1IBKE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ibkE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibkE02
4WUDA 3JAMQ 2RTXA 4LFBE 4I3HA 2R42A 4JI3I 4X65E 1Z0BA 2LJHA 4LF6I 1HNXE 2UXBE 4X66I 4DU8A 4UT4A 2BM0A 3LLHA 1YYOA 2L33A 2B7TA 5LMNE 1NHHA 4P7AA 1N36I 4UTGA 4JI5I 1Z59A 4DV7E 4X64E 2LUQA 4HY1A 1B62A 1FKAE 1FJGI 5BR8E 2WW4A 4DV5I 2N3GA 4JI8E 3QT6A 4WUBA 5FLXQ 3HTXA 1XNQI 1Z0GA 2VQFI 1N33E 4ED4A 2Q2EB 1UEKA 4MYUA 5IWAI 1QZRA 4FW9A 5A2QQ 1RR9A 4X62E 2B7VA 1H73A 2L2KB 1I94E 4FN5A 3ZM7A 1HR0E 1RC7A 2IHR1 4JI6E 4Z7YA 4DPUA 4JI7E 2UXCI 2EZ6A 4JI0I 1XHKA 1OJ4A 1KKHA 1Z5CA 2NA2A 4LF5I 4B3TE 3J80C 4JV5E 2UXDI 1N34I 2X7IA 4WFTA 4PRVA 1WUUA 2OI2A 2HK2A 2B3TB 2DMYA 4OX9E 4PRXA 4GKKE 1X49A 4B3SE 2UUBE 4LF4I 3PYFA 1NHIA 4DV4I 5IT9Q 3C4BA 5LMUI 2L3JA 4JI2E 3OTOE 1PVGA 4AQYE 3C4TA 1U2RA 2UUCI 2HHHE 4NXNE 5GMDA 2GS8A 2BV3A 4LFBI 2RSMA 4YY3E 2JY9A 2CPNA 4X65I 2XEXA 3F0NA 4DR1E 1ZM9A 1HNXI 2UXBI 5GMEA 4DUYE 4HACA 3K17A 2F4VE 4LF9E 1PKPA 4DR6E 4M30A 3WU3A 4USMA 2RS7A 5LMNI 2LTSA 4HXZA 4GKJE 1D6TA 3B8HA 1RREA 1EKZA 4DV7I 4X64I 3Q1QA 2UUAE 1ZM2A 2LUPB 1ELOA 4DV0E 3J81Q 5BR8I 5FLXC 4ZVIA 3J7Yp 1K47A 4LF7E 1H74A 1S16A 4JI8I 4LF8E 4DPXA 2BM1A 1XNRE 3P1XA 1N33I 1ZM3A 5A2QC 4DUZE 1T4LB 4R1FA 1Z0WA 4YHHE 4X8WA 4X62I 1IBLE 1NZ0A 4EMDA 3LNUA 1I94I 4DXLA 1H7UA 1HR0I 1IBKE 1XMOE 4JI6I 4JI7I 4LFCE 3PYGA 2ZM6E 1T4OA 4KHPE 4DR3E 3J7AG 4DR2E 2VQEE 1N0VC 1S4EA 3HULA 1Z5AA 2J7KA 1KVKA 4JI4E 4XTJA 4B3TI 1DI2A 4OOGC 1XMQE 1PIEA 3V2UC 4JV5I 4DV2E 5LL6R 4DPWA 2E1RA 1STUA 1HNWE 4HYMA 3T1HE 4B3RE 1KTVA 4OX9I 3PYDA 1NHJA 1X48A 4GKKI 2ZITA 4P52A 3ZZ0A 4B3SI 2UUBI 3ADJA 4DV3E 1Z0VA 3T1YE 3J7AM 4DR4E 2DIXA 3QT7A 4DV6E 2DB2A 1N32E 4JI2I 3OTOI 1WHNA 4K0KE 4AQYI 2E5LE 4LFAE 4HACB 2HHHI 4NXNI 4WYQB 3B78A 3LTOA 1DARA 1J5EE 4DR5E 2L2MA 1UHZA 3B82A 4YY3I 3JAMC 2V8PA 3V5RA 3J80Q 3WU4A 3K1JA 4DR1I 2EFGA 4DUYI 2RS6A 2F4VI 4LF9I 4DV1E 1QU6A 3WU5A 4DR6I 4NXME 1BKNA 2UU9E 2LJPA 2JVAA 3ZZUA 1H72C 2V2ZA 3WU6A 1RQ0A 3ZKBA 4DR7E 4GKJI 2LRSA 4M1KA 3J81C 4FWGA 3ADGA 2UUAI 4DKKA 4B3ME 4M2ZA 4WUCA 4DV0I 2R3VA 4LF7I 1FNMA 1VISA 4JI1E 4JYAE 3GONA 4LF8I 2A2DA 2HFUA 1XNRI 3H4LA 2AJ4A 3CWVA 4DUZI 1HNZE 2LTRA 1IBME 1ZXNA 2V2VA 4YHHI 5CFFE 1IBLI 1Z0TA 3M6AA 4JI3E 1T4NA 1GQEA 4LF6E 3ZZTA 1IBKI 4X66E 2L3CA 1XMOI 2NUFA 4LFCI 1Z0EA 2ZM6I 4KHPI 1FI4A 4DR3I 4DR2I 2VQEI 2HKEA 4Z7CA 1N36E 3QT5A 4JI4I 2HFSA 1ZBTA 4JI5E 4PU9A 1MU5A 2CZ9A 1XMQI 1FJGE 4DV2I 3LPSA 3VYYA 4DV5E 1YZ9A 1Z5BA 1A6FA 2ZBKB 1HNWI 3T1HI 4B3RI 1O0WA 1ZXMA 1XNQE 2VQFE 5IWAE 1EI1A 4DV3I 3T1YI 2NUGA 1UILA 3PYEA 2HK3A 2MDRA 4DR4I 1MX0A 1FWLA 2HKJA 5IT9C 1EA6A 4DV6I 1N0UA 1WHQA 1N32I 2LBSB 4DPYA 4K0KI 2NPFA 2E5LI 3D4JA 2VF3A 2NUEA 4LFAI 2UXCE 3ADLA 1J5EI 4DR5I 3VYXA 4JI0E 1YYKA 1H7SA 2A2CA 4LF5E 4JG4A 2KHXA 1Z0CA 3ADIA 4DPTA 1KIJA 4DV1I 3QT8A 2UXDE 5L3JA 1N34E 4NXMI 2DEIA 1MG7A 2UU9I 4USKA 4FWHA 2L2NA 3ZKDA 1FWKA 4DR7I 4MYTA 2N3HA 4B3MI 4LF4E 1YYWA 2DEJA 1B63A 4DV4E 4FWDA 1ZM4A 4KQVA 4JI1I 4DU7A 4RPFA 4JYAI 5LMUE 1X47A 2V34A 4URLA 2V2QA 2X36A 2YT4A 1HNZI 1IBMI 1J26A 2UUCE
chains in the Genus database with same CATH superfamily
4WUDA 2AE8A 4F6NA 3JAMQ 2GPIA 2RTXA 2WZOA 4LFBE 4DMIA 4IS1C 1B69A 2PO0B 4I3HA 2R42A 4JI3I 2EPOA 2MKNA 1YUIA 2Z5BB 4X65E 4DV1I 4LU9A 1Z0BA 4OO1D 2LJHA 4LF6I 1HNXE 2UXBE 4X66I 3M99B 3Q6MA 2NN6B 4R2PA 2JE6A 4DU8A 4UT4A 2V86A 2BM0A 4QNJA 2EPPA 3LLHA 1YYOA 2L33A 4R2AA 2C38A 2B7TA 2C37A 1IQOA 5LMNE 1USVA 1NHHA 1EH6A 4P7AA 1N36I 2EOEA 2EM8A 2G7HA 3HQ1A 2BA1D 4UTGA 4JI5I 1Z59A 4M0VA 2WP8A 4IZJB 4DV7E 2BB8A 4X64E 4BA2B 2PNZA 3CDIA 2LUQA 1B62A 1HK7A 4HY1A 4R2CA 1FKAE 4AIMA 1FJGI 5BR8E 3H09A 2WW4A 2V87A 2YRHA 3VK6A 4DV5I 2PO1A 2N3GA 4JI8E 4OKGA 3QT6A 4WUBA 5DNXA 4MDTA 5FLXQ 2DGCA 3HTXA 2JPAA 2GQ0A 4O43A 4KZSA 5KL6A 1XNQI 1Z0GA 2VQFI 3KZZA 1A1LA 1N33E 4ED4A 2Q2EB 2LO3A 1XXEA 2IERA 1SR9A 1PJQA 1UEKA 4MYUA 5IWAI 1QZRA 4FW9A 5C0XA 3M7NG 2EPRA 2GO4A 2CSHA 4IZKB 3DF6A 3VHTB 1KJKA 1RR9A 4X62E 2YTDA 5A2QQ 2DSYA 1PJTA 2A25A 2B7VA 4I8OA 3KZYA 1H73A 2L2KB 1I94E 1QNTA 4P7DA 1WRJA 3GLLA 2EOXA 4FN5A 1HR0E 3ZM7A 3KWRA 3UHMA 1Y4UA 3H1CA 5JEAC 2BA0G 1RC7A 4MU3A 2V83A 2IHR1 1MGTA 5AC5A 3U1KA 1BB8A 2YU5A 4JI6E 4Z7YA 4FW4A 4DPUA 4JI7E 3NZKA 2Z5CA 2UXCI 2EZ6A 2EN7A 4OO1E 4JI0I 2NN6F 3JTZA 3EPKA 1E3HA 