1IBKE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ibkE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibkE02
2UU9E 2UXDI 2L2NA 3VYXA 1YYOA 4DV4I 4JG4A 4DUYE 4LFCE 3J7AM 2ZM6E 3WU4A 2LRSA 2NUGA 5L3JA 3T1HE 1H7UA 4NXMI 4B3SI 3OTOE 3WU5A 3ADLA 4YY3E 2NPFA 2CZ9A 4JI1I 4DR4I 4DR7I 4JI7E 1ELOA 5IWAI 4JYAI 3K1JA 1KIJA 4DXLA 4DR6E 2N3HA 1Z59A 4LFBE 4NXNI 1FJGE 4WFTA 1T4NA 3QT5A 2HKJA 2NUFA 2UUAE 2DIXA 4LF6I 4RPFA 1KTVA 1Z5CA 3JAMQ 4FW9A 2RSMA 1X48A 4LF4I 4X64E 4P7AA 2X7IA 1N32E 4DR3E 2DEJA 2L3CA 1N34I 1HNZE 3PYDA 1UHZA 4K0KI 2L2KB 1N0UA 3WU3A 4JI4E 1T4OA 1XNQE 4OX9E 1RC7A 2X36A 3ZZTA 1HNWI 2UUCI 1RQ0A 2LTRA 3H4LA 1H74A 1UEKA 2LBSB 4ED4A 4JI8E 4USKA 1HR0I 4DV1E 3F0NA 1IBMI 1FWLA 5CFFE 2L3JA 1FKAE 1Z0WA 1B63A 1Z0BA 4X62I 2HHHI 4DV6I 2B7VA 4HY1A 1QZRA 4LF7E 3J81C 4YHHE 3HTXA 2LUPB 2V34A 1HNXI 2V2VA 4DV2I 4UT4A 3LPSA 2UXDE 2XEXA 3VYYA 4DV4E 2EFGA 2VF3A 4JI2I 4DKKA 2HFUA 1XMOI 1VISA 4WYQB 4DPUA 2UXCI 4NXME 2MDRA 4JI5I 4B3SE 2VQEI 2NA2A 1NHJA 5LMNI 3PYFA 1ZM9A 2L33A 2UXBI 3CWVA 2A2DA 4JI1E 4DR4E 4DR7E 1WUUA 4PRXA 5IWAE 4JYAE 4LFAI 1ZM2A 2R42A 1XMQI 2ZITA 4NXNE 1J5EI 4DV7I 4B3MI 4XTJA 4USMA 2WW4A 1X49A 4LF6E 3QT8A 4DR1E 4GKJI 4P52A 3LLHA 4HYMA 1YYWA 5IT9C 3QT6A 4X66I 2F4VI 1N34E 4I3HA 4K0KE 1NHHA 4DV3I 1OJ4A 4X65I 1X47A 3C4BA 1HNWE 2UUCE 1N33E 1K47A 5FLXC 2NUEA 4M2ZA 2HK2A 4LF9I 3B82A 2JY9A 1HR0E 4B3RI 4Z7YA 1EKZA 1IBME 4HACA 1Z0CA 4KHPI 2LJHA 4X62E 4JI6I 2HHHE 4DV6E 2J7KA 4KQVA 4JI3I 1S16A 1EA6A 4FWGA 3J7Yp 2HKEA 2BM1A 1NZ0A 4DV0I 4M1KA 3ZKBA 2L2MA 3OTOI 1A6FA 2VQFI 2N3GA 1WHQA 4DU7A 1O0WA 4M30A 1HNXE 1IBLI 4DV2E 5GMEA 1XHKA 5IT9Q 3J80C 2DEIA 3LNUA 2LTSA 4JI2E 5A2QC 1XMOE 5BR8I 5LMUI 4LF8I 4DR5I 3P1XA 4JI5E 2VQEE 1PIEA 5LMNE 4DV5I 4WUCA 2UXBE 1KVKA 1H72C 1H73A 1ZXMA 2E5LI 2RS7A 4GKKI 1HNZI 2UUBI 4LFAE 4Z7CA 3LTOA 1B62A 1XMQE 1ZM4A 4MYTA 4DPWA 1KKHA 1RR9A 4JI0I 4DV7E 4B3ME 2YT4A 3GONA 1DI2A 1NHIA 4GKJE 2E1RA 3C4TA 3Q1QA 4DU8A 4B3TI 4X66E 2F4VE 4OOGC 2V2ZA 4JV5I 2V2QA 4DPTA 3PYGA 4DV3E 1ZM3A 1PKPA 2LJPA 3ZZUA 1S4EA 2B3TB 4LF5I 3J81Q 4LF9E 1N0VC 1Z5BA 1I94I 4PU9A 4UTGA 4LF4E 4B3RE 2V8PA 1XNRI 4KHPE 3T1YI 4JI6E 1FWKA 4FN5A 4JI3E 4AQYI 2RTXA 3ZZ0A 3QT7A 3V5RA 4DUZI 1J26A 4DV0E 2AJ4A 2R3VA 1FNMA 4DR2I 4HXZA 2VQFE 1N36I 3ZM7A 2GS8A 1RREA 1Z0GA 2BM0A 1IBKI 1IBLE 2UU9I 2IHR1 1D6TA 4DUYI 4LFCI 4FWDA 3ADJA 5BR8E 4WUDA 2ZM6I 5LMUE 1WHNA 2JVAA 4LF8E 4DR5E 3T1HI 2KHXA 1STUA 1EI1A 4DR1I 4DV5E 2LUQA 1FI4A 2HK3A 4YY3I 3D4JA 4JI7I 2E5LE 3PYEA 4X8WA 4WUBA 4GKKE 2RS6A 1U2RA 2UUBE 3B78A 4DR6I 4LFBI 4MYUA 1BKNA 1FJGI 4JI0E 2OI2A 1Z0EA 1H7SA 2UUAI 4DPYA 4R1FA 2Q2EB 2UXCE 3B8HA 1N33I 4HACB 2DMYA 1Z0VA 3K17A 1YZ9A 1UILA 4PRVA 4ZVIA 2EZ6A 4X64I 5FLXQ 4URLA 1MX0A 4B3TE 1N32I 2A2CA 4DR3I 1ZBTA 4JV5E 4FWHA 2HFSA 4DPXA 1PVGA 2ZBKB 4JI4I 2BV3A 1J5EE 1Z0TA 1XNQI 4OX9I 3J7AG 1DARA 4LF5E 2B7TA 4JI8I 1I94E 1ZXNA 3HULA 2CPNA 4DV1I 3V2UC 1GQEA 1XNRE 5GMDA 3T1YE 3ZKDA 3M6AA 4AQYE 3J80Q 1T4LB 2DB2A 4X65E 1MG7A 5A2QQ 4DUZE 3ADGA 5LL6R 4LF7I 3JAMC 3WU6A 4DR2E 1Z5AA 4YHHI 1N36E 3ADIA 1IBKE 4EMDA 1QU6A 1MU5A 1YYKA
chains in the Genus database with same CATH superfamily
2UU9E 2O1TA 4IZKA 4LTYA 3GLLA 4N3OA 2UXDI 2L2NA 5AC5A 3VYXA 4IS9A 4MQYA 1YYOA 4DV4I 4JG4A 4DUYE 2EE8A 1T39A 1UDOA 2EMXA 4NBQA 3UHMA 4LFCE 3J7AM 4BA2A 2ZM6E 3WU4A 2LRSA 2DLKA 2V85A 1WRJA 3DJWA 3EQ1A 3T1HE 2NUGA 3AUZA 1H7UA 5L3JA 4NXMI 3M85G 4B3SI 5K36A 2JOXA 2VESA 4BHCA 2Z5CB 3OTOE 3WU5A 2YTDA 3ADLA 4YY3E 2NPFA 2CZ9A 2L8TA 4JI1I 4DR4I 2IESA 4JI7E 4DR7I 4U3DA 4BC9A 2EOMA 1ELOA 5KL4A 5IWAI 4JYAI 3K1JA 1KIJA 3THNA 1QU6A 4DXLA 4DR6E 2N3HA 2E1MA 3M99B 1Z59A 4LFBE 2CVEA 4NXNI 1A1HA 2WBTA 2EM4A 1FJGE 1Y60A 2O1WA 4WFTA 1T4NA 2GO3A 3QT5A 2HKJA 2NUFA 2UUAE 4IZKB 4GEQB 2DIXA 5EKWA 2YTEA 2MKDA 2WNRA 4LF6I 4RPFA 2MDGA 1KTVA 2MKNA 2IOPA 1Z5CA 1UBDC 2PNLA 2D9HA 2YTJA 3P3CA 3U1KA 3JAMQ 1XXEA 4IFDD 3F6GA 4IJDA 2NN6D 2PO2A 4FW9A 4O43A 5EL9A 2RSMA 1X48A 4LF4I 4X64E 4P7AA 2X7IA 1SFEA 2EOFA 2NABA 4I8OA 2V83A 2VE7C 1JK1A 2I13A 3PS2A 1N32E 1YPNA 5KL5A 2VF1A 4DR3E 2DEJA 2L3CA 5JEAA 4OO1F 1N34I 4MU3A 1HNZE 5K36B 3PYDA 2EOXA 1UHZA 4K0KI 1P47A 3IWDA 4RHBB 2Z5EA 2L2KB 1R6LA 2MC5A 1N0UA 3P76A 3WU3A 3M7NG 2YRMA 2JYAA 4JI4E 3ECRA 1T4OA 2EMYA 1XNQE 2EL6A 4OX9E 4Q35B 1RC7A 2X36A 3ZZTA 1HNWI 2UUCI 2ADRA 