4JYAI

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jyaI00
1EA6A 4DR3E 4PU9A 5A2QQ 2R3VA 4EMDA 4JI8E 4LF8I 3QT6A 4DR1E 1K47A 3PYGA 1VISA 1OJ4A 1N36E 4ZVIA 1ZXNA 2V34A 3ZZTA 3F0NA 4P52A 4JI6I 4LFBI 5BR8E 3ZKDA 4DR5E 4JI2I 3LPSA 4UTGA 1FI4A 4JYAE 1PKPA 4DV2E 1HR0I 4DV3I 3WU4A 4LF7E 1J5EE 4DV1E 4B3RE 2LJPA 1HNZI 4DV0E 4FWHA 1NHIA 3QT8A 1NHHA 2HKEA 4DV4E 4FWDA 3K1JA 1HNWI 4USMA 4JYAI 3J81C 1EI1A 1H74A 4I3HA 5FLXQ 4JI1I 1KKHA 1H7SA 4DV0I 2UXDE 4USKA 4JI4I 1IBLI 2UXBE 4LFAI 2DEIA 4X62I 4LF5I 1B62A 4DV3E 2UUBE 1Z0CA 3CWVA 3LTOA 2UU9I 4DUZI 4YY3E 4DR2I 1N33E 4NXME 1IBLE 4WUDA 4JI8I 1MX0A 1Z0BA 4GKKE 4LF9E 1N32E 2NPFA 4B3SE 4DPWA 4DR2E 5GMDA 1ZM3A 1Z59A 1Z0WA 1FJGE 4X62E 4GKKI 4X66I 2HFUA 2HKJA 3T1HE 4P7AA 4JV5E 1ZM2A 2V8PA 1H73A 2ZM6E 3J81Q 4LF6E 3WU5A 1MG7A 2WW4A 1S4EA 2V2ZA 2UXCE 4Z7YA 4DR7E 4DR7I 3PYDA 4HACB 3D4JA 4KHPE 1XMOE 4URLA 4LF7I 2HK3A 1HNWE 4KQVA 3OTOI 2HFSA 4DV5E 4LF4I 4HY1A 2F4VI 1Z5CA 2EFGA 1H72C 3WU3A 1HNXI 3ZZUA 1UEKA 4YHHI 3M6AA 1IBKI 2J7KA 5IT9C 4DU7A 4DV2I 3B8HA 4DUZE 2UU9E 2OI2A 2UUAI 4OX9I 4FN5A 1RR9A 2Q2EB 4LF8E 4JG4A 1H7UA 4KHPI 4FWGA 4DR6E 1RREA 4PRXA 3K17A 1PIEA 4K0KI 4YY3I 1XHKA 2UUBI 1N0VC 2VQEE 4NXNE 1U2RA 2UUCE 4JI0E 2HK2A 3PYEA 4Z7CA 5IWAI 1XNQE 4RPFA 4DV1I 3T1YE 5LL6R 2UUAE 1S16A 4MYUA 1Z0VA 4LFCE 1ZM9A 5BR8I 3GONA 4HYMA 4DUYI 2E5LE 1HNXE 2VQFI 4DU8A 2AJ4A 4NXMI 1XNRI 1HR0E 3V2UC 1ZM4A 4DR1I 5IT9Q 4B3SI 5LMNI 4JI6E 4LFAE 3ZM7A 4YHHE 2E5LI 4DR4E 4DR4I 3JAMC 1IBMI 4M1KA 1B63A 4AQYI 2BM0A 4B3TE 4ED4A 4DV5I 1BKNA 4DPYA 2XEXA 1XNRE 3LNUA 1I94I 3QT5A 1FWLA 5L3JA 4R1FA 4JI5E 4X65I 3OTOE 1I94E 1ZXMA 4HXZA 4K0KE 3ZKBA 4UT4A 4JI3I 4LF9I 1IBME 3H4LA 3J80C 4DV6E 3T1HI 4B3ME 2R42A 1ELOA 4OX9E 1DARA 1N34I 1XMQI 3WU6A 1N32I 4JV5I 2V2QA 2E1RA 4DXLA 4B3MI 2VQFE 2HHHE 2HHHI 4GKJE 1N33I 4JI3E 1FJGI 4LF4E 2A2DA 1Z0TA 4JI7E 4X64I 4X64E 2ZITA 4WUCA 5LMUI 4DV7E 1N34E 4JI4E 2ZBKB 1WUUA 3PYFA 3T1YI 3J80Q 4JI5I 1XNQI 1KTVA 5GMEA 5FLXC 4DPXA 3ZZ0A 1A6FA 4LFCI 1XMQE 2VQEI 2UXBI 2GS8A 4LF6I 2UXDI 2ZM6I 4DR5I 2BM1A 4JI2E 4MYTA 5IWAE 4AQYE 1NZ0A 4B3RI 2UXCI 4DPUA 4DPTA 3HULA 1J5EI 1MU5A 4PRVA 2CZ9A 5LMNE 5LMUE 4DV7I 2VF3A 4DV4I 3B82A 4LFBE 2V2VA 1D6TA 1IBKE 2BV3A 1FNMA 1HNZE 3JAMQ 1KIJA 3V5RA 1N36I 4X66E 1KVKA 2F4VE 1FWKA 4JI7I 1FKAE 4LF5E 1Z5BA 4B3TI 1PVGA 3J7AG 4GKJI 5A2QC 1Z5AA 3J7AM 4DR3I 4JI1E 2A2CA 3QT7A 1Z0GA 3Q1QA 4XTJA 2DEJA 1QZRA 2X36A 1XMOI 4DV6I 4DUYE 4WUBA 3B78A 4FW9A 2X7IA 1N0UA 4DR6I 4JI0I 2UUCI 4NXNI 4HACA 1Z0EA 1NHJA 4X65E
chains in the Genus database with same CATH superfamily
