2UUBI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uubI00
4JI0E 1KTVA 4OX9E 1N33I 5GMDA 4LF5E 4DV7I 4USKA 4JI3I 4NXMI 5IT9Q 3HULA 3LTOA 2HK3A 1XNRE 1VISA 1HNWE 4DR1I 3JAMQ 4WUCA 4DR3I 4JI2E 1N32E 1U2RA 4LFAI 1H74A 5L3JA 2V2QA 4DR4E 4JI4I 4LF7E 1Z59A 4B3TE 3ZZTA 1XMQI 3PYEA 3H4LA 4X65E 4JI0I 1ZXMA 1FWLA 2UUBE 4JI1E 2UU9E 1J5EE 4LF5I 1NHJA 1D6TA 3ZZ0A 3PYDA 4Z7YA 1PIEA 1Z0TA 2F4VE 1ELOA 4X64I 1ZM9A 1S16A 3ZM7A 3M6AA 5IT9C 1Z0BA 1B62A 4LF9I 1HR0I 4DPWA 4DR2E 4HYMA 1XNRI 3T1HE 3T1YI 1Z0WA 3V5RA 1H7UA 4DPTA 3K1JA 2BM0A 5LMNI 3JAMC 2VQEI 1N32I 1N34E 4DR4I 4PU9A 1HNXE 2UXBE 2V2VA 4M1KA 2UUBI 4NXNE 4LFCI 5LL6R 2UU9I 2DEIA 3D4JA 4UTGA 1H7SA 2HHHE 2UUCE 4KQVA 2V34A 3LNUA 4GKJE 1Z0VA 4DR2I 2E5LI 4X66E 3ZKBA 3GONA 1HNZI 2V8PA 4URLA 4LF8E 1NZ0A 2A2DA 2HFUA 1MX0A 1N34I 2A2CA 4DUZE 1XMOI 1A6FA 1HNXI 2UXBI 1EA6A 4FWHA 4RPFA 3CWVA 4DR7E 4KHPI 1IBKE 4B3SI 4X62I 5A2QQ 1ZXNA 1ZM3A 4EMDA 3WU5A 4DV1E 4MYUA 1FI4A 5LMUE 4GKJI 4JI5I 2VF3A 3J80Q 4LFBE 4Z7CA 3PYFA 2VQFE 4DUYI 4LF8I 3J7AM 4PRVA 1H72C 3J7AG 4DV6E 1QZRA 1EI1A 4MYTA 3J81Q 4DPUA 4JI7E 2UXCE 4YHHI 2UXDE 4K0KE 1WUUA 1PKPA 1OJ4A 1IBLE 3OTOE 3PYGA 4OX9I 4JV5E 1IBKI 2GS8A 4FN5A 1S4EA 4ZVIA 2ZM6E 4DV3E 4DV4E 2HKJA 1HNWI 3WU3A 1N36E 4GKKE 2EFGA 1KIJA 4JYAE 3B82A 1IBME 4B3RE 4LF6E 4JI2I 2HFSA 4B3ME 4DV6I 4DV5E 4JI7I 3QT8A 2LJPA 4LF7I 4B3TI 1XHKA 1I94E 4X65I 4HY1A 4JI1I 4DPYA 1J5EI 4WUDA 5FLXQ 2E1RA 4DPXA 2ZM6I 4DU7A 2HKEA 2F4VI 5IWAE 5BR8E 4JI6E 3T1HI 3F0NA 1RREA 1IBMI 4DV7E 4B3RI 4HACB 2UUAE 4NXME 1Z5AA 1H73A 4DV2E 4WUBA 4FWDA 2CZ9A 1I94I 4DR1E 1DARA 3QT6A 4HXZA 4NXNI 4DR3E 4LFAE 2ZITA 4LF4E 4R1FA 2HHHI 2UUCI 1FNMA 1PVGA 5IWAI 3LPSA 4DXLA 1XMQE 2DEJA 4X66I 4JI6I 3B78A 3WU6A 1UEKA 3WU4A 1Z0GA 2UUAI 4X64E 1KKHA 4DV0E 4LF9E 4DUZI 1HR0E 4DV2I 3QT5A 1NHIA 3T1YE 4JG4A 2R42A 1KVKA 5LMNE 4DR7I 1FWKA 2OI2A 2VQEE 4FWGA 2ZBKB 1K47A 2Q2EB 4LF4I 1ZM4A 5A2QC 4DV1I 3B8HA 4UT4A 2XEXA 5LMUI 2BM1A 4P7AA 4LFBI 1NHHA 3J80C 1XNQE 4LFCE 2VQFI 3Q1QA 4ED4A 4DR5E 4PRXA 4JI8E 4DV0I 1FJGE 3J81C 2UXCI 4DU8A 4USMA 2E5LE 2J7KA 2UXDI 5GMEA 4K0KI 1HNZE 1IBLI 3OTOI 1MG7A 3QT7A 4HACA 1FKAE 1Z5CA 4JV5I 1B63A 4AQYE 1N0VC 1ZM2A 4DR6E 2R3VA 4DV3I 2V2ZA 1XMOE 4YY3E 2WW4A 3ZZUA 4DV4I 2BV3A 1N36I 4GKKI 1XNQI 4JYAI 1N33E 4KHPE 4FW9A 4B3SE 4X62E 1Z0EA 4JI3E 4DR5I 4LF6I 4B3MI 1N0UA 2X7IA 1MU5A 4DV5I 4JI8I 1FJGI 4JI5E 3V2UC 4DUYE 2AJ4A 2X36A 1RR9A 1Z0CA 4XTJA 1BKNA 4AQYI 1Z5BA 4I3HA 5FLXC 4JI4E 3ZKDA 2HK2A 4DR6I 4P52A 2NPFA 4YHHE 4YY3I 3K17A 5BR8I
chains in the Genus database with same CATH superfamily
