4DV1I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv1I00
4LF9I 4DUZE 2UUAE 4DR3E 2HHHE 4B3SI 2VF3A 4B3RI 4URLA 2X7IA 1N36I 1IBLI 2AJ4A 1K47A 3WU4A 1NZ0A 1I94E 2R3VA 1FKAE 4DV7I 1NHJA 3B82A 3LTOA 1ELOA 3WU5A 4JI7I 1HR0I 2Q2EB 2VQFE 1N34I 4DR6I 2BV3A 4JG4A 3WU6A 5FLXC 3QT5A 5BR8I 4DV6I 4K0KI 4DV5I 3B78A 3HULA 4LF9E 3T1HE 1BKNA 2A2DA 4OX9I 4B3SE 4B3RE 2V2VA 1N0VC 4B3MI 1N36E 4DPYA 1IBLE 1HNZI 1OJ4A 2V2QA 4DV7E 4JV5I 2DEIA 1ZXNA 1QZRA 1HR0E 3JAMQ 1XMQI 1N34E 4DR6E 4JI1I 1D6TA 5A2QC 4MYUA 2E5LI 3B8HA 2UXCI 3PYFA 5IWAI 3J80Q 5BR8E 1Z0CA 2OI2A 4DV6E 4K0KE 4JI4I 4DV5E 1MX0A 4OX9E 3H4LA 2HFSA 4B3ME 4PRXA 4DR5I 2UUCI 2X36A 4X66I 1HNZE 4JI0E 1HNWI 4DR4I 4JV5E 4LFBI 4YHHI 1H74A 3PYDA 1WUUA 4GKJI 2VQEI 3J7AG 3F0NA 1XMQE 2VQFI 4JI8I 4JI1E 4NXNI 1MU5A 4UTGA 2UXCE 3V5RA 4DV3I 1EI1A 4HACB 4JI4E 3J81C 4RPFA 3T1HI 2WW4A 4FWHA 5LMNI 4DV2I 4FW9A 2DEJA 1NHHA 4DR5E 2UUCE 4X66E 1IBMI 1HNWE 4DPTA 4DR4E 4LFBE 4YHHE 4ED4A 2R42A 4P7AA 4XTJA 4GKJE 2VQEE 4JI8E 4NXNE 1PVGA 1H73A 4DU8A 3V2UC 2BM0A 2V8PA 1B63A 1ZM9A 4DV3E 1HNXI 3PYGA 4PU9A 3M6AA 4WUDA 4LF5I 1ZXMA 5LMNE 4DV2E 4JI5E 1Z5BA 4JI0I 4JI3I 1IBME 4DXLA 1XNRI 4HXZA 4ZVIA 3CWVA 1B62A 3ZZ0A 4P52A 1S16A 4JYAI 1Z0BA 3ZM7A 1A6FA 4LF4I 1Z0VA 1IBKI 3LPSA 1HNXE 3PYEA 2UXBI 1MG7A 4USKA 1PIEA 1FWLA 2BM1A 1XNQI 4LF7I 4LF5E 1FJGI 4KQVA 1XMOI 4JI3E 4X65I 4DV0I 4NXMI 1J5EI 4R1FA 4LFCI 1XNRE 1H7UA 4GKKI 4LF6I 1XHKA 2HKEA 1ZM3A 4JYAE 4WUCA 4DV4I 4M1KA 1Z5AA 3D4JA 4LF4E 3QT8A 1IBKE 4DR7I 5FLXQ 1KIJA 1Z59A 4LF8I 2UXBE 2EFGA 4FWDA 1RR9A 4JI2I 3WU3A 2UUBI 1XNQE 5LMUI 4WUBA 4LF7E 4X62I 1FJGE 1ZM4A 4EMDA 1N32I 5IT9C 3LNUA 4JI5I 4DR2I 1XMOE 3J7AM 4X65E 4DV0E 4NXME 1J5EE 3J80C 4FN5A 4LFCE 1RREA 2CZ9A 1FNMA 4GKKE 4LF6E 2LJPA 4HY1A 2HK2A 1S4EA 4JI6I 4DV4E 3T1YI 1N0UA 1KVKA 1EA6A 5A2QQ 4DR7E 3QT7A 1Z0TA 4HYMA 4LF8E 2V34A 2ZITA 4JI2E 1VISA 