4JYAI

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jyaI00
2R42A 3OTOE 4USKA 1PIEA 1IBKE 5IWAI 4FWHA 4DU7A 4JI7E 1ZM4A 4DV6I 5IT9Q 1FJGI 4DR5E 4DR1I 4P52A 2ZBKB 4LF7I 1ZM2A 3B82A 1FJGE 4DUZI 1K47A 4DV7E 4JV5I 2R3VA 2GS8A 4JI0I 4LF5I 2EFGA 4X64I 1Z5CA 2UUCE 4LF6I 4DV4I 1A6FA 1H7UA 4GKJE 4DR4I 2BV3A 1WUUA 4AQYE 1HNZE 1EA6A 3V2UC 4YHHE 1Z5AA 1IBME 2A2DA 5LL6R 5BR8E 3D4JA 2BM0A 4DR6I 4NXMI 2UUAE 1KKHA 5LMUI 1Z0GA 2E5LE 2VQEI 1MG7A 1J5EE 4JI3E 4DV3E 1IBLE 4DU8A 2UU9E 4HACB 3QT8A 3J81Q 5LMNE 2V2VA 4DR6E 4DXLA 4FW9A 4R1FA 4WUDA 2HK3A 2LJPA 4ED4A 4JG4A 4K0KE 1ELOA 4DV4E 2ZITA 1N34I 2V2QA 1J5EI 3PYEA 1Z5BA 2A2CA 2HKJA 2V2ZA 4URLA 4JI2I 3Q1QA 4MYTA 4LFAE 3T1HI 1XNRI 5IT9C 1IBMI 1FKAE 4X65I 4FWGA 3J7AM 2X36A 3LPSA 4DV7I 4DPTA 1KVKA 3K17A 4HXZA 2UXBE 4DV1E 4LF4I 1Z0BA 4X66E 1I94I 4JI6E 4DR4E 1H7SA 4WUCA 1NHJA 4DV3I 3J80C 4JI2E 2F4VE 3ZZTA 1DARA 1H72C 4X62I 3CWVA 2VQFI 4B3ME 1FWKA 3JAMQ 2VQFE 1N32I 1ZXMA 3H4LA 4YY3E 2CZ9A 3T1YI 3QT7A 1B63A 1XMQI 4HACA 1XMQE 5FLXC 5FLXQ 4LF8I 3WU3A 2UXCI 4LF4E 4DR3E 2UXBI 3ZM7A 2DEJA 1XHKA 4P7AA 1NZ0A 4HY1A 4USMA 1OJ4A 2OI2A 4Z7CA 2UXDE 4OX9E 1Z0WA 5A2QQ 4JI7I 1N33I 4DPYA 1IBLI 3QT5A 1HNZI 4AQYI 3PYFA 4LF9I 1QZRA 4HYMA 1NHHA 4DUZE 2E1RA 1HNXI 1H73A 4NXNI 4LF7E 4DPWA 4UTGA 3B8HA 3LTOA 1H74A 1FWLA 4JI4E 4JI4I 4JV5E 4OX9I 2UXDI 1I94E 2V34A 3F0NA 4DR2E 4FN5A 2XEXA 3ZZ0A 4DR2I 4JI1I 1RREA 1RR9A 2HKEA 4DV6E 2ZM6I 2UXCE 4XTJA 3ZKDA 1Z0EA 4JI3I 1BKNA 4WUBA 4LFCE 2E5LI 4KHPI 1MX0A 4MYUA 1S16A 5BR8I 2DEIA 4DR3I 2J7KA 1UEKA 1HR0E 4GKKI 2UU9I 2HK2A 4RPFA 4B3TE 4JI8E 3WU5A 1KIJA 2BM1A 4LF9E 1XNQI 4PU9A 4NXME 3J80Q 1FNMA 4LFBI 1XNQE 4K0KI 1N36I 4FWDA 4KQVA 4M1KA 4B3MI 4JI1E 4DR7E 4DPXA 3PYGA 2UUAI 3K1JA 1U2RA 4DV2E 3GONA 3OTOI 1ZXNA 1NHIA 4X62E 4NXNE 1N0VC 1Z59A 4KHPE 1Z0CA 4JI6I 3J7AG 2V8PA 4LFCI 5LMUE 4DV1I 3PYDA 5GMEA 5L3JA 4JYAE 4EMDA 4LF6E 4JI5E 1N34E 4B3SI 3QT6A 4X64E 1FI4A 3ZKBA 1N33E 2ZM6E 1Z0VA 5IWAE 1IBKI 4X66I 4PRVA 3WU4A 1XNRE 1XMOI 4DR1E 4DR5I 4UT4A 1N0UA 2HFUA 1S4EA 2F4VI 4X65E 1HNWI 4LFBE 1EI1A 2UUBE 4JI5I 3WU6A 4B3RI 1PVGA 1PKPA 4JI8I 4YY3I 4ZVIA 2HFSA 4DR7I 3M6AA 4PRXA 5GMDA 1B62A 4LF8E 3B78A 3T1HE 4LFAI 4DV0I 3HULA 4DV0E 3V5RA 4DV5I 3J81C 2X7IA 4DUYI 3JAMC 4LF5E 4JI0E 4DV5E 5A2QC 1N32E 1MU5A 2WW4A 1HR0I 2VF3A 2AJ4A 4GKKE 4DV2I 3T1YE 1XMOE 1ZM3A 2HHHE 2HHHI 4B3TI 1KTVA 2Q2EB 4DPUA 5LMNI 4B3RE 4YHHI 1N36E 1D6TA 4B3SE 2UUBI 4JYAI 4DUYE 1Z0TA 1HNXE 3LNUA 1HNWE 2VQEE 2NPFA 4GKJI 1VISA 1ZM9A 3ZZUA 4I3HA 2UUCI 4Z7YA
chains in the Genus database with same CATH superfamily
