4JYAI

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jyaI00
4DR3I 4DU8A 4JG4A 4DUZE 2UU9E 4YY3I 5BR8E 1D6TA 3ZZ0A 1DARA 1H7SA 4DV5I 1HR0I 1XHKA 4P52A 2ZBKB 2UUCE 4DPYA 5IWAE 1N33E 4USKA 4DR5I 1MG7A 4JI2E 2UXCI 3T1HI 3M6AA 4HY1A 2DEIA 1N0UA 2XEXA 5LMUE 4DV3E 4PRXA 1HNZI 4DPXA 4PRVA 4WUDA 3ZKBA 3QT7A 4Z7CA 2UUBE 4HACB 2DEJA 1XNQE 4GKKI 4NXNE 3HULA 1HNWE 4LF5E 1FKAE 1Z5BA 4X64E 4X65E 2HK3A 4JI3E 4DR2E 1FJGE 4FW9A 2V34A 1XNRI 1KTVA 2A2DA 4B3TE 2V2VA 2ZM6E 4XTJA 4JI0E 2F4VI 1IBME 3Q1QA 2UUAE 3F0NA 4UT4A 4DV0E 3OTOI 1N32I 3ZKDA 3OTOE 2VF3A 1N32E 4DV0I 1B63A 1Z0VA 4LF7I 4MYUA 3B78A 4LF4E 4DPTA 4DR7I 4DV7E 1IBKI 4EMDA 4ED4A 3J7AM 4JI8I 4LF8E 3LNUA 4DR4E 4B3MI 4DR2I 4JI5E 1S4EA 1B62A 4DR6I 4DV1I 1S16A 3ZZTA 3QT5A 4X62E 3J80C 4X62I 1HNWI 3K17A 5L3JA 4JI4I 1VISA 2LJPA 1H73A 4B3ME 3J7AG 4LF8I 3K1JA 3WU6A 1Z5CA 4DV3I 4DUYE 4FWGA 4DV7I 3T1HE 4DR1I 1I94E 2E5LI 4LF7E 4HYMA 2E1RA 4M1KA 1N33I 5IWAI 4JI7E 5FLXC 1ZM4A 1KVKA 3GONA 2HKEA 4LFCI 4LFBE 4DPWA 1Z0BA 3WU4A 1RR9A 4JI1E 4JI0I 2F4VE 5A2QC 4USMA 2A2CA 1H72C 2ZM6I 4WUCA 1NHHA 4JI6E 4B3RE 3V5RA 2HFSA 1N0VC 1J5EE 2UXBI 3CWVA 4JI3I 4X65I 3PYDA 4LF5I 2ZITA 4DV6E 4GKKE 3PYFA 1QZRA 1J5EI 2UUBI 1Z0CA 1HNXI 1HNZE 1Z0GA 5LMUI 4HXZA 4JI1I 4LF6E 1ZXMA 1N36E 4I3HA 4JV5I 2UXCE 1ZM2A 2V2ZA 4LFBI 1K47A 4P7AA 4KHPI 1XMQE 4K0KE 5GMDA 2X36A 2HKJA 4JI7I 4WUBA 1XMOE 1MX0A 5A2QQ 1I94I 5FLXQ 2E5LE 4DR1E 2UU9I 1N36I 3H4LA 3QT6A 4OX9E 2UXDI 4GKJE 3JAMQ 3D4JA 3ZZUA 1Z59A 2GS8A 4JI4E 2Q2EB 4LFAI 1WUUA 3PYGA 4HACA 4X66I 4DV4E 3PYEA 2UXBE 4JI5I 3B8HA 4URLA 3JAMC 3T1YI 4DR4I 1EA6A 1EI1A 1Z0WA 1IBKE 3LPSA 1KIJA 1FI4A 2HHHI 2AJ4A 4DPUA 4UTGA 3ZM7A 4LF4I 1Z0TA 1U2RA 2EFGA 4LFCE 2HFUA 1H74A 2VQFI 1H7UA 2R3VA 3J81Q 2UUAI 4ZVIA 1IBMI 2BM0A 1OJ4A 5LMNE 4DUYI 2X7IA 4DXLA 1N34E 4JYAI 1XNRE 1N34I 4AQYI 3V2UC 5LMNI 1BKNA 2BM1A 4X64I 1KKHA 2V2QA 1IBLE 4NXME 2V8PA 4NXNI 1XNQI 4DV1E 4DV2E 1NHJA 2HK2A 4DR6E 2VQFE 1PIEA 1Z5AA 4JI8E 4YHHE 4RPFA 3B82A 4DR7E 3QT8A 4JI2I 2OI2A 4DR5E 4YHHI 2UUCI 3T1YE 1ZXNA 1ZM9A 2WW4A 1HR0E 1MU5A 4DV5E 1A6FA 2R42A 4FWDA 4DV2I 3J80Q 4KQVA 1IBLI 4NXMI 1FWLA 4LFAE 4DUZI 4FWHA 1Z0EA 4B3TI 4AQYE 4JYAE 4B3SE 1NHIA 1PVGA 4OX9I 1FJGI 1FWKA 3J81C 4PU9A 1XMOI 4DU7A 3LTOA 1XMQI 4K0KI 3WU3A 4KHPE 1ZM3A 2J7KA 5IT9Q 4LF9I 4R1FA 4JV5E 5GMEA 4LF6I 2HHHE 4LF9E 1ELOA 1HNXE 1UEKA 1PKPA 2BV3A 5LL6R 4DV4I 4X66E 4DV6I 1FNMA 5BR8I 4YY3E 1RREA 4MYTA 4DR3E 2VQEE 1NZ0A 4FN5A 4B3SI 5IT9C 2NPFA 4Z7YA 4JI6I 4B3RI 3WU5A 2CZ9A 4GKJI 2UXDE 2VQEI
chains in the Genus database with same CATH superfamily
