4JYAI

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jyaI00
1ZXNA 2DEJA 4JI5I 2V8PA 3J7AG 4JI2E 4JI3E 4X64I 1OJ4A 4P52A 4DR7E 3V2UC 4I3HA 1I94E 2AJ4A 4DR2I 2BM0A 4DR6I 1MG7A 4FW9A 4K0KE 4LF4I 4JI7I 3LTOA 4JG4A 3ZKBA 1HR0E 4X65E 1HNWI 1N0VC 3ZKDA 2OI2A 4LF6E 1PVGA 1N36E 4JV5I 4GKKI 1XHKA 2UU9I 4NXME 4USMA 2HK2A 4B3RI 3ZZTA 1UEKA 5LMNI 2E5LE 1KIJA 4UT4A 2R3VA 4LF5E 4LF8E 3J81Q 1IBKE 1H7UA 1BKNA 1S4EA 2UXCI 4WUCA 4JI5E 4X66E 4GKJI 4Z7CA 4DV5I 2F4VI 2Q2EB 1RREA 1XMQI 4DR5E 4X64E 2LJPA 2UUCI 1ZM9A 4DR6E 4XTJA 1IBLI 1A6FA 1N32E 1D6TA 4LFBI 4JI4I 4JI7E 1N33E 4DU7A 2A2DA 3V5RA 3WU3A 1HNWE 2VQEE 3JAMC 4OX9E 2A2CA 4YHHE 4M1KA 3Q1QA 2HKJA 4ZVIA 2X36A 4DV6I 4P7AA 1DARA 3PYGA 4GKKE 4FWDA 2UU9E 4X62I 4DV1E 4LF9E 2HFSA 1VISA 1ZM2A 5LMNE 2J7KA 3B8HA 4JYAE 1PIEA 1Z5BA 4JI6I 2V2VA 2UUAI 5LL6R 4JI0E 4DV7I 1HNXI 1IBME 4DR4I 1NHIA 4LFCI 2UXBI 1Z0VA 3ZM7A 4B3SE 3K1JA 4DV5E 2F4VE 3GONA 1XMQE 4FN5A 4KHPE 4B3ME 4DUYE 1QZRA 2BM1A 2VF3A 3ZZUA 4DR3E 4LFBE 3H4LA 3WU6A 4JI4E 4AQYI 3T1HI 1H74A 1HNZE 3OTOE 1ZM3A 5GMDA 4DUZI 3QT8A 1FJGE 5FLXQ 4DV2I 5IWAI 1WUUA 2UUBI 4DV3I 2HFUA 4USKA 3T1YE 3JAMQ 4DV0E 4X62E 2V2QA 1NZ0A 3PYDA 1FWLA 2ZM6I 1Z5CA 2VQFE 1KVKA 4DPUA 4JI6E 4JI8I 3F0NA 4DV7E 1HNXE 2X7IA 2DEIA 2E1RA 4URLA 4B3TI 5LMUI 3QT6A 1N0UA 1H72C 4DR1I 1XNRI 1PKPA 4HYMA 1N34I 1XMOI 2UXDI 1XNQI 3M6AA 4R1FA 1EI1A 4DR2E 2GS8A 3QT5A 5FLXC 4LF4E 3WU5A 2V2ZA 4FWHA 1I94I 4HXZA 4LFAI 1Z0CA 4K0KI 1NHHA 2HKEA 4JV5E 1MX0A 2R42A 5IWAE 1HR0I 4DPYA 4X65I 2UUBE 4B3RE 4RPFA 5L3JA 3J80C 4JI1I 4LF6I 1FKAE 1Z5AA 4WUBA 1B62A 4MYTA 2ZITA 4NXMI 2HK3A 1RR9A 4PRVA 4JI8E 3ZZ0A 2E5LI 4ED4A 4NXNI 3QT7A 2UXCE 4LF5I 5BR8I 4GKJE 2EFGA 4DR1E 2XEXA 1IBKI 1H7SA 4HY1A 1XMOE 2UXDE 4DV4I 3LPSA 2UUCE 4DPTA 1IBLE 4X66I 3D4JA 1Z0WA 4LF7I 2NPFA 4DR5I 4UTGA 2V34A 1J5EI 3CWVA 4LFAE 1N32I 4DV6E 4DPWA 3LNUA 1N33I 1ZXMA 3B82A 2VQEI 4OX9I 5A2QQ 4YHHI 4DXLA 4JI1E 1S16A 2UUAE 4EMDA 3J80Q 4DV1I 4LF9I 4DR4E 1ELOA 2HHHI 1KKHA 2CZ9A 4LFCE 1FNMA 2UXBE 4JYAI 4PRXA 5IT9Q 4DU8A 4NXNE 1Z0TA 5BR8E 1Z0EA 4JI0I 1K47A 4YY3I 1IBMI 1H73A 1FI4A 4DV4E 4FWGA 4B3SI 4JI2I 1EA6A 4JI3I 1Z59A 4DR7I 4DPXA 1MU5A 3PYEA 4LF7E 1J5EE 4AQYE 3T1HE 4KHPI 4B3MI 4MYUA 4DUYI 5A2QC 1ZM4A 1KTVA 4DUZE 4DR3I 1Z0BA 4DV2E 4DV3E 1NHJA 4WUDA 2WW4A 1HNZI 4HACB 3OTOI 2ZM6E 1N36I 1FJGI 5IT9C 1B63A 3J7AM 1U2RA 3J81C 1FWKA 3T1YI 3PYFA 4DV0I 2ZBKB 4HACA 3B78A 4B3TE 5LMUE 2HHHE 4KQVA 4LF8I 3K17A 2VQFI 3WU4A 1Z0GA 3HULA 1XNRE 4Z7YA 1N34E 5GMEA 4PU9A 1XNQE 4YY3E 2BV3A
chains in the Genus database with same CATH superfamily
