1IBKE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ibkE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibkE02
4DU8A 2X36A 4GKJE 1Z5AA 3QT8A 4UTGA 5FLXQ 4JI2E 4USMA 2HHHI 4JV5E 4NXNI 2VQEE 2EFGA 3PYFA 4B3TI 4PRXA 1N32E 3ADJA 2RS7A 5BR8I 5IT9C 4LFAE 4YHHI 1DARA 1ZXMA 1ZM4A 1HNWI 4DUYE 3J80C 2DEJA 1NHHA 2F4VI 2JVAA 2UU9I 1J5EE 1Z0TA 2IHR1 1MU5A 2CPNA 1S4EA 1N34E 1FI4A 2UUBI 2ZM6E 4ZVIA 3WU5A 2UXDI 1KVKA 3LPSA 3ZM7A 2HFSA 2LJHA 3LTOA 1ZM2A 5LMNE 3JAMC 2B7VA 5IWAE 1B63A 4RPFA 1HNXI 5L3JA 1N33I 2UUAE 2LTSA 1KKHA 1ZM3A 4B3ME 4DR4E 1UEKA 1WUUA 3K17A 1Z0VA 1X48A 2NUGA 1XNRI 1VISA 3ADIA 4LF6I 2HHHE 4NXNE 4P52A 4WFTA 1Z59A 4GKKE 2RTXA 2LJPA 3WU4A 5BR8E 2E5LE 3ZZTA 4DXLA 4X62I 1YYOA 5GMEA 4YHHE 2KHXA 1HNWE 2HK2A 2J7KA 1NHJA 4FWGA 1A6FA 4FWHA 2GS8A 4DR1I 4DR6E 1Z0WA 4DV0E 2LRSA 5GMDA 1ZM9A 4LF7E 4DR5I 2UUBE 5FLXC 1PKPA 1N36I 4WYQB 1IBKE 1RREA 3WU3A 1D6TA 1IBMI 3LLHA 2N3GA 2UUCE 2VQFE 3B78A 1DI2A 1T4NA 1RC7A 1STUA 3P1XA 4FWDA 3B8HA 3LNUA 1HNXE 2B7TA 2DIXA 4X64E 1N33E 2R42A 3VYXA 1YZ9A 4UT4A 4K0KE 2E1RA 3C4TA 1J26A 1GQEA 1YYWA 2X7IA 1XNRE 1T4LB 3B82A 2L3CA 4LF6E 2V34A 2LUPB 4Z7CA 2CZ9A 2UXBI 4HXZA 4OOGC 3D4JA 4JI6I 2BM1A 4X62E 4OX9I 4WUDA 3GONA 2NA2A 4X8WA 4DR2I 1XMQI 4DV3I 4WUBA 2A2DA 4DR1E 1HNZE 4FW9A 2MDRA 1H74A 1H72C 4LFBI 4DKKA 1MX0A 3CWVA 4JI4I 1Z0EA 1XNQI 1FKAE 2L2MA 2B3TB 1IBME 3OTOI 3WU6A 2DMYA 4JG4A 4JI5I 2NPFA 4DV7I 4I3HA 1HR0I 1MG7A 2ZBKB 3QT7A 3J81C 4JI0I 1X49A 2L2NA 1K47A 1XMOI 2BV3A 1EI1A 1Z0BA 4DPXA 1N0VC 2HFUA 1NHIA 4LFCI 1Z0CA 2L33A 4X65I 3QT5A 2UXBE 4B3TE 4HACA 4DPTA 1EA6A 1H7UA 1FJGI 1XHKA 4DV2I 2N3HA 2V2QA 2YT4A 4DR2E 1XMQE 4DR7I 4DV3E 4PRVA 4HY1A 3J7AM 4DV6I 4KQVA 4JI3I 2F4VE 2LTRA 4KHPI 4DV1I 4MYTA 2UU9E 3K1JA 4PU9A 4DPYA 1QU6A 2RS6A 4JV5I 4XTJA 4NXMI 4DPWA 1IBLI 1XNQE 2UXDE 4LF4I 1FNMA 2HKJA 1EKZA 4JI1I 4AQYI 3OTOE 3V5RA 4DR3I 4JI5E 3ADLA 1ELOA 1HR0E 5LMUI 1J5EI 2XEXA 4R1FA 4MYUA 2V2VA 1Z5CA 1XMOE 1I94I 2ZM6I 1O0WA 1FWKA 5A2QQ 3ADGA 1Z5BA 4JI8I 2L3JA 4YY3I 4X65E 1OJ4A 2DEIA 1KIJA 2HKEA 3V2UC 4DV4I 1FJGE 3T1HI 4JI7I 2UXCI 4DV2E 1FWLA 5IWAI 4DR7E 1PIEA 3VYYA 2UUAI 4DV6E 1QZRA 4WUCA 4B3RI 4JI3E 4KHPE 1T4OA 2V2ZA 4DR4I 2L2KB 4DV1E 4P7AA 2EZ6A 3F0NA 4DR5E 4GKKI 4NXME 1N36E 1IBLE 2E5LI 4LF8I 1N0UA 2LUQA 4LF4E 2R3VA 4AQYE 4JI1E 3T1YI 3ZZUA 4X66I 2JY9A 4DR3E 3J7Yp 4EMDA 2OI2A 5LMUE 4DR6I 4ED4A 4LF9I 4DV0I 1H7SA 1YYKA 3ZKBA 4LF5I 1U2RA 4LF7I 1I94E 1B62A 1UHZA 1PVGA 1RR9A 1IBKI 4Z7YA 4JI8E 4YY3E 3ZZ0A 2UUCI 2VQFI 1X47A 2NUFA 5IT9Q 4DV4E 3T1HE 4JI6E 4JI7E 2UXCE 4DV5I 1ZBTA 5CFFE 4OX9E 2NUEA 3HULA 1BKNA 4X64I 3J80Q 4JYAI 4DUZI 4B3SI 1WHQA 4K0KI 4B3RE 1Z0GA 4USKA 4GKJI 4M1KA 4HYMA 2WW4A 4HACB 3PYGA 5A2QC 4LFBE 4JI2I 1RQ0A 3PYDA 4M2ZA 2VQEI 4JI4E 1N32I 4LF8E 1KTVA 3M6AA 2DB2A 2BM0A 3T1YE 4LFAI 4X66E 1S16A 3H4LA 3J81Q 1HNZI 3JAMQ 4DUYI 4DV7E 4LF9E 4LF5E 3HTXA 4JI0E 3J7AG 4DU7A 1UILA 3QT6A 1N34I 2VF3A 3Q1QA 4URLA 4FN5A 2LBSB 4DPUA 1NZ0A 4M30A 4LFCE 3PYEA 2HK3A 5LL6R 2AJ4A 2ZITA 5LMNI 4DV5E 1H73A 2Q2EB 1WHNA 3ZKDA 2A2CA 3C4BA 4JYAE 2V8PA 4DUZE 4B3SE 2RSMA 4B3MI 1ZXNA
chains in the Genus database with same CATH superfamily
1GTKA 1N3GA 1PJTA 4DU8A 2X36A 4LCFA 4GKJE 1Z5AA 2WBSA 1IQOA 2O3ZA 3H1CA 3QT8A 4MQYA 2MDGA 4UTGA 1MEYC 3BF2A 5C0XB 2EPZA 5FLXQ 2CTDA 3JU0A 4JI2E 2GHFA 4USMA 4FW5A 2HHHI 2EPLX 2VRDA 4JV5E 3P06A 4NXNI 2VQEE 2EFGA 3PYFA 4B3TI 4PRXA 4BHCA 1N32E 1YUJA 3ADJA 5A6AA 2RS7A 5BR8I 3BIDA 5IT9C 4LFAE 5K36E 4YHHI 3AV0A 3IWBA 1DARA 1ZXMA 1ZM4A 1HNWI 4DUYE 1KYQA 5K36D 3J80C 1G2DC 1L4SA 2IERA 4LF4I 2EQ3A 1F2IG 1NHHA 2DEJA 3C6MA 2F4VI 2YSPA 2JVAA 2Z5EA 4WXDA 4WX9A 4MU0A 2FV4B 1DQ3A 2UU9I 1J5EE 2O1UA 5C0XE 1Z0TA 2IHR1 4BHBA 1ZR9A 1MU5A 2CPNA 3IWCA 1YH8A 3CDIA 1S4EA 1N34E 1FI4A 5DRQA 2UUBI 2GO3A 3GMEA 2ZM6E 4I8OA 3OMLA 3K6QA 4ZVIA 2EMZA 3PS1A 3WU5A 5JEAB 5C0XD 1KVKA 2IOQA 2UXDI 1P47A 3LPSA 2VE7C 4IJDA 3HPZA 2YWQA 1A1JA 1YUIA 3ZM7A 1E3PA 2J7JA 2HFSA 5DRPA 4R03A 1OYPA 2LJHA 5A6KA 1XXEA 1YSAC 3LTOA 1JK2A 4IFDC 1ZM2A 5LMNE 2E1MA 2Z5BA 1USVA 3JAMC 5K36F 2B7VA 4ZYEA 2EN1A 4ZYHA 3MSWA 5A6JA 5IWAE 1B63A 4RPFA 5L3JA 2JYAA 1A1IA 2GPIA 1HNXI 1N33I 2UUAE 2LTSA 1KKHA 1ZM3A 4B3ME 2N8XA 5DROA 1YHCA 3M7NG 3CDJA 3L7ZB 2ENAA 2YU5A 2VESA 5JEAE 4F9CB 2JWOA 3H09A 4DR4E 1UEKA 1WUUA 3K17A 2EE8A 1Z0VA 5KL2A 1X3CA 