I 2LJPA 4B3RE 4AQYI 2V8PA 3K1JA 1Z5BA 4X66I 1NHIA 2PNMA 4KHPE 1Y4SA 1Z5CA 2Z5CA 2VQFI 1ZXNA 1NHHA 4LF8E 2V2VA 1HNWE 1FI4A 2ZM6I 4DV0I 5IWAI 4URLA 2HKJA 2BM0A 4NXMI 1XMQE 4DV7I 4K0KE 3J81C 2DEJA 4DUZE 4RPFA 4B3SI 1A6FA 4HACA 3B8HA 3PYGA 2A2DA 4JI5E 4JV5I 3WU5A 2Q2EB 5FWKA 3ZKBA 4DR6I 2UU9I 4X64I 3P06A 3QT8A 4GKJE 4NXME 2IOPA 1HNXI 2BM1A 1FJGE 1N32E 2X7IA 3J80Q 4DV2E 2E1RA 4R1FA 4JV5E 2UXBI 1ELOA 4LF9I 2F4VE 4FW9A 1PKPA 2X36A 3PYDA 2CGEA 4Z7YA 4DV5I 4UTGA 3D4JA 4NXNE 1H7SA 3QT7A 4JG4A 4DV3I 1Z0GA 1J5EI 4FN5A 1OJ4A 2ZBKB 4DR3I 4JI6I 1S16A 4JI4E 5A2QC 4ED4A 4JI2E 4LF6I 4JI8E 4DR2E 1XMOI 4LF7E 3V2UC 2J7KA 5LMNI 4JI1E 4LFCE 3CWVA 4JI0E 3OTOE 2UUCE 4LF4I 1BKNA 1ZXMA 5LMUI 3ZM7A 4PRXA 1H72C 4DR4I 1XNQI 1H73A 1N0UA 3WU4A 3QT6A 4DR3E 2O1TA 1Z0TA 1Z5AA 3Q1QA 3F0NA 1IBMI 1HNZE 1HR0E 1Y6ZA 5IT9C 3HJCA 4HYMA 1N34I 5GMDA 1B62A 1N36E 2UUAI 2XEXA 2VF3A 3WU3A 4HACB 1XNRI 3T1HE 2VQEI 1KIJA 4DV1E 2R42A 4HXZA 4AQYE 4DPTA 4X66E 2HKEA 2DEIA 2R3VA 2VQFE 4DUYI 1ZM2A 1IBKI 1NZ0A 2OI2A 4JI3I 4JI7I 1KTVA 1EI1A 2ZM6E 4LFBI 5FLXQ 4DV0E 2UXDI 1USUA 3JAMQ 5IWAE 1B63A 5L3JA 4FWDA 4B3TI 1Z59A 4DU8A 3H4LA 4GKKI 1Y4UA 4DV7E 2HHHI 4KQVA 1I94I 1IBLI 4B3SE 2GS8A 3Q6NA 1MU5A 4USKA 1Z0EA 1Z0VA 3T1YI 1IBKE 3K17A 4LFBE 4DPXA 4DPWA 4YHHI 2BV3A 5GMEA 3GONA 4DR6E 3HULA 2UU9E 4YY3I 4DPYA 1Z0CA 4X64E 4LFAI 1XHKA 4DV4I 4ZVIA 5BR8I 1HNXE 1H7UA 4DU7A 2E5LI 1PIEA 1N33I 4B3MI 4DR7I 1KVKA 2O1WA 1DARA 4X65I 1FNMA 4DR5I 2WW4A 3ZZTA 2UXBE 4LF9E 1USVA 1MG7A 2CZ9A 2AJ4A 2PNLA 2HK2A 4MYTA 4B3RI 5LL6R 4DV5E 2UXCI 3J80C 4HY1A 4DPUA 4KHPI 4FWHA 1UEKA 4DV3E 1ZM9A 1J5EE 1VISA 2E5LE 1U2RA 3PYFA 4JI6E 4X62I 4LF8I 4DXLA 4X65E 4LF6E 3J81Q 4PRVA 3Q6MA 1HNWI 1XMOE 5LMNE 2HK3A 1FWLA 3V5RA 3ZZUA 1Z0BA 3QT5A 1RR9A 4IZKA 4DV6I 3B78A 1QZRA 4LF4E 1XMQI 2UXCE 5LMUE 4DR4E 3LNUA 1XNQE 4K0KI 4WUDA 4DUZI 2Z5BA 4M1KA 4N3OA 2HFUA 4MYUA 4JI5I 4X62E 1HK7A 1EA6A 1NHJA 3J7AG 1MX0A 4WUBA 1IBME 1S4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFS A;  4JYA I;  3J7A M;  4PU9 A;  1N34 E;  3M6A A;  2UUA E;  4DV6 E;  4GKJ I;  1XNR E;  1K47 A;  2VQE E;  1N32 I;  1FJG I;  3ZKD A;  2V34 A;  4UT4 A;  4DV2 I;  1FKA E;  1WUU A;  3ZZ0 A;  3B82 