4JYAI

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jyaI00
4DV3I 3JAMC 1FWLA 2GS8A 1H7UA 4P52A 4X65E 1PKPA 2BM1A 3J80C 5BR8E 4GKKE 4Z7CA 4DV2E 5LMUE 4EMDA 4NXMI 5FLXC 1MU5A 1XNQE 4B3RI 1N33I 4AQYI 4DUYE 5IT9C 4X62E 4DR4I 4LF5E 4FWGA 1IBLI 3QT5A 3J7AM 2BV3A 5L3JA 4LF7I 4YY3I 2V2QA 1KVKA 1H7SA 1A6FA 1NHHA 4JI5E 2A2CA 1HNXE 1UEKA 1XMQI 4DPYA 3ZKBA 2HKJA 2HFUA 1S4EA 4DR3I 1RR9A 4USKA 3V5RA 1IBKE 3HULA 2UUCI 4DR5I 4HY1A 2HHHE 3PYDA 4JI7E 1Z5BA 2VQEI 4B3TI 1Z5AA 4OX9E 1B63A 1NHIA 1D6TA 1H73A 3CWVA 4X66E 1FNMA 1MX0A 4JI0I 4LFCI 4DPTA 1EI1A 2HK2A 4DV5I 2R3VA 2CZ9A 5IWAE 4LF9E 2UXBE 3WU4A 2DEIA 2DEJA 4X64I 3QT6A 4DUZE 4DR2I 1IBME 2UXCI 1HNWI 4DXLA 4JI2I 4I3HA 4HACB 2UUBI 1NHJA 4K0KE 3ZZ0A 4DV7E 3J81Q 5FLXQ 4GKJI 4JYAE 4JI4I 1HNZE 2UU9I 1XMOE 4WUDA 2UUAI 1U2RA 4USMA 1FWKA 5IT9Q 4LF4E 3QT8A 1H74A 1J5EI 2VF3A 1N0UA 4UTGA 1N34E 2EFGA 3T1HE 1B62A 4JI3I 4R1FA 3T1YI 4LF6I 1EA6A 3B82A 4B3SI 4DV6I 4LF8I 1FI4A 4DV4E 4DR7E 1NZ0A 2WW4A 1OJ4A 3QT7A 4FWHA 1I94I 4DV1I 1KIJA 3J81C 2ZM6I 2E5LI 3M6AA 4FW9A 4NXME 1BKNA 4X65I 5LMNI 1XHKA 4LFBI 3V2UC 4JI8E 5BR8I 1N32I 4DPXA 1N33E 4AQYE 4DR4E 4DV2I 1IBLE 1XNQI 1FJGE 1KTVA 2AJ4A 3LTOA 4DUYI 4X62I 3OTOE 3J7AG 4YY3E 2V2VA 2VQFE 4B3ME 1Z0BA 1XMQE 4HYMA 3B78A 4DPWA 4JV5E 2UXDI 4LFAI 4NXNI 4MYTA 4DR3E 2HFSA 4KHPE 1ZXNA 4DR5E 3D4JA 2Q2EB 1PIEA 4Z7YA 1N36E 4JI0E 1S16A 2X36A 1Z0TA 4LFCE 4DR6I 4M1KA 4JI1I 1XNRE 4DV5E 3Q1QA 1ZM9A 2R42A 2F4VE 4DR1E 3PYFA 4DU7A 4DV0E 3WU5A 4UT4A 3F0NA 4WUCA 1MG7A 2UXCE 4DR2E 2HK3A 2LJPA 1HNWE 5IWAI 1HR0I 4LF9I 2UXBI 1ELOA 4HXZA 2ZITA 4GKJE 4JI4E 2UU9E 1ZM3A 1IBMI 4MYUA 2UUAE 4DPUA 4XTJA 2V8PA 3ZZTA 4DV7I 1ZXMA 2OI2A 4YHHE 1XMOI 3PYEA 4DV6E 4LF8E 2XEXA 4DV3E 5A2QQ 4HACA 1N34I 4PRXA 1PVGA 4JI6I 2X7IA 3PYGA 1I94E 4URLA 4DV1E 4DV4I 4DR7I 2ZM6E 2E5LE 1Z0WA 1Z0VA 4PU9A 5LMNE 4GKKI 4B3RE 1H72C 4LFBE 5LMUI 1N32E 2E1RA 3K17A 4KQVA 1KKHA 3WU6A 4JI8I 4P7AA 3B8HA 4LF5I 4LF7E 4ED4A 4JG4A 5A2QC 1ZM4A 3ZKDA 4ZVIA 2V34A 2J7KA 1FJGI 2UXDE 3OTOI 4LFAE 4NXNE 5GMEA 4JI5I 4WUBA 2UUCE 1WUUA 1HNXI 2VQEE 4B3TE 2VQFI 2HKEA 4RPFA 3H4LA 1Z0GA 4B3MI 3WU3A 1Z0CA 1K47A 4JV5I 1ZM2A 1IBKI 2HHHI 1Z0EA 3LPSA 4JI7I 4OX9I 4KHPI 4DU8A 4DR6E 1Z59A 4JI1E 4X66I 1N36I 4X64E 4FWDA 1DARA 2ZBKB 4FN5A 4JI2E 1XNRI 3ZM7A 2UUBE 3K1JA 2BM0A 2F4VI 4DR1I 1HR0E 3JAMQ 1RREA 1QZRA 4DV0I 5LL6R 4DUZI 3J80Q 3ZZUA 1FKAE 3GONA 4K0KI 1VISA 1J5EE 2NPFA 4JYAI 1HNZI 4JI3E 3T1YE 4LF6E 4B3SE 4LF4I 2A2DA 4PRVA 1Z5CA 3LNUA 3T1HI 1N0VC 2V2ZA 5GMDA 4YHHI 4JI6E
chains in the Genus database with same CATH superfamily