1FI4A 1H72C 2UUBE 5LMUE 4YY3I 4X64I 4X62E 3ZZUA 4Z7YA 1NHIA 1N32E 4DR2E 4KHPI 2UU9I 4AQYI 2ZBKB 1FWKA 3K17A 2XEXA 4DPXA 1Z5CA 2UXDI 3ZKBA 4B3TI 4DUYI 4Z7CA 4JI6E 3T1YE 4DR1I 3GONA 2E1RA 4HACA 3ZZTA 4LFAI 4DV1I 3J81Q 4FWGA 4YY3E 4JI7E 2ZM6I 4X64E 1KKHA 2A2CA 4USMA 3Q1QA 5IT9Q 4KHPE 5GMEA 2UU9E 4AQYE 1DARA 3OTOI 1N33I 4MYTA 1Z0EA 5GMDA 2J7KA 2F4VI 2UXDE 4B3TE 4DUYE 2UUAI 2GS8A 1H7SA 4DPUA 4DUZI 4DR3I 2HHHI 1Z0GA 1Z0WA 4DR1E 1I94I 3K1JA 4PRVA 4LFAE 4DU7A 4DV1E 1PKPA 3JAMC 2ZM6E 2V2ZA 5LL6R 2NPFA 2HKJA 2E5LE 1KTVA 3QT6A 3ZKDA 3OTOE 5L3JA 1ZM2A 1U2RA 5IWAE 1UEKA 2HK3A 4I3HA 1N33E 4UT4A 4DPWA 2F4VE 2HFUA
chains in the Genus database with same CATH superfamily
2NN6C 4LF9I 4BA1A 4DUZE 2UUAE 4DR3E 2HHHE 4B3SI 2VF3A 4B3RI 4URLA 2X7IA 1N36I 1R6MA 1IBLI 5K36C 2AJ4A 1K47A 3WU4A 1NZ0A 1OYRA 1I94E 2R3VA 1FKAE 4DV7I 5JEAE 4IS9A 1NHJA 5DRQA 2J65A 3B82A 3LTOA 1ELOA 3NZKA 5C0XB 3WU5A 4IZJB 4JI7I 1HR0I 2Q2EB 2VQFE 2NN6E 1N34I 4DR6I 2BV3A 4OO1C 4JG4A 5DROA 3WU6A 3M85D 5FLXC 4OKGA 3QT5A 5BR8I 3M7ND 4MDTA 4DV6I 4K0KI 4LOMA 4DV5I 3B78A 3HULA 4LF9E 4ISAA 3T1HE 1BKNA 2A2DA 4OX9I 4B3SE 4B3RE 2V2VA 1N0VC 4B3MI 1N36E 4IFDC 4DPYA 1IBLE 1HNZI 4OO1E 2C37A 1OJ4A 1Y5YA 2V2QA 4MQYA 4DV7E 4JV5I 5ELWA 4AIMA 2DEIA 1ZXNA 1QZRA 2PNMA 5C0XD 3JAMQ 1HR0E 5DNXA 4IZJD 1XMQI 1N34E 4DR6E 4JI1I 1D6TA 2JT2A 2GQ0A 1E3PA 3H1CA 4N3OA 4MYUA 3B8HA 5A2QC 2E5LI 2UXCI 3PYFA 1Y4UA 2BA0D 5IWAI 3J80Q 5BR8E 1Z0CA 2OI2A 4FW3A 4DV6E 4K0KE 2BA1G 2C38B 4JI4I 4DV5E 3CDIA 1MX0A 4OX9E 4AM3A 3H4LA 4IZKA 2HFSA 4B3ME 4PRXA 3B4TA 2PO1B 5DRRA 4DR5I 2UUCI 2X36A 4OZEA 4X66I 1HNZE 4JI0E 4BA2A 2O1UA 1HNWI 4DR4I 4JV5E 4LFBI 4YHHI 1H74A 3PYDA 1WUUA 2AE8A 2NN6A 4GKJI 2VQEI 3J7AG 3F0NA 2BR2A 1XMQE 2VQFI 4JI8I 4JI1E 4NXNI 1MU5A 3GCMA 4UTGA 2UXCE 3V5RA 5K36A 3PS1A 1Y60A 4J3DA 3U1YA 5JEAF 4DV3I 1EI1A 4HACB 4JI4E 2WNRA 2PNZA 4FW5A 