1XHKA 5IXMB 4R8OA 1OJ4A 3PRYA 1KKHA 1Z5CA 2NA2A 4J3DA 5C0XD 4LF5I 3IWBA 4B3TE 4LCGA 1R6MA 4BA1A 1ZAAC 4IS9A 2EMAA 4L8NA 3PS3A 3J80C 4JV5E 2M1SA 2UXDI 1N34I 2X7IA 2JOBA 4WFTA 2MC6A 4PRVA 1WUUA 3M85D 3OMLA 4MLQA 5TSEA 2OI2A 4ZYDA 3HPSA 2HK2A 5KL2A 4OO1B 2WNRB 2B3TB 2DMYA 4BHBA 4OX9E 4PRXA 4GQUA 4Z7CA 4GKKE 2EMFA 1UBDC 2RSIA 1X49A 4R03A 4B3SE 2UUBE 4LF4I 3PYFA 5LLQA 4RH8A 1NHIA 4N3OA 4DV4I 2LCEA 4IFDC 5IT9Q 2KOUA 4LPFA 1EH7A 2EQ1A 3C4BA 3CDJA 2DLQA 4WXDA 5LMUI 2J7JA 2PRTA 1UDNA 2UUCE 2YRMA 2L3JA 2EOYA 5A6KA 4JI2E 3OTOE 3PS1A 5K36C 1PVGA 5K36A 2EMWA 4AQYE 3PS2A 2EOQA 3C4TA 1U2RA 5IV8B 1A1HA 2UUCI 2HHHE 4NXNE 2PO2A 2EORA 2GS8A 2YSPA 2J65A 3K85A 4OZEA 5GMDA 4RHBB 3BBGA 2BV3A 3EPJA 4LFBI 2RSMA 4YY3E 2JY9A 5KL7A 2C37B 2CPNA 4L5NC 3L00A 1Z1BA 4X65I 2XEXA 3F0NA 4DR1E 2EM3A 1ZM9A 1HNXI 2UXBI 5GMEA 2WCC3 2ENAA 4DUYE 1A1IA 2F4VE 2EN1A 2M4IA 2WP8B 3K17A 4LF9E 4HACA 2PNZB 1PKPA 4DR6E 2CG9A 2EMBA 2GO3A 5C0XE 4M30A 3WU3A 3P06A 4R2RA 1JK1A 2JWOA 4USMA 2RS7A 3M85G 5K36D 3MHSC 1UN6B 4FW7A 4HEIA 5LMNI 2LTSA 5JEAA 2EMCA 1AAYA 4GKJE 4HXZA 1D6TA 3B8HA 4NBQA 1RREA 1VI7A 2EN8A 1EKZA 4DV7I 4X64I 3Q1QA 2RPCA 2YWQA 2UUAE 3MSWA 1ZM2A 1X5WA 2LUPB 4ZYHA 1ELOA 4DV0E 3J81Q 4AIDA 5BR8I 2EOIA 5FLXC 4LCFA 3J7Yp 1K47A 4ZVIA 4LF7E 5C0XB 1H74A 1S16A 4JI8I 1PDAA 5ELWA 2F8BA 3UK3C 1E3PA 2YTFA 4LF8E 4DPXA 2EMGA 2BM1A 1XNRE 5DROA 2KONA 3P1XA 1N33I 4LTYA 3AV0A 3DD6A 1ZM3A 1Y6ZA 5A2QC 2VESA 4DUZE 1T4LB 4R1FA 1Z0WA 4YHHE 4X8WA 2JR1A 4N4RB 5ADZA 3AUZA 4X62I 2Z5CB 1DQ3A 2EN2A 2MKDA 2RQLA 1IBLE 2JP9A 1NZ0A 3LNUA 4EMDA 4BC7A 4MQYA 2H36X 1I94I 4NXNI 4DXLA 2K4VA 1H7UA 1HR0I 2GHFA 4GEQB 4TUIA 3TQMA 1IBKE 2Z5BA 2V89A 1XMOE 4JI6I 5EKWA 3L7ZB 2IOQA 4BBYA 2O1WA 4JI7I 1A1GA 4U3DA 2EM4A 4LFCE 3J7AG 2ZM6E 1T4OA 4KHPE 4DR3E 2NN6C 1UDQA 3PYGA 2VRDA 4DR2E 3P3CA 2FGGA 2VQEE 1A1JA 1N0VC 1S4EA 1UDSA 1Z5AA 4WPYA 4WSPA 4R2EA 5KL5A 3HULA 2J7KA 1BBOA 1KVKA 2Z5EA 4U3BA 4JI4E 4XTJA 4F9CB 1DI2A 4B3TI 4KWYA 2JEAA 4OOGC 1XMQE 2IESA 5K36E 1PIEA 2FTXB 2YU8A 3V2UC 4JV5I 3BGHA 4IZJA 2EL5A 4O4KA 2E1MA 4DV2E 4BA2A 5LL6R 2ELYA 3IWCA 2EOSA 4MU1A 2DMIA 4DPWA 2E1RA 1RMDA 1X6HA 2BA1G 1STUA 1TF3A 2BR2A 2LJUA 1HNWE 4HYMA 3T1HE 4B3RE 1KTVA 5C0XF 4OX9I 3PYDA 1NHJA 2YPNA 3P3EA 1X48A 2D9HA 4GKKI 2EPAA 5JEAD 2ZITA 4P52A 2EMHA 3ZZ0A 4B3SI 2UUBI 3U1YA 2LMZA 3ADJA 4DV3E 1Z0VA 3T1YE 1P42A 3J7AM 2LV2A 2YTGA 2YTNA 2CTDA 4IJDA 2EMKA 2M7QA 1G2FC 4DR4E 2DIXA 1ZU1A 4FK5C 4BCAA 5AE1A 4IZJD 3QT7A 1DGCA 3MHHC 4DV6E 2LVHA 2DB2A 5AE3A 4MU0A 1N32E 1Y60A 3OTOI 1WHNA 4JI2I 4IFDA 4K0KE 4AQYI 2E5LE 4WXCA 4O24A 5DRQA 2YTQA 2YTOA 5DRPA 2EPLX 4LFAE 4HACB 2HHHI 2ENHA 2EL4A 4WYQB 2N8XA 2O1VA 1DARA 3B78A 1J5EE 3LTOA 4DR5E 4BHCA 2L2MA 1UHZA 4F6MA 3B82A 4YY3I 3JAMC 2V8PA 2I13A 2JT2A 1F2IG 4FW6A 2M9AA 1MEYC 3V5RA 3J80Q 3WU4A 3K1JA 1TN9A 2EM0A 4J8ZA 2JE6B 4DR1I 2V88A 5KL4A 2YTEA 4F9AB 2EFGA 4DUYI 2RS6A 5DNYA 1Y5YA 2F4VI 4LF9I 4DV1E 1QU6A 3WU5A 4DR6I 3EQ1A 4NXME 1BKNA 1NEIA 2C39A 2MC5A 2L8TA 1RHYA 2UU9E 2C38B 2VE7C 2LJPA 4IFDD 2JVAA 2WBTA 3ZZUA 1H72C 1JK2A 2V2ZA 2ELZA 1RQ0A 2YTIA 2JEBA 3WU6A 3P3GA 3ZKBA 4DR7E 4GKJI 2LE2A 2LRSA 2PNMA 4M1KA 2EPKX 4MLVA 4M9VC 3J81C 4FWGA 3ADGA 1OYSA 2EWLA 2HC5A 4DKKA 4B3ME 2UUAI 2EN3A 4M2ZA 4WUCA 2V8QB 1BBGA 2LT7A 2EQ3A 4DV0I 1L4SA 2PO1B 2R3VA 2ADRA 4LF7I 4OO1F 1FNMA 1VISA 2B9DA 3M7ND 1R6LA 4JI1E 5JEAE 2EM6A 2EMYA 2WBSA 4QNKA 4JYAE 3KRNA 4HTGA 5FWKA 3GONA 2BBGA 3HJCA 2A2DA 2HFUA 4LF8I 1X6FA 1TF6A 3F6GA 1XNRI 4P78A 3H4LA 4ZYGA 2AJ4A 3CWVA 3FIGA 1X3CA 4DUZI 1HNZE 2LTRA 2BA0D 1GZ6A 1IBME 4R2DA 4X9JA 1ZXNA 2V2VA 4YHHI 1WXRA 3RMPA 2EPZA 3BF2A 4WSGA 2GLIA 5CFFE 1IBLI 1Z0TA 2EM2A 3M6AA 4F9BB 5A6AA 2CGEA 3THOB 3EPLA 4JI3E 5JEAB 1OYRA 5DRRA 2EMLA 2EQ0A 1T4NA 1GQEA 2DLKA 4LF6E 3ZZTA 4FW5A 4R2SA 1IBKI 3LMLA 4X66E 2L3CA 1XMOI 2IOPA 4NHRA 3K6QA 3IWDA 2NUFA 4AM3A 2JEAB 5EL9A 2EPXA 4LFCI 3JU0A 1Z0EA 2ZM6I 1FI4A 4DR3I 4KHPI 2R76A 2WBUA 2DRPA 2PO0A 4DR2I 2VQEI 1X6EA 2JYAA 5AE2A 1YHCA 2HKEA 1YPNA 4BA1B 2EM7A 1ZR9A 2ENCA 1N36E 2BR2B 2HFSA 3GMEA 3QT5A 1ZBTA 4JI4I 3DJWA 4JI5E 4PU9A 2EN6A 1MU5A 2CZ9A 2NN6A 1XMQI 2O1TA 1P47A 4IFDE 3EPHA 1LLMC 3C6MA 2EMZA 1FJGE 3HPZA 4DV2I 1IQSA 2I9IA 1T38A 3LPSA 3VYYA 2L92A 4DV5E 1A1KA 1YZ9A 2EP3A 1Z5BA 2O3ZA 3C6KA 3B4TA 1A6FA 4O5GA 2ZBKB 5C0XC 2EOZA 4BS9A 1HNWI 3T1HI 4B3RI 