1X48A 2EPMX 3NZKA 2NUGA 1XNRI 1VISA 2EM4A 5JEAD 3ADIA 4KWYA 2HHHE 2J65A 4LF6I 4NXNE 4P52A 1PJSA 2RSIA 4RHBB 4WFTA 1Z59A 4GKKE 2RTXA 4IFDA 2PNLA 2LJPA 3WU4A 5BR8E 2E5LE 1X6FA 3ZZTA 3EPLA 4DXLA 4R2RA 4X62I 1YYOA 5AASA 2MC6A 5GMEA 4YHHE 2KHXA 2PO1A 2EMLA 4WXCA 3M85G 1HNWE 2EMBA 2HC5A 2HK2A 5AE1A 1RHYA 2VF1A 2EQ0A 4M9VC 1A6FA 1NHJA 1UDOA 2GS8A 2J7KA 4FWHA 4FWGA 2L6MA 5KL7A 4DR6E 3HQ1A 1Z0WA 4HTGA 2R76A 4DV0E 2LRSA 2EOQA 1LLMC 2JR1A 1X6EA 2JOBA 3DD6A 5DRRA 4WSGA 5GMDA 3UHMA 2O1TA 1ZM9A 4LF7E 4DR5I 2UUBE 5FLXC 1PKPA 2LT7A 1N36I 2YZTA 2EPKX 3KWRA 4WSPA 4WYQB 1SR9A 1JK1A 1IBKE 2I13A 1RREA 3PRYA 3WU3A 2GLIA 2LJUA 1TN9A 2EJ4A 2PO0B 2ENHA 4BA1B 1D6TA 3HKMA 4TUIA 1IBMI 4TUGA 1TF3A 2EOJA 3LLHA 2N3GA 2UUCE 2JE6B 2VQFE 2PO2B 4HEIA 3B78A 2GQ0A 5EKWA 2YRHA 4IS1C 5AC4A 1T4NA 2FTXB 5AE3A 1STUA 2ELYA 1RC7A 3P1XA 1DI2A 3JTZA 2NN6C 4LCGA 4FWDA 2WP8A 3B8HA 2EM8A 5K36B 2JPAA 3LNUA 1HNXE 5EL9A 2B7TA 1NCSA 2EN4A 4L5NC 2DIXA 4X64E 2C38A 3M7ND 1N33E 2R42A 3RMPA 3VYXA 1YZ9A 5DNLA 4UT4A 4K0KE 2EMKA 1EH8A 2V86A 5AE2A 4R2PA 2E1RA 4X9JA 3C4TA 1J26A 4BA2A 1GQEA 1YYWA 2X7IA 2EP3A 1XNRE 1T4LB 3B82A 2L3CA 2V85A 4LF6E 1YPNA 4MDTA 3MHHC 2GO4A 2V34A 4RH8A 5KL3A 2M4IA 2LUPB 4ZYDA 3L00A 2C39A 4Z7CA 2CZ9A 2UXBI 1TF6A 4MU1A 4HXZA 4OOGC 2PRTA 2WNRB 3D4JA 2CG9A 4JI6I 4F9BB 2BM1A 4LPFA 4X62E 3M85D 2EORA 4R2QA 2NN6A 4OX9I 4WUDA 3GONA 2NA2A 4O5GA 4F6MA 2EQ1A 1RMDA 1QNTA 4X8WA 4DR2I 1XMQI 2YTJA 4DV3I 1BBOA 2YTGA 5KL6A 4OO1C 4WUBA 2A2DA 4DR1E 1HNZE 5A69A 4QNJA 4M0VA 3PS2A 4FW9A 1EH6A 2C37A 2MDRA 2EPRA 1GZ6A 1H74A 2L8TA 4IFDF 3EQ1A 1H72C 4LFBI 4BBYA 3P3GA 4DKKA 1MX0A 5ADZA 3QG5C 2M7QA 3CWVA 2BB8A 4FW6A 3IWDA 4JI4I 2EOXA 1Z0EA 3B4TA 2ODRC 4R2SA 4MU3A 2EL4A 1XNQI 5KL4A 2O1VA 1T38A 1FKAE 4U3DA 2L2MA 2B3TB 1IBME 1UBDC 3OTOI 4IS9A 2V8QB 2DMYA 3WU6A 2ADRA 2MC5A 4JG4A 4JI5I 2NPFA 2DMIA 2EOEA 2DSYA 4OO1A 4DV7I 5F3WA 2DLKA 2BA0D 4I3HA 1HR0I 2EN7A 3THOB 4DMIA 1MG7A 2ZBKB 3J81C 3QT7A 2IESA 4JI0I 1X49A 1R6MA 2ENCA 2L2NA 4KZSA 4IZJA 4N3OA 2EN2A 1K47A 4IZKB 4B3RI 1XMOI 1Y4UA 2BV3A 1Z1BA 4R2DA 2YSOA 2V83A 1EI1A 1Z0BA 2EPAA 4DPXA 3T1YI 5T6JA 1N0VC 2HFUA 1NHIA 4LFCI 3MHSC 2HJJA 2Z5BB 2DGCA 1Z0CA 2L33A 2L92A 1A1KA 1IQSA 4X65I 4AIDA 2EPOA 2Z5CA 2PNZA 3QT5A 4ZYGA 2UXBE 4B3TE 1BBGA 4HACA 4DPTA 2JT2A 5IXMB 1EA6A 1H7UA 1FJGI 4R2EA 2M9AA 4NBQA 5TSEA 2V89A 3HPSA 1XHKA 4DV2I 2N3HA 2EMCA 2V88A 2V2QA 2YT4A 4DR2E 1XMQE 3HXLA 4DR7I 4DV3E 2EOHA 1E3HA 4PRVA 4HY1A 3J7AM 2EMYA 3THNA 4DV6I 3AUZA 1HK7A 4KQVA 4JI3I 4N4RB 2LTRA 1ZBQA 4O24A 2F4VE 4DV1I 4KHPI 4MLQA 2JEAA 4IFDB 4MYTA 4OZEA 2UU9E 3K1JA 4PU9A 2CT1A 2BR2A 4DPYA 2EOMA 2V87A 4P78A 1QU6A 2NN6F 4F54A 2RS6A 4JV5I 5K36C 2NABA 2EMAA 2YU8A 4XTJA 2PO1B 4O4KA 1UDNA 4NXMI 4DPWA 1IBLI 3KZZA 1XNQE 2BA1D 3U1KA 2UXDE 1BB8A 4J8ZA 2EOFA 2EPXA 2CSHA 1SFEA 3Q6MA 1EH7A 2F8BA 2EMGA 1VI7A 1FNMA 4IZJD 2HKJA 1EKZA 2JEBA 2YTQA 2EOOA 3KZYA 3OTOE 2PNMA 3P3CA 4JI1I 3V5RA 2K7IA 4DR3I 3VK6A 3Q6NA 1DGCA 2YTIA 3K85A 2RQLA 4LTYA 4JI5E 5C0XC 3ADLA 4R2AA 1HR0E 1ELOA 4FW3A 2LMZA 1WRJA 5LMUI 4ISAA 5ELWA 2D9HA 2YTOA 1J5EI 4IFDE 2XEXA 1Y6ZA 2BA0G 4MYUA 1WXRA 4R1FA 3EPKA 3M99B 2K4VA 2WBUA 2V2VA 1OYSA 1Z5CA 1XMOE 1I94I 3ZOQB 2ZM6I 1Y4SA 1O0WA 4R2CA 4IFDD 2ELZA 3DJWA 1FWKA 2EN8A 5A2QQ 2EPCA 3BGHA 4OO1F 3ADGA 1Z5BA 4BS9A 2L3JA 4JI8I 4YY3I 4X65E 2EOZA 2F1DA 1OJ4A 2WP8B 2DEIA 1KIJA 2HKEA 2YRKA 2C38B 2EM3A 3V2UC 4DV4I 1FJGE 5C0XA 3T1HI 2A25A 2EMIA 2EM7A 3DF6A 1YFHA 4L8NA 1G2FC 1B69A 4JI7I 2UXCI 5JEAC 4DV2E 2B9DA 1FWLA 5IWAI 1T39A 4DR7E 1PIEA 2I9IA 4F9AB 3VYYA 2UUAI 2EMWA 4BA2B 2R1FA 3F6GA 2LVHA 4DV6E 2EL5A 3LMLA 1ZU1A 4BC9A 1QZRA 1A1HA 4WUCA 4JI3E 4KHPE 1T4OA 2V2ZA 2DRPA 2L2KB 4DV1E 2C39B 4DR4I 1UN6B 4P7AA 1UDSA 4GZNC 2E72A 2NN6B 2EZ6A 2MKDA 3F0NA 3PS3A 4DR5E 1Y5YA 4FW4A 2EOYA 4GKKI 4NXME 1N36E 1PJQA 1IBLE 4Q35B 2E5LI 4LF8I 2M1SA 5IV8B 1N0UA 2LUQA 3EPJA 4LF4E 2R3VA 2WCC3 4AQYE 4JI1E 4J3DA 3ZZUA 2LV2A 2EOSA 1MGTA 2JY9A 4X66I 4DR3E 2BA1G 5JEAA 4OKGA 3J7Yp 2C37B 1KJKA 4EMDA 2OI2A 2YTDA 5LMUE 3VHTB 1A1FA 3GLLA 4DR6I 2EWLA 3KRNA 4ED4A 4AQYI 5KL5A 4LF9I 4DV0I 1H7SA 1YYKA 3ZKBA 2EM9A 3TQMA 4LF5I 1U2RA 2KONA 4LF7I 1I94E 1AH5A 1B62A 2NN6E 2YRMA 2EMHA 2YPNA 1UHZA 2JP9A 1PVGA 2WZOA 2YTPA 1RR9A 1PDAA 3EPHA 1IBKI 2O1WA 4O43A 4IZKA 4MU4A 2AE8A 1X5WA 4FK5C 2NN6D 5FWKA 4Z7YA 4JI8E 