4DV1I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv1I00
1I94I 2V2ZA 4ZVIA 3D4JA 1ZXMA 2UUCI 1IBME 3ZZUA 3V5RA 4JI6I 4FW9A 4NXNE 1H74A 4FWGA 4OX9I 1ZM9A 5LL6R 4YHHI 1H7SA 2BM0A 4MYTA 3OTOI 5A2QC 1FJGI 4DPYA 1N33E 1NHIA 5IT9Q 2BV3A 1NHHA 1N33I 5BR8E 4K0KE 4JI0E 1S16A 4KHPI 4DR1E 4DV2I 3M6AA 4K0KI 2V8PA 2V2VA 3PYEA 2F4VI 1MG7A 3LNUA 1Z59A 3B82A 4DR2E 1IBKE 4USMA 4HY1A 5LMNI 4HACA 4DR2I 4DPTA 3JAMC 1Z0VA 1ZM3A 1Z5CA 4B3RE 1H73A 2HHHE 1XHKA 3QT5A 2UXCE 4FWDA 4LF9I 2R3VA 4DR7E 2VQEI 2HHHI 4FN5A 1B63A 5FLXQ 4B3TI 4DV0E 4JI3I 1XMOI 4PU9A 1EA6A 4EMDA 1N36I 2GS8A 3QT7A 4DR6I 4HACB 1HNXI 4DUYI 3ZZTA 1XNQI 4Z7YA 4HXZA 1BKNA 1HR0I 4NXME 4DR3E 3T1YE 1PVGA 4JI1I 2AJ4A 3WU3A 3J7AM 1ZM2A 2HK2A 1I94E 4WUCA 4AQYE 4JV5E 3F0NA 4LFAE 2UUCE 3QT6A 4DU8A 4DR5I 5IT9C 1FWLA 4JI6E 1FNMA 4AQYI 4JV5I 4LFAI 4DPXA 2VF3A 4OX9E 1Z0CA 4P52A 2UXDI 3K1JA 4DV1I 4JI8I 4ED4A 4YHHE 4JI5I 2E1RA 1J5EE 3OTOE 1Z0GA 4X65I 1S4EA 1XMQI 4DXLA 4LFBI 1RR9A 1FJGE 2UUBI 4DV6E 2X36A 1J5EI 1KTVA 2A2DA 4HYMA 4DPUA 4DV6I 3LPSA 1Z0WA 1PKPA 4KHPE 2VQFI 1A6FA 2ZM6I 5GMDA 4DV2E 4LF7I 4JI2E 1H7UA 4JYAE 2F4VE 3T1HI 2A2CA 1XNRE 4JI2I 1HNZI 4JYAI 4PRVA 1XNRI 1MX0A 5LMNE 2E5LI 1ZXNA 5FLXC 2DEJA 4DU7A 2R42A 4MYUA 4DR4I 3PYGA 1VISA 2J7KA 2UUAI 2HKEA 1Z0TA 4LF9E 1IBLE 2VQEE 4X64I 4Z7CA 4B3TE 4JI3E 1IBLI 1XMOE 4X62I 4DV3I 1PIEA 1N36E 4JI7I 4GKJI 4DR6E 3WU4A 1HNXE 3ZZ0A 4DUYE 1XNQE 4LF6E 2V34A 2UU9E 2V2QA 1ELOA 1HR0E 4B3SI 3HULA 1N32E 4JI1E 3V2UC 1ZM4A 1KIJA 1QZRA 2ZITA 4LF6I 2UU9I 3LTOA 4X66I 2HFSA 2NPFA 1N32I 2Q2EB 3J80Q 4DR5E 4WUBA 3ZKDA 2X7IA 3CWVA 4DV7I 1WUUA 1H72C 3J81Q 2UXDE 1U2RA 3PYDA 5L3JA 4JI8E 3H4LA 4DV1E 2HFUA 3K17A 4JI5E 1Z0BA 2HK3A 1D6TA 4DV4E 4X65E 1XMQE 4LF5I 4LFBE 2LJPA 2UUBE 4LF8E 3ZKBA 5GMEA 4DV4I 4FWHA 1KKHA 4DV5I 1FWKA 1NZ0A 1NHJA 4LF8I 5LMUI 2VQFE 2ZM6E 2UXBI 5IWAE 4LF7E 4JG4A 3T1HE 3WU6A 5IWAI 1IBMI 1K47A 3PYFA 4LF4E 1HNZE 4YY3E 4PRXA 2OI2A 4NXNI 1FKAE 2E5LE 4LF4I 4YY3I 3Q1QA 1EI1A 4DR4E 1HNWE 1RREA 4URLA 2HKJA 2UUAE 1HNWI 4R1FA 1UEKA 5BR8I 4JI0I 4USKA 2ZBKB 3ZM7A 4X64E 4DR1I 4XTJA 4M1KA 1Z5AA 4X62E 3J80C 5A2QQ 1B62A 4DV3E 4JI7E 3B8HA 4GKJE 1Z0EA 4GKKE 1IBKI 3J81C 4RPFA 1N0UA 4B3SE 4P7AA 4GKKI 1KVKA 4X66E 1OJ4A 4B3RI 4KQVA 4DPWA 2UXCI 1Z5BA 4DR7I 4DV7E 1FI4A 3GONA 4JI4E 4WUDA 4I3HA 3QT8A 4DV0I 3J7AG 4JI4I 1N0VC 2DEIA 4LF5E 2BM1A 1N34E 4B3ME 3JAMQ 1MU5A 4DUZE 2WW4A 3WU5A 4UT4A 1N34I 4DV5E 4B3MI 2CZ9A 4LFCE 4DUZI 4NXMI 3B78A 5LMUE 2XEXA 4DR3I 1DARA 3T1YI 2UXBE 4UTGA 2EFGA 4LFCI
chains in the Genus database with same CATH superfamily