1O0WA 1ZXMA 1XNQE 2VQFE 2EPUA 5AASA 4R2QA 2EM9A 2R1FA 5IWAE 2EM5A 4F2JC 1EI1A 4DV3I 3T1YI 4IFDB 2NUGA 2EOMA 2ODRC 1UILA 1T39A 3PYEA 2EJ4A 2HJJA 2HK3A 2NN6D 2MDRA 3BIDA 1MX0A 4DR4I 1UDOA 1FWLA 3GCMA 2HKJA 5KL3A 5IT9C 1EA6A 4DV6I 1N0UA 1WHQA 2MDGA 2CVEA 4ISAA 1IMUA 5K36B 2EE8A 3QG5C 1OYPA 1N32I 1YUJA 2LBSB 4DPYA 2YTJA 4Q35B 5JEAF 4K0KI 2EMIA 2PO2B 2NPFA 2E5LI 2FV4B 3D4JA 2VF3A 4IZKA 2NUEA 4LFAI 4ZYEA 2UXCE 5DNLA 3ADLA 5T6JA 3L7ZA 1J5EI 4DR5I 3VYXA 2NABA 4JI0E 2C39B 3Q6NA 1YYKA 5AC4A 1H7SA 2Q8UA 2A2CA 1PJSA 1GTKA 1A1FA 4LF5E 2L6MA 1WJPA 4JG4A 2KHXA 2ODRD 2JEBB 1Z0CA 3ADIA 4DPTA 4Q28A 5A6BA 1KIJA 2K7IA 1Y4SA 2EN4A 2YRKA 2UXDE 2V85A 1N34E 2EMXA 3QT8A 2DEIA 5L3JA 4GZNC 1MG7A 4NXMI 2UU9I 4USKA 1N3GA 4TUGA 4FWHA 4MU4A 2CT1A 2L2NA 2VF1A 4WX9A 2E72A 4LCHA 3ZKDA 1YSAC 1SFEA 2EPMX 2HGHA 1FWKA 3ECRA 2EOFA 1YH8A 4DR7I 1ZBQA 1AH5A 5A6JA 4MYTA 2N3HA 5A69A 1KYQA 3THNA 4B3MI 2YZTA 2EOJA 3HKMA 4LF4E 3ZOQB 1YYWA 2DEJA 1B63A 3P76A 2JOXA 3F6HA 4DV4E 4FWDA 1EH8A 2O1UA 2PNLA 2EL6A 2WNRA 4OO1A 4OO1C 1ZM4A 4IFDF 2YSOA 2EPNA 4KQVA 3HXLA 4JI1I 4DU7A 4RPFA 5A6BD 2JXPA 1USUA 5LMUE 4JYAI 4BC9A 5F3WA 1G2DC 1X47A 2F1DA 2V34A 2EOOA 4URLA 1YFHA 2V2QA 2X36A 2EPCA 1NCSA 4NZVA 2NN6E 5K36F 2YT4A 2YTPA 1HNZI 4FW3A 4F54A 1IBMI 1J26A 2EOHA 4LOMA 4BMJA
chains in the Genus database with same CATH topology
4WUDA 3JAMQ 2RTXA 2WZOA 4LFBE 4DMIA 4I3HA 2R42A 4JI3I 2Z5BB 4X65E 4LU9A 1Z0BA 2LJHA 4LF6I 1HNXE 2UXBE 4X66I 3Q6MA 4DU8A 4UT4A 2V86A 2BM0A 3LLHA 1YYOA 2L33A 2B7TA 5LMNE 1USVA 1NHHA 4P7AA 1N36I 2G7HA 3HQ1A 4UTGA 4JI5I 1Z59A 4M0VA 4IZJB 4DV7E 4X64E 2LUQA 1B62A 1HK7A 4HY1A 1FKAE 1FJGI 5BR8E 3H09A 2WW4A 2V87A 3VK6A 4DV5I 2N3GA 4JI8E 3QT6A 4WUBA 5FLXQ 3HTXA 2GQ0A 4KZSA 1XNQI 1Z0GA 2VQFI 1N33E 4ED4A 2Q2EB 1SR9A 1UEKA 4MYUA 5IWAI 1QZRA 4FW9A 4IZKB 3DF6A 5A2QQ 1RR9A 4X62E 2DSYA 2B7VA 4I8OA 1H73A 2L2KB 1I94E 4P7DA 4FN5A 3ZM7A 1HR0E 3KWRA 1Y4UA 1RC7A 2V83A 2IHR1 4JI6E 4Z7YA 4DPUA 4JI7E 2Z5CA 2UXCI 2EZ6A 4JI0I 3JTZA 1XHKA 4R8OA 1OJ4A 3PRYA 1KKHA 1Z5CA 2NA2A 4LF5I 3IWBA 4B3TE 4L8NA 3J80C 4JV5E 2M1SA 2UXDI 1N34I 2X7IA 2JOBA 4WFTA 2MC6A 4PRVA 1WUUA 3OMLA 2OI2A 3HPSA 2HK2A 2B3TB 2DMYA 4OX9E 4PRXA 4GKKE 4R03A 1X49A 4B3SE 2UUBE 4LF4I 3PYFA 1NHIA 4N3OA 4DV4I 5IT9Q 2KOUA 3C4BA 5LMUI 2L3JA 4JI2E 3OTOE 1PVGA 4AQYE 3C4TA 1U2RA 2UUCI 2HHHE 4NXNE 5GMDA 2GS8A 3K85A 2BV3A 4LFBI 2RSMA 4YY3E 2JY9A 2CPNA 4L5NC 4X65I 2XEXA 3F0NA 4DR1E 1ZM9A 1HNXI 2UXBI 5GMEA 4DUYE 4HACA 3K17A 2F4VE 2M4IA 4LF9E 1PKPA 4DR6E 2CG9A 4M30A 3WU3A 3P06A 2JWOA 4USMA 2RS7A 5LMNI 2LTSA 4HXZA 4GKJE 1D6TA 3B8HA 1RREA 1EKZA 4DV7I 4X64I 3Q1QA 2UUAE 3MSWA 1ZM2A 2LUPB 1ELOA 4DV0E 3J81Q 5BR8I 5FLXC 4ZVIA 3J7Yp 1K47A 4LF7E 1H74A 1S16A 4JI8I 2F8BA 4LF8E 4DPXA 2BM1A 1XNRE 2KONA 3P1XA 1N33I 4LTYA 3AV0A 1ZM3A 1Y6ZA 5A2QC 4DUZE 1T4LB 4R1FA 1Z0WA 4YHHE 4X8WA 2JR1A 5ADZA 3AUZA 4X62I 2Z5CB 1DQ3A 1IBLE 1NZ0A 4EMDA 3LNUA 4BC7A 2H36X 1I94I 4DXLA 2K4VA 1H7UA 1HR0I 4GEQB 4TUIA 1IBKE 2Z5BA 2V89A 1XMOE 4JI6I 2IOQA 4BBYA 2O1WA 4JI7I 4LFCE 3J7AG 2ZM6E 1T4OA 4KHPE 4DR3E 3PYGA 4DR2E 2FGGA 2VQEE 1N0VC 1S4EA 3HULA 1Z5AA 4WPYA 4WSPA 2J7KA 1KVKA 2Z5EA 4JI4E 4XTJA 4F9CB 1DI2A 4B3TI 4OOGC 1XMQE 1PIEA 2FTXB 3V2UC 4JV5I 4IZJA 2E1MA 4DV2E 5LL6R 3IWCA 4DPWA 2E1RA 1STUA 1HNWE 4HYMA 3T1HE 4B3RE 1KTVA 4OX9I 3PYDA 1NHJA 1X48A 4GKKI 2ZITA 4P52A 3ZZ0A 4B3SI 2UUBI 2LMZA 3ADJA 4DV3E 1Z0VA 3T1YE 3J7AM 2M7QA 4DR4E 2DIXA 4BCAA 5AE1A 4IZJD 3QT7A 4DV6E 2DB2A 5AE3A 1N32E 4JI2I 3OTOI 1WHNA 4K0KE 4AQYI 2E5LE 4LFAE 4HACB 2HHHI 4NXNI 4WYQB 2O1VA 3B78A 3LTOA 1DARA 1J5EE 4DR5E 2L2MA 1UHZA 3B82A 4YY3I 3JAMC 2V8PA 3V5RA 3J80Q 3WU4A 3K1JA 4J8ZA 4DR1I 2V88A 4F9AB 2EFGA 4DUYI 2RS6A 5DNYA 2F4VI 4LF9I 4DV1E 1QU6A 3WU5A 4DR6I 4NXME 1BKNA 2MC5A 2L8TA 2UU9E 2VE7C 2LJPA 2JVAA 3ZZUA 1H72C 2V2ZA 3WU6A 1RQ0A 3ZKBA 4DR7E 4GKJI 2LE2A 2LRSA 2PNMA 4M1KA 3J81C 4FWGA 3ADGA 2UUAI 2EWLA 4DKKA 4B3ME 4M2ZA 4WUCA 2V8QB 4DV0I 2R3VA 4LF7I 1FNMA 1VISA 2B9DA 4JI1E 4JYAE 5FWKA 3GONA 3HJCA 4LF8I 2A2DA 2HFUA 3F6GA 1XNRI 4P78A 3H4LA 2AJ4A 3CWVA 3FIGA 4DUZI 1HNZE 2LTRA 1IBME 1GZ6A 1ZXNA 2V2VA 4YHHI 1WXRA 3RMPA 5CFFE 1IBLI 1Z0TA 3M6AA 4F9BB 2CGEA 4JI3E 1T4NA 1GQEA 4LF6E 3ZZTA 1IBKI 3LMLA 4X66E 2L3CA 1XMOI 2IOPA 3K6QA 3IWDA 2NUFA 4LFCI 3JU0A 1Z0EA 2ZM6I 1FI4A 4DR3I 4KHPI 4DR2I 2VQEI 