4JI0E 5FWKA 2IESA 1KTVA 2JE6A 3P3CA 4OX9E 1N33I 5GMDA 4LF5E 3L7ZB 3P06A 4DV7I 4USKA 4JI3I 4NXMI 5JEAF 5IT9Q 2NN6D 3HULA 3LTOA 3Q6NA 2HK3A 1XNRE 1VISA 1HNWE 4DR1I 3PS2A 5ELWA 4IZJA 3JAMQ 2O1TA 4WUCA 4DR3I 4JI2E 1N32E 1U2RA 4LFAI 1H74A 2JEAA 5L3JA 2V2QA 4DR4E 4JI4I 4LF7E 1Z59A 4B3TE 2BR2A 3ZZTA 1XMQI 3PYEA 3H4LA 2PO0A 4X65E 2O3ZA 4JI0I 1ZXMA 2J65A 1FWLA 4BA2A 2UUBE 4JI1E 5JEAC 2UU9E 1J5EE 2JT2A 1NHJA 4LF5I 2BA1D 4FW5A 2O1VA 1D6TA 3ZZ0A 3PYDA 2PO1A 4Z7YA 1PIEA 1Z0TA 2F4VE 1ELOA 2C38A 4X64I 1ZM9A 1S16A 5DRQA 3ZM7A 3M6AA 5IT9C 1Z0BA 1B62A 4LF9I 5JEAE 1HR0I 4DPWA 4DR2E 4HYMA 1XNRI 4LCHA 3T1HE 3T1YI 1Z0WA 3V5RA 1H7UA 4DPTA 2GQ0A 3K1JA 2BM0A 5LMNI 3JAMC 2VQEI 1N32I 1N34E 4U3DA 4DR4I 3CDJA 1YH8A 4PU9A 4IFDC 1HNXE 3P3EA 2UXBE 2V2VA 4IFDB 1E3HA 4M1KA 3PRYA 2UUBI 4NXNE 4LFCI 5LL6R 2UU9I 4IFDE 5K36B 2DEIA 4MQYA 4QNJA 4BA1A 3D4JA 4UTGA 1H7SA 2HHHE 2UUCE 4KQVA 2V34A 3LNUA 4GKJE 5C0XF 4MU1A 1Z0VA 4DR2I 2E5LI 4OZEA 4X66E 2NN6F 3ZKBA 3GONA 1HNZI 2V8PA 3L7ZA 4URLA 4LF8E 1NZ0A 2A2DA 2HFUA 3NZKA 4IZKB 1MX0A 1N34I 1E3PA 2PO2B 2A2CA 2Z5BA 4DUZE 1XMOI 1A6FA 4OO1C 1OYPA 1HNXI 2UXBI 4OKGA 1EA6A 4OO1B 4FWHA 4RPFA 1UDQA 4N3OA 3CWVA 4DR7E 4KHPI 1IBKE 1OYRA 4B3SI 4X62I 5C0XD 4OO1E 2WNRB 1R6MA 5A2QQ 1ZXNA 1Y6ZA 1ZM3A 2NN6C 4EMDA 3WU5A 4DV1E 4MYUA 4LOMA 1FI4A 5LMUE 4GKJI 4JI5I 2VF3A 3J80Q 4LFBE 1HK7A 4Z7CA 3PYFA 2VQFE 4DUYI 4LF8I 2NN6E 2C39B 3J7AM 2CG9A 4PRVA 1H72C 3J7AG 3M7ND 4DV6E 1QZRA 1R6LA 1EI1A 4MYTA 3J81Q 4DPUA 4JI7E 2UXCE 3KRNA 4YHHI 3HJCA 1XXEA 2UXDE 4K0KE 1WUUA 1PKPA 1OJ4A 1IBLE 1Y4SA 3OTOE 4FW7A 3PYGA 4OX9I 4LPFA 4JV5E 1IBKI 2GS8A 4FN5A 1S4EA 4ZVIA 5JEAB 4MU3A 2ZM6E 4DV3E 4DV4E 4IFDA 2HKJA 4IZJD 1HNWI 4FW3A 3WU3A 1N36E 4GKKE 2EFGA 4LCFA 1KIJA 3P76A 3M7NG 4JYAE 3B82A 1UDOA 2GO4A 1IBME 4B3RE 5K36A 1Y60A 4LF6E 4JI2I 2HFSA 4B3ME 3U1YA 4DV6I 4DV5E 4JI7I 2Z5EA 2CGEA 3QT8A 2LJPA 4LF7I 4B3TI 1XHKA 1I94E 2PNZB 2BA1G 4X65I 2PO0B 4HY1A 4IS9A 4JI1I 4DPYA 3B4TA 1J5EI 4WUDA 5FLXQ 4IZKA 2E1RA 3PS1A 4MU0A 4DPXA 2PO2A 2ZM6I 4DU7A 2HKEA 2F4VI 5IWAE 5DNXA 5BR8E 4AIDA 2PNMA 4OO1A 5DRRA 4JI6E 5DRPA 3T1HI 2Z5CB 3F0NA 1VI7A 5K36D 3PS3A 2GO3A 1RREA 1IBMI 3DD6A 4DV7E 4B3RI 2WNRA 2C37B 4HACB 4NBQA 2UUAE 4NXME 2JEBB 1Z5AA 3K85A 1H73A 2F1DA 4DV2E 4WUBA 1UDSA 2WP8B 4FWDA 2CZ9A 1I94I 4DR1E 1DARA 2C39A 3QT6A 4HXZA 4J3DA 4NXNI 4DR3E 5EL9A 3HKMA 3H1CA 4LFAE 5C0XC 2ZITA 4BA1B 4LF4E 4R1FA 3GMEA 5C0XB 2HHHI 2UUCI 1FNMA 1PVGA 5IWAI 3LPSA 4OO1D 4DXLA 2NN6B 1XMQE 2O1UA 4FW4A 2DEJA 4X66I 4JI6I 5C0XE 3B78A 4ISAA 3WU6A 2IOPA 4FW6A 1UEKA 3WU4A 1YHCA 5JEAA 3CDIA 1RHYA 5DNLA 1Z0GA 2UUAI 4X64E 1KKHA 4DV0E 4LF9E 4DUZI 1HR0E 1OYSA 4DV2I 2Z5BB 3QT5A 1NHIA 4QNKA 3T1YE 4AM3A 4JG4A 2R42A 1KVKA 2JE6B 5LMNE 4DR7I 1FWKA 2OI2A 2VQEE 3M85D 1USVA 4FWGA 4LCGA 2AE8A 2ZBKB 1K47A 2Q2EB 4LF4I 1ZM4A 1Y5YA 1USUA 4AIMA 2BA0D 5A2QC 3B8HA 4MDTA 2XEXA 4UT4A 5LMUI 4DV1I 2BM1A 2PNZA 4P7AA 4LFBI 1UDNA 1NHHA 3J80C 4IFDF 1XNQE 4MU4A 4LFCE 5JEAD 2VQFI 4IZJB 3Q1QA 5EKWA 1Y4UA 4ED4A 4DR5E 3U1KA 4PRXA 5K36F 4JI8E 4DV0I 1FJGE 2VESA 