4DV3I 3JAMC 1FWLA 2GS8A 1H7UA 2Z5CA 4P52A 4X65E 1PKPA 2BM1A 3J80C 1OYPA 3Q6NA 5BR8E 4GKKE 3UHMA 2JEAA 4Z7CA 4DV2E 5LMUE 2PO1A 4EMDA 2J65A 4NXMI 5FLXC 1MU5A 1XNQE 3HJCA 4B3RI 1N33I 4AQYI 4DUYE 5K36F 5IT9C 4X62E 4DR4I 3L7ZB 4LF5E 4FWGA 2PO2B 1IBLI 1Y4SA 4LCHA 3QT5A 3J7AM 1YHCA 2BV3A 4BA2B 5L3JA 4LF7I 4YY3I 2V2QA 1KVKA 4U3BA 1H7SA 1A6FA 1NHHA 4JI5E 2A2CA 5FWKA 1HNXE 4MU4A 1UEKA 1XMQI 1OYSA 1E3HA 5DRRA 5EL9A 3H1CA 4DPYA 3ZKBA 2HKJA 2HFUA 1S4EA 4DR3I 1RR9A 4USKA 3V5RA 1IBKE 2NN6D 1UDSA 3HULA 2UUCI 4DR5I 4HY1A 2HHHE 3PYDA 4JI7E 1Z5BA 2VQEI 4B3TI 3M7NG 1Z5AA 4OX9E 1B63A 4IS9A 1NHIA 1D6TA 1H73A 3Q6MA 3CWVA 4X66E 1FNMA 1MX0A 4JI0I 2C38A 4LFCI 4AIDA 4OO1D 4DPTA 2NN6A 1EI1A 2HK2A 4DV5I 2R3VA 2CZ9A 5IWAE 4LF9E 4IZJA 2GQ0A 2UXBE 3WU4A 2DEIA 2DEJA 4X64I 2WNRA 5JEAF 5DROA 1R6LA 3QT6A 4N3OA 4DUZE 4DR2I 1IBME 2UXCI 1HNWI 4DXLA 4IFDF 4JI2I 4OO1A 4I3HA 4HACB 4AIMA 2UUBI 1NHJA 4K0KE 3U1YA 3ZZ0A 4DV7E 3J81Q 5FLXQ 4GKJI 4JYAE 5C0XD 4JI4I 1HNZE 2UU9I 5JEAA 1XMOE 2JE6B 4WUDA 2UUAI 1U2RA 4USMA 1FWKA 5IT9Q 3P3EA 4LF4E 4OKGA 3QT8A 1H74A 2NN6C 1Y4UA 1UDNA 2Z5CB 1J5EI 2VF3A 1N0UA 2CG9A 4UTGA 1N34E 2EFGA 3T1HE 1B62A 2IERA 4JI3I 4R1FA 2C39A 3T1YI 1EA6A 4LF6I 2JEAB 3B82A 4B3SI 4DV6I 4LF8I 2WP8A 3U1KA 2PO1B 1FI4A 4BA1B 4DV4E 4DR7E 1NZ0A 4OO1C 2O1VA 4MU0A 2WW4A 1OJ4A 3QT7A 4FWHA 1RHYA 2IESA 1I94I 4DV1I 1KIJA 3J81C 2ZM6I 4U3DA 2E5LI 1Y6ZA 3M6AA 3P3CA 4FW9A 4NXME 1BKNA 4LPFA 5K36D 4FW4A 4X65I 5LMNI 4MDTA 1XHKA 4LFBI 3V2UC 4JI8E 4MQYA 5BR8I 1N32I 2GO3A 4DPXA 1N33E 4AQYE 4DR4E 2PO0A 4DV2I 5C0XC 3GCMA 3HKMA 4LCFA 1IBLE 4QNJA 3CDIA 1XNQI 1FJGE 1KTVA 2AJ4A 5K36A 3LTOA 4DUYI 4X62I 3OTOE 3J7AG 4YY3E 1UDQA 2V2VA 3NZKA 2NN6E 2VQFE 2C37A 4B3ME 1Z0BA 1XMQE 4HYMA 3B78A 4DPWA 2C38B 4JV5E 2UXDI 4LFAI 4NXNI 4MYTA 4DR3E 2HFSA 2NN6B 3L7ZA 4KHPE 1ZXNA 4DR5E 4OO1E 2BR2A 4IZJD 3D4JA 1YH8A 2Q2EB 4IZJB 1PIEA 3K85A 1R6MA 2WNRB 5K36C 4Z7YA 4LOMA 2Z5BB 1N36E 4JI0E 1S16A 2X36A 1Y60A 1Z0TA 4LFCE 4OO1B 4DR6I 4M1KA 3GMEA 2PNLA 4JI1I 1XNRE 2BA0G 2BA1D 4QNKA 4DV5E 3P76A 3Q1QA 1ZM9A 2R42A 2F4VE 4FW6A 3PYFA 4IZKB 4DR1E 5JEAD 4FW5A 4DU7A 4DV0E 2O1TA 3WU5A 4IFDD 4UT4A 3F0NA 5C0XE 4WUCA 2IOPA 1MG7A 2UXCE 1Y5YA 4DR2E 2HK3A 2LJPA 1HNWE 3B4TA 5IWAI 1HR0I 3GLLA 4LF9I 3DD6A 2UXBI 1ELOA 4HXZA 2ZITA 1UDOA 2O1WA 5C0XB 4GKJE 2JT2A 2WP8B 4JI4E 2UU9E 1ZM3A 1USUA 4IFDA 1IBMI 4MYUA 2UUAE 4DPUA 4XTJA 2V8PA 3ZZTA 4DV7I 1ZXMA 4LCGA 2CVEA 2OI2A 4YHHE 1XMOI 2O1UA 3PYEA 4DV6E 2JEBA 4LF8E 1HK7A 2XEXA 4DV3E 5A2QQ 4HACA 3PS2A 1N34I 5K36E 4PRXA 1PVGA 4JI6I 2X7IA 3PYGA 2PNZA 5JEAC 2PO0B 4URLA 2VESA 3PRYA 4DV1E 1I94E 4IFDC 4DV4I 4DR7I 2PNMA 2ZM6E 2E5LE 1Z0WA 5K36B 5DNXA 1Z0VA 4PU9A 5LMNE 4GKKI 4B3RE 1H72C 4LFBE 5LMUI 1N32E 2E1RA 2C37B 4BA1A 3K17A 4KQVA 1KKHA 5ELWA 2CGEA 4NBQA 3KRNA 5EKWA 3WU6A 4JI8I 4P7AA 3B8HA 4LF5I 4LF7E 4ED4A 3M85D 4FW3A 4JG4A 5DNLA 5A2QC 1ZM4A 2BA1G 3ZKDA 4ZVIA 2V34A 2BR2B 2O3ZA 2J7KA 4FW7A 1FJGI 1OYRA 2UXDE 1E3PA 3OTOI 4LFAE 4NXNE 5GMEA 4JI5I 4WUBA 2PO2A 2UUCE 1VI7A 1WUUA 1HNXI 2VQEE 4B3TE 2VQFI 2HKEA 4RPFA 