1ZXNA 2DEJA 4JI5I 2IERA 2V8PA 2O1UA 5JEAE 3J7AG 2O3ZA 4JI2E 4JI3E 4X64I 1OJ4A 2PO2A 4P52A 4QNJA 2Z5CA 4DR7E 3V2UC 4I3HA 1I94E 2AJ4A 3L7ZA 4DR2I 2BM0A 3P3CA 4DR6I 3DD6A 2BA1D 1MG7A 4FW9A 4K0KE 1R6LA 4LF4I 4JI7I 3LTOA 4JG4A 4MU1A 3ZKBA 1HR0E 4X65E 1HNWI 1N0VC 3ZKDA 3PRYA 2GO3A 2OI2A 4LF6E 1PVGA 1N36E 4JV5I 5K36D 4GKKI 1XHKA 3HKMA 2UU9I 1Y6ZA 4NXME 2JT2A 4USMA 2HK2A 4B3RI 3ZZTA 2NN6D 1UEKA 2O1VA 4IZJB 1E3HA 5LMNI 2E5LE 1KIJA 4UT4A 5JEAB 4FW5A 2BA0G 2R3VA 4LF5E 3NZKA 4LF8E 2IOPA 3J81Q 2AE8A 4BA1B 1IBKE 4U3DA 1Y60A 2PNZB 1H7UA 1BKNA 2CG9A 1Y5YA 4IZJA 1S4EA 2Z5BB 2UXCI 4WUCA 4JI5E 5JEAA 4X66E 4AIMA 3CDIA 4Z7CA 4DV5I 2F4VI 4GKJI 2Q2EB 1RREA 1XMQI 4DR5E 1HK7A 4X64E 4BA1A 2LJPA 2PNZA 2UUCI 1ZM9A 2IESA 2BR2B 4BA2B 4DR6E 4XTJA 1IBLI 2Z5BA 1A6FA 1N32E 1D6TA 4N3OA 4LFBI 4JI4I 4JI7E 1N33E 4IFDE 4DU7A 4NBQA 2A2DA 3V5RA 3WU3A 1HNWE 2VQEE 3JAMC 4OX9E 4IFDC 4MU4A 2A2CA 2WP8A 4YHHE 4M1KA 3Q1QA 2BR2A 4BA2A 5DRPA 2HKJA 3KRNA 4ZVIA 2X36A 4DV6I 4IS9A 4P7AA 2BA0D 1DARA 3PYGA 4GKKE 4FWDA 4AM3A 2PNLA 2UU9E 4X62I 4DV1E 4LF9E 2HFSA 1VISA 4MU0A 1YHCA 1ZM2A 5LMNE 2J7KA 3B8HA 4JYAE 1PIEA 1Z5BA 4JI6I 2V2VA 2UUAI 5LL6R 2F1DA 4JI0E 4FW3A 4DV7I 1HNXI 5EL9A 1IBME 4DR4I 5ELWA 1NHIA 4LFCI 2UXBI 3H1CA 1Z0VA 3ZM7A 4B3SE 4IFDB 4FW7A 3K1JA 4DV5E 2F4VE 3GONA 4OKGA 1XMQE 4FN5A 4KHPE 4B3ME 1P42A 4DUYE 1QZRA 2BM1A 2VF3A 3B4TA 2PO1B 3ZZUA 4DR3E 3P06A 4IFDA 4LFBE 3H4LA 3WU6A 3UHMA 4JI4E 4AQYI 3T1HI 3GLLA 4AIDA 1H74A 1HNZE 3OTOE 1ZM3A 2PO1A 5GMDA 4DUZI 3QT8A 4FW6A 1FJGE 2CVEA 5FLXQ 4DV2I 5IWAI 1WUUA 5C0XE 2UUBI 4DV3I 2HFUA 4USKA 4IZJD 1Y4UA 3JAMQ 4DV0E 3T1YE 4X62E 5C0XC 2V2QA 1NZ0A 3PYDA 1FWLA 2ZM6I 5JEAD 1Z5CA 4IFDF 1YH8A 2VQFE 1KVKA 4DPUA 5DNLA 4JI6E 2Z5EA 4JI8I 3F0NA 2GQ0A 4DV7E 1HNXE 2X7IA 2DEIA 2E1RA 1XXEA 2JE6B 4URLA 4B3TI 5LMUI 3QT6A 2J65A 1N0UA 1H72C 2VESA 3P3EA 4DR1I 2IOQA 1XNRI 1PKPA 4HYMA 1N34I 5FWKA 3U1KA 1XMOI 2UXDI 1XNQI 3M6AA 5EKWA 4R1FA 1EI1A 4DR2E 2GS8A 2JE6A 3QT5A 2C37B 5FLXC 4LF4E 5C0XB 3WU5A 2V2ZA 1OYRA 4FWHA 1OYSA 1I94I 4HXZA 4LFAI 4OO1E 1Z0CA 1USUA 4K0KI 1USVA 4LCHA 2C37A 4LCGA 4OO1C 1NHHA 2HKEA 4JV5E 3M7NG 5C0XA 1MX0A 2R42A 5IWAE 1HR0I 4DPYA 4X65I 2UUBE 4B3RE 1RHYA 4RPFA 2NN6F 5L3JA 3J80C 4JI1I 4LF6I 3HJCA 1FKAE 1Z5AA 4WUBA 4QNKA 1B62A 4MYTA 2ZITA 4NXMI 2HK3A 1RR9A 4PRVA 2C39B 4JI8E 3ZZ0A 4MQYA 2E5LI 4U3BA 4ED4A 3GCMA 3Q6MA 5C0XF 4IFDD 1OYPA 4NXNI 3QT7A 2UXCE 4LF5I 5BR8I 3K85A 4GKJE 2EFGA 4DR1E 1VI7A 2XEXA 1IBKI 4OO1B 1H7SA 4HY1A 3PS2A 5K36E 2C39A 1XMOE 2UXDE 4DV4I 3LPSA 2NN6E 2UUCE 5K36C 4DPTA 2JEBB 4ISAA 1IBLE 2CGEA 4X66I 3D4JA 1Z0WA 3M7ND 2NN6C 2PO0B 4LF7I 2NPFA 4DR5I 4UTGA 2V34A 1J5EI 3CDJA 3CWVA 2WNRB 4OO1A 1UDQA 5JEAC 4LFAE 3U1YA 1N32I 2JEBA 1UDSA 4DV6E 4DPWA 3LNUA 1N33I 1ZXMA 3P3GA 2PO0A 3B82A 4J3DA 2WNRA 2VQEI 4OX9I 5A2QQ 4YHHI 4DXLA 4JI1E 1S16A 4LOMA 5K36B 2UUAE 4OO1F 4EMDA 5DNXA 3J80Q 4DV1I 3P76A 4LF9I 4DR4E 1ELOA 2NN6B 1UDOA 2O1TA 2HHHI 1KKHA 2CZ9A 1R6MA 4LFCE 1FNMA 2UXBE 4JYAI 4PRXA 5IT9Q 4DU8A 4NXNE 1Z0TA 5BR8E 4LPFA 5K36A 1Z0EA 4JI0I 4LCFA 1K47A 