4LCGA 3J81C 4RPFA 3T1HI 2VESA 2WW4A 4FWHA 2JEAA 5LMNI 1USUA 4LCHA 4DV2I 4LPFA 5EKWA 4FW9A 3L7ZB 3P3CA 4OO1A 2DEJA 1NHHA 2GO4A 4DR5E 2UUCE 4X66E 1YH8A 1IBMI 1HNWE 4DPTA 4DR4E 2C39A 4LFBE 4YHHE 4ED4A 2R42A 2PO2B 4P7AA 4XTJA 4GKJE 2VQEE 4JI8E 4NXNE 2O1VA 1PVGA 1H73A 4DU8A 3V2UC 4IFDA 4MU4A 2BM0A 2V8PA 4OO1F 3Q6NA 1B63A 1Y4SA 1ZM9A 3PRYA 2BA1D 5JEAB 4DV3E 5K36E 1HNXI 3U1KA 3PYGA 4PU9A 1VI7A 3M6AA 4WUDA 4MU1A 4LF5I 1ZXMA 3PS3A 5LMNE 4DV2E 5DRPA 2PO1A 4QNJA 2JE6B 3CDJA 4JI5E 1Y6ZA 1Z5BA 2PO0A 4JI0I 4JI3I 1IBME 3P76A 4DXLA 1XNRI 4HXZA 4ZVIA 2JEBA 3CWVA 2IESA 1B62A 3ZZ0A 4P52A 1S16A 4JYAI 2WP8B 4BA1B 2IOPA 1Z0BA 3ZM7A 1A6FA 4LF4I 2Z5CA 1Z0VA 1IBKI 3LPSA 4IFDE 2O3ZA 1HNXE 5DNLA 3PYEA 2UXBI 3HKMA 5JEAD 1MG7A 4USKA 1PIEA 1FWLA 3GLLA 2CVEA 2BM1A 1XNQI 4LF7I 4LF5E 3PS2A 1FJGI 1E3HA 4KQVA 1XMOI 3P06A 4JI3E 4X65I 4DV0I 4NXMI 1J5EI 4R1FA 4LFCI 1XNRE 3KRNA 5C0XA 1H7UA 4IZJA 4GKKI 4LF6I 3K85A 1XHKA 2HKEA 1ZM3A 4JYAE 4WUCA 4DV4I 4M1KA 1UDOA 1Z5AA 3D4JA 4LF4E 4FW6A 3QT8A 1IBKE 4DR7I 2GO3A 5FLXQ 1UDQA 1KIJA 1Z59A 1UDSA 4LF8I 2C37B 5C0XC 2UXBE 2EFGA 4FWDA 1RR9A 4JI2I 3WU3A 2UUBI 1XNQE 5LMUI 4WUBA 4LF7E 4X62I 1FJGE 1ZM4A 2NN6F 4EMDA 1N32I 5IT9C 3LNUA 4JI5I 4DR2I 4LCFA 1XMOE 3J7AM 5JEAC 4X65E 4DV0E 4NXME 1J5EE 3J80C 2Z5BB 4FN5A 4LFCE 1RREA 2CZ9A 5K36F 1FNMA 4GKKE 4LF6E 4FW7A 5C0XE 2F1DA 2LJPA 2WP8A 4HY1A 2HK2A 1S4EA 4JI6I 4DV4E 4IZKB 1N0UA 3T1YI 1KVKA 1EA6A 1HK7A 5A2QQ 4AIDA 4DR7E 3QT7A 1Z0TA 4HYMA 4LF8E 3P3EA 2C38A 2IOQA 4BA2B 2V34A 2ZITA 4JI2E 1VISA 1FI4A 1H72C 2UUBE 5LMUE 4YY3I 4X64I 4X62E 2NN6B 3ZZUA 4Z7YA 1NHIA 2BR2B 1N32E 4DR2E 4KHPI 2UU9I 4AQYI 1OYPA 2ZBKB 4MU0A 1FWKA 3K17A 4IFDF 3UHMA 2XEXA 5K36B 4U3DA 3HJCA 4DPXA 1Z5CA 2UXDI 3ZKBA 2WNRB 2PNZB 4B3TI 4DUYI 4Z7CA 1USVA 4JI6E 2O1TA 5EL9A 2JEAB 3T1YE 4DR1I 2CG9A 3GONA 1XXEA 4OO1B 1P42A 2E1RA 2CGEA 4HACA 2O1WA 4U3BA 