2PO0A 3NZKA 2R42A 3OTOE 4USKA 1PIEA 4OO1D 1IBKE 5IWAI 5K36F 4FWHA 4DU7A 4JI7E 1ZM4A 4DV6I 5IT9Q 2CGEA 2GO4A 5JEAF 4DR5E 1FJGI 4DR1I 3P06A 4P52A 2ZBKB 4LF7I 1ZM2A 3B82A 3GMEA 5ELWA 1FJGE 4DUZI 2JE6A 1Y5YA 1K47A 4DV7E 4JV5I 4IFDC 2R3VA 2GS8A 4JI0I 4LF5I 2EFGA 4X64I 1Z5CA 3M7ND 2UUCE 4LF6I 4DV4I 1A6FA 2PO1A 1H7UA 3P76A 4GKJE 4FW4A 2O1WA 4I3HA 2BV3A 4DR4I 2NN6A 4FW5A 1WUUA 4AQYE 1HNZE 3PS2A 1EA6A 3V2UC 5K36B 1YHCA 4YHHE 2GO3A 2CG9A 5C0XB 1Z5AA 1IBME 5C0XC 2A2DA 5LL6R 5BR8E 4BA1A 3D4JA 2BM0A 4DR6I 4NXMI 2UUAE 1HK7A 3GLLA 3PRYA 5C0XE 1KKHA 5LMUI 1Z0GA 2E5LE 2VQEI 5K36E 1MG7A 1J5EE 4JI3E 2C37B 4DV3E 1IBLE 2JEAA 4DU8A 2UU9E 4HACB 5EL9A 3QT8A 3J81Q 5LMNE 2IOPA 4BA2B 2V2VA 3P3CA 4DR6E 4DXLA 4LCHA 4FW9A 4IZJA 4R1FA 4WUDA 4IFDE 2HK3A 1Y4SA 2LJPA 4ED4A 1E3PA 4JG4A 4K0KE 1ELOA 4DV4E 2ZITA 1N34I 2V2QA 1J5EI 3PYEA 4LCFA 1Z5BA 2C38A 2A2CA 2HKJA 2V2ZA 4URLA 4JI2I 3KRNA 3PS3A 3Q1QA 4MYTA 3T1HI 4LFAE 1UDNA 1Y6ZA 1XNRI 5IT9C 1IBMI 1FKAE 4X65I 4FWGA 3J7AM 2X36A 5FWKA 3LPSA 4DV7I 3U1YA 4OZEA 4DPTA 1KVKA 3K17A 4HXZA 2UXBE 2Z5BA 4DV1E 4LF4I 1Z0BA 4X66E 1I94I 4JI6E 4DR4E 1H7SA 4WUCA 1NHJA 4DV3I 5DRRA 3U1KA 2WP8A 4FW7A 3J80C 2VESA 4JI2E 4FW6A 2F4VE 5K36C 3ZZTA 1DARA 1H72C 5C0XA 4MU1A 4X62I 4OO1F 1R6MA 3CWVA 2C38B 4OO1E 2VQFI 4B3ME 2PO2A 1FWKA 3JAMQ 2VQFE 1N32I 1ZXMA 3H4LA 2NN6F 2PNZA 4YY3E 2CZ9A 5JEAB 3T1YI 1Y4UA 2PNLA 4N3OA 3P3EA 3GCMA 3QT7A 5EKWA 1B63A 1R6LA 3HJCA 1XMQI 4HACA 1P42A 1XMQE 5FLXC 5FLXQ 4LF8I 3WU3A 2UXCI 2O1UA 2F1DA 4IZKA 2Z5EA 4LF4E 4DR3E 2UXBI 3ZM7A 1XXEA 3B4TA 4AIMA 2DEJA 1XHKA 2IOQA 4P7AA 2IESA 5C0XF 1NZ0A 4HY1A 4USMA 1OJ4A 3L7ZB 2OI2A 4Z7CA 3L7ZA 1YH8A 2UXDE 4GQUA 4OX9E 1Z0WA 5A2QQ 4JI7I 2PO1B 1N33I 4DPYA 1IBLI 2CVEA 5DRPA 4MQYA 3QT5A 1HNZI 4AQYI 3PYFA 2O1VA 4LF9I 1QZRA 5K36A 4HYMA 1NHHA 2NN6B 1OYPA 2NN6C 3DD6A 2BR2B 4DUZE 2E1RA 1HNXI 1H73A 4NXNI 4LF7E 4DPWA 4UTGA 3B8HA 3LTOA 1H74A 1FWLA 5JEAA 4OO1C 4JI4E 4JI4I 4JV5E 4OX9I 2UXDI 5JEAD 1I94E 2V34A 3F0NA 4DR2E 4FN5A 2XEXA 3ZZ0A 4QNKA 4DR2I 2BA0G 4JI1I 1RREA 1RR9A 2HKEA 4DV6E 2ZM6I 2UXCE 4XTJA 3ZKDA 2JEBA 1Z0EA 4JI3I 1OYRA 2JEBB 3H1CA 1BKNA 2JT2A 2BA1G 4IZJB 4WUBA 4LFCE 4IFDD 2E5LI 4KHPI 1MX0A 2C39B 1USUA 4MDTA 4MYUA 5DNLA 4MU4A 1S16A 5BR8I 2DEIA 4DR3I 4FW3A 2J7KA 1UEKA 5JEAC 5C0XD 1HR0E 2WNRB 4GKKI 2IERA 2UU9I 2HK2A 1E3HA 4RPFA 4B3TE 1OYSA 4JI8E 3WU5A 1KIJA 2BM1A 2PNMA 4BA2A 4AIDA 2Z5CB 4LF9E 1XNQI 2C37A 4PU9A 3CDIA 2Z5CA 4NXME 3J80Q 1FNMA 4LFBI 1XNQE 4K0KI 1N36I 1VI7A 4U3DA 4FWDA 4KQVA 4M1KA 4B3MI 4JI1E 4IFDA 4DR7E 4DPXA 4OKGA 2AE8A 3PYGA 2WP8B 5DRQA 2UUAI 3K1JA 4IZKB 1U2RA 4DV2E 3GONA 1Y60A 2O3ZA 3OTOI 1ZXNA 2GQ0A 1NHIA 2BA1D 4X62E 4NXNE 1Z59A 1N0VC 4KHPE 2WNRA 1Z0CA 2BR2A 4JI6I 3J7AG 2V8PA 4LFCI 5LMUE 4IS9A 4DV1I 3PYDA 5GMEA 1UDSA 3PS1A 5L3JA 4JYAE 4EMDA 4LF6E 4JI5E 1N34E 2Z5BB 4B3SI 3QT6A 4X64E 1FI4A 3ZKBA 1N33E 2NN6E 3CDJA 2ZM6E 2JE6B 1Z0VA 5IWAE 1IBKI 4X66I 4PRVA 3WU4A 1XNRE 4LCGA 2O1TA 1XMOI 4DR1E 4DR5I 4UT4A 1N0UA 2HFUA 1S4EA 5DNXA 2F4VI 3P3GA 4X65E 3K85A 1HNWI 5DROA 4LFBE 1EI1A 2UUBE 