2JEAB 3J81C 2UXCI 4DU8A 4USMA 2E5LE 2J7KA 2BR2B 5DROA 2Z5CA 2UXDI 5GMEA 4K0KI 1HNZE 3GLLA 3M85G 1IBLI 3OTOI 1MG7A 3QT7A 4BA2B 2C37A 4HACA 1FKAE 1Z5CA 4JV5I 1B63A 2JEBA 4AQYE 2BA0G 1N0VC 1ZM2A 2PO1B 4DR6E 3UHMA 2R3VA 2C38B 4DV3I 2V2ZA 1XMOE 4IFDD 4GQUA 2WP8A 4YY3E 2WW4A 3ZZUA 4DV4I 2BV3A 1N36I 4GKKI 4OO1F 5K36C 1XNQI 4JYAI 1N33E 3P3GA 4KHPE 4FW9A 4B3SE 4X62E 1Z0EA 4JI3E 4DR5I 4LF6I 1P42A 4B3MI 1N0UA 2X7IA 5C0XA 1MU5A 2O1WA 4DV5I 4JI8I 1FJGI 2IERA 4JI5E 2NN6A 5K36E 2IOQA 3GCMA 3V2UC 4DUYE 2AJ4A 2X36A 1RR9A 1Z0CA 4XTJA 1BKNA 2PNLA 4AQYI 1Z5BA 4I3HA 5FLXC 4U3BA 4JI4E 3ZKDA 2HK2A 4DR6I 4P52A 2CVEA 3Q6MA 2NPFA 4YHHE 4YY3I 3K17A 5BR8I
chains in the Genus database with same CATH topology
4JI0E 5FWKA 1KTVA 4OX9E 1N33I 5GMDA 4LF5E 3P06A 4DV7I 4USKA 4JI3I 4NXMI 5IT9Q 3HULA 3LTOA 3Q6NA 2HK3A 1XNRE 1VISA 1HNWE 4DR1I 4IZJA 3JAMQ 2O1TA 4WUCA 4DR3I 4JI2E 1N32E 1U2RA 4LFAI 1H74A 5L3JA 2V2QA 4DR4E 4JI4I 4LF7E 1Z59A 4B3TE 3ZZTA 1XMQI 3PYEA 3H4LA 4X65E 4JI0I 1ZXMA 1FWLA 2UUBE 4JI1E 2UU9E 1J5EE 4LF5I 1NHJA 2O1VA 1D6TA 3ZZ0A 3PYDA 4Z7YA 1PIEA 1Z0TA 2F4VE 1ELOA 4X64I 1ZM9A 1S16A 3ZM7A 3M6AA 5IT9C 1Z0BA 1B62A 4LF9I 1HR0I 4DPWA 4DR2E 4HYMA 1XNRI 3T1HE 3T1YI 1Z0WA 3V5RA 1H7UA 4DPTA 2GQ0A 3K1JA 2BM0A 5LMNI 3JAMC 2VQEI 1N32I 1N34E 4DR4I 4PU9A 1HNXE 2UXBE 2V2VA 4M1KA 3PRYA 2UUBI 4NXNE 4LFCI 5LL6R 2UU9I 2DEIA 3D4JA 4UTGA 1H7SA 2HHHE 2UUCE 4KQVA 2V34A 3LNUA 4GKJE 1Z0VA 4DR2I 2E5LI 4X66E 3ZKBA 3GONA 1HNZI 2V8PA 4URLA 4LF8E 1NZ0A 2A2DA 2HFUA 4IZKB 1MX0A 1N34I 2A2CA 2Z5BA 4DUZE 1XMOI 1A6FA 1HNXI 2UXBI 1EA6A 4FWHA 4RPFA 4N3OA 3CWVA 4DR7E 4KHPI 1IBKE 4B3SI 4X62I 5A2QQ 1ZXNA 1Y6ZA 1ZM3A 4EMDA 3WU5A 4DV1E 4MYUA 1FI4A 5LMUE 4GKJI 4JI5I 2VF3A 3J80Q 4LFBE 1HK7A 4Z7CA 3PYFA 2VQFE 4DUYI 4LF8I 3J7AM 2CG9A 4PRVA 1H72C 3J7AG 4DV6E 1QZRA 1EI1A 4MYTA 3J81Q 4DPUA 4JI7E 2UXCE 4YHHI 3HJCA 2UXDE 4K0KE 1WUUA 1PKPA 1OJ4A 1IBLE 1Y4SA 3OTOE 3PYGA 4OX9I 4JV5E 1IBKI 2GS8A 4FN5A 1S4EA 4ZVIA 2ZM6E 4DV3E 4DV4E 2HKJA 4IZJD 1HNWI 3WU3A 1N36E 4GKKE 2EFGA 1KIJA 4JYAE 3B82A 1IBME 4B3RE 4LF6E 4JI2I 2HFSA 4B3ME 4DV6I 4DV5E 4JI7I 2Z5EA 2CGEA 3QT8A 2LJPA 4LF7I 4B3TI 1XHKA 1I94E 4X65I 4HY1A 4JI1I 4DPYA 1J5EI 4WUDA 5FLXQ 4IZKA 2E1RA 4DPXA 2ZM6I 4DU7A 2HKEA 2F4VI 5IWAE 5BR8E 2PNMA 4JI6E 3T1HI 2Z5CB 3F0NA 1RREA 1IBMI 4DV7E 4B3RI 4HACB 2UUAE 4NXME 1Z5AA 3K85A 1H73A 4DV2E 4WUBA 4FWDA 2CZ9A 1I94I 4DR1E 1DARA 3QT6A 4HXZA 4NXNI 4DR3E 4LFAE 2ZITA 4LF4E 4R1FA 2HHHI 2UUCI 1FNMA 1PVGA 5IWAI 3LPSA 4DXLA 1XMQE 2O1UA 2DEJA 4X66I 4JI6I 3B78A 3WU6A 2IOPA 1UEKA 3WU4A 1Z0GA 2UUAI 4X64E 1KKHA 4DV0E 4LF9E 4DUZI 1HR0E 4DV2I 2Z5BB 3QT5A 1NHIA 3T1YE 4JG4A 2R42A 1KVKA 5LMNE 4DR7I 1FWKA 2OI2A 2VQEE 1USVA 4FWGA 2ZBKB 1K47A 2Q2EB 4LF4I 1ZM4A 1USUA 5A2QC 4DV1I 3B8HA 4UT4A 2XEXA 5LMUI 2BM1A 4P7AA 4LFBI 1NHHA 3J80C 