4QNJA 1EA6A 4DR3E 2C39B 2PO1A 2O1VA 4GQUA 2GO4A 4PU9A 5A2QQ 2R3VA 4EMDA 4JI8E 4LF8I 3QT6A 4BA1B 4DR1E 2JEAA 3L7ZB 1K47A 4OO1A 3PYGA 1VISA 1OJ4A 1N36E 2WNRB 5ELWA 4ZVIA 1ZXNA 2V34A 4MU4A 3ZZTA 4OKGA 2PNLA 3F0NA 4P52A 4JI6I 2JT2A 4LFBI 5BR8E 3ZKDA 4DR5E 4JI2I 3LPSA 2JEBB 5C0XB 4UTGA 4OO1C 1FI4A 4JYAE 1PKPA 4DV2E 1HR0I 4DV3I 3WU4A 5JEAE 3PRYA 4LF7E 2GQ0A 4DV1E 1J5EE 3HJCA 2BA1D 4B3RE 2Z5EA 2LJPA 1HNZI 4DV0E 2F1DA 4FWHA 4LPFA 1NHIA 3QT8A 1NHHA 2HKEA 4DV4E 4FWDA 1UDOA 3K1JA 1HNWI 4USMA 2NN6A 4JYAI 3J81C 1EI1A 4IZJB 4AIMA 1H74A 4I3HA 5FLXQ 4JI1I 1KKHA 1H7SA 2Z5CA 4DV0I 4FW4A 2BR2B 2UXDE 4USKA 4JI4I 5EKWA 1IBLI 2UXBE 4LFAI 2DEIA 4X62I 1B62A 4DV3E 4LF5I 2UUBE 1Z0CA 2CGEA 3CWVA 3LTOA 2UU9I 4LCHA 4DUZI 2BA0D 4YY3E 4DR2I 1N33E 2JEAB 3Q6NA 1E3PA 4NXME 3M85G 1IBLE 4WUDA 4JI8I 2WP8B 1MX0A 1Z0BA 2J65A 4GKKE 4LF9E 2JEBA 5C0XA 1N32E 2JE6B 2NPFA 4B3SE 4DPWA 4DR2E 5GMDA 1ZM3A 1Z59A 2JE6A 4FW3A 1Z0WA 4IFDB 1FJGE 3GCMA 4X62E 4GKKI 4X66I 3KRNA 2HFUA 2HKJA 3T1HE 4P7AA 3U1YA 4JV5E 1RHYA 1ZM2A 2V8PA 5K36A 1R6LA 1H73A 3K85A 4OZEA 2ZM6E 3J81Q 4LF6E 3WU5A 1MG7A 2WW4A 3P06A 2C37B 2NN6D 1S4EA 4BA2A 4MU3A 4IZJD 2V2ZA 4OO1E 2UXCE 4Z7YA 4DR7E 4IFDE 5DRPA 4DR7I 3PYDA 4HACB 3D4JA 4KHPE 5C0XD 1XMOE 4URLA 1USUA 4MU1A 4LF7I 2HK3A 1HNWE 4KQVA 3OTOI 2HFSA 2PO2A 4DV5E 5FWKA 5JEAF 4LF4I 4HY1A 2F4VI 1Z5CA 2EFGA 1YHCA 1H72C 2BA1G 3WU3A 1HNXI 3ZZUA 1UEKA 4YHHI 3M6AA 1IBKI 2J7KA 5IT9C 4DU7A 4DV2I 1OYRA 3B8HA 4DUZE 2UU9E 2O1WA 3P76A 1Y6ZA 3M85D 2OI2A 2UUAI 4OX9I 4FN5A 1RR9A 2Q2EB 4LF8E 4IFDC 4JG4A 1H7UA 2CG9A 4KHPI 4FWGA 4DR6E 4FW7A 1RREA 1OYSA 4PRXA 3K17A 5K36D 1PIEA 5C0XF 4K0KI 4YY3I 1XHKA 3PS3A 5K36F 2UUBI 1N0VC 2VQEE 1E3HA 4NXNE 1U2RA 2UUCE 4JI0E 5JEAA 4N3OA 4J3DA 2HK2A 3PYEA 4Z7CA 5IWAI 1XNQE 4RPFA 3H1CA 4DV1I 3T1YE 4IFDD 4NBQA 2PO2B 2CVEA 5LL6R 2Z5BB 2UUAE 1S16A 4MYUA 4LCFA 1Z0VA 4LFCE 1ZM9A 5BR8I 1P42A 4BA2B 3GONA 4HYMA 1XXEA 4DUYI 2E5LE 1HNXE 2VQFI 4DU8A 2Z5CB 2AJ4A 4NXMI 1XNRI 1HR0E 3DD6A 3V2UC 1ZM4A 4DR1I 2AE8A 2IOQA 5IT9Q 4B3SI 5LMNI 4JI6E 4LFAE 3ZM7A 5JEAD 3GMEA 4YHHE 2BA0G 4IS9A 2E5LI 3L7ZA 4DR4E 4DR4I 2GO3A 2NN6F 3CDJA 2VESA 3JAMC 4M1KA 1IBMI 1B63A 4AQYI 2BM0A 1VI7A 4B3TE 5DNLA 4ED4A 5DNXA 4IFDA 1HK7A 4DV5I 1BKNA 4DPYA 2XEXA 4U3DA 1R6MA 1XNRE 3LNUA 1I94I 3QT5A 1FWLA 5L3JA 3PS1A 2IOPA 5K36C 2O1TA 5DRRA 2PNMA 4R1FA 4JI5E 4X65I 3P3EA 4ISAA 5K36E 3OTOE 4BA1A 4FW6A 3GLLA 1I94E 1ZXMA 4HXZA 2C38A 4K0KE 3ZKBA 2Z5BA 4UT4A 2NN6B 3Q6MA 4JI3I 2C38B 4LF9I 5DROA 1IBME 3H4LA 1Y5YA 4AIDA 3J80C 4DV6E 3T1HI 4B3ME 2R42A 1ELOA 4OX9E 1DARA 1N34I 1XMQI 3WU6A 2WNRA 1N32I 4IZKB 3M7ND 2V2QA 4JV5I 2E1RA 4DXLA 4B3MI 2VQFE 3P3CA 2HHHE 2HHHI 5K36B 4U3BA 4GKJE 1N33I 4JI3E 1FJGI 4LF4E 4FW5A 2A2DA 4QNKA 1Z0TA 4JI7E 4X64I 2C37A 4X64E 2NN6C 2ZITA 5EL9A 4WUCA 5LMUI 4DV7E 4IZJA 1N34E 4JI4E 2ZBKB 1WUUA 3PYFA 5DRQA 3T1YI 4IZKA 3J80Q 4JI5I 4OO1F 1XNQI 1KTVA 5GMEA 3UHMA 1UDNA 4DPXA 5FLXC 3ZZ0A 2O1UA 1A6FA 4LOMA 4LFCI 1XMQE 2VQEI 4MQYA 2IESA 2UXBI 2GS8A 4LF6I 2PNZA 2UXDI 2ZM6I 4DR5I 2BM1A 4JI2E 4MYTA 5IWAE 