3ZZTA 2C39B 4LFAI 4DV1I 3J81Q 4FWGA 4YY3E 4JI7E 2ZM6I 4X64E 1KKHA 3L7ZA 2A2CA 4USMA 1UDNA 4MU3A 2NN6D 5FWKA 3Q1QA 5IT9Q 1RHYA 4KHPE 5GMEA 2UU9E 2Z5BA 4AQYE 1DARA 3OTOI 3M85G 4IFDB 2Z5EA 1N33I 4MYTA 3GMEA 1Z0EA 3M7NG 2PO2A 5GMDA 5K36D 2J7KA 2F4VI 4NBQA 2UXDE 4B3TE 4DUYE 2GS8A 1H7SA 4QNKA 3P3GA 4DPUA 4DUZI 4DR3I 1Z0GA 2HHHI 2UUAI 1YHCA 1Z0WA 1OYSA 2IERA 4DR1E 3DD6A 2PO0B 5JEAA 4OO1D 1I94I 3K1JA 4PRVA 4LFAE 4DU7A 4DV1E 5C0XF 1PKPA 2JEBB 3JAMC 2ZM6E 2JE6A 2V2ZA 5LL6R 4GQUA 2NPFA 2PNLA 2HKJA 2E5LE 1KTVA 3QT6A 3ZKDA 3OTOE 5L3JA 1ZM2A 1U2RA 5IWAE 1UEKA 2HK3A 4I3HA 4FW4A 2Z5CB 2BA0G 1N33E 1R6LA 4IFDD 4UT4A 4DPWA 3Q6MA 2F4VE 2HFUA
chains in the Genus database with same CATH topology
4LF9I 4DUZE 2UUAE 4DR3E 2HHHE 4B3SI 2VF3A 4B3RI 4URLA 2X7IA 1N36I 1IBLI 2AJ4A 1K47A 3WU4A 1NZ0A 1I94E 2R3VA 1FKAE 4DV7I 1NHJA 3B82A 3LTOA 1ELOA 3WU5A 4IZJB 4JI7I 1HR0I 2Q2EB 2VQFE 1N34I 4DR6I 2BV3A 4JG4A 3WU6A 5FLXC 3QT5A 5BR8I 4DV6I 4K0KI 4DV5I 3B78A 3HULA 4LF9E 3T1HE 1BKNA 2A2DA 4OX9I 4B3SE 4B3RE 2V2VA 1N0VC 4B3MI 1N36E 4DPYA 1IBLE 1HNZI 1OJ4A 2V2QA 4DV7E 4JV5I 2DEIA 1ZXNA 1QZRA 2PNMA 1HR0E 3JAMQ 4IZJD 1XMQI 1N34E 4DR6E 4JI1I 1D6TA 2GQ0A 4N3OA 4MYUA 5A2QC 3B8HA 2E5LI 2UXCI 3PYFA 1Y4UA 5IWAI 3J80Q 5BR8E 1Z0CA 2OI2A 4DV6E 4K0KE 4JI4I 4DV5E 1MX0A 4OX9E 3H4LA 4IZKA 2HFSA 4B3ME 4PRXA 4DR5I 2UUCI 2X36A 4X66I 1HNZE 4JI0E 2O1UA 1HNWI 4DR4I 4JV5E 4LFBI 4YHHI 1H74A 3PYDA 1WUUA 4GKJI 2VQEI 3J7AG 3F0NA 1XMQE 2VQFI 4JI8I 4JI1E 4NXNI 1MU5A 4UTGA 2UXCE 3V5RA 4DV3I 1EI1A 4HACB 4JI4E 3J81C 4RPFA 3T1HI 2WW4A 4FWHA 5LMNI 1USUA 4DV2I 4FW9A 2DEJA 1NHHA 4DR5E 2UUCE 4X66E 1IBMI 1HNWE 4DPTA 4DR4E 4LFBE 4YHHE 4ED4A 2R42A 4P7AA 4XTJA 4GKJE 2VQEE 4JI8E 4NXNE 2O1VA 1PVGA 1H73A 4DU8A 3V2UC 2BM0A 2V8PA 3Q6NA 1B63A 1Y4SA 1ZM9A 3PRYA 4DV3E 1HNXI 3PYGA 4PU9A 3M6AA 4WUDA 4LF5I 1ZXMA 5LMNE 4DV2E 4JI5E 1Y6ZA 1Z5BA 