1XNQE 4LFCE 2VQFI 4IZJB 3Q1QA 1Y4UA 4ED4A 4DR5E 4PRXA 4JI8E 4DV0I 1FJGE 3J81C 2UXCI 4DU8A 4USMA 2E5LE 2J7KA 2Z5CA 2UXDI 5GMEA 4K0KI 1HNZE 1IBLI 3OTOI 1MG7A 3QT7A 4HACA 1FKAE 1Z5CA 4JV5I 1B63A 4AQYE 1N0VC 1ZM2A 4DR6E 2R3VA 4DV3I 2V2ZA 1XMOE 4YY3E 2WW4A 3ZZUA 4DV4I 2BV3A 1N36I 4GKKI 1XNQI 4JYAI 1N33E 4KHPE 4FW9A 4B3SE 4X62E 1Z0EA 4JI3E 4DR5I 4LF6I 4B3MI 1N0UA 2X7IA 1MU5A 2O1WA 4DV5I 4JI8I 1FJGI 4JI5E 2IOQA 3V2UC 4DUYE 2AJ4A 2X36A 1RR9A 1Z0CA 4XTJA 1BKNA 2PNLA 4AQYI 1Z5BA 4I3HA 5FLXC 4JI4E 3ZKDA 2HK2A 4DR6I 4P52A 3Q6MA 2NPFA 4YHHE 4YY3I 3K17A 5BR8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 E;  1KTV A;  4OX9 E;  1N33 I;  5GMD A;  4LF5 E;  4DV7 I;  4USK A;  4JI3 I;  4NXM I;  5IT9 Q;  3HUL A;  3LTO A;  2HK3 A;  1XNR E;  1VIS A;  1HNW E;  4DR1 I;  3JAM Q;  4WUC A;  4DR3 I;  4JI2 E;  1N32 E;  1U2R A;  4LFA I;  1H74 A;  5L3J A;  2V2Q A;  4DR4 E;  4JI4 I;  4LF7 E;  1Z59 A;  4B3T E;  3ZZT A;  1XMQ I;  3PYE A;  3H4L A;  4X65 E;  4JI0 I;  1ZXM A;  1FWL A;  2UUB E;  4JI1 E;  2UU9 E;  1J5E E;  4LF5 I;  1NHJ A;  1D6T A;  3ZZ0 A;  3PYD A;  4Z7Y A;  1PIE A;  1Z0T A;  2F4V E;  1ELO A;  4X64 I;  1ZM9 A;  1S16 A;  3ZM7 A;  3M6A A;  5IT9 C;  1Z0B A;  1B62 A;  4LF9 I;  1HR0 I;  4DPW A;  4DR2 E;  4HYM A;  1XNR I;  3T1H E;  3T1Y I;  1Z0W A;  3V5R A;  1H7U A;  4DPT A;  3K1J A;  2BM0 A;  5LMN I;  3JAM C;  2VQE I;  1N32 I;  1N34 E;  4DR4 I;  4PU9 A;  1HNX E;  2UXB E;  2V2V A;  4M1K A;  2UUB I;  4NXN E;  4LFC I;  5LL6 R;  2UU9 I;  2DEI A;  3D4J A;  4UTG A;  1H7S A;  2HHH E;  2UUC E;  4KQV A;  2V34 A;  3LNU A;  4GKJ E;  1Z0V A;  4DR2 I;  2E5L I;  4X66 E;  3ZKB A;  3GON A;  1HNZ I;  2V8P A;  4URL A;  4LF8 E;  1NZ0 A;  2A2D A;  2HFU A;  1MX0 A;  1N34 I;  2A2C A;  4DUZ E;  1XMO I;  1A6F A;  1HNX I;  2UXB I;  1EA6 A;  4FWH A;  4RPF A;  3CWV A;  4DR7 E;  4KHP I;  1IBK E;  4B3S I;  4X62 I;  5A2Q Q;  1ZXN A;  1ZM3 A;  4EMD A;  3WU5 A;  4DV1 E;  4MYU A;  1FI4 A;  5LMU E;  4GKJ I;  4JI5 I;  2VF3 A;  3J80 Q;  4LFB E;  4Z7C A;  3PYF A;  2VQF E;  4DUY I;  4LF8 I;  3J7A M;  4PRV A;  1H72 C;  3J7A G;  4DV6 E;  1QZR A;  1EI1 A;  4MYT A;  3J81 Q;  4DPU A;  4JI7 E;  2UXC E;  4YHH I;  2UXD E;  4K0K E;  1WUU A;  1PKP A;  1OJ4 A;  1IBL E;  3OTO E;  3PYG A;  4OX9 I;  4JV5 E;  1IBK I;  2GS8 A;  4FN5 A;  1S4E A;  4ZVI A;  2ZM6 E;  4DV3 E;  4DV4 E;  2HKJ A;  1HNW I;  3WU3 A;  1N36 E;  4GKK E;  2EFG A;  1KIJ A;  4JYA E;  3B82 A;  1IBM E;  4B3R E;  4LF6 E;  4JI2 I;  2HFS A;  4B3M E;  4DV6 I;  4DV5 E;  4JI7 I;  3QT8 A;  2LJP A;  4LF7 I;  4B3T I;  1XHK A;  1I94 E;  4X65 I;  4HY1 A;  4JI1 I;  4DPY A;  1J5E I;  4WUD A;  5FLX Q;  2E1R A;  4DPX A;  2ZM6 I;  4DU7 A;  2HKE A;  2F4V I;  5IWA E;  5BR8 E;  4JI6 E;  3T1H I;  3F0N A;  1RRE A;  1IBM I;  4DV7 E;  4B3R I;  