5AE2A 2HKEA 4Z7CA 1N36E 3QT5A 4JI4I 2HFSA 1ZBTA 3DJWA 4JI5E 4PU9A 1MU5A 2CZ9A 1XMQI 2O1TA 1FJGE 3HPZA 4DV2I 3LPSA 3VYYA 2L92A 4DV5E 1YZ9A 1Z5BA 1A6FA 2ZBKB 4BS9A 1HNWI 3T1HI 4B3RI 1O0WA 1ZXMA 1XNQE 2VQFE 5AASA 5IWAE 1EI1A 4DV3I 3T1YI 2NUGA 2ODRC 1UILA 3PYEA 2HK3A 2MDRA 4DR4I 1MX0A 1FWLA 2HKJA 5IT9C 1EA6A 4DV6I 1N0UA 1WHQA 1N32I 2LBSB 4DPYA 4K0KI 2NPFA 2E5LI 2FV4B 3D4JA 2VF3A 4IZKA 2NUEA 4LFAI 2UXCE 3ADLA 5T6JA 1J5EI 4DR5I 3VYXA 4JI0E 3Q6NA 1YYKA 1H7SA 2A2CA 4LF5E 2L6MA 4JG4A 2KHXA 2ODRD 1Z0CA 3ADIA 4DPTA 4Q28A 1KIJA 1Y4SA 3QT8A 2UXDE 5L3JA 2V85A 1N34E 4DV1I 4NXMI 2DEIA 1MG7A 2UU9I 4USKA 4TUGA 4FWHA 2L2NA 2VF1A 3ZKDA 1FWKA 4DR7I 1ZBQA 4MYTA 2N3HA 4B3MI 2YZTA 4LF4E 3ZOQB 1YYWA 2DEJA 1B63A 2JOXA 3F6HA 4DV4E 4FWDA 2O1UA 2PNLA 1ZM4A 4KQVA 3HXLA 4JI1I 4DU7A 4RPFA 1USUA 4JYAI 5LMUE 4BC9A 5F3WA 1X47A 2V34A 4URLA 2V2QA 2X36A 2YT4A 1HNZI 4F54A 1IBMI 1J26A 2UUCE 4BMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUD A;  3JAM Q;  2RTX A;  4LFB E;  4I3H A;  2R42 A;  4JI3 I;  4X65 E;  1Z0B A;  2LJH A;  4LF6 I;  1HNX E;  2UXB E;  4X66 I;  4DU8 A;  4UT4 A;  2BM0 A;  3LLH A;  1YYO A;  2L33 A;  2B7T A;  5LMN E;  1NHH A;  4P7A A;  1N36 I;  4UTG A;  4JI5 I;  1Z59 A;  4DV7 E;  4X64 E;  2LUQ A;  4HY1 A;  1B62 A;  1FKA E;  1FJG I;  5BR8 E;  2WW4 A;  4DV5 I;  2N3G A;  4JI8 E;  3QT6 A;  4WUB A;  5FLX Q;  3HTX A;  1XNQ I;  1Z0G A;  2VQF I;  1N33 E;  4ED4 A;  2Q2E B;  1UEK A;  4MYU A;  5IWA I;  1QZR A;  4FW9 A;  5A2Q Q;  1RR9 A;  4X62 E;  2B7V A;  1H73 A;  2L2K B;  1I94 E;  4FN5 A;  3ZM7 A;  1HR0 E;  1RC7 A;  2IHR 1;  4JI6 E;  4Z7Y A;  4DPU A;  4JI7 E;  2UXC I;  2EZ6 A;  4JI0 I;  1XHK A;  1OJ4 A;  1KKH A;  1Z5C A;  2NA2 A;  4LF5 I;  4B3T E;  3J80 C;  4JV5 E;  2UXD I;  1N34 I;  2X7I A;  4WFT A;  4PRV A;  1WUU A;  2OI2 A;  2HK2 A;  2B3T B;  2DMY A;  4OX9 E;  4PRX A;  4GKK E;  1X49 A;  4B3S E;  2UUB E;  4LF4 I;  3PYF A;  1NHI A;  4DV4 I;  5IT9 Q;  3C4B A;  5LMU I;  2L3J A;  4JI2 E;  3OTO E;  1PVG A;  4AQY E;  3C4T A;  1U2R A;  2UUC I;  2HHH E;  4NXN E;  5GMD A;  2GS8 A;  2BV3 A;  4LFB I;  2RSM A;  4YY3 E;  2JY9 A;  2CPN A;  4X65 I;  2XEX A;  3F0N A;  4DR1 E;  1ZM9 A;  1HNX I;  2UXB I;  5GME A;  4DUY E;  4HAC A;  3K17 A;  2F4V E;  4LF9 E;  1PKP A;  4DR6 E;  4M30 A;  3WU3 A;  4USM A;  2RS7 A;  5LMN I;  2LTS A;  4HXZ A;  4GKJ E;  1D6T A;  3B8H A;  1RRE A;  1EKZ A;  4DV7 I;  4X64 I;  3Q1Q A;  2UUA E;  1ZM2 A;  2LUP B;  1ELO A;  4DV0 E;  3J81 Q;  5BR8 I;  5FLX C;  4ZVI A;  3J7Y p;  1K47 A;  4LF7 E;  1H74 A;  1S16 A;  4JI8 I;  4LF8 E;  4DPX A;  2BM1 A;  1XNR E;  3P1X A;  1N33 I;  1ZM3 A;  5A2Q C;  4DUZ E;  1T4L B;  4R1F A;  1Z0W A;  4YHH E;  4X8W A;  4X62 I;  1IBL E;  1NZ0 A;  4EMD A;  3LNU A;  1I94 I;  4DXL A;  1H7U A;  1HR0 I;  1IBK E;  1XMO E;  4JI6 I;  4JI7 I;  4LFC E;  3PYG A;  2ZM6 E;  1T4O A;  4KHP E;  4DR3 E;  3J7A G;  4DR2 E;  2VQE E;  1N0V C;  1S4E A;  3HUL A;  1Z5A A;  2J7K A;  1KVK A;  4JI4 E;  4XTJ A;  4B3T I;  1DI2 A;  4OOG C;  1XMQ E;  1PIE A;  3V2U C;  4JV5 I;  4DV2 E;  5LL6 R;  4DPW A;  2E1R A;  1STU A;  1HNW E;  4HYM A;  3T1H E;  4B3R E;  1KTV A;  4OX9 I;  3PYD A;  1NHJ A;  1X48 A;  4GKK I;  2ZIT A;  4P52 A;  3ZZ0 A;  4B3S I;  2UUB I;  3ADJ A;  4DV3 E;  1Z0V A;  3T1Y E;  3J7A M;  4DR4 E;  2DIX A;  3QT7 A;  4DV6 E;  2DB2 A;  1N32 E;  4JI2 I;  3OTO I;  1WHN A;  4K0K E;  4AQY I;  2E5L E;  4LFA E;  4HAC B;  2HHH I;  4NXN I;  4WYQ B;  3B78 A;  3LTO A;  1DAR A;  1J5E E;  4DR5 E;  2L2M A;  1UHZ A;  3B82 A;  4YY3 I;  3JAM C;  2V8P A;  3V5R A;  3J80 Q;  3WU4 A;  3K1J A;  4DR1 I;  2EFG A;  4DUY I;  2RS6 A;  2F4V I;  4LF9 I;  4DV1 E;  1QU6 A;  3WU5 A;  4DR6 I;  4NXM E;  1BKN A;  2UU9 E;  2LJP A;  2JVA A;  3ZZU A;  1H72 C;  2V2Z A;  3WU6 A;  1RQ0 A;  3ZKB A;  4DR7 E;  4GKJ I;  2LRS A;  4M1K A;  3J81 C;  4FWG A;  3ADG A;  2UUA I;  4DKK A;  4B3M E;  4M2Z A;  4WUC A;  4DV0 I;  2R3V A;  4LF7 I;  1FNM A;  1VIS A;  4JI1 E;  4JYA E;  3GON A;  4LF8 I;  2A2D A;  2HFU A;  1XNR I;  3H4L A;  2AJ4 A;  3CWV A;  4DUZ I;  1HNZ E;  2LTR A;  1IBM E;  1ZXN A;  2V2V A;  4YHH I;  5CFF E;  1IBL I;  1Z0T A;  3M6A A;  4JI3 E;  1T4N A;  1GQE A;  4LF6 E;  3ZZT A;  1IBK I;  4X66 E;  2L3C A;  1XMO I;  2NUF A;  4LFC I;  1Z0E A;  2ZM6 I;  4KHP I;  