1RQ0A 1F2IG 2LTRA 1H74A 1UEKA 3H4LA 2LBSB 4ED4A 5C0XE 4JI8E 4USKA 4R2QA 3K85A 2EM6A 2EN6A 2EMKA 1HR0I 4DV1E 3F0NA 1R6MA 2WBUA 1IBMI 1FWLA 5CFFE 2EN2A 2L3JA 1FKAE 1B63A 1Z0BA 1Z0WA 2N8XA 2WNRB 2CSHA 4X62I 4BA1A 2HHHI 4DV6I 1YH8A 4AM3A 2GLIA 2B7VA 2EWLA 2EM2A 4FW5A 2EPZA 5TSEA 3NZKA 5AE3A 2KONA 2PNZA 4HY1A 1X6EA 3HJCA 1QZRA 1A1LA 4LF7E 2EMGA 1Y6ZA 3J81C 4LCHA 5JEAB 3EPLA 4LU9A 4YHHE 2R1FA 5DNXA 3B4TA 2HJJA 2GO4A 2BA1G 4F6MA 3HTXA 2LUPB 2V34A 1HNXI 2V2VA 4WPYA 4DV2I 2EPAA 1GZ6A 2DRPA 4UT4A 3LPSA 2AE8A 2V86A 2JEAA 5T6JA 5A6BD 3VYYA 2UXDE 2XEXA 4LPFA 3H1CA 1YFHA 4DV4E 2EFGA 3FIGA 2VF3A 4JI2I 4DKKA 2HFUA 4P7DA 1XMOI 3MSWA 2CTDA 1VISA 4WYQB 4DPUA 4OKGA 1VI7A 2UXCI 4NXME 2MDRA 5DRRA 4JI5I 2M7QA 4B3SE 4MU0A 4BA1B 2NA2A 1NHJA 2YSPA 4IZJA 2VQEI 3PYFA 1ZM9A 5LMNI 2HGHA 2YU5A 2L33A 2UXBI 3CWVA 3C6MA 3GCMA 2A2DA 3P3EA 4AIMA 4JI1E 4ZYGA 4DR4E 4DR7E 2JT2A 2PNZB 4GQUA 1WUUA 4PRXA 2BB8A 4MDTA 5LLQA 5IWAE 5K36F 4JYAE 4O4KA 2EPXA 4LFAI 1ZM2A 2DMIA 4MU1A 2R42A 2EOEA 2ZITA 1XMQI 1KJKA 2PO1A 2JE6A 2JP9A 4NXNE 3H09A 5C0XA 1J5EI 5ADZA 5ELWA 4LCGA 4DV7I 5KL7A 4B3MI 1UN6B 4XTJA 2JEAB 1T38A 4U3BA 5DRPA 4USMA 2WW4A 3GMEA 1PDAA 1X49A 1X5WA 4L8NA 1TF6A 4LF6E 4LCFA 2M1SA 1Y5YA 3QT8A 4DR1E 4MLQA 5A6BA 2PNMA 4GKJI 2EPMX 2I9IA 4P52A 4IFDE 3LLHA 4HYMA 2NN6E 4F9BB 4AIDA 1YYWA 2ENAA 1JK2A 4WSGA 5IT9C 1OYSA 3RMPA 4OO1E 2BR2A 3QT6A 3HQ1A 4X66I 2F4VI 2ENHA 1N34E 2NN6C 4IZJB 4I3HA 1MGTA 2BBGA 2EMZA 4K0KE 1NHHA 4NHRA 4DV3I 2DLQA 1OJ4A 4X65I 1X47A 2EMLA 3CDIA 2ODRD 3C4BA 5DNYA 5JEAF 4J8ZA 1AH5A 1A1FA 2EMIA 5KL6A 1WJPA 3BIDA 4BS9A 2UUCE 1HNWE 1N33E 1K47A 5FLXC 2LV2A 1YSAC 2EOHA 2NUEA 4M2ZA 3K6QA 2PO1B 2HK2A 2JE6B 4LF9I 2EOJA 3B82A 5C0XB 2JY9A 1HR0E 4BA2B 4B3RI 2B9DA 3BGHA 4Z7YA 4OO1D 1EKZA 1IBME 4HACA 1Z0CA 2EMBA 4KHPI 1L4SA 2LJHA 4X62E 4JI6I 2HHHE 4DV6E 2J7KA 2EOOA 1EH6A 4KQVA 1G2FC 2GPIA 1NCSA 4JI3I 1S16A 1N3GA 2GHFA 2JR1A 2L92A 3J7Yp 4F2JC 1EA6A 2HKEA 4FWGA 4LOMA 2WCC3 1NZ0A 2BM1A 3BBGA 4DV0I 1OYRA 4KZSA 1RHYA 4Q28A 4HTGA 4WXDA 2BR2B 4M1KA 4R2DA 3ZKBA 3ZOQB 2L2MA 3OTOI 1A6FA 2VQFI 2N3GA 1WHQA 3EPJA 4DU7A 1O0WA 4M30A 3VK6A 1YHCA 3M7ND 5DROA 1HNXE 1X6HA 5DRQA 1IBLI 4R2PA 3BF2A 4DV2E 5GMEA 3TQMA 2EQ1A 1USUA 1XHKA 5C0XC 4R2RA 2YZTA 3KZYA 3J80C 2DEIA 3LNUA 1YUJA 5IT9Q 4TUIA 2LTSA 4N4RB 5A2QC 4JI2E 5A69A 4MU4A 2FTXB 1XMOE 3MHHC 2PO2B 5LMUI 5BR8I 4LF8I 4IFDA 2WP8A 2EN1A 4IS1C 4DR5I 2ELZA 2NN6A 2EP3A 1KYQA 3P1XA 4JI5E 1UDQA 2VQEE 1PIEA 5LMNE 3HKMA 4DV5I 2LCEA 4ISAA 2EL4A 4WUCA 2UXBE 2EN7A 1KVKA 1H72C 2YTFA 1H73A 2EM7A 1ZXMA 2JPAA 2E5LI 1DQ3A 5K36E 4FK5C 1Y4SA 2RS7A 2JWOA 2R76A 3THOB 4GKKI 1HNZI 2UUBI 4LFAE 4Z7CA 4J3DA 3LTOA 1BBOA 1B62A 1XMQE 2EPOA 1ZM4A 4MYTA 3IWBA 4DPWA 2VRDA 5AC4A 1KKHA 1RR9A 4JI0I 4DV7E 4B3ME 2YT4A 3AV0A 4FW7A 3GONA 2M9AA 1DI2A 2WZOA 2YU8A 1DGCA 1Y4UA 2EPLX 2PO0A 1NHIA 2BA0D 2LMZA 4GKJE 3KRNA 2YSOA 2V88A 2E1RA 5C0XF 1QNTA 2FV4B 4QNJA 3C4TA 2LJUA 3Q1QA 2WP8B 1B69A 3HXLA 4DU8A 4IFDB 5K36D 2NN6B 4B3TI 4FW4A 1PJSA 3VHTB 2EM0A 3UK3C 4X66E 2F4VE 3L00A 4OOGC 3PS1A 2V2ZA 2FGGA 1A1IA 4JV5I 2YRKA 2F1DA 2V2QA 4DPTA 1A1GA 3PYGA 3PS3A 4O24A 3Q6NA 2WBSA 4DV3E 3DF6A 2EOYA 2ENCA 1USVA 2EMCA 1ZM3A 1PKPA 5JEAE 4F54A 2LJPA 4NZVA 2G7HA 5AE2A 1IMUA 2K7IA 2YTPA 3ZZUA 1S4EA 1Z1BA 2EL5A 2B3TB 2DSYA 1NEIA 4LF5I 3J81Q 1OYPA 1IQOA 4LF9E 1N0VC 1Z5BA 1I94I 3IWCA 4PU9A 5KL2A 1EH7A 4UTGA 2LT7A 4LF4E 4B3RE 4ZYHA 2CT1A 2V8PA 2EMAA 1XNRI 5A6JA 4IFDC 3M85D 4KHPE 3T1YI 2EOQA 4JI6E 3KWRA 1UDNA 3CDJA 3P06A 4X9JA 1FWKA 2PO0B 4R03A 4FN5A 3PRYA 4JI3E 2EORA 2EPCA 4AQYI 4R2AA 4OO1C 2RTXA 3ZZ0A 1X3CA 2RQLA 1UDSA 5JEAD 5K36C 2EPUA 3QT7A 3V5RA 1X6FA 4DUZI 1J26A 4DV0E 4DMIA 3JU0A 2AJ4A 4KWYA 2R3VA 1FNMA 4DR2I 4R2CA 4R2EA 4HXZA 2VQFE 1N36I 2V89A 2GS8A 3ZM7A 1ZU1A 3HPSA 1RREA 1Z0GA 1LLMC 2E72A 2BM0A 1IBKI 1IBLE 2L6MA 2UU9I 2IHR1 2K4VA 2EM8A 2RPCA 1D6TA 2YTGA 1IQSA 4DUYI 2EM5A 3LMLA 2A25A 2EMFA 5A6AA 1A1KA 1TN9A 4LFCI 4WSPA 4FWDA 4GZNC 3ADJA 5BR8E 4WUDA 2ZM6I 5LMUE 1WHNA 1EH8A 2JVAA 4LF8E 2M4IA 2EM3A 4DR5E 2JEBA 1WXRA 3T1HI 4WXCA 2KHXA 1E3PA 1STUA 1ZAAC 2EPKX 4L5NC 2J7JA 1SR9A 1EI1A 1ZBQA 2YTIA 4DR1I 4R2SA 2Q8UA 2C39A 4BCAA 2EMWA 4DV5E 2LUQA 1FI4A 2C38A 5F3WA 2JOBA 4RH8A 2HK3A 5IV8B 2J65A 4YY3I 4IFDF 2CGEA 3D4JA 4JI7I 2NN6F 5A6KA 2YRHA 2E5LE 3PYEA 1YUIA 4X8WA 1PJTA 2EQ3A 