1UDOA 4JI5I 4ISAA 3WU6A 4B3RI 1PVGA 1PKPA 4JI8I 3HKMA 4YY3I 3UHMA 3M85G 4ZVIA 2HFSA 4NBQA 2PNZB 4DR7I 4AM3A 3M6AA 4PRXA 3M85D 4OO1A 5GMDA 1B62A 4LF8E 4LOMA 5JEAE 3B78A 3T1HE 4LFAI 2JEAB 4DV0I 3HULA 4J3DA 4IZJD 4IFDB 1UDQA 4DV0E 3V5RA 4OO1B 4DV5I 3J81C 1USVA 2X7IA 4DUYI 4LPFA 3JAMC 4LF5E 4JI0E 3Q6NA 5A2QC 4DV5E 1N32E 1MU5A 2BA0D 2WW4A 1HR0I 4U3BA 2VF3A 2AJ4A 2NN6D 4GKKE 4DV2I 3T1YE 1XMOE 1ZM3A 2HHHE 2HHHI 4B3TI 3Q6MA 1KTVA 2Q2EB 4QNJA 4DPUA 5LMNI 4B3RE 4YHHI 1N36E 1D6TA 2J65A 4B3SE 4IFDF 2UUBI 4JYAI 4DUYE 1Z0TA 4MU0A 1HNXE 3LNUA 1HNWE 4MU3A 2VQEE 2NPFA 2C39A 4GKJI 3M7NG 2PO2B 5K36D 1VISA 1ZM9A 3ZZUA 1RHYA 2PO0B 4BA1B 2UUCI 4Z7YA
chains in the Genus database with same CATH topology
2R42A 3OTOE 4USKA 1PIEA 1IBKE 5IWAI 4FWHA 4DU7A 4JI7E 1ZM4A 4DV6I 5IT9Q 2CGEA 1FJGI 4DR5E 4DR1I 3P06A 4P52A 2ZBKB 4LF7I 1ZM2A 3B82A 1FJGE 4DUZI 1K47A 4DV7E 4JV5I 2R3VA 2GS8A 4JI0I 4LF5I 2EFGA 4X64I 1Z5CA 2UUCE 4LF6I 4DV4I 1A6FA 1H7UA 4GKJE 2O1WA 4DR4I 2BV3A 1WUUA 4AQYE 1HNZE 1EA6A 3V2UC 4YHHE 2CG9A 1Z5AA 1IBME 2A2DA 5LL6R 5BR8E 3D4JA 2BM0A 4DR6I 4NXMI 2UUAE 1HK7A 3PRYA 1KKHA 5LMUI 1Z0GA 2E5LE 2VQEI 1MG7A 1J5EE 4JI3E 4DV3E 1IBLE 4DU8A 2UU9E 4HACB 3QT8A 3J81Q 5LMNE 2IOPA 2V2VA 4DR6E 4DXLA 4FW9A 4IZJA 4R1FA 4WUDA 2HK3A 1Y4SA 2LJPA 4ED4A 4JG4A 4K0KE 1ELOA 4DV4E 2ZITA 1N34I 2V2QA 1J5EI 3PYEA 1Z5BA 2A2CA 2HKJA 2V2ZA 4URLA 4JI2I 3Q1QA 4MYTA 3T1HI 4LFAE 1Y6ZA 1XNRI 5IT9C 1IBMI 1FKAE 4X65I 4FWGA 3J7AM 2X36A 5FWKA 3LPSA 4DV7I 4DPTA 1KVKA 3K17A 4HXZA 2UXBE 2Z5BA 4DV1E 4LF4I 1Z0BA 4X66E 1I94I 4JI6E 4DR4E 1H7SA 4WUCA 1NHJA 4DV3I 3J80C 4JI2E 2F4VE 3ZZTA 1DARA 1H72C 4X62I 3CWVA 2VQFI 4B3ME 1FWKA 3JAMQ 2VQFE 1N32I 1ZXMA 3H4LA 4YY3E 2CZ9A 3T1YI 1Y4UA 2PNLA 4N3OA 3QT7A 1B63A 3HJCA 1XMQI 4HACA 1XMQE 5FLXC 5FLXQ 4LF8I 3WU3A 2UXCI 2O1UA 4IZKA 2Z5EA 4LF4E 4DR3E 2UXBI 3ZM7A 2DEJA 1XHKA 2IOQA 4P7AA 1NZ0A 4HY1A 4USMA 1OJ4A 2OI2A 4Z7CA 2UXDE 4OX9E 1Z0WA 5A2QQ 4JI7I 1N33I 4DPYA 1IBLI 3QT5A 1HNZI 4AQYI 3PYFA 2O1VA 4LF9I 1QZRA 4HYMA 1NHHA 4DUZE 2E1RA 1HNXI 1H73A 4NXNI 4LF7E 4DPWA 4UTGA 3B8HA 3LTOA 1H74A 1FWLA 4JI4E 4JI4I 4JV5E 4OX9I 2UXDI 1I94E 2V34A 3F0NA 4DR2E 4FN5A 2XEXA 3ZZ0A 4DR2I 4JI1I 1RREA 1RR9A 2HKEA 4DV6E 2ZM6I 2UXCE 4XTJA 3ZKDA 1Z0EA 4JI3I 1BKNA 4IZJB 4WUBA 4LFCE 2E5LI 4KHPI 1MX0A 1USUA 4MYUA 1S16A 5BR8I 2DEIA 4DR3I 2J7KA 1UEKA 1HR0E 4GKKI 2UU9I 2HK2A 4RPFA 4B3TE 4JI8E 3WU5A 1KIJA 2BM1A 2PNMA 2Z5CB 4LF9E 1XNQI 4PU9A 4NXME 2Z5CA 3J80Q 1FNMA 4LFBI 1XNQE 4K0KI 1N36I 4FWDA 4KQVA 4M1KA 4B3MI 4JI1E 4DR7E 4DPXA 3PYGA 2UUAI 3K1JA 4IZKB 1U2RA 4DV2E 3GONA 3OTOI 1ZXNA 2GQ0A 1NHIA 4X62E 4NXNE 1N0VC 1Z59A 4KHPE 1Z0CA 4JI6I 3J7AG 2V8PA 4LFCI 5LMUE 4DV1I 3PYDA 5GMEA 5L3JA 4JYAE 4EMDA 4LF6E 4JI5E 1N34E 2Z5BB 4B3SI 3QT6A 4X64E 1FI4A 3ZKBA 1N33E 2ZM6E 1Z0VA 5IWAE 1IBKI 4X66I 