4DR3I 1Y60A 2PNLA 4IFDE 4DU8A 4JG4A 4DUZE 2UU9E 3P06A 4YY3I 4FW5A 2PO0A 5BR8E 1D6TA 2JEBB 3ZZ0A 1DARA 2BA1D 1H7SA 4DV5I 2PO2B 1HR0I 1XHKA 4P52A 2ZBKB 2UUCE 4DPYA 5C0XB 4J3DA 5IWAE 1N33E 5C0XA 4USKA 4DR5I 1MG7A 4JI2E 2NN6B 3GCMA 2UXCI 1UDOA 3T1HI 3M6AA 4HY1A 2DEIA 1Y4UA 4IS9A 2PNZB 2F1DA 3UHMA 1N0UA 2IESA 2XEXA 5LMUE 4DV3E 4PRXA 1HNZI 4DPXA 3L7ZB 4PRVA 4WUDA 1OYRA 4MU0A 3QT7A 3ZKBA 4Z7CA 2PNMA 2UUBE 4HACB 2DEJA 5JEAF 1XNQE 4GKKI 4NXNE 3HULA 1HNWE 2Z5CA 4LF5E 1FKAE 1Z5BA 2O3ZA 4X64E 2NN6F 1OYPA 1UDSA 2HK3A 4X65E 4JI3E 4DR2E 1FJGE 4FW9A 4OO1D 2V34A 2O1UA 1XNRI 1KTVA 2JE6A 2A2DA 1E3PA 4B3TE 2V2VA 2ZM6E 2NN6D 4XTJA 4JI0E 2F4VI 1IBME 3Q1QA 5K36A 2C38A 2PO0B 2UUAE 3F0NA 4UT4A 2PO1B 4DV0E 3OTOI 1N32I 3ZKDA 3M85D 3OTOE 2VF3A 1N32E 5DRRA 1XXEA 4DV0I 1B63A 1Z0VA 2NN6A 4LF7I 3Q6MA 4MYUA 3B78A 4LF4E 4DPTA 4U3BA 2Z5EA 4DR7I 5JEAA 4DV7E 3PS1A 1IBKI 4EMDA 4ED4A 3J7AM 4JI8I 4LF8E 2BA0D 3LNUA 4DR4E 3P3GA 4B3MI 4DR2I 5DRQA 4JI5E 1S4EA 1B62A 4DR6I 4DV1I 1S16A 3ZZTA 2Z5BB 3QT5A 4X62E 3J80C 4X62I 1HNWI 4BA2B 3K17A 2JEAA 5L3JA 4JI4I 1VISA 2LJPA 1Y5YA 1H73A 4BA1B 4B3ME 2NN6E 5DNLA 2J65A 3J7AG 4AM3A 4LF8I 3K1JA 4ISAA 1Z5CA 2VESA 3WU6A 4DV3I 4DUYE 4FWGA 4DV7I 1USUA 5JEAE 4AIMA 3T1HE 4DR1I 1I94E 2E5LI 4LF7E 4HYMA 2E1RA 4M1KA 1N33I 5IWAI 4JI7E 5FLXC 1ZM4A 1KVKA 4QNJA 3GONA 2HKEA 4IFDD 2BR2A 4LFCI 2BR2B 1USVA 4LFBE 2O1TA 4FW3A 4DPWA 2O1VA 1Z0BA 3KRNA 3WU4A 1RR9A 4JI1E 4JI0I 2F4VE 5A2QC 4USMA 2A2CA 1H72C 2ZM6I 4WUCA 5EL9A 1NHHA 4JI6E 4B3RE 3V5RA 2HFSA 1N0VC 2WP8A 1J5EE 1VI7A 2UXBI 3CWVA 4JI3I 4X65I 3PYDA 4LF5I 2GQ0A 2ZITA 4DV6E 3U1YA 2PO1A 3PYFA 4GKKE 5C0XC 1QZRA 3CDIA 1J5EI 2UUBI 1YHCA 4FW4A 4OO1A 1Z0CA 1HNXI 1HNZE 1Z0GA 5LMUI 4HXZA 3HJCA 4JI1I 4LF6E 1ZXMA 4IZKB 1N36E 4I3HA 4JV5I 4IFDC 3U1KA 2UXCE 1ZM2A 2V2ZA 2GO3A 4LFBI 1K47A 4P7AA 4KHPI 3H1CA 1XMQE 4K0KE 5GMDA 2X36A 2HKJA 4JI7I 4WUBA 2C39A 1XMOE 3M7ND 1MX0A 4IZJB 5A2QQ 1I94I 5FLXQ 2E5LE 4DR1E 2UU9I 4BA2A 4LOMA 1N36I 3H4LA 2JE6B 3QT6A 4OX9E 2UXDI 4GKJE 3JAMQ 1YH8A 3D4JA 3ZZUA 1Z59A 2GS8A 3GLLA 2JEBA 4QNKA 4JI4E 2Q2EB 4MU1A 4LFAI 3K85A 1RHYA 1WUUA 3PYGA 4HACA 2C39B 4X66I 4DV4E 2O1WA 3PYEA 1UDQA 2UXBE 1R6MA 4OKGA 3B8HA 4URLA 4JI5I 3JAMC 3T1YI 4DR4I 1EA6A 1EI1A 1Z0WA 1IBKE 3LPSA 1KIJA 1FI4A 2HHHI 2AJ4A 2WNRA 4MDTA 4DPUA 5K36F 4U3DA 2C38B 4UTGA 3ZM7A 4LF4I 3P76A 2C37A 1Z0TA 4AIDA 1U2RA 2EFGA 5K36E 1E3HA 4LFCE 2HFUA 1H74A 2VQFI 2C37B 1H7UA 2R3VA 3J81Q 2PO2A 2UUAI 4IZJA 2CVEA 4N3OA 5DRPA 4ZVIA 1IBMI 2BM0A 1OJ4A 5LMNE 4DUYI 2X7IA 4DXLA 1N34E 4JYAI 1XNRE 2PNZA 1N34I 4AQYI 4NBQA 3V2UC 5LMNI 1BKNA 2BM1A 2IOQA 4X64I 1KKHA 2V2QA 5K36B 4LCFA 1IBLE 4NXME 2V8PA 4NXNI 1XNQI 4DV1E 4DV2E 1NHJA 2HK2A 4DR6E 4MQYA 4OO1B 3PS2A 3M85G 2VQFE 3M7NG 3P3EA 1PIEA 1R6LA 1Z5AA 4JI8E 4YHHE 4RPFA 3B82A 4DR7E 3QT8A 2WNRB 4JI2I 2CGEA 2OI2A 4DR5E 4YHHI 1HK7A 1Y4SA 2UUCI 2GO4A 3T1YE 5K36C 1ZXNA 1ZM9A 2WW4A 1HR0E 4OO1F 1MU5A 1A6FA 4LPFA 4DV5E 2R42A 4FWDA 4DV2I 3J80Q 4KQVA 3DD6A 5K36D 3Q6NA 4OO1C 1IBLI 2Z5BA 3HKMA 4NXMI 1FWLA 4LFAE 4DUZI 4FWHA 2JEAB 