4JYAI

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jyaI00
4YHHI 2X7IA 4JI2E 4DPUA 3Q1QA 4NXME 3H4LA 1Z0BA 1U2RA 1IBME 1XNQE 4LF9I 4HACB 3HULA 4FWGA 4DUZE 5FLXQ 2X36A 1RREA 1RR9A 3B8HA 4UT4A 5LL6R 1J5EE 2BV3A 2UU9I 4JI8E 3ZKDA 1ZM4A 4DUYE 4KQVA 1IBKI 2HHHI 5GMDA 2UXDI 3QT8A 4DU7A 5LMUE 1XNRE 1Z5BA 2BM0A 4JI5I 3T1YI 3B78A 1XMQI 2XEXA 2WW4A 2EFGA 1N33E 5A2QC 1KIJA 4ZVIA 1Z0CA 1Z5CA 4JI7E 1BKNA 4X65I 1FNMA 4LF7I 4X64E 4LFAE 1B62A 4LF4E 3OTOI 4LF8E 4B3TE 1HR0E 5LMNE 1ZM9A 2V2QA 2A2CA 4PRXA 4DV4E 2CZ9A 4JI6E 3WU4A 4JI3I 4FN5A 4DR6I 4DV1I 3ZM7A 2F4VE 1NZ0A 4JI1I 1EI1A 3J81Q 2UUCE 4DPTA 3ZZUA 2VQFI 4DPYA 4LFBI 5BR8I 1FI4A 4GKJI 4OX9E 1HNXI 4YY3I 4DR5I 1S16A 4FWHA 4LF6E 4GKKE 2ZM6E 4DV6I 5IWAI 2A2DA 1VISA 4JYAI 1ZM2A 3V2UC 3D4JA 2HKEA 1PKPA 3J7AM 4DV7E 1OJ4A 4FWDA 2ZBKB 4FW9A 4B3RE 2V2VA 4M1KA 1HNZE 1IBLI 1HNWE 1H7UA 4I3HA 2UXCE 1N36I 2UXBE 3LPSA 4JV5E 2UUAI 1XHKA 3F0NA 4B3SI 1B63A 1PIEA 1XMOE 1ZXMA 5GMEA 1MX0A 3PYDA 4X62I 4KHPE 4LF5E 3JAMQ 5IT9C 3ZKBA 1UEKA 2NPFA 3ZZ0A 2GS8A 3J80C 4UTGA 4DV0I 4LFCI 4YHHE 4DV2I 4DR3I 4K0KI 4X66I 4MYTA 1FWLA 3QT7A 1N32I 2E5LI 2HK3A 4DV5I 4JI4I 4LF9E 4HXZA 1EA6A 4DR4I 2HKJA 1N0VC 2DEJA 3PYFA 2AJ4A 3T1HI 5L3JA 2UU9E 4NXNI 1KKHA 2J7KA 2DEIA 5FLXC 1Z5AA 4DR2I 1IBKE 4AQYI 1PVGA 4JI0I 2HHHE 3QT5A 4DR7I 2UXDE 4DR1I 2UUBI 4ED4A 4JI5E 2V8PA 3T1YE 4DPXA 4DXLA 1XMQE 1H73A 3WU5A 1Z0EA 2E1RA 1I94I 3K17A 1MU5A 2VQEI 1N34I 4DV3I 4LF7E 4JG4A 2LJPA 1FJGI 4B3MI 3OTOE 4JI2I 2UXBI 4NXMI 3M6AA 4DPWA 1IBMI 1XNQI 4JI3E 4DR6E 4DUZI 2HFUA 4DV1E 4USKA 4XTJA 1N0UA 4JI1E 3B82A 2V2ZA 4P7AA 1J5EI 2VQFE 3WU6A 2R3VA 5BR8E 4LFBE 4GKJE 1HNXE 4YY3E 4DR5E 4JI8I 1Z59A 2HFSA 4DUYI 4PU9A 1ELOA 4DV6E 5IWAE 4P52A 1DARA 4JYAE 5A2QQ 3J81C 4Z7CA 5LMUI 3WU3A 2ZITA 1IBLE 1XNRI 1N36E 2UUAE 1Z0TA 3PYEA 1N33I 1S4EA 3V5RA 4B3SE 1FWKA 1QZRA 4JI7I 4MYUA 1H74A 1K47A 4X64I 4EMDA 4X62E 4LFAI 4HY1A 4LF4I 4WUCA 4LF8I 1ZM3A 4B3TI 1HR0I 2V34A 2OI2A 5LMNI 1KTVA 4DV4I 4WUDA 4DV0E 3QT6A 4JI6I 4LFCE 3PYGA 4DV2E 4DR3E 4K0KE 4X66E 2F4VI 3JAMC 2UUCI 4DU8A 4R1FA 1MG7A 1N32E 1NHIA 3GONA 4RPFA 2E5LE 1D6TA 4DV5E 4JI4E 4OX9I 1Z0WA 4USMA 3CWVA 4DR4E 3J7AG 4LF6I 1Z0VA 4GKKI 2ZM6I 4Z7YA 3T1HE 4DV7I 4NXNE 4X65E 3K1JA 4B3RI 1HNZI 1HNWI 2Q2EB 1Z0GA 4DR2E 2UXCI 4AQYE 4JI0E 4JV5I 4URLA 5IT9Q 1NHHA 3LTOA 4HYMA 4DR7E 3J80Q 1FKAE 4DR1E 1KVKA 1XMOI 2UUBE 1ZXNA 2HK2A 1H7SA 1H72C 4WUBA 4HACA 1A6FA 2R42A 4KHPI 1NHJA 4LF5I 1WUUA 3LNUA 2BM1A 1I94E 2VQEE 4PRVA 1N34E 4DV3E 3ZZTA 2VF3A 1FJGE 4B3ME
chains in the Genus database with same CATH superfamily