4AQYE 1Y4SA 1NZ0A 1USVA 4B3RI 2UXCI 4DPUA 4DPTA 3HULA 1J5EI 3NZKA 1MU5A 4MDTA 4PRVA 3P3GA 2CZ9A 4AM3A 5LMNE 5LMUE 4DV7I 2VF3A 4DV4I 2PO0B 3B82A 3U1KA 4OO1D 4LFBE 2V2VA 5JEAB 1D6TA 1IBKE 1OYPA 2BV3A 1FNMA 1Y4UA 1HNZE 3JAMQ 1KIJA 5C0XE 3V5RA 1N36I 1UDSA 4X66E 1KVKA 4OO1B 4MU0A 2F4VE 2NN6E 2BR2A 3B4TA 1FWKA 2WP8A 4JI7I 1FKAE 4LF5E 1Z5BA 3HKMA 4B3TI 1PVGA 3J7AG 4GKJI 4LCGA 5A2QC 3PS2A 1Z5AA 3J7AM 4DR3I 4JI1E 2A2CA 3QT7A 2O3ZA 5JEAC 1Z0GA 3Q1QA 1UDQA 4XTJA 2DEJA 1YH8A 1QZRA 2X36A 2IERA 1XMOI 3CDIA 4DV6I 4DUYE 3M7NG 4WUBA 3B78A 4FW9A 2PNZB 1Y60A 2X7IA 1N0UA 4DR6I 4JI0I 2UUCI 4IFDF 4NXNI 2PO0A 4HACA 1Z0EA 1NHJA 2C39A 2PO1B 4X65E 5C0XC
chains in the Genus database with same CATH topology
1EA6A 4DR3E 2O1VA 4PU9A 5A2QQ 2R3VA 4EMDA 4JI8E 4LF8I 3QT6A 4DR1E 1K47A 3PYGA 1VISA 1OJ4A 1N36E 4ZVIA 1ZXNA 2V34A 3ZZTA 2PNLA 3F0NA 4P52A 4JI6I 4LFBI 5BR8E 3ZKDA 4DR5E 4JI2I 3LPSA 4UTGA 1FI4A 4JYAE 1PKPA 4DV2E 1HR0I 4DV3I 3WU4A 3PRYA 4LF7E 2GQ0A 4DV1E 1J5EE 3HJCA 4B3RE 2Z5EA 2LJPA 1HNZI 4DV0E 4FWHA 1NHIA 3QT8A 1NHHA 2HKEA 4DV4E 4FWDA 3K1JA 1HNWI 4USMA 4JYAI 3J81C 1EI1A 4IZJB 1H74A 4I3HA 5FLXQ 4JI1I 1KKHA 1H7SA 2Z5CA 4DV0I 2UXDE 4USKA 4JI4I 1IBLI 2UXBE 4LFAI 2DEIA 4X62I 1B62A 4DV3E 4LF5I 2UUBE 2CGEA 1Z0CA 3CWVA 3LTOA 2UU9I 4DUZI 4YY3E 4DR2I 1N33E 3Q6NA 4NXME 1IBLE 4WUDA 4JI8I 1MX0A 1Z0BA 4GKKE 4LF9E 1N32E 2NPFA 4B3SE 4DPWA 4DR2E 5GMDA 1ZM3A 1Z59A 1Z0WA 1FJGE 4X62E 4GKKI 4X66I 2HFUA 2HKJA 3T1HE 4P7AA 4JV5E 1ZM2A 2V8PA 3K85A 1H73A 2ZM6E 3J81Q 4LF6E 3WU5A 1MG7A 2WW4A 3P06A 1S4EA 4IZJD 2V2ZA 2UXCE 4Z7YA 4DR7E 4DR7I 3PYDA 4HACB 3D4JA 4KHPE 1XMOE 4URLA 1USUA 4LF7I 2HK3A 1HNWE 4KQVA 3OTOI 2HFSA 4DV5E 5FWKA 4LF4I 4HY1A 2F4VI 1Z5CA 2EFGA 1H72C 3WU3A 1HNXI 3ZZUA 1UEKA 4YHHI 3M6AA 1IBKI 2J7KA 5IT9C 4DU7A 4DV2I 3B8HA 4DUZE 2UU9E 2O1WA 1Y6ZA 2OI2A 2UUAI 4OX9I 4FN5A 1RR9A 2Q2EB 4LF8E 4JG4A 1H7UA 2CG9A 4KHPI 4FWGA 4DR6E 1RREA 4PRXA 3K17A 1PIEA 4K0KI 4YY3I 1XHKA 2UUBI 1N0VC 2VQEE 4NXNE 1U2RA 2UUCE 4JI0E 4N3OA 2HK2A 3PYEA 4Z7CA 5IWAI 1XNQE 4RPFA 4DV1I 3T1YE 5LL6R 2Z5BB 2UUAE 1S16A 4MYUA 1Z0VA 4LFCE 1ZM9A 5BR8I 3GONA 4HYMA 4DUYI 2E5LE 1HNXE 2VQFI 4DU8A 2Z5CB 2AJ4A 4NXMI 1XNRI 1HR0E 3V2UC 1ZM4A 4DR1I 2IOQA 5IT9Q 4B3SI 5LMNI 4JI6E 4LFAE 3ZM7A 4YHHE 2E5LI 4DR4E 4DR4I 3JAMC 1IBMI 4M1KA 1B63A 4AQYI 2BM0A 4B3TE 4ED4A 1HK7A 4DV5I 1BKNA 4DPYA 2XEXA 1XNRE 3LNUA 1I94I 3QT5A 1FWLA 5L3JA 2IOPA 2O1TA 2PNMA 4R1FA 4JI5E 4X65I 3OTOE 1I94E 1ZXMA 4HXZA 4K0KE 3ZKBA 2Z5BA 4UT4A 3Q6MA 4JI3I 4LF9I 1IBME 3H4LA 3J80C 4DV6E 3T1HI 4B3ME 2R42A 1ELOA 4OX9E 1DARA 1N34I 1XMQI 3WU6A 1N32I 4IZKB 4JV5I 2V2QA 2E1RA 4DXLA 4B3MI 2VQFE 2HHHE 2HHHI 4GKJE 1N33I 4JI3E 1FJGI 4LF4E 2A2DA 1Z0TA 4JI7E 4X64I 4X64E 2ZITA 4WUCA 5LMUI 4DV7E 4IZJA 1N34E 4JI4E 2ZBKB 1WUUA 3PYFA 3T1YI 4IZKA 3J80Q 4JI5I 1XNQI 