4YY3I 1IBMI 3M85G 1H73A 2NN6A 3Q6NA 1FI4A 5DRRA 4DV4E 4FWGA 4MU3A 5C0XD 4B3SI 4JI2I 1EA6A 4JI3I 1Z59A 4DR7I 4DPXA 1MU5A 3PYEA 4LF7E 1J5EE 4AQYE 3T1HE 4KHPI 4B3MI 4MYUA 4DUYI 3GMEA 5A2QC 1ZM4A 1KTVA 2PNMA 4FW4A 2WP8B 4DUZE 4DR3I 1Z0BA 2C38B 5K36F 4DV2E 2JEAB 4MDTA 4DV3E 1NHJA 4WUDA 2WW4A 4GQUA 1HNZI 4HACB 3PS3A 2BA1G 3OTOI 2GO4A 1Y4SA 2ZM6E 2O1WA 4IZKB 1N36I 1FJGI 5JEAF 5IT9C 1B63A 2C38A 3J7AM 1U2RA 2JEAA 3J81C 1FWKA 5DRQA 3T1YI 3PS1A 3PYFA 4DV0I 3M85D 2ZBKB 4HACA 1E3PA 3B78A 4B3TE 5LMUE 2HHHE 4KQVA 5DROA 4IZKA 4LF8I 3K17A 2VQFI 3WU4A 1UDNA 1Z0GA 4OZEA 3HULA 1XNRE 4Z7YA 4OO1D 2PO2B 2Z5CB 1N34E 5GMEA 3L7ZB 4PU9A 1XNQE 4YY3E 2BV3A
chains in the Genus database with same CATH topology
1ZXNA 2DEJA 4JI5I 2V8PA 2O1UA 3J7AG 4JI2E 4JI3E 4X64I 1OJ4A 4P52A 2Z5CA 4DR7E 3V2UC 4I3HA 1I94E 2AJ4A 4DR2I 2BM0A 4DR6I 1MG7A 4FW9A 4K0KE 4LF4I 4JI7I 3LTOA 4JG4A 3ZKBA 1HR0E 4X65E 1HNWI 1N0VC 3ZKDA 3PRYA 2OI2A 4LF6E 1PVGA 1N36E 4JV5I 4GKKI 1XHKA 2UU9I 1Y6ZA 4NXME 4USMA 2HK2A 4B3RI 3ZZTA 1UEKA 2O1VA 4IZJB 5LMNI 2E5LE 1KIJA 4UT4A 2R3VA 4LF5E 4LF8E 2IOPA 3J81Q 1IBKE 1H7UA 1BKNA 2CG9A 2Z5BB 1S4EA 4IZJA 2UXCI 4WUCA 4JI5E 4X66E 4GKJI 4Z7CA 4DV5I 2F4VI 2Q2EB 1RREA 1XMQI 4DR5E 1HK7A 4X64E 2LJPA 2UUCI 1ZM9A 4DR6E 4XTJA 1IBLI 2Z5BA 1A6FA 1N32E 1D6TA 4N3OA 4LFBI 4JI4I 4JI7E 1N33E 4DU7A 2A2DA 3V5RA 3WU3A 1HNWE 2VQEE 3JAMC 4OX9E 2A2CA 4YHHE 4M1KA 3Q1QA 2HKJA 4ZVIA 2X36A 4DV6I 4P7AA 1DARA 3PYGA 4GKKE 4FWDA 2PNLA 2UU9E 4X62I 4DV1E 4LF9E 2HFSA 1VISA 1ZM2A 5LMNE 2J7KA 3B8HA 4JYAE 1PIEA 1Z5BA 4JI6I 2V2VA 2UUAI 5LL6R 4JI0E 4DV7I 1HNXI 1IBME 4DR4I 1NHIA 4LFCI 2UXBI 1Z0VA 3ZM7A 4B3SE 3K1JA 4DV5E 2F4VE 3GONA 1XMQE 4FN5A 4KHPE 4B3ME 4DUYE 1QZRA 2BM1A 2VF3A 3ZZUA 4DR3E 3P06A 4LFBE 3H4LA 3WU6A 4JI4E 4AQYI 3T1HI 1H74A 1HNZE 3OTOE 1ZM3A 5GMDA 4DUZI 3QT8A 1FJGE 5FLXQ 4DV2I 5IWAI 1WUUA 2UUBI 4DV3I 2HFUA 4USKA 4IZJD 1Y4UA 3JAMQ 4DV0E 3T1YE 4X62E 2V2QA 1NZ0A 3PYDA 1FWLA 2ZM6I 1Z5CA 2VQFE 1KVKA 4DPUA 4JI6E 2Z5EA 4JI8I 3F0NA 2GQ0A 4DV7E 1HNXE 2X7IA 2DEIA 2E1RA 4URLA 4B3TI 5LMUI 3QT6A 1N0UA 1H72C 4DR1I 2IOQA 1XNRI 1PKPA 4HYMA 1N34I 5FWKA 1XMOI 2UXDI 1XNQI 3M6AA 4R1FA 1EI1A 4DR2E 2GS8A 3QT5A 5FLXC 4LF4E 3WU5A 2V2ZA 4FWHA 1I94I 4HXZA 4LFAI 1Z0CA 1USUA 4K0KI 1USVA 1NHHA 2HKEA 4JV5E 1MX0A 2R42A 5IWAE 1HR0I 4DPYA 4X65I 2UUBE 4B3RE 4RPFA 5L3JA 3J80C 4JI1I 4LF6I 3HJCA 1FKAE 1Z5AA 4WUBA 1B62A 4MYTA 2ZITA 4NXMI 2HK3A 1RR9A 4PRVA 4JI8E 3ZZ0A 2E5LI 4ED4A 3Q6MA 4NXNI 3QT7A 2UXCE 4LF5I 5BR8I 3K85A 4GKJE 2EFGA 4DR1E 2XEXA 1IBKI 1H7SA 4HY1A 1XMOE 2UXDE 4DV4I 3LPSA 2UUCE 4DPTA 1IBLE 2CGEA 4X66I 3D4JA 1Z0WA 4LF7I 2NPFA 4DR5I 4UTGA 2V34A 1J5EI 3CWVA 4LFAE 1N32I 4DV6E 4DPWA 3LNUA 1N33I 1ZXMA 3B82A 2VQEI 4OX9I 5A2QQ 4YHHI 4DXLA 4JI1E 1S16A 2UUAE 4EMDA 3J80Q 4DV1I 4LF9I 4DR4E 1ELOA 2O1TA 2HHHI 