3H4LA 1Z0GA 4B3MI 3WU3A 4BA2A 1Z0CA 1K47A 4JV5I 1ZM2A 5JEAE 5DRPA 1IBKI 5DRQA 2HHHI 1Z0EA 3LPSA 4JI7I 4IFDE 4OX9I 4KHPI 4DU8A 4DR6E 1Z59A 2F1DA 2NN6F 2Z5EA 4JI1E 4X66I 4J3DA 5JEAB 2AE8A 2IOQA 3CDJA 4ISAA 1N36I 4X64E 4IFDB 4FWDA 1DARA 2ZBKB 4FN5A 4JI2E 1XNRI 3ZM7A 1P42A 2UUBE 3K1JA 2BM0A 4OO1F 3PS3A 2F4VI 4DR1I 2C39B 1HR0E 3JAMQ 1RREA 1QZRA 4DV0I 4OZEA 4MU3A 5LL6R 4DUZI 2JEBB 3P06A 2Z5BA 1XXEA 3J80Q 3ZZUA 1FKAE 3GONA 1USVA 4K0KI 2GO4A 1VISA 3P3GA 1J5EE 3M7ND 2NPFA 3PS1A 4JYAI 1HNZI 4JI3E 4IZKA 2PNZB 3T1YE 4LF6E 4B3SE 4GQUA 5C0XF 4LF4I 2A2DA 4PRVA 1Z5CA 3LNUA 3T1HI 3M85G 4AM3A 2BA0D 1N0VC 2V2ZA 4MU1A 5GMDA 4YHHI 4JI6E 5C0XA 2JE6A
chains in the Genus database with same CATH topology
4DV3I 3JAMC 1FWLA 2GS8A 1H7UA 2Z5CA 4P52A 4X65E 1PKPA 2BM1A 3J80C 3Q6NA 5BR8E 4GKKE 4Z7CA 4DV2E 5LMUE 4EMDA 4NXMI 5FLXC 1MU5A 1XNQE 3HJCA 4B3RI 1N33I 4AQYI 4DUYE 5IT9C 4X62E 4DR4I 4LF5E 4FWGA 1IBLI 1Y4SA 3QT5A 3J7AM 2BV3A 5L3JA 4LF7I 4YY3I 2V2QA 1KVKA 1H7SA 1A6FA 1NHHA 4JI5E 2A2CA 5FWKA 1HNXE 1UEKA 1XMQI 4DPYA 3ZKBA 2HKJA 2HFUA 1S4EA 4DR3I 1RR9A 4USKA 3V5RA 1IBKE 3HULA 2UUCI 4DR5I 4HY1A 2HHHE 3PYDA 4JI7E 1Z5BA 2VQEI 4B3TI 1Z5AA 4OX9E 1B63A 1NHIA 1D6TA 1H73A 3Q6MA 3CWVA 4X66E 1FNMA 1MX0A 4JI0I 4LFCI 4DPTA 1EI1A 2HK2A 4DV5I 2R3VA 2CZ9A 5IWAE 4LF9E 4IZJA 2GQ0A 2UXBE 3WU4A 2DEIA 2DEJA 4X64I 3QT6A 4N3OA 4DUZE 4DR2I 1IBME 2UXCI 1HNWI 4DXLA 4JI2I 4I3HA 4HACB 2UUBI 1NHJA 4K0KE 3ZZ0A 4DV7E 3J81Q 5FLXQ 4GKJI 4JYAE 4JI4I 1HNZE 2UU9I 1XMOE 4WUDA 2UUAI 1U2RA 4USMA 1FWKA 5IT9Q 4LF4E 3QT8A 1H74A 1Y4UA 2Z5CB 1J5EI 2VF3A 1N0UA 2CG9A 4UTGA 1N34E 2EFGA 3T1HE 1B62A 4JI3I 4R1FA 3T1YI 4LF6I 1EA6A 3B82A 4B3SI 4DV6I 4LF8I 1FI4A 4DV4E 4DR7E 1NZ0A 2O1VA 2WW4A 1OJ4A 3QT7A 4FWHA 1I94I 4DV1I 1KIJA 3J81C 2ZM6I 2E5LI 1Y6ZA 3M6AA 4FW9A 4NXME 1BKNA 4X65I 5LMNI 1XHKA 4LFBI 3V2UC 4JI8E 5BR8I 1N32I 4DPXA 1N33E 4AQYE 4DR4E 4DV2I 1IBLE 1XNQI 1FJGE 1KTVA 2AJ4A 3LTOA 4DUYI 4X62I 3OTOE 3J7AG 4YY3E 2V2VA 2VQFE 4B3ME 1Z0BA 1XMQE 4HYMA 3B78A 4DPWA 4JV5E 2UXDI 4LFAI 4NXNI 4MYTA 4DR3E 2HFSA 4KHPE 1ZXNA 4DR5E 4IZJD 3D4JA 2Q2EB 4IZJB 1PIEA 3K85A 4Z7YA 2Z5BB 1N36E 4JI0E 1S16A 2X36A 1Z0TA 4LFCE 4DR6I 4M1KA 4JI1I 2PNLA 1XNRE 4DV5E 3Q1QA 1ZM9A 2R42A 2F4VE 4DR1E 3PYFA 4IZKB 4DU7A 4DV0E 2O1TA 3WU5A 4UT4A 3F0NA 4WUCA 2IOPA 1MG7A 2UXCE 4DR2E 2HK3A 2LJPA 1HNWE 5IWAI 1HR0I 4LF9I 2UXBI 1ELOA 4HXZA 2ZITA 4GKJE 2O1WA 4JI4E 2UU9E 1ZM3A 1USUA 1IBMI 4MYUA 2UUAE 4DPUA 4XTJA 2V8PA 3ZZTA 4DV7I 1ZXMA 2OI2A 4YHHE 1XMOI 2O1UA 3PYEA 4DV6E 4LF8E 1HK7A 2XEXA 4DV3E 5A2QQ 4HACA 1N34I 4PRXA 1PVGA 4JI6I 2X7IA 3PYGA 4URLA 3PRYA 1I94E 4DV1E 4DV4I 4DR7I 2PNMA 2ZM6E 2E5LE 1Z0WA 1Z0VA 4PU9A 5LMNE 4GKKI 4B3RE 1H72C 4LFBE 5LMUI 1N32E 2E1RA 3K17A 4KQVA 1KKHA 2CGEA 3WU6A 4JI8I 4P7AA 3B8HA 4LF5I 4LF7E 4ED4A 4JG4A 5A2QC 1ZM4A 