4PRVA 3WU4A 1XNRE 2O1TA 1XMOI 4DR1E 4DR5I 4UT4A 1N0UA 2HFUA 1S4EA 2F4VI 4X65E 3K85A 1HNWI 4LFBE 1EI1A 2UUBE 4JI5I 3WU6A 4B3RI 1PVGA 1PKPA 4JI8I 4YY3I 4ZVIA 2HFSA 4DR7I 3M6AA 4PRXA 5GMDA 1B62A 4LF8E 3B78A 3T1HE 4LFAI 4DV0I 3HULA 4IZJD 4DV0E 3V5RA 4DV5I 3J81C 1USVA 2X7IA 4DUYI 3JAMC 4LF5E 4JI0E 3Q6NA 5A2QC 4DV5E 1N32E 1MU5A 2WW4A 1HR0I 2VF3A 2AJ4A 4GKKE 4DV2I 3T1YE 1XMOE 1ZM3A 2HHHE 2HHHI 4B3TI 3Q6MA 1KTVA 2Q2EB 4DPUA 5LMNI 4B3RE 4YHHI 1N36E 1D6TA 4B3SE 2UUBI 4JYAI 4DUYE 1Z0TA 1HNXE 3LNUA 1HNWE 2VQEE 2NPFA 4GKJI 1VISA 1ZM9A 3ZZUA 4I3HA 2UUCI 4Z7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R42 A;  3OTO E;  4USK A;  1PIE A;  1IBK E;  5IWA I;  4FWH A;  4DU7 A;  4JI7 E;  1ZM4 A;  4DV6 I;  5IT9 Q;  1FJG I;  4DR5 E;  4DR1 I;  4P52 A;  2ZBK B;  4LF7 I;  1ZM2 A;  3B82 A;  1FJG E;  4DUZ I;  1K47 A;  4DV7 E;  4JV5 I;  2R3V A;  2GS8 A;  4JI0 I;  4LF5 I;  2EFG A;  4X64 I;  1Z5C A;  2UUC E;  4LF6 I;  4DV4 I;  1A6F A;  1H7U A;  4GKJ E;  4DR4 I;  2BV3 A;  1WUU A;  4AQY E;  1HNZ E;  1EA6 A;  3V2U C;  4YHH E;  1Z5A A;  1IBM E;  2A2D A;  5LL6 R;  5BR8 E;  3D4J A;  2BM0 A;  4DR6 I;  4NXM I;  2UUA E;  1KKH A;  5LMU I;  1Z0G A;  2E5L E;  2VQE I;  1MG7 A;  1J5E E;  4JI3 E;  4DV3 E;  1IBL E;  4DU8 A;  2UU9 E;  4HAC B;  3QT8 A;  3J81 Q;  5LMN E;  2V2V A;  4DR6 E;  4DXL A;  4FW9 A;  4R1F A;  4WUD A;  2HK3 A;  2LJP A;  4ED4 A;  4JG4 A;  4K0K E;  1ELO A;  4DV4 E;  2ZIT A;  1N34 I;  2V2Q A;  1J5E I;  3PYE A;  1Z5B A;  2A2C A;  2HKJ A;  2V2Z A;  4URL A;  4JI2 I;  3Q1Q A;  4MYT A;  4LFA E;  3T1H I;  1XNR I;  5IT9 C;  1IBM I;  1FKA E;  4X65 I;  4FWG A;  3J7A M;  2X36 A;  3LPS A;  4DV7 I;  4DPT A;  1KVK A;  3K17 A;  4HXZ A;  2UXB E;  4DV1 E;  4LF4 I;  1Z0B A;  4X66 E;  1I94 I;  4JI6 E;  4DR4 E;  1H7S A;  4WUC A;  1NHJ A;  4DV3 I;  3J80 C;  4JI2 E;  2F4V E;  3ZZT A;  1DAR A;  1H72 C;  4X62 I;  3CWV A;  2VQF I;  4B3M E;  1FWK A;  3JAM Q;  2VQF E;  1N32 I;  1ZXM A;  3H4L A;  4YY3 E;  2CZ9 A;  3T1Y I;  3QT7 A;  1B63 A;  1XMQ I;  4HAC A;  1XMQ E;  5FLX C;  5FLX Q;  4LF8 I;  3WU3 A;  2UXC I;  4LF4 E;  4DR3 E;  2UXB I;  3ZM7 A;  2DEJ A;  1XHK A;  4P7A A;  1NZ0 A;  4HY1 A;  4USM A;  1OJ4 A;  2OI2 A;  4Z7C A;  2UXD E;  4OX9 E;  1Z0W A;  5A2Q Q;  4JI7 I;  1N33 I;  4DPY A;  1IBL I;  3QT5 A;  1HNZ I;  4AQY I;  3PYF A;  4LF9 I;  1QZR A;  4HYM A;  1NHH A;  4DUZ E;  2E1R A;  1HNX I;  1H73 A;  4NXN I;  4LF7 E;  4DPW A;  4UTG A;  3B8H A;  3LTO A;  1H74 A;  1FWL A;  4JI4 E;  4JI4 I;  4JV5 E;  4OX9 I;  2UXD I;  1I94 E;  2V34 A;  3F0N A;  4DR2 E;  4FN5 A;  2XEX A;  3ZZ0 A;  4DR2 I;  4JI1 I;  1RRE A;  1RR9 A;  2HKE A;  4DV6 E;  2ZM6 I;  2UXC E;  4XTJ A;  3ZKD A;  1Z0E A;  4JI3 I;  1BKN A;  4WUB A;  4LFC E;  2E5L I;  4KHP I;  1MX0 A;  4MYU A;  1S16 A;  5BR8 