1KKHA 2CZ9A 4LFCE 1FNMA 2UXBE 4JYAI 4PRXA 5IT9Q 4DU8A 4NXNE 1Z0TA 5BR8E 1Z0EA 4JI0I 1K47A 4YY3I 1IBMI 1H73A 3Q6NA 1FI4A 4DV4E 4FWGA 4B3SI 4JI2I 1EA6A 4JI3I 1Z59A 4DR7I 4DPXA 1MU5A 3PYEA 4LF7E 1J5EE 4AQYE 3T1HE 4KHPI 4B3MI 4MYUA 4DUYI 5A2QC 1ZM4A 1KTVA 2PNMA 4DUZE 4DR3I 1Z0BA 4DV2E 4DV3E 1NHJA 4WUDA 2WW4A 1HNZI 4HACB 3OTOI 1Y4SA 2ZM6E 2O1WA 4IZKB 1N36I 1FJGI 5IT9C 1B63A 3J7AM 1U2RA 3J81C 1FWKA 3T1YI 3PYFA 4DV0I 2ZBKB 4HACA 3B78A 4B3TE 5LMUE 2HHHE 4KQVA 4LF8I 4IZKA 3K17A 2VQFI 3WU4A 1Z0GA 3HULA 1XNRE 4Z7YA 2Z5CB 1N34E 5GMEA 4PU9A 1XNQE 4YY3E 2BV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXN A;  2DEJ A;  4JI5 I;  2V8P A;  3J7A G;  4JI2 E;  4JI3 E;  4X64 I;  1OJ4 A;  4P52 A;  4DR7 E;  3V2U C;  4I3H A;  1I94 E;  2AJ4 A;  4DR2 I;  2BM0 A;  4DR6 I;  1MG7 A;  4FW9 A;  4K0K E;  4LF4 I;  4JI7 I;  3LTO A;  4JG4 A;  3ZKB A;  1HR0 E;  4X65 E;  1HNW I;  1N0V C;  3ZKD A;  2OI2 A;  4LF6 E;  1PVG A;  1N36 E;  4JV5 I;  4GKK I;  1XHK A;  2UU9 I;  4NXM E;  4USM A;  2HK2 A;  4B3R I;  3ZZT A;  1UEK A;  5LMN I;  2E5L E;  1KIJ A;  4UT4 A;  2R3V A;  4LF5 E;  4LF8 E;  3J81 Q;  1IBK E;  1H7U A;  1BKN A;  1S4E A;  2UXC I;  4WUC A;  4JI5 E;  4X66 E;  4GKJ I;  4Z7C A;  4DV5 I;  2F4V I;  2Q2E B;  1RRE A;  1XMQ I;  4DR5 E;  4X64 E;  2LJP A;  2UUC I;  1ZM9 A;  4DR6 E;  4XTJ A;  1IBL I;  1A6F A;  1N32 E;  1D6T A;  4LFB I;  4JI4 I;  4JI7 E;  1N33 E;  4DU7 A;  2A2D A;  3V5R A;  3WU3 A;  1HNW E;  2VQE E;  3JAM C;  4OX9 E;  2A2C A;  4YHH E;  4M1K A;  3Q1Q A;  2HKJ A;  4ZVI A;  2X36 A;  4DV6 I;  4P7A A;  1DAR A;  3PYG A;  4GKK E;  4FWD A;  2UU9 E;  4X62 I;  4DV1 E;  4LF9 E;  2HFS A;  1VIS A;  1ZM2 A;  5LMN E;  2J7K A;  3B8H A;  4JYA E;  1PIE A;  1Z5B A;  4JI6 I;  2V2V A;  2UUA I;  5LL6 R;  4JI0 E;  4DV7 I;  1HNX I;  1IBM E;  4DR4 I;  1NHI A;  4LFC I;  2UXB I;  1Z0V A;  3ZM7 A;  4B3S E;  3K1J A;  4DV5 E;  2F4V E;  3GON A;  1XMQ E;  4FN5 A;  4KHP E;  4B3M E;  4DUY E;  1QZR A;  2BM1 A;  2VF3 A;  3ZZU A;  4DR3 E;  4LFB E;  3H4L A;  3WU6 A;  4JI4 E;  4AQY I;  3T1H I;  1H74 A;  1HNZ E;  3OTO E;  1ZM3 A;  5GMD A;  4DUZ I;  3QT8 A;  1FJG E;  5FLX Q;  4DV2 I;  5IWA I;  1WUU A;  2UUB I;  4DV3 I;  2HFU A;  4USK A;  3T1Y E;  3JAM Q;  4DV0 E;  4X62 E;  2V2Q A;  1NZ0 A;  3PYD A;  1FWL A;  2ZM6 I;  1Z5C A;  2VQF E;  1KVK A;  4DPU A;  4JI6 E;  4JI8 I;  3F0N A;  4DV7 E;  1HNX E;  2X7I A;  2DEI A;  2E1R A;  4URL A;  4B3T I;  5LMU I;  3QT6 A;  1N0U A;  1H72 C;  4DR1 I;  1XNR I;  1PKP A;  4HYM A;  1N34 I;  1XMO I;  2UXD I;  1XNQ I;  3M6A A;  4R1F A;  1EI1 A;  4DR2 E;  2GS8 A;  3QT5 A;  5FLX C;  4LF4 E;  3WU5 A;  2V2Z A;  4FWH A;  1I94 I;  4HXZ A;  4LFA I;  1Z0C A;  4K0K I;  1NHH A;  2HKE A;  4JV5 E;  1MX0 A;  2R42 A;  5IWA E;  1HR0 I;  4DPY A;  4X65 I;  2UUB