5DRQA 1I94I 2V2ZA 4ZVIA 3D4JA 1ZXMA 4LCHA 2UUCI 4FW7A 1IBME 3ZZUA 3V5RA 4JI6I 5K36B 2PO0A 4FW9A 4NXNE 1H74A 4FWGA 4LCFA 5C0XE 4OX9I 1YHCA 1ZM9A 3U1KA 4IFDB 5LL6R 4YHHI 1H7SA 2BM0A 2BA1D 4BA2A 4MYTA 3OTOI 1RHYA 5EKWA 5A2QC 2PNLA 1FJGI 4DPYA 1N33E 1NHIA 2BR2A 2WP8A 5C0XB 5IT9Q 4OO1B 2BV3A 1NHHA 1N33I 5BR8E 4K0KE 4JI0E 1S16A 4KHPI 4DR1E 4DV2I 2GO3A 2O1TA 3M6AA 4K0KI 2V8PA 3K85A 2V2VA 1Y60A 3PYEA 2F4VI 1MG7A 4U3DA 3LNUA 2PO0B 1Z59A 3B82A 3M7ND 4DR2E 1OYSA 2IOQA 1IBKE 4BA2B 4USMA 4HY1A 5LMNI 2GQ0A 4IZKA 4GQUA 4HACA 2O1UA 4MQYA 4DR2I 2WP8B 2PO2B 4DPTA 3JAMC 1Z0VA 1OYRA 1ZM3A 1Z5CA 4B3RE 3P3EA 1H73A 2HHHE 1XHKA 3QT5A 2UXCE 2JE6A 4FWDA 4LF9I 5K36C 2R3VA 4U3BA 2VQEI 4DR7E 5DROA 2HHHI 4FN5A 1B63A 5FLXQ 4J3DA 4B3TI 4N3OA 4DV0E 4JI3I 3Q6NA 1XMOI 5JEAF 4PU9A 1EA6A 4EMDA 1N36I 4MU4A 4OKGA 4IZKB 2GS8A 3QT7A 4DR6I 4HACB 4IZJD 1XXEA 4IFDA 1HNXI 4DUYI 3ZZTA 1XNQI 4Z7YA 4HXZA 1BKNA 1HR0I 4NXME 4DR3E 3T1YE 1PVGA 4IZJA 4JI1I 4LPFA 2AJ4A 1P42A 3WU3A 3J7AM 1ZM2A 5C0XA 2HK2A 1I94E 4OO1A 2CG9A 4WUCA 4AQYE 4JV5E 3F0NA 4LFAE 2UUCE 3QT6A 4DU8A 4DR5I 1Y6ZA 2PNZA 5IT9C 1FWLA 4JI6E 1FNMA 4AQYI 4JV5I 4LFAI 4DPXA 2VF3A 4OX9E 1Z0CA 4P52A 2UXDI 3K1JA 4DV1I 4JI8I 1Y4UA 5JEAD 4ED4A 4YHHE 4JI5I 2E1RA 1J5EE 3OTOE 1Z0GA 4X65I 2Z5EA 1S4EA 1XMQI 4DXLA 4FW5A 4LFBI 1RR9A 1FJGE 5FWKA 2UUBI 4DV6E 2X36A 2O1WA 3P76A 4NBQA 1J5EI 2IERA 1KTVA 2A2DA 4HYMA 4IZJB 4DPUA 4DV6I 1VI7A 2NN6F 3LPSA 1Z0WA 1PKPA 4KHPE 2PO2A 2VQFI 3M85G 1A6FA 2ZM6I 5GMDA 4DV2E 4LF7I 4JI2E 1USVA 1H7UA 2PNZB 4JYAE 5JEAE 2F4VE 3T1HI 2A2CA 2NN6C 1XNRE 2C37A 3U1YA 2Z5BA 5DRRA 4JI2I 2PNMA 2AE8A 1HNZI 4JYAI 2C39B 3NZKA 4PRVA 2O1VA 1R6LA 1XNRI 1MX0A 5LMNE 3KRNA 4BA1B 2E5LI 1ZXNA 5FLXC 2DEJA 5JEAB 4DU7A 2R42A 3CDJA 4MYUA 4DR4I 2BA0G 3PYGA 1VISA 4QNJA 2CGEA 2J7KA 2NN6D 2UUAI 2HKEA 5K36F 1R6MA 1Z0TA 3GLLA 3UHMA 4LF9E 1IBLE 2WNRB 2VQEE 4X64I 4Z7CA 4B3TE 1UDSA 2C37B 2Z5BB 4JI3E 1IBLI 1XMOE 4X62I 4DV3I 1PIEA 4IFDC 1N36E 2VESA 4JI7I 4GKJI 4DR6E 3WU4A 3H1CA 1E3HA 3ZZ0A 4DUYE 1HNXE 1XNQE 4LF6E 2V34A 2NN6E 2V2QA 2UU9E 1ELOA 1HR0E 4B3SI 3HULA 3P06A 5C0XC 1N32E 4JI1E 3V2UC 4OO1C 1ZM4A 1KIJA 1USUA 1QZRA 2ZITA 5ELWA 4LF6I 2UU9I 3PS2A 3LTOA 4X66I 2HFSA 2NPFA 5K36D 1N32I 2Q2EB 3J80Q 4DR5E 2IESA 1UDQA 3Q6MA 4WUBA 3ZKDA 2F1DA 2X7IA 3CWVA 4DV7I 1WUUA 2C38B 4AM3A 1H72C 3J81Q 2UXDE 1U2RA 3PYDA 5L3JA 4JI8E 3H4LA 4MU0A 4DV1E 2HFUA 3K17A 4JI5E 1Z0BA 4ISAA 2HK3A 1D6TA 2JT2A 4AIMA 3DD6A 4DV4E 2GO4A 3HKMA 4X65E 4FW3A 1XMQE 4LF5I 4LFBE 2LJPA 2C39A 3CDIA 2UUBE 4LF8E 4AIDA 3ZKBA 5GMEA 4DV4I 5K36E 4BA1A 4FWHA 1KKHA 4DV5I 1FWKA 1NZ0A 5JEAA 2JEAB 1NHJA 4LF8I 4LCGA 4IFDE 5LMUI 2VQFE 1UDOA 2ZM6E 2UXBI 3PS3A 5IWAE 4LF7E 5DNXA 3M85D 4JG4A 3T1HE 3WU6A 5IWAI 2WNRA 4FW6A 1IBMI 4OO1E 1K47A 3PYFA 4LF4E 1HNZE 4YY3E 2PO1A 1Y5YA 4PRXA 2OI2A 4NXNI 1FKAE 5EL9A 2BA1G 2E5LE 4LF4I 4MU1A 4YY3I 3Q1QA 5DRPA 2J65A 1EI1A 2Z5CB 4DR4E 1HNWE 3L7ZB 1RREA 3GCMA 3P3CA 2BA0D 4URLA 2HKJA 2UUAE 1HNWI 4R1FA 1UEKA 5BR8I 4JI0I 4USKA 2ZBKB 3ZM7A 4X64E 4LOMA 4DR1I 4XTJA 4M1KA 3PS1A 1OYPA 