4OO1B 4YY3E 3ZZ0A 3L7ZA 3P76A 2Q8UA 4U3BA 2UUCI 4R8OA 2VQFI 1X47A 5DNYA 2EPUA 2FGGA 3BBGA 3C6KA 2NUFA 4IZJB 5IT9Q 4DV4E 2JXPA 1AAYA 3T1HE 4JI6E 4JI7E 2UXCE 4DV5I 1ZBTA 5CFFE 4QNKA 4OX9E 4DR1I 2EM6A 2NUEA 3HULA 5DNXA 1BKNA 4X64I 3J80Q 4JYAI 2G7HA 4DUZI 5A6BA 4B3SI 2EMXA 1WHQA 4BC7A 3FIGA 2LE2A 4B3RE 1Z0GA 4K0KI 4USKA 4GKJI 2Z5CB 1WJPA 4LU9A 4M1KA 1USUA 2PNZB 4HYMA 2EM5A 2LO3A 4BMJA 4NHRA 2CVEA 2WW4A 4HACB 5C0XF 3PYGA 4OO1E 2DLQA 5A2QC 4LFBE 4JI2I 1A1LA 1RQ0A 3PYDA 1A1GA 4M2ZA 2EL6A 2EM0A 2VQEI 2EM2A 2LCEA 4JI4E 2CGEA 4OO1D 1N32I 4LCHA 4LF8E 1KTVA 3M6AA 2DB2A 4GQUA 2BM0A 3T1YE 1P42A 4AIMA 4LFAI 2EPNA 4X66E 1IMUA 1S16A 3H4LA 5LLQA 2YTEA 3J81Q 2JEAB 1X6HA 1HNZI 3JAMQ 4DUYI 2BR2B 2PO0A 4BA1A 4DV7E 2EOIA 4LF9E 2ODRD 2HGHA 2MKNA 1UDQA 2KOUA 4LF5E 3HTXA 2JE6A 2RPCA 4JI0E 2PO2A 5AC5A 3F6HA 1R6LA 4FW7A 3P3EA 3J7AG 4DU7A 1UILA 3QT6A 1N34I 2JEBB 2VF3A 3Q1QA 4URLA 5JEAF 4FN5A 5K36A 4MLVA 2LBSB 4DPUA 2H36X 1NZ0A 2EPPA 4GEQB 2EN3A 2EMFA 2YTFA 4M30A 4LFCE 4WPYA 3ECRA 3PYEA 2HK3A 3U1YA 4Q28A 2WBTA 5LL6R 5A6BD 3GCMA 4LOMA 4F6NA 2AJ4A 2EN6A 2ZITA 5LMNI 4P7DA 4DV5E 4AM3A 1H73A 2Q2EB 3UK3C 2YTNA 1WHNA 1ZAAC 1OYRA 2IOPA 3ZKDA 2A2CA 3HJCA 3C4BA 2BBGA 4NZVA 4BCAA 4F2JC 4JYAE 2V8PA 1Y60A 4DUZE 2WNRA 1NEIA 2JOXA 4B3SE 2RSMA 4B3MI 1ZXNA
chains in the Genus database with same CATH topology
4DU8A 2X36A 4GKJE 1Z5AA 3QT8A 4UTGA 5FLXQ 4JI2E 3JU0A 4USMA 2HHHI 4JV5E 3P06A 4NXNI 2VQEE 2EFGA 3PYFA 4B3TI 4PRXA 1N32E 3ADJA 2RS7A 5BR8I 5IT9C 4LFAE 4YHHI 3AV0A 3IWBA 1DARA 1ZXMA 1ZM4A 1HNWI 4DUYE 3J80C 2DEJA 1NHHA 2F4VI 2JVAA 2Z5EA 2FV4B 1DQ3A 2UU9I 1J5EE 2O1UA 1Z0TA 2IHR1 1MU5A 2CPNA 3IWCA 1S4EA 1N34E 1FI4A 2UUBI 2ZM6E 4I8OA 3OMLA 3K6QA 4ZVIA 3WU5A 2UXDI 1KVKA 2IOQA 3LPSA 2VE7C 3HPZA 3ZM7A 2HFSA 4R03A 2LJHA 3LTOA 1ZM2A 5LMNE 2E1MA 2Z5BA 1USVA 3JAMC 2B7VA 3MSWA 5IWAE 1B63A 4RPFA 1HNXI 5L3JA 1N33I 2UUAE 2LTSA 1KKHA 1ZM3A 4B3ME 4F9CB 2JWOA 3H09A 4DR4E 1UEKA 1WUUA 3K17A 1Z0VA 1X48A 2NUGA 1XNRI 1VISA 3ADIA 4LF6I 2HHHE 4NXNE 4P52A 4WFTA 1Z59A 4GKKE 2RTXA 2PNLA 2LJPA 3WU4A 5BR8E 2E5LE 3ZZTA 4DXLA 4X62I 1YYOA 5AASA 2MC6A 5GMEA 4YHHE 2KHXA 1HNWE 2HK2A 5AE1A 2VF1A 1NHJA 2J7KA 1A6FA 4FWHA 2GS8A 4FWGA 4DR1I 2L6MA 4DR6E 3HQ1A 1Z0WA 4DV0E 2LRSA 2JR1A 2JOBA 5GMDA 2O1TA 1ZM9A 4LF7E 4DR5I 2UUBE 5FLXC 1PKPA 1N36I 2YZTA 3KWRA 4WSPA 4WYQB 1SR9A 1IBKE 1RREA 3WU3A 3PRYA 1D6TA 4TUIA 1IBMI 4TUGA 3LLHA 2N3GA 2UUCE 2VQFE 3B78A 2GQ0A 1DI2A 1T4NA 2FTXB 5AE3A 1STUA 1RC7A 3P1XA 3JTZA 4FWDA 3B8HA 3LNUA 1HNXE 2B7TA 4L5NC 2DIXA 4X64E 1N33E 2R42A 3RMPA 3VYXA 1YZ9A 4UT4A 4K0KE 2V86A 5AE2A 2E1RA 1J26A 3C4TA 1GQEA 1YYWA 2X7IA 1XNRE 1T4LB 3B82A 2L3CA 2V85A 4LF6E 2V34A 2LUPB 2M4IA 4Z7CA 2CZ9A 2UXBI 4HXZA 4OOGC 3D4JA 2CG9A 4JI6I 4F9BB 2BM1A 4X62E 4OX9I 4WUDA 3GONA 2NA2A 4X8WA 4DR2I 1XMQI 4DV3I 4WUBA 2A2DA 4DR1E 1HNZE 4M0VA 4FW9A 2MDRA 1H74A 1GZ6A 2L8TA 1H72C 4LFBI 4BBYA 4DKKA 1MX0A 5ADZA 2M7QA 3CWVA 3IWDA 4JI4I 1Z0EA 2ODRC 1XNQI 2O1VA 1FKAE 2L2MA 2B3TB 1IBME 3OTOI 3WU6A 2V8QB 2DMYA 2MC5A 4JG4A 4JI5I 2NPFA 4DV7I 2DSYA 5F3WA 4I3HA 1HR0I 4DMIA 1MG7A 2ZBKB 3J81C 3QT7A 4JI0I 1X49A 2L2NA 4KZSA 4IZJA 4N3OA 1K47A 4IZKB 1XMOI 1Y4UA 2BV3A 1EI1A 2V83A 1Z0BA 4DPXA 5T6JA 1N0VC 2HFUA 1NHIA 4LFCI 2Z5BB 1Z0CA 2L33A 2L92A 4X65I 2Z5CA 3QT5A 2UXBE 4B3TE 4HACA 4DPTA 1EA6A 1H7UA 1FJGI 2V89A 3HPSA 1XHKA 4DV2I 2N3HA 2V88A 2V2QA 2YT4A 4DR2E 1XMQE 3HXLA 4DR7I 4DV3E 4PRVA 4HY1A 3J7AM 4DV6I 3AUZA 1HK7A 4KQVA 4JI3I 2F4VE 2LTRA 1ZBQA 4KHPI 4DV1I 4MYTA 2UU9E 3K1JA 4PU9A 4DPYA 2V87A 4P78A 1QU6A 4F54A 2RS6A 4JV5I 4XTJA 4NXMI 4DPWA 1IBLI 1XNQE 2UXDE 4J8ZA 3Q6MA 2F8BA 4IZJD 1FNMA 4LF4I 2HKJA 1EKZA 4JI1I 2PNMA 4AQYI 3OTOE 3V5RA 4DR3I 3VK6A 3Q6NA 3K85A 4LTYA 4JI5E 1ELOA 3ADLA 1HR0E 2LMZA 5LMUI 1J5EI 2XEXA 1Y6ZA 4R1FA 4MYUA 1WXRA 2K4VA 2V2VA 1Z5CA 1XMOE 1I94I 3ZOQB 2ZM6I 1Y4SA 1O0WA 3DJWA 1FWKA 5A2QQ 3ADGA 1Z5BA 4BS9A 2L3JA 4JI8I 4YY3I 4X65E 1OJ4A 2DEIA 1KIJA 2HKEA 3V2UC 4DV4I 1FJGE 3T1HI 3DF6A 4JI7I 2UXCI 4L8NA 4DV2E 2B9DA 1FWLA 5IWAI 4DR7E 1PIEA 4F9AB 3VYYA 2UUAI 3F6GA 4DV6E 3LMLA 4BC9A 1QZRA 4WUCA 4B3RI 4JI3E 4KHPE 1T4OA 2V2ZA 4DR4I 2L2KB 4DV1E 4P7AA 2EZ6A 3F0NA 4DR5E 4GKKI 4NXME 1N36E 1IBLE 2E5LI 4LF8I 2M1SA 1N0UA 2LUQA 4LF4E 2R3VA 4AQYE 4JI1E 3T1YI 3ZZUA 4X66I 2JY9A 4DR3E 3J7Yp 4EMDA 2OI2A 5LMUE 4DR6I 