4YHHI 2X7IA 4JI2E 2VESA 3H1CA 4LPFA 4DPUA 3PRYA 3Q1QA 4NXME 3H4LA 1Z0BA 1U2RA 1IBME 2CG9A 1XNQE 4LF9I 4HACB 3HULA 4FWGA 4DUZE 5FLXQ 2X36A 1RREA 1RR9A 1Y4UA 3B8HA 5JEAA 4UT4A 5JEAC 4BA2B 5LL6R 1J5EE 3M85D 1YH8A 2BV3A 2UU9I 4JI8E 3ZKDA 1ZM4A 4DUYE 4OO1E 4KQVA 1IBKI 5FWKA 2HHHI 5GMDA 2BA0D 2UXDI 3QT8A 3HJCA 4DU7A 5LMUE 4U3DA 1XNRE 3DD6A 1Z5BA 3GMEA 2BM0A 4JI5I 3T1YI 3B78A 1XMQI 5JEAB 2XEXA 2WW4A 2EFGA 1N33E 5A2QC 1KIJA 3L7ZA 1UDOA 2JE6A 4ZVIA 1Z0CA 1Z5CA 4IFDF 4JI7E 1BKNA 5ELWA 4X65I 3KRNA 1FNMA 4LF7I 4X64E 2NN6F 4LFAE 1B62A 2GQ0A 2CGEA 4LF4E 3OTOI 4LF8E 4B3TE 1HR0E 2C38A 5LMNE 5C0XA 1ZM9A 5C0XC 1Y60A 5DROA 2V2QA 2A2CA 4PRXA 4DV4E 2CZ9A 4QNKA 4JI6E 3WU4A 4JI3I 4NBQA 4FN5A 5K36A 4DR6I 2JEAA 4DV1I 2J65A 1HK7A 3ZM7A 2F4VE 1NZ0A 4JI1I 4IS9A 1EI1A 3J81Q 2UUCE 4IZJA 4DPTA 4OZEA 3L7ZB 3ZZUA 2JE6B 2VQFI 4DPYA 4LFBI 5BR8I 1FI4A 4GKJI 4OX9E 5DRQA 1HNXI 4YY3I 4DR5I 1S16A 4FWHA 1UDSA 4LF6E 4GKKE 2ZM6E 1USVA 4DV6I 5IWAI 2A2DA 1VISA 2NN6D 4IZKA 5C0XB 4JYAI 1ZM2A 3PS1A 3D4JA 3GCMA 2HKEA 3V2UC 1PKPA 3J7AM 4DV7E 1OJ4A 1USUA 4FWDA 2ZBKB 2CVEA 4FW9A 4B3RE 2V2VA 4M1KA 4J3DA 1HNZE 5K36B 5C0XD 5DNXA 3U1KA 1P42A 1IBLI 2JEAB 1H7UA 1HNWE 4I3HA 2UXCE 1N36I 2UXBE 3LPSA 4JV5E 2UUAI 3PS2A 1XHKA 3F0NA 4IZJB 5K36D 5EL9A 4B3SI 1B63A 1PIEA 1XMOE 1ZXMA 5GMEA 4IZJD 1MX0A 4LOMA 4FW5A 3PYDA 4X62I 4KHPE 4IZKB 4LF5E 3JAMQ 5JEAF 5IT9C 4OO1A 2PO2B 3ZKBA 4GQUA 4OO1C 1UEKA 2NPFA 3ZZ0A 2GS8A 4AM3A 3J80C 4UTGA 4LCGA 2PNLA 5DRRA 4DV0I 4LFCI 4YHHE 4DV2I 4DR3I 4K0KI 4X66I 4MYTA 1FWLA 3QT7A 1N32I 2E5LI 2HK3A 4DV5I 4JI4I 4LF9E 4HXZA 1EA6A 4U3BA 4DR4I 2HKJA 1N0VC 3M7NG 4ISAA 2DEJA 2PNMA 4OO1B 4MU3A 3PYFA 4MU1A 2AJ4A 3T1HI 5L3JA 5JEAD 2UU9E 1OYSA 4NXNI 1KKHA 2J7KA 2PNZA 2DEIA 5FLXC 1Z5AA 3PS3A 4DR2I 1IBKE 4AQYI 1PVGA 4JI0I 4MQYA 2IOQA 2Z5CA 1Y6ZA 2BA1G 2HHHE 5C0XF 3QT5A 4DR7I 2UXDE 4DR1I 2UUBI 2BR2A 4IFDC 4ED4A 2JT2A 2WP8A 5K36F 4JI5E 2V8PA 3T1YE 4IFDE 4DPXA 4DXLA 1XMQE 1H73A 3WU5A 4LCFA 1VI7A 2NN6E 1Z0EA 3HKMA 2E1RA 1I94I 3K17A 1MU5A 2VQEI 2PNZB 1N34I 4DV3I 4LF7E 4FW6A 4JG4A 2LJPA 1FJGI 4B3MI 3OTOE 1UDQA 4JI2I 4FW4A 3M7ND 2Z5CB 2UXBI 4QNJA 4N3OA 3K85A 2PO2A 4IFDB 4NXMI 2BR2B 4FW3A 3M6AA 4DPWA 1IBMI 1XNQI 3B4TA 2WP8B 4JI3E 4DR6E 4DUZI 2HFUA 4DV1E 4USKA 4XTJA 1N0UA 2PO0A 2O1WA 2C37A 4JI1E 3B82A 2V2ZA 4P7AA 3P3EA 1J5EI 2BA1D 2VQFE 3WU6A 2R3VA 5BR8E 4LFBE 4GKJE 2IESA 1HNXE 4YY3E 4DR5E 2JEBA 4JI8I 1Z59A 2HFSA 4DUYI 4PU9A 2GO3A 1ELOA 3Q6MA 1R6MA 4DV6E 5IWAE 4P52A 2PO1A 1DARA 4JYAE 4OO1F 1R6LA 5A2QQ 4MU4A 3J81C 4Z7CA 2O1UA 5LMUI 3WU3A 5DNLA 2ZITA 1IBLE 1XNRI 3P06A 2Z5BA 1E3PA 2PO0B 1N36E 2C37B 2UUAE 1Z0TA 3PYEA 1N33I 1S4EA 3V5RA 4B3SE 1FWKA 1QZRA 4JI7I 2JEBB 4MYUA 5JEAE 1H74A 2WNRA 1K47A 4X64I 4EMDA 4X62E 4LFAI 4AIDA 1RHYA 2O3ZA 4FW7A 4HY1A 4LF4I 2PO1B 2O1TA 4WUCA 4LF8I 1ZM3A 4B3TI 1HR0I 2V34A 2OI2A 5LMNI 3CDJA 1KTVA 2IERA 4DV4I 4OO1D 4WUDA 4DV0E 3QT6A 4JI6I 3P3GA 2Z5BB 4LFCE 1OYPA 4OKGA 2C39A 2Z5EA 3PYGA 4DV2E 4DR3E 4K0KE 4X66E 2F4VI 3JAMC 3CDIA 2UUCI 4DU8A 4R1FA 1MG7A 1N32E 2AE8A 3NZKA 1NHIA 