3M7NG 4IFDF 1Z5AA 2NN6A 4X62E 3P3GA 4FW4A 2PO1B 3J80C 5A2QQ 1B62A 4DV3E 4JI7E 3B8HA 4GKJE 1Z0EA 2C38A 2JEBA 1E3PA 4GKKE 2BR2B 5C0XF 1IBKI 4OO1F 3J81C 4MU3A 4RPFA 1N0UA 4B3SE 4P7AA 4GKKI 1KVKA 4IS9A 4X66E 1OJ4A 2JEAA 4B3RI 4KQVA 3GMEA 5DNLA 4DPWA 2UXCI 2CVEA 2O3ZA 1Z5BA 4DR7I 4DV7E 1FI4A 3GONA 4JI4E 2NN6B 4MDTA 4WUDA 4IFDD 4I3HA 5K36A 4QNKA 3HJCA 3QT8A 1HK7A 4DV0I 3J7AG 1Y4SA 4JI4I 1N0VC 2DEIA 4LF5E 2BM1A 2IOPA 2JEBB 1N34E 4B3ME 3B4TA 3JAMQ 1MU5A 4DUZE 5JEAC 5C0XD 2WW4A 3WU5A 4OO1D 4UT4A 1N34I 4DV5E 4B3MI 2CZ9A 1UDNA 4LFCE 4DUZI 2Z5CA 4NXMI 3B78A 5LMUE 2XEXA 4DR3I 1DARA 3T1YI 1YH8A 3L7ZA 4UTGA 3PRYA 4OZEA 2JE6B 2EFGA 2UXBE 4LFCI
chains in the Genus database with same CATH topology
1I94I 2V2ZA 4ZVIA 3D4JA 1ZXMA 2UUCI 1IBME 3ZZUA 3V5RA 4JI6I 4FW9A 4NXNE 1H74A 4FWGA 4OX9I 1ZM9A 5LL6R 4YHHI 1H7SA 2BM0A 4MYTA 3OTOI 5A2QC 2PNLA 1FJGI 4DPYA 1N33E 1NHIA 5IT9Q 2BV3A 1NHHA 1N33I 5BR8E 4K0KE 4JI0E 1S16A 4KHPI 4DR1E 4DV2I 2O1TA 3M6AA 4K0KI 2V8PA 3K85A 2V2VA 3PYEA 2F4VI 1MG7A 3LNUA 1Z59A 3B82A 4DR2E 2IOQA 1IBKE 4USMA 4HY1A 5LMNI 2GQ0A 4IZKA 4HACA 2O1UA 4DR2I 4DPTA 3JAMC 1Z0VA 1ZM3A 1Z5CA 4B3RE 1H73A 2HHHE 1XHKA 3QT5A 2UXCE 4FWDA 4LF9I 2R3VA 4DR7E 2VQEI 2HHHI 4FN5A 1B63A 5FLXQ 4B3TI 4N3OA 4DV0E 4JI3I 3Q6NA 1XMOI 4PU9A 1EA6A 4EMDA 1N36I 4IZKB 2GS8A 3QT7A 4DR6I 4HACB 4IZJD 1HNXI 4DUYI 3ZZTA 1XNQI 4Z7YA 4HXZA 1BKNA 1HR0I 4NXME 4DR3E 3T1YE 1PVGA 4IZJA 4JI1I 2AJ4A 3WU3A 3J7AM 1ZM2A 2HK2A 1I94E 2CG9A 4WUCA 4AQYE 4JV5E 3F0NA 4LFAE 2UUCE 3QT6A 4DU8A 4DR5I 1Y6ZA 5IT9C 1FWLA 4JI6E 1FNMA 4AQYI 4JV5I 4LFAI 4DPXA 2VF3A 4OX9E 1Z0CA 4P52A 2UXDI 3K1JA 4DV1I 4JI8I 1Y4UA 4ED4A 4YHHE 4JI5I 2E1RA 1J5EE 3OTOE 1Z0GA 4X65I 2Z5EA 1S4EA 1XMQI 4DXLA 4LFBI 1RR9A 1FJGE 5FWKA 2UUBI 4DV6E 2X36A 2O1WA 1J5EI 1KTVA 2A2DA 4HYMA 4IZJB 4DPUA 4DV6I 3LPSA 1Z0WA 1PKPA 4KHPE 2VQFI 1A6FA 2ZM6I 5GMDA 4DV2E 4LF7I 4JI2E 1USVA 1H7UA 4JYAE 2F4VE 3T1HI 2A2CA 1XNRE 2Z5BA 4JI2I 2PNMA 1HNZI 4JYAI 4PRVA 2O1VA 1XNRI 1MX0A 5LMNE 2E5LI 1ZXNA 5FLXC 2DEJA 4DU7A 2R42A 4MYUA 4DR4I 3PYGA 1VISA 2CGEA 2J7KA 2UUAI 2HKEA 1Z0TA 4LF9E 1IBLE 2VQEE 4X64I 4Z7CA 4B3TE 2Z5BB 4JI3E 1IBLI 1XMOE 4X62I 4DV3I 1PIEA 1N36E 4JI7I 4GKJI 4DR6E 3WU4A 1HNXE 3ZZ0A 4DUYE 1XNQE 4LF6E 2V34A 2UU9E 2V2QA 1ELOA 1HR0E 4B3SI 3HULA 3P06A 1N32E 4JI1E 3V2UC 1ZM4A 1KIJA 1USUA 1QZRA 2ZITA 4LF6I 2UU9I 3LTOA 4X66I 2HFSA 2NPFA 1N32I 2Q2EB 3J80Q 4DR5E 3Q6MA 4WUBA 3ZKDA 2X7IA 3CWVA 4DV7I 1WUUA 1H72C 3J81Q 2UXDE 1U2RA 3PYDA 5L3JA 4JI8E 3H4LA 4DV1E 2HFUA 3K17A 4JI5E 1Z0BA 2HK3A 1D6TA 4DV4E 4X65E 1XMQE 4LF5I 4LFBE 2LJPA 2UUBE 4LF8E 3ZKBA 5GMEA 4DV4I 4FWHA 1KKHA 4DV5I 1FWKA 1NZ0A 1NHJA 4LF8I 5LMUI 2VQFE 2ZM6E 2UXBI 5IWAE 4LF7E 4JG4A 3T1HE 3WU6A 5IWAI 1IBMI 1K47A 3PYFA 4LF4E 1HNZE 4YY3E 4PRXA 2OI2A 4NXNI 1FKAE 2E5LE 4LF4I 4YY3I 3Q1QA 