1KTVA 5GMEA 5FLXC 4DPXA 3ZZ0A 2O1UA 1A6FA 4LFCI 1XMQE 2VQEI 2UXBI 2GS8A 4LF6I 2UXDI 2ZM6I 4DR5I 2BM1A 4JI2E 4MYTA 5IWAE 4AQYE 1Y4SA 1NZ0A 1USVA 4B3RI 2UXCI 4DPUA 4DPTA 3HULA 1J5EI 1MU5A 4PRVA 2CZ9A 5LMNE 5LMUE 4DV7I 2VF3A 4DV4I 3B82A 4LFBE 2V2VA 1D6TA 1IBKE 2BV3A 1FNMA 1Y4UA 1HNZE 3JAMQ 1KIJA 3V5RA 1N36I 4X66E 1KVKA 2F4VE 1FWKA 4JI7I 1FKAE 4LF5E 1Z5BA 4B3TI 1PVGA 3J7AG 4GKJI 5A2QC 1Z5AA 3J7AM 4DR3I 4JI1E 2A2CA 3QT7A 1Z0GA 3Q1QA 4XTJA 2DEJA 1QZRA 2X36A 1XMOI 4DV6I 4DUYE 4WUBA 3B78A 4FW9A 2X7IA 1N0UA 4DR6I 4JI0I 2UUCI 4NXNI 4HACA 1Z0EA 1NHJA 4X65E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA6 A;  4DR3 E;  4PU9 A;  5A2Q Q;  2R3V A;  4EMD A;  4JI8 E;  4LF8 I;  3QT6 A;  4DR1 E;  1K47 A;  3PYG A;  1VIS A;  1OJ4 A;  1N36 E;  4ZVI A;  1ZXN A;  2V34 A;  3ZZT A;  3F0N A;  4P52 A;  4JI6 I;  4LFB I;  5BR8 E;  3ZKD A;  4DR5 E;  4JI2 I;  3LPS A;  4UTG A;  1FI4 A;  4JYA E;  1PKP A;  4DV2 E;  1HR0 I;  4DV3 I;  3WU4 A;  4LF7 E;  1J5E E;  4DV1 E;  4B3R E;  2LJP A;  1HNZ I;  4DV0 E;  4FWH A;  1NHI A;  3QT8 A;  1NHH A;  2HKE A;  4DV4 E;  4FWD A;  3K1J A;  1HNW I;  4USM A;  4JYA I;  3J81 C;  1EI1 A;  1H74 A;  4I3H A;  5FLX Q;  4JI1 I;  1KKH A;  1H7S A;  4DV0 I;  2UXD E;  4USK A;  4JI4 I;  1IBL I;  2UXB E;  4LFA I;  2DEI A;  4X62 I;  4LF5 I;  1B62 A;  4DV3 E;  2UUB E;  1Z0C A;  3CWV A;  3LTO A;  2UU9 I;  4DUZ I;  4YY3 E;  4DR2 I;  1N33 E;  4NXM E;  1IBL E;  4WUD A;  4JI8 I;  1MX0 A;  1Z0B A;  4GKK E;  4LF9 E;  1N32 E;  2NPF A;  4B3S E;  4DPW A;  4DR2 E;  5GMD A;  1ZM3 A;  1Z59 A;  1Z0W A;  1FJG E;  4X62 E;  4GKK I;  4X66 I;  2HFU A;  2HKJ A;  3T1H E;  4P7A A;  4JV5 E;  1ZM2 A;  2V8P A;  1H73 A;  2ZM6 E;  3J81 Q;  4LF6 E;  3WU5 A;  1MG7 A;  2WW4 A;  1S4E A;  2V2Z A;  2UXC E;  4Z7Y A;  4DR7 E;  4DR7 I;  3PYD A;  4HAC B;  3D4J A;  4KHP E;  1XMO E;  4URL A;  4LF7 I;  2HK3 A;  1HNW E;  4KQV A;  3OTO I;  2HFS A;  4DV5 E;  4LF4 I;  4HY1 A;  2F4V I;  1Z5C A;  2EFG A;  1H72 C;  3WU3 A;  1HNX I;  3ZZU A;  1UEK A;  4YHH I;  3M6A A;  1IBK I;  2J7K A;  5IT9 C;  4DU7 A;  4DV2 I;  3B8H A;  4DUZ E;  2UU9 E;  2OI2 A;  2UUA I;  4OX9 I;  4FN5 A;  1RR9 A;  2Q2E B;  4LF8 E;  4JG4 A;  1H7U A;  4KHP I;  4FWG A;  4DR6 E;  1RRE A;  4PRX A;  3K17 A;  1PIE A;  4K0K I;  4YY3 I;  1XHK A;  2UUB I;  1N0V C;  2VQE E;  4NXN E;  1U2R A;  2UUC E;  4JI0 E;  2HK2 A;  3PYE A;  4Z7C A;  5IWA I;  1XNQ E;  4RPF A;  4DV1 I;  3T1Y E;  5LL6 R;  2UUA E;  1S16 A;  4MYU A;  1Z0V A;  4LFC E;  1ZM9 A;  5BR8 I;  3GON A;  4HYM A;  4DUY I;  2E5L E;  1HNX E;  2VQF I;  4DU8 A;  2AJ4 A;  4NXM I;  1XNR I;  1HR0 E;  3V2U C;  1ZM4 A;  4DR1 I;  5IT9 Q;  4B3S I;  5LMN I;  4JI6 E;  4LFA E;  3ZM7 A;  4YHH E;  2E5L I;  4DR4 E;  4DR4 I;  3JAM C;  1IBM I;  4M1K A;  1B63 A;  4AQY I;  2BM0 