3ZKDA 4ZVIA 2V34A 2J7KA 1FJGI 2UXDE 3OTOI 4LFAE 4NXNE 5GMEA 4JI5I 4WUBA 2UUCE 1WUUA 1HNXI 2VQEE 4B3TE 2VQFI 2HKEA 4RPFA 3H4LA 1Z0GA 4B3MI 3WU3A 1Z0CA 1K47A 4JV5I 1ZM2A 1IBKI 2HHHI 1Z0EA 3LPSA 4JI7I 4OX9I 4KHPI 4DU8A 4DR6E 1Z59A 2Z5EA 4JI1E 4X66I 2IOQA 1N36I 4X64E 4FWDA 1DARA 2ZBKB 4FN5A 4JI2E 1XNRI 3ZM7A 2UUBE 3K1JA 2BM0A 2F4VI 4DR1I 1HR0E 3JAMQ 1RREA 1QZRA 4DV0I 5LL6R 4DUZI 3P06A 2Z5BA 3J80Q 3ZZUA 1FKAE 3GONA 1USVA 4K0KI 1VISA 1J5EE 2NPFA 4JYAI 1HNZI 4JI3E 4IZKA 3T1YE 4LF6E 4B3SE 4LF4I 2A2DA 4PRVA 1Z5CA 3LNUA 3T1HI 1N0VC 2V2ZA 5GMDA 4YHHI 4JI6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 I;  3JAM C;  1FWL A;  2GS8 A;  1H7U A;  4P52 A;  4X65 E;  1PKP A;  2BM1 A;  3J80 C;  5BR8 E;  4GKK E;  4Z7C A;  4DV2 E;  5LMU E;  4EMD A;  4NXM I;  5FLX C;  1MU5 A;  1XNQ E;  4B3R I;  1N33 I;  4AQY I;  4DUY E;  5IT9 C;  4X62 E;  4DR4 I;  4LF5 E;  4FWG A;  1IBL I;  3QT5 A;  3J7A M;  2BV3 A;  5L3J A;  4LF7 I;  4YY3 I;  2V2Q A;  1KVK A;  1H7S A;  1A6F A;  1NHH A;  4JI5 E;  2A2C A;  1HNX E;  1UEK A;  1XMQ I;  4DPY A;  3ZKB A;  2HKJ A;  2HFU A;  1S4E A;  4DR3 I;  1RR9 A;  4USK A;  3V5R A;  1IBK E;  3HUL A;  2UUC I;  4DR5 I;  4HY1 A;  2HHH E;  3PYD A;  4JI7 E;  1Z5B A;  2VQE I;  4B3T I;  1Z5A A;  4OX9 E;  1B63 A;  1NHI A;  1D6T A;  1H73 A;  3CWV A;  4X66 E;  1FNM A;  1MX0 A;  4JI0 I;  4LFC I;  4DPT A;  1EI1 A;  2HK2 A;  4DV5 I;  2R3V A;  2CZ9 A;  5IWA E;  4LF9 E;  2UXB E;  3WU4 A;  2DEI A;  2DEJ A;  4X64 I;  3QT6 A;  4DUZ E;  4DR2 I;  1IBM E;  2UXC I;  1HNW I;  4DXL A;  4JI2 I;  4I3H A;  4HAC B;  2UUB I;  1NHJ A;  4K0K E;  3ZZ0 A;  4DV7 E;  3J81 Q;  5FLX Q;  4GKJ I;  4JYA E;  4JI4 I;  1HNZ E;  2UU9 I;  1XMO E;  4WUD A;  2UUA I;  1U2R A;  4USM A;  1FWK A;  5IT9 Q;  4LF4 E;  3QT8 A;  1H74 A;  1J5E I;  2VF3 A;  1N0U A;  4UTG A;  1N34 E;  2EFG A;  3T1H E;  1B62 A;  4JI3 I;  4R1F A;  3T1Y I;  4LF6 I;  1EA6 A;  3B82 A;  4B3S I;  4DV6 I;  4LF8 I;  1FI4 A;  4DV4 E;  4DR7 E;  1NZ0 A;  2WW4 A;  1OJ4 A;  3QT7 A;  4FWH A;  1I94 I;  4DV1 I;  1KIJ A;  3J81 C;  2ZM6 I;  2E5L I;  3M6A A;  4FW9 A;  4NXM E;  1BKN A;  4X65 I;  5LMN I;  1XHK A;  4LFB I;  3V2U C;  4JI8 E;  5BR8 I;  1N32 I;  4DPX A;  1N33 E;  4AQY E;  4DR4 E;  4DV2 I;  1IBL E;  1XNQ I;  1FJG E;  1KTV A;  2AJ4 A;  3LTO A;  4DUY I;  4X62 I;  3OTO E;  3J7A G;  4YY3 E;  2V2V A;  2VQF E;  4B3M E;  1Z0B A;  1XMQ E;  4HYM A;  3B78 A;  4DPW A;  4JV5 E;  2UXD I;  4LFA I;  4NXN I;  4MYT A;  4DR3 E;  2HFS A;  4KHP E;  1ZXN A;  4DR5 E;  3D4J A;  2Q2E B;  1PIE A;  4Z7Y A;  1N36 E;  4JI0 E;  1S16 A;  2X36 A;  1Z0T A;  4LFC E;  4DR6 I;  4M1K A;  4JI1 I;  1XNR E;  4DV5 E;  3Q1Q A;  1ZM9 A;  2R42 A;  2F4V E;  4DR1 E;  3PYF A;  4DU7 A;  4DV0 E;  3WU5 A;  4UT4 A;  3F0N A;  4WUC A;  1MG7 A;  2UXC E;  