3GONA 4RPFA 2E5LE 1D6TA 4DV5E 4IFDA 4JI4E 4OX9I 1Z0WA 2WNRB 4USMA 3CWVA 4DR4E 2NN6A 3J7AG 2NN6C 3P76A 3U1YA 4LF6I 1Z0VA 4GKKI 2ZM6I 4Z7YA 3UHMA 3T1HE 4AIMA 4BA1A 4DV7I 4NXNE 4X65E 1OYRA 3K1JA 2IOPA 4MDTA 4B3RI 1HNZI 2C39B 5C0XE 1HNWI 5K36C 3Q6NA 2Q2EB 1Y4SA 1Z0GA 4DR2E 2UXCI 4AQYE 2O1VA 4JI0E 4URLA 4JV5I 5IT9Q 4LCHA 1NHHA 5K36E 3LTOA 2GO4A 4HYMA 3M85G 3J80Q 1FKAE 4DR1E 4DR7E 1KVKA 1XMOI 2F1DA 2UUBE 1ZXNA 2HK2A 2NN6B 1H7SA 1XXEA 1H72C 4WUBA 4HACA 3P3CA 4IFDD 1A6FA 2R42A 5DRPA 4KHPI 1NHJA 4LF5I 2C38B 1WUUA 1YHCA 4BA2A 3LNUA 1Y5YA 2BM1A 1E3HA 2BA0G 4BA1B 1I94E 2VQEE 1UDNA 3GLLA 4PRVA 1N34E 4DV3E 4MU0A 3ZZTA 5EKWA 2VF3A 1FJGE 4B3ME
chains in the Genus database with same CATH topology
4YHHI 2X7IA 4JI2E 4DPUA 3PRYA 3Q1QA 4NXME 3H4LA 1Z0BA 1U2RA 1IBME 2CG9A 1XNQE 4LF9I 4HACB 3HULA 4FWGA 4DUZE 5FLXQ 2X36A 1RREA 1RR9A 1Y4UA 3B8HA 4UT4A 5LL6R 1J5EE 2BV3A 2UU9I 4JI8E 3ZKDA 1ZM4A 4DUYE 4KQVA 1IBKI 5FWKA 2HHHI 5GMDA 2UXDI 3QT8A 3HJCA 4DU7A 5LMUE 1XNRE 1Z5BA 2BM0A 4JI5I 3T1YI 3B78A 1XMQI 2XEXA 2WW4A 2EFGA 1N33E 5A2QC 1KIJA 4ZVIA 1Z0CA 1Z5CA 4JI7E 1BKNA 4X65I 1FNMA 4LF7I 4X64E 4LFAE 1B62A 2GQ0A 2CGEA 4LF4E 3OTOI 4LF8E 4B3TE 1HR0E 5LMNE 1ZM9A 2V2QA 2A2CA 4PRXA 4DV4E 2CZ9A 4JI6E 3WU4A 4JI3I 4FN5A 4DR6I 4DV1I 1HK7A 3ZM7A 2F4VE 1NZ0A 4JI1I 1EI1A 3J81Q 2UUCE 4IZJA 4DPTA 3ZZUA 2VQFI 4DPYA 4LFBI 5BR8I 1FI4A 4GKJI 4OX9E 1HNXI 4YY3I 4DR5I 1S16A 4FWHA 4LF6E 4GKKE 2ZM6E 1USVA 4DV6I 5IWAI 2A2DA 1VISA 4IZKA 4JYAI 1ZM2A 3V2UC 3D4JA 2HKEA 1PKPA 3J7AM 4DV7E 1OJ4A 1USUA 4FWDA 2ZBKB 4FW9A 4B3RE 2V2VA 4M1KA 1HNZE 1IBLI 1HNWE 1H7UA 4I3HA 2UXCE 1N36I 2UXBE 3LPSA 4JV5E 2UUAI 1XHKA 3F0NA 4IZJB 4B3SI 1B63A 1PIEA 1XMOE 1ZXMA 5GMEA 4IZJD 1MX0A 3PYDA 4X62I 4KHPE 4IZKB 4LF5E 3JAMQ 5IT9C 3ZKBA 1UEKA 2NPFA 3ZZ0A 2GS8A 3J80C 4UTGA 2PNLA 4DV0I 4LFCI 4YHHE 4DV2I 4DR3I 4K0KI 4X66I 4MYTA 1FWLA 3QT7A 1N32I 2E5LI 2HK3A 4DV5I 4JI4I 4LF9E 4HXZA 1EA6A 4DR4I 2HKJA 1N0VC 2DEJA 2PNMA 3PYFA 2AJ4A 3T1HI 5L3JA 2UU9E 4NXNI 1KKHA 2J7KA 2DEIA 5FLXC 1Z5AA 4DR2I 1IBKE 4AQYI 1PVGA 4JI0I 2IOQA 2Z5CA 1Y6ZA 2HHHE 3QT5A 4DR7I 2UXDE 4DR1I 2UUBI 4ED4A 4JI5E 3T1YE 2V8PA 4DPXA 4DXLA 1XMQE 1H73A 3WU5A 1Z0EA 2E1RA 1I94I 3K17A 1MU5A 2VQEI 1N34I 4DV3I 4LF7E 4JG4A 2LJPA 1FJGI 4B3MI 3OTOE 4JI2I 2Z5CB 2UXBI 4N3OA 3K85A 4NXMI 3M6AA 4DPWA 1IBMI 1XNQI 4JI3E 4DR6E 4DUZI 2HFUA 4DV1E 4USKA 4XTJA 1N0UA 2O1WA 4JI1E 3B82A 2V2ZA 4P7AA 1J5EI 2VQFE 3WU6A 2R3VA 5BR8E 4LFBE 4GKJE 1HNXE 4YY3E 4DR5E 4JI8I 1Z59A 2HFSA 4DUYI 4PU9A 1ELOA 3Q6MA 4DV6E 5IWAE 4P52A 1DARA 4JYAE 5A2QQ 3J81C 4Z7CA 2O1UA 5LMUI 3WU3A 2ZITA 1IBLE 1XNRI 3P06A 2Z5BA 1N36E 2UUAE 1Z0TA 3PYEA 1N33I 1S4EA 3V5RA 4B3SE 1FWKA 1QZRA 4JI7I 4MYUA 1H74A 1K47A 4X64I 4EMDA 4X62E 4LFAI 4HY1A 4LF4I 2O1TA 4WUCA 4LF8I 1ZM3A 4B3TI 1HR0I 2V34A 2OI2A 5LMNI 1KTVA 