1EI1A 2Z5CB 4DR4E 1HNWE 1RREA 4URLA 2HKJA 2UUAE 1HNWI 4R1FA 1UEKA 5BR8I 4JI0I 4USKA 2ZBKB 3ZM7A 4X64E 4DR1I 4XTJA 4M1KA 1Z5AA 4X62E 3J80C 5A2QQ 1B62A 4DV3E 4JI7E 3B8HA 4GKJE 1Z0EA 4GKKE 1IBKI 3J81C 4RPFA 1N0UA 4B3SE 4P7AA 4GKKI 1KVKA 4X66E 1OJ4A 4B3RI 4KQVA 4DPWA 2UXCI 1Z5BA 4DR7I 4DV7E 1FI4A 3GONA 4JI4E 4WUDA 4I3HA 3HJCA 3QT8A 1HK7A 4DV0I 3J7AG 1Y4SA 4JI4I 1N0VC 2DEIA 4LF5E 2BM1A 2IOPA 1N34E 4B3ME 3JAMQ 1MU5A 4DUZE 2WW4A 3WU5A 4UT4A 1N34I 4DV5E 4B3MI 2CZ9A 4LFCE 4DUZI 2Z5CA 4NXMI 3B78A 5LMUE 2XEXA 4DR3I 1DARA 3T1YI 3PRYA 4UTGA 2UXBE 2EFGA 4LFCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 I;  2V2Z A;  4ZVI A;  3D4J A;  1ZXM A;  2UUC I;  1IBM E;  3ZZU A;  3V5R A;  4JI6 I;  4FW9 A;  4NXN E;  1H74 A;  4FWG A;  4OX9 I;  1ZM9 A;  5LL6 R;  4YHH I;  1H7S A;  2BM0 A;  4MYT A;  3OTO I;  5A2Q C;  1FJG I;  4DPY A;  1N33 E;  1NHI A;  5IT9 Q;  2BV3 A;  1NHH A;  1N33 I;  5BR8 E;  4K0K E;  4JI0 E;  1S16 A;  4KHP I;  4DR1 E;  4DV2 I;  3M6A A;  4K0K I;  2V8P A;  2V2V A;  3PYE A;  2F4V I;  1MG7 A;  3LNU A;  1Z59 A;  3B82 A;  4DR2 E;  1IBK E;  4USM A;  4HY1 A;  5LMN I;  4HAC A;  4DR2 I;  4DPT A;  3JAM C;  1Z0V A;  1ZM3 A;  1Z5C A;  4B3R E;  1H73 A;  2HHH E;  1XHK A;  3QT5 A;  2UXC E;  4FWD A;  4LF9 I;  2R3V A;  4DR7 E;  2VQE I;  2HHH I;  4FN5 A;  1B63 A;  5FLX Q;  4B3T I;  4DV0 E;  4JI3 I;  1XMO I;  4PU9 A;  1EA6 A;  4EMD A;  1N36 I;  2GS8 A;  3QT7 A;  4DR6 I;  4HAC B;  1HNX I;  4DUY I;  3ZZT A;  1XNQ I;  4Z7Y A;  4HXZ A;  1BKN A;  1HR0 I;  4NXM E;  4DR3 E;  3T1Y E;  1PVG A;  4JI1 I;  2AJ4 A;  3WU3 A;  3J7A M;  1ZM2 A;  2HK2 A;  1I94 E;  4WUC A;  4AQY E;  4JV5 E;  3F0N A;  4LFA E;  2UUC E;  3QT6 A;  4DU8 A;  4DR5 I;  5IT9 C;  1FWL A;  4JI6 E;  1FNM A;  4AQY I;  4JV5 I;  4LFA I;  4DPX A;  2VF3 A;  4OX9 E;  1Z0C A;  4P52 A;  2UXD I;  3K1J A;  4DV1 I;  4JI8 I;  4ED4 A;  4YHH E;  4JI5 I;  2E1R A;  1J5E E;  3OTO E;  1Z0G A;  4X65 I;  1S4E A;  1XMQ I;  4DXL A;  4LFB I;  1RR9 A;  1FJG E;  2UUB I;  4DV6 E;  2X36 A;  1J5E I;  1KTV A;  2A2D A;  4HYM A;  4DPU A;  4DV6 I;  3LPS A;  1Z0W A;  1PKP A;  4KHP E;  2VQF I;  1A6F A;  2ZM6 I;  5GMD A;  4DV2 E;  4LF7 I;  4JI2 E;  1H7U A;  4JYA E;  2F4V E;  3T1H I;  2A2C A;  1XNR E;  4JI2 I;  1HNZ I;  4JYA I;  4PRV A;  1XNR I;  1MX0 A;  5LMN E;  2E5L I;  1ZXN A;  5FLX C;  2DEJ A;  4DU7 A;  2R42 A;  4MYU A;  4DR4 I;  3PYG A;  1VIS A;  2J7K A;  2UUA I;  2HKE A;  1Z0T A;  4LF9 E;  1IBL E;  2VQE E;  4X64 I;  4Z7C A;  4B3T E;  4JI3 E;  1IBL I;  1XMO E;  4X62 I;  4DV3 I;  1PIE A;  1N36 E;  4JI7 I;  4GKJ I;  4DR6 E;  3WU4 A;  1HNX E;  3ZZ0 A;  4DUY E;  1XNQ E;  4LF6 E;  2V34 A;  2UU9 E;  2V2Q A;  1ELO A;  1HR0 E;  4B3S I;  3HUL A;  1N32 E;  4JI1 E;  3V2U C;  1ZM4 A;  1KIJ A;  1QZR A;  2ZIT A;  4LF6 I;  