E;  4B3R E;  4RPF A;  5L3J A;  3J80 C;  4JI1 I;  4LF6 I;  1FKA E;  1Z5A A;  4WUB A;  1B62 A;  4MYT A;  2ZIT A;  4NXM I;  2HK3 A;  1RR9 A;  4PRV A;  4JI8 E;  3ZZ0 A;  2E5L I;  4ED4 A;  4NXN I;  3QT7 A;  2UXC E;  4LF5 I;  5BR8 I;  4GKJ E;  2EFG A;  4DR1 E;  2XEX A;  1IBK I;  1H7S A;  4HY1 A;  1XMO E;  2UXD E;  4DV4 I;  3LPS A;  2UUC E;  4DPT A;  1IBL E;  4X66 I;  3D4J A;  1Z0W A;  4LF7 I;  2NPF A;  4DR5 I;  4UTG A;  2V34 A;  1J5E I;  3CWV A;  4LFA E;  1N32 I;  4DV6 E;  4DPW A;  3LNU A;  1N33 I;  1ZXM A;  3B82 A;  2VQE I;  4OX9 I;  5A2Q Q;  4YHH I;  4DXL A;  4JI1 E;  1S16 A;  2UUA E;  4EMD A;  3J80 Q;  4DV1 I;  4LF9 I;  4DR4 E;  1ELO A;  2HHH I;  1KKH A;  2CZ9 A;  4LFC E;  1FNM A;  2UXB E;  4JYA I;  4PRX A;  5IT9 Q;  4DU8 A;  4NXN E;  1Z0T A;  5BR8 E;  1Z0E A;  4JI0 I;  1K47 A;  4YY3 I;  1IBM I;  1H73 A;  1FI4 A;  4DV4 E;  4FWG A;  4B3S I;  4JI2 I;  1EA6 A;  4JI3 I;  1Z59 A;  4DR7 I;  4DPX A;  1MU5 A;  3PYE A;  4LF7 E;  1J5E E;  4AQY E;  3T1H E;  4KHP I;  4B3M I;  4MYU A;  4DUY I;  5A2Q C;  1ZM4 A;  1KTV A;  4DUZ E;  4DR3 I;  1Z0B A;  4DV2 E;  4DV3 E;  1NHJ A;  4WUD A;  2WW4 A;  1HNZ I;  4HAC B;  3OTO I;  2ZM6 E;  1N36 I;  1FJG I;  5IT9 C;  1B63 A;  3J7A M;  1U2R A;  3J81 C;  1FWK A;  3T1Y I;  3PYF A;  4DV0 I;  2ZBK B;  4HAC A;  3B78 A;  4B3T E;  5LMU E;  2HHH E;  4KQV A;  4LF8 I;  3K17 A;  2VQF I;  3WU4 A;  1Z0G A;  3HUL A;  1XNR E;  4Z7Y A;  1N34 E;  5GME A;  4PU9 A;  1XNQ E;  4YY3 E;  2BV3 A; 
#chains in the Genus database with same CATH topology
 1ZXN A;  2DEJ A;  4JI5 I;  2IER A;  2V8P A;  2O1U A;  5JEA E;  3J7A G;  2O3Z A;  4JI2 E;  4JI3 E;  4X64 I;  1OJ4 A;  2PO2 A;  4P52 A;  4QNJ A;  2Z5C A;  4DR7 E;  3V2U C;  4I3H A;  1I94 E;  2AJ4 A;  3L7Z A;  4DR2 I;  2BM0 A;  3P3C A;  4DR6 I;  3DD6 A;  2BA1 D;  1MG7 A;  4FW9 A;  4K0K E;  1R6L A;  4LF4 I;  4JI7 I;  3LTO A;  4JG4 A;  4MU1 A;  3ZKB A;  1HR0 E;  4X65 E;  1HNW I;  1N0V C;  3ZKD A;  3PRY A;  2GO3 A;  2OI2 A;  4LF6 E;  1PVG A;  1N36 E;  4JV5 I;  5K36 D;  4GKK I;  1XHK A;  3HKM A;  2UU9 I;  1Y6Z A;  4NXM E;  2JT2 A;  4USM A;  2HK2 A;  4B3R I;  3ZZT A;  2NN6 D;  1UEK A;  2O1V A;  4IZJ B;  1E3H A;  5LMN I;  2E5L E;  1KIJ A;  4UT4 A;  5JEA B;  4FW5 A;  2BA0 G;  2R3V A;  4LF5 E;  3NZK A;  4LF8 E;  2IOP A;  3J81 Q;  2AE8 A;  4BA1 B;  1IBK E;  4U3D A;  1Y60 A;  2PNZ B;  1H7U A;  1BKN A;  2CG9 A;  1Y5Y A;  4IZJ A;  1S4E A;  2Z5B B;  2UXC I;  4WUC A;  4JI5 E;  5JEA A;  4X66 E;  4AIM A;  3CDI A;  4Z7C A;  4DV5 I;  2F4V I;  4GKJ I;  2Q2E B;  1RRE A;  1XMQ I;  4DR5 E;  1HK7 A;  4X64 E;  4BA1 A;  2LJP A;  2PNZ A;  2UUC I;  1ZM9 A;  2IES A;  2BR2 B;  4BA2 B;  4DR6 E;  4XTJ A;  1IBL I;  2Z5B A;  1A6F A;  1N32 E;  1D6T A;  4N3O A;  4LFB I;  4JI4 I;  4JI7 E;  1N33 E;  4IFD E;  4DU7 