4DV4I 4WUDA 4DV0E 3QT6A 4JI6I 2Z5BB 4LFCE 3PYGA 2Z5EA 4DV2E 4DR3E 4K0KE 4X66E 2F4VI 3JAMC 2UUCI 4DU8A 4R1FA 1MG7A 1N32E 1NHIA 3GONA 4RPFA 2E5LE 1D6TA 4DV5E 4JI4E 4OX9I 1Z0WA 4USMA 3CWVA 4DR4E 3J7AG 4LF6I 1Z0VA 4GKKI 2ZM6I 4Z7YA 3T1HE 4DV7I 4NXNE 4X65E 3K1JA 2IOPA 4B3RI 1HNZI 1HNWI 3Q6NA 2Q2EB 1Y4SA 1Z0GA 4DR2E 2UXCI 4AQYE 2O1VA 4JI0E 4URLA 4JV5I 5IT9Q 1NHHA 3LTOA 4HYMA 4DR7E 3J80Q 1FKAE 4DR1E 1KVKA 1XMOI 2UUBE 1ZXNA 2HK2A 1H7SA 1H72C 4WUBA 4HACA 1A6FA 2R42A 4KHPI 1NHJA 4LF5I 1WUUA 3LNUA 2BM1A 1I94E 2VQEE 4PRVA 1N34E 4DV3E 3ZZTA 2VF3A 1FJGE 4B3ME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH I;  2X7I A;  4JI2 E;  4DPU A;  3Q1Q A;  4NXM E;  3H4L A;  1Z0B A;  1U2R A;  1IBM E;  1XNQ E;  4LF9 I;  4HAC B;  3HUL A;  4FWG A;  4DUZ E;  5FLX Q;  2X36 A;  1RRE A;  1RR9 A;  3B8H A;  4UT4 A;  5LL6 R;  1J5E E;  2BV3 A;  2UU9 I;  4JI8 E;  3ZKD A;  1ZM4 A;  4DUY E;  4KQV A;  1IBK I;  2HHH I;  5GMD A;  2UXD I;  3QT8 A;  4DU7 A;  5LMU E;  1XNR E;  1Z5B A;  2BM0 A;  4JI5 I;  3T1Y I;  3B78 A;  1XMQ I;  2XEX A;  2WW4 A;  2EFG A;  1N33 E;  5A2Q C;  1KIJ A;  4ZVI A;  1Z0C A;  1Z5C A;  4JI7 E;  1BKN A;  4X65 I;  1FNM A;  4LF7 I;  4X64 E;  4LFA E;  1B62 A;  4LF4 E;  3OTO I;  4LF8 E;  4B3T E;  1HR0 E;  5LMN E;  1ZM9 A;  2V2Q A;  2A2C A;  4PRX A;  4DV4 E;  2CZ9 A;  4JI6 E;  3WU4 A;  4JI3 I;  4FN5 A;  4DR6 I;  4DV1 I;  3ZM7 A;  2F4V E;  1NZ0 A;  4JI1 I;  1EI1 A;  3J81 Q;  2UUC E;  4DPT A;  3ZZU A;  2VQF I;  4DPY A;  4LFB I;  5BR8 I;  1FI4 A;  4GKJ I;  4OX9 E;  1HNX I;  4YY3 I;  4DR5 I;  1S16 A;  4FWH A;  4LF6 E;  4GKK E;  2ZM6 E;  4DV6 I;  5IWA I;  2A2D A;  1VIS A;  4JYA I;  1ZM2 A;  3V2U C;  3D4J A;  2HKE A;  1PKP A;  3J7A M;  4DV7 E;  1OJ4 A;  4FWD A;  2ZBK B;  4FW9 A;  4B3R E;  2V2V A;  4M1K A;  1HNZ E;  1IBL I;  1HNW E;  1H7U A;  4I3H A;  2UXC E;  1N36 I;  2UXB E;  3LPS A;  4JV5 E;  2UUA I;  1XHK A;  3F0N A;  4B3S I;  1B63 A;  1PIE A;  1XMO E;  1ZXM A;  5GME A;  1MX0 A;  3PYD A;  4X62 I;  4KHP E;  4LF5 E;  3JAM Q;  5IT9 C;  3ZKB A;  1UEK A;  2NPF A;  3ZZ0 A;  2GS8 A;  3J80 C;  4UTG A;  4DV0 I;  4LFC I;  4YHH E;  4DV2 I;  4DR3 I;  4K0K I;  4X66 I;  4MYT A;  1FWL A;  3QT7 A;  1N32 I;  2E5L I;  2HK3 A;  4DV5 I;  4JI4 I;  4LF9 E;  4HXZ A;  1EA6 A;  4DR4 I;  2HKJ A;  1N0V C;  2DEJ A;  3PYF A;  2AJ4 A;  3T1H I;  5L3J A;  2UU9 E;  4NXN I;  1KKH A;  2J7K A;  2DEI A;  5FLX C;  1Z5A A;  4DR2 I;  1IBK E;  4AQY I;  1PVG A;  4JI0 I;  2HHH E;  3QT5 A;  4DR7 I;  2UXD E;  4DR1 I;  2UUB I;  4ED4 A;  4JI5 E;  2V8P A;  3T1Y E;  4DPX A;  4DXL A;  1XMQ E;  1H73 A;  3WU5 A;  1Z0E A;  2E1R A;  1I94 I;  3K17 A;  1MU5 A;  2VQE I;  1N34 I;  4DV3 I;  4LF7 E;  4JG4 A;  2LJP A;  1FJG I;  4B3M I;  3OTO E;  4JI2 I;  2UXB I;  4NXM I;  3M6A A;  4DPW A;  1IBM I;  