2UU9 I;  3LTO A;  4X66 I;  2HFS A;  2NPF A;  1N32 I;  2Q2E B;  3J80 Q;  4DR5 E;  4WUB A;  3ZKD A;  2X7I A;  3CWV A;  4DV7 I;  1WUU A;  1H72 C;  3J81 Q;  2UXD E;  1U2R A;  3PYD A;  5L3J A;  4JI8 E;  3H4L A;  4DV1 E;  2HFU A;  3K17 A;  4JI5 E;  1Z0B A;  2HK3 A;  1D6T A;  4DV4 E;  4X65 E;  1XMQ E;  4LF5 I;  4LFB E;  2LJP A;  2UUB E;  4LF8 E;  3ZKB A;  5GME A;  4DV4 I;  4FWH A;  1KKH A;  4DV5 I;  1FWK A;  1NZ0 A;  1NHJ A;  4LF8 I;  5LMU I;  2VQF E;  2ZM6 E;  2UXB I;  5IWA E;  4LF7 E;  4JG4 A;  3T1H E;  3WU6 A;  5IWA I;  1IBM I;  1K47 A;  3PYF A;  4LF4 E;  1HNZ E;  4YY3 E;  4PRX A;  2OI2 A;  4NXN I;  1FKA E;  2E5L E;  4LF4 I;  4YY3 I;  3Q1Q A;  1EI1 A;  4DR4 E;  1HNW E;  1RRE A;  4URL A;  2HKJ A;  2UUA E;  1HNW I;  4R1F A;  1UEK A;  5BR8 I;  4JI0 I;  4USK A;  2ZBK B;  3ZM7 A;  4X64 E;  4DR1 I;  4XTJ A;  4M1K A;  1Z5A A;  4X62 E;  3J80 C;  5A2Q Q;  1B62 A;  4DV3 E;  4JI7 E;  3B8H A;  4GKJ E;  1Z0E A;  4GKK E;  1IBK I;  3J81 C;  4RPF A;  1N0U A;  4B3S E;  4P7A A;  4GKK I;  1KVK A;  4X66 E;  1OJ4 A;  4B3R I;  4KQV A;  4DPW A;  2UXC I;  1Z5B A;  4DR7 I;  4DV7 E;  1FI4 A;  3GON A;  4JI4 E;  4WUD A;  4I3H A;  3QT8 A;  4DV0 I;  3J7A G;  4JI4 I;  1N0V C;  2DEI A;  4LF5 E;  2BM1 A;  1N34 E;  4B3M E;  3JAM Q;  1MU5 A;  4DUZ E;  2WW4 A;  3WU5 A;  4UT4 A;  1N34 I;  4DV5 E;  4B3M I;  2CZ9 A;  4LFC E;  4DUZ I;  4NXM I;  3B78 A;  5LMU E;  2XEX A;  4DR3 I;  1DAR A;  3T1Y I;  2UXB E;  4UTG A;  2EFG A;  4LFC I; 
#chains in the Genus database with same CATH topology
 5DRQ A;  1I94 I;  2V2Z A;  4ZVI A;  3D4J A;  1ZXM A;  4LCH A;  2UUC I;  4FW7 A;  1IBM E;  3ZZU A;  3V5R A;  4JI6 I;  5K36 B;  2PO0 A;  4FW9 A;  4NXN E;  1H74 A;  4FWG A;  4LCF A;  5C0X E;  4OX9 I;  1YHC A;  1ZM9 A;  3U1K A;  4IFD B;  5LL6 R;  4YHH I;  1H7S A;  2BM0 A;  2BA1 D;  4BA2 A;  4MYT A;  3OTO I;  1RHY A;  5EKW A;  5A2Q C;  2PNL A;  1FJG I;  4DPY A;  1N33 E;  1NHI A;  2BR2 A;  2WP8 A;  5C0X B;  5IT9 Q;  4OO1 B;  2BV3 A;  1NHH A;  1N33 I;  5BR8 E;  4K0K E;  4JI0 E;  1S16 A;  4KHP I;  4DR1 E;  4DV2 I;  2GO3 A;  2O1T A;  3M6A A;  4K0K I;  2V8P A;  3K85 A;  2V2V A;  1Y60 A;  3PYE A;  2F4V I;  1MG7 A;  4U3D A;  3LNU A;  2PO0 B;  1Z59 A;  3B82 A;  3M7N D;  4DR2 E;  1OYS A;  2IOQ A;  1IBK E;  4BA2 B;  4USM A;  4HY1 A;  5LMN I;  2GQ0 A;  4IZK A;  4GQU A;  4HAC A;  2O1U A;  4MQY A;  4DR2 I;  2WP8 B;  2PO2 B;  4DPT A;  3JAM C;  1Z0V A;  1OYR A;  1ZM3 A;  1Z5C A;  4B3R E;  3P3E A;  1H73 A;  2HHH E;  1XHK A;  3QT5 A;  2UXC E;  2JE6 A;  4FWD A;  4LF9 I;  5K36 C;  2R3V A;  4U3B A;  2VQE I;  4DR7 E;  5DRO A;  2HHH I;  4FN5 A;  1B63 A;  5FLX Q;  4J3D A;  4B3T I;  4N3O A;  4DV0 E;  4JI3 I;  3Q6N A;  1XMO I;  5JEA F;  4PU9 A;  1EA6 A;  4EMD A;  1N36 I;  4MU4 A;  4OKG A;  4IZK B;  2GS8 