4DR2 E;  2HK3 A;  2LJP A;  1HNW E;  5IWA I;  1HR0 I;  4LF9 I;  2UXB I;  1ELO A;  4HXZ A;  2ZIT A;  4GKJ E;  4JI4 E;  2UU9 E;  1ZM3 A;  1IBM I;  4MYU A;  2UUA E;  4DPU A;  4XTJ A;  2V8P A;  3ZZT A;  4DV7 I;  1ZXM A;  2OI2 A;  4YHH E;  1XMO I;  3PYE A;  4DV6 E;  4LF8 E;  2XEX A;  4DV3 E;  5A2Q Q;  4HAC A;  1N34 I;  4PRX A;  1PVG A;  4JI6 I;  2X7I A;  3PYG A;  1I94 E;  4URL A;  4DV1 E;  4DV4 I;  4DR7 I;  2ZM6 E;  2E5L E;  1Z0W A;  1Z0V A;  4PU9 A;  5LMN E;  4GKK I;  4B3R E;  1H72 C;  4LFB E;  5LMU I;  1N32 E;  2E1R A;  3K17 A;  4KQV A;  1KKH A;  3WU6 A;  4JI8 I;  4P7A A;  3B8H A;  4LF5 I;  4LF7 E;  4ED4 A;  4JG4 A;  5A2Q C;  1ZM4 A;  3ZKD A;  4ZVI A;  2V34 A;  2J7K A;  1FJG I;  2UXD E;  3OTO I;  4LFA E;  4NXN E;  5GME A;  4JI5 I;  4WUB A;  2UUC E;  1WUU A;  1HNX I;  2VQE E;  4B3T E;  2VQF I;  2HKE A;  4RPF A;  3H4L A;  1Z0G A;  4B3M I;  3WU3 A;  1Z0C A;  1K47 A;  4JV5 I;  1ZM2 A;  1IBK I;  2HHH I;  1Z0E A;  3LPS A;  4JI7 I;  4OX9 I;  4KHP I;  4DU8 A;  4DR6 E;  1Z59 A;  4JI1 E;  4X66 I;  1N36 I;  4X64 E;  4FWD A;  1DAR A;  2ZBK B;  4FN5 A;  4JI2 E;  1XNR I;  3ZM7 A;  2UUB E;  3K1J A;  2BM0 A;  2F4V I;  4DR1 I;  1HR0 E;  3JAM Q;  1RRE A;  1QZR A;  4DV0 I;  5LL6 R;  4DUZ I;  3J80 Q;  3ZZU A;  1FKA E;  3GON A;  4K0K I;  1VIS A;  1J5E E;  2NPF A;  4JYA I;  1HNZ I;  4JI3 E;  3T1Y E;  4LF6 E;  4B3S E;  4LF4 I;  2A2D A;  4PRV A;  1Z5C A;  3LNU A;  3T1H I;  1N0V C;  2V2Z A;  5GMD A;  4YHH I;  4JI6 E; 
#chains in the Genus database with same CATH topology
 4DV3 I;  3JAM C;  1FWL A;  2GS8 A;  1H7U A;  2Z5C A;  4P52 A;  4X65 E;  1PKP A;  2BM1 A;  3J80 C;  1OYP A;  3Q6N A;  5BR8 E;  4GKK E;  3UHM A;  2JEA A;  4Z7C A;  4DV2 E;  5LMU E;  2PO1 A;  4EMD A;  2J65 A;  4NXM I;  5FLX C;  1MU5 A;  1XNQ E;  3HJC A;  4B3R I;  1N33 I;  4AQY I;  4DUY E;  5K36 F;  5IT9 C;  4X62 E;  4DR4 I;  3L7Z B;  4LF5 E;  4FWG A;  2PO2 B;  1IBL I;  1Y4S A;  4LCH A;  3QT5 A;  3J7A M;  1YHC A;  2BV3 A;  4BA2 B;  5L3J A;  4LF7 I;  4YY3 I;  2V2Q A;  1KVK A;  4U3B A;  1H7S A;  1A6F A;  1NHH A;  4JI5 E;  2A2C A;  5FWK A;  1HNX E;  4MU4 A;  1UEK A;  1XMQ I;  1OYS A;  1E3H A;  5DRR A;  5EL9 A;  3H1C A;  4DPY A;  3ZKB A;  2HKJ A;  2HFU A;  1S4E A;  4DR3 I;  1RR9 A;  4USK A;  3V5R A;  1IBK E;  2NN6 D;  1UDS A;  3HUL A;  2UUC I;  4DR5 I;  4HY1 A;  2HHH E;  3PYD A;  4JI7 E;  1Z5B A;  2VQE I;  4B3T I;  3M7N G;  1Z5A A;  4OX9 E;  1B63 A;  4IS9 A;  1NHI A;  1D6T A;  1H73 A;  3Q6M A;  3CWV A;  4X66 E;  1FNM A;  1MX0 A;  4JI0 I;  2C38 A;  4LFC I;  4AID A;  4OO1 D;  4DPT A;  2NN6 A;  1EI1 A;  2HK2 A;  4DV5 I;  2R3V A;  2CZ9 A;  5IWA E;  4LF9 E;  4IZJ A;  2GQ0 A;  2UXB E;  3WU4 A;  2DEI A;  2DEJ A;  4X64 I;  2WNR A;  5JEA F;  5DRO A;  1R6L A;  3QT6 A;  4N3O A;  4DUZ E;  4DR2 