4HAC B;  2UUA E;  4NXM E;  1Z5A A;  1H73 A;  4DV2 E;  4WUB A;  4FWD A;  2CZ9 A;  1I94 I;  4DR1 E;  1DAR A;  3QT6 A;  4HXZ A;  4NXN I;  4DR3 E;  4LFA E;  2ZIT A;  4LF4 E;  4R1F A;  2HHH I;  2UUC I;  1FNM A;  1PVG A;  5IWA I;  3LPS A;  4DXL A;  1XMQ E;  2DEJ A;  4X66 I;  4JI6 I;  3B78 A;  3WU6 A;  1UEK A;  3WU4 A;  1Z0G A;  2UUA I;  4X64 E;  1KKH A;  4DV0 E;  4LF9 E;  4DUZ I;  1HR0 E;  4DV2 I;  3QT5 A;  1NHI A;  3T1Y E;  4JG4 A;  2R42 A;  1KVK A;  5LMN E;  4DR7 I;  1FWK A;  2OI2 A;  2VQE E;  4FWG A;  2ZBK B;  1K47 A;  2Q2E B;  4LF4 I;  1ZM4 A;  5A2Q C;  4DV1 I;  3B8H A;  4UT4 A;  2XEX A;  5LMU I;  2BM1 A;  4P7A A;  4LFB I;  1NHH A;  3J80 C;  1XNQ E;  4LFC E;  2VQF I;  3Q1Q A;  4ED4 A;  4DR5 E;  4PRX A;  4JI8 E;  4DV0 I;  1FJG E;  3J81 C;  2UXC I;  4DU8 A;  4USM A;  2E5L E;  2J7K A;  2UXD I;  5GME A;  4K0K I;  1HNZ E;  1IBL I;  3OTO I;  1MG7 A;  3QT7 A;  4HAC A;  1FKA E;  1Z5C A;  4JV5 I;  1B63 A;  4AQY E;  1N0V C;  1ZM2 A;  4DR6 E;  2R3V A;  4DV3 I;  2V2Z A;  1XMO E;  4YY3 E;  2WW4 A;  3ZZU A;  4DV4 I;  2BV3 A;  1N36 I;  4GKK I;  1XNQ I;  4JYA I;  1N33 E;  4KHP E;  4FW9 A;  4B3S E;  4X62 E;  1Z0E A;  4JI3 E;  4DR5 I;  4LF6 I;  4B3M I;  1N0U A;  2X7I A;  1MU5 A;  4DV5 I;  4JI8 I;  1FJG I;  4JI5 E;  3V2U C;  4DUY E;  2AJ4 A;  2X36 A;  1RR9 A;  1Z0C A;  4XTJ A;  1BKN A;  4AQY I;  1Z5B A;  4I3H A;  5FLX C;  4JI4 E;  3ZKD A;  2HK2 A;  4DR6 I;  4P52 A;  2NPF A;  4YHH E;  4YY3 I;  3K17 A;  5BR8 I; 
#chains in the Genus database with same CATH topology
 4JI0 E;  5FWK A;  2IES A;  1KTV A;  2JE6 A;  3P3C A;  4OX9 E;  1N33 I;  5GMD A;  4LF5 E;  3L7Z B;  3P06 A;  4DV7 I;  4USK A;  4JI3 I;  4NXM I;  5JEA F;  5IT9 Q;  2NN6 D;  3HUL A;  3LTO A;  3Q6N A;  2HK3 A;  1XNR E;  1VIS A;  1HNW E;  4DR1 I;  3PS2 A;  5ELW A;  4IZJ A;  3JAM Q;  2O1T A;  4WUC A;  4DR3 I;  4JI2 E;  1N32 E;  1U2R A;  4LFA I;  1H74 A;  2JEA A;  5L3J A;  2V2Q A;  4DR4 E;  4JI4 I;  4LF7 E;  1Z59 A;  4B3T E;  2BR2 A;  3ZZT A;  1XMQ I;  3PYE A;  3H4L A;  2PO0 A;  4X65 E;  2O3Z A;  4JI0 I;  1ZXM A;  2J65 A;  1FWL A;  4BA2 A;  2UUB E;  4JI1 E;  5JEA C;  2UU9 E;  1J5E E;  2JT2 A;  1NHJ A;  4LF5 I;  2BA1 D;  4FW5 A;  2O1V A;  1D6T A;  3ZZ0 A;  3PYD A;  2PO1 A;  4Z7Y A;  1PIE A;  1Z0T A;  2F4V E;  1ELO A;  2C38 A;  4X64 I;  1ZM9 A;  1S16 A;  5DRQ A;  3ZM7 A;  3M6A A;  5IT9 C;  1Z0B A;  1B62 A;  4LF9 I;  5JEA E;  1HR0 I;  4DPW A;  4DR2 E;  4HYM A;  1XNR I;  4LCH A;  3T1H E;  3T1Y I;  1Z0W A;  3V5R A;  1H7U A;  4DPT A;  2GQ0 A;  3K1J A;  2BM0 A;  5LMN I;  3JAM C;  2VQE I;  1N32 I;  1N34 E;  4U3D A;  4DR4 I;  3CDJ A;  1YH8 A;  4PU9 A;  4IFD C;  1HNX E;  3P3E A;  2UXB E;  2V2V A;  4IFD B;  1E3H A;  4M1K A;  3PRY A;  2UUB I;  4NXN E;  4LFC I;  5LL6 R;  2UU9 I;  4IFD E;  5K36 