A;  3QT7 A;  4DR6 I;  4HAC B;  4IZJ D;  1XXE A;  4IFD A;  1HNX I;  4DUY I;  3ZZT A;  1XNQ I;  4Z7Y A;  4HXZ A;  1BKN A;  1HR0 I;  4NXM E;  4DR3 E;  3T1Y E;  1PVG A;  4IZJ A;  4JI1 I;  4LPF A;  2AJ4 A;  1P42 A;  3WU3 A;  3J7A M;  1ZM2 A;  5C0X A;  2HK2 A;  1I94 E;  4OO1 A;  2CG9 A;  4WUC A;  4AQY E;  4JV5 E;  3F0N A;  4LFA E;  2UUC E;  3QT6 A;  4DU8 A;  4DR5 I;  1Y6Z A;  2PNZ A;  5IT9 C;  1FWL A;  4JI6 E;  1FNM A;  4AQY I;  4JV5 I;  4LFA I;  4DPX A;  2VF3 A;  4OX9 E;  1Z0C A;  4P52 A;  2UXD I;  3K1J A;  4DV1 I;  4JI8 I;  1Y4U A;  5JEA D;  4ED4 A;  4YHH E;  4JI5 I;  2E1R A;  1J5E E;  3OTO E;  1Z0G A;  4X65 I;  2Z5E A;  1S4E A;  1XMQ I;  4DXL A;  4FW5 A;  4LFB I;  1RR9 A;  1FJG E;  5FWK A;  2UUB I;  4DV6 E;  2X36 A;  2O1W A;  3P76 A;  4NBQ A;  1J5E I;  2IER A;  1KTV A;  2A2D A;  4HYM A;  4IZJ B;  4DPU A;  4DV6 I;  1VI7 A;  2NN6 F;  3LPS A;  1Z0W A;  1PKP A;  4KHP E;  2PO2 A;  2VQF I;  3M85 G;  1A6F A;  2ZM6 I;  5GMD A;  4DV2 E;  4LF7 I;  4JI2 E;  1USV A;  1H7U A;  2PNZ B;  4JYA E;  5JEA E;  2F4V E;  3T1H I;  2A2C A;  2NN6 C;  1XNR E;  2C37 A;  3U1Y A;  2Z5B A;  5DRR A;  4JI2 I;  2PNM A;  2AE8 A;  1HNZ I;  4JYA I;  2C39 B;  3NZK A;  4PRV A;  2O1V A;  1R6L A;  1XNR I;  1MX0 A;  5LMN E;  3KRN A;  4BA1 B;  2E5L I;  1ZXN A;  5FLX C;  2DEJ A;  5JEA B;  4DU7 A;  2R42 A;  3CDJ A;  4MYU A;  4DR4 I;  2BA0 G;  3PYG A;  1VIS A;  4QNJ A;  2CGE A;  2J7K A;  2NN6 D;  2UUA I;  2HKE A;  5K36 F;  1R6M A;  1Z0T A;  3GLL A;  3UHM A;  4LF9 E;  1IBL E;  2WNR B;  2VQE E;  4X64 I;  4Z7C A;  4B3T E;  1UDS A;  2C37 B;  2Z5B B;  4JI3 E;  1IBL I;  1XMO E;  4X62 I;  4DV3 I;  1PIE A;  4IFD C;  1N36 E;  2VES A;  4JI7 I;  4GKJ I;  4DR6 E;  3WU4 A;  3H1C A;  1E3H A;  3ZZ0 A;  4DUY E;  1HNX E;  1XNQ E;  4LF6 E;  2V34 A;  2NN6 E;  2V2Q A;  2UU9 E;  1ELO A;  1HR0 E;  4B3S I;  3HUL A;  3P06 A;  5C0X C;  1N32 E;  4JI1 E;  3V2U C;  4OO1 C;  1ZM4 A;  1KIJ A;  1USU A;  1QZR A;  2ZIT A;  5ELW A;  4LF6 I;  2UU9 I;  3PS2 A;  3LTO A;  4X66 I;  2HFS A;  2NPF A;  5K36 D;  1N32 I;  2Q2E B;  3J80 Q;  4DR5 E;  2IES A;  1UDQ A;  3Q6M A;  4WUB A;  3ZKD A;  2F1D A;  2X7I A;  3CWV A;  4DV7 I;  1WUU A;  2C38 B;  4AM3 A;  1H72 C;  3J81 Q;  2UXD E;  1U2R A;  3PYD A;  5L3J A;  4JI8 E;  3H4L A;  4MU0 A;  4DV1 E;  2HFU A;  3K17 A;  4JI5 E;  1Z0B A;  4ISA A;  2HK3 A;  1D6T A;  2JT2 A;  4AIM A;  3DD6 A;  4DV4 E;  2GO4 A;  3HKM A;  4X65 E;  4FW3 A;  1XMQ E;  4LF5 I;  4LFB E;  2LJP A;  2C39 A;  3CDI A;  2UUB E;  4LF8 E;  4AID A;  3ZKB A;  5GME A;  4DV4 I;  5K36 E;  4BA1 A;  4FWH A;  1KKH A;  4DV5 I;  1FWK A;  1NZ0 A;  5JEA A;  2JEA B;  1NHJ A;  4LF8 I;  4LCG A;  4IFD E;  5LMU I;  2VQF E;  1UDO A;  2ZM6 E;  2UXB I;  3PS3 A;  5IWA E;  4LF7 E;  5DNX A;  3M85 D;  4JG4 A;  3T1H E;  3WU6 