I;  1IBM E;  2UXC I;  1HNW I;  4DXL A;  4IFD F;  4JI2 I;  4OO1 A;  4I3H A;  4HAC B;  4AIM A;  2UUB I;  1NHJ A;  4K0K E;  3U1Y A;  3ZZ0 A;  4DV7 E;  3J81 Q;  5FLX Q;  4GKJ I;  4JYA E;  5C0X D;  4JI4 I;  1HNZ E;  2UU9 I;  5JEA A;  1XMO E;  2JE6 B;  4WUD A;  2UUA I;  1U2R A;  4USM A;  1FWK A;  5IT9 Q;  3P3E A;  4LF4 E;  4OKG A;  3QT8 A;  1H74 A;  2NN6 C;  1Y4U A;  1UDN A;  2Z5C B;  1J5E I;  2VF3 A;  1N0U A;  2CG9 A;  4UTG A;  1N34 E;  2EFG A;  3T1H E;  1B62 A;  2IER A;  4JI3 I;  4R1F A;  2C39 A;  3T1Y I;  1EA6 A;  4LF6 I;  2JEA B;  3B82 A;  4B3S I;  4DV6 I;  4LF8 I;  2WP8 A;  3U1K A;  2PO1 B;  1FI4 A;  4BA1 B;  4DV4 E;  4DR7 E;  1NZ0 A;  4OO1 C;  2O1V A;  4MU0 A;  2WW4 A;  1OJ4 A;  3QT7 A;  4FWH A;  1RHY A;  2IES A;  1I94 I;  4DV1 I;  1KIJ A;  3J81 C;  2ZM6 I;  4U3D A;  2E5L I;  1Y6Z A;  3M6A A;  3P3C A;  4FW9 A;  4NXM E;  1BKN A;  4LPF A;  5K36 D;  4FW4 A;  4X65 I;  5LMN I;  4MDT A;  1XHK A;  4LFB I;  3V2U C;  4JI8 E;  4MQY A;  5BR8 I;  1N32 I;  2GO3 A;  4DPX A;  1N33 E;  4AQY E;  4DR4 E;  2PO0 A;  4DV2 I;  5C0X C;  3GCM A;  3HKM A;  4LCF A;  1IBL E;  4QNJ A;  3CDI A;  1XNQ I;  1FJG E;  1KTV A;  2AJ4 A;  5K36 A;  3LTO A;  4DUY I;  4X62 I;  3OTO E;  3J7A G;  4YY3 E;  1UDQ A;  2V2V A;  3NZK A;  2NN6 E;  2VQF E;  2C37 A;  4B3M E;  1Z0B A;  1XMQ E;  4HYM A;  3B78 A;  4DPW A;  2C38 B;  4JV5 E;  2UXD I;  4LFA I;  4NXN I;  4MYT A;  4DR3 E;  2HFS A;  2NN6 B;  3L7Z A;  4KHP E;  1ZXN A;  4DR5 E;  4OO1 E;  2BR2 A;  4IZJ D;  3D4J A;  1YH8 A;  2Q2E B;  4IZJ B;  1PIE A;  3K85 A;  1R6M A;  2WNR B;  5K36 C;  4Z7Y A;  4LOM A;  2Z5B B;  1N36 E;  4JI0 E;  1S16 A;  2X36 A;  1Y60 A;  1Z0T A;  4LFC E;  4OO1 B;  4DR6 I;  4M1K A;  3GME A;  2PNL A;  4JI1 I;  1XNR E;  2BA0 G;  2BA1 D;  4QNK A;  4DV5 E;  3P76 A;  3Q1Q A;  1ZM9 A;  2R42 A;  2F4V E;  4FW6 A;  3PYF A;  4IZK B;  4DR1 E;  5JEA D;  4FW5 A;  4DU7 A;  4DV0 E;  2O1T A;  3WU5 A;  4IFD D;  4UT4 A;  3F0N A;  5C0X E;  4WUC A;  2IOP A;  1MG7 A;  2UXC E;  1Y5Y A;  4DR2 E;  2HK3 A;  2LJP A;  1HNW E;  3B4T A;  5IWA I;  1HR0 I;  3GLL A;  4LF9 I;  3DD6 A;  2UXB I;  1ELO A;  4HXZ A;  2ZIT A;  1UDO A;  2O1W A;  5C0X B;  4GKJ E;  2JT2 A;  2WP8 B;  4JI4 E;  2UU9 E;  1ZM3 A;  1USU A;  4IFD A;  1IBM I;  4MYU A;  2UUA E;  4DPU A;  4XTJ A;  2V8P A;  3ZZT A;  4DV7 I;  1ZXM A;  4LCG A;  2CVE A;  2OI2 A;  4YHH E;  1XMO I;  2O1U A;  3PYE A;  4DV6 E;  2JEB A;  4LF8 E;  1HK7 A;  2XEX A;  4DV3 E;  5A2Q Q;  4HAC A;  3PS2 A;  1N34 I;  5K36 E;  4PRX A;  1PVG A;  4JI6 I;  2X7I A;  3PYG A;  2PNZ A;  5JEA C;  2PO0 B;  4URL A;  2VES A;  3PRY A;  4DV1 E;  1I94 E;  4IFD C;  4DV4 I;  4DR7 I;  2PNM A;  2ZM6 E;  2E5L E;  1Z0W A;  5K36 B;  5DNX A;  1Z0V A;  4PU9 A;  5LMN E;  4GKK I;  4B3R E;  1H72 C;  4LFB E;  5LMU I;  