A;  4P52 A;  2F4V I;  4DUY E;  5A2Q Q;  2A2C A;  4JYA E;  4LF5 I;  4JI7 E;  4JI3 E;  2NPF A;  1Z0W A;  4NXN I;  2UUB I;  1RRE A;  1D6T A;  2UXD E;  4OX9 I;  4EMD A;  4DR1 I;  2V2Q A;  4B3T E;  4JI4 I;  4JI2 I;  4GKK E;  1FWK A;  2EFG A;  4JI8 I;  4DR2 I;  4LF7 I;  1PVG A;  2HHH E;  2V2Z A;  1I94 E;  1IBL E;  4FWG A;  5FLX C;  3LPS A;  4JI1 I;  4LFC I;  4P7A A;  4JI0 I;  3T1Y E;  4LF5 E;  3OTO I;  3JAM C;  1N0V C;  1ZM3 A;  3LTO A;  2UUC I;  2UUB E;  5IT9 Q;  4YHH E;  4OX9 E;  4DR1 E;  4YY3 E;  4LFA E;  4USM A;  4WUC A;  4DV4 E;  4Z7C A;  1ZM4 A;  5BR8 E;  1HNZ I;  3PYE A;  1HR0 I;  1N33 E;  4B3M E;  4DR7 E;  1KKH A;  1N36 I;  3WU6 A;  4DR5 E;  4XTJ A;  2ZIT A;  4I3H A;  3T1H I;  1H74 A;  4DV1 I;  2LJP A;  4B3R E;  4AQY I;  2V8P A;  3K1J A;  1Z5B A;  4X66 I;  1NHI A;  4KHP E;  1Z5C A;  2VQF I;  1ZXN A;  1NHH A;  4LF8 E;  2V2V A;  1HNW E;  1FI4 A;  2ZM6 I;  4DV0 I;  5IWA I;  4URL A;  2HKJ A;  2BM0 A;  4NXM I;  1XMQ E;  4DV7 I;  4K0K E;  3J81 C;  2DEJ A;  4DUZ E;  4RPF A;  4B3S I;  1A6F A;  4HAC A;  3B8H A;  3PYG A;  2A2D A;  4JI5 E;  4JV5 I;  3WU5 A;  2Q2E B;  3ZKB A;  4DR6 I;  2UU9 I;  4X64 I;  3QT8 A;  4GKJ E;  4NXM E;  1HNX I;  2BM1 A;  1FJG E;  1N32 E;  2X7I A;  3J80 Q;  4DV2 E;  2E1R A;  4R1F A;  4JV5 E;  2UXB I;  1ELO A;  4LF9 I;  2F4V E;  4FW9 A;  1PKP A;  2X36 A;  3PYD A;  4Z7Y A;  4DV5 I;  4UTG A;  3D4J A;  4NXN E;  1H7S A;  3QT7 A;  4JG4 A;  4DV3 I;  1Z0G A;  1J5E I;  4FN5 A;  1OJ4 A;  2ZBK B;  4DR3 I;  4JI6 I;  1S16 A;  4JI4 E;  5A2Q C;  4ED4 A;  4JI2 E;  4LF6 I;  4JI8 E;  4DR2 E;  1XMO I;  4LF7 E;  3V2U C;  2J7K A;  5LMN I;  4JI1 E;  4LFC E;  3CWV A;  4JI0 E;  3OTO E;  2UUC E;  4LF4 I;  1BKN A;  1ZXM A;  5LMU I;  3ZM7 A;  4PRX A;  1H72 C;  4DR4 I;  1XNQ I;  1H73 A;  1N0U A;  3WU4 A;  3QT6 A;  4DR3 E;  1Z0T A;  1Z5A A;  3Q1Q A;  3F0N A;  1IBM I;  1HNZ E;  1HR0 E;  5IT9 C;  4HYM A;  1N34 I;  5GMD A;  1B62 A;  1N36 E;  2UUA I;  2XEX A;  2VF3 A;  3WU3 A;  4HAC B;  1XNR I;  3T1H E;  2VQE I;  1KIJ A;  4DV1 E;  2R42 A;  4HXZ A;  4AQY E;  4DPT A;  4X66 E;  2HKE A;  2DEI A;  2R3V A;  2VQF E;  4DUY I;  1ZM2 A;  1IBK I;  1NZ0 A;  2OI2 A;  4JI3 I;  