I;  2DEI A;  4DR3 I;  2J7K A;  1UEK A;  1HR0 E;  4GKK I;  2UU9 I;  2HK2 A;  4RPF A;  4B3T E;  4JI8 E;  3WU5 A;  1KIJ A;  2BM1 A;  4LF9 E;  1XNQ I;  4PU9 A;  4NXM E;  3J80 Q;  1FNM A;  4LFB I;  1XNQ E;  4K0K I;  1N36 I;  4FWD A;  4KQV A;  4M1K A;  4B3M I;  4JI1 E;  4DR7 E;  4DPX A;  3PYG A;  2UUA I;  3K1J A;  1U2R A;  4DV2 E;  3GON A;  3OTO I;  1ZXN A;  1NHI A;  4X62 E;  4NXN E;  1N0V C;  1Z59 A;  4KHP E;  1Z0C A;  4JI6 I;  3J7A G;  2V8P A;  4LFC I;  5LMU E;  4DV1 I;  3PYD A;  5GME A;  5L3J A;  4JYA E;  4EMD A;  4LF6 E;  4JI5 E;  1N34 E;  4B3S I;  3QT6 A;  4X64 E;  1FI4 A;  3ZKB A;  1N33 E;  2ZM6 E;  1Z0V A;  5IWA E;  1IBK I;  4X66 I;  4PRV A;  3WU4 A;  1XNR E;  1XMO I;  4DR1 E;  4DR5 I;  4UT4 A;  1N0U A;  2HFU A;  1S4E A;  2F4V I;  4X65 E;  1HNW I;  4LFB E;  1EI1 A;  2UUB E;  4JI5 I;  3WU6 A;  4B3R I;  1PVG A;  1PKP A;  4JI8 I;  4YY3 I;  4ZVI A;  2HFS A;  4DR7 I;  3M6A A;  4PRX A;  5GMD A;  1B62 A;  4LF8 E;  3B78 A;  3T1H E;  4LFA I;  4DV0 I;  3HUL A;  4DV0 E;  3V5R A;  4DV5 I;  3J81 C;  2X7I A;  4DUY I;  3JAM C;  4LF5 E;  4JI0 E;  4DV5 E;  5A2Q C;  1N32 E;  1MU5 A;  2WW4 A;  1HR0 I;  2VF3 A;  2AJ4 A;  4GKK E;  4DV2 I;  3T1Y E;  1XMO E;  1ZM3 A;  2HHH E;  2HHH I;  4B3T I;  1KTV A;  2Q2E B;  4DPU A;  5LMN I;  4B3R E;  4YHH I;  1N36 E;  1D6T A;  4B3S E;  2UUB I;  4JYA I;  4DUY E;  1Z0T A;  1HNX E;  3LNU A;  1HNW E;  2VQE E;  2NPF A;  4GKJ I;  1VIS A;  1ZM9 A;  3ZZU A;  4I3H A;  2UUC I;  4Z7Y A; 
#chains in the Genus database with same CATH topology
 2PO0 A;  3NZK A;  2R42 A;  3OTO E;  4USK A;  1PIE A;  4OO1 D;  1IBK E;  5IWA I;  5K36 F;  4FWH A;  4DU7 A;  4JI7 E;  1ZM4 A;  4DV6 I;  5IT9 Q;  2CGE A;  2GO4 A;  5JEA F;  4DR5 E;  1FJG I;  4DR1 I;  3P06 A;  4P52 A;  2ZBK B;  4LF7 I;  1ZM2 A;  3B82 A;  3GME A;  5ELW A;  1FJG E;  4DUZ I;  2JE6 A;  1Y5Y A;  1K47 A;  4DV7 E;  4JV5 I;  4IFD C;  2R3V A;  2GS8 A;  4JI0 I;  4LF5 I;  2EFG A;  4X64 I;  1Z5C A;  3M7N D;  2UUC E;  4LF6 I;  4DV4 I;  1A6F A;  2PO1 A;  1H7U A;  3P76 A;  4GKJ E;  4FW4 A;  2O1W A;  4I3H A;  2BV3 A;  4DR4 I;  2NN6 A;  4FW5 A;  1WUU A;  4AQY E;  1HNZ E;  3PS2 A;  1EA6 A;  3V2U C;  5K36 B;  1YHC A;  4YHH E;  2GO3 A;  2CG9 A;  5C0X B;  1Z5A A;  1IBM E;  5C0X C;  2A2D A;  5LL6 R;  5BR8 E;  4BA1 A;  3D4J A;  2BM0 A;  4DR6 I;  4NXM I;  2UUA E;  1HK7 A;  3GLL A;  3PRY A;  5C0X E;  1KKH A;  5LMU I;  1Z0G A;  2E5L E;  2VQE I;  5K36 E;  1MG7 A;  1J5E E;  4JI3 E;  2C37 B;  4DV3 E;  1IBL E;  2JEA A;  4DU8 A;  2UU9 E;  4HAC B;  5EL9 A;  3QT8 A;  3J81 Q;  5LMN E;  2IOP A;  4BA2 B;  2V2V A;  3P3C A;  4DR6 E;  4DXL A;  4LCH A;  4FW9 A;  4IZJ A;  4R1F A;  4WUD A;  4IFD E;  2HK3 A;  1Y4S A;  2LJP A;  4ED4 A;  1E3P A;  4JG4 A;  4K0K E;  1ELO A;  4DV4 E;  2ZIT A;  1N34 I;  2V2Q