4JI0I 4JI3I 1IBME 4DXLA 1XNRI 4HXZA 4ZVIA 3CWVA 1B62A 3ZZ0A 4P52A 1S16A 4JYAI 2IOPA 1Z0BA 3ZM7A 1A6FA 4LF4I 2Z5CA 1Z0VA 1IBKI 3LPSA 1HNXE 3PYEA 2UXBI 1MG7A 4USKA 1PIEA 1FWLA 2BM1A 1XNQI 4LF7I 4LF5E 1FJGI 4KQVA 1XMOI 3P06A 4JI3E 4X65I 4DV0I 4NXMI 1J5EI 4R1FA 4LFCI 1XNRE 1H7UA 4IZJA 4GKKI 4LF6I 3K85A 1XHKA 2HKEA 1ZM3A 4JYAE 4WUCA 4DV4I 4M1KA 1Z5AA 3D4JA 4LF4E 3QT8A 1IBKE 4DR7I 5FLXQ 1KIJA 1Z59A 4LF8I 2UXBE 2EFGA 4FWDA 1RR9A 4JI2I 3WU3A 2UUBI 1XNQE 5LMUI 4WUBA 4LF7E 4X62I 1FJGE 1ZM4A 4EMDA 1N32I 5IT9C 3LNUA 4JI5I 4DR2I 1XMOE 3J7AM 4X65E 4DV0E 4NXME 1J5EE 3J80C 2Z5BB 4FN5A 4LFCE 1RREA 2CZ9A 1FNMA 4GKKE 4LF6E 2LJPA 4HY1A 2HK2A 1S4EA 4JI6I 4DV4E 4IZKB 1N0UA 3T1YI 1KVKA 1EA6A 1HK7A 5A2QQ 4DR7E 3QT7A 1Z0TA 4HYMA 4LF8E 2IOQA 2V34A 2ZITA 4JI2E 1VISA 1FI4A 1H72C 2UUBE 5LMUE 4YY3I 4X64I 4X62E 3ZZUA 4Z7YA 1NHIA 1N32E 4DR2E 4KHPI 2UU9I 4AQYI 2ZBKB 1FWKA 3K17A 2XEXA 3HJCA 4DPXA 1Z5CA 2UXDI 3ZKBA 4B3TI 4DUYI 4Z7CA 1USVA 4JI6E 2O1TA 3T1YE 4DR1I 2CG9A 3GONA 2E1RA 2CGEA 4HACA 2O1WA 3ZZTA 4LFAI 4DV1I 3J81Q 4FWGA 4YY3E 4JI7E 2ZM6I 4X64E 1KKHA 2A2CA 4USMA 5FWKA 3Q1QA 5IT9Q 4KHPE 5GMEA 2UU9E 2Z5BA 4AQYE 1DARA 3OTOI 2Z5EA 1N33I 4MYTA 1Z0EA 5GMDA 2J7KA 2F4VI 2UXDE 4B3TE 4DUYE 2GS8A 1H7SA 4DUZI 4DPUA 4DR3I 2HHHI 2UUAI 1Z0GA 1Z0WA 4DR1E 1I94I 3K1JA 4PRVA 4LFAE 4DU7A 4DV1E 1PKPA 3JAMC 2ZM6E 2V2ZA 5LL6R 2NPFA 2PNLA 2HKJA 2E5LE 1KTVA 3QT6A 3ZKDA 3OTOE 5L3JA 1ZM2A 1U2RA 5IWAE 1UEKA 2HK3A 4I3HA 2Z5CB 1N33E 4UT4A 4DPWA 3Q6MA 2F4VE 2HFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 I;  4DUZ E;  2UUA E;  4DR3 E;  2HHH E;  4B3S I;  2VF3 A;  4B3R I;  4URL A;  2X7I A;  1N36 I;  1IBL I;  2AJ4 A;  1K47 A;  3WU4 A;  1NZ0 A;  1I94 E;  2R3V A;  1FKA E;  4DV7 I;  1NHJ A;  3B82 A;  3LTO A;  1ELO A;  3WU5 A;  4JI7 I;  1HR0 I;  2Q2E B;  2VQF E;  1N34 I;  4DR6 I;  2BV3 A;  4JG4 A;  3WU6 