A;  5IWA I;  2WNR A;  4FW6 A;  1IBM I;  4OO1 E;  1K47 A;  3PYF A;  4LF4 E;  1HNZ E;  4YY3 E;  2PO1 A;  1Y5Y A;  4PRX A;  2OI2 A;  4NXN I;  1FKA E;  5EL9 A;  2BA1 G;  2E5L E;  4LF4 I;  4MU1 A;  4YY3 I;  3Q1Q A;  5DRP A;  2J65 A;  1EI1 A;  2Z5C B;  4DR4 E;  1HNW E;  3L7Z B;  1RRE A;  3GCM A;  3P3C A;  2BA0 D;  4URL A;  2HKJ A;  2UUA E;  1HNW I;  4R1F A;  1UEK A;  5BR8 I;  4JI0 I;  4USK A;  2ZBK B;  3ZM7 A;  4X64 E;  4LOM A;  4DR1 I;  4XTJ A;  4M1K A;  3PS1 A;  1OYP A;  3M7N G;  4IFD F;  1Z5A A;  2NN6 A;  4X62 E;  3P3G A;  4FW4 A;  2PO1 B;  3J80 C;  5A2Q Q;  1B62 A;  4DV3 E;  4JI7 E;  3B8H A;  4GKJ E;  1Z0E A;  2C38 A;  2JEB A;  1E3P A;  4GKK E;  2BR2 B;  5C0X F;  1IBK I;  4OO1 F;  3J81 C;  4MU3 A;  4RPF A;  1N0U A;  4B3S E;  4P7A A;  4GKK I;  1KVK A;  4IS9 A;  4X66 E;  1OJ4 A;  2JEA A;  4B3R I;  4KQV A;  3GME A;  5DNL A;  4DPW A;  2UXC I;  2CVE A;  2O3Z A;  1Z5B A;  4DR7 I;  4DV7 E;  1FI4 A;  3GON A;  4JI4 E;  2NN6 B;  4MDT A;  4WUD A;  4IFD D;  4I3H A;  5K36 A;  4QNK A;  3HJC A;  3QT8 A;  1HK7 A;  4DV0 I;  3J7A G;  1Y4S A;  4JI4 I;  1N0V C;  2DEI A;  4LF5 E;  2BM1 A;  2IOP A;  2JEB B;  1N34 E;  4B3M E;  3B4T A;  3JAM Q;  1MU5 A;  4DUZ E;  5JEA C;  5C0X D;  2WW4 A;  3WU5 A;  4OO1 D;  4UT4 A;  1N34 I;  4DV5 E;  4B3M I;  2CZ9 A;  1UDN A;  4LFC E;  4DUZ I;  2Z5C A;  4NXM I;  3B78 A;  5LMU E;  2XEX A;  4DR3 I;  1DAR A;  3T1Y I;  1YH8 A;  3L7Z A;  4UTG A;  3PRY A;  4OZE A;  2JE6 B;  2EFG A;  2UXB E;  4LFC I; 
#chains in the Genus database with same CATH homology
 1I94 I;  2V2Z A;  4ZVI A;  3D4J A;  1ZXM A;  2UUC I;  1IBM E;  3ZZU A;  3V5R A;  4JI6 I;  4FW9 A;  4NXN E;  1H74 A;  4FWG A;  4OX9 I;  1ZM9 A;  5LL6 R;  4YHH I;  1H7S A;  2BM0 A;  4MYT A;  3OTO I;  5A2Q C;  2PNL A;  1FJG I;  4DPY A;  1N33 E;  1NHI A;  5IT9 Q;  2BV3 A;  1NHH A;  1N33 I;  5BR8 E;  4K0K E;  4JI0 E;  1S16 A;  4KHP I;  4DR1 E;  4DV2 I;  2O1T A;  3M6A A;  4K0K I;  2V8P A;  3K85 A;  2V2V A;  3PYE A;  2F4V I;  1MG7 A;  3LNU A;  1Z59 A;  3B82 A;  4DR2 E;  2IOQ A;  1IBK E;  4USM A;  4HY1 A;  5LMN I;  2GQ0 A;  4IZK A;  4HAC A;  2O1U A;  4DR2 I;  4DPT A;  3JAM C;  1Z0V A;  1ZM3 A;  1Z5C A;  4B3R E;  1H73 A;  2HHH E;  1XHK A;  3QT5 A;  2UXC E;  4FWD A;  4LF9 I;  2R3V A;  4DR7 E;  2VQE I;  2HHH I;  4FN5 A;  1B63 A;  5FLX Q;  4B3T I;  4N3O A;  4DV0 E;  4JI3 I;  3Q6N A;  1XMO I;  4PU9 A;  1EA6 A;  4EMD A;  1N36 I;  4IZK B;  2GS8 A;  3QT7 A;  4DR6 I;  4HAC B;  4IZJ D;  1HNX I;  4DUY I;  3ZZT A;  1XNQ I;  4Z7Y A;  4HXZ A;  1BKN A;  1HR0 I;  4NXM E;  4DR3 E;  3T1Y E;  1PVG A;  4IZJ A;  4JI1 I;  2AJ4 A;  3WU3 A;  3J7A M;  1ZM2 A;  2HK2 A;  1I94 E;  2CG9 A;  4WUC A;  4AQY E;  4JV5 E;  3F0N A;  4LFA E;  2UUC E;  3QT6 A;  4DU8 A;  4DR5 I;  1Y6Z A;  5IT9 C;  1FWL A;  