1XNQ I;  4JI3 E;  4DR6 E;  4DUZ I;  2HFU A;  4DV1 E;  4USK A;  4XTJ A;  1N0U A;  4JI1 E;  3B82 A;  2V2Z A;  4P7A A;  1J5E I;  2VQF E;  3WU6 A;  2R3V A;  5BR8 E;  4LFB E;  4GKJ E;  1HNX E;  4YY3 E;  4DR5 E;  4JI8 I;  1Z59 A;  2HFS A;  4DUY I;  4PU9 A;  1ELO A;  4DV6 E;  5IWA E;  4P52 A;  1DAR A;  4JYA E;  5A2Q Q;  3J81 C;  4Z7C A;  5LMU I;  3WU3 A;  2ZIT A;  1IBL E;  1XNR I;  1N36 E;  2UUA E;  1Z0T A;  3PYE A;  1N33 I;  1S4E A;  3V5R A;  4B3S E;  1FWK A;  1QZR A;  4JI7 I;  4MYU A;  1H74 A;  1K47 A;  4X64 I;  4EMD A;  4X62 E;  4LFA I;  4HY1 A;  4LF4 I;  4WUC A;  4LF8 I;  1ZM3 A;  4B3T I;  1HR0 I;  2V34 A;  2OI2 A;  5LMN I;  1KTV A;  4DV4 I;  4WUD A;  4DV0 E;  3QT6 A;  4JI6 I;  4LFC E;  3PYG A;  4DV2 E;  4DR3 E;  4K0K E;  4X66 E;  2F4V I;  3JAM C;  2UUC I;  4DU8 A;  4R1F A;  1MG7 A;  1N32 E;  1NHI A;  3GON A;  4RPF A;  2E5L E;  1D6T A;  4DV5 E;  4JI4 E;  4OX9 I;  1Z0W A;  4USM A;  3CWV A;  4DR4 E;  3J7A G;  4LF6 I;  1Z0V A;  4GKK I;  2ZM6 I;  4Z7Y A;  3T1H E;  4DV7 I;  4NXN E;  4X65 E;  3K1J A;  4B3R I;  1HNZ I;  1HNW I;  2Q2E B;  1Z0G A;  4DR2 E;  2UXC I;  4AQY E;  4JI0 E;  4JV5 I;  4URL A;  5IT9 Q;  1NHH A;  3LTO A;  4HYM A;  4DR7 E;  3J80 Q;  1FKA E;  4DR1 E;  1KVK A;  1XMO I;  2UUB E;  1ZXN A;  2HK2 A;  1H7S A;  1H72 C;  4WUB A;  4HAC A;  1A6F A;  2R42 A;  4KHP I;  1NHJ A;  4LF5 I;  1WUU A;  3LNU A;  2BM1 A;  1I94 E;  2VQE E;  4PRV A;  1N34 E;  4DV3 E;  3ZZT A;  2VF3 A;  1FJG E;  4B3M E; 
#chains in the Genus database with same CATH topology
 4YHH I;  2X7I A;  4JI2 E;  2VES A;  3H1C A;  4LPF A;  4DPU A;  3PRY A;  3Q1Q A;  4NXM E;  3H4L A;  1Z0B A;  1U2R A;  1IBM E;  2CG9 A;  1XNQ E;  4LF9 I;  4HAC B;  3HUL A;  4FWG A;  4DUZ E;  5FLX Q;  2X36 A;  1RRE A;  1RR9 A;  1Y4U A;  3B8H A;  5JEA A;  4UT4 A;  5JEA C;  4BA2 B;  5LL6 R;  1J5E E;  3M85 D;  1YH8 A;  2BV3 A;  2UU9 I;  4JI8 E;  3ZKD A;  1ZM4 A;  4DUY E;  4OO1 E;  4KQV A;  1IBK I;  5FWK A;  2HHH I;  5GMD A;  2BA0 D;  2UXD I;  3QT8 A;  3HJC A;  4DU7 A;  5LMU E;  4U3D A;  1XNR E;  3DD6 A;  1Z5B A;  3GME A;  2BM0 A;  4JI5 I;  3T1Y I;  3B78 A;  1XMQ I;  5JEA B;  2XEX A;  2WW4 A;  2EFG A;  1N33 E;  5A2Q C;  1KIJ A;  3L7Z A;  1UDO A;  2JE6 A;  4ZVI A;  1Z0C A;  1Z5C A;  4IFD F;  4JI7 E;  1BKN A;  5ELW A;  4X65 I;  3KRN A;  1FNM A;  4LF7 I;  4X64 E;  2NN6 F;  4LFA E;  1B62 A;  2GQ0 A;  2CGE A;  4LF4 E;  3OTO I;  4LF8 E;  4B3T E;  1HR0 E;  2C38 A;  5LMN E;  5C0X A;  1ZM9 A;  5C0X C;  1Y60 A;  5DRO A;  2V2Q A;  2A2C A;  4PRX A;  4DV4 E;  2CZ9 A;  4QNK A;  4JI6 E;  3WU4 A;  4JI3 I;  4NBQ A;  4FN5 A;  5K36 A;  4DR6 I;  2JEA A;  4DV1 I;  2J65 A;  1HK7 A;  3ZM7 A;  2F4V E;  1NZ0 A;  4JI1 I;  4IS9 A;  1EI1 A;  3J81 Q;  2UUC E;  4IZJ A;  4DPT A;  4OZE A;  3L7Z B;  3ZZU A;  2JE6 