B;  2DEI A;  4MQY A;  4QNJ A;  4BA1 A;  3D4J A;  4UTG A;  1H7S A;  2HHH E;  2UUC E;  4KQV A;  2V34 A;  3LNU A;  4GKJ E;  5C0X F;  4MU1 A;  1Z0V A;  4DR2 I;  2E5L I;  4OZE A;  4X66 E;  2NN6 F;  3ZKB A;  3GON A;  1HNZ I;  2V8P A;  3L7Z A;  4URL A;  4LF8 E;  1NZ0 A;  2A2D A;  2HFU A;  3NZK A;  4IZK B;  1MX0 A;  1N34 I;  1E3P A;  2PO2 B;  2A2C A;  2Z5B A;  4DUZ E;  1XMO I;  1A6F A;  4OO1 C;  1OYP A;  1HNX I;  2UXB I;  4OKG A;  1EA6 A;  4OO1 B;  4FWH A;  4RPF A;  1UDQ A;  4N3O A;  3CWV A;  4DR7 E;  4KHP I;  1IBK E;  1OYR A;  4B3S I;  4X62 I;  5C0X D;  4OO1 E;  2WNR B;  1R6M A;  5A2Q Q;  1ZXN A;  1Y6Z A;  1ZM3 A;  2NN6 C;  4EMD A;  3WU5 A;  4DV1 E;  4MYU A;  4LOM A;  1FI4 A;  5LMU E;  4GKJ I;  4JI5 I;  2VF3 A;  3J80 Q;  4LFB E;  1HK7 A;  4Z7C A;  3PYF A;  2VQF E;  4DUY I;  4LF8 I;  2NN6 E;  2C39 B;  3J7A M;  2CG9 A;  4PRV A;  1H72 C;  3J7A G;  3M7N D;  4DV6 E;  1QZR A;  1R6L A;  1EI1 A;  4MYT A;  3J81 Q;  4DPU A;  4JI7 E;  2UXC E;  3KRN A;  4YHH I;  3HJC A;  1XXE A;  2UXD E;  4K0K E;  1WUU A;  1PKP A;  1OJ4 A;  1IBL E;  1Y4S A;  3OTO E;  4FW7 A;  3PYG A;  4OX9 I;  4LPF A;  4JV5 E;  1IBK I;  2GS8 A;  4FN5 A;  1S4E A;  4ZVI A;  5JEA B;  4MU3 A;  2ZM6 E;  4DV3 E;  4DV4 E;  4IFD A;  2HKJ A;  4IZJ D;  1HNW I;  4FW3 A;  3WU3 A;  1N36 E;  4GKK E;  2EFG A;  4LCF A;  1KIJ A;  3P76 A;  3M7N G;  4JYA E;  3B82 A;  1UDO A;  2GO4 A;  1IBM E;  4B3R E;  5K36 A;  1Y60 A;  4LF6 E;  4JI2 I;  2HFS A;  4B3M E;  3U1Y A;  4DV6 I;  4DV5 E;  4JI7 I;  2Z5E A;  2CGE A;  3QT8 A;  2LJP A;  4LF7 I;  4B3T I;  1XHK A;  1I94 E;  2PNZ B;  2BA1 G;  4X65 I;  2PO0 B;  4HY1 A;  4IS9 A;  4JI1 I;  4DPY A;  3B4T A;  1J5E I;  4WUD A;  5FLX Q;  4IZK A;  2E1R A;  3PS1 A;  4MU0 A;  4DPX A;  2PO2 A;  2ZM6 I;  4DU7 A;  2HKE A;  2F4V I;  5IWA E;  5DNX A;  5BR8 E;  4AID A;  2PNM A;  4OO1 A;  5DRR A;  4JI6 E;  5DRP A;  3T1H I;  2Z5C B;  3F0N A;  1VI7 A;  5K36 D;  3PS3 A;  2GO3 A;  1RRE A;  1IBM I;  3DD6 A;  4DV7 E;  4B3R I;  2WNR A;  2C37 B;  4HAC B;  4NBQ A;  2UUA E;  4NXM E;  2JEB B;  1Z5A A;  3K85 A;  1H73 A;  2F1D A;  4DV2 E;  4WUB A;  1UDS A;  2WP8 B;  4FWD A;  2CZ9 A;  1I94 I;  4DR1 E;  1DAR A;  2C39 A;  3QT6 A;  4HXZ A;  4J3D A;  4NXN I;  4DR3 E;  5EL9 A;  3HKM A;  3H1C A;  4LFA E;  5C0X C;  2ZIT A;  4BA1 B;  4LF4 E;  4R1F A;  3GME A;  5C0X B;  2HHH I;  2UUC I;  1FNM A;  1PVG A;  5IWA I;  3LPS A;  4OO1 D;  4DXL A;  2NN6 B;  1XMQ E;  2O1U A;  4FW4 A;  2DEJ A;  4X66 I;  4JI6 I;  5C0X E;  3B78 A;  4ISA A;  3WU6 A;  2IOP A;  4FW6 A;  1UEK A;  3WU4 A;  1YHC A;  5JEA A;  3CDI A;  1RHY A;  5DNL A;  1Z0G A;  2UUA I;  4X64 E;  1KKH A;  4DV0 E;  4LF9 E;  4DUZ I;  1HR0 E;  1OYS A;  4DV2 I;  2Z5B B;  3QT5 A;  1NHI A;  4QNK A;  3T1Y E;  4AM3 A;  4JG4 A;  2R42 A;  1KVK A;  2JE6 