2EWLA 4ED4A 4LF9I 4DV0I 1H7SA 1YYKA 3ZKBA 4LF5I 1U2RA 2KONA 4LF7I 1I94E 1B62A 1UHZA 1PVGA 2WZOA 1RR9A 1IBKI 2O1WA 4IZKA 5FWKA 4Z7YA 4JI8E 4YY3E 3ZZ0A 2UUCI 4R8OA 2VQFI 1X47A 5DNYA 2NUFA 2FGGA 5IT9Q 4IZJB 4DV4E 3T1HE 4JI6E 4JI7E 2UXCE 4DV5I 1ZBTA 5CFFE 4OX9E 2NUEA 3HULA 1BKNA 4X64I 3J80Q 4JYAI 2G7HA 4DUZI 4B3SI 1WHQA 4BC7A 3FIGA 2LE2A 4B3RE 1Z0GA 4K0KI 4USKA 4GKJI 2Z5CB 4LU9A 4M1KA 1USUA 4HYMA 4BMJA 2WW4A 4HACB 3PYGA 5A2QC 4LFBE 4JI2I 1RQ0A 3PYDA 4M2ZA 2VQEI 4JI4E 2CGEA 1N32I 4LF8E 1KTVA 3M6AA 2DB2A 2BM0A 3T1YE 4LFAI 4X66E 1S16A 3H4LA 3J81Q 1HNZI 3JAMQ 4DUYI 4DV7E 4LF9E 2ODRD 2KOUA 4LF5E 3HTXA 4JI0E 3F6HA 3J7AG 4DU7A 1UILA 3QT6A 1N34I 2VF3A 3Q1QA 4URLA 4FN5A 2LBSB 4DPUA 2H36X 1NZ0A 4GEQB 4M30A 4LFCE 4WPYA 3PYEA 2HK3A 4Q28A 5LL6R 2AJ4A 2ZITA 5LMNI 4P7DA 4DV5E 1H73A 2Q2EB 1WHNA 3ZKDA 2IOPA 2A2CA 3HJCA 3C4BA 4BCAA 4JYAE 2V8PA 4DUZE 2JOXA 4B3SE 2RSMA 4B3MI 1ZXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DU8 A;  2X36 A;  4GKJ E;  1Z5A A;  3QT8 A;  4UTG A;  5FLX Q;  4JI2 E;  4USM A;  2HHH I;  4JV5 E;  4NXN I;  2VQE E;  2EFG A;  3PYF A;  4B3T I;  4PRX A;  1N32 E;  3ADJ A;  2RS7 A;  5BR8 I;  5IT9 C;  4LFA E;  4YHH I;  1DAR A;  1ZXM A;  1ZM4 A;  1HNW I;  4DUY E;  3J80 C;  2DEJ A;  1NHH A;  2F4V I;  2JVA A;  2UU9 I;  1J5E E;  1Z0T A;  2IHR 1;  1MU5 A;  2CPN A;  1S4E A;  1N34 E;  1FI4 A;  2UUB I;  2ZM6 E;  4ZVI A;  3WU5 A;  2UXD I;  1KVK A;  3LPS A;  3ZM7 A;  2HFS A;  2LJH A;  3LTO A;  1ZM2 A;  5LMN E;  3JAM C;  2B7V A;  5IWA E;  1B63 A;  4RPF A;  1HNX I;  5L3J A;  1N33 I;  2UUA E;  2LTS A;  1KKH A;  1ZM3 A;  4B3M E;  4DR4 E;  1UEK A;  1WUU A;  3K17 A;  1Z0V A;  1X48 A;  2NUG A;  1XNR I;  1VIS A;  3ADI A;  4LF6 I;  2HHH E;  4NXN E;  4P52 A;  4WFT A;  1Z59 A;  4GKK E;  2RTX A;  2LJP A;  3WU4 A;  5BR8 E;  2E5L E;  3ZZT A;  4DXL A;  4X62 I;  1YYO A;  5GME A;  4YHH E;  2KHX A;  1HNW E;  2HK2 A;  2J7K A;  1NHJ A;  4FWG A;  1A6F A;  4FWH A;  2GS8 A;  4DR1 I;  4DR6 E;  1Z0W A;  4DV0 E;  2LRS A;  5GMD A;  1ZM9 A;  4LF7 E;  4DR5 I;  2UUB E;  5FLX C;  1PKP A;  1N36 I;  4WYQ B;  1IBK E;  1RRE A;  3WU3 A;  1D6T A;  1IBM I;  3LLH A;  2N3G A;  2UUC E;  2VQF E;  3B78 A;  1DI2 A;  1T4N A;  1RC7 A;  1STU A;  3P1X A;  4FWD A;  3B8H A;  3LNU A;  1HNX E;  2B7T A;  2DIX A;  4X64 E;  1N33 E;  2R42 A;  3VYX A;  1YZ9 A;  4UT4 A;  4K0K E;  2E1R A;  3C4T A;  1J26 A;  1GQE A;  1YYW A;  2X7I A;  1XNR E;  1T4L B;  3B82 A;  2L3C A;  4LF6 E;  2V34 A;  2LUP B;  4Z7C A;  2CZ9 A;  2UXB I;  4HXZ A;  4OOG C;  3D4J A;  4JI6 I;  2BM1 A;  4X62 E;  4OX9 I;  4WUD A;  3GON A;  2NA2 A;  4X8W A;  4DR2 I;  1XMQ I;  4DV3 I;  4WUB A;  2A2D A;  4DR1 E;  1HNZ E;  4FW9 A;  2MDR A;  1H74 A;  1H72 C;  4LFB I;  4DKK A;  1MX0 A;  3CWV A;  4JI4 I;  1Z0E A;  1XNQ I;  1FKA E;  2L2M A;  2B3T B;  1IBM E;  3OTO I;  3WU6 A;  2DMY A;  4JG4 A;  4JI5 I;  2NPF A;  4DV7 I;  4I3H A;  1HR0 I;  1MG7 A;  2ZBK B;  3QT7 A;  3J81 C;  4JI0 I;  1X49 A;  2L2N A;  1K47 A;  1XMO I;  2BV3 A;  1EI1 A;  1Z0B A;  4DPX A;  1N0V C;  2HFU A;  1NHI A;  4LFC I;  1Z0C A;  2L33 A;  4X65 I;  3QT5 A;  2UXB E;  4B3T E;  4HAC A;  4DPT A;  1EA6 A;  1H7U A;  1FJG I;  1XHK A;  4DV2 I;  2N3H A;  2V2Q A;  2YT4 A;  4DR2 E;  1XMQ E;  4DR7 I;  4DV3 E;  4PRV A;  4HY1 A;  3J7A M;  4DV6 I;  4KQV A;  4JI3 I;  2F4V E;  2LTR A;  4KHP I;  4DV1 I;  4MYT A;  2UU9 E;  3K1J A;  4PU9 A;  4DPY A;  1QU6 A;  2RS6 A;  4JV5 I;  4XTJ A;  4NXM I;  4DPW A;  1IBL I;  1XNQ E;  2UXD E;  4LF4 I;  1FNM A;  2HKJ A;  1EKZ A;  4JI1 I;  4AQY I;  3OTO E;  3V5R A;  4DR3 I;  4JI5 E;  3ADL A;  1ELO A;  1HR0 E;  5LMU I;  1J5E I;  2XEX A;  4R1F A;  4MYU A;  2V2V A;  1Z5C A;  1XMO E;  1I94 I;  2ZM6 I;  1O0W A;  1FWK A;  5A2Q Q;  3ADG A;  1Z5B A;  4JI8 I;  2L3J A;  4YY3 I;  4X65 E;  1OJ4 A;  2DEI A;  1KIJ A;  2HKE A;  3V2U C;  4DV4 I;  1FJG E;  3T1H I;  4JI7 I;  2UXC I;  4DV2 E;  1FWL A;  5IWA I;  4DR7 E;  1PIE A;  3VYY A;  2UUA I;  4DV6 E;  1QZR A;  4WUC A;  4B3R I;  4JI3 E;  4KHP E;  1T4O A;  2V2Z A;  4DR4 I;  2L2K B;  4DV1 E;  4P7A A;  2EZ6 A;  3F0N A;  4DR5 E;  4GKK I;  4NXM E;  1N36 E;  1IBL E;  2E5L I;  4LF8 I;  1N0U A;  2LUQ A;  4LF4 E;  2R3V A;  4AQY E;  4JI1 E;  3T1Y I;  3ZZU A;  4X66 I;  2JY9 A;  4DR3 E;  3J7Y p;  4EMD A;  