4JI7 I;  1KTV A;  1EI1 A;  2ZM6 E;  4LFB I;  5FLX Q;  4DV0 E;  2UXD I;  3JAM Q;  5IWA E;  1B63 A;  5L3J A;  4FWD A;  4B3T I;  1Z59 A;  4DU8 A;  3H4L A;  4GKK I;  4DV7 E;  2HHH I;  4KQV A;  1I94 I;  1IBL I;  4B3S E;  2GS8 A;  1MU5 A;  4USK A;  1Z0E A;  1Z0V A;  3T1Y I;  1IBK E;  3K17 A;  4LFB E;  4DPX A;  4DPW A;  4YHH I;  2BV3 A;  5GME A;  3GON A;  4DR6 E;  3HUL A;  2UU9 E;  4YY3 I;  4DPY A;  1Z0C A;  4X64 E;  4LFA I;  1XHK A;  4DV4 I;  4ZVI A;  5BR8 I;  1HNX E;  1H7U A;  4DU7 A;  2E5L I;  1PIE A;  1N33 I;  4B3M I;  4DR7 I;  1KVK A;  1DAR A;  4X65 I;  1FNM A;  4DR5 I;  2WW4 A;  3ZZT A;  2UXB E;  4LF9 E;  1MG7 A;  2CZ9 A;  2AJ4 A;  2HK2 A;  4MYT A;  4B3R I;  5LL6 R;  4DV5 E;  2UXC I;  3J80 C;  4HY1 A;  4DPU A;  4KHP I;  4FWH A;  1UEK A;  4DV3 E;  1ZM9 A;  1J5E E;  1VIS A;  2E5L E;  1U2R A;  3PYF A;  4JI6 E;  4X62 I;  4LF8 I;  4DXL A;  4X65 E;  4LF6 E;  3J81 Q;  4PRV A;  1HNW I;  1XMO E;  5LMN E;  2HK3 A;  1FWL A;  3V5R A;  3ZZU A;  1Z0B A;  3QT5 A;  1RR9 A;  4DV6 I;  3B78 A;  1QZR A;  4LF4 E;  1XMQ I;  2UXC E;  5LMU E;  4DR4 E;  3LNU A;  1XNQ E;  4K0K I;  4WUD A;  4DUZ I;  4M1K A;  2HFU A;  4MYU A;  4JI5 I;  4X62 E;  1EA6 A;  1NHJ A;  3J7A G;  1MX0 A;  4WUB A;  1IBM E;  1S4E A; 
#chains in the Genus database with same CATH topology
 2HFS A;  2VES A;  4JYA I;  4OO1 C;  3J7A M;  4PU9 A;  1N34 E;  4IFD A;  2CG9 A;  3M6A A;  2UUA E;  5JEA E;  4DV6 E;  4GKJ I;  1XNR E;  1E3P A;  1K47 A;  2VQE E;  1N32 I;  1FJG I;  4FW7 A;  3UHM A;  3ZKD A;  2V34 A;  4FW6 A;  4UT4 A;  3K85 A;  4DV2 I;  4IZJ B;  1FKA E;  2PNZ A;  3NZK A;  4LOM A;  1WUU A;  3ZZ0 A;  2IOQ A;  3B82 A;  5DRR A;  4P52 A;  4IFD C;  4OO1 D;  2BA1 G;  2F4V I;  4DUY E;  2GO3 A;  5A2Q Q;  2Z5E A;  2A2C A;  3CDI A;  4JYA E;  5DNX A;  4LF5 I;  4IZJ A;  4JI7 E;  2NPF A;  1Z0W A;  4NXN I;  2UUB I;  1RRE A;  4JI3 E;  5K36 D;  1D6T A;  4MDT A;  4AM3 A;  2UXD E;  4OX9 I;  4EMD A;  4DR1 I;  4IFD D;  2V2Q A;  4B3T E;  4JI4 I;  2O1U A;  1OYS A;  4JI2 I;  1UDS A;  4GKK E;  1FWK A;  2EFG A;  1Y5Y A;  4JI8 I;  4DR2 I;  4LF7 I;  5C0X F;  1PVG A;  2HHH E;  4MU0 A;  2V2Z A;  1I94 E;  3HKM A;  1IBL E;  4FWG A;  5FLX C;  