A;  1J5E I;  3PYE A;  4LCF A;  1Z5B A;  2C38 A;  2A2C A;  2HKJ A;  2V2Z A;  4URL A;  4JI2 I;  3KRN A;  3PS3 A;  3Q1Q A;  4MYT A;  3T1H I;  4LFA E;  1UDN A;  1Y6Z A;  1XNR I;  5IT9 C;  1IBM I;  1FKA E;  4X65 I;  4FWG A;  3J7A M;  2X36 A;  5FWK A;  3LPS A;  4DV7 I;  3U1Y A;  4OZE A;  4DPT A;  1KVK A;  3K17 A;  4HXZ A;  2UXB E;  2Z5B A;  4DV1 E;  4LF4 I;  1Z0B A;  4X66 E;  1I94 I;  4JI6 E;  4DR4 E;  1H7S A;  4WUC A;  1NHJ A;  4DV3 I;  5DRR A;  3U1K A;  2WP8 A;  4FW7 A;  3J80 C;  2VES A;  4JI2 E;  4FW6 A;  2F4V E;  5K36 C;  3ZZT A;  1DAR A;  1H72 C;  5C0X A;  4MU1 A;  4X62 I;  4OO1 F;  1R6M A;  3CWV A;  2C38 B;  4OO1 E;  2VQF I;  4B3M E;  2PO2 A;  1FWK A;  3JAM Q;  2VQF E;  1N32 I;  1ZXM A;  3H4L A;  2NN6 F;  2PNZ A;  4YY3 E;  2CZ9 A;  5JEA B;  3T1Y I;  1Y4U A;  2PNL A;  4N3O A;  3P3E A;  3GCM A;  3QT7 A;  5EKW A;  1B63 A;  1R6L A;  3HJC A;  1XMQ I;  4HAC A;  1P42 A;  1XMQ E;  5FLX C;  5FLX Q;  4LF8 I;  3WU3 A;  2UXC I;  2O1U A;  2F1D A;  4IZK A;  2Z5E A;  4LF4 E;  4DR3 E;  2UXB I;  3ZM7 A;  1XXE A;  3B4T A;  4AIM A;  2DEJ A;  1XHK A;  2IOQ A;  4P7A A;  2IES A;  5C0X F;  1NZ0 A;  4HY1 A;  4USM A;  1OJ4 A;  3L7Z B;  2OI2 A;  4Z7C A;  3L7Z A;  1YH8 A;  2UXD E;  4GQU A;  4OX9 E;  1Z0W A;  5A2Q Q;  4JI7 I;  2PO1 B;  1N33 I;  4DPY A;  1IBL I;  2CVE A;  5DRP A;  4MQY A;  3QT5 A;  1HNZ I;  4AQY I;  3PYF A;  2O1V A;  4LF9 I;  1QZR A;  5K36 A;  4HYM A;  1NHH A;  2NN6 B;  1OYP A;  2NN6 C;  3DD6 A;  2BR2 B;  4DUZ E;  2E1R A;  1HNX I;  1H73 A;  4NXN I;  4LF7 E;  4DPW A;  4UTG A;  3B8H A;  3LTO A;  1H74 A;  1FWL A;  5JEA A;  4OO1 C;  4JI4 E;  4JI4 I;  4JV5 E;  4OX9 I;  2UXD I;  5JEA D;  1I94 E;  2V34 A;  3F0N A;  4DR2 E;  4FN5 A;  2XEX A;  3ZZ0 A;  4QNK A;  4DR2 I;  2BA0 G;  4JI1 I;  1RRE A;  1RR9 A;  2HKE A;  4DV6 E;  2ZM6 I;  2UXC E;  4XTJ A;  3ZKD A;  2JEB A;  1Z0E A;  4JI3 I;  1OYR A;  2JEB B;  3H1C A;  1BKN A;  2JT2 A;  2BA1 G;  4IZJ B;  4WUB A;  4LFC E;  4IFD D;  2E5L I;  4KHP I;  1MX0 A;  2C39 B;  1USU A;  4MDT A;  4MYU A;  5DNL A;  4MU4 A;  1S16 A;  5BR8 I;  2DEI A;  4DR3 I;  4FW3 A;  2J7K A;  1UEK A;  5JEA C;  5C0X D;  1HR0 E;  2WNR B;  4GKK I;  2IER A;  2UU9 I;  2HK2 A;  1E3H A;  4RPF A;  4B3T E;  1OYS A;  4JI8 E;  3WU5 A;  1KIJ A;  2BM1 A;  2PNM A;  4BA2 A;  4AID A;  2Z5C B;  4LF9 E;  1XNQ I;  2C37 A;  4PU9 A;  3CDI A;  2Z5C A;  4NXM E;  3J80 Q;  1FNM A;  4LFB I;  1XNQ E;  4K0K I;  1N36 I;  1VI7 A;  4U3D A;  4FWD A;  4KQV A;  4M1K A;  4B3M I;  4JI1 E;  4IFD A;  4DR7 E;  4DPX A;  4OKG A;  2AE8 A;  3PYG A;  2WP8 B;  5DRQ A;  2UUA I;  3K1J A;  4IZK B;  1U2R A;  4DV2 E;  3GON A;  1Y60 A;  2O3Z A;  3OTO I;  1ZXN A;  2GQ0 A;  1NHI A;  2BA1 D;  4X62 E;  4NXN E;  1Z59 A;  1N0V C;  4KHP E;  2WNR A;  1Z0C A;  2BR2 A;  4JI6 I;  