4WUBA 3U1YA 4GKKE 4M0VA 1E3HA 2RS6A 1U2RA 2UUBE 3B78A 3OMLA 4M9VC 4DR6I 5IXMB 4R8OA 2EOZA 1P42A 2EPNA 2GQ0A 4LFBI 4MYUA 4P78A 1MEYC 1TF3A 1BKNA 1FJGI 5AASA 4JI0E 5KL3A 2OI2A 1Z0EA 2EM9A 1H7SA 2O1UA 2UUAI 4DPYA 4R1FA 2Q2EB 2EOSA 2EPRA 2UXCE 3B8HA 4HACB 1N33I 4ZYEA 2C37A 2DMYA 5AE1A 1Z0VA 3EPKA 1ZR9A 3K17A 4OO1A 1YZ9A 4O5GA 5FWKA 1UILA 2EPPA 4ZYDA 2YTOA 4PRVA 4ZVIA 2JEBB 3KZZA 2EZ6A 4X64I 5FLXQ 2PRTA 4IZJD 4URLA 1GTKA 1MX0A 4B3TE 1N32I 2A2CA 4DR3I 1ZBTA 2Z5BA 2EN4A 4F9CB 4JV5E 2C39B 3F6HA 2EN8A 3C6KA 4FWHA 4F6NA 3JTZA 4BBYA 2C38B 2BA1D 2HFSA 3L7ZA 1PVGA 4DPXA 2CG9A 2ZBKB 1PJQA 2EN3A 2BV3A 2V87A 4JI4I 2LVHA 4TUGA 1J5EE 1Z0TA 1XNQI 4OX9I 2EMHA 2KOUA 2YPNA 3EPHA 4BHBA 2HC5A 3J7AG 1AAYA 3P3GA 2V8QB 4BC7A 3QG5C 2YTNA 4BMJA 4F9AB 1DARA 5C0XD 4LF5E 2B7TA 4WX9A 4JI8I 4MLVA 1I94E 4HEIA 1ZXNA 2O1VA 3HULA 2EQ0A 4QNKA 2CPNA 4DV1I 2EJ4A 2LE2A 2JXPA 1HK7A 2IERA 3V2UC 1GQEA 1RMDA 2F8BA 2MC6A 1BBGA 1XNRE 3DD6A 3Q6MA 5GMDA 2C37B 2ELYA 3T1YE 1G2DC 4OO1B 2Z5CA 2BA0G 1BB8A 3ZKDA 3M6AA 5DNLA 4AQYE 3J80Q 2RSIA 2YTQA 2DB2A 1T4LB 4X65E 1MG7A 5A2QQ 4OZEA 4DUZE 3ADGA 3MHSC 5LL6R 4LF7I 2EOIA 2DGCA 3JAMC 1A1JA 2O3ZA 3WU6A 4DR2E 2Z5BB 4FW6A 3HPZA 1Z5AA 4YHHI 1N36E 3ADIA 4FW3A 5JEAC 3L7ZB 2H36X 1IBKE 4EMDA 2YWQA 2ODRC 1MU5A 1YYKA 2LO3A 2IOQA
chains in the Genus database with same CATH topology
2UU9E 2O1TA 4IZKA 4LTYA 4N3OA 2UXDI 2L2NA 3VYXA 1YYOA 4DV4I 4JG4A 4DUYE 4LFCE 3J7AM 2ZM6E 3WU4A 2LRSA 2V85A 2NUGA 3DJWA 5L3JA 3T1HE 1H7UA 3AUZA 4NXMI 4B3SI 2JOXA 2Z5CB 3OTOE 3WU5A 3ADLA 4YY3E 2NPFA 2CZ9A 2L8TA 4JI1I 4DR4I 4DR7I 4JI7E 4BC9A 1ELOA 5IWAI 4JYAI 3K1JA 1KIJA 2ODRC 4DXLA 4DR6E 2N3HA 2E1MA 1Z59A 4LFBE 4NXNI 1FJGE 2O1WA 4WFTA 1T4NA 3QT5A 2HKJA 2NUFA 2UUAE 4IZKB 4GEQB 2DIXA 4LF6I 4RPFA 1KTVA 2PNLA 2IOPA 1Z5CA 3JAMQ 3F6GA 4FW9A 2RSMA 1X48A 4LF4I 4X64E 4P7AA 2X7IA 4I8OA 2V83A 2VE7C 1N32E 2VF1A 4DR3E 2DEJA 2L3CA 1N34I 1HNZE 3PYDA 1UHZA 4K0KI 3IWDA 2Z5EA 2L2KB 2MC5A 1N0UA 3WU3A 4JI4E 1T4OA 1XNQE 4OX9E 1RC7A 2X36A 3ZZTA 1HNWI 2UUCI 1RQ0A 2LTRA 1H74A 1UEKA 3H4LA 2LBSB 4ED4A 4JI8E 4USKA 3K85A 1HR0I 4DV1E 3F0NA 1IBMI 1FWLA 5CFFE 2L3JA 1FKAE 1Z0WA 1B63A 1Z0BA 4X62I 2HHHI 4DV6I 2B7VA 2EWLA 5AE3A 2KONA 4HY1A 3HJCA 1QZRA 4LF7E 1Y6ZA 3J81C 4LU9A 4YHHE 3HTXA 2LUPB 2V34A 1HNXI 2V2VA 4WPYA 4DV2I 1GZ6A 4UT4A 3LPSA 2V86A 5T6JA 2UXDE 3VYYA 2XEXA 4DV4E 2EFGA 3FIGA 2VF3A 4JI2I 4DKKA 2HFUA 4P7DA 1XMOI 3MSWA 1VISA 4WYQB 4DPUA 2UXCI 4NXME 2MDRA 4JI5I 2M7QA 4B3SE 2VQEI 2NA2A 1NHJA 4IZJA 5LMNI 3PYFA 1ZM9A 2L33A 2UXBI 3CWVA 2A2DA 4JI1E 4DR4E 4DR7E 1WUUA 4PRXA 5IWAE 4JYAE 4LFAI 1ZM2A 2R42A 1XMQI 2ZITA 4NXNE 3H09A 1J5EI 5ADZA 4DV7I 4B3MI 4XTJA 4USMA 2WW4A 1X49A 4L8NA 4LF6E 2M1SA 3QT8A 4DR1E 2PNMA 4GKJI 4P52A 3LLHA 4HYMA 4F9BB 1YYWA 5IT9C 3RMPA 3QT6A 3HQ1A 4X66I 2F4VI 1N34E 4IZJB 4I3HA 4K0KE 1NHHA 4DV3I 1OJ4A 4X65I 1X47A 2ODRD 3C4BA 5DNYA 4J8ZA 1HNWE 4BS9A 2UUCE 1N33E 1K47A 5FLXC 2NUEA 4M2ZA 3K6QA 2HK2A 4LF9I 3B82A 2JY9A 1HR0E 4B3RI 2B9DA 4Z7YA 1EKZA 1IBME 4HACA 1Z0CA 4KHPI 2LJHA 4X62E 4JI6I 2HHHE 4DV6E 2J7KA 4KQVA 4JI3I 1S16A 2JR1A 2L92A 1EA6A 3J7Yp 4FWGA 2HKEA 2BM1A 1NZ0A 4DV0I 4M1KA 4KZSA 4Q28A 3ZKBA 3ZOQB 2L2MA 3OTOI 1A6FA 2VQFI 2N3GA 1WHQA 4DU7A 1O0WA 4M30A 3VK6A 1HNXE 1IBLI 4DV2E 5GMEA 1USUA 1XHKA 2YZTA 5IT9Q 3J80C 2DEIA 3LNUA 4TUIA 2LTSA 5A2QC 4JI2E 2FTXB 1XMOE 5BR8I 5LMUI 4LF8I 4DR5I 3P1XA 4JI5E 2VQEE 1PIEA 5LMNE 4DV5I 4WUCA 2UXBE 1KVKA 1H72C 1H73A 1ZXMA 2E5LI 1DQ3A 1Y4SA 2RS7A 2JWOA 4GKKI 1HNZI 2UUBI 4LFAE 4Z7CA 3LTOA 1B62A 1XMQE 1ZM4A 4MYTA 3IWBA 4DPWA 1KKHA 1RR9A 4JI0I 4DV7E 4B3ME 2YT4A 3AV0A 3GONA 1DI2A 2WZOA 1Y4UA 1NHIA 2LMZA 4GKJE 2V88A 2E1RA 2FV4B 3C4TA 3Q1QA 4DU8A 3HXLA 4B3TI 4X66E 2F4VE 4OOGC 2V2ZA 2FGGA 4JV5I 2V2QA 4DPTA 3PYGA 3Q6NA 4DV3E 3DF6A 1USVA 1ZM3A 1PKPA 4F54A 2LJPA 2G7HA 5AE2A 3ZZUA 1S4EA 2B3TB 2DSYA 4LF5I 3J81Q 4LF9E 1N0VC 1Z5BA 1I94I 3IWCA 4PU9A 4UTGA 4LF4E 4B3RE 2V8PA 1XNRI 4KHPE 3T1YI 4JI6E 3KWRA 3P06A 1FWKA 4R03A 4FN5A 3PRYA 4JI3E 4AQYI 2RTXA 3ZZ0A 3QT7A 3V5RA 4DUZI 1J26A 4DV0E 4DMIA 3JU0A 2AJ4A 2R3VA 1FNMA 4DR2I 4HXZA 2VQFE 1N36I 2V89A 2GS8A 3ZM7A 3HPSA 1RREA 1Z0GA 2BM0A 1IBKI 1IBLE 2L6MA 2UU9I 2IHR1 2K4VA 1D6TA 4DUYI 3LMLA 4LFCI 4WSPA 4FWDA 3ADJA 5BR8E 4WUDA 2ZM6I 5LMUE 1WHNA 2JVAA 4LF8E 2M4IA 4DR5E 1WXRA 3T1HI 2KHXA 1STUA 