B;  2VQF I;  4DPY A;  4LFB I;  5BR8 I;  1FI4 A;  4GKJ I;  4OX9 E;  5DRQ A;  1HNX I;  4YY3 I;  4DR5 I;  1S16 A;  4FWH A;  1UDS A;  4LF6 E;  4GKK E;  2ZM6 E;  1USV A;  4DV6 I;  5IWA I;  2A2D A;  1VIS A;  2NN6 D;  4IZK A;  5C0X B;  4JYA I;  1ZM2 A;  3PS1 A;  3D4J A;  3GCM A;  2HKE A;  3V2U C;  1PKP A;  3J7A M;  4DV7 E;  1OJ4 A;  1USU A;  4FWD A;  2ZBK B;  2CVE A;  4FW9 A;  4B3R E;  2V2V A;  4M1K A;  4J3D A;  1HNZ E;  5K36 B;  5C0X D;  5DNX A;  3U1K A;  1P42 A;  1IBL I;  2JEA B;  1H7U A;  1HNW E;  4I3H A;  2UXC E;  1N36 I;  2UXB E;  3LPS A;  4JV5 E;  2UUA I;  3PS2 A;  1XHK A;  3F0N A;  4IZJ B;  5K36 D;  5EL9 A;  4B3S I;  1B63 A;  1PIE A;  1XMO E;  1ZXM A;  5GME A;  4IZJ D;  1MX0 A;  4LOM A;  4FW5 A;  3PYD A;  4X62 I;  4KHP E;  4IZK B;  4LF5 E;  3JAM Q;  5JEA F;  5IT9 C;  4OO1 A;  2PO2 B;  3ZKB A;  4GQU A;  4OO1 C;  1UEK A;  2NPF A;  3ZZ0 A;  2GS8 A;  4AM3 A;  3J80 C;  4UTG A;  4LCG A;  2PNL A;  5DRR A;  4DV0 I;  4LFC I;  4YHH E;  4DV2 I;  4DR3 I;  4K0K I;  4X66 I;  4MYT A;  1FWL A;  3QT7 A;  1N32 I;  2E5L I;  2HK3 A;  4DV5 I;  4JI4 I;  4LF9 E;  4HXZ A;  1EA6 A;  4U3B A;  4DR4 I;  2HKJ A;  1N0V C;  3M7N G;  4ISA A;  2DEJ A;  2PNM A;  4OO1 B;  4MU3 A;  3PYF A;  4MU1 A;  2AJ4 A;  3T1H I;  5L3J A;  5JEA D;  2UU9 E;  1OYS A;  4NXN I;  1KKH A;  2J7K A;  2PNZ A;  2DEI A;  5FLX C;  1Z5A A;  3PS3 A;  4DR2 I;  1IBK E;  4AQY I;  1PVG A;  4JI0 I;  4MQY A;  2IOQ A;  2Z5C A;  1Y6Z A;  2BA1 G;  2HHH E;  5C0X F;  3QT5 A;  4DR7 I;  2UXD E;  4DR1 I;  2UUB I;  2BR2 A;  4IFD C;  4ED4 A;  2JT2 A;  2WP8 A;  5K36 F;  4JI5 E;  2V8P A;  3T1Y E;  4IFD E;  4DPX A;  4DXL A;  1XMQ E;  1H73 A;  3WU5 A;  4LCF A;  1VI7 A;  2NN6 E;  1Z0E A;  3HKM A;  2E1R A;  1I94 I;  3K17 A;  1MU5 A;  2VQE I;  2PNZ B;  1N34 I;  4DV3 I;  4LF7 E;  4FW6 A;  4JG4 A;  2LJP A;  1FJG I;  4B3M I;  3OTO E;  1UDQ A;  4JI2 I;  4FW4 A;  3M7N D;  2Z5C B;  2UXB I;  4QNJ A;  4N3O A;  3K85 A;  2PO2 A;  4IFD B;  4NXM I;  2BR2 B;  4FW3 A;  3M6A A;  4DPW A;  1IBM I;  1XNQ I;  3B4T A;  2WP8 B;  4JI3 E;  4DR6 E;  4DUZ I;  2HFU A;  4DV1 E;  4USK A;  4XTJ A;  1N0U A;  2PO0 A;  2O1W A;  2C37 A;  4JI1 E;  3B82 A;  2V2Z A;  4P7A A;  3P3E A;  1J5E I;  2BA1 D;  2VQF E;  3WU6 A;  2R3V A;  5BR8 E;  4LFB E;  4GKJ E;  2IES A;  1HNX E;  4YY3 E;  4DR5 E;  2JEB A;  4JI8 I;  1Z59 A;  2HFS A;  4DUY I;  4PU9 A;  2GO3 A;  1ELO A;  3Q6M A;  1R6M A;  4DV6 E;  5IWA E;  4P52 A;  2PO1 A;  1DAR A;  4JYA E;  4OO1 F;  1R6L A;  5A2Q Q;  4MU4 A;  3J81 C;  4Z7C A;  2O1U A;  5LMU I;  3WU3 A;  5DNL A;  2ZIT A;  1IBL E;  1XNR I;  3P06 A;  2Z5B A;  1E3P A;  2PO0 B;  1N36 E;  2C37 B;  2UUA E;  1Z0T A;  3PYE A;  1N33 I;  1S4E A;  3V5R A;  4B3S E;  1FWK A;  1QZR A;  4JI7 I;  2JEB B;  4MYU A;  5JEA E;  1H74 A;  2WNR A;  1K47 