3LPS A;  4JI1 I;  4LFC I;  4P7A A;  2O1V A;  2GQ0 A;  2O3Z A;  1UDO A;  4JI0 I;  3T1Y E;  4LF5 E;  3OTO I;  3JAM C;  1N0V C;  1ZM3 A;  3LTO A;  2UUC I;  4OO1 E;  2UUB E;  5IT9 Q;  4YHH E;  2JT2 A;  4OX9 E;  2JEB A;  4DR1 E;  4YY3 E;  4IZJ D;  4LFA E;  4USM A;  2BA0 D;  2C39 B;  4WUC A;  3M7N D;  2J65 A;  4DV4 E;  5K36 E;  4BA1 A;  4Z7C A;  1ZM4 A;  5BR8 E;  2PO2 A;  4U3D A;  4QNK A;  1HNZ I;  3L7Z B;  3PYE A;  4IZK B;  1HR0 I;  1N33 E;  5DRO A;  4B3M E;  4DR7 E;  4IFD E;  1KKH A;  5DNL A;  4MQY A;  1N36 I;  3WU6 A;  4DR5 E;  2Z5C B;  4XTJ A;  2Z5B B;  2ZIT A;  4I3H A;  3T1H I;  3PRY A;  1H74 A;  4DV1 I;  3L7Z A;  2LJP A;  4B3R E;  4AQY I;  2BA0 G;  5EKW A;  3M7N G;  2V8P A;  3U1K A;  3K1J A;  1Z5B A;  4X66 I;  1VI7 A;  1NHI A;  2PNM A;  4KHP E;  1Y4S A;  1Z5C A;  2Z5C A;  2VQF I;  1ZXN A;  3KRN A;  1NHH A;  4LF8 E;  3PS2 A;  2V2V A;  2BA1 D;  1HNW E;  3H1C A;  1FI4 A;  2ZM6 I;  4DV0 I;  4OO1 F;  2PNZ B;  5IWA I;  3M85 G;  4URL A;  2HKJ A;  2BM0 A;  4NXM I;  1XMQ E;  5K36 F;  2IER A;  4DV7 I;  4K0K E;  3J81 C;  2DEJ A;  4DUZ E;  4RPF A;  4B3S I;  1A6F A;  4HAC A;  2C37 A;  3B8H A;  3PYG A;  2A2D A;  4JI5 E;  4GQU A;  4JV5 I;  1Y60 A;  3WU5 A;  2Q2E B;  3GLL A;  5FWK A;  4LCF A;  2JEA B;  3ZKB A;  4DR6 I;  2NN6 F;  2UU9 I;  4X64 I;  3P06 A;  3CDJ A;  3QT8 A;  1OYP A;  4GKJ E;  4NXM E;  2IOP A;  1HNX I;  2BM1 A;  1FJG E;  1N32 E;  2X7I A;  3J80 Q;  4DV2 E;  2JEA A;  2E1R A;  3P3E A;  4R1F A;  4JV5 E;  4MU4 A;  2JEB B;  2UXB I;  1ELO A;  4LF9 I;  4AID A;  4FW9 A;  2F4V E;  1PKP A;  2X36 A;  3PYD A;  4BA1 B;  5C0X A;  2BR2 A;  4IS9 A;  2CGE A;  4Z7Y A;  2PO2 B;  4MU3 A;  4DV5 I;  4UTG A;  3D4J A;  4NXN E;  1H7S A;  5JEA F;  3QT7 A;  4JG4 A;  1Z0G A;  4DV3 I;  1J5E I;  4FN5 A;  1OJ4 A;  2ZBK B;  4DR3 I;  4JI6 I;  4ISA A;  1S16 A;  4JI4 E;  5A2Q C;  2C38 A;  4ED4 A;  4JI2 E;  4LF6 I;  4JI8 E;  4DR2 E;  1XMO I;  4LF7 E;  3V2U C;  2J7K A;  5LMN I;  1UDN A;  3PS3 A;  4JI1 E;  4LFC E;  3CWV A;  4BA2 A;  5ELW A;  3GME A;  4JI0 E;  3OTO E;  2UUC E;  4LF4 I;  1BKN A;  1ZXM A;  5LMU I;  3ZM7 A;  4PRX A;  1H72 C;  4DR4 I;  1XNQ I;  1H73 A;  1N0U A;  3M85 D;  3WU4 