A;  4B3T E;  4ED4 A;  4DV5 I;  1BKN A;  4DPY A;  2XEX A;  1XNR E;  3LNU A;  1I94 I;  3QT5 A;  1FWL A;  5L3J A;  4R1F A;  4JI5 E;  4X65 I;  3OTO E;  1I94 E;  1ZXM A;  4HXZ A;  4K0K E;  3ZKB A;  4UT4 A;  4JI3 I;  4LF9 I;  1IBM E;  3H4L A;  3J80 C;  4DV6 E;  3T1H I;  4B3M E;  2R42 A;  1ELO A;  4OX9 E;  1DAR A;  1N34 I;  1XMQ I;  3WU6 A;  1N32 I;  4JV5 I;  2V2Q A;  2E1R A;  4DXL A;  4B3M I;  2VQF E;  2HHH E;  2HHH I;  4GKJ E;  1N33 I;  4JI3 E;  1FJG I;  4LF4 E;  2A2D A;  1Z0T A;  4JI7 E;  4X64 I;  4X64 E;  2ZIT A;  4WUC A;  5LMU I;  4DV7 E;  1N34 E;  4JI4 E;  2ZBK B;  1WUU A;  3PYF A;  3T1Y I;  3J80 Q;  4JI5 I;  1XNQ I;  1KTV A;  5GME A;  5FLX C;  4DPX A;  3ZZ0 A;  1A6F A;  4LFC I;  1XMQ E;  2VQE I;  2UXB I;  2GS8 A;  4LF6 I;  2UXD I;  2ZM6 I;  4DR5 I;  2BM1 A;  4JI2 E;  4MYT A;  5IWA E;  4AQY E;  1NZ0 A;  4B3R I;  2UXC I;  4DPU A;  4DPT A;  3HUL A;  1J5E I;  1MU5 A;  4PRV A;  2CZ9 A;  5LMN E;  5LMU E;  4DV7 I;  2VF3 A;  4DV4 I;  3B82 A;  4LFB E;  2V2V A;  1D6T A;  1IBK E;  2BV3 A;  1FNM A;  1HNZ E;  3JAM Q;  1KIJ A;  3V5R A;  1N36 I;  4X66 E;  1KVK A;  2F4V E;  1FWK A;  4JI7 I;  1FKA E;  4LF5 E;  1Z5B A;  4B3T I;  1PVG A;  3J7A G;  4GKJ I;  5A2Q C;  1Z5A A;  3J7A M;  4DR3 I;  4JI1 E;  2A2C A;  3QT7 A;  1Z0G A;  3Q1Q A;  4XTJ A;  2DEJ A;  1QZR A;  2X36 A;  1XMO I;  4DV6 I;  4DUY E;  4WUB A;  3B78 A;  4FW9 A;  2X7I A;  1N0U A;  4DR6 I;  4JI0 I;  2UUC I;  4NXN I;  4HAC A;  1Z0E A;  1NHJ A;  4X65 E; 
#chains in the Genus database with same CATH topology
 4QNJ A;  1EA6 A;  4DR3 E;  2C39 B;  2PO1 A;  2O1V A;  4GQU A;  2GO4 A;  4PU9 A;  5A2Q Q;  2R3V A;  4EMD A;  4JI8 E;  4LF8 I;  3QT6 A;  4BA1 B;  4DR1 E;  2JEA A;  3L7Z B;  1K47 A;  4OO1 A;  3PYG A;  1VIS A;  1OJ4 A;  1N36 E;  2WNR B;  5ELW A;  4ZVI A;  1ZXN A;  2V34 A;  4MU4 A;  3ZZT A;  4OKG A;  2PNL A;  3F0N A;  4P52 A;  4JI6 I;  2JT2 A;  4LFB I;  5BR8 E;  3ZKD A;  4DR5 E;  4JI2 I;  3LPS A;  2JEB B;  5C0X B;  4UTG A;  4OO1 C;  1FI4 A;  4JYA E;  1PKP A;  4DV2 E;  1HR0 I;  4DV3 I;  3WU4 A;  5JEA E;  3PRY A;  4LF7 E;  2GQ0 A;  4DV1 E;  1J5E E;  3HJC A;  2BA1 D;  4B3R E;  2Z5E A;  2LJP A;  1HNZ I;  4DV0 E;  2F1D A;  4FWH A;  4LPF A;  1NHI A;  3QT8 A;  1NHH A;  2HKE A;  4DV4 E;  4FWD A;  1UDO A;  3K1J A;  1HNW I;  4USM A;  2NN6 A;  4JYA I;  3J81 C;  1EI1 A;  4IZJ B;  4AIM A;  1H74 A;  4I3H A;  5FLX Q;  4JI1 I;  1KKH A;  1H7S A;  2Z5C A;  4DV0 I;  4FW4 A;  2BR2 B;  2UXD E;  4USK A;  4JI4 I;  5EKW A;  1IBL I;  2UXB E;  4LFA I;  2DEI A;  4X62 I;  1B62 A;  4DV3 E;  4LF5 I;  2UUB E;  1Z0C A;  2CGE A;  3CWV A;  3LTO A;  2UU9 I;  4LCH A;  4DUZ I;  2BA0 D;  4YY3 E;  4DR2 I;  1N33 E;  2JEA B;  3Q6N A;  1E3P A;  4NXM E;  3M85 G;  1IBL E;  4WUD A;  4JI8 I;  2WP8 B;  1MX0 A;  1Z0B A;  2J65 