1FI4 A;  4DR3 I;  4DR2 I;  2VQE I;  2HKE A;  4Z7C A;  1N36 E;  3QT5 A;  4JI4 I;  2HFS A;  1ZBT A;  4JI5 E;  4PU9 A;  1MU5 A;  2CZ9 A;  1XMQ I;  1FJG E;  4DV2 I;  3LPS A;  3VYY A;  4DV5 E;  1YZ9 A;  1Z5B A;  1A6F A;  2ZBK B;  1HNW I;  3T1H I;  4B3R I;  1O0W A;  1ZXM A;  1XNQ E;  2VQF E;  5IWA E;  1EI1 A;  4DV3 I;  3T1Y I;  2NUG A;  1UIL A;  3PYE A;  2HK3 A;  2MDR A;  4DR4 I;  1MX0 A;  1FWL A;  2HKJ A;  5IT9 C;  1EA6 A;  4DV6 I;  1N0U A;  1WHQ A;  1N32 I;  2LBS B;  4DPY A;  4K0K I;  2NPF A;  2E5L I;  3D4J A;  2VF3 A;  2NUE A;  4LFA I;  2UXC E;  3ADL A;  1J5E I;  4DR5 I;  3VYX A;  4JI0 E;  1YYK A;  1H7S A;  2A2C A;  4LF5 E;  4JG4 A;  2KHX A;  1Z0C A;  3ADI A;  4DPT A;  1KIJ A;  4DV1 I;  3QT8 A;  2UXD E;  5L3J A;  1N34 E;  4NXM I;  2DEI A;  1MG7 A;  2UU9 I;  4USK A;  4FWH A;  2L2N A;  3ZKD A;  1FWK A;  4DR7 I;  4MYT A;  2N3H A;  4B3M I;  4LF4 E;  1YYW A;  2DEJ A;  1B63 A;  4DV4 E;  4FWD A;  1ZM4 A;  4KQV A;  4JI1 I;  4DU7 A;  4RPF A;  4JYA I;  5LMU E;  1X47 A;  2V34 A;  4URL A;  2V2Q A;  2X36 A;  2YT4 A;  1HNZ I;  1IBM I;  1J26 A;  2UUC E; 
#chains in the Genus database with same CATH topology
 4WUD A;  2AE8 A;  4F6N A;  3JAM Q;  2GPI A;  2RTX A;  2WZO A;  4LFB E;  4DMI A;  4IS1 C;  1B69 A;  2PO0 B;  4I3H A;  2R42 A;  4JI3 I;  2EPO A;  2MKN A;  1YUI A;  2Z5B B;  4X65 E;  4DV1 I;  4LU9 A;  1Z0B A;  4OO1 D;  2LJH A;  4LF6 I;  1HNX E;  2UXB E;  4X66 I;  3M99 B;  3Q6M A;  2NN6 B;  4R2P A;  2JE6 A;  4DU8 A;  4UT4 A;  2V86 A;  2BM0 A;  4QNJ A;  2EPP A;  3LLH A;  1YYO A;  2L33 A;  4R2A A;  2C38 A;  2B7T A;  2C37 A;  1IQO A;  5LMN E;  1USV A;  1NHH A;  1EH6 A;  4P7A A;  1N36 I;  2EOE A;  2EM8 A;  2G7H A;  3HQ1 A;  2BA1 D;  4UTG A;  4JI5 I;  1Z59 A;  4M0V A;  2WP8 A;  4IZJ B;  4DV7 E;  2BB8 A;  4X64 E;  4BA2 B;  2PNZ A;  3CDI A;  2LUQ A;  1B62 A;  1HK7 A;  4HY1 A;  4R2C A;  1FKA E;  4AIM A;  1FJG I;  5BR8 E;  3H09 A;  2WW4 A;  2V87 A;  2YRH A;  3VK6 A;  4DV5 I;  2PO1 A;  2N3G A;  4JI8 E;  4OKG A;  3QT6 A;  4WUB A;  5DNX A;  4MDT A;  5FLX Q;  2DGC A;  3HTX A;  2JPA A;  2GQ0 A;  4O43 A;  4KZS A;  5KL6 A;  1XNQ I;  1Z0G A;  2VQF I;  3KZZ A;  1A1L A;  1N33 E;  4ED4 A;  2Q2E B;  2LO3 A;  1XXE A;  2IER A;  1SR9 A;  1PJQ A;  1UEK A;  4MYU A;  5IWA I;  1QZR A;  4FW9 A;  5C0X A;  3M7N G;  2EPR A;  2GO4 A;  2CSH A;  4IZK B;  3DF6 A;  3VHT B;  1KJK A;  1RR9 A;  4X62 E;  2YTD A;  5A2Q Q;  2DSY A;  1PJT A;  2A25 A;  2B7V A;  4I8O A;  3KZY A;  1H73 A;  2L2K B;  1I94 E;  1QNT A;  4P7D A;  1WRJ A;  3GLL A;  2EOX A;  4FN5 A;  1HR0 E;  3ZM7 A;  3KWR A;  3UHM A;  1Y4U A;  3H1C A;  5JEA C;  2BA0 G;  1RC7 A;  4MU3 A;  2V83 A;  2IHR 1;  1MGT A;  5AC5 A;  3U1K A;  1BB8 A;  2YU5 A;  4JI6 E;  4Z7Y A;  4FW4 A;  4DPU A;  4JI7 E;  3NZK A;  2Z5C A;  2UXC I;  2EZ6 A;  2EN7 A;  4OO1 E;  4JI0 I;  2NN6 F;  3JTZ A;  3EPK A;  1E3H A;  1XHK A;  5IXM B;  4R8O A;  1OJ4 A;  3PRY A;  1KKH A;  1Z5C A;  2NA2 A;  4J3D A;  5C0X D;  4LF5 I;  3IWB A;  4B3T E;  4LCG A;  1R6M A;  4BA1 A;  1ZAA C;  4IS9 A;  2EMA A;  4L8N A;  3PS3 A;  3J80 C;  4JV5 E;  2M1S A;  2UXD I;  1N34 I;  2X7I A;  2JOB A;  4WFT A;  2MC6 A;  4PRV A;  1WUU A;  3M85 D;  3OML A;  4MLQ A;  5TSE A;  2OI2 A;  4ZYD A;  3HPS A;  2HK2 A;  5KL2 A;  4OO1 B;  2WNR B;  2B3T B;  2DMY A;  4BHB A;  4OX9 E;  4PRX A;  4GQU A;  4Z7C A;  4GKK E;  2EMF A;  1UBD C;  2RSI A;  1X49 A;  4R03 A;  4B3S E;  2UUB E;  4LF4 I;  3PYF A;  5LLQ A;  4RH8 A;  1NHI A;  4N3O A;  4DV4 I;  2LCE A;  4IFD C;  5IT9 Q;  2KOU A;  4LPF A;  1EH7 A;  2EQ1 A;  3C4B A;  3CDJ A;  2DLQ A;  4WXD A;  5LMU I;  2J7J A;  2PRT A;  1UDN A;  2UUC E;  2YRM A;  2L3J A;  2EOY A;  5A6K A;  4JI2 E;  3OTO E;  3PS1 A;  5K36 C;  1PVG A;  5K36 A;  2EMW A;  4AQY E;  3PS2 A;  2EOQ A;  3C4T A;  1U2R A;  5IV8 B;  1A1H A;  2UUC I;  2HHH E;  4NXN E;  2PO2 A;  2EOR A;  2GS8 A;  2YSP A;  2J65 A;  3K85 A;  4OZE A;  5GMD A;  4RHB B;  3BBG A;  2BV3 A;  3EPJ A;  4LFB I;  2RSM A;  4YY3 E;  2JY9 A;  5KL7 A;  2C37 B;  2CPN A;  4L5N C;  3L00 A;  1Z1B A;  4X65 I;  2XEX A;  3F0N A;  4DR1 E;  2EM3 A;  1ZM9 A;  1HNX I;  2UXB I;  5GME A;  2WCC 3;  2ENA A;  4DUY E;  1A1I A;  2F4V E;  2EN1 A;  2M4I A;  2WP8 B;  3K17 A;  4LF9 E;  4HAC A;  2PNZ B;  1PKP A;  4DR6 E;  2CG9 A;  