4L5NC 1SR9A 1EI1A 1ZBQA 4DR1I 4BCAA 4DV5E 2LUQA 1FI4A 5F3WA 2JOBA 2HK3A 4YY3I 2CGEA 3D4JA 4JI7I 2E5LE 3PYEA 4X8WA 4WUBA 4GKKE 4M0VA 2RS6A 1U2RA 2UUBE 3B78A 3OMLA 4DR6I 4R8OA 2GQ0A 4LFBI 4MYUA 4P78A 1BKNA 1FJGI 5AASA 4JI0E 2OI2A 1Z0EA 1H7SA 2O1UA 2UUAI 4DPYA 4R1FA 2Q2EB 2UXCE 3B8HA 1N33I 4HACB 2DMYA 5AE1A 1Z0VA 5FWKA 3K17A 1YZ9A 1UILA 4PRVA 4ZVIA 2EZ6A 4X64I 5FLXQ 4IZJD 4URLA 1MX0A 4B3TE 1N32I 2A2CA 4DR3I 1ZBTA 2Z5BA 4F9CB 4JV5E 3F6HA 4FWHA 3JTZA 4BBYA 2HFSA 4DPXA 1PVGA 2CG9A 2ZBKB 4JI4I 2BV3A 2V87A 4TUGA 1J5EE 1Z0TA 1XNQI 4OX9I 2KOUA 3J7AG 2V8QB 4BC7A 1DARA 4BMJA 4F9AB 4LF5E 2B7TA 4JI8I 1I94E 1ZXNA 2O1VA 3HULA 2CPNA 4DV1I 2LE2A 1HK7A 3V2UC 1GQEA 2MC6A 2F8BA 1XNRE 3Q6MA 5GMDA 3T1YE 2Z5CA 3ZKDA 3M6AA 4AQYE 3J80Q 1T4LB 2DB2A 4X65E 1MG7A 5A2QQ 4DUZE 3ADGA 5LL6R 4LF7I 3JAMC 3WU6A 4DR2E 2Z5BB 3HPZA 1Z5AA 4YHHI 1N36E 3ADIA 2H36X 1IBKE 4EMDA 1QU6A 1MU5A 1YYKA 2IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 E;  2UXD I;  2L2N A;  3VYX A;  1YYO A;  4DV4 I;  4JG4 A;  4DUY E;  4LFC E;  3J7A M;  2ZM6 E;  3WU4 A;  2LRS A;  2NUG A;  5L3J A;  3T1H E;  1H7U A;  4NXM I;  4B3S I;  3OTO E;  3WU5 A;  3ADL A;  4YY3 E;  2NPF A;  2CZ9 A;  4JI1 I;  4DR4 I;  4DR7 I;  4JI7 E;  1ELO A;  5IWA I;  4JYA I;  3K1J A;  1KIJ A;  4DXL A;  4DR6 E;  2N3H A;  1Z59 A;  4LFB E;  4NXN I;  1FJG E;  4WFT A;  1T4N A;  3QT5 A;  2HKJ A;  2NUF A;  2UUA E;  2DIX A;  4LF6 I;  4RPF A;  1KTV A;  1Z5C A;  3JAM Q;  4FW9 A;  2RSM A;  1X48 A;  4LF4 I;  4X64 E;  4P7A A;  2X7I A;  1N32 E;  4DR3 E;  2DEJ A;  2L3C A;  1N34 I;  1HNZ E;  3PYD A;  1UHZ A;  4K0K I;  2L2K B;  1N0U A;  3WU3 A;  4JI4 E;  1T4O A;  1XNQ E;  4OX9 E;  1RC7 A;  2X36 A;  3ZZT A;  1HNW I;  2UUC I;  1RQ0 A;  2LTR A;  3H4L A;  1H74 A;  1UEK A;  2LBS B;  4ED4 A;  4JI8 E;  4USK A;  1HR0 I;  4DV1 E;  3F0N A;  1IBM I;  1FWL A;  5CFF E;  2L3J A;  1FKA E;  1Z0W A;  1B63 A;  1Z0B A;  4X62 I;  2HHH I;  4DV6 I;  2B7V A;  4HY1 A;  1QZR A;  4LF7 E;  3J81 C;  4YHH E;  3HTX A;  2LUP B;  2V34 A;  1HNX I;  2V2V A;  4DV2 I;  4UT4 A;  3LPS A;  2UXD E;  2XEX A;  3VYY A;  4DV4 E;  2EFG A;  2VF3 A;  4JI2 I;  4DKK A;  2HFU A;  1XMO I;  1VIS A;  4WYQ B;  4DPU A;  2UXC I;  4NXM E;  2MDR A;  4JI5 I;  4B3S E;  2VQE I;  2NA2 A;  1NHJ A;  5LMN I;  3PYF A;  1ZM9 A;  2L33 A;  2UXB I;  3CWV A;  2A2D A;  4JI1 E;  4DR4 E;  4DR7 E;  1WUU A;  4PRX A;  5IWA E;  4JYA E;  4LFA I;  1ZM2 A;  2R42 A;  1XMQ I;  2ZIT A;  4NXN E;  1J5E I;  4DV7 I;  4B3M I;  4XTJ A;  4USM A;  2WW4 A;  1X49 A;  4LF6 E;  3QT8 A;  4DR1 E;  4GKJ I;  4P52 A;  3LLH A;  4HYM A;  1YYW A;  5IT9 C;  3QT6 A;  4X66 I;  2F4V I;  1N34 E;  4I3H A;  4K0K E;  1NHH A;  4DV3 I;  1OJ4 A;  4X65 I;  1X47 A;  3C4B A;  1HNW E;  2UUC E;  1N33 E;  1K47 A;  5FLX C;  2NUE A;  4M2Z A;  2HK2 A;  4LF9 I;  3B82 A;  2JY9 A;  1HR0 E;  4B3R I;  4Z7Y A;  1EKZ A;  1IBM E;  4HAC A;  1Z0C A;  4KHP I;  2LJH A;  4X62 E;  4JI6 I;  2HHH E;  4DV6 E;  2J7K A;  4KQV A;  4JI3 I;  1S16 A;  1EA6 A;  4FWG A;  3J7Y p;  2HKE A;  2BM1 A;  1NZ0 A;  4DV0 I;  4M1K A;  3ZKB A;  2L2M A;  3OTO I;  1A6F A;  2VQF I;  2N3G A;  1WHQ A;  4DU7 A;  1O0W A;  4M30 A;  1HNX E;  1IBL I;  4DV2 E;  5GME A;  1XHK A;  5IT9 Q;  3J80 C;  2DEI A;  3LNU A;  2LTS A;  4JI2 E;  5A2Q C;  1XMO E;  5BR8 I;  5LMU I;  4LF8 I;  4DR5 I;  3P1X A;  4JI5 E;  2VQE E;  1PIE A;  5LMN E;  4DV5 I;  4WUC A;  2UXB E;  1KVK A;  1H72 C;  1H73 A;  1ZXM A;  2E5L I;  2RS7 A;  4GKK I;  1HNZ I;  2UUB I;  4LFA E;  4Z7C A;  3LTO A;  1B62 A;  1XMQ E;  1ZM4 A;  4MYT A;  4DPW A;  1KKH A;  1RR9 A;  4JI0 I;  4DV7 E;  4B3M E;  2YT4 A;  3GON A;  1DI2 A;  1NHI A;  4GKJ E;  2E1R A;  3C4T A;  3Q1Q A;  4DU8 A;  4B3T I;  4X66 E;  2F4V E;  4OOG C;  2V2Z A;  4JV5 I;  2V2Q A;  4DPT A;  3PYG A;  4DV3 E;  1ZM3 A;  1PKP A;  2LJP A;  3ZZU A;  1S4E A;  2B3T B;  4LF5 I;  3J81 Q;  4LF9 E;  1N0V C;  1Z5B A;  1I94 I;  4PU9 A;  4UTG A;  4LF4 E;  4B3R E;  2V8P A;  1XNR I;  4KHP E;  3T1Y I;  4JI6 E;  1FWK A;  4FN5 A;  4JI3 E;  4AQY I;  2RTX A;  3ZZ0 A;  3QT7 A;  3V5R A;  4DUZ I;  1J26 A;  4DV0 E;  2AJ4 A;  2R3V A;  1FNM A;  4DR2 I;  4HXZ A;  2VQF E;  1N36 I;  3ZM7 A;  2GS8 A;  1RRE A;  1Z0G A;  2BM0 A;  1IBK I;  1IBL E;  2UU9 I;  2IHR 1;  1D6T A;  4DUY I;  4LFC I;  