3J7A G;  2V8P A;  4LFC I;  5LMU E;  4IS9 A;  4DV1 I;  3PYD A;  5GME A;  1UDS A;  3PS1 A;  5L3J A;  4JYA E;  4EMD A;  4LF6 E;  4JI5 E;  1N34 E;  2Z5B B;  4B3S I;  3QT6 A;  4X64 E;  1FI4 A;  3ZKB A;  1N33 E;  2NN6 E;  3CDJ A;  2ZM6 E;  2JE6 B;  1Z0V A;  5IWA E;  1IBK I;  4X66 I;  4PRV A;  3WU4 A;  1XNR E;  4LCG A;  2O1T A;  1XMO I;  4DR1 E;  4DR5 I;  4UT4 A;  1N0U A;  2HFU A;  1S4E A;  5DNX A;  2F4V I;  3P3G A;  4X65 E;  3K85 A;  1HNW I;  5DRO A;  4LFB E;  1EI1 A;  2UUB E;  1UDO A;  4JI5 I;  4ISA A;  3WU6 A;  4B3R I;  1PVG A;  1PKP A;  4JI8 I;  3HKM A;  4YY3 I;  3UHM A;  3M85 G;  4ZVI A;  2HFS A;  4NBQ A;  2PNZ B;  4DR7 I;  4AM3 A;  3M6A A;  4PRX A;  3M85 D;  4OO1 A;  5GMD A;  1B62 A;  4LF8 E;  4LOM A;  5JEA E;  3B78 A;  3T1H E;  4LFA I;  2JEA B;  4DV0 I;  3HUL A;  4J3D A;  4IZJ D;  4IFD B;  1UDQ A;  4DV0 E;  3V5R A;  4OO1 B;  4DV5 I;  3J81 C;  1USV A;  2X7I A;  4DUY I;  4LPF A;  3JAM C;  4LF5 E;  4JI0 E;  3Q6N A;  5A2Q C;  4DV5 E;  1N32 E;  1MU5 A;  2BA0 D;  2WW4 A;  1HR0 I;  4U3B A;  2VF3 A;  2AJ4 A;  2NN6 D;  4GKK E;  4DV2 I;  3T1Y E;  1XMO E;  1ZM3 A;  2HHH E;  2HHH I;  4B3T I;  3Q6M A;  1KTV A;  2Q2E B;  4QNJ A;  4DPU A;  5LMN I;  4B3R E;  4YHH I;  1N36 E;  1D6T A;  2J65 A;  4B3S E;  4IFD F;  2UUB I;  4JYA I;  4DUY E;  1Z0T A;  4MU0 A;  1HNX E;  3LNU A;  1HNW E;  4MU3 A;  2VQE E;  2NPF A;  2C39 A;  4GKJ I;  3M7N G;  2PO2 B;  5K36 D;  1VIS A;  1ZM9 A;  3ZZU A;  1RHY A;  2PO0 B;  4BA1 B;  2UUC I;  4Z7Y A; 
#chains in the Genus database with same CATH homology
 2R42 A;  3OTO E;  4USK A;  1PIE A;  1IBK E;  5IWA I;  4FWH A;  4DU7 A;  4JI7 E;  1ZM4 A;  4DV6 I;  5IT9 Q;  2CGE A;  1FJG I;  4DR5 E;  4DR1 I;  3P06 A;  4P52 A;  2ZBK B;  4LF7 I;  1ZM2 A;  3B82 A;  1FJG E;  4DUZ I;  1K47 A;  4DV7 E;  4JV5 I;  2R3V A;  2GS8 A;  4JI0 I;  4LF5 I;  2EFG A;  4X64 I;  1Z5C A;  2UUC E;  4LF6 I;  4DV4 I;  1A6F A;  1H7U A;  4GKJ E;  2O1W A;  4DR4 I;  2BV3 A;  1WUU A;  4AQY E;  1HNZ E;  1EA6 A;  3V2U C;  4YHH E;  2CG9 A;  1Z5A A;  1IBM E;  2A2D A;  5LL6 R;  5BR8 E;  3D4J A;  2BM0 A;  4DR6 I;  4NXM I;  2UUA E;  1HK7 A;  3PRY A;  1KKH A;  5LMU I;  1Z0G A;  2E5L E;  2VQE I;  1MG7 A;  1J5E E;  4JI3 E;  4DV3 E;  1IBL E;  4DU8 A;  2UU9 E;  4HAC B;  3QT8 A;  3J81 Q;  5LMN E;  2IOP A;  2V2V A;  4DR6 E;  4DXL A;  4FW9 A;  4IZJ A;  4R1F A;  4WUD A;  2HK3 A;  1Y4S A;  2LJP A;  4ED4 A;  4JG4 A;  4K0K E;  1ELO A;  4DV4 E;  2ZIT A;  1N34 I;  2V2Q A;  1J5E I;  3PYE A;  1Z5B A;  2A2C A;  2HKJ A;  2V2Z A;  4URL A;  4JI2 I;  3Q1Q A;  4MYT A;  3T1H I;  4LFA E;  1Y6Z A;  1XNR I;  5IT9 C;  1IBM I;  1FKA E;  4X65 I;  4FWG A;  3J7A M;  2X36 A;  5FWK A;  3LPS A;  4DV7 I;  4DPT A;  1KVK A;  3K17 A;  4HXZ A;  2UXB E;  2Z5B A;  4DV1 E;  4LF4 I;  1Z0B A;  4X66 E;  