A;  4NBQ A;  2A2D A;  3V5R A;  3WU3 A;  1HNW E;  2VQE E;  3JAM C;  4OX9 E;  4IFD C;  4MU4 A;  2A2C A;  2WP8 A;  4YHH E;  4M1K A;  3Q1Q A;  2BR2 A;  4BA2 A;  5DRP A;  2HKJ A;  3KRN A;  4ZVI A;  2X36 A;  4DV6 I;  4IS9 A;  4P7A A;  2BA0 D;  1DAR A;  3PYG A;  4GKK E;  4FWD A;  4AM3 A;  2PNL A;  2UU9 E;  4X62 I;  4DV1 E;  4LF9 E;  2HFS A;  1VIS A;  4MU0 A;  1YHC A;  1ZM2 A;  5LMN E;  2J7K A;  3B8H A;  4JYA E;  1PIE A;  1Z5B A;  4JI6 I;  2V2V A;  2UUA I;  5LL6 R;  2F1D A;  4JI0 E;  4FW3 A;  4DV7 I;  1HNX I;  5EL9 A;  1IBM E;  4DR4 I;  5ELW A;  1NHI A;  4LFC I;  2UXB I;  3H1C A;  1Z0V A;  3ZM7 A;  4B3S E;  4IFD B;  4FW7 A;  3K1J A;  4DV5 E;  2F4V E;  3GON A;  4OKG A;  1XMQ E;  4FN5 A;  4KHP E;  4B3M E;  1P42 A;  4DUY E;  1QZR A;  2BM1 A;  2VF3 A;  3B4T A;  2PO1 B;  3ZZU A;  4DR3 E;  3P06 A;  4IFD A;  4LFB E;  3H4L A;  3WU6 A;  3UHM A;  4JI4 E;  4AQY I;  3T1H I;  3GLL A;  4AID A;  1H74 A;  1HNZ E;  3OTO E;  1ZM3 A;  2PO1 A;  5GMD A;  4DUZ I;  3QT8 A;  4FW6 A;  1FJG E;  2CVE A;  5FLX Q;  4DV2 I;  5IWA I;  1WUU A;  5C0X E;  2UUB I;  4DV3 I;  2HFU A;  4USK A;  4IZJ D;  1Y4U A;  3JAM Q;  4DV0 E;  3T1Y E;  4X62 E;  5C0X C;  2V2Q A;  1NZ0 A;  3PYD A;  1FWL A;  2ZM6 I;  5JEA D;  1Z5C A;  4IFD F;  1YH8 A;  2VQF E;  1KVK A;  4DPU A;  5DNL A;  4JI6 E;  2Z5E A;  4JI8 I;  3F0N A;  2GQ0 A;  4DV7 E;  1HNX E;  2X7I A;  2DEI A;  2E1R A;  1XXE A;  2JE6 B;  4URL A;  4B3T I;  5LMU I;  3QT6 A;  2J65 A;  1N0U A;  1H72 C;  2VES A;  3P3E A;  4DR1 I;  2IOQ A;  1XNR I;  1PKP A;  4HYM A;  1N34 I;  5FWK A;  3U1K A;  1XMO I;  2UXD I;  1XNQ I;  3M6A A;  5EKW A;  4R1F A;  1EI1 A;  4DR2 E;  2GS8 A;  2JE6 A;  3QT5 A;  2C37 B;  5FLX C;  4LF4 E;  5C0X B;  3WU5 A;  2V2Z A;  1OYR A;  4FWH A;  1OYS A;  1I94 I;  4HXZ A;  4LFA I;  4OO1 E;  1Z0C A;  1USU A;  4K0K I;  1USV A;  4LCH A;  2C37 A;  4LCG A;  4OO1 C;  1NHH A;  2HKE A;  4JV5 E;  3M7N G;  5C0X A;  1MX0 A;  2R42 A;  5IWA E;  1HR0 I;  4DPY A;  4X65 I;  2UUB E;  4B3R E;  1RHY A;  4RPF A;  2NN6 F;  5L3J A;  3J80 C;  4JI1 I;  4LF6 I;  3HJC A;  1FKA E;  1Z5A A;  4WUB A;  4QNK A;  1B62 A;  4MYT A;  2ZIT A;  4NXM I;  2HK3 A;  1RR9 A;  4PRV A;  2C39 B;  4JI8 E;  3ZZ0 A;  4MQY A;  2E5L I;  4U3B A;  4ED4 A;  3GCM A;  3Q6M A;  5C0X F;  4IFD D;  1OYP A;  4NXN I;  3QT7 A;  2UXC E;  4LF5 I;  5BR8 I;  3K85 A;  4GKJ E;  2EFG A;  4DR1 E;  1VI7 A;  2XEX A;  1IBK I;  4OO1 B;  1H7S A;  4HY1 A;  3PS2 A;  5K36 E;  2C39 A;  1XMO E;  2UXD E;  4DV4 I;  3LPS A;  2NN6 E;  2UUC E;  5K36 C;  4DPT A;  2JEB B;  4ISA A;  1IBL E;  2CGE A;  4X66 I;  3D4J A;  1Z0W A;  3M7N D;  2NN6 C;  2PO0 B;  4LF7 I;  2NPF A;  4DR5 I;  4UTG A;  2V34 A;  1J5E I;  3CDJ A;  3CWV A;  2WNR B;  4OO1 A;  1UDQ A;  5JEA C;  4LFA E;  3U1Y A;  1N32 I;  2JEB A;  