2OI2 A;  5LMU E;  4DR6 I;  4ED4 A;  4LF9 I;  4DV0 I;  1H7S A;  1YYK A;  3ZKB A;  4LF5 I;  1U2R A;  4LF7 I;  1I94 E;  1B62 A;  1UHZ A;  1PVG A;  1RR9 A;  1IBK I;  4Z7Y A;  4JI8 E;  4YY3 E;  3ZZ0 A;  2UUC I;  2VQF I;  1X47 A;  2NUF A;  5IT9 Q;  4DV4 E;  3T1H E;  4JI6 E;  4JI7 E;  2UXC E;  4DV5 I;  1ZBT A;  5CFF E;  4OX9 E;  2NUE A;  3HUL A;  1BKN A;  4X64 I;  3J80 Q;  4JYA I;  4DUZ I;  4B3S I;  1WHQ A;  4K0K I;  4B3R E;  1Z0G A;  4USK A;  4GKJ I;  4M1K A;  4HYM A;  2WW4 A;  4HAC B;  3PYG A;  5A2Q C;  4LFB E;  4JI2 I;  1RQ0 A;  3PYD A;  4M2Z A;  2VQE I;  4JI4 E;  1N32 I;  4LF8 E;  1KTV A;  3M6A A;  2DB2 A;  2BM0 A;  3T1Y E;  4LFA I;  4X66 E;  1S16 A;  3H4L A;  3J81 Q;  1HNZ I;  3JAM Q;  4DUY I;  4DV7 E;  4LF9 E;  4LF5 E;  3HTX A;  4JI0 E;  3J7A G;  4DU7 A;  1UIL A;  3QT6 A;  1N34 I;  2VF3 A;  3Q1Q A;  4URL A;  4FN5 A;  2LBS B;  4DPU A;  1NZ0 A;  4M30 A;  4LFC E;  3PYE A;  2HK3 A;  5LL6 R;  2AJ4 A;  2ZIT A;  5LMN I;  4DV5 E;  1H73 A;  2Q2E B;  1WHN A;  3ZKD A;  2A2C A;  3C4B A;  4JYA E;  2V8P A;  4DUZ E;  4B3S E;  2RSM A;  4B3M I;  1ZXN A; 
#chains in the Genus database with same CATH topology
 1GTK A;  1N3G A;  1PJT A;  4DU8 A;  2X36 A;  4LCF A;  4GKJ E;  1Z5A A;  2WBS A;  1IQO A;  2O3Z A;  3H1C A;  3QT8 A;  4MQY A;  2MDG A;  4UTG A;  1MEY C;  3BF2 A;  5C0X B;  2EPZ A;  5FLX Q;  2CTD A;  3JU0 A;  4JI2 E;  2GHF A;  4USM A;  4FW5 A;  2HHH I;  2EPL X;  2VRD A;  4JV5 E;  3P06 A;  4NXN I;  2VQE E;  2EFG A;  3PYF A;  4B3T I;  4PRX A;  4BHC A;  1N32 E;  1YUJ A;  3ADJ A;  5A6A A;  2RS7 A;  5BR8 I;  3BID A;  5IT9 C;  4LFA E;  5K36 E;  4YHH I;  3AV0 A;  3IWB A;  1DAR A;  1ZXM A;  1ZM4 A;  1HNW I;  4DUY E;  1KYQ A;  5K36 D;  3J80 C;  1G2D C;  1L4S A;  2IER A;  4LF4 I;  2EQ3 A;  1F2I G;  1NHH A;  2DEJ A;  3C6M A;  2F4V I;  2YSP A;  2JVA A;  2Z5E A;  4WXD A;  4WX9 A;  4MU0 A;  2FV4 B;  1DQ3 A;  2UU9 I;  1J5E E;  2O1U A;  5C0X E;  1Z0T A;  2IHR 1;  4BHB A;  1ZR9 A;  1MU5 A;  2CPN A;  3IWC A;  1YH8 A;  3CDI A;  1S4E A;  1N34 E;  1FI4 A;  5DRQ A;  2UUB I;  2GO3 A;  3GME A;  2ZM6 E;  4I8O A;  3OML A;  3K6Q A;  4ZVI A;  2EMZ A;  3PS1 A;  3WU5 A;  5JEA B;  5C0X D;  1KVK A;  2IOQ A;  2UXD I;  1P47 A;  3LPS A;  2VE7 C;  4IJD A;  3HPZ A;  2YWQ A;  1A1J A;  1YUI A;  3ZM7 A;  1E3P A;  2J7J A;  2HFS A;  5DRP A;  4R03 A;  1OYP A;  2LJH A;  5A6K A;  1XXE A;  1YSA C;  3LTO A;  1JK2 A;  4IFD C;  1ZM2 A;  5LMN E;  2E1M A;  2Z5B A;  1USV A;  3JAM C;  5K36 F;  2B7V A;  4ZYE A;  2EN1 A;  4ZYH A;  3MSW A;  5A6J A;  5IWA E;  1B63 A;  4RPF A;  5L3J A;  2JYA A;  1A1I A;  2GPI A;  1HNX I;  1N33 I;  2UUA E;  2LTS A;  1KKH A;  1ZM3 A;  4B3M E;  2N8X A;  5DRO A;  1YHC A;  3M7N G;  3CDJ A;  3L7Z B;  2ENA A;  2YU5 A;  2VES A;  5JEA E;  4F9C B;  2JWO A;  3H09 A;  4DR4 E;  1UEK A;  1WUU A;  3K17 A;  2EE8 A;  1Z0V A;  5KL2 A;  1X3C A;  1X48 A;  2EPM X;  3NZK A;  2NUG A;  1XNR I;  1VIS A;  2EM4 A;  5JEA D;  3ADI A;  4KWY A;  2HHH E;  2J65 A;  4LF6 I;  4NXN E;  4P52 A;  1PJS A;  2RSI A;  4RHB B;  4WFT A;  1Z59 A;  4GKK E;  2RTX A;  4IFD A;  2PNL A;  2LJP A;  3WU4 A;  5BR8 E;  2E5L E;  1X6F A;  3ZZT A;  3EPL A;  4DXL A;  4R2R A;  4X62 I;  1YYO A;  5AAS A;  2MC6 A;  5GME A;  4YHH E;  2KHX A;  2PO1 A;  2EML A;  4WXC A;  3M85 G;  1HNW E;  2EMB A;  2HC5 A;  2HK2 A;  5AE1 A;  1RHY A;  2VF1 A;  2EQ0 A;  4M9V C;  1A6F A;  1NHJ A;  1UDO A;  2GS8 A;  2J7K A;  4FWH A;  4FWG A;  2L6M A;  5KL7 A;  4DR6 E;  3HQ1 A;  1Z0W A;  4HTG A;  2R76 A;  4DV0 E;  2LRS A;  2EOQ A;  1LLM C;  2JR1 A;  1X6E A;  2JOB A;  3DD6 A;  5DRR A;  4WSG A;  5GMD A;  3UHM A;  2O1T A;  1ZM9 A;  4LF7 E;  4DR5 I;  2UUB E;  5FLX C;  1PKP A;  2LT7 A;  1N36 I;  2YZT A;  2EPK X;  3KWR A;  4WSP A;  4WYQ B;  1SR9 A;  1JK1 A;  1IBK E;  2I13 A;  1RRE A;  3PRY A;  3WU3 A;  2GLI A;  2LJU A;  1TN9 A;  2EJ4 A;  2PO0 B;  2ENH A;  4BA1 B;  1D6T A;  3HKM A;  4TUI A;  1IBM I;  4TUG A;  1TF3 A;  2EOJ A;  3LLH A;  2N3G A;  2UUC E;  2JE6 B;  2VQF E;  2PO2 B;  4HEI A;  3B78 A;  2GQ0 A;  5EKW A;  2YRH A;  4IS1 C;  5AC4 A;  1T4N A;  2FTX B;  5AE3 A;  1STU A;  2ELY A;  1RC7 A;  3P1X A;  1DI2 A;  3JTZ A;  2NN6 C;  4LCG A;  4FWD A;  2WP8 A;  3B8H A;  2EM8 A;  5K36 B;  2JPA A;  3LNU A;  1HNX E;  5EL9 A;  2B7T A;  