5ELWA 3B4TA 1Z0EA 2NN6C 4B3TI 2AE8A 4AQYE 4MU4A 4JYAE 4IFDF 3NZKA 4IFDA 4B3SE 1NHIA 4FW7A 1PVGA 4OX9I 5JEAC 5JEAB 1FJGI 4FW6A 1FWKA 3J81C 2Z5CB 2WP8B 4MU3A 4PU9A 5DNXA 1XMOI 4DU7A 3LTOA 1XMQI 4K0KI 2IERA 3WU3A 4KHPE 1ZM3A 2CG9A 2J7KA 5IT9Q 4BA1A 1OYSA 4LF9I 4LCGA 2JT2A 1P42A 4R1FA 4JV5E 4IZJD 5GMEA 4IZKA 4LF6I 2HHHE 4LF9E 1ELOA 3PRYA 4LCHA 1HNXE 2BA0G 1UEKA 1PKPA 3GMEA 4IFDB 2BV3A 2IOPA 5JEAD 5LL6R 5C0XD 2BA1G 4DV4I 4X66E 5DROA 4DV6I 1FNMA 5BR8I 3CDJA 4OZEA 5C0XE 4OO1E 4YY3E 1UDNA 1RREA 3P3CA 3PS3A 4MYTA 4DR3E 5EKWA 2VQEE 1NZ0A 4GQUA 4FN5A 5C0XF 5IT9C 4B3SI 2NPFA 4Z7YA 1Y6ZA 4JI6I 4B3RI 3L7ZA 3WU5A 2CZ9A 5FWKA 4GKJI 2UXDE 2VQEI
chains in the Genus database with same CATH topology
4DR3I 2PNLA 4DU8A 4JG4A 4DUZE 2UU9E 3P06A 4YY3I 5BR8E 1D6TA 3ZZ0A 1DARA 1H7SA 4DV5I 1HR0I 1XHKA 4P52A 2ZBKB 2UUCE 4DPYA 5IWAE 1N33E 4USKA 4DR5I 1MG7A 4JI2E 2UXCI 3T1HI 3M6AA 4HY1A 2DEIA 1Y4UA 1N0UA 2XEXA 5LMUE 4DV3E 4PRXA 1HNZI 4DPXA 4PRVA 4WUDA 3ZKBA 3QT7A 4Z7CA 2PNMA 2UUBE 4HACB 2DEJA 1XNQE 4GKKI 4NXNE 3HULA 1HNWE 2Z5CA 4LF5E 1FKAE 1Z5BA 4X64E 4X65E 2HK3A 4JI3E 4DR2E 1FJGE 4FW9A 2V34A 2O1UA 1XNRI 1KTVA 2A2DA 4B3TE 2V2VA 2ZM6E 4XTJA 4JI0E 2F4VI 1IBME 3Q1QA 2UUAE 3F0NA 4UT4A 4DV0E 3OTOI 1N32I 3ZKDA 3OTOE 2VF3A 1N32E 4DV0I 1B63A 1Z0VA 4LF7I 3Q6MA 4MYUA 3B78A 4LF4E 4DPTA 2Z5EA 4DR7I 4DV7E 1IBKI 4EMDA 4ED4A 3J7AM 4JI8I 4LF8E 3LNUA 4DR4E 4B3MI 4DR2I 4JI5E 1S4EA 1B62A 4DR6I 4DV1I 1S16A 3ZZTA 2Z5BB 3QT5A 4X62E 3J80C 4X62I 1HNWI 3K17A 5L3JA 4JI4I 1VISA 2LJPA 1H73A 4B3ME 3J7AG 4LF8I 3K1JA 3WU6A 1Z5CA 4DV3I 4DUYE 4FWGA 4DV7I 1USUA 3T1HE 4DR1I 1I94E 2E5LI 4LF7E 4HYMA 2E1RA 4M1KA 1N33I 5IWAI 4JI7E 5FLXC 1ZM4A 1KVKA 3GONA 2HKEA 4LFCI 1USVA 4LFBE 2O1TA 4DPWA 2O1VA 1Z0BA 3WU4A 1RR9A 4JI1E 4JI0I 2F4VE 5A2QC 4USMA 2A2CA 1H72C 2ZM6I 4WUCA 1NHHA 4JI6E 4B3RE 3V5RA 2HFSA 1N0VC 1J5EE 2UXBI 3CWVA 4JI3I 4X65I 3PYDA 4LF5I 2GQ0A 2ZITA 4DV6E 4GKKE 3PYFA 1QZRA 1J5EI 2UUBI 1Z0CA 1HNXI 1HNZE 1Z0GA 5LMUI 4HXZA 3HJCA 4JI1I 4LF6E 1ZXMA 4IZKB 1N36E 4I3HA 4JV5I 2UXCE 1ZM2A 2V2ZA 4LFBI 1K47A 4P7AA 4KHPI 1XMQE 4K0KE 5GMDA 2X36A 2HKJA 4JI7I 4WUBA 1XMOE 1MX0A 4IZJB 5A2QQ 1I94I 5FLXQ 2E5LE 4DR1E 2UU9I 1N36I 3H4LA 3QT6A 4OX9E 2UXDI 4GKJE 3JAMQ 3D4JA 3ZZUA 1Z59A 2GS8A 4JI4E 2Q2EB 4LFAI 3K85A 1WUUA 3PYGA 4HACA 4X66I 4DV4E 2O1WA 3PYEA 2UXBE 4JI5I 3B8HA 4URLA 3JAMC 3T1YI 4DR4I 1EA6A 1EI1A 1Z0WA 1IBKE 3LPSA 1KIJA 1FI4A 2HHHI 2AJ4A 4DPUA 4UTGA 3ZM7A 4LF4I 1Z0TA 1U2RA 2EFGA 4LFCE 2HFUA 1H74A 2VQFI 1H7UA 2R3VA 3J81Q 2UUAI 4IZJA 4N3OA 4ZVIA 1IBMI 2BM0A 1OJ4A 5LMNE 4DUYI 2X7IA 4DXLA 1N34E 4JYAI 1XNRE 1N34I 4AQYI 3V2UC 5LMNI 1BKNA 2BM1A 2IOQA 4X64I 1KKHA 2V2QA 1IBLE 4NXME 2V8PA 4NXNI 1XNQI 4DV1E 4DV2E 1NHJA 2HK2A 4DR6E 2VQFE 1PIEA 1Z5AA 4JI8E 4YHHE 4RPFA 3B82A 4DR7E 3QT8A 4JI2I 2CGEA 2OI2A 