4FWD A;  3ADJ A;  5BR8 E;  4WUD A;  2ZM6 I;  5LMU E;  1WHN A;  2JVA A;  4LF8 E;  4DR5 E;  3T1H I;  2KHX A;  1STU A;  1EI1 A;  4DR1 I;  4DV5 E;  2LUQ A;  1FI4 A;  2HK3 A;  4YY3 I;  3D4J A;  4JI7 I;  2E5L E;  3PYE A;  4X8W A;  4WUB A;  4GKK E;  2RS6 A;  1U2R A;  2UUB E;  3B78 A;  4DR6 I;  4LFB I;  4MYU A;  1BKN A;  1FJG I;  4JI0 E;  2OI2 A;  1Z0E A;  1H7S A;  2UUA I;  4DPY A;  4R1F A;  2Q2E B;  2UXC E;  3B8H A;  1N33 I;  4HAC B;  2DMY A;  1Z0V A;  3K17 A;  1YZ9 A;  1UIL A;  4PRV A;  4ZVI A;  2EZ6 A;  4X64 I;  5FLX Q;  4URL A;  1MX0 A;  4B3T E;  1N32 I;  2A2C A;  4DR3 I;  1ZBT A;  4JV5 E;  4FWH A;  2HFS A;  4DPX A;  1PVG A;  2ZBK B;  4JI4 I;  2BV3 A;  1J5E E;  1Z0T A;  1XNQ I;  4OX9 I;  3J7A G;  1DAR A;  4LF5 E;  2B7T A;  4JI8 I;  1I94 E;  1ZXN A;  3HUL A;  2CPN A;  4DV1 I;  3V2U C;  1GQE A;  1XNR E;  5GMD A;  3T1Y E;  3ZKD A;  3M6A A;  4AQY E;  3J80 Q;  1T4L B;  2DB2 A;  4X65 E;  1MG7 A;  5A2Q Q;  4DUZ E;  3ADG A;  5LL6 R;  4LF7 I;  3JAM C;  3WU6 A;  4DR2 E;  1Z5A A;  4YHH I;  1N36 E;  3ADI A;  1IBK E;  4EMD A;  1QU6 A;  1MU5 A;  1YYK A; 
#chains in the Genus database with same CATH topology
 2UU9 E;  2O1T A;  4IZK A;  4LTY A;  3GLL A;  4N3O A;  2UXD I;  2L2N A;  5AC5 A;  3VYX A;  4IS9 A;  4MQY A;  1YYO A;  4DV4 I;  4JG4 A;  4DUY E;  2EE8 A;  1T39 A;  1UDO A;  2EMX A;  4NBQ A;  3UHM A;  4LFC E;  3J7A M;  4BA2 A;  2ZM6 E;  3WU4 A;  2LRS A;  2DLK A;  2V85 A;  1WRJ A;  3DJW A;  3EQ1 A;  3T1H E;  2NUG A;  3AUZ A;  1H7U A;  5L3J A;  4NXM I;  3M85 G;  4B3S I;  5K36 A;  2JOX A;  2VES A;  4BHC A;  2Z5C B;  3OTO E;  3WU5 A;  2YTD A;  3ADL A;  4YY3 E;  2NPF A;  2CZ9 A;  2L8T A;  4JI1 I;  4DR4 I;  2IES A;  4JI7 E;  4DR7 I;  4U3D A;  4BC9 A;  2EOM A;  1ELO A;  5KL4 A;  5IWA I;  4JYA I;  3K1J A;  1KIJ A;  3THN A;  1QU6 A;  4DXL A;  4DR6 E;  2N3H A;  2E1M A;  3M99 B;  1Z59 A;  4LFB E;  2CVE A;  4NXN I;  1A1H A;  2WBT A;  2EM4 A;  1FJG E;  1Y60 A;  2O1W A;  4WFT A;  1T4N A;  2GO3 A;  3QT5 A;  2HKJ A;  2NUF A;  2UUA E;  4IZK B;  4GEQ B;  2DIX A;  5EKW A;  2YTE A;  2MKD A;  2WNR A;  4LF6 I;  4RPF A;  2MDG A;  1KTV A;  2MKN A;  2IOP A;  1Z5C A;  1UBD C;  2PNL A;  2D9H A;  2YTJ A;  3P3C A;  3U1K A;  3JAM Q;  1XXE A;  4IFD D;  3F6G A;  4IJD A;  2NN6 D;  2PO2 A;  4FW9 A;  4O43 A;  5EL9 A;  2RSM A;  1X48 A;  4LF4 I;  4X64 E;  4P7A A;  2X7I A;  1SFE A;  2EOF A;  2NAB A;  4I8O A;  2V83 A;  2VE7 C;  1JK1 A;  2I13 A;  3PS2 A;  1N32 E;  1YPN A;  5KL5 A;  2VF1 A;  4DR3 E;  2DEJ A;  2L3C A;  5JEA A;  4OO1 F;  1N34 I;  4MU3 A;  1HNZ E;  5K36 B;  3PYD A;  2EOX A;  1UHZ A;  4K0K I;  1P47 A;  3IWD A;  4RHB B;  2Z5E A;  2L2K B;  1R6L A;  2MC5 A;  1N0U A;  3P76 A;  3WU3 A;  3M7N G;  2YRM A;  2JYA A;  4JI4 E;  3ECR A;  1T4O A;  2EMY A;  1XNQ E;  2EL6 A;  4OX9 E;  4Q35 B;  1RC7 A;  2X36 A;  3ZZT A;  1HNW I;  2UUC I;  2ADR A;  1RQ0 A;  1F2I G;  2LTR A;  1H74 A;  1UEK A;  3H4L A;  2LBS B;  4ED4 A;  5C0X E;  4JI8 E;  4USK A;  4R2Q A;  3K85 A;  2EM6 A;  2EN6 A;  2EMK A;  1HR0 I;  4DV1 E;  3F0N A;  1R6M A;  2WBU A;  1IBM I;  1FWL A;  5CFF E;  2EN2 A;  2L3J A;  1FKA E;  1B63 A;  1Z0B A;  1Z0W A;  2N8X A;  2WNR B;  2CSH A;  4X62 I;  4BA1 A;  2HHH I;  4DV6 I;  1YH8 A;  4AM3 A;  2GLI A;  2B7V A;  2EWL A;  2EM2 A;  4FW5 A;  2EPZ A;  5TSE A;  3NZK A;  5AE3 A;  2KON A;  2PNZ A;  4HY1 A;  1X6E A;  3HJC A;  1QZR A;  1A1L A;  4LF7 E;  2EMG A;  1Y6Z A;  3J81 C;  4LCH A;  5JEA B;  3EPL A;  4LU9 A;  4YHH E;  2R1F A;  5DNX A;  3B4T A;  2HJJ A;  2GO4 A;  2BA1 G;  4F6M A;  3HTX A;  2LUP B;  2V34 A;  1HNX I;  2V2V A;  4WPY A;  4DV2 I;  2EPA A;  1GZ6 A;  2DRP A;  4UT4 A;  3LPS A;  2AE8 A;  2V86 A;  2JEA A;  5T6J A;  5A6B D;  3VYY A;  2UXD E;  2XEX A;  4LPF A;  3H1C A;  1YFH A;  4DV4 E;  2EFG A;  3FIG A;  2VF3 A;  4JI2 I;  4DKK A;  2HFU A;  4P7D A;  1XMO I;  3MSW A;  2CTD A;  1VIS A;  4WYQ B;  4DPU A;  4OKG A;  1VI7 A;  2UXC I;  4NXM E;  2MDR A;  5DRR A;  4JI5 I;  2M7Q A;  4B3S E;  4MU0 A;  4BA1 B;  2NA2 A;  1NHJ A;  2YSP A;  4IZJ A;  2VQE I;  3PYF A;  1ZM9 A;  5LMN I;  2HGH A;  2YU5 A;  2L33 A;  2UXB I;  3CWV A;  3C6M A;  3GCM A;  2A2D A;  3P3E A;  4AIM A;  4JI1 E;  4ZYG A;  4DR4 E;  4DR7 E;  2JT2 A;  2PNZ B;  4GQU A;  1WUU A;  4PRX A;  2BB8 A;  4MDT A;  