A;  5FLX C;  3QT5 A;  5BR8 I;  4DV6 I;  4K0K I;  4DV5 I;  3B78 A;  3HUL A;  4LF9 E;  3T1H E;  1BKN A;  2A2D A;  4OX9 I;  4B3S E;  4B3R E;  2V2V A;  1N0V C;  4B3M I;  1N36 E;  4DPY A;  1IBL E;  1HNZ I;  1OJ4 A;  2V2Q A;  4DV7 E;  4JV5 I;  2DEI A;  1ZXN A;  1QZR A;  1HR0 E;  3JAM Q;  1XMQ I;  1N34 E;  4DR6 E;  4JI1 I;  1D6T A;  5A2Q C;  4MYU A;  2E5L I;  3B8H A;  2UXC I;  3PYF A;  5IWA I;  3J80 Q;  5BR8 E;  1Z0C A;  2OI2 A;  4DV6 E;  4K0K E;  4JI4 I;  4DV5 E;  1MX0 A;  4OX9 E;  3H4L A;  2HFS A;  4B3M E;  4PRX A;  4DR5 I;  2UUC I;  2X36 A;  4X66 I;  1HNZ E;  4JI0 E;  1HNW I;  4DR4 I;  4JV5 E;  4LFB I;  4YHH I;  1H74 A;  3PYD A;  1WUU A;  4GKJ I;  2VQE I;  3J7A G;  3F0N A;  1XMQ E;  2VQF I;  4JI8 I;  4JI1 E;  4NXN I;  1MU5 A;  4UTG A;  2UXC E;  3V5R A;  4DV3 I;  1EI1 A;  4HAC B;  4JI4 E;  3J81 C;  4RPF A;  3T1H I;  2WW4 A;  4FWH A;  5LMN I;  4DV2 I;  4FW9 A;  2DEJ A;  1NHH A;  4DR5 E;  2UUC E;  4X66 E;  1IBM I;  1HNW E;  4DPT A;  4DR4 E;  4LFB E;  4YHH E;  4ED4 A;  2R42 A;  4P7A A;  4XTJ A;  4GKJ E;  2VQE E;  4JI8 E;  4NXN E;  1PVG A;  1H73 A;  4DU8 A;  3V2U C;  2BM0 A;  2V8P A;  1B63 A;  1ZM9 A;  4DV3 E;  1HNX I;  3PYG A;  4PU9 A;  3M6A A;  4WUD A;  4LF5 I;  1ZXM A;  5LMN E;  4DV2 E;  4JI5 E;  1Z5B A;  4JI0 I;  4JI3 I;  1IBM E;  4DXL A;  1XNR I;  4HXZ A;  4ZVI A;  3CWV A;  1B62 A;  3ZZ0 A;  4P52 A;  1S16 A;  4JYA I;  1Z0B A;  3ZM7 A;  1A6F A;  4LF4 I;  1Z0V A;  1IBK I;  3LPS A;  1HNX E;  3PYE A;  2UXB I;  1MG7 A;  4USK A;  1PIE A;  1FWL A;  2BM1 A;  1XNQ I;  4LF7 I;  4LF5 E;  1FJG I;  4KQV A;  1XMO I;  4JI3 E;  4X65 I;  4DV0 I;  4NXM I;  1J5E I;  4R1F A;  4LFC I;  1XNR E;  1H7U A;  4GKK I;  4LF6 I;  1XHK A;  2HKE A;  1ZM3 A;  4JYA E;  4WUC A;  4DV4 I;  4M1K A;  1Z5A A;  3D4J A;  4LF4 E;  3QT8 A;  1IBK E;  4DR7 I;  5FLX Q;  1KIJ A;  1Z59 A;  4LF8 I;  