4DR5E 4YHHI 1HK7A 1Y4SA 2UUCI 3T1YE 1ZXNA 1ZM9A 2WW4A 1HR0E 1MU5A 4DV5E 1A6FA 2R42A 4FWDA 4DV2I 3J80Q 4KQVA 3Q6NA 1IBLI 2Z5BA 4NXMI 1FWLA 4LFAE 4DUZI 4FWHA 1Z0EA 4B3TI 4AQYE 4JYAE 4B3SE 1NHIA 1PVGA 4OX9I 1FJGI 1FWKA 3J81C 2Z5CB 4PU9A 1XMOI 4DU7A 3LTOA 1XMQI 4K0KI 3WU3A 4KHPE 1ZM3A 2CG9A 2J7KA 5IT9Q 4LF9I 4R1FA 4JV5E 4IZJD 5GMEA 4IZKA 4LF6I 2HHHE 4LF9E 1ELOA 3PRYA 1HNXE 1UEKA 1PKPA 2BV3A 2IOPA 5LL6R 4DV4I 4X66E 4DV6I 1FNMA 5BR8I 4YY3E 1RREA 4MYTA 4DR3E 2VQEE 1NZ0A 4FN5A 4B3SI 5IT9C 2NPFA 4Z7YA 1Y6ZA 4JI6I 4B3RI 3WU5A 2CZ9A 5FWKA 4GKJI 2UXDE 2VQEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 I;  4DU8 A;  4JG4 A;  4DUZ E;  2UU9 E;  4YY3 I;  5BR8 E;  1D6T A;  3ZZ0 A;  1DAR A;  1H7S A;  4DV5 I;  1HR0 I;  1XHK A;  4P52 A;  2ZBK B;  2UUC E;  4DPY A;  5IWA E;  1N33 E;  4USK A;  4DR5 I;  1MG7 A;  4JI2 E;  2UXC I;  3T1H I;  3M6A A;  4HY1 A;  2DEI A;  1N0U A;  2XEX A;  5LMU E;  4DV3 E;  4PRX A;  1HNZ I;  4DPX A;  4PRV A;  4WUD A;  3ZKB A;  3QT7 A;  4Z7C A;  2UUB E;  4HAC B;  2DEJ A;  1XNQ E;  4GKK I;  4NXN E;  3HUL A;  1HNW E;  4LF5 E;  1FKA E;  1Z5B A;  4X64 E;  4X65 E;  2HK3 A;  4JI3 E;  4DR2 E;  1FJG E;  4FW9 A;  2V34 A;  1XNR I;  1KTV A;  2A2D A;  4B3T E;  2V2V A;  2ZM6 E;  4XTJ A;  4JI0 E;  2F4V I;  1IBM E;  3Q1Q A;  2UUA E;  3F0N A;  4UT4 A;  4DV0 E;  3OTO I;  1N32 I;  3ZKD A;  3OTO E;  2VF3 A;  1N32 E;  4DV0 I;  1B63 A;  1Z0V A;  4LF7 I;  4MYU A;  3B78 A;  4LF4 E;  4DPT A;  4DR7 I;  4DV7 E;  1IBK I;  4EMD A;  4ED4 A;  3J7A M;  4JI8 I;  4LF8 E;  3LNU A;  4DR4 E;  4B3M I;  4DR2 I;  4JI5 E;  1S4E A;  1B62 A;  4DR6 I;  4DV1 I;  1S16 A;  3ZZT A;  3QT5 A;  4X62 E;  3J80 C;  4X62 I;  1HNW I;  3K17 A;  5L3J A;  4JI4 I;  1VIS A;  2LJP A;  1H73 A;  4B3M E;  3J7A G;  4LF8 I;  3K1J A;  3WU6 A;  1Z5C A;  4DV3 I;  4DUY E;  4FWG A;  4DV7 I;  3T1H E;  4DR1 I;  1I94 E;  2E5L I;  4LF7 E;  4HYM A;  2E1R A;  4M1K A;  1N33 I;  5IWA I;  4JI7 E;  5FLX C;  1ZM4 A;  1KVK A;  3GON A;  2HKE A;  4LFC I;  4LFB E;  4DPW A;  1Z0B A;  3WU4 A;  1RR9 A;  4JI1 E;  4JI0 I;  2F4V E;  5A2Q C;  4USM A;  2A2C A;  1H72 C;  2ZM6 I;  4WUC A;  1NHH A;  4JI6 E;  4B3R E;  3V5R A;  2HFS A;  1N0V C;  1J5E E;  2UXB I;  3CWV A;  4JI3 I;  4X65 I;  3PYD A;  4LF5 I;  2ZIT A;  4DV6 E;  4GKK E;  3PYF A;  1QZR A;  1J5E I;  2UUB I;  1Z0C A;  1HNX I;  1HNZ E;  1Z0G A;  5LMU I;  4HXZ A;  4JI1 I;  4LF6 E;  1ZXM A;  1N36 E;  4I3H A;  4JV5 I;  2UXC E;  1ZM2 A;  2V2Z A;  4LFB I;  1K47 A;  4P7A A;  4KHP I;  1XMQ E;  4K0K E;  5GMD A;  2X36 A;  2HKJ A;  4JI7 I;  4WUB A;  1XMO E;  1MX0 A;  5A2Q Q;  1I94 I;  5FLX Q;  2E5L E;  4DR1 E;  2UU9 I;  1N36 I;  3H4L A;  3QT6 A;  4OX9 E;  2UXD I;  4GKJ E;  3JAM Q;  3D4J A;  3ZZU A;  1Z59 A;  2GS8 A;  4JI4 E;  2Q2E B;  4LFA I;  1WUU A;  