1N32 E;  2E1R A;  2C37 B;  4BA1 A;  3K17 A;  4KQV A;  1KKH A;  5ELW A;  2CGE A;  4NBQ A;  3KRN A;  5EKW A;  3WU6 A;  4JI8 I;  4P7A A;  3B8H A;  4LF5 I;  4LF7 E;  4ED4 A;  3M85 D;  4FW3 A;  4JG4 A;  5DNL A;  5A2Q C;  1ZM4 A;  2BA1 G;  3ZKD A;  4ZVI A;  2V34 A;  2BR2 B;  2O3Z A;  2J7K A;  4FW7 A;  1FJG I;  1OYR A;  2UXD E;  1E3P A;  3OTO I;  4LFA E;  4NXN E;  5GME A;  4JI5 I;  4WUB A;  2PO2 A;  2UUC E;  1VI7 A;  1WUU A;  1HNX I;  2VQE E;  4B3T E;  2VQF I;  2HKE A;  4RPF A;  3H4L A;  1Z0G A;  4B3M I;  3WU3 A;  4BA2 A;  1Z0C A;  1K47 A;  4JV5 I;  1ZM2 A;  5JEA E;  5DRP A;  1IBK I;  5DRQ A;  2HHH I;  1Z0E A;  3LPS A;  4JI7 I;  4IFD E;  4OX9 I;  4KHP I;  4DU8 A;  4DR6 E;  1Z59 A;  2F1D A;  2NN6 F;  2Z5E A;  4JI1 E;  4X66 I;  4J3D A;  5JEA B;  2AE8 A;  2IOQ A;  3CDJ A;  4ISA A;  1N36 I;  4X64 E;  4IFD B;  4FWD A;  1DAR A;  2ZBK B;  4FN5 A;  4JI2 E;  1XNR I;  3ZM7 A;  1P42 A;  2UUB E;  3K1J A;  2BM0 A;  4OO1 F;  3PS3 A;  2F4V I;  4DR1 I;  2C39 B;  1HR0 E;  3JAM Q;  1RRE A;  1QZR A;  4DV0 I;  4OZE A;  4MU3 A;  5LL6 R;  4DUZ I;  2JEB B;  3P06 A;  2Z5B A;  1XXE A;  3J80 Q;  3ZZU A;  1FKA E;  3GON A;  1USV A;  4K0K I;  2GO4 A;  1VIS A;  3P3G A;  1J5E E;  3M7N D;  2NPF A;  3PS1 A;  4JYA I;  1HNZ I;  4JI3 E;  4IZK A;  2PNZ B;  3T1Y E;  4LF6 E;  4B3S E;  4GQU A;  5C0X F;  4LF4 I;  2A2D A;  4PRV A;  1Z5C A;  3LNU A;  3T1H I;  3M85 G;  4AM3 A;  2BA0 D;  1N0V C;  2V2Z A;  4MU1 A;  5GMD A;  4YHH I;  4JI6 E;  5C0X A;  2JE6 A; 
#chains in the Genus database with same CATH homology
 4DV3 I;  3JAM C;  1FWL A;  2GS8 A;  1H7U A;  2Z5C A;  4P52 A;  4X65 E;  1PKP A;  2BM1 A;  3J80 C;  3Q6N A;  5BR8 E;  4GKK E;  4Z7C A;  4DV2 E;  5LMU E;  4EMD A;  4NXM I;  5FLX C;  1MU5 A;  1XNQ E;  3HJC A;  4B3R I;  1N33 I;  4AQY I;  4DUY E;  5IT9 C;  4X62 E;  4DR4 I;  4LF5 E;  4FWG A;  1IBL I;  1Y4S A;  3QT5 A;  3J7A M;  2BV3 A;  5L3J A;  4LF7 I;  4YY3 I;  2V2Q A;  1KVK A;  1H7S A;  1A6F A;  1NHH A;  4JI5 E;  2A2C A;  5FWK A;  1HNX E;  1UEK A;  1XMQ I;  4DPY A;  3ZKB A;  2HKJ A;  2HFU A;  1S4E A;  4DR3 I;  1RR9 A;  4USK A;  3V5R A;  1IBK E;  3HUL A;  2UUC I;  4DR5 I;  4HY1 A;  2HHH E;  3PYD A;  4JI7 E;  1Z5B A;  2VQE I;  4B3T I;  1Z5A A;  4OX9 E;  1B63 A;  1NHI A;  1D6T A;  1H73 A;  3Q6M A;  3CWV A;  4X66 E;  1FNM A;  1MX0 A;  4JI0 I;  4LFC I;  4DPT A;  1EI1 A;  2HK2 A;  4DV5 I;  2R3V A;  2CZ9 A;  5IWA E;  4LF9 E;  4IZJ A;  2GQ0 A;  2UXB E;  3WU4 A;  2DEI A;  2DEJ A;  4X64 I;  3QT6 A;  4N3O A;  4DUZ E;  4DR2 I;  1IBM E;  2UXC I;  1HNW I;  4DXL A;  4JI2 I;  4I3H A;  4HAC B;  2UUB I;  1NHJ A;  4K0K E;  3ZZ0 A;  4DV7 E;  3J81 Q;  5FLX Q;  4GKJ I;  4JYA E;  4JI4 I;  1HNZ E;  2UU9 I;  1XMO E;  4WUD A;  2UUA I;  1U2R A;  4USM A;  1FWK A;  5IT9 Q;  4LF4 E;  3QT8 A;  