A;  3P3G A;  1E3H A;  4AIM A;  3QT6 A;  4DR3 E;  2O1T A;  1Z0T A;  1Z5A A;  3Q1Q A;  3F0N A;  1IBM I;  1HNZ E;  2IES A;  1HR0 E;  1Y6Z A;  5IT9 C;  3HJC A;  4HYM A;  4NBQ A;  4LCG A;  3B4T A;  1N34 I;  5GMD A;  1B62 A;  1OYR A;  1N36 E;  1R6L A;  2UUA I;  2XEX A;  2VF3 A;  3WU3 A;  4HAC B;  1XNR I;  2C37 B;  5K36 B;  3T1H E;  2VQE I;  1KIJ A;  4DV1 E;  2R42 A;  4HXZ A;  4OO1 A;  2F1D A;  4AQY E;  4OZE A;  4DPT A;  4X66 E;  2HKE A;  2DEI A;  2R3V A;  4FW5 A;  2VQF E;  5K36 A;  2PO0 A;  4DUY I;  4IFD F;  2NN6 B;  1ZM2 A;  1IBK I;  1RHY A;  1NZ0 A;  1R6M A;  2OI2 A;  4JI3 I;  4JI7 I;  1KTV A;  1EI1 A;  2ZM6 E;  4LFB I;  5FLX Q;  4DV0 E;  2UXD I;  1USU A;  5EL9 A;  5DRP A;  5K36 C;  3JAM Q;  5IWA E;  1B63 A;  5L3J A;  4FWD A;  4FW3 A;  2NN6 A;  4FW4 A;  4B3T I;  2CVE A;  1Z59 A;  4DU8 A;  3H4L A;  4GKK I;  5C0X B;  1Y4U A;  4DV7 E;  2BR2 B;  2HHH I;  3P76 A;  1P42 A;  4KQV A;  1I94 I;  4OKG A;  1IBL I;  4B3S E;  2GS8 A;  2WNR B;  3Q6N A;  1MU5 A;  4LPF A;  4USK A;  1Z0E A;  1Z0V A;  3T1Y I;  1IBK E;  2NN6 C;  2JE6 B;  5JEA B;  3K17 A;  4LFB E;  4DPX A;  4DPW A;  4YHH I;  2BV3 A;  2C38 B;  5GME A;  3GON A;  4DR6 E;  3DD6 A;  3HUL A;  2UU9 E;  4YY3 I;  4DPY A;  1Z0C A;  4X64 E;  1XXE A;  4LFA I;  2WNR A;  2WP8 B;  1XHK A;  4DV4 I;  4ZVI A;  5BR8 I;  1HNX E;  1H7U A;  4DU7 A;  4BA2 B;  2E5L I;  5JEA A;  1PIE A;  2JE6 A;  4MU1 A;  1N33 I;  5C0X C;  4B3M I;  1KVK A;  2O1W A;  4DR7 I;  1DAR A;  2NN6 D;  2PO1 B;  4X65 I;  1FNM A;  4DR5 I;  2WP8 A;  2WW4 A;  3ZZT A;  2UXB E;  4LF9 E;  1USV A;  3U1Y A;  1MG7 A;  1YH8 A;  2CZ9 A;  2AJ4 A;  5JEA C;  2PNL A;  2HK2 A;  4MYT A;  5DRQ A;  4B3R I;  5LL6 R;  4DV5 E;  3PS1 A;  2PO1 A;  2UXC I;  3J80 C;  4HY1 A;  5C0X D;  4DPU A;  4LCH A;  4KHP I;  4FWH A;  1UEK A;  4DV3 E;  1ZM9 A;  2AE8 A;  1J5E E;  1VIS A;  2E5L E;  1U2R A;  3PYF A;  3P3C A;  4JI6 E;  4X62 I;  4LF8 I;  4DXL A;  2GO4 A;  4U3B A;  4X65 E;  4LF6 E;  3J81 Q;  4PRV A;  3Q6M A;  5JEA D;  1UDQ A;  1HNW I;  2C39 A;  1XMO E;  4OO1 B;  5LMN E;  2HK3 A;  1FWL A;  2NN6 E;  3V5R A;  3ZZU A;  1Z0B A;  3QT5 A;  1RR9 A;  4IZK A;  4DV6 I;  3B78 A;  2PO0 B;  1QZR A;  4LF4 E;  1XMQ I;  2UXC E;  5LMU E;  4DR4 E;  3LNU A;  1XNQ E;  4K0K I;  4WUD A;  4DUZ I;  2Z5B A;  4QNJ A;  3GCM A;  4J3D A;  4M1K A;  4IFD B;  4N3O A;  2HFU A;  4MYU A;  4JI5 I;  4X62 E;  1HK7 A;  1EA6 A;  5C0X E;  1NHJ A;  3J7A G;  1YHC A;  1MX0 A;  4WUB A;  1IBM E;  1S4E A; 