1NCS A;  2EN4 A;  4L5N C;  2DIX A;  4X64 E;  2C38 A;  3M7N D;  1N33 E;  2R42 A;  3RMP A;  3VYX A;  1YZ9 A;  5DNL A;  4UT4 A;  4K0K E;  2EMK A;  1EH8 A;  2V86 A;  5AE2 A;  4R2P A;  2E1R A;  4X9J A;  3C4T A;  1J26 A;  4BA2 A;  1GQE A;  1YYW A;  2X7I A;  2EP3 A;  1XNR E;  1T4L B;  3B82 A;  2L3C A;  2V85 A;  4LF6 E;  1YPN A;  4MDT A;  3MHH C;  2GO4 A;  2V34 A;  4RH8 A;  5KL3 A;  2M4I A;  2LUP B;  4ZYD A;  3L00 A;  2C39 A;  4Z7C A;  2CZ9 A;  2UXB I;  1TF6 A;  4MU1 A;  4HXZ A;  4OOG C;  2PRT A;  2WNR B;  3D4J A;  2CG9 A;  4JI6 I;  4F9B B;  2BM1 A;  4LPF A;  4X62 E;  3M85 D;  2EOR A;  4R2Q A;  2NN6 A;  4OX9 I;  4WUD A;  3GON A;  2NA2 A;  4O5G A;  4F6M A;  2EQ1 A;  1RMD A;  1QNT A;  4X8W A;  4DR2 I;  1XMQ I;  2YTJ A;  4DV3 I;  1BBO A;  2YTG A;  5KL6 A;  4OO1 C;  4WUB A;  2A2D A;  4DR1 E;  1HNZ E;  5A69 A;  4QNJ A;  4M0V A;  3PS2 A;  4FW9 A;  1EH6 A;  2C37 A;  2MDR A;  2EPR A;  1GZ6 A;  1H74 A;  2L8T A;  4IFD F;  3EQ1 A;  1H72 C;  4LFB I;  4BBY A;  3P3G A;  4DKK A;  1MX0 A;  5ADZ A;  3QG5 C;  2M7Q A;  3CWV A;  2BB8 A;  4FW6 A;  3IWD A;  4JI4 I;  2EOX A;  1Z0E A;  3B4T A;  2ODR C;  4R2S A;  4MU3 A;  2EL4 A;  1XNQ I;  5KL4 A;  2O1V A;  1T38 A;  1FKA E;  4U3D A;  2L2M A;  2B3T B;  1IBM E;  1UBD C;  3OTO I;  4IS9 A;  2V8Q B;  2DMY A;  3WU6 A;  2ADR A;  2MC5 A;  4JG4 A;  4JI5 I;  2NPF A;  2DMI A;  2EOE A;  2DSY A;  4OO1 A;  4DV7 I;  5F3W A;  2DLK A;  2BA0 D;  4I3H A;  1HR0 I;  2EN7 A;  3THO B;  4DMI A;  1MG7 A;  2ZBK B;  3J81 C;  3QT7 A;  2IES A;  4JI0 I;  1X49 A;  1R6M A;  2ENC A;  2L2N A;  4KZS A;  4IZJ A;  4N3O A;  2EN2 A;  1K47 A;  4IZK B;  4B3R I;  1XMO I;  1Y4U A;  2BV3 A;  1Z1B A;  4R2D A;  2YSO A;  2V83 A;  1EI1 A;  1Z0B A;  2EPA A;  4DPX A;  3T1Y I;  5T6J A;  1N0V C;  2HFU A;  1NHI A;  4LFC I;  3MHS C;  2HJJ A;  2Z5B B;  2DGC A;  1Z0C A;  2L33 A;  2L92 A;  1A1K A;  1IQS A;  4X65 I;  4AID A;  2EPO A;  2Z5C A;  2PNZ A;  3QT5 A;  4ZYG A;  2UXB E;  4B3T E;  1BBG A;  4HAC A;  4DPT A;  2JT2 A;  5IXM B;  1EA6 A;  1H7U A;  1FJG I;  4R2E A;  2M9A A;  4NBQ A;  5TSE A;  2V89 A;  3HPS A;  1XHK A;  4DV2 I;  2N3H A;  2EMC A;  2V88 A;  2V2Q A;  2YT4 A;  4DR2 E;  1XMQ E;  3HXL A;  4DR7 I;  4DV3 E;  2EOH A;  1E3H A;  4PRV A;  4HY1 A;  3J7A M;  2EMY A;  3THN A;  4DV6 I;  3AUZ A;  1HK7 A;  4KQV A;  4JI3 I;  4N4R B;  2LTR A;  1ZBQ A;  4O24 A;  2F4V E;  4DV1 I;  4KHP I;  4MLQ A;  2JEA A;  4IFD B;  4MYT A;  4OZE A;  2UU9 E;  3K1J A;  4PU9 A;  2CT1 A;  2BR2 A;  4DPY A;  2EOM A;  2V87 A;  4P78 A;  1QU6 A;  2NN6 F;  4F54 A;  2RS6 A;  4JV5 I;  5K36 C;  2NAB A;  2EMA A;  2YU8 A;  4XTJ A;  2PO1 B;  4O4K A;  1UDN A;  4NXM I;  4DPW A;  1IBL I;  3KZZ A;  1XNQ E;  2BA1 D;  3U1K A;  2UXD E;  1BB8 A;  4J8Z A;  2EOF A;  2EPX A;  2CSH A;  1SFE A;  3Q6M A;  1EH7 A;  2F8B A;  2EMG A;  1VI7 A;  1FNM A;  4IZJ D;  2HKJ A;  1EKZ A;  2JEB A;  2YTQ A;  2EOO A;  3KZY A;  3OTO E;  2PNM A;  3P3C A;  4JI1 I;  3V5R A;  2K7I A;  4DR3 I;  3VK6 A;  3Q6N A;  1DGC A;  2YTI A;  3K85 A;  2RQL A;  4LTY A;  4JI5 E;  5C0X C;  3ADL A;  4R2A A;  1HR0 E;  1ELO A;  4FW3 A;  2LMZ A;  1WRJ A;  5LMU I;  4ISA A;  5ELW A;  2D9H A;  2YTO A;  1J5E I;  4IFD E;  2XEX A;  1Y6Z A;  2BA0 G;  4MYU A;  1WXR A;  4R1F A;  3EPK A;  3M99 B;  2K4V A;  2WBU A;  2V2V A;  1OYS A;  1Z5C A;  1XMO E;  1I94 I;  3ZOQ B;  2ZM6 I;  1Y4S A;  1O0W A;  4R2C A;  4IFD D;  2ELZ A;  3DJW A;  1FWK A;  2EN8 A;  5A2Q Q;  2EPC A;  3BGH A;  4OO1 F;  3ADG A;  1Z5B A;  4BS9 A;  2L3J A;  4JI8 I;  4YY3 I;  4X65 E;  2EOZ A;  2F1D A;  1OJ4 A;  2WP8 B;  2DEI A;  1KIJ A;  2HKE A;  2YRK A;  2C38 B;  2EM3 A;  3V2U C;  4DV4 I;  1FJG E;  5C0X A;  3T1H I;  2A25 A;  2EMI A;  2EM7 A;  3DF6 A;  1YFH A;  4L8N A;  1G2F C;  1B69 A;  4JI7 I;  2UXC I;  5JEA C;  4DV2 E;  2B9D A;  1FWL A;  5IWA I;  1T39 A;  4DR7 E;  1PIE A;  2I9I A;  4F9A B;  3VYY A;  2UUA I;  2EMW A;  4BA2 B;  2R1F A;  3F6G A;  2LVH A;  4DV6 E;  2EL5 A;  3LML A;  1ZU1 A;  4BC9 A;  1QZR A;  1A1H A;  4WUC A;  4JI3 E;  4KHP E;  1T4O A;  2V2Z A;  2DRP A;  2L2K B;  4DV1 E;  2C39 B;  4DR4 I;  1UN6 B;  4P7A A;  1UDS A;  4GZN C;  2E72 A;  2NN6 B;  2EZ6 A;  2MKD A;  3F0N A;  3PS3 A;  4DR5 E;  1Y5Y A;  4FW4 A;  2EOY A;  4GKK I;  4NXM E;  1N36 E;  1PJQ A;  1IBL