2UXB E;  2EFG A;  4FWD A;  1RR9 A;  4JI2 I;  3WU3 A;  2UUB I;  1XNQ E;  5LMU I;  4WUB A;  4LF7 E;  4X62 I;  1FJG E;  1ZM4 A;  4EMD A;  1N32 I;  5IT9 C;  3LNU A;  4JI5 I;  4DR2 I;  1XMO E;  3J7A M;  4X65 E;  4DV0 E;  4NXM E;  1J5E E;  3J80 C;  4FN5 A;  4LFC E;  1RRE A;  2CZ9 A;  1FNM A;  4GKK E;  4LF6 E;  2LJP A;  4HY1 A;  2HK2 A;  1S4E A;  4JI6 I;  4DV4 E;  3T1Y I;  1N0U A;  1KVK A;  1EA6 A;  5A2Q Q;  4DR7 E;  3QT7 A;  1Z0T A;  4HYM A;  4LF8 E;  2V34 A;  2ZIT A;  4JI2 E;  1VIS A;  1FI4 A;  1H72 C;  2UUB E;  5LMU E;  4YY3 I;  4X64 I;  4X62 E;  3ZZU A;  4Z7Y A;  1NHI A;  1N32 E;  4DR2 E;  4KHP I;  2UU9 I;  4AQY I;  2ZBK B;  1FWK A;  3K17 A;  2XEX A;  4DPX A;  1Z5C A;  2UXD I;  3ZKB A;  4B3T I;  4DUY I;  4Z7C A;  4JI6 E;  3T1Y E;  4DR1 I;  3GON A;  2E1R A;  4HAC A;  3ZZT A;  4LFA I;  4DV1 I;  3J81 Q;  4FWG A;  4YY3 E;  4JI7 E;  2ZM6 I;  4X64 E;  1KKH A;  2A2C A;  4USM A;  3Q1Q A;  5IT9 Q;  4KHP E;  5GME A;  2UU9 E;  4AQY E;  1DAR A;  3OTO I;  1N33 I;  4MYT A;  1Z0E A;  5GMD A;  2J7K A;  2F4V I;  2UXD E;  4B3T E;  4DUY E;  2UUA I;  2GS8 A;  1H7S A;  4DPU A;  4DUZ I;  4DR3 I;  2HHH I;  1Z0G A;  1Z0W A;  4DR1 E;  1I94 I;  3K1J A;  4PRV A;  4LFA E;  4DU7 A;  4DV1 E;  1PKP A;  3JAM C;  2ZM6 E;  2V2Z A;  5LL6 R;  2NPF A;  2HKJ A;  2E5L E;  1KTV A;  3QT6 A;  3ZKD A;  3OTO E;  5L3J A;  1ZM2 A;  1U2R A;  5IWA E;  1UEK A;  2HK3 A;  4I3H A;  1N33 E;  4UT4 A;  4DPW A;  2F4V E;  2HFU A; 
#chains in the Genus database with same CATH topology
 2NN6 C;  4LF9 I;  4BA1 A;  4DUZ E;  2UUA E;  4DR3 E;  2HHH E;  4B3S I;  2VF3 A;  4B3R I;  4URL A;  2X7I A;  1N36 I;  1R6M A;  1IBL I;  5K36 C;  2AJ4 A;  1K47 A;  3WU4 A;  1NZ0 A;  1OYR A;  1I94 E;  2R3V A;  1FKA E;  4DV7 I;  5JEA E;  4IS9 A;  1NHJ A;  5DRQ A;  2J65 A;  3B82 A;  3LTO A;  1ELO A;  3NZK A;  5C0X B;  3WU5 A;  