5LLQ A;  5IWA E;  5K36 F;  4JYA E;  4O4K A;  2EPX A;  4LFA I;  1ZM2 A;  2DMI A;  4MU1 A;  2R42 A;  2EOE A;  2ZIT A;  1XMQ I;  1KJK A;  2PO1 A;  2JE6 A;  2JP9 A;  4NXN E;  3H09 A;  5C0X A;  1J5E I;  5ADZ A;  5ELW A;  4LCG A;  4DV7 I;  5KL7 A;  4B3M I;  1UN6 B;  4XTJ A;  2JEA B;  1T38 A;  4U3B A;  5DRP A;  4USM A;  2WW4 A;  3GME A;  1PDA A;  1X49 A;  1X5W A;  4L8N A;  1TF6 A;  4LF6 E;  4LCF A;  2M1S A;  1Y5Y A;  3QT8 A;  4DR1 E;  4MLQ A;  5A6B A;  2PNM A;  4GKJ I;  2EPM X;  2I9I A;  4P52 A;  4IFD E;  3LLH A;  4HYM A;  2NN6 E;  4F9B B;  4AID A;  1YYW A;  2ENA A;  1JK2 A;  4WSG A;  5IT9 C;  1OYS A;  3RMP A;  4OO1 E;  2BR2 A;  3QT6 A;  3HQ1 A;  4X66 I;  2F4V I;  2ENH A;  1N34 E;  2NN6 C;  4IZJ B;  4I3H A;  1MGT A;  2BBG A;  2EMZ A;  4K0K E;  1NHH A;  4NHR A;  4DV3 I;  2DLQ A;  1OJ4 A;  4X65 I;  1X47 A;  2EML A;  3CDI A;  2ODR D;  3C4B A;  5DNY A;  5JEA F;  4J8Z A;  1AH5 A;  1A1F A;  2EMI A;  5KL6 A;  1WJP A;  3BID A;  4BS9 A;  2UUC E;  1HNW E;  1N33 E;  1K47 A;  5FLX C;  2LV2 A;  1YSA C;  2EOH A;  2NUE A;  4M2Z A;  3K6Q A;  2PO1 B;  2HK2 A;  2JE6 B;  4LF9 I;  2EOJ A;  3B82 A;  5C0X B;  2JY9 A;  1HR0 E;  4BA2 B;  4B3R I;  2B9D A;  3BGH A;  4Z7Y A;  4OO1 D;  1EKZ A;  1IBM E;  4HAC A;  1Z0C A;  2EMB A;  4KHP I;  1L4S A;  2LJH A;  4X62 E;  4JI6 I;  2HHH E;  4DV6 E;  2J7K A;  2EOO A;  1EH6 A;  4KQV A;  1G2F C;  2GPI A;  1NCS A;  4JI3 I;  1S16 A;  1N3G A;  2GHF A;  2JR1 A;  2L92 A;  3J7Y p;  4F2J C;  1EA6 A;  2HKE A;  4FWG A;  4LOM A;  2WCC 3;  1NZ0 A;  2BM1 A;  3BBG A;  4DV0 I;  1OYR A;  4KZS A;  1RHY A;  4Q28 A;  4HTG A;  4WXD A;  2BR2 B;  4M1K A;  4R2D A;  3ZKB A;  3ZOQ B;  2L2M A;  3OTO I;  1A6F A;  2VQF I;  2N3G A;  1WHQ A;  3EPJ A;  4DU7 A;  1O0W A;  4M30 A;  3VK6 A;  1YHC A;  3M7N D;  5DRO A;  1HNX E;  1X6H A;  5DRQ A;  1IBL I;  4R2P A;  3BF2 A;  4DV2 E;  5GME A;  3TQM A;  2EQ1 A;  1USU A;  1XHK A;  5C0X C;  4R2R A;  2YZT A;  3KZY A;  3J80 C;  2DEI A;  3LNU A;  1YUJ A;  5IT9 Q;  4TUI A;  2LTS A;  4N4R B;  5A2Q C;  4JI2 E;  5A69 A;  4MU4 A;  2FTX B;  1XMO E;  3MHH C;  2PO2 B;  5LMU I;  5BR8 I;  4LF8 I;  4IFD A;  2WP8 A;  2EN1 A;  4IS1 C;  4DR5 I;  2ELZ A;  2NN6 A;  2EP3 A;  1KYQ A;  3P1X A;  4JI5 E;  1UDQ A;  2VQE E;  1PIE A;  5LMN E;  3HKM A;  4DV5 I;  2LCE A;  4ISA A;  2EL4 A;  4WUC A;  2UXB E;  2EN7 A;  1KVK A;  1H72 C;  2YTF A;  1H73 A;  2EM7 A;  1ZXM A;  2JPA A;  2E5L I;  1DQ3 A;  5K36 E;  4FK5 C;  1Y4S A;  2RS7 A;  2JWO A;  2R76 A;  3THO B;  4GKK I;  1HNZ I;  2UUB I;  4LFA E;  4Z7C A;  4J3D A;  3LTO A;  1BBO A;  1B62 A;  1XMQ E;  2EPO A;  1ZM4 A;  4MYT A;  3IWB A;  4DPW A;  2VRD A;  5AC4 A;  1KKH A;  1RR9 A;  4JI0 I;  4DV7 E;  4B3M E;  2YT4 A;  3AV0 A;  4FW7 A;  3GON A;  2M9A A;  1DI2 A;  2WZO A;  2YU8 A;  1DGC A;  1Y4U A;  2EPL X;  2PO0 A;  1NHI A;  2BA0 D;  2LMZ A;  4GKJ E;  3KRN A;  2YSO A;  2V88 A;  2E1R A;  5C0X F;  1QNT A;  2FV4 B;  4QNJ A;  3C4T A;  2LJU A;  3Q1Q A;  2WP8 B;  1B69 A;  3HXL A;  4DU8 A;  4IFD B;  5K36 D;  2NN6 B;  4B3T I;  4FW4 A;  1PJS A;  3VHT B;  2EM0 A;  3UK3 C;  4X66 E;  2F4V E;  3L00 A;  4OOG C;  3PS1 A;  2V2Z A;  2FGG A;  1A1I A;  4JV5 I;  2YRK A;  2F1D A;  2V2Q A;  4DPT A;  1A1G A;  3PYG A;  3PS3 A;  4O24 A;  3Q6N A;  2WBS A;  4DV3 E;  3DF6 A;  2EOY A;  2ENC A;  1USV A;  2EMC A;  1ZM3 A;  1PKP A;  5JEA E;  4F54 A;  2LJP A;  4NZV A;  2G7H A;  5AE2 A;  1IMU A;  2K7I A;  2YTP A;  3ZZU A;  1S4E A;  1Z1B A;  2EL5 A;  2B3T B;  2DSY A;  1NEI A;  4LF5 I;  3J81 Q;  1OYP A;  1IQO A;  4LF9 E;  1N0V C;  1Z5B A;  1I94 I;  3IWC A;  4PU9 A;  5KL2 A;  1EH7 A;  4UTG A;  2LT7 A;  4LF4 E;  4B3R E;  4ZYH A;  2CT1 A;  2V8P A;  2EMA A;  1XNR I;  5A6J A;  4IFD C;  3M85 D;  4KHP E;  3T1Y I;  2EOQ A;  4JI6 E;  3KWR A;  1UDN A;  3CDJ A;  3P06 A;  4X9J A;  1FWK A;  2PO0 B;  4R03 A;  4FN5 A;  3PRY A;  4JI3 E;  2EOR A;  2EPC A;  4AQY I;  4R2A A;  4OO1 C;  2RTX A;  3ZZ0 A;  1X3C A;  2RQL A;  1UDS A;  5JEA D;  5K36 C;  2EPU A;  3QT7 A;  3V5R A;  1X6F A;  4DUZ I;  1J26 A;  4DV0 E;  4DMI A;  3JU0 A;  2AJ4 A;  4KWY A;  2R3V A;  1FNM A;  4DR2 I;  4R2C A;  4R2E A;  4HXZ A;  2VQF E;  1N36 I;  2V89 A;  2GS8 A;  3ZM7 A;  1ZU1 A;  3HPS A;  1RRE A;  1Z0G A;  1LLM C;  2E72 A;  2BM0 A;  1IBK I;  1IBL E;  