3PYG A;  4HAC A;  4X66 I;  4DV4 E;  3PYE A;  2UXB E;  4JI5 I;  3B8H A;  4URL A;  3JAM C;  3T1Y I;  4DR4 I;  1EA6 A;  1EI1 A;  1Z0W A;  1IBK E;  3LPS A;  1KIJ A;  1FI4 A;  2HHH I;  2AJ4 A;  4DPU A;  4UTG A;  3ZM7 A;  4LF4 I;  1Z0T A;  1U2R A;  2EFG A;  4LFC E;  2HFU A;  1H74 A;  2VQF I;  1H7U A;  2R3V A;  3J81 Q;  2UUA I;  4ZVI A;  1IBM I;  2BM0 A;  1OJ4 A;  5LMN E;  4DUY I;  2X7I A;  4DXL A;  1N34 E;  4JYA I;  1XNR E;  1N34 I;  4AQY I;  3V2U C;  5LMN I;  1BKN A;  2BM1 A;  4X64 I;  1KKH A;  2V2Q A;  1IBL E;  4NXM E;  2V8P A;  4NXN I;  1XNQ I;  4DV1 E;  4DV2 E;  1NHJ A;  2HK2 A;  4DR6 E;  2VQF E;  1PIE A;  1Z5A A;  4JI8 E;  4YHH E;  4RPF A;  3B82 A;  4DR7 E;  3QT8 A;  4JI2 I;  2OI2 A;  4DR5 E;  4YHH I;  2UUC I;  3T1Y E;  1ZXN A;  1ZM9 A;  2WW4 A;  1HR0 E;  1MU5 A;  4DV5 E;  1A6F A;  2R42 A;  4FWD A;  4DV2 I;  3J80 Q;  4KQV A;  1IBL I;  4NXM I;  1FWL A;  4LFA E;  4DUZ I;  4FWH A;  1Z0E A;  4B3T I;  4AQY E;  4JYA E;  4B3S E;  1NHI A;  1PVG A;  4OX9 I;  1FJG I;  1FWK A;  3J81 C;  4PU9 A;  1XMO I;  4DU7 A;  3LTO A;  1XMQ I;  4K0K I;  3WU3 A;  4KHP E;  1ZM3 A;  2J7K A;  5IT9 Q;  4LF9 I;  4R1F A;  4JV5 E;  5GME A;  4LF6 I;  2HHH E;  4LF9 E;  1ELO A;  1HNX E;  1UEK A;  1PKP A;  2BV3 A;  5LL6 R;  4DV4 I;  4X66 E;  4DV6 I;  1FNM A;  5BR8 I;  4YY3 E;  1RRE A;  4MYT A;  4DR3 E;  2VQE E;  1NZ0 A;  4FN5 A;  4B3S I;  5IT9 C;  2NPF A;  4Z7Y A;  4JI6 I;  4B3R I;  3WU5 A;  2CZ9 A;  4GKJ I;  2UXD E;  2VQE I; 
#chains in the Genus database with same CATH topology
 4DR3 I;  1Y60 A;  2PNL A;  4IFD E;  4DU8 A;  4JG4 A;  4DUZ E;  2UU9 E;  3P06 A;  4YY3 I;  4FW5 A;  2PO0 A;  5BR8 E;  1D6T A;  2JEB B;  3ZZ0 A;  1DAR A;  2BA1 D;  1H7S A;  4DV5 I;  2PO2 B;  1HR0 I;  1XHK A;  4P52 A;  2ZBK B;  2UUC E;  4DPY A;  5C0X B;  4J3D A;  5IWA E;  1N33 E;  5C0X A;  4USK A;  4DR5 I;  1MG7 A;  4JI2 E;  2NN6 B;  3GCM A;  2UXC I;  1UDO A;  3T1H I;  3M6A A;  4HY1 A;  2DEI A;  1Y4U A;  4IS9 A;  2PNZ B;  2F1D A;  3UHM A;  1N0U A;  2IES A;  2XEX A;  5LMU E;  4DV3 E;  4PRX A;  1HNZ I;  4DPX A;  3L7Z B;  4PRV A;  4WUD A;  1OYR A;  4MU0 A;  3QT7 A;  3ZKB A;  4Z7C A;  2PNM A;  2UUB E;  4HAC B;  2DEJ A;  5JEA F;  1XNQ E;  4GKK I;  4NXN E;  3HUL A;  1HNW E;  2Z5C A;  4LF5 E;  1FKA E;  1Z5B A;  2O3Z A;  4X64 E;  2NN6 F;  1OYP A;  1UDS A;  2HK3 A;  4X65 E;  4JI3 E;  4DR2 E;  1FJG E;  4FW9 A;  4OO1 D;  2V34 A;  2O1U A;  1XNR I;  1KTV A;  2JE6 A;  2A2D A;  1E3P A;  4B3T E;  2V2V A;  2ZM6 E;  2NN6 D;  4XTJ A;  4JI0 E;  2F4V I;  1IBM E;  3Q1Q A;  5K36 A;  2C38 A;  2PO0 B;  2UUA E;  3F0N A;  4UT4 A;  2PO1 B;  4DV0 E;  3OTO I;  1N32 I;  3ZKD A;  3M85 D;  3OTO E;  2VF3 A;  1N32 E;  5DRR A;  1XXE A;  4DV0 I;  1B63 A;  1Z0V A;  2NN6 A;  4LF7 I;  3Q6M A;  4MYU A;  3B78 A;  4LF4 