2EMB A;  2GO3 A;  5C0X E;  4M30 A;  3WU3 A;  3P06 A;  4R2R A;  1JK1 A;  2JWO A;  4USM A;  2RS7 A;  3M85 G;  5K36 D;  3MHS C;  1UN6 B;  4FW7 A;  4HEI A;  5LMN I;  2LTS A;  5JEA A;  2EMC A;  1AAY A;  4GKJ E;  4HXZ A;  1D6T A;  3B8H A;  4NBQ A;  1RRE A;  1VI7 A;  2EN8 A;  1EKZ A;  4DV7 I;  4X64 I;  3Q1Q A;  2RPC A;  2YWQ A;  2UUA E;  3MSW A;  1ZM2 A;  1X5W A;  2LUP B;  4ZYH A;  1ELO A;  4DV0 E;  3J81 Q;  4AID A;  5BR8 I;  2EOI A;  5FLX C;  4LCF A;  3J7Y p;  1K47 A;  4ZVI A;  4LF7 E;  5C0X B;  1H74 A;  1S16 A;  4JI8 I;  1PDA A;  5ELW A;  2F8B A;  3UK3 C;  1E3P A;  2YTF A;  4LF8 E;  4DPX A;  2EMG A;  2BM1 A;  1XNR E;  5DRO A;  2KON A;  3P1X A;  1N33 I;  4LTY A;  3AV0 A;  3DD6 A;  1ZM3 A;  1Y6Z A;  5A2Q C;  2VES A;  4DUZ E;  1T4L B;  4R1F A;  1Z0W A;  4YHH E;  4X8W A;  2JR1 A;  4N4R B;  5ADZ A;  3AUZ A;  4X62 I;  2Z5C B;  1DQ3 A;  2EN2 A;  2MKD A;  2RQL A;  1IBL E;  2JP9 A;  1NZ0 A;  3LNU A;  4EMD A;  4BC7 A;  4MQY A;  2H36 X;  1I94 I;  4NXN I;  4DXL A;  2K4V A;  1H7U A;  1HR0 I;  2GHF A;  4GEQ B;  4TUI A;  3TQM A;  1IBK E;  2Z5B A;  2V89 A;  1XMO E;  4JI6 I;  5EKW A;  3L7Z B;  2IOQ A;  4BBY A;  2O1W A;  4JI7 I;  1A1G A;  4U3D A;  2EM4 A;  4LFC E;  3J7A G;  2ZM6 E;  1T4O A;  4KHP E;  4DR3 E;  2NN6 C;  1UDQ A;  3PYG A;  2VRD A;  4DR2 E;  3P3C A;  2FGG A;  2VQE E;  1A1J A;  1N0V C;  1S4E A;  1UDS A;  1Z5A A;  4WPY A;  4WSP A;  4R2E A;  5KL5 A;  3HUL A;  2J7K A;  1BBO A;  1KVK A;  2Z5E A;  4U3B A;  4JI4 E;  4XTJ A;  4F9C B;  1DI2 A;  4B3T I;  4KWY A;  2JEA A;  4OOG C;  1XMQ E;  2IES A;  5K36 E;  1PIE A;  2FTX B;  2YU8 A;  3V2U C;  4JV5 I;  3BGH A;  4IZJ A;  2EL5 A;  4O4K A;  2E1M A;  4DV2 E;  4BA2 A;  5LL6 R;  2ELY A;  3IWC A;  2EOS A;  4MU1 A;  2DMI A;  4DPW A;  2E1R A;  1RMD A;  1X6H A;  2BA1 G;  1STU A;  1TF3 A;  2BR2 A;  2LJU A;  1HNW E;  4HYM A;  3T1H E;  4B3R E;  1KTV A;  5C0X F;  4OX9 I;  3PYD A;  1NHJ A;  2YPN A;  3P3E A;  1X48 A;  2D9H A;  4GKK I;  2EPA A;  5JEA D;  2ZIT A;  4P52 A;  2EMH A;  3ZZ0 A;  4B3S I;  2UUB I;  3U1Y A;  2LMZ A;  3ADJ A;  4DV3 E;  1Z0V A;  3T1Y E;  1P42 A;  3J7A M;  2LV2 A;  2YTG A;  2YTN A;  2CTD A;  4IJD A;  2EMK A;  2M7Q A;  1G2F C;  4DR4 E;  2DIX A;  1ZU1 A;  4FK5 C;  4BCA A;  5AE1 A;  4IZJ D;  3QT7 A;  1DGC A;  3MHH C;  4DV6 E;  2LVH A;  2DB2 A;  5AE3 A;  4MU0 A;  1N32 E;  1Y60 A;  3OTO I;  1WHN A;  4JI2 I;  4IFD A;  4K0K E;  4AQY I;  2E5L E;  4WXC A;  4O24 A;  5DRQ A;  2YTQ A;  2YTO A;  5DRP A;  2EPL X;  4LFA E;  4HAC B;  2HHH I;  2ENH A;  2EL4 A;  4WYQ B;  2N8X A;  2O1V A;  1DAR A;  3B78 A;  1J5E E;  3LTO A;  4DR5 E;  4BHC A;  2L2M A;  1UHZ A;  4F6M A;  3B82 A;  4YY3 I;  3JAM C;  2V8P A;  2I13 A;  2JT2 A;  1F2I G;  4FW6 A;  2M9A A;  1MEY C;  3V5R A;  3J80 Q;  3WU4 A;  3K1J A;  1TN9 A;  2EM0 A;  4J8Z A;  2JE6 B;  4DR1 I;  2V88 A;  5KL4 A;  2YTE A;  4F9A B;  2EFG A;  4DUY I;  2RS6 A;  5DNY A;  1Y5Y A;  2F4V I;  4LF9 I;  4DV1 E;  1QU6 A;  3WU5 A;  4DR6 I;  3EQ1 A;  4NXM E;  1BKN A;  1NEI A;  2C39 A;  2MC5 A;  2L8T A;  1RHY A;  2UU9 E;  2C38 B;  2VE7 C;  2LJP A;  4IFD D;  2JVA A;  2WBT A;  3ZZU A;  1H72 C;  1JK2 A;  2V2Z A;  2ELZ A;  1RQ0 A;  2YTI A;  2JEB A;  3WU6 A;  3P3G A;  3ZKB A;  4DR7 E;  4GKJ I;  2LE2 A;  2LRS A;  2PNM A;  4M1K A;  2EPK X;  4MLV A;  4M9V C;  3J81 C;  4FWG A;  3ADG A;  1OYS A;  2EWL A;  2HC5 A;  4DKK A;  4B3M E;  2UUA I;  2EN3 A;  4M2Z A;  4WUC A;  2V8Q B;  1BBG A;  2LT7 A;  2EQ3 A;  4DV0 I;  1L4S A;  2PO1 B;  2R3V A;  2ADR A;  4LF7 I;  4OO1 F;  1FNM A;  1VIS A;  2B9D A;  3M7N D;  1R6L A;  4JI1 E;  5JEA E;  2EM6 A;  2EMY A;  2WBS A;  4QNK A;  4JYA E;  3KRN A;  4HTG A;  5FWK A;  3GON A;  2BBG A;  3HJC A;  2A2D A;  2HFU A;  4LF8 I;  1X6F A;  1TF6 A;  3F6G A;  1XNR I;  4P78 A;  3H4L A;  4ZYG A;  2AJ4 A;  3CWV A;  3FIG A;  1X3C A;  4DUZ I;  1HNZ E;  2LTR A;  2BA0 D;  1GZ6 A;  1IBM E;  4R2D A;  4X9J A;  1ZXN A;  2V2V A;  4YHH I;  1WXR A;  3RMP A;  2EPZ A;  3BF2 A;  4WSG A;  2GLI A;  5CFF E;  1IBL I;  1Z0T A;  2EM2 A;  3M6A A;  4F9B B;  5A6A A;  2CGE A;  3THO B;  3EPL A;  4JI3 E;  5JEA B;  1OYR A;  5DRR A;  2EML A;  2EQ0 A;  1T4N A;  1GQE A;  2DLK A;  4LF6 E;  3ZZT A;  4FW5 A;  4R2S A;  1IBK I;  3LML A;  4X66 E;  2L3C A;  1XMO I;  2IOP A;  4NHR A;  