4JI6 E;  1FNM A;  4AQY I;  4JV5 I;  4LFA I;  4DPX A;  2VF3 A;  4OX9 E;  1Z0C A;  4P52 A;  2UXD I;  3K1J A;  4DV1 I;  4JI8 I;  1Y4U A;  4ED4 A;  4YHH E;  4JI5 I;  2E1R A;  1J5E E;  3OTO E;  1Z0G A;  4X65 I;  2Z5E A;  1S4E A;  1XMQ I;  4DXL A;  4LFB I;  1RR9 A;  1FJG E;  5FWK A;  2UUB I;  4DV6 E;  2X36 A;  2O1W A;  1J5E I;  1KTV A;  2A2D A;  4HYM A;  4IZJ B;  4DPU A;  4DV6 I;  3LPS A;  1Z0W A;  1PKP A;  4KHP E;  2VQF I;  1A6F A;  2ZM6 I;  5GMD A;  4DV2 E;  4LF7 I;  4JI2 E;  1USV A;  1H7U A;  4JYA E;  2F4V E;  3T1H I;  2A2C A;  1XNR E;  2Z5B A;  4JI2 I;  2PNM A;  1HNZ I;  4JYA I;  4PRV A;  2O1V A;  1XNR I;  1MX0 A;  5LMN E;  2E5L I;  1ZXN A;  5FLX C;  2DEJ A;  4DU7 A;  2R42 A;  4MYU A;  4DR4 I;  3PYG A;  1VIS A;  2CGE A;  2J7K A;  2UUA I;  2HKE A;  1Z0T A;  4LF9 E;  1IBL E;  2VQE E;  4X64 I;  4Z7C A;  4B3T E;  2Z5B B;  4JI3 E;  1IBL I;  1XMO E;  4X62 I;  4DV3 I;  1PIE A;  1N36 E;  4JI7 I;  4GKJ I;  4DR6 E;  3WU4 A;  1HNX E;  3ZZ0 A;  4DUY E;  1XNQ E;  4LF6 E;  2V34 A;  2UU9 E;  2V2Q A;  1ELO A;  1HR0 E;  4B3S I;  3HUL A;  3P06 A;  1N32 E;  4JI1 E;  3V2U C;  1ZM4 A;  1KIJ A;  1USU A;  1QZR A;  2ZIT A;  4LF6 I;  2UU9 I;  3LTO A;  4X66 I;  2HFS A;  2NPF A;  1N32 I;  2Q2E B;  3J80 Q;  4DR5 E;  3Q6M A;  4WUB A;  3ZKD A;  2X7I A;  3CWV A;  4DV7 I;  1WUU A;  1H72 C;  3J81 Q;  2UXD E;  1U2R A;  3PYD A;  5L3J A;  4JI8 E;  3H4L A;  4DV1 E;  2HFU A;  3K17 A;  4JI5 E;  1Z0B A;  2HK3 A;  1D6T A;  4DV4 E;  4X65 E;  1XMQ E;  4LF5 I;  4LFB E;  2LJP A;  2UUB E;  4LF8 E;  3ZKB A;  5GME A;  4DV4 I;  4FWH A;  1KKH A;  4DV5 I;  1FWK A;  1NZ0 A;  1NHJ A;  4LF8 I;  5LMU I;  2VQF E;  2ZM6 E;  2UXB I;  5IWA E;  4LF7 E;  4JG4 A;  3T1H E;  3WU6 A;  5IWA I;  1IBM I;  1K47 A;  3PYF A;  4LF4 E;  1HNZ E;  4YY3 E;  4PRX A;  2OI2 A;  4NXN I;  1FKA E;  2E5L E;  4LF4 I;  4YY3 I;  3Q1Q A;  1EI1 A;  2Z5C B;  4DR4 E;  1HNW E;  1RRE A;  4URL A;  2HKJ A;  2UUA E;  1HNW I;  4R1F A;  1UEK A;  5BR8 I;  4JI0 I;  4USK A;  2ZBK B;  3ZM7 A;  4X64 E;  4DR1 I;  4XTJ A;  4M1K A;  1Z5A A;  4X62 E;  3J80 C;  5A2Q Q;  1B62 A;  4DV3 E;  4JI7 E;  3B8H A;  4GKJ E;  1Z0E A;  4GKK E;  1IBK I;  3J81 C;  4RPF A;  1N0U A;  4B3S E;  4P7A A;  4GKK I;  1KVK A;  4X66 E;  1OJ4 A;  4B3R I;  4KQV A;  4DPW A;  2UXC I;  1Z5B A;  4DR7 I;  4DV7 E;  1FI4 A;  3GON A;  4JI4 E;  4WUD A;  4I3H A;  3HJC A;  3QT8 A;  1HK7 A;  4DV0 I;  3J7A G;  1Y4S A;  4JI4 I;  1N0V C;  2DEI A;  4LF5 E;  2BM1 A;  2IOP A;  1N34 E;  4B3M E;  3JAM Q;  1MU5 A;  4DUZ E;  2WW4 A;  3WU5 A;  4UT4 A;  1N34 I;  4DV5 E;  4B3M I;  2CZ9 A;  4LFC E;  4DUZ I;  2Z5C A;  4NXM I;  3B78 A;  5LMU E;  2XEX A;  4DR3 I;  1DAR A;  3T1Y I;  3PRY A;  4UTG A;  2UXB E;  2EFG A;  4LFC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...