A;  4GKK E;  4LF9 E;  2JEB A;  5C0X A;  1N32 E;  2JE6 B;  2NPF A;  4B3S E;  4DPW A;  4DR2 E;  5GMD A;  1ZM3 A;  1Z59 A;  2JE6 A;  4FW3 A;  1Z0W A;  4IFD B;  1FJG E;  3GCM A;  4X62 E;  4GKK I;  4X66 I;  3KRN A;  2HFU A;  2HKJ A;  3T1H E;  4P7A A;  3U1Y A;  4JV5 E;  1RHY A;  1ZM2 A;  2V8P A;  5K36 A;  1R6L A;  1H73 A;  3K85 A;  4OZE A;  2ZM6 E;  3J81 Q;  4LF6 E;  3WU5 A;  1MG7 A;  2WW4 A;  3P06 A;  2C37 B;  2NN6 D;  1S4E A;  4BA2 A;  4MU3 A;  4IZJ D;  2V2Z A;  4OO1 E;  2UXC E;  4Z7Y A;  4DR7 E;  4IFD E;  5DRP A;  4DR7 I;  3PYD A;  4HAC B;  3D4J A;  4KHP E;  5C0X D;  1XMO E;  4URL A;  1USU A;  4MU1 A;  4LF7 I;  2HK3 A;  1HNW E;  4KQV A;  3OTO I;  2HFS A;  2PO2 A;  4DV5 E;  5FWK A;  5JEA F;  4LF4 I;  4HY1 A;  2F4V I;  1Z5C A;  2EFG A;  1YHC A;  1H72 C;  2BA1 G;  3WU3 A;  1HNX I;  3ZZU A;  1UEK A;  4YHH I;  3M6A A;  1IBK I;  2J7K A;  5IT9 C;  4DU7 A;  4DV2 I;  1OYR A;  3B8H A;  4DUZ E;  2UU9 E;  2O1W A;  3P76 A;  1Y6Z A;  3M85 D;  2OI2 A;  2UUA I;  4OX9 I;  4FN5 A;  1RR9 A;  2Q2E B;  4LF8 E;  4IFD C;  4JG4 A;  1H7U A;  2CG9 A;  4KHP I;  4FWG A;  4DR6 E;  4FW7 A;  1RRE A;  1OYS A;  4PRX A;  3K17 A;  5K36 D;  1PIE A;  5C0X F;  4K0K I;  4YY3 I;  1XHK A;  3PS3 A;  5K36 F;  2UUB I;  1N0V C;  2VQE E;  1E3H A;  4NXN E;  1U2R A;  2UUC E;  4JI0 E;  5JEA A;  4N3O A;  4J3D A;  2HK2 A;  3PYE A;  4Z7C A;  5IWA I;  1XNQ E;  4RPF A;  3H1C A;  4DV1 I;  3T1Y E;  4IFD D;  4NBQ A;  2PO2 B;  2CVE A;  5LL6 R;  2Z5B B;  2UUA E;  1S16 A;  4MYU A;  4LCF A;  1Z0V A;  4LFC E;  1ZM9 A;  5BR8 I;  1P42 A;  4BA2 B;  3GON A;  4HYM A;  1XXE A;  4DUY I;  2E5L E;  1HNX E;  2VQF I;  4DU8 A;  2Z5C B;  2AJ4 A;  4NXM I;  1XNR I;  1HR0 E;  3DD6 A;  3V2U C;  1ZM4 A;  4DR1 I;  2AE8 A;  2IOQ A;  5IT9 Q;  4B3S I;  5LMN I;  4JI6 E;  4LFA E;  3ZM7 A;  5JEA D;  3GME A;  4YHH E;  2BA0 G;  4IS9 A;  2E5L I;  3L7Z A;  4DR4 E;  4DR4 I;  2GO3 A;  2NN6 F;  3CDJ A;  2VES A;  3JAM C;  4M1K A;  1IBM I;  1B63 A;  4AQY I;  2BM0 A;  1VI7 A;  4B3T E;  5DNL A;  4ED4 A;  5DNX A;  4IFD A;  1HK7 A;  4DV5 I;  1BKN A;  4DPY A;  2XEX A;  4U3D A;  1R6M A;  1XNR E;  3LNU A;  1I94 I;  3QT5 A;  1FWL A;  5L3J A;  3PS1 A;  2IOP A;  5K36 C;  2O1T A;  5DRR A;  2PNM A;  4R1F A;  4JI5 E;  4X65 I;  3P3E A;  4ISA A;  5K36 E;  3OTO E;  4BA1 A;  4FW6 A;  3GLL A;  1I94 E;  1ZXM A;  4HXZ A;  2C38 A;  4K0K E;  3ZKB A;  2Z5B A;  4UT4 A;  2NN6 B;  3Q6M A;  4JI3 I;  2C38 B;  4LF9 I;  5DRO A;  1IBM E;  3H4L A;  1Y5Y A;  4AID A;  3J80 C;  4DV6 E;  3T1H I;  4B3M E;  2R42 A;  1ELO A;  4OX9 E;  1DAR A;  1N34 I;  1XMQ I;  3WU6 A;  2WNR A;  1N32 I;  4IZK B;  3M7N D;  2V2Q A;  4JV5 I;  2E1R A;  4DXL A;  4B3M I;  2VQF E;  3P3C A;  2HHH E;  2HHH I;  5K36 B;  4U3B A;  4GKJ E;  1N33 I;  4JI3 E;  1FJG I;  4LF4 E;  