E;  4DPT A;  4U3B A;  2Z5E A;  4DR7 I;  5JEA A;  4DV7 E;  3PS1 A;  1IBK I;  4EMD A;  4ED4 A;  3J7A M;  4JI8 I;  4LF8 E;  2BA0 D;  3LNU A;  4DR4 E;  3P3G A;  4B3M I;  4DR2 I;  5DRQ A;  4JI5 E;  1S4E A;  1B62 A;  4DR6 I;  4DV1 I;  1S16 A;  3ZZT A;  2Z5B B;  3QT5 A;  4X62 E;  3J80 C;  4X62 I;  1HNW I;  4BA2 B;  3K17 A;  2JEA A;  5L3J A;  4JI4 I;  1VIS A;  2LJP A;  1Y5Y A;  1H73 A;  4BA1 B;  4B3M E;  2NN6 E;  5DNL A;  2J65 A;  3J7A G;  4AM3 A;  4LF8 I;  3K1J A;  4ISA A;  1Z5C A;  2VES A;  3WU6 A;  4DV3 I;  4DUY E;  4FWG A;  4DV7 I;  1USU A;  5JEA E;  4AIM A;  3T1H E;  4DR1 I;  1I94 E;  2E5L I;  4LF7 E;  4HYM A;  2E1R A;  4M1K A;  1N33 I;  5IWA I;  4JI7 E;  5FLX C;  1ZM4 A;  1KVK A;  4QNJ A;  3GON A;  2HKE A;  4IFD D;  2BR2 A;  4LFC I;  2BR2 B;  1USV A;  4LFB E;  2O1T A;  4FW3 A;  4DPW A;  2O1V A;  1Z0B A;  3KRN A;  3WU4 A;  1RR9 A;  4JI1 E;  4JI0 I;  2F4V E;  5A2Q C;  4USM A;  2A2C A;  1H72 C;  2ZM6 I;  4WUC A;  5EL9 A;  1NHH A;  4JI6 E;  4B3R E;  3V5R A;  2HFS A;  1N0V C;  2WP8 A;  1J5E E;  1VI7 A;  2UXB I;  3CWV A;  4JI3 I;  4X65 I;  3PYD A;  4LF5 I;  2GQ0 A;  2ZIT A;  4DV6 E;  3U1Y A;  2PO1 A;  3PYF A;  4GKK E;  5C0X C;  1QZR A;  3CDI A;  1J5E I;  2UUB I;  1YHC A;  4FW4 A;  4OO1 A;  1Z0C A;  1HNX I;  1HNZ E;  1Z0G A;  5LMU I;  4HXZ A;  3HJC A;  4JI1 I;  4LF6 E;  1ZXM A;  4IZK B;  1N36 E;  4I3H A;  4JV5 I;  4IFD C;  3U1K A;  2UXC E;  1ZM2 A;  2V2Z A;  2GO3 A;  4LFB I;  1K47 A;  4P7A A;  4KHP I;  3H1C A;  1XMQ E;  4K0K E;  5GMD A;  2X36 A;  2HKJ A;  4JI7 I;  4WUB A;  2C39 A;  1XMO E;  3M7N D;  1MX0 A;  4IZJ B;  5A2Q Q;  1I94 I;  5FLX Q;  2E5L E;  4DR1 E;  2UU9 I;  4BA2 A;  4LOM A;  1N36 I;  3H4L A;  2JE6 B;  3QT6 A;  4OX9 E;  2UXD I;  4GKJ E;  3JAM Q;  1YH8 A;  3D4J A;  3ZZU A;  1Z59 A;  2GS8 A;  3GLL A;  2JEB A;  4QNK A;  4JI4 E;  2Q2E B;  4MU1 A;  4LFA I;  3K85 A;  1RHY A;  1WUU A;  3PYG A;  4HAC A;  2C39 B;  4X66 I;  4DV4 E;  2O1W A;  3PYE A;  1UDQ A;  2UXB E;  1R6M A;  4OKG A;  3B8H A;  4URL A;  4JI5 I;  3JAM C;  3T1Y I;  4DR4 I;  1EA6 A;  1EI1 A;  1Z0W A;  1IBK E;  3LPS A;  1KIJ A;  1FI4 A;  2HHH I;  2AJ4 A;  2WNR A;  4MDT A;  4DPU A;  5K36 F;  4U3D A;  2C38 B;  4UTG A;  3ZM7 A;  4LF4 I;  3P76 A;  2C37 A;  1Z0T A;  4AID A;  1U2R A;  2EFG A;  5K36 E;  1E3H A;  4LFC E;  2HFU A;  1H74 A;  2VQF I;  2C37 B;  1H7U A;  2R3V A;  3J81 Q;  2PO2 A;  2UUA I;  4IZJ A;  2CVE A;  4N3O A;  5DRP A;  4ZVI A;  1IBM I;  2BM0 A;  1OJ4 A;  5LMN E;  4DUY I;  2X7I A;  4DXL A;  1N34 E;  4JYA I;  1XNR E;  2PNZ A;  1N34 I;  4AQY I;  4NBQ A;  3V2U C;  5LMN I;  1BKN A;  2BM1 A;  2IOQ A;  4X64 I;  1KKH A;  2V2Q A;  5K36 B;  4LCF A;  1IBL E;  4NXM E;  2V8P A;  4NXN I;  1XNQ I;  4DV1 E;  4DV2 E;  1NHJ A;  2HK2 A;  4DR6 E;  4MQY A;  4OO1 B;  