E;  4Q35 B;  2E5L I;  4LF8 I;  2M1S A;  5IV8 B;  1N0U A;  2LUQ A;  3EPJ A;  4LF4 E;  2R3V A;  2WCC 3;  4AQY E;  4JI1 E;  4J3D A;  3ZZU A;  2LV2 A;  2EOS A;  1MGT A;  2JY9 A;  4X66 I;  4DR3 E;  2BA1 G;  5JEA A;  4OKG A;  3J7Y p;  2C37 B;  1KJK A;  4EMD A;  2OI2 A;  2YTD A;  5LMU E;  3VHT B;  1A1F A;  3GLL A;  4DR6 I;  2EWL A;  3KRN A;  4ED4 A;  4AQY I;  5KL5 A;  4LF9 I;  4DV0 I;  1H7S A;  1YYK A;  3ZKB A;  2EM9 A;  3TQM A;  4LF5 I;  1U2R A;  2KON A;  4LF7 I;  1I94 E;  1AH5 A;  1B62 A;  2NN6 E;  2YRM A;  2EMH A;  2YPN A;  1UHZ A;  2JP9 A;  1PVG A;  2WZO A;  2YTP A;  1RR9 A;  1PDA A;  3EPH A;  1IBK I;  2O1W A;  4O43 A;  4IZK A;  4MU4 A;  2AE8 A;  1X5W A;  4FK5 C;  2NN6 D;  5FWK A;  4Z7Y A;  4JI8 E;  4OO1 B;  4YY3 E;  3ZZ0 A;  3L7Z A;  3P76 A;  2Q8U A;  4U3B A;  2UUC I;  4R8O A;  2VQF I;  1X47 A;  5DNY A;  2EPU A;  2FGG A;  3BBG A;  3C6K A;  2NUF A;  4IZJ B;  5IT9 Q;  4DV4 E;  2JXP A;  1AAY A;  3T1H E;  4JI6 E;  4JI7 E;  2UXC E;  4DV5 I;  1ZBT A;  5CFF E;  4QNK A;  4OX9 E;  4DR1 I;  2EM6 A;  2NUE A;  3HUL A;  5DNX A;  1BKN A;  4X64 I;  3J80 Q;  4JYA I;  2G7H A;  4DUZ I;  5A6B A;  4B3S I;  2EMX A;  1WHQ A;  4BC7 A;  3FIG A;  2LE2 A;  4B3R E;  1Z0G A;  4K0K I;  4USK A;  4GKJ I;  2Z5C B;  1WJP A;  4LU9 A;  4M1K A;  1USU A;  2PNZ B;  4HYM A;  2EM5 A;  2LO3 A;  4BMJ A;  4NHR A;  2CVE A;  2WW4 A;  4HAC B;  5C0X F;  3PYG A;  4OO1 E;  2DLQ A;  5A2Q C;  4LFB E;  4JI2 I;  1A1L A;  1RQ0 A;  3PYD A;  1A1G A;  4M2Z A;  2EL6 A;  2EM0 A;  2VQE I;  2EM2 A;  2LCE A;  4JI4 E;  2CGE A;  4OO1 D;  1N32 I;  4LCH A;  4LF8 E;  1KTV A;  3M6A A;  2DB2 A;  4GQU A;  2BM0 A;  3T1Y E;  1P42 A;  4AIM A;  4LFA I;  2EPN A;  4X66 E;  1IMU A;  1S16 A;  3H4L A;  5LLQ A;  2YTE A;  3J81 Q;  2JEA B;  1X6H A;  1HNZ I;  3JAM Q;  4DUY I;  2BR2 B;  2PO0 A;  4BA1 A;  4DV7 E;  2EOI A;  4LF9 E;  2ODR D;  2HGH A;  2MKN A;  1UDQ A;  2KOU A;  4LF5 E;  3HTX A;  2JE6 A;  2RPC A;  4JI0 E;  2PO2 A;  5AC5 A;  3F6H A;  1R6L A;  4FW7 A;  3P3E A;  3J7A G;  4DU7 A;  1UIL A;  3QT6 A;  1N34 I;  2JEB B;  2VF3 A;  3Q1Q A;  4URL A;  5JEA F;  4FN5 A;  5K36 A;  4MLV A;  2LBS B;  4DPU A;  2H36 X;  1NZ0 A;  2EPP A;  4GEQ B;  2EN3 A;  2EMF A;  2YTF A;  4M30 A;  4LFC E;  4WPY A;  3ECR A;  3PYE A;  2HK3 A;  3U1Y A;  4Q28 A;  2WBT A;  5LL6 R;  5A6B D;  3GCM A;  4LOM A;  4F6N A;  2AJ4 A;  2EN6 A;  2ZIT A;  5LMN I;  4P7D A;  4DV5 E;  4AM3 A;  1H73 A;  2Q2E B;  3UK3 C;  2YTN A;  1WHN A;  1ZAA C;  1OYR A;  2IOP A;  3ZKD A;  2A2C A;  3HJC A;  3C4B A;  2BBG A;  4NZV A;  4BCA A;  4F2J C;  4JYA E;  2V8P A;  1Y60 A;  4DUZ E;  2WNR A;  1NEI A;  2JOX A;  4B3S E;  2RSM A;  4B3M I;  1ZXN A; 
#chains in the Genus database with same CATH homology
 4DU8 A;  2X36 A;  4GKJ E;  1Z5A A;  3QT8 A;  4UTG A;  5FLX Q;  4JI2 E;  3JU0 A;  4USM A;  2HHH I;  4JV5 E;  3P06 A;  4NXN I;  2VQE E;  2EFG A;  3PYF A;  4B3T I;  4PRX A;  1N32 E;  3ADJ A;  2RS7 A;  5BR8 I;  5IT9 C;  4LFA E;  4YHH I;  3AV0 A;  3IWB A;  1DAR A;  1ZXM A;  1ZM4 A;  1HNW I;  4DUY E;  3J80 C;  2DEJ A;  1NHH A;  2F4V I;  2JVA A;  2Z5E A;  2FV4 B;  1DQ3 A;  2UU9 I;  1J5E E;  2O1U A;  1Z0T A;  2IHR 1;  1MU5 A;  2CPN A;  3IWC A;  1S4E A;  1N34 E;  1FI4 A;  2UUB I;  2ZM6 E;  4I8O A;  3OML A;  3K6Q A;  4ZVI A;  3WU5 A;  2UXD I;  1KVK A;  2IOQ A;  3LPS A;  2VE7 C;  3HPZ A;  3ZM7 A;  2HFS A;  4R03 A;  2LJH A;  3LTO A;  1ZM2 A;  5LMN E;  2E1M A;  2Z5B A;  1USV A;  3JAM C;  2B7V A;  3MSW A;  5IWA E;  1B63 A;  4RPF A;  1HNX I;  5L3J A;  1N33 I;  2UUA E;  2LTS A;  1KKH A;  1ZM3 A;  4B3M E;  4F9C B;  2JWO A;  3H09 A;  4DR4 E;  1UEK A;  1WUU A;  3K17 A;  1Z0V A;  1X48 A;  2NUG A;  1XNR I;  1VIS A;  3ADI A;  4LF6 I;  2HHH E;  4NXN E;  4P52 A;  4WFT A;  1Z59 A;  4GKK E;  2RTX A;  2PNL A;  2LJP A;  3WU4 A;  5BR8 E;  2E5L E;  3ZZT A;  4DXL A;  4X62 I;  1YYO A;  5AAS A;  2MC6 A;  5GME A;  4YHH E;  2KHX A;  1HNW E;  2HK2 A;  5AE1 A;  2VF1 A;  1NHJ A;  2J7K A;  1A6F A;  4FWH A;  2GS8 A;  4FWG A;  4DR1 I;  2L6M A;  4DR6 E;  3HQ1 A;  1Z0W A;  4DV0 E;  2LRS A;  2JR1 A;  2JOB A;  5GMD A;  2O1T A;  1ZM9 A;  4LF7 E;  4DR5 I;  2UUB E;  5FLX C;  1PKP A;  1N36 I;  2YZT A;  3KWR A;  4WSP A;  4WYQ B;  1SR9 A;  1IBK E;  1RRE A;  3WU3 A;  3PRY A;  1D6T A;  4TUI