2L6M A;  2UU9 I;  2IHR 1;  2K4V A;  2EM8 A;  2RPC A;  1D6T A;  2YTG A;  1IQS A;  4DUY I;  2EM5 A;  3LML A;  2A25 A;  2EMF A;  5A6A A;  1A1K A;  1TN9 A;  4LFC I;  4WSP A;  4FWD A;  4GZN C;  3ADJ A;  5BR8 E;  4WUD A;  2ZM6 I;  5LMU E;  1WHN A;  1EH8 A;  2JVA A;  4LF8 E;  2M4I A;  2EM3 A;  4DR5 E;  2JEB A;  1WXR A;  3T1H I;  4WXC A;  2KHX A;  1E3P A;  1STU A;  1ZAA C;  2EPK X;  4L5N C;  2J7J A;  1SR9 A;  1EI1 A;  1ZBQ A;  2YTI A;  4DR1 I;  4R2S A;  2Q8U A;  2C39 A;  4BCA A;  2EMW A;  4DV5 E;  2LUQ A;  1FI4 A;  2C38 A;  5F3W A;  2JOB A;  4RH8 A;  2HK3 A;  5IV8 B;  2J65 A;  4YY3 I;  4IFD F;  2CGE A;  3D4J A;  4JI7 I;  2NN6 F;  5A6K A;  2YRH A;  2E5L E;  3PYE A;  1YUI A;  4X8W A;  1PJT A;  2EQ3 A;  4WUB A;  3U1Y A;  4GKK E;  4M0V A;  1E3H A;  2RS6 A;  1U2R A;  2UUB E;  3B78 A;  3OML A;  4M9V C;  4DR6 I;  5IXM B;  4R8O A;  2EOZ A;  1P42 A;  2EPN A;  2GQ0 A;  4LFB I;  4MYU A;  4P78 A;  1MEY C;  1TF3 A;  1BKN A;  1FJG I;  5AAS A;  4JI0 E;  5KL3 A;  2OI2 A;  1Z0E A;  2EM9 A;  1H7S A;  2O1U A;  2UUA I;  4DPY A;  4R1F A;  2Q2E B;  2EOS A;  2EPR A;  2UXC E;  3B8H A;  4HAC B;  1N33 I;  4ZYE A;  2C37 A;  2DMY A;  5AE1 A;  1Z0V A;  3EPK A;  1ZR9 A;  3K17 A;  4OO1 A;  1YZ9 A;  4O5G A;  5FWK A;  1UIL A;  2EPP A;  4ZYD A;  2YTO A;  4PRV A;  4ZVI A;  2JEB B;  3KZZ A;  2EZ6 A;  4X64 I;  5FLX Q;  2PRT A;  4IZJ D;  4URL A;  1GTK A;  1MX0 A;  4B3T E;  1N32 I;  2A2C A;  4DR3 I;  1ZBT A;  2Z5B A;  2EN4 A;  4F9C B;  4JV5 E;  2C39 B;  3F6H A;  2EN8 A;  3C6K A;  4FWH A;  4F6N A;  3JTZ A;  4BBY A;  2C38 B;  2BA1 D;  2HFS A;  3L7Z A;  1PVG A;  4DPX A;  2CG9 A;  2ZBK B;  1PJQ A;  2EN3 A;  2BV3 A;  2V87 A;  4JI4 I;  2LVH A;  4TUG A;  1J5E E;  1Z0T A;  1XNQ I;  4OX9 I;  2EMH A;  2KOU A;  2YPN A;  3EPH A;  4BHB A;  2HC5 A;  3J7A G;  1AAY A;  3P3G A;  2V8Q B;  4BC7 A;  3QG5 C;  2YTN A;  4BMJ A;  4F9A B;  1DAR A;  5C0X D;  4LF5 E;  2B7T A;  4WX9 A;  4JI8 I;  4MLV A;  1I94 E;  4HEI A;  1ZXN A;  2O1V A;  3HUL A;  2EQ0 A;  4QNK A;  2CPN A;  4DV1 I;  2EJ4 A;  2LE2 A;  2JXP A;  1HK7 A;  2IER A;  3V2U C;  1GQE A;  1RMD A;  2F8B A;  2MC6 A;  1BBG A;  1XNR E;  3DD6 A;  3Q6M A;  5GMD A;  2C37 B;  2ELY A;  3T1Y E;  1G2D C;  4OO1 B;  2Z5C A;  2BA0 G;  1BB8 A;  3ZKD A;  3M6A A;  5DNL A;  4AQY E;  3J80 Q;  2RSI A;  2YTQ A;  2DB2 A;  1T4L B;  4X65 E;  1MG7 A;  5A2Q Q;  4OZE A;  4DUZ E;  3ADG A;  3MHS C;  5LL6 R;  4LF7 I;  2EOI A;  2DGC A;  3JAM C;  1A1J A;  2O3Z A;  3WU6 A;  4DR2 E;  2Z5B B;  4FW6 A;  3HPZ A;  1Z5A A;  4YHH I;  1N36 E;  3ADI A;  4FW3 A;  5JEA C;  3L7Z B;  2H36 X;  1IBK E;  4EMD A;  2YWQ A;  2ODR C;  1MU5 A;  1YYK A;  2LO3 A;  2IOQ A; 
#chains in the Genus database with same CATH homology
 2UU9 E;  2O1T A;  4IZK A;  4LTY A;  4N3O A;  2UXD I;  2L2N A;  3VYX A;  1YYO A;  4DV4 I;  4JG4 A;  4DUY E;  4LFC E;  3J7A M;  2ZM6 E;  3WU4 A;  2LRS A;  2V85 A;  2NUG A;  3DJW A;  5L3J A;  3T1H E;  1H7U A;  3AUZ A;  4NXM I;  4B3S I;  2JOX A;  2Z5C B;  3OTO E;  3WU5 A;  3ADL A;  4YY3 E;  2NPF A;  2CZ9 A;  2L8T A;  4JI1 I;  4DR4 I;  4DR7 I;  4JI7 E;  4BC9 A;  1ELO A;  5IWA I;  4JYA I;  3K1J A;  1KIJ A;  2ODR C;  4DXL A;  4DR6 E;  2N3H A;  2E1M A;  1Z59 A;  4LFB E;  4NXN I;  1FJG E;  2O1W A;  4WFT A;  1T4N A;  3QT5 A;  2HKJ A;  2NUF A;  2UUA E;  4IZK B;  4GEQ B;  2DIX A;  4LF6 I;  4RPF A;  1KTV A;  2PNL A;  2IOP A;  1Z5C A;  3JAM Q;  3F6G A;  4FW9 A;  2RSM A;  1X48 A;  4LF4 I;  4X64 E;  4P7A A;  2X7I A;  4I8O A;  2V83 A;  2VE7 C;  1N32 E;  2VF1 A;  4DR3 E;  2DEJ A;  2L3C A;  1N34 I;  1HNZ E;  3PYD A;  1UHZ A;  4K0K I;  3IWD A;  2Z5E A;  2L2K B;  2MC5 A;  1N0U A;  3WU3 A;  4JI4 E;  1T4O A;  1XNQ E;  4OX9 E;  1RC7 A;  2X36 A;  3ZZT A;  1HNW I;  2UUC I;  1RQ0 A;  2LTR A;  1H74 A;  1UEK A;  3H4L A;  2LBS B;  4ED4 A;  4JI8 E;  4USK A;  3K85 A;  1HR0 I;  4DV1 E;  3F0N A;  1IBM I;  1FWL A;  5CFF E;  2L3J A;  1FKA E;  1Z0W A;  1B63 A;  1Z0B A;  4X62 I;  2HHH I;  4DV6 I;  2B7V A;  2EWL A;  5AE3 A;  2KON A;  4HY1 A;  3HJC A;  1QZR A;  4LF7 E;  1Y6Z A;  3J81 C;  4LU9 A;  4YHH E;  3HTX A;  2LUP B;  2V34 A;  1HNX I;  2V2V A;  4WPY A;  4DV2 I;  1GZ6 A;  4UT4 A;  3LPS A;  2V86 A;  5T6J A;  2UXD E;  3VYY A;  2XEX A;  4DV4 E;  2EFG A;  3FIG A;  2VF3 A;  4JI2 