1UDS A;  4DV6 E;  4DPW A;  3LNU A;  1N33 I;  1ZXM A;  3P3G A;  2PO0 A;  3B82 A;  4J3D A;  2WNR A;  2VQE I;  4OX9 I;  5A2Q Q;  4YHH I;  4DXL A;  4JI1 E;  1S16 A;  4LOM A;  5K36 B;  2UUA E;  4OO1 F;  4EMD A;  5DNX A;  3J80 Q;  4DV1 I;  3P76 A;  4LF9 I;  4DR4 E;  1ELO A;  2NN6 B;  1UDO A;  2O1T A;  2HHH I;  1KKH A;  2CZ9 A;  1R6M A;  4LFC E;  1FNM A;  2UXB E;  4JYA I;  4PRX A;  5IT9 Q;  4DU8 A;  4NXN E;  1Z0T A;  5BR8 E;  4LPF A;  5K36 A;  1Z0E A;  4JI0 I;  4LCF A;  1K47 A;  4YY3 I;  1IBM I;  3M85 G;  1H73 A;  2NN6 A;  3Q6N A;  1FI4 A;  5DRR A;  4DV4 E;  4FWG A;  4MU3 A;  5C0X D;  4B3S I;  4JI2 I;  1EA6 A;  4JI3 I;  1Z59 A;  4DR7 I;  4DPX A;  1MU5 A;  3PYE A;  4LF7 E;  1J5E E;  4AQY E;  3T1H E;  4KHP I;  4B3M I;  4MYU A;  4DUY I;  3GME A;  5A2Q C;  1ZM4 A;  1KTV A;  2PNM A;  4FW4 A;  2WP8 B;  4DUZ E;  4DR3 I;  1Z0B A;  2C38 B;  5K36 F;  4DV2 E;  2JEA B;  4MDT A;  4DV3 E;  1NHJ A;  4WUD A;  2WW4 A;  4GQU A;  1HNZ I;  4HAC B;  3PS3 A;  2BA1 G;  3OTO I;  2GO4 A;  1Y4S A;  2ZM6 E;  2O1W A;  4IZK B;  1N36 I;  1FJG I;  5JEA F;  5IT9 C;  1B63 A;  2C38 A;  3J7A M;  1U2R A;  2JEA A;  3J81 C;  1FWK A;  5DRQ A;  3T1Y I;  3PS1 A;  3PYF A;  4DV0 I;  3M85 D;  2ZBK B;  4HAC A;  1E3P A;  3B78 A;  4B3T E;  5LMU E;  2HHH E;  4KQV A;  5DRO A;  4IZK A;  4LF8 I;  3K17 A;  2VQF I;  3WU4 A;  1UDN A;  1Z0G A;  4OZE A;  3HUL A;  1XNR E;  4Z7Y A;  4OO1 D;  2PO2 B;  2Z5C B;  1N34 E;  5GME A;  3L7Z B;  4PU9 A;  1XNQ E;  4YY3 E;  2BV3 A; 
#chains in the Genus database with same CATH homology
 1ZXN A;  2DEJ A;  4JI5 I;  2V8P A;  2O1U A;  3J7A G;  4JI2 E;  4JI3 E;  4X64 I;  1OJ4 A;  4P52 A;  2Z5C A;  4DR7 E;  3V2U C;  4I3H A;  1I94 E;  2AJ4 A;  4DR2 I;  2BM0 A;  4DR6 I;  1MG7 A;  4FW9 A;  4K0K E;  4LF4 I;  4JI7 I;  3LTO A;  4JG4 A;  3ZKB A;  1HR0 E;  4X65 E;  1HNW I;  1N0V C;  3ZKD A;  3PRY A;  2OI2 A;  4LF6 E;  1PVG A;  1N36 E;  4JV5 I;  4GKK I;  1XHK A;  2UU9 I;  1Y6Z A;  4NXM E;  4USM A;  2HK2 A;  4B3R I;  3ZZT A;  1UEK A;  2O1V A;  4IZJ B;  5LMN I;  2E5L E;  1KIJ A;  4UT4 A;  2R3V A;  4LF5 E;  4LF8 E;  2IOP A;  3J81 Q;  1IBK E;  1H7U A;  1BKN A;  2CG9 A;  2Z5B B;  1S4E A;  4IZJ A;  2UXC I;  4WUC A;  4JI5 E;  4X66 E;  4GKJ I;  4Z7C A;  4DV5 I;  2F4V I;  2Q2E B;  1RRE A;  1XMQ I;  4DR5 E;  1HK7 A;  4X64 E;  2LJP A;  2UUC I;  1ZM9 A;  4DR6 E;  4XTJ A;  1IBL I;  2Z5B A;  1A6F A;  1N32 E;  1D6T A;  4N3O A;  4LFB I;  4JI4 I;  4JI7 E;  1N33 E;  4DU7 A;  2A2D A;  3V5R A;  3WU3 A;  1HNW E;  2VQE E;  3JAM C;  4OX9 E;  2A2C A;  4YHH E;  4M1K A;  3Q1Q A;  2HKJ A;  4ZVI A;  2X36 A;  4DV6 I;  4P7A A;  1DAR A;  3PYG A;  4GKK E;  4FWD A;  2PNL A;  2UU9 E;  4X62 I;  4DV1 E;  4LF9 E;  2HFS A;  1VIS A;  1ZM2 A;  5LMN E;  2J7K A;  3B8H A;  4JYA E;  1PIE A;  1Z5B A;  