A;  1IBM I;  4TUG A;  3LLH A;  2N3G A;  2UUC E;  2VQF E;  3B78 A;  2GQ0 A;  1DI2 A;  1T4N A;  2FTX B;  5AE3 A;  1STU A;  1RC7 A;  3P1X A;  3JTZ A;  4FWD A;  3B8H A;  3LNU A;  1HNX E;  2B7T A;  4L5N C;  2DIX A;  4X64 E;  1N33 E;  2R42 A;  3RMP A;  3VYX A;  1YZ9 A;  4UT4 A;  4K0K E;  2V86 A;  5AE2 A;  2E1R A;  1J26 A;  3C4T A;  1GQE A;  1YYW A;  2X7I A;  1XNR E;  1T4L B;  3B82 A;  2L3C A;  2V85 A;  4LF6 E;  2V34 A;  2LUP B;  2M4I A;  4Z7C A;  2CZ9 A;  2UXB I;  4HXZ A;  4OOG C;  3D4J A;  2CG9 A;  4JI6 I;  4F9B B;  2BM1 A;  4X62 E;  4OX9 I;  4WUD A;  3GON A;  2NA2 A;  4X8W A;  4DR2 I;  1XMQ I;  4DV3 I;  4WUB A;  2A2D A;  4DR1 E;  1HNZ E;  4M0V A;  4FW9 A;  2MDR A;  1H74 A;  1GZ6 A;  2L8T A;  1H72 C;  4LFB I;  4BBY A;  4DKK A;  1MX0 A;  5ADZ A;  2M7Q A;  3CWV A;  3IWD A;  4JI4 I;  1Z0E A;  2ODR C;  1XNQ I;  2O1V A;  1FKA E;  2L2M A;  2B3T B;  1IBM E;  3OTO I;  3WU6 A;  2V8Q B;  2DMY A;  2MC5 A;  4JG4 A;  4JI5 I;  2NPF A;  4DV7 I;  2DSY A;  5F3W A;  4I3H A;  1HR0 I;  4DMI A;  1MG7 A;  2ZBK B;  3J81 C;  3QT7 A;  4JI0 I;  1X49 A;  2L2N A;  4KZS A;  4IZJ A;  4N3O A;  1K47 A;  4IZK B;  1XMO I;  1Y4U A;  2BV3 A;  1EI1 A;  2V83 A;  1Z0B A;  4DPX A;  5T6J A;  1N0V C;  2HFU A;  1NHI A;  4LFC I;  2Z5B B;  1Z0C A;  2L33 A;  2L92 A;  4X65 I;  2Z5C A;  3QT5 A;  2UXB E;  4B3T E;  4HAC A;  4DPT A;  1EA6 A;  1H7U A;  1FJG I;  2V89 A;  3HPS A;  1XHK A;  4DV2 I;  2N3H A;  2V88 A;  2V2Q A;  2YT4 A;  4DR2 E;  1XMQ E;  3HXL A;  4DR7 I;  4DV3 E;  4PRV A;  4HY1 A;  3J7A M;  4DV6 I;  3AUZ A;  1HK7 A;  4KQV A;  4JI3 I;  2F4V E;  2LTR A;  1ZBQ A;  4KHP I;  4DV1 I;  4MYT A;  2UU9 E;  3K1J A;  4PU9 A;  4DPY A;  2V87 A;  4P78 A;  1QU6 A;  4F54 A;  2RS6 A;  4JV5 I;  4XTJ A;  4NXM I;  4DPW A;  1IBL I;  1XNQ E;  2UXD E;  4J8Z A;  3Q6M A;  2F8B A;  4IZJ D;  1FNM A;  4LF4 I;  2HKJ A;  1EKZ A;  4JI1 I;  2PNM A;  4AQY I;  3OTO E;  3V5R A;  4DR3 I;  3VK6 A;  3Q6N A;  3K85 A;  4LTY A;  4JI5 E;  1ELO A;  3ADL A;  1HR0 E;  2LMZ A;  5LMU I;  1J5E I;  2XEX A;  1Y6Z A;  4R1F A;  4MYU A;  1WXR A;  2K4V A;  2V2V A;  1Z5C A;  1XMO E;  1I94 I;  3ZOQ B;  2ZM6 I;  1Y4S A;  1O0W A;  3DJW A;  1FWK A;  5A2Q Q;  3ADG A;  1Z5B A;  4BS9 A;  2L3J A;  4JI8 I;  4YY3 I;  4X65 E;  1OJ4 A;  2DEI A;  1KIJ A;  2HKE A;  3V2U C;  4DV4 I;  1FJG E;  3T1H I;  3DF6 A;  4JI7 I;  2UXC I;  4L8N A;  4DV2 E;  2B9D A;  1FWL A;  5IWA I;  4DR7 E;  1PIE A;  4F9A B;  3VYY A;  2UUA I;  3F6G A;  4DV6 E;  3LML A;  4BC9 A;  1QZR A;  4WUC A;  4B3R I;  4JI3 E;  4KHP E;  1T4O A;  2V2Z A;  4DR4 I;  2L2K B;  4DV1 E;  4P7A A;  2EZ6 A;  3F0N A;  4DR5 E;  4GKK I;  4NXM E;  1N36 E;  1IBL E;  2E5L I;  4LF8 I;  2M1S A;  1N0U A;  2LUQ A;  4LF4 E;  2R3V A;  4AQY E;  4JI1 E;  3T1Y I;  3ZZU A;  4X66 I;  2JY9 A;  4DR3 E;  3J7Y p;  4EMD A;  2OI2 A;  5LMU E;  4DR6 I;  2EWL A;  4ED4 A;  4LF9 I;  4DV0 I;  1H7S A;  1YYK A;  3ZKB A;  4LF5 I;  1U2R A;  2KON A;  4LF7 I;  1I94 E;  1B62 A;  1UHZ A;  1PVG A;  2WZO A;  1RR9 A;  1IBK I;  2O1W A;  4IZK A;  5FWK A;  4Z7Y A;  4JI8 E;  4YY3 E;  3ZZ0 A;  2UUC I;  4R8O A;  2VQF I;  1X47 A;  5DNY A;  2NUF A;  2FGG A;  5IT9 Q;  4IZJ B;  4DV4 E;  3T1H E;  4JI6 E;  4JI7 E;  2UXC E;  4DV5 I;  1ZBT A;  5CFF E;  4OX9 E;  2NUE A;  3HUL A;  1BKN A;  4X64 I;  3J80 Q;  4JYA I;  2G7H A;  4DUZ I;  4B3S I;  1WHQ A;  4BC7 A;  3FIG A;  2LE2 A;  4B3R E;  1Z0G A;  4K0K I;  4USK A;  4GKJ I;  2Z5C B;  4LU9 A;  4M1K A;  1USU A;  4HYM A;  4BMJ A;  2WW4 A;  4HAC B;  3PYG A;  5A2Q C;  4LFB E;  4JI2 I;  1RQ0 A;  3PYD A;  4M2Z A;  2VQE I;  4JI4 E;  2CGE A;  1N32 I;  4LF8 E;  1KTV A;  3M6A A;  2DB2 A;  2BM0 A;  3T1Y E;  4LFA I;  4X66 E;  1S16 A;  3H4L A;  3J81 Q;  1HNZ I;  3JAM Q;  4DUY I;  4DV7 E;  4LF9 E;  2ODR D;  2KOU A;  4LF5 E;  3HTX A;  4JI0 E;  3F6H A;  3J7A G;  4DU7 A;  1UIL A;  3QT6 A;  1N34 I;  2VF3 A;  3Q1Q A;  4URL A;  4FN5 A;  2LBS B;  4DPU A;  2H36 X;  1NZ0 A;  4GEQ B;  4M30 A;  4LFC E;  4WPY A;  3PYE A;  2HK3 A;  4Q28 A;  5LL6 R;  2AJ4 A;  2ZIT A;  5LMN I;  4P7D A;  4DV5 E;  1H73 A;  2Q2E B;  1WHN A;  3ZKD A;  2IOP A;  2A2C A;  3HJC A;  3C4B A;  4BCA A;  4JYA E;  2V8P A;  4DUZ E;  2JOX A;  4B3S E;  2RSM A;  4B3M I;  1ZXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...