3PS2 A;  3M85 G;  2VQF E;  3M7N G;  3P3E A;  1PIE A;  1R6L A;  1Z5A A;  4JI8 E;  4YHH E;  4RPF A;  3B82 A;  4DR7 E;  3QT8 A;  2WNR B;  4JI2 I;  2CGE A;  2OI2 A;  4DR5 E;  4YHH I;  1HK7 A;  1Y4S A;  2UUC I;  2GO4 A;  3T1Y E;  5K36 C;  1ZXN A;  1ZM9 A;  2WW4 A;  1HR0 E;  4OO1 F;  1MU5 A;  1A6F A;  4LPF A;  4DV5 E;  2R42 A;  4FWD A;  4DV2 I;  3J80 Q;  4KQV A;  3DD6 A;  5K36 D;  3Q6N A;  4OO1 C;  1IBL I;  2Z5B A;  3HKM A;  4NXM I;  1FWL A;  4LFA E;  4DUZ I;  4FWH A;  2JEA B;  5ELW A;  3B4T A;  1Z0E A;  2NN6 C;  4B3T I;  2AE8 A;  4AQY E;  4MU4 A;  4JYA E;  4IFD F;  3NZK A;  4IFD A;  4B3S E;  1NHI A;  4FW7 A;  1PVG A;  4OX9 I;  5JEA C;  5JEA B;  1FJG I;  4FW6 A;  1FWK A;  3J81 C;  2Z5C B;  2WP8 B;  4MU3 A;  4PU9 A;  5DNX A;  1XMO I;  4DU7 A;  3LTO A;  1XMQ I;  4K0K I;  2IER A;  3WU3 A;  4KHP E;  1ZM3 A;  2CG9 A;  2J7K A;  5IT9 Q;  4BA1 A;  1OYS A;  4LF9 I;  4LCG A;  2JT2 A;  1P42 A;  4R1F A;  4JV5 E;  4IZJ D;  5GME A;  4IZK A;  4LF6 I;  2HHH E;  4LF9 E;  1ELO A;  3PRY A;  4LCH A;  1HNX E;  2BA0 G;  1UEK A;  1PKP A;  3GME A;  4IFD B;  2BV3 A;  2IOP A;  5JEA D;  5LL6 R;  5C0X D;  2BA1 G;  4DV4 I;  4X66 E;  5DRO A;  4DV6 I;  1FNM A;  5BR8 I;  3CDJ A;  4OZE A;  5C0X E;  4OO1 E;  4YY3 E;  1UDN A;  1RRE A;  3P3C A;  3PS3 A;  4MYT A;  4DR3 E;  5EKW A;  2VQE E;  1NZ0 A;  4GQU A;  4FN5 A;  5C0X F;  5IT9 C;  4B3S I;  2NPF A;  4Z7Y A;  1Y6Z A;  4JI6 I;  4B3R I;  3L7Z A;  3WU5 A;  2CZ9 A;  5FWK A;  4GKJ I;  2UXD E;  2VQE I; 
#chains in the Genus database with same CATH homology
 4DR3 I;  2PNL A;  4DU8 A;  4JG4 A;  4DUZ E;  2UU9 E;  3P06 A;  4YY3 I;  5BR8 E;  1D6T A;  3ZZ0 A;  1DAR A;  1H7S A;  4DV5 I;  1HR0 I;  1XHK A;  4P52 A;  2ZBK B;  2UUC E;  4DPY A;  5IWA E;  1N33 E;  4USK A;  4DR5 I;  1MG7 A;  4JI2 E;  2UXC I;  3T1H I;  3M6A A;  4HY1 A;  2DEI A;  1Y4U A;  1N0U A;  2XEX A;  5LMU E;  4DV3 E;  4PRX A;  1HNZ I;  4DPX A;  4PRV A;  4WUD A;  3ZKB A;  3QT7 A;  4Z7C A;  2PNM A;  2UUB E;  4HAC B;  2DEJ A;  1XNQ E;  4GKK I;  4NXN E;  3HUL A;  1HNW E;  2Z5C A;  4LF5 E;  1FKA E;  1Z5B A;  4X64 E;  4X65 E;  2HK3 A;  4JI3 E;  4DR2 E;  1FJG E;  4FW9 A;  2V34 A;  2O1U A;  1XNR I;  1KTV A;  2A2D A;  4B3T E;  2V2V A;  2ZM6 E;  4XTJ A;  4JI0 E;  2F4V I;  1IBM E;  3Q1Q A;  2UUA E;  3F0N A;  4UT4 A;  4DV0 E;  3OTO I;  1N32 I;  3ZKD A;  3OTO E;  2VF3 A;  1N32 E;  4DV0 I;  1B63 A;  1Z0V A;  4LF7 I;  3Q6M A;  4MYU A;  3B78 A;  4LF4 E;  4DPT A;  2Z5E A;  4DR7 I;  4DV7 E;  1IBK I;  4EMD A;  4ED4 A;  3J7A M;  4JI8 I;  4LF8 E;  3LNU A;  4DR4 E;  4B3M I;  4DR2 I;  4JI5 E;  1S4E A;  1B62 A;  4DR6 I;  4DV1 I;  1S16 A;  3ZZT A;  2Z5B B;  3QT5 A;  4X62 E;  3J80 C;  4X62 I;  1HNW I;  3K17 A;  5L3J A;  4JI4 I;  1VIS A;  2LJP A;  1H73 A;  4B3M E;  3J7A G;  4LF8 I;  