1I94 I;  4JI6 E;  4DR4 E;  1H7S A;  4WUC A;  1NHJ A;  4DV3 I;  3J80 C;  4JI2 E;  2F4V E;  3ZZT A;  1DAR A;  1H72 C;  4X62 I;  3CWV A;  2VQF I;  4B3M E;  1FWK A;  3JAM Q;  2VQF E;  1N32 I;  1ZXM A;  3H4L A;  4YY3 E;  2CZ9 A;  3T1Y I;  1Y4U A;  2PNL A;  4N3O A;  3QT7 A;  1B63 A;  3HJC A;  1XMQ I;  4HAC A;  1XMQ E;  5FLX C;  5FLX Q;  4LF8 I;  3WU3 A;  2UXC I;  2O1U A;  4IZK A;  2Z5E A;  4LF4 E;  4DR3 E;  2UXB I;  3ZM7 A;  2DEJ A;  1XHK A;  2IOQ A;  4P7A A;  1NZ0 A;  4HY1 A;  4USM A;  1OJ4 A;  2OI2 A;  4Z7C A;  2UXD E;  4OX9 E;  1Z0W A;  5A2Q Q;  4JI7 I;  1N33 I;  4DPY A;  1IBL I;  3QT5 A;  1HNZ I;  4AQY I;  3PYF A;  2O1V A;  4LF9 I;  1QZR A;  4HYM A;  1NHH A;  4DUZ E;  2E1R A;  1HNX I;  1H73 A;  4NXN I;  4LF7 E;  4DPW A;  4UTG A;  3B8H A;  3LTO A;  1H74 A;  1FWL A;  4JI4 E;  4JI4 I;  4JV5 E;  4OX9 I;  2UXD I;  1I94 E;  2V34 A;  3F0N A;  4DR2 E;  4FN5 A;  2XEX A;  3ZZ0 A;  4DR2 I;  4JI1 I;  1RRE A;  1RR9 A;  2HKE A;  4DV6 E;  2ZM6 I;  2UXC E;  4XTJ A;  3ZKD A;  1Z0E A;  4JI3 I;  1BKN A;  4IZJ B;  4WUB A;  4LFC E;  2E5L I;  4KHP I;  1MX0 A;  1USU A;  4MYU A;  1S16 A;  5BR8 I;  2DEI A;  4DR3 I;  2J7K A;  1UEK A;  1HR0 E;  4GKK I;  2UU9 I;  2HK2 A;  4RPF A;  4B3T E;  4JI8 E;  3WU5 A;  1KIJ A;  2BM1 A;  2PNM A;  2Z5C B;  4LF9 E;  1XNQ I;  4PU9 A;  4NXM E;  2Z5C A;  3J80 Q;  1FNM A;  4LFB I;  1XNQ E;  4K0K I;  1N36 I;  4FWD A;  4KQV A;  4M1K A;  4B3M I;  4JI1 E;  4DR7 E;  4DPX A;  3PYG A;  2UUA I;  3K1J A;  4IZK B;  1U2R A;  4DV2 E;  3GON A;  3OTO I;  1ZXN A;  2GQ0 A;  1NHI A;  4X62 E;  4NXN E;  1N0V C;  1Z59 A;  4KHP E;  1Z0C A;  4JI6 I;  3J7A G;  2V8P A;  4LFC I;  5LMU E;  4DV1 I;  3PYD A;  5GME A;  5L3J A;  4JYA E;  4EMD A;  4LF6 E;  4JI5 E;  1N34 E;  2Z5B B;  4B3S I;  3QT6 A;  4X64 E;  1FI4 A;  3ZKB A;  1N33 E;  2ZM6 E;  1Z0V A;  5IWA E;  1IBK I;  4X66 I;  4PRV A;  3WU4 A;  1XNR E;  2O1T A;  1XMO I;  4DR1 E;  4DR5 I;  4UT4 A;  1N0U A;  2HFU A;  1S4E A;  2F4V I;  4X65 E;  3K85 A;  1HNW I;  4LFB E;  1EI1 A;  2UUB E;  4JI5 I;  3WU6 A;  4B3R I;  1PVG A;  1PKP A;  4JI8 I;  4YY3 I;  4ZVI A;  2HFS A;  4DR7 I;  3M6A A;  4PRX A;  5GMD A;  1B62 A;  4LF8 E;  3B78 A;  3T1H E;  4LFA I;  4DV0 I;  3HUL A;  4IZJ D;  4DV0 E;  3V5R A;  4DV5 I;  3J81 C;  1USV A;  2X7I A;  4DUY I;  3JAM C;  4LF5 E;  4JI0 E;  3Q6N A;  5A2Q C;  4DV5 E;  1N32 E;  1MU5 A;  2WW4 A;  1HR0 I;  2VF3 A;  2AJ4 A;  4GKK E;  4DV2 I;  3T1Y E;  1XMO E;  1ZM3 A;  2HHH E;  2HHH I;  4B3T I;  3Q6M A;  1KTV A;  2Q2E B;  4DPU A;  5LMN I;  4B3R E;  4YHH I;  1N36 E;  1D6T A;  4B3S E;  2UUB I;  4JYA I;  4DUY E;  1Z0T A;  1HNX E;  3LNU A;  1HNW E;  2VQE E;  2NPF A;  4GKJ I;  1VIS A;  1ZM9 A;  3ZZU A;  4I3H A;  2UUC I;  4Z7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...