#chains in the Genus database with same CATH homology
 2HFS A;  4JYA I;  3J7A M;  4PU9 A;  1N34 E;  2CG9 A;  3M6A A;  2UUA E;  4DV6 E;  4GKJ I;  1XNR E;  1K47 A;  2VQE E;  1N32 I;  1FJG I;  3ZKD A;  2V34 A;  4UT4 A;  3K85 A;  4DV2 I;  4IZJ B;  1FKA E;  1WUU A;  3ZZ0 A;  2IOQ A;  3B82 A;  4P52 A;  2F4V I;  4DUY E;  5A2Q Q;  2Z5E A;  2A2C A;  4JYA E;  4LF5 I;  4IZJ A;  4JI7 E;  2NPF A;  1Z0W A;  4NXN I;  2UUB I;  1RRE A;  4JI3 E;  1D6T A;  2UXD E;  4OX9 I;  4EMD A;  4DR1 I;  2V2Q A;  4B3T E;  4JI4 I;  2O1U A;  4JI2 I;  4GKK E;  1FWK A;  2EFG A;  4JI8 I;  4DR2 I;  4LF7 I;  1PVG A;  2HHH E;  2V2Z A;  1I94 E;  1IBL E;  4FWG A;  5FLX C;  3LPS A;  4JI1 I;  4LFC I;  4P7A A;  2O1V A;  2GQ0 A;  4JI0 I;  3T1Y E;  4LF5 E;  3OTO I;  3JAM C;  1N0V C;  1ZM3 A;  3LTO A;  2UUC I;  2UUB E;  5IT9 Q;  4YHH E;  4OX9 E;  4DR1 E;  4YY3 E;  4IZJ D;  4LFA E;  4USM A;  4WUC A;  4DV4 E;  4Z7C A;  1ZM4 A;  5BR8 E;  1HNZ I;  3PYE A;  4IZK B;  1HR0 I;  1N33 E;  4B3M E;  4DR7 E;  1KKH A;  1N36 I;  3WU6 A;  4DR5 E;  2Z5C B;  4XTJ A;  2Z5B B;  2ZIT A;  4I3H A;  3T1H I;  3PRY A;  1H74 A;  4DV1 I;  2LJP A;  4B3R E;  4AQY I;  2V8P A;  3K1J A;  1Z5B A;  4X66 I;  1NHI A;  2PNM A;  4KHP E;  1Y4S A;  1Z5C A;  2Z5C A;  2VQF I;  1ZXN A;  1NHH A;  4LF8 E;  2V2V A;  1HNW E;  1FI4 A;  2ZM6 I;  4DV0 I;  5IWA I;  4URL A;  2HKJ A;  2BM0 A;  4NXM I;  1XMQ E;  4DV7 I;  4K0K E;  3J81 C;  2DEJ A;  4DUZ E;  4RPF A;  4B3S I;  1A6F A;  4HAC A;  3B8H A;  3PYG A;  2A2D A;  4JI5 E;  4JV5 I;  3WU5 A;  2Q2E B;  5FWK A;  3ZKB A;  4DR6 I;  2UU9 I;  4X64 I;  3P06 A;  3QT8 A;  4GKJ E;  4NXM E;  2IOP A;  1HNX I;  2BM1 A;  1FJG E;  1N32 E;  2X7I A;  3J80 Q;  4DV2 E;  2E1R A;  4R1F A;  4JV5 E;  2UXB I;  1ELO A;  4LF9 I;  2F4V E;  4FW9 A;  1PKP A;  2X36 A;  3PYD A;  2CGE A;  4Z7Y A;  4DV5 I;  4UTG A;  3D4J A;  4NXN E;  1H7S A;  3QT7 A;  4JG4 A;  