A;  4X64 I;  4EMD A;  4X62 E;  4LFA I;  4AID A;  1RHY A;  2O3Z A;  4FW7 A;  4HY1 A;  4LF4 I;  2PO1 B;  2O1T A;  4WUC A;  4LF8 I;  1ZM3 A;  4B3T I;  1HR0 I;  2V34 A;  2OI2 A;  5LMN I;  3CDJ A;  1KTV A;  2IER A;  4DV4 I;  4OO1 D;  4WUD A;  4DV0 E;  3QT6 A;  4JI6 I;  3P3G A;  2Z5B B;  4LFC E;  1OYP A;  4OKG A;  2C39 A;  2Z5E A;  3PYG A;  4DV2 E;  4DR3 E;  4K0K E;  4X66 E;  2F4V I;  3JAM C;  3CDI A;  2UUC I;  4DU8 A;  4R1F A;  1MG7 A;  1N32 E;  2AE8 A;  3NZK A;  1NHI A;  3GON A;  4RPF A;  2E5L E;  1D6T A;  4DV5 E;  4IFD A;  4JI4 E;  4OX9 I;  1Z0W A;  2WNR B;  4USM A;  3CWV A;  4DR4 E;  2NN6 A;  3J7A G;  2NN6 C;  3P76 A;  3U1Y A;  4LF6 I;  1Z0V A;  4GKK I;  2ZM6 I;  4Z7Y A;  3UHM A;  3T1H E;  4AIM A;  4BA1 A;  4DV7 I;  4NXN E;  4X65 E;  1OYR A;  3K1J A;  2IOP A;  4MDT A;  4B3R I;  1HNZ I;  2C39 B;  5C0X E;  1HNW I;  5K36 C;  3Q6N A;  2Q2E B;  1Y4S A;  1Z0G A;  4DR2 E;  2UXC I;  4AQY E;  2O1V A;  4JI0 E;  4URL A;  4JV5 I;  5IT9 Q;  4LCH A;  1NHH A;  5K36 E;  3LTO A;  2GO4 A;  4HYM A;  3M85 G;  3J80 Q;  1FKA E;  4DR1 E;  4DR7 E;  1KVK A;  1XMO I;  2F1D A;  2UUB E;  1ZXN A;  2HK2 A;  2NN6 B;  1H7S A;  1XXE A;  1H72 C;  4WUB A;  4HAC A;  3P3C A;  4IFD D;  1A6F A;  2R42 A;  5DRP A;  4KHP I;  1NHJ A;  4LF5 I;  2C38 B;  1WUU A;  1YHC A;  4BA2 A;  3LNU A;  1Y5Y A;  2BM1 A;  1E3H A;  2BA0 G;  4BA1 B;  1I94 E;  2VQE E;  1UDN A;  3GLL A;  4PRV A;  1N34 E;  4DV3 E;  4MU0 A;  3ZZT A;  5EKW A;  2VF3 A;  1FJG E;  4B3M E; 
#chains in the Genus database with same CATH homology
 4YHH I;  2X7I A;  4JI2 E;  4DPU A;  3PRY A;  3Q1Q A;  4NXM E;  3H4L A;  1Z0B A;  1U2R A;  1IBM E;  2CG9 A;  1XNQ E;  4LF9 I;  4HAC B;  3HUL A;  4FWG A;  4DUZ E;  5FLX Q;  2X36 A;  1RRE A;  1RR9 A;  1Y4U A;  3B8H A;  4UT4 A;  5LL6 R;  1J5E E;  2BV3 A;  2UU9 I;  4JI8 E;  3ZKD A;  1ZM4 A;  4DUY E;  4KQV A;  1IBK I;  5FWK A;  2HHH I;  5GMD A;  2UXD I;  3QT8 A;  3HJC A;  4DU7 A;  5LMU E;  1XNR E;  1Z5B A;  2BM0 A;  4JI5 I;  3T1Y I;  3B78 A;  1XMQ I;  2XEX A;  2WW4 A;  2EFG A;  1N33 E;  5A2Q C;  1KIJ A;  4ZVI A;  1Z0C A;  1Z5C A;  4JI7 E;  1BKN A;  4X65 I;  1FNM A;  4LF7 I;  4X64 E;  4LFA E;  1B62 A;  2GQ0 A;  2CGE A;  4LF4 E;  3OTO I;  4LF8 E;  4B3T E;  1HR0 E;  5LMN E;  1ZM9 A;  2V2Q A;  2A2C A;  4PRX A;  4DV4 E;  2CZ9 A;  4JI6 E;  3WU4 A;  4JI3 I;  4FN5 A;  4DR6 I;  4DV1 I;  1HK7 A;  3ZM7 A;  2F4V E;  1NZ0 A;  4JI1 I;  1EI1 A;  3J81 Q;  2UUC E;  4IZJ A;  4DPT A;  3ZZU A;  2VQF I;  4DPY A;  4LFB I;  5BR8 I;  1FI4 A;  4GKJ I;  4OX9 E;  1HNX I;  4YY3 I;  4DR5 I;  1S16 A;  4FWH A;  4LF6 E;  4GKK E;  2ZM6 E;  1USV A;  4DV6 I;  5IWA I;  2A2D A;  1VIS A;  4IZK A;  4JYA I;  1ZM2 A;  3V2U C;  3D4J A;  2HKE A;  1PKP A;  3J7A M;  4DV7 E;  1OJ4 A;  1USU A;  4FWD A;  2ZBK B;  