3K6Q A;  3IWD A;  2NUF A;  4AM3 A;  2JEA B;  5EL9 A;  2EPX A;  4LFC I;  3JU0 A;  1Z0E A;  2ZM6 I;  1FI4 A;  4DR3 I;  4KHP I;  2R76 A;  2WBU A;  2DRP A;  2PO0 A;  4DR2 I;  2VQE I;  1X6E A;  2JYA A;  5AE2 A;  1YHC A;  2HKE A;  1YPN A;  4BA1 B;  2EM7 A;  1ZR9 A;  2ENC A;  1N36 E;  2BR2 B;  2HFS A;  3GME A;  3QT5 A;  1ZBT A;  4JI4 I;  3DJW A;  4JI5 E;  4PU9 A;  2EN6 A;  1MU5 A;  2CZ9 A;  2NN6 A;  1XMQ I;  2O1T A;  1P47 A;  4IFD E;  3EPH A;  1LLM C;  3C6M A;  2EMZ A;  1FJG E;  3HPZ A;  4DV2 I;  1IQS A;  2I9I A;  1T38 A;  3LPS A;  3VYY A;  2L92 A;  4DV5 E;  1A1K A;  1YZ9 A;  2EP3 A;  1Z5B A;  2O3Z A;  3C6K A;  3B4T A;  1A6F A;  4O5G A;  2ZBK B;  5C0X C;  2EOZ A;  4BS9 A;  1HNW I;  3T1H I;  4B3R I;  1O0W A;  1ZXM A;  1XNQ E;  2VQF E;  2EPU A;  5AAS A;  4R2Q A;  2EM9 A;  2R1F A;  5IWA E;  2EM5 A;  4F2J C;  1EI1 A;  4DV3 I;  3T1Y I;  4IFD B;  2NUG A;  2EOM A;  2ODR C;  1UIL A;  1T39 A;  3PYE A;  2EJ4 A;  2HJJ A;  2HK3 A;  2NN6 D;  2MDR A;  3BID A;  1MX0 A;  4DR4 I;  1UDO A;  1FWL A;  3GCM A;  2HKJ A;  5KL3 A;  5IT9 C;  1EA6 A;  4DV6 I;  1N0U A;  1WHQ A;  2MDG A;  2CVE A;  4ISA A;  1IMU A;  5K36 B;  2EE8 A;  3QG5 C;  1OYP A;  1N32 I;  1YUJ A;  2LBS B;  4DPY A;  2YTJ A;  4Q35 B;  5JEA F;  4K0K I;  2EMI A;  2PO2 B;  2NPF A;  2E5L I;  2FV4 B;  3D4J A;  2VF3 A;  4IZK A;  2NUE A;  4LFA I;  4ZYE A;  2UXC E;  5DNL A;  3ADL A;  5T6J A;  3L7Z A;  1J5E I;  4DR5 I;  3VYX A;  2NAB A;  4JI0 E;  2C39 B;  3Q6N A;  1YYK A;  5AC4 A;  1H7S A;  2Q8U A;  2A2C A;  1PJS A;  1GTK A;  1A1F A;  4LF5 E;  2L6M A;  1WJP A;  4JG4 A;  2KHX A;  2ODR D;  2JEB B;  1Z0C A;  3ADI A;  4DPT A;  4Q28 A;  5A6B A;  1KIJ A;  2K7I A;  1Y4S A;  2EN4 A;  2YRK A;  2UXD E;  2V85 A;  1N34 E;  2EMX A;  3QT8 A;  2DEI A;  5L3J A;  4GZN C;  1MG7 A;  4NXM I;  2UU9 I;  4USK A;  1N3G A;  4TUG A;  4FWH A;  4MU4 A;  2CT1 A;  2L2N A;  2VF1 A;  4WX9 A;  2E72 A;  4LCH A;  3ZKD A;  1YSA C;  1SFE A;  2EPM X;  2HGH A;  1FWK A;  3ECR A;  2EOF A;  1YH8 A;  4DR7 I;  1ZBQ A;  1AH5 A;  5A6J A;  4MYT A;  2N3H A;  5A69 A;  1KYQ A;  3THN A;  4B3M I;  2YZT A;  2EOJ A;  3HKM A;  4LF4 E;  3ZOQ B;  1YYW A;  2DEJ A;  1B63 A;  3P76 A;  2JOX A;  3F6H A;  4DV4 E;  4FWD A;  1EH8 A;  2O1U A;  2PNL A;  2EL6 A;  2WNR A;  4OO1 A;  4OO1 C;  1ZM4 A;  4IFD F;  2YSO A;  2EPN A;  4KQV A;  3HXL A;  4JI1 I;  4DU7 A;  4RPF A;  5A6B D;  2JXP A;  1USU A;  5LMU E;  4JYA I;  4BC9 A;  5F3W A;  1G2D C;  1X47 A;  2F1D A;  2V34 A;  2EOO A;  4URL A;  1YFH A;  2V2Q A;  2X36 A;  2EPC A;  1NCS A;  4NZV A;  2NN6 E;  5K36 F;  2YT4 A;  2YTP A;  1HNZ I;  4FW3 A;  4F54 A;  1IBM I;  1J26 A;  2EOH A;  4LOM A;  4BMJ A; 
#chains in the Genus database with same CATH homology
 4WUD A;  3JAM Q;  2RTX A;  2WZO A;  4LFB E;  4DMI A;  4I3H A;  2R42 A;  4JI3 I;  2Z5B B;  4X65 E;  4LU9 A;  1Z0B A;  2LJH A;  4LF6 I;  1HNX E;  2UXB E;  4X66 I;  3Q6M A;  4DU8 A;  4UT4 A;  2V86 A;  2BM0 A;  3LLH A;  1YYO A;  2L33 A;  2B7T A;  5LMN E;  1USV A;  1NHH A;  4P7A A;  1N36 I;  2G7H A;  3HQ1 A;  4UTG A;  4JI5 I;  1Z59 A;  4M0V A;  4IZJ B;  4DV7 E;  4X64 E;  2LUQ A;  1B62 A;  1HK7 A;  4HY1 A;  1FKA E;  1FJG I;  5BR8 E;  3H09 A;  2WW4 A;  2V87 A;  3VK6 A;  4DV5 I;  2N3G A;  4JI8 E;  3QT6 A;  4WUB A;  5FLX Q;  3HTX A;  2GQ0 A;  4KZS A;  1XNQ I;  1Z0G A;  2VQF I;  1N33 E;  4ED4 A;  2Q2E B;  1SR9 A;  1UEK A;  4MYU A;  5IWA I;  1QZR A;  4FW9 A;  4IZK B;  3DF6 A;  5A2Q Q;  1RR9 A;  4X62 E;  2DSY A;  2B7V A;  4I8O A;  1H73 A;  2L2K B;  1I94 E;  4P7D A;  4FN5 A;  3ZM7 A;  1HR0 E;  3KWR A;  1Y4U A;  1RC7 A;  2V83 A;  2IHR 1;  4JI6 E;  4Z7Y A;  4DPU A;  4JI7 E;  2Z5C A;  2UXC I;  2EZ6 A;  4JI0 I;  3JTZ A;  1XHK A;  4R8O A;  1OJ4 A;  3PRY A;  1KKH A;  1Z5C A;  2NA2 A;  4LF5 I;  3IWB A;  4B3T E;  4L8N A;  3J80 C;  4JV5 E;  2M1S A;  2UXD I;  1N34 I;  2X7I A;  2JOB A;  4WFT A;  2MC6 A;  4PRV A;  1WUU A;  3OML A;  2OI2 A;  3HPS A;  2HK2 A;  2B3T B;  2DMY A;  4OX9 E;  4PRX A;  4GKK E;  4R03 A;  1X49 A;  4B3S E;  2UUB E;  4LF4 I;  3PYF A;  1NHI A;  4N3O A;  4DV4 I;  5IT9 Q;  2KOU A;  3C4B A;  5LMU I;  2L3J A;  4JI2 E;  3OTO E;  1PVG A;  4AQY E;  3C4T A;  1U2R A;  2UUC I;  2HHH E;  4NXN E;  5GMD A;  2GS8 A;  3K85 A;  2BV3 A;  4LFB I;  2RSM A;  4YY3 