B;  5LMN E;  4DR7 I;  1FWK A;  2OI2 A;  2VQE E;  3M85 D;  1USV A;  4FWG A;  4LCG A;  2AE8 A;  2ZBK B;  1K47 A;  2Q2E B;  4LF4 I;  1ZM4 A;  1Y5Y A;  1USU A;  4AIM A;  2BA0 D;  5A2Q C;  3B8H A;  4MDT A;  2XEX A;  4UT4 A;  5LMU I;  4DV1 I;  2BM1 A;  2PNZ A;  4P7A A;  4LFB I;  1UDN A;  1NHH A;  3J80 C;  4IFD F;  1XNQ E;  4MU4 A;  4LFC E;  5JEA D;  2VQF I;  4IZJ B;  3Q1Q A;  5EKW A;  1Y4U A;  4ED4 A;  4DR5 E;  3U1K A;  4PRX A;  5K36 F;  4JI8 E;  4DV0 I;  1FJG E;  2VES A;  2JEA B;  3J81 C;  2UXC I;  4DU8 A;  4USM A;  2E5L E;  2J7K A;  2BR2 B;  5DRO A;  2Z5C A;  2UXD I;  5GME A;  4K0K I;  1HNZ E;  3GLL A;  3M85 G;  1IBL I;  3OTO I;  1MG7 A;  3QT7 A;  4BA2 B;  2C37 A;  4HAC A;  1FKA E;  1Z5C A;  4JV5 I;  1B63 A;  2JEB A;  4AQY E;  2BA0 G;  1N0V C;  1ZM2 A;  2PO1 B;  4DR6 E;  3UHM A;  2R3V A;  2C38 B;  4DV3 I;  2V2Z A;  1XMO E;  4IFD D;  4GQU A;  2WP8 A;  4YY3 E;  2WW4 A;  3ZZU A;  4DV4 I;  2BV3 A;  1N36 I;  4GKK I;  4OO1 F;  5K36 C;  1XNQ I;  4JYA I;  1N33 E;  3P3G A;  4KHP E;  4FW9 A;  4B3S E;  4X62 E;  1Z0E A;  4JI3 E;  4DR5 I;  4LF6 I;  1P42 A;  4B3M I;  1N0U A;  2X7I A;  5C0X A;  1MU5 A;  2O1W A;  4DV5 I;  4JI8 I;  1FJG I;  2IER A;  4JI5 E;  2NN6 A;  5K36 E;  2IOQ A;  3GCM A;  3V2U C;  4DUY E;  2AJ4 A;  2X36 A;  1RR9 A;  1Z0C A;  4XTJ A;  1BKN A;  2PNL A;  4AQY I;  1Z5B A;  4I3H A;  5FLX C;  4U3B A;  4JI4 E;  3ZKD A;  2HK2 A;  4DR6 I;  4P52 A;  2CVE A;  3Q6M A;  2NPF A;  4YHH E;  4YY3 I;  3K17 A;  5BR8 I; 
#chains in the Genus database with same CATH homology
 4JI0 E;  5FWK A;  1KTV A;  4OX9 E;  1N33 I;  5GMD A;  4LF5 E;  3P06 A;  4DV7 I;  4USK A;  4JI3 I;  4NXM I;  5IT9 Q;  3HUL A;  3LTO A;  3Q6N A;  2HK3 A;  1XNR E;  1VIS A;  1HNW E;  4DR1 I;  4IZJ A;  3JAM Q;  2O1T A;  4WUC A;  4DR3 I;  4JI2 E;  1N32 E;  1U2R A;  4LFA I;  1H74 A;  5L3J A;  2V2Q A;  4DR4 E;  4JI4 I;  4LF7 E;  1Z59 A;  4B3T E;  3ZZT A;  1XMQ I;  3PYE A;  3H4L A;  4X65 E;  4JI0 I;  1ZXM A;  1FWL A;  2UUB E;  4JI1 E;  2UU9 E;  1J5E E;  4LF5 I;  1NHJ A;  2O1V A;  1D6T A;  3ZZ0 A;  3PYD A;  4Z7Y A;  1PIE A;  1Z0T A;  2F4V E;  1ELO A;  4X64 I;  1ZM9 A;  1S16 A;  3ZM7 A;  3M6A A;  5IT9 C;  1Z0B A;  1B62 A;  4LF9 I;  1HR0 I;  4DPW A;  4DR2 E;  4HYM A;  1XNR I;  3T1H E;  3T1Y I;  1Z0W A;  3V5R A;  1H7U A;  4DPT A;  2GQ0 A;  3K1J A;  2BM0 A;  5LMN I;  3JAM C;  2VQE I;  1N32 I;  1N34 E;  4DR4 I;  4PU9 A;  1HNX E;  2UXB E;  2V2V A;  4M1K A;  3PRY A;  2UUB I;  4NXN E;  4LFC I;  5LL6 R;  2UU9 I;  2DEI A;  3D4J A;  4UTG A;  1H7S A;  2HHH E;  2UUC E;  4KQV A;  2V34 A;  3LNU A;  4GKJ E;  1Z0V A;  4DR2 I;  2E5L I;  4X66 E;  3ZKB A;  3GON A;  1HNZ I;  2V8P A;  4URL A;  4LF8 E;  1NZ0 A;  2A2D A;  2HFU A;  4IZK B;  1MX0 A;  1N34 I;  2A2C A;  2Z5B A;  4DUZ E;  1XMO I;  