I;  4DKK A;  2HFU A;  4P7D A;  1XMO I;  3MSW A;  1VIS A;  4WYQ B;  4DPU A;  2UXC I;  4NXM E;  2MDR A;  4JI5 I;  2M7Q A;  4B3S E;  2VQE I;  2NA2 A;  1NHJ A;  4IZJ A;  5LMN I;  3PYF A;  1ZM9 A;  2L33 A;  2UXB I;  3CWV A;  2A2D A;  4JI1 E;  4DR4 E;  4DR7 E;  1WUU A;  4PRX A;  5IWA E;  4JYA E;  4LFA I;  1ZM2 A;  2R42 A;  1XMQ I;  2ZIT A;  4NXN E;  3H09 A;  1J5E I;  5ADZ A;  4DV7 I;  4B3M I;  4XTJ A;  4USM A;  2WW4 A;  1X49 A;  4L8N A;  4LF6 E;  2M1S A;  3QT8 A;  4DR1 E;  2PNM A;  4GKJ I;  4P52 A;  3LLH A;  4HYM A;  4F9B B;  1YYW A;  5IT9 C;  3RMP A;  3QT6 A;  3HQ1 A;  4X66 I;  2F4V I;  1N34 E;  4IZJ B;  4I3H A;  4K0K E;  1NHH A;  4DV3 I;  1OJ4 A;  4X65 I;  1X47 A;  2ODR D;  3C4B A;  5DNY A;  4J8Z A;  1HNW E;  4BS9 A;  2UUC E;  1N33 E;  1K47 A;  5FLX C;  2NUE A;  4M2Z A;  3K6Q A;  2HK2 A;  4LF9 I;  3B82 A;  2JY9 A;  1HR0 E;  4B3R I;  2B9D A;  4Z7Y A;  1EKZ A;  1IBM E;  4HAC A;  1Z0C A;  4KHP I;  2LJH A;  4X62 E;  4JI6 I;  2HHH E;  4DV6 E;  2J7K A;  4KQV A;  4JI3 I;  1S16 A;  2JR1 A;  2L92 A;  1EA6 A;  3J7Y p;  4FWG A;  2HKE A;  2BM1 A;  1NZ0 A;  4DV0 I;  4M1K A;  4KZS A;  4Q28 A;  3ZKB A;  3ZOQ B;  2L2M A;  3OTO I;  1A6F A;  2VQF I;  2N3G A;  1WHQ A;  4DU7 A;  1O0W A;  4M30 A;  3VK6 A;  1HNX E;  1IBL I;  4DV2 E;  5GME A;  1USU A;  1XHK A;  2YZT A;  5IT9 Q;  3J80 C;  2DEI A;  3LNU A;  4TUI A;  2LTS A;  5A2Q C;  4JI2 E;  2FTX B;  1XMO E;  5BR8 I;  5LMU I;  4LF8 I;  4DR5 I;  3P1X A;  4JI5 E;  2VQE E;  1PIE A;  5LMN E;  4DV5 I;  4WUC A;  2UXB E;  1KVK A;  1H72 C;  1H73 A;  1ZXM A;  2E5L I;  1DQ3 A;  1Y4S A;  2RS7 A;  2JWO A;  4GKK I;  1HNZ I;  2UUB I;  4LFA E;  4Z7C A;  3LTO A;  1B62 A;  1XMQ E;  1ZM4 A;  4MYT A;  3IWB A;  4DPW A;  1KKH A;  1RR9 A;  4JI0 I;  4DV7 E;  4B3M E;  2YT4 A;  3AV0 A;  3GON A;  1DI2 A;  2WZO A;  1Y4U A;  1NHI A;  2LMZ A;  4GKJ E;  2V88 A;  2E1R A;  2FV4 B;  3C4T A;  3Q1Q A;  4DU8 A;  3HXL A;  4B3T I;  4X66 E;  2F4V E;  4OOG C;  2V2Z A;  2FGG A;  4JV5 I;  2V2Q A;  4DPT A;  3PYG A;  3Q6N A;  4DV3 E;  3DF6 A;  1USV A;  1ZM3 A;  1PKP A;  4F54 A;  2LJP A;  2G7H A;  5AE2 A;  3ZZU A;  1S4E A;  2B3T B;  2DSY A;  4LF5 I;  3J81 Q;  4LF9 E;  1N0V C;  1Z5B A;  1I94 I;  3IWC A;  4PU9 A;  4UTG A;  4LF4 E;  4B3R E;  2V8P A;  1XNR I;  4KHP E;  3T1Y I;  4JI6 E;  3KWR A;  3P06 A;  1FWK A;  4R03 A;  4FN5 A;  3PRY A;  4JI3 E;  4AQY I;  2RTX A;  3ZZ0 A;  3QT7 A;  3V5R A;  4DUZ I;  1J26 A;  4DV0 E;  4DMI A;  3JU0 A;  2AJ4 A;  2R3V A;  1FNM A;  4DR2 I;  4HXZ A;  2VQF E;  1N36 I;  2V89 A;  2GS8 A;  3ZM7 A;  3HPS A;  1RRE A;  1Z0G A;  2BM0 A;  1IBK I;  1IBL E;  2L6M A;  2UU9 I;  2IHR 1;  2K4V A;  1D6T A;  4DUY I;  3LML A;  4LFC I;  4WSP A;  4FWD A;  3ADJ A;  5BR8 E;  4WUD A;  2ZM6 I;  5LMU E;  1WHN A;  2JVA A;  4LF8 E;  2M4I A;  4DR5 E;  1WXR A;  3T1H I;  2KHX A;  1STU A;  4L5N C;  1SR9 A;  1EI1 A;  1ZBQ A;  4DR1 I;  4BCA A;  4DV5 E;  2LUQ A;  1FI4 A;  5F3W A;  2JOB A;  2HK3 A;  4YY3 I;  2CGE A;  3D4J A;  4JI7 I;  2E5L E;  3PYE A;  4X8W A;  4WUB A;  4GKK E;  4M0V A;  2RS6 A;  1U2R A;  2UUB E;  3B78 A;  3OML A;  4DR6 I;  4R8O A;  2GQ0 A;  4LFB I;  4MYU A;  4P78 A;  1BKN A;  1FJG I;  5AAS A;  4JI0 E;  2OI2 A;  1Z0E A;  1H7S A;  2O1U A;  2UUA I;  4DPY A;  4R1F A;  2Q2E B;  2UXC E;  3B8H A;  1N33 I;  4HAC B;  2DMY A;  5AE1 A;  1Z0V A;  5FWK A;  3K17 A;  1YZ9 A;  1UIL A;  4PRV A;  4ZVI A;  2EZ6 A;  4X64 I;  5FLX Q;  4IZJ D;  4URL A;  1MX0 A;  4B3T E;  1N32 I;  2A2C A;  4DR3 I;  1ZBT A;  2Z5B A;  4F9C B;  4JV5 E;  3F6H A;  4FWH A;  3JTZ A;  4BBY A;  2HFS A;  4DPX A;  1PVG A;  2CG9 A;  2ZBK B;  4JI4 I;  2BV3 A;  2V87 A;  4TUG A;  1J5E E;  1Z0T A;  1XNQ I;  4OX9 I;  2KOU A;  3J7A G;  2V8Q B;  4BC7 A;  1DAR A;  4BMJ A;  4F9A B;  4LF5 E;  2B7T A;  4JI8 I;  1I94 E;  1ZXN A;  2O1V A;  3HUL A;  2CPN A;  4DV1 I;  2LE2 A;  1HK7 A;  3V2U C;  1GQE A;  2MC6 A;  2F8B A;  1XNR E;  3Q6M A;  5GMD A;  3T1Y E;  2Z5C A;  3ZKD A;  3M6A A;  4AQY E;  3J80 Q;  1T4L B;  2DB2 A;  4X65 E;  1MG7 A;  5A2Q Q;  4DUZ E;  3ADG A;  5LL6 R;  4LF7 I;  3JAM C;  3WU6 A;  4DR2 E;  2Z5B B;  3HPZ A;  1Z5A A;  4YHH I;  1N36 E;  3ADI A;  2H36 X;  1IBK E;  4EMD A;  1QU6 A;  1MU5 A;  1YYK A;  2IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...