4FW5 A;  2A2D A;  4QNK A;  1Z0T A;  4JI7 E;  4X64 I;  2C37 A;  4X64 E;  2NN6 C;  2ZIT A;  5EL9 A;  4WUC A;  5LMU I;  4DV7 E;  4IZJ A;  1N34 E;  4JI4 E;  2ZBK B;  1WUU A;  3PYF A;  5DRQ A;  3T1Y I;  4IZK A;  3J80 Q;  4JI5 I;  4OO1 F;  1XNQ I;  1KTV A;  5GME A;  3UHM A;  1UDN A;  4DPX A;  5FLX C;  3ZZ0 A;  2O1U A;  1A6F A;  4LOM A;  4LFC I;  1XMQ E;  2VQE I;  4MQY A;  2IES A;  2UXB I;  2GS8 A;  4LF6 I;  2PNZ A;  2UXD I;  2ZM6 I;  4DR5 I;  2BM1 A;  4JI2 E;  4MYT A;  5IWA E;  4AQY E;  1Y4S A;  1NZ0 A;  1USV A;  4B3R I;  2UXC I;  4DPU A;  4DPT A;  3HUL A;  1J5E I;  3NZK A;  1MU5 A;  4MDT A;  4PRV A;  3P3G A;  2CZ9 A;  4AM3 A;  5LMN E;  5LMU E;  4DV7 I;  2VF3 A;  4DV4 I;  2PO0 B;  3B82 A;  3U1K A;  4OO1 D;  4LFB E;  2V2V A;  5JEA B;  1D6T A;  1IBK E;  1OYP A;  2BV3 A;  1FNM A;  1Y4U A;  1HNZ E;  3JAM Q;  1KIJ A;  5C0X E;  3V5R A;  1N36 I;  1UDS A;  4X66 E;  1KVK A;  4OO1 B;  4MU0 A;  2F4V E;  2NN6 E;  2BR2 A;  3B4T A;  1FWK A;  2WP8 A;  4JI7 I;  1FKA E;  4LF5 E;  1Z5B A;  3HKM A;  4B3T I;  1PVG A;  3J7A G;  4GKJ I;  4LCG A;  5A2Q C;  3PS2 A;  1Z5A A;  3J7A M;  4DR3 I;  4JI1 E;  2A2C A;  3QT7 A;  2O3Z A;  5JEA C;  1Z0G A;  3Q1Q A;  1UDQ A;  4XTJ A;  2DEJ A;  1YH8 A;  1QZR A;  2X36 A;  2IER A;  1XMO I;  3CDI A;  4DV6 I;  4DUY E;  3M7N G;  4WUB A;  3B78 A;  4FW9 A;  2PNZ B;  1Y60 A;  2X7I A;  1N0U A;  4DR6 I;  4JI0 I;  2UUC I;  4IFD F;  4NXN I;  2PO0 A;  4HAC A;  1Z0E A;  1NHJ A;  2C39 A;  2PO1 B;  4X65 E;  5C0X C; 
#chains in the Genus database with same CATH homology
 1EA6 A;  4DR3 E;  2O1V A;  4PU9 A;  5A2Q Q;  2R3V A;  4EMD A;  4JI8 E;  4LF8 I;  3QT6 A;  4DR1 E;  1K47 A;  3PYG A;  1VIS A;  1OJ4 A;  1N36 E;  4ZVI A;  1ZXN A;  2V34 A;  3ZZT A;  2PNL A;  3F0N A;  4P52 A;  4JI6 I;  4LFB I;  5BR8 E;  3ZKD A;  4DR5 E;  4JI2 I;  3LPS A;  4UTG A;  1FI4 A;  4JYA E;  1PKP A;  4DV2 E;  1HR0 I;  4DV3 I;  3WU4 A;  3PRY A;  4LF7 E;  2GQ0 A;  4DV1 E;  1J5E E;  3HJC A;  4B3R E;  2Z5E A;  2LJP A;  1HNZ I;  4DV0 E;  4FWH A;  1NHI A;  3QT8 A;  1NHH A;  2HKE A;  4DV4 E;  4FWD A;  3K1J A;  1HNW I;  4USM A;  4JYA I;  3J81 C;  1EI1 A;  4IZJ B;  1H74 A;  4I3H A;  5FLX Q;  4JI1 I;  1KKH A;  1H7S A;  2Z5C A;  4DV0 I;  2UXD E;  4USK A;  4JI4 I;  1IBL I;  2UXB E;  4LFA I;  2DEI A;  4X62 I;  1B62 A;  4DV3 E;  4LF5 I;  2UUB E;  2CGE A;  1Z0C A;  3CWV A;  3LTO A;  2UU9 I;  4DUZ I;  4YY3 E;  4DR2 I;  1N33 E;  3Q6N A;  4NXM E;  1IBL E;  4WUD A;  4JI8 I;  1MX0 A;  1Z0B A;  4GKK E;  4LF9 E;  1N32 E;  2NPF A;  4B3S E;  4DPW A;  4DR2 E;  5GMD A;  1ZM3 A;  1Z59 A;  1Z0W A;  1FJG E;  4X62 E;  4GKK I;  4X66 I;  2HFU A;  2HKJ A;  3T1H E;  4P7A A;  4JV5 E;  1ZM2 A;  2V8P A;  3K85 A;  1H73 A;  2ZM6 E;  3J81 Q;  4LF6 E;  3WU5 A;  1MG7 A;  2WW4 A;  3P06 A;  1S4E A;  