E;  2JY9 A;  2CPN A;  4L5N C;  4X65 I;  2XEX A;  3F0N A;  4DR1 E;  1ZM9 A;  1HNX I;  2UXB I;  5GME A;  4DUY E;  4HAC A;  3K17 A;  2F4V E;  2M4I A;  4LF9 E;  1PKP A;  4DR6 E;  2CG9 A;  4M30 A;  3WU3 A;  3P06 A;  2JWO A;  4USM A;  2RS7 A;  5LMN I;  2LTS A;  4HXZ A;  4GKJ E;  1D6T A;  3B8H A;  1RRE A;  1EKZ A;  4DV7 I;  4X64 I;  3Q1Q A;  2UUA E;  3MSW A;  1ZM2 A;  2LUP B;  1ELO A;  4DV0 E;  3J81 Q;  5BR8 I;  5FLX C;  4ZVI A;  3J7Y p;  1K47 A;  4LF7 E;  1H74 A;  1S16 A;  4JI8 I;  2F8B A;  4LF8 E;  4DPX A;  2BM1 A;  1XNR E;  2KON A;  3P1X A;  1N33 I;  4LTY A;  3AV0 A;  1ZM3 A;  1Y6Z A;  5A2Q C;  4DUZ E;  1T4L B;  4R1F A;  1Z0W A;  4YHH E;  4X8W A;  2JR1 A;  5ADZ A;  3AUZ A;  4X62 I;  2Z5C B;  1DQ3 A;  1IBL E;  1NZ0 A;  4EMD A;  3LNU A;  4BC7 A;  2H36 X;  1I94 I;  4DXL A;  2K4V A;  1H7U A;  1HR0 I;  4GEQ B;  4TUI A;  1IBK E;  2Z5B A;  2V89 A;  1XMO E;  4JI6 I;  2IOQ A;  4BBY A;  2O1W A;  4JI7 I;  4LFC E;  3J7A G;  2ZM6 E;  1T4O A;  4KHP E;  4DR3 E;  3PYG A;  4DR2 E;  2FGG A;  2VQE E;  1N0V C;  1S4E A;  3HUL A;  1Z5A A;  4WPY A;  4WSP A;  2J7K A;  1KVK A;  2Z5E A;  4JI4 E;  4XTJ A;  4F9C B;  1DI2 A;  4B3T I;  4OOG C;  1XMQ E;  1PIE A;  2FTX B;  3V2U C;  4JV5 I;  4IZJ A;  2E1M A;  4DV2 E;  5LL6 R;  3IWC A;  4DPW A;  2E1R A;  1STU A;  1HNW E;  4HYM A;  3T1H E;  4B3R E;  1KTV A;  4OX9 I;  3PYD A;  1NHJ A;  1X48 A;  4GKK I;  2ZIT A;  4P52 A;  3ZZ0 A;  4B3S I;  2UUB I;  2LMZ A;  3ADJ A;  4DV3 E;  1Z0V A;  3T1Y E;  3J7A M;  2M7Q A;  4DR4 E;  2DIX A;  4BCA A;  5AE1 A;  4IZJ D;  3QT7 A;  4DV6 E;  2DB2 A;  5AE3 A;  1N32 E;  4JI2 I;  3OTO I;  1WHN A;  4K0K E;  4AQY I;  2E5L E;  4LFA E;  4HAC B;  2HHH I;  4NXN I;  4WYQ B;  2O1V A;  3B78 A;  3LTO A;  1DAR A;  1J5E E;  4DR5 E;  2L2M A;  1UHZ A;  3B82 A;  4YY3 I;  3JAM C;  2V8P A;  3V5R A;  3J80 Q;  3WU4 A;  3K1J A;  4J8Z A;  4DR1 I;  2V88 A;  4F9A B;  2EFG A;  4DUY I;  2RS6 A;  5DNY A;  2F4V I;  4LF9 I;  4DV1 E;  1QU6 A;  3WU5 A;  4DR6 I;  4NXM E;  1BKN A;  2MC5 A;  2L8T A;  2UU9 E;  2VE7 C;  2LJP A;  2JVA A;  3ZZU A;  1H72 C;  2V2Z A;  3WU6 A;  1RQ0 A;  3ZKB A;  4DR7 E;  4GKJ I;  2LE2 A;  2LRS A;  2PNM A;  4M1K A;  3J81 C;  4FWG A;  3ADG A;  2UUA I;  2EWL A;  4DKK A;  4B3M E;  4M2Z A;  4WUC A;  2V8Q B;  4DV0 I;  2R3V A;  4LF7 I;  1FNM A;  1VIS A;  2B9D A;  4JI1 E;  4JYA E;  5FWK A;  3GON A;  3HJC A;  4LF8 I;  2A2D A;  2HFU A;  3F6G A;  1XNR I;  4P78 A;  3H4L A;  2AJ4 A;  3CWV A;  3FIG A;  4DUZ I;  1HNZ E;  2LTR A;  1IBM E;  1GZ6 A;  1ZXN A;  2V2V A;  4YHH I;  1WXR A;  3RMP A;  5CFF E;  1IBL I;  1Z0T A;  3M6A A;  4F9B B;  2CGE A;  4JI3 E;  1T4N A;  1GQE A;  4LF6 E;  3ZZT A;  1IBK I;  3LML A;  4X66 E;  2L3C A;  1XMO I;  2IOP A;  3K6Q A;  3IWD A;  2NUF A;  4LFC I;  3JU0 A;  1Z0E A;  2ZM6 I;  1FI4 A;  4DR3 I;  4KHP I;  4DR2 I;  2VQE I;  5AE2 A;  2HKE A;  4Z7C A;  1N36 E;  3QT5 A;  4JI4 I;  2HFS A;  1ZBT A;  3DJW A;  4JI5 E;  4PU9 A;  1MU5 A;  2CZ9 A;  1XMQ I;  2O1T A;  1FJG E;  3HPZ A;  4DV2 I;  3LPS A;  3VYY A;  2L92 A;  4DV5 E;  1YZ9 A;  1Z5B A;  1A6F A;  2ZBK B;  4BS9 A;  1HNW I;  3T1H I;  4B3R I;  1O0W A;  1ZXM A;  1XNQ E;  2VQF E;  5AAS A;  5IWA E;  1EI1 A;  4DV3 I;  3T1Y I;  2NUG A;  2ODR C;  1UIL A;  3PYE A;  2HK3 A;  2MDR A;  4DR4 I;  1MX0 A;  1FWL A;  2HKJ A;  5IT9 C;  1EA6 A;  4DV6 I;  1N0U A;  1WHQ A;  1N32 I;  2LBS B;  4DPY A;  4K0K I;  2NPF A;  2E5L I;  2FV4 B;  3D4J A;  2VF3 A;  4IZK A;  2NUE A;  4LFA I;  2UXC E;  3ADL A;  5T6J A;  1J5E I;  4DR5 I;  3VYX A;  4JI0 E;  3Q6N A;  1YYK A;  1H7S A;  2A2C A;  4LF5 E;  2L6M A;  4JG4 A;  2KHX A;  2ODR D;  1Z0C A;  3ADI A;  4DPT A;  4Q28 A;  1KIJ A;  1Y4S A;  3QT8 A;  2UXD E;  5L3J A;  2V85 A;  1N34 E;  4DV1 I;  4NXM I;  2DEI A;  1MG7 A;  2UU9 I;  4USK A;  4TUG A;  4FWH A;  2L2N A;  2VF1 A;  3ZKD A;  1FWK A;  4DR7 I;  1ZBQ A;  4MYT A;  2N3H A;  4B3M I;  2YZT A;  4LF4 E;  3ZOQ B;  1YYW A;  2DEJ A;  1B63 A;  2JOX A;  3F6H A;  4DV4 E;  4FWD A;  2O1U A;  2PNL A;  1ZM4 A;  4KQV A;  3HXL A;  4JI1 I;  4DU7 A;  4RPF A;  1USU A;  4JYA I;  5LMU E;  4BC9 A;  5F3W A;  1X47 A;  2V34 A;  4URL A;  2V2Q A;  2X36 A;  2YT4 A;  1HNZ I;  4F54 A;  1IBM I;  1J26 A;  2UUC E;  4BMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...