1H74 A;  1Y4U A;  2Z5C B;  1J5E I;  2VF3 A;  1N0U A;  2CG9 A;  4UTG A;  1N34 E;  2EFG A;  3T1H E;  1B62 A;  4JI3 I;  4R1F A;  3T1Y I;  4LF6 I;  1EA6 A;  3B82 A;  4B3S I;  4DV6 I;  4LF8 I;  1FI4 A;  4DV4 E;  4DR7 E;  1NZ0 A;  2O1V A;  2WW4 A;  1OJ4 A;  3QT7 A;  4FWH A;  1I94 I;  4DV1 I;  1KIJ A;  3J81 C;  2ZM6 I;  2E5L I;  1Y6Z A;  3M6A A;  4FW9 A;  4NXM E;  1BKN A;  4X65 I;  5LMN I;  1XHK A;  4LFB I;  3V2U C;  4JI8 E;  5BR8 I;  1N32 I;  4DPX A;  1N33 E;  4AQY E;  4DR4 E;  4DV2 I;  1IBL E;  1XNQ I;  1FJG E;  1KTV A;  2AJ4 A;  3LTO A;  4DUY I;  4X62 I;  3OTO E;  3J7A G;  4YY3 E;  2V2V A;  2VQF E;  4B3M E;  1Z0B A;  1XMQ E;  4HYM A;  3B78 A;  4DPW A;  4JV5 E;  2UXD I;  4LFA I;  4NXN I;  4MYT A;  4DR3 E;  2HFS A;  4KHP E;  1ZXN A;  4DR5 E;  4IZJ D;  3D4J A;  2Q2E B;  4IZJ B;  1PIE A;  3K85 A;  4Z7Y A;  2Z5B B;  1N36 E;  4JI0 E;  1S16 A;  2X36 A;  1Z0T A;  4LFC E;  4DR6 I;  4M1K A;  4JI1 I;  2PNL A;  1XNR E;  4DV5 E;  3Q1Q A;  1ZM9 A;  2R42 A;  2F4V E;  4DR1 E;  3PYF A;  4IZK B;  4DU7 A;  4DV0 E;  2O1T A;  3WU5 A;  4UT4 A;  3F0N A;  4WUC A;  2IOP A;  1MG7 A;  2UXC E;  4DR2 E;  2HK3 A;  2LJP A;  1HNW E;  5IWA I;  1HR0 I;  4LF9 I;  2UXB I;  1ELO A;  4HXZ A;  2ZIT A;  4GKJ E;  2O1W A;  4JI4 E;  2UU9 E;  1ZM3 A;  1USU A;  1IBM I;  4MYU A;  2UUA E;  4DPU A;  4XTJ A;  2V8P A;  3ZZT A;  4DV7 I;  1ZXM A;  2OI2 A;  4YHH E;  1XMO I;  2O1U A;  3PYE A;  4DV6 E;  4LF8 E;  1HK7 A;  2XEX A;  4DV3 E;  5A2Q Q;  4HAC A;  1N34 I;  4PRX A;  1PVG A;  4JI6 I;  2X7I A;  3PYG A;  4URL A;  3PRY A;  1I94 E;  4DV1 E;  4DV4 I;  4DR7 I;  2PNM A;  2ZM6 E;  2E5L E;  1Z0W A;  1Z0V A;  4PU9 A;  5LMN E;  4GKK I;  4B3R E;  1H72 C;  4LFB E;  5LMU I;  1N32 E;  2E1R A;  3K17 A;  4KQV A;  1KKH A;  2CGE A;  3WU6 A;  4JI8 I;  4P7A A;  3B8H A;  4LF5 I;  4LF7 E;  4ED4 A;  4JG4 A;  5A2Q C;  1ZM4 A;  3ZKD A;  4ZVI A;  2V34 A;  2J7K A;  1FJG I;  2UXD E;  3OTO I;  4LFA E;  4NXN E;  5GME A;  4JI5 I;  4WUB A;  2UUC E;  1WUU A;  1HNX I;  2VQE E;  4B3T E;  2VQF I;  2HKE A;  4RPF A;  3H4L A;  1Z0G A;  4B3M I;  3WU3 A;  1Z0C A;  1K47 A;  4JV5 I;  1ZM2 A;  1IBK I;  2HHH I;  1Z0E A;  3LPS A;  4JI7 I;  4OX9 I;  4KHP I;  4DU8 A;  4DR6 E;  1Z59 A;  2Z5E A;  4JI1 E;  4X66 I;  2IOQ A;  1N36 I;  4X64 E;  4FWD A;  1DAR A;  2ZBK B;  4FN5 A;  4JI2 E;  1XNR I;  3ZM7 A;  2UUB E;  3K1J A;  2BM0 A;  2F4V I;  4DR1 I;  1HR0 E;  3JAM Q;  1RRE A;  1QZR A;  4DV0 I;  5LL6 R;  4DUZ I;  3P06 A;  2Z5B A;  3J80 Q;  3ZZU A;  1FKA E;  3GON A;  1USV A;  4K0K I;  1VIS A;  1J5E E;  2NPF A;  4JYA I;  1HNZ I;  4JI3 E;  4IZK A;  3T1Y E;  4LF6 E;  4B3S E;  4LF4 I;  2A2D A;  4PRV A;  1Z5C A;  3LNU A;  3T1H I;  1N0V C;  2V2Z A;  5GMD A;  4YHH I;  4JI6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...