4IZJ D;  2V2Z A;  2UXC E;  4Z7Y A;  4DR7 E;  4DR7 I;  3PYD A;  4HAC B;  3D4J A;  4KHP E;  1XMO E;  4URL A;  1USU A;  4LF7 I;  2HK3 A;  1HNW E;  4KQV A;  3OTO I;  2HFS A;  4DV5 E;  5FWK A;  4LF4 I;  4HY1 A;  2F4V I;  1Z5C A;  2EFG A;  1H72 C;  3WU3 A;  1HNX I;  3ZZU A;  1UEK A;  4YHH I;  3M6A A;  1IBK I;  2J7K A;  5IT9 C;  4DU7 A;  4DV2 I;  3B8H A;  4DUZ E;  2UU9 E;  2O1W A;  1Y6Z A;  2OI2 A;  2UUA I;  4OX9 I;  4FN5 A;  1RR9 A;  2Q2E B;  4LF8 E;  4JG4 A;  1H7U A;  2CG9 A;  4KHP I;  4FWG A;  4DR6 E;  1RRE A;  4PRX A;  3K17 A;  1PIE A;  4K0K I;  4YY3 I;  1XHK A;  2UUB I;  1N0V C;  2VQE E;  4NXN E;  1U2R A;  2UUC E;  4JI0 E;  4N3O A;  2HK2 A;  3PYE A;  4Z7C A;  5IWA I;  1XNQ E;  4RPF A;  4DV1 I;  3T1Y E;  5LL6 R;  2Z5B B;  2UUA E;  1S16 A;  4MYU A;  1Z0V A;  4LFC E;  1ZM9 A;  5BR8 I;  3GON A;  4HYM A;  4DUY I;  2E5L E;  1HNX E;  2VQF I;  4DU8 A;  2Z5C B;  2AJ4 A;  4NXM I;  1XNR I;  1HR0 E;  3V2U C;  1ZM4 A;  4DR1 I;  2IOQ A;  5IT9 Q;  4B3S I;  5LMN I;  4JI6 E;  4LFA E;  3ZM7 A;  4YHH E;  2E5L I;  4DR4 E;  4DR4 I;  3JAM C;  1IBM I;  4M1K A;  1B63 A;  4AQY I;  2BM0 A;  4B3T E;  4ED4 A;  1HK7 A;  4DV5 I;  1BKN A;  4DPY A;  2XEX A;  1XNR E;  3LNU A;  1I94 I;  3QT5 A;  1FWL A;  5L3J A;  2IOP A;  2O1T A;  2PNM A;  4R1F A;  4JI5 E;  4X65 I;  3OTO E;  1I94 E;  1ZXM A;  4HXZ A;  4K0K E;  3ZKB A;  2Z5B A;  4UT4 A;  3Q6M A;  4JI3 I;  4LF9 I;  1IBM E;  3H4L A;  3J80 C;  4DV6 E;  3T1H I;  4B3M E;  2R42 A;  1ELO A;  4OX9 E;  1DAR A;  1N34 I;  1XMQ I;  3WU6 A;  1N32 I;  4IZK B;  4JV5 I;  2V2Q A;  2E1R A;  4DXL A;  4B3M I;  2VQF E;  2HHH E;  2HHH I;  4GKJ E;  1N33 I;  4JI3 E;  1FJG I;  4LF4 E;  2A2D A;  1Z0T A;  4JI7 E;  4X64 I;  4X64 E;  2ZIT A;  4WUC A;  5LMU I;  4DV7 E;  4IZJ A;  1N34 E;  4JI4 E;  2ZBK B;  1WUU A;  3PYF A;  3T1Y I;  4IZK A;  3J80 Q;  4JI5 I;  1XNQ I;  1KTV A;  5GME A;  5FLX C;  4DPX A;  3ZZ0 A;  2O1U A;  1A6F A;  4LFC I;  1XMQ E;  2VQE I;  2UXB I;  2GS8 A;  4LF6 I;  2UXD I;  2ZM6 I;  4DR5 I;  2BM1 A;  4JI2 E;  4MYT A;  5IWA E;  4AQY E;  1Y4S A;  1NZ0 A;  1USV A;  4B3R I;  2UXC I;  4DPU A;  4DPT A;  3HUL A;  1J5E I;  1MU5 A;  4PRV A;  2CZ9 A;  5LMN E;  5LMU E;  4DV7 I;  2VF3 A;  4DV4 I;  3B82 A;  4LFB E;  2V2V A;  1D6T A;  1IBK E;  2BV3 A;  1FNM A;  1Y4U A;  1HNZ E;  3JAM Q;  1KIJ A;  3V5R A;  1N36 I;  4X66 E;  1KVK A;  2F4V E;  1FWK A;  4JI7 I;  1FKA E;  4LF5 E;  1Z5B A;  4B3T I;  1PVG A;  3J7A G;  4GKJ I;  5A2Q C;  1Z5A A;  3J7A M;  4DR3 I;  4JI1 E;  2A2C A;  3QT7 A;  1Z0G A;  3Q1Q A;  4XTJ A;  2DEJ A;  1QZR A;  2X36 A;  1XMO I;  4DV6 I;  4DUY E;  4WUB A;  3B78 A;  4FW9 A;  2X7I A;  1N0U A;  4DR6 I;  4JI0 I;  2UUC I;  4NXN I;  4HAC A;  1Z0E A;  1NHJ A;  4X65 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...