4JI6 I;  2V2V A;  2UUA I;  5LL6 R;  4JI0 E;  4DV7 I;  1HNX I;  1IBM E;  4DR4 I;  1NHI A;  4LFC I;  2UXB I;  1Z0V A;  3ZM7 A;  4B3S E;  3K1J A;  4DV5 E;  2F4V E;  3GON A;  1XMQ E;  4FN5 A;  4KHP E;  4B3M E;  4DUY E;  1QZR A;  2BM1 A;  2VF3 A;  3ZZU A;  4DR3 E;  3P06 A;  4LFB E;  3H4L A;  3WU6 A;  4JI4 E;  4AQY I;  3T1H I;  1H74 A;  1HNZ E;  3OTO E;  1ZM3 A;  5GMD A;  4DUZ I;  3QT8 A;  1FJG E;  5FLX Q;  4DV2 I;  5IWA I;  1WUU A;  2UUB I;  4DV3 I;  2HFU A;  4USK A;  4IZJ D;  1Y4U A;  3JAM Q;  4DV0 E;  3T1Y E;  4X62 E;  2V2Q A;  1NZ0 A;  3PYD A;  1FWL A;  2ZM6 I;  1Z5C A;  2VQF E;  1KVK A;  4DPU A;  4JI6 E;  2Z5E A;  4JI8 I;  3F0N A;  2GQ0 A;  4DV7 E;  1HNX E;  2X7I A;  2DEI A;  2E1R A;  4URL A;  4B3T I;  5LMU I;  3QT6 A;  1N0U A;  1H72 C;  4DR1 I;  2IOQ A;  1XNR I;  1PKP A;  4HYM A;  1N34 I;  5FWK A;  1XMO I;  2UXD I;  1XNQ I;  3M6A A;  4R1F A;  1EI1 A;  4DR2 E;  2GS8 A;  3QT5 A;  5FLX C;  4LF4 E;  3WU5 A;  2V2Z A;  4FWH A;  1I94 I;  4HXZ A;  4LFA I;  1Z0C A;  1USU A;  4K0K I;  1USV A;  1NHH A;  2HKE A;  4JV5 E;  1MX0 A;  2R42 A;  5IWA E;  1HR0 I;  4DPY A;  4X65 I;  2UUB E;  4B3R E;  4RPF A;  5L3J A;  3J80 C;  4JI1 I;  4LF6 I;  3HJC A;  1FKA E;  1Z5A A;  4WUB A;  1B62 A;  4MYT A;  2ZIT A;  4NXM I;  2HK3 A;  1RR9 A;  4PRV A;  4JI8 E;  3ZZ0 A;  2E5L I;  4ED4 A;  3Q6M A;  4NXN I;  3QT7 A;  2UXC E;  4LF5 I;  5BR8 I;  3K85 A;  4GKJ E;  2EFG A;  4DR1 E;  2XEX A;  1IBK I;  1H7S A;  4HY1 A;  1XMO E;  2UXD E;  4DV4 I;  3LPS A;  2UUC E;  4DPT A;  1IBL E;  2CGE A;  4X66 I;  3D4J A;  1Z0W A;  4LF7 I;  2NPF A;  4DR5 I;  4UTG A;  2V34 A;  1J5E I;  3CWV A;  4LFA E;  1N32 I;  4DV6 E;  4DPW A;  3LNU A;  1N33 I;  1ZXM A;  3B82 A;  2VQE I;  4OX9 I;  5A2Q Q;  4YHH I;  4DXL A;  4JI1 E;  1S16 A;  2UUA E;  4EMD A;  3J80 Q;  4DV1 I;  4LF9 I;  4DR4 E;  1ELO A;  2O1T A;  2HHH I;  1KKH A;  2CZ9 A;  4LFC E;  1FNM A;  2UXB E;  4JYA I;  4PRX A;  5IT9 Q;  4DU8 A;  4NXN E;  1Z0T A;  5BR8 E;  1Z0E A;  4JI0 I;  1K47 A;  4YY3 I;  1IBM I;  1H73 A;  3Q6N A;  1FI4 A;  4DV4 E;  4FWG A;  4B3S I;  4JI2 I;  1EA6 A;  4JI3 I;  1Z59 A;  4DR7 I;  4DPX A;  1MU5 A;  3PYE A;  4LF7 E;  1J5E E;  4AQY E;  3T1H E;  4KHP I;  4B3M I;  4MYU A;  4DUY I;  5A2Q C;  1ZM4 A;  1KTV A;  2PNM A;  4DUZ E;  4DR3 I;  1Z0B A;  4DV2 E;  4DV3 E;  1NHJ A;  4WUD A;  2WW4 A;  1HNZ I;  4HAC B;  3OTO I;  1Y4S A;  2ZM6 E;  2O1W A;  4IZK B;  1N36 I;  1FJG I;  5IT9 C;  1B63 A;  3J7A M;  1U2R A;  3J81 C;  1FWK A;  3T1Y I;  3PYF A;  4DV0 I;  2ZBK B;  4HAC A;  3B78 A;  4B3T E;  5LMU E;  2HHH E;  4KQV A;  4LF8 I;  4IZK A;  3K17 A;  2VQF I;  3WU4 A;  1Z0G A;  3HUL A;  1XNR E;  4Z7Y A;  2Z5C B;  1N34 E;  5GME A;  4PU9 A;  1XNQ E;  4YY3 E;  2BV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...