1A6F A;  1HNX I;  2UXB I;  1EA6 A;  4FWH A;  4RPF A;  4N3O A;  3CWV A;  4DR7 E;  4KHP I;  1IBK E;  4B3S I;  4X62 I;  5A2Q Q;  1ZXN A;  1Y6Z A;  1ZM3 A;  4EMD A;  3WU5 A;  4DV1 E;  4MYU A;  1FI4 A;  5LMU E;  4GKJ I;  4JI5 I;  2VF3 A;  3J80 Q;  4LFB E;  1HK7 A;  4Z7C A;  3PYF A;  2VQF E;  4DUY I;  4LF8 I;  3J7A M;  2CG9 A;  4PRV A;  1H72 C;  3J7A G;  4DV6 E;  1QZR A;  1EI1 A;  4MYT A;  3J81 Q;  4DPU A;  4JI7 E;  2UXC E;  4YHH I;  3HJC A;  2UXD E;  4K0K E;  1WUU A;  1PKP A;  1OJ4 A;  1IBL E;  1Y4S A;  3OTO E;  3PYG A;  4OX9 I;  4JV5 E;  1IBK I;  2GS8 A;  4FN5 A;  1S4E A;  4ZVI A;  2ZM6 E;  4DV3 E;  4DV4 E;  2HKJ A;  4IZJ D;  1HNW I;  3WU3 A;  1N36 E;  4GKK E;  2EFG A;  1KIJ A;  4JYA E;  3B82 A;  1IBM E;  4B3R E;  4LF6 E;  4JI2 I;  2HFS A;  4B3M E;  4DV6 I;  4DV5 E;  4JI7 I;  2Z5E A;  2CGE A;  3QT8 A;  2LJP A;  4LF7 I;  4B3T I;  1XHK A;  1I94 E;  4X65 I;  4HY1 A;  4JI1 I;  4DPY A;  1J5E I;  4WUD A;  5FLX Q;  4IZK A;  2E1R A;  4DPX A;  2ZM6 I;  4DU7 A;  2HKE A;  2F4V I;  5IWA E;  5BR8 E;  2PNM A;  4JI6 E;  3T1H I;  2Z5C B;  3F0N A;  1RRE A;  1IBM I;  4DV7 E;  4B3R I;  4HAC B;  2UUA E;  4NXM E;  1Z5A A;  3K85 A;  1H73 A;  4DV2 E;  4WUB A;  4FWD A;  2CZ9 A;  1I94 I;  4DR1 E;  1DAR A;  3QT6 A;  4HXZ A;  4NXN I;  4DR3 E;  4LFA E;  2ZIT A;  4LF4 E;  4R1F A;  2HHH I;  2UUC I;  1FNM A;  1PVG A;  5IWA I;  3LPS A;  4DXL A;  1XMQ E;  2O1U A;  2DEJ A;  4X66 I;  4JI6 I;  3B78 A;  3WU6 A;  2IOP A;  1UEK A;  3WU4 A;  1Z0G A;  2UUA I;  4X64 E;  1KKH A;  4DV0 E;  4LF9 E;  4DUZ I;  1HR0 E;  4DV2 I;  2Z5B B;  3QT5 A;  1NHI A;  3T1Y E;  4JG4 A;  2R42 A;  1KVK A;  5LMN E;  4DR7 I;  1FWK A;  2OI2 A;  2VQE E;  1USV A;  4FWG A;  2ZBK B;  1K47 A;  2Q2E B;  4LF4 I;  1ZM4 A;  1USU A;  5A2Q C;  4DV1 I;  3B8H A;  4UT4 A;  2XEX A;  5LMU I;  2BM1 A;  4P7A A;  4LFB I;  1NHH A;  3J80 C;  1XNQ E;  4LFC E;  2VQF I;  4IZJ B;  3Q1Q A;  1Y4U A;  4ED4 A;  4DR5 E;  4PRX A;  4JI8 E;  4DV0 I;  1FJG E;  3J81 C;  2UXC I;  4DU8 A;  4USM A;  2E5L E;  2J7K A;  2Z5C A;  2UXD I;  5GME A;  4K0K I;  1HNZ E;  1IBL I;  3OTO I;  1MG7 A;  3QT7 A;  4HAC A;  1FKA E;  1Z5C A;  4JV5 I;  1B63 A;  4AQY E;  1N0V C;  1ZM2 A;  4DR6 E;  2R3V A;  4DV3 I;  2V2Z A;  1XMO E;  4YY3 E;  2WW4 A;  3ZZU A;  4DV4 I;  2BV3 A;  1N36 I;  4GKK I;  1XNQ I;  4JYA I;  1N33 E;  4KHP E;  4FW9 A;  4B3S E;  4X62 E;  1Z0E A;  4JI3 E;  4DR5 I;  4LF6 I;  4B3M I;  1N0U A;  2X7I A;  1MU5 A;  2O1W A;  4DV5 I;  4JI8 I;  1FJG I;  4JI5 E;  2IOQ A;  3V2U C;  4DUY E;  2AJ4 A;  2X36 A;  1RR9 A;  1Z0C A;  4XTJ A;  1BKN A;  2PNL A;  4AQY I;  1Z5B A;  4I3H A;  5FLX C;  4JI4 E;  3ZKD A;  2HK2 A;  4DR6 I;  4P52 A;  3Q6M A;  2NPF A;  4YHH E;  4YY3 I;  3K17 A;  5BR8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...