3K1J A;  3WU6 A;  1Z5C A;  4DV3 I;  4DUY E;  4FWG A;  4DV7 I;  1USU A;  3T1H E;  4DR1 I;  1I94 E;  2E5L I;  4LF7 E;  4HYM A;  2E1R A;  4M1K A;  1N33 I;  5IWA I;  4JI7 E;  5FLX C;  1ZM4 A;  1KVK A;  3GON A;  2HKE A;  4LFC I;  1USV A;  4LFB E;  2O1T A;  4DPW A;  2O1V A;  1Z0B A;  3WU4 A;  1RR9 A;  4JI1 E;  4JI0 I;  2F4V E;  5A2Q C;  4USM A;  2A2C A;  1H72 C;  2ZM6 I;  4WUC A;  1NHH A;  4JI6 E;  4B3R E;  3V5R A;  2HFS A;  1N0V C;  1J5E E;  2UXB I;  3CWV A;  4JI3 I;  4X65 I;  3PYD A;  4LF5 I;  2GQ0 A;  2ZIT A;  4DV6 E;  4GKK E;  3PYF A;  1QZR A;  1J5E I;  2UUB I;  1Z0C A;  1HNX I;  1HNZ E;  1Z0G A;  5LMU I;  4HXZ A;  3HJC A;  4JI1 I;  4LF6 E;  1ZXM A;  4IZK B;  1N36 E;  4I3H A;  4JV5 I;  2UXC E;  1ZM2 A;  2V2Z A;  4LFB I;  1K47 A;  4P7A A;  4KHP I;  1XMQ E;  4K0K E;  5GMD A;  2X36 A;  2HKJ A;  4JI7 I;  4WUB A;  1XMO E;  1MX0 A;  4IZJ B;  5A2Q Q;  1I94 I;  5FLX Q;  2E5L E;  4DR1 E;  2UU9 I;  1N36 I;  3H4L A;  3QT6 A;  4OX9 E;  2UXD I;  4GKJ E;  3JAM Q;  3D4J A;  3ZZU A;  1Z59 A;  2GS8 A;  4JI4 E;  2Q2E B;  4LFA I;  3K85 A;  1WUU A;  3PYG A;  4HAC A;  4X66 I;  4DV4 E;  2O1W A;  3PYE A;  2UXB E;  4JI5 I;  3B8H A;  4URL A;  3JAM C;  3T1Y I;  4DR4 I;  1EA6 A;  1EI1 A;  1Z0W A;  1IBK E;  3LPS A;  1KIJ A;  1FI4 A;  2HHH I;  2AJ4 A;  4DPU A;  4UTG A;  3ZM7 A;  4LF4 I;  1Z0T A;  1U2R A;  2EFG A;  4LFC E;  2HFU A;  1H74 A;  2VQF I;  1H7U A;  2R3V A;  3J81 Q;  2UUA I;  4IZJ A;  4N3O A;  4ZVI A;  1IBM I;  2BM0 A;  1OJ4 A;  5LMN E;  4DUY I;  2X7I A;  4DXL A;  1N34 E;  4JYA I;  1XNR E;  1N34 I;  4AQY I;  3V2U C;  5LMN I;  1BKN A;  2BM1 A;  2IOQ A;  4X64 I;  1KKH A;  2V2Q A;  1IBL E;  4NXM E;  2V8P A;  4NXN I;  1XNQ I;  4DV1 E;  4DV2 E;  1NHJ A;  2HK2 A;  4DR6 E;  2VQF E;  1PIE A;  1Z5A A;  4JI8 E;  4YHH E;  4RPF A;  3B82 A;  4DR7 E;  3QT8 A;  4JI2 I;  2CGE A;  2OI2 A;  4DR5 E;  4YHH I;  1HK7 A;  1Y4S A;  2UUC I;  3T1Y E;  1ZXN A;  1ZM9 A;  2WW4 A;  1HR0 E;  1MU5 A;  4DV5 E;  1A6F A;  2R42 A;  4FWD A;  4DV2 I;  3J80 Q;  4KQV A;  3Q6N A;  1IBL I;  2Z5B A;  4NXM I;  1FWL A;  4LFA E;  4DUZ I;  4FWH A;  1Z0E A;  4B3T I;  4AQY E;  4JYA E;  4B3S E;  1NHI A;  1PVG A;  4OX9 I;  1FJG I;  1FWK A;  3J81 C;  2Z5C B;  4PU9 A;  1XMO I;  4DU7 A;  3LTO A;  1XMQ I;  4K0K I;  3WU3 A;  4KHP E;  1ZM3 A;  2CG9 A;  2J7K A;  5IT9 Q;  4LF9 I;  4R1F A;  4JV5 E;  4IZJ D;  5GME A;  4IZK A;  4LF6 I;  2HHH E;  4LF9 E;  1ELO A;  3PRY A;  1HNX E;  1UEK A;  1PKP A;  2BV3 A;  2IOP A;  5LL6 R;  4DV4 I;  4X66 E;  4DV6 I;  1FNM A;  5BR8 I;  4YY3 E;  1RRE A;  4MYT A;  4DR3 E;  2VQE E;  1NZ0 A;  4FN5 A;  4B3S I;  5IT9 C;  2NPF A;  4Z7Y A;  1Y6Z A;  4JI6 I;  4B3R I;  3WU5 A;  2CZ9 A;  5FWK A;  4GKJ I;  2UXD E;  2VQE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...