4DV3 I;  1Z0G A;  1J5E I;  4FN5 A;  1OJ4 A;  2ZBK B;  4DR3 I;  4JI6 I;  1S16 A;  4JI4 E;  5A2Q C;  4ED4 A;  4JI2 E;  4LF6 I;  4JI8 E;  4DR2 E;  1XMO I;  4LF7 E;  3V2U C;  2J7K A;  5LMN I;  4JI1 E;  4LFC E;  3CWV A;  4JI0 E;  3OTO E;  2UUC E;  4LF4 I;  1BKN A;  1ZXM A;  5LMU I;  3ZM7 A;  4PRX A;  1H72 C;  4DR4 I;  1XNQ I;  1H73 A;  1N0U A;  3WU4 A;  3QT6 A;  4DR3 E;  2O1T A;  1Z0T A;  1Z5A A;  3Q1Q A;  3F0N A;  1IBM I;  1HNZ E;  1HR0 E;  1Y6Z A;  5IT9 C;  3HJC A;  4HYM A;  1N34 I;  5GMD A;  1B62 A;  1N36 E;  2UUA I;  2XEX A;  2VF3 A;  3WU3 A;  4HAC B;  1XNR I;  3T1H E;  2VQE I;  1KIJ A;  4DV1 E;  2R42 A;  4HXZ A;  4AQY E;  4DPT A;  4X66 E;  2HKE A;  2DEI A;  2R3V A;  2VQF E;  4DUY I;  1ZM2 A;  1IBK I;  1NZ0 A;  2OI2 A;  4JI3 I;  4JI7 I;  1KTV A;  1EI1 A;  2ZM6 E;  4LFB I;  5FLX Q;  4DV0 E;  2UXD I;  1USU A;  3JAM Q;  5IWA E;  1B63 A;  5L3J A;  4FWD A;  4B3T I;  1Z59 A;  4DU8 A;  3H4L A;  4GKK I;  1Y4U A;  4DV7 E;  2HHH I;  4KQV A;  1I94 I;  1IBL I;  4B3S E;  2GS8 A;  3Q6N A;  1MU5 A;  4USK A;  1Z0E A;  1Z0V A;  3T1Y I;  1IBK E;  3K17 A;  4LFB E;  4DPX A;  4DPW A;  4YHH I;  2BV3 A;  5GME A;  3GON A;  4DR6 E;  3HUL A;  2UU9 E;  4YY3 I;  4DPY A;  1Z0C A;  4X64 E;  4LFA I;  1XHK A;  4DV4 I;  4ZVI A;  5BR8 I;  1HNX E;  1H7U A;  4DU7 A;  2E5L I;  1PIE A;  1N33 I;  4B3M I;  4DR7 I;  1KVK A;  2O1W A;  1DAR A;  4X65 I;  1FNM A;  4DR5 I;  2WW4 A;  3ZZT A;  2UXB E;  4LF9 E;  1USV A;  1MG7 A;  2CZ9 A;  2AJ4 A;  2PNL A;  2HK2 A;  4MYT A;  4B3R I;  5LL6 R;  4DV5 E;  2UXC I;  3J80 C;  4HY1 A;  4DPU A;  4KHP I;  4FWH A;  1UEK A;  4DV3 E;  1ZM9 A;  1J5E E;  1VIS A;  2E5L E;  1U2R A;  3PYF A;  4JI6 E;  4X62 I;  4LF8 I;  4DXL A;  4X65 E;  4LF6 E;  3J81 Q;  4PRV A;  3Q6M A;  1HNW I;  1XMO E;  5LMN E;  2HK3 A;  1FWL A;  3V5R A;  3ZZU A;  1Z0B A;  3QT5 A;  1RR9 A;  4IZK A;  4DV6 I;  3B78 A;  1QZR A;  4LF4 E;  1XMQ I;  2UXC E;  5LMU E;  4DR4 E;  3LNU A;  1XNQ E;  4K0K I;  4WUD A;  4DUZ I;  2Z5B A;  4M1K A;  4N3O A;  2HFU A;  4MYU A;  4JI5 I;  4X62 E;  1HK7 A;  1EA6 A;  1NHJ A;  3J7A G;  1MX0 A;  4WUB A;  1IBM E;  1S4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...