4FW9 A;  4B3R E;  2V2V A;  4M1K A;  1HNZ E;  1IBL I;  1HNW E;  1H7U A;  4I3H A;  2UXC E;  1N36 I;  2UXB E;  3LPS A;  4JV5 E;  2UUA I;  1XHK A;  3F0N A;  4IZJ B;  4B3S I;  1B63 A;  1PIE A;  1XMO E;  1ZXM A;  5GME A;  4IZJ D;  1MX0 A;  3PYD A;  4X62 I;  4KHP E;  4IZK B;  4LF5 E;  3JAM Q;  5IT9 C;  3ZKB A;  1UEK A;  2NPF A;  3ZZ0 A;  2GS8 A;  3J80 C;  4UTG A;  2PNL A;  4DV0 I;  4LFC I;  4YHH E;  4DV2 I;  4DR3 I;  4K0K I;  4X66 I;  4MYT A;  1FWL A;  3QT7 A;  1N32 I;  2E5L I;  2HK3 A;  4DV5 I;  4JI4 I;  4LF9 E;  4HXZ A;  1EA6 A;  4DR4 I;  2HKJ A;  1N0V C;  2DEJ A;  2PNM A;  3PYF A;  2AJ4 A;  3T1H I;  5L3J A;  2UU9 E;  4NXN I;  1KKH A;  2J7K A;  2DEI A;  5FLX C;  1Z5A A;  4DR2 I;  1IBK E;  4AQY I;  1PVG A;  4JI0 I;  2IOQ A;  2Z5C A;  1Y6Z A;  2HHH E;  3QT5 A;  4DR7 I;  2UXD E;  4DR1 I;  2UUB I;  4ED4 A;  4JI5 E;  3T1Y E;  2V8P A;  4DPX A;  4DXL A;  1XMQ E;  1H73 A;  3WU5 A;  1Z0E A;  2E1R A;  1I94 I;  3K17 A;  1MU5 A;  2VQE I;  1N34 I;  4DV3 I;  4LF7 E;  4JG4 A;  2LJP A;  1FJG I;  4B3M I;  3OTO E;  4JI2 I;  2Z5C B;  2UXB I;  4N3O A;  3K85 A;  4NXM I;  3M6A A;  4DPW A;  1IBM I;  1XNQ I;  4JI3 E;  4DR6 E;  4DUZ I;  2HFU A;  4DV1 E;  4USK A;  4XTJ A;  1N0U A;  2O1W A;  4JI1 E;  3B82 A;  2V2Z A;  4P7A A;  1J5E I;  2VQF E;  3WU6 A;  2R3V A;  5BR8 E;  4LFB E;  4GKJ E;  1HNX E;  4YY3 E;  4DR5 E;  4JI8 I;  1Z59 A;  2HFS A;  4DUY I;  4PU9 A;  1ELO A;  3Q6M A;  4DV6 E;  5IWA E;  4P52 A;  1DAR A;  4JYA E;  5A2Q Q;  3J81 C;  4Z7C A;  2O1U A;  5LMU I;  3WU3 A;  2ZIT A;  1IBL E;  1XNR I;  3P06 A;  2Z5B A;  1N36 E;  2UUA E;  1Z0T A;  3PYE A;  1N33 I;  1S4E A;  3V5R A;  4B3S E;  1FWK A;  1QZR A;  4JI7 I;  4MYU A;  1H74 A;  1K47 A;  4X64 I;  4EMD A;  4X62 E;  4LFA I;  4HY1 A;  4LF4 I;  2O1T A;  4WUC A;  4LF8 I;  1ZM3 A;  4B3T I;  1HR0 I;  2V34 A;  2OI2 A;  5LMN I;  1KTV A;  4DV4 I;  4WUD A;  4DV0 E;  3QT6 A;  4JI6 I;  2Z5B B;  4LFC E;  3PYG A;  2Z5E A;  4DV2 E;  4DR3 E;  4K0K E;  4X66 E;  2F4V I;  3JAM C;  2UUC I;  4DU8 A;  4R1F A;  1MG7 A;  1N32 E;  1NHI A;  3GON A;  4RPF A;  2E5L E;  1D6T A;  4DV5 E;  4JI4 E;  4OX9 I;  1Z0W A;  4USM A;  3CWV A;  4DR4 E;  3J7A G;  4LF6 I;  1Z0V A;  4GKK I;  2ZM6 I;  4Z7Y A;  3T1H E;  4DV7 I;  4NXN E;  4X65 E;  3K1J A;  2IOP A;  4B3R I;  1HNZ I;  1HNW I;  3Q6N A;  2Q2E B;  1Y4S A;  1Z0G A;  4DR2 E;  2UXC I;  4AQY E;  2O1V A;  4JI0 E;  4URL A;  4JV5 I;  5IT9 Q;  1NHH A;  3LTO A;  4HYM A;  4DR7 E;  3J80 Q;  1FKA E;  4DR1 E;  1KVK A;  1XMO I;  2UUB E;  1ZXN A;  2HK2 A;  1H7S A;  1H72 C;  4WUB A;  4HAC A;  1A6F A;  2R42 A;  4KHP I;  1NHJ A;  4LF5 I;  1WUU A;  3LNU A;  2BM1 A;  1I94 E;  2VQE E;  4PRV A;  1N34 E;  4DV3 E;  3ZZT A;  2VF3 A;  1FJG E;  4B3M E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...