4IZJ B;  4JI7 I;  1HR0 I;  2Q2E B;  2VQF E;  2NN6 E;  1N34 I;  4DR6 I;  2BV3 A;  4OO1 C;  4JG4 A;  5DRO A;  3WU6 A;  3M85 D;  5FLX C;  4OKG A;  3QT5 A;  5BR8 I;  3M7N D;  4MDT A;  4DV6 I;  4K0K I;  4LOM A;  4DV5 I;  3B78 A;  3HUL A;  4LF9 E;  4ISA A;  3T1H E;  1BKN A;  2A2D A;  4OX9 I;  4B3S E;  4B3R E;  2V2V A;  1N0V C;  4B3M I;  1N36 E;  4IFD C;  4DPY A;  1IBL E;  1HNZ I;  4OO1 E;  2C37 A;  1OJ4 A;  1Y5Y A;  2V2Q A;  4MQY A;  4DV7 E;  4JV5 I;  5ELW A;  4AIM A;  2DEI A;  1ZXN A;  1QZR A;  2PNM A;  5C0X D;  3JAM Q;  1HR0 E;  5DNX A;  4IZJ D;  1XMQ I;  1N34 E;  4DR6 E;  4JI1 I;  1D6T A;  2JT2 A;  2GQ0 A;  1E3P A;  3H1C A;  4N3O A;  4MYU A;  3B8H A;  5A2Q C;  2E5L I;  2UXC I;  3PYF A;  1Y4U A;  2BA0 D;  5IWA I;  3J80 Q;  5BR8 E;  1Z0C A;  2OI2 A;  4FW3 A;  4DV6 E;  4K0K E;  2BA1 G;  2C38 B;  4JI4 I;  4DV5 E;  3CDI A;  1MX0 A;  4OX9 E;  4AM3 A;  3H4L A;  4IZK A;  2HFS A;  4B3M E;  4PRX A;  3B4T A;  2PO1 B;  5DRR A;  4DR5 I;  2UUC I;  2X36 A;  4OZE A;  4X66 I;  1HNZ E;  4JI0 E;  4BA2 A;  2O1U A;  1HNW I;  4DR4 I;  4JV5 E;  4LFB I;  4YHH I;  1H74 A;  3PYD A;  1WUU A;  2AE8 A;  2NN6 A;  4GKJ I;  2VQE I;  3J7A G;  3F0N A;  2BR2 A;  1XMQ E;  2VQF I;  4JI8 I;  4JI1 E;  4NXN I;  1MU5 A;  3GCM A;  4UTG A;  2UXC E;  3V5R A;  5K36 A;  3PS1 A;  1Y60 A;  4J3D A;  3U1Y A;  5JEA F;  4DV3 I;  1EI1 A;  4HAC B;  4JI4 E;  2WNR A;  2PNZ A;  4FW5 A;  4LCG A;  3J81 C;  4RPF A;  3T1H I;  2VES A;  2WW4 A;  4FWH A;  2JEA A;  5LMN I;  1USU A;  4LCH A;  4DV2 I;  4LPF A;  5EKW A;  4FW9 A;  3L7Z B;  3P3C A;  4OO1 A;  2DEJ A;  1NHH A;  2GO4 A;  4DR5 E;  2UUC E;  4X66 E;  1YH8 A;  1IBM I;  1HNW E;  4DPT A;  4DR4 E;  2C39 A;  4LFB E;  4YHH E;  4ED4 A;  2R42 A;  2PO2 B;  4P7A A;  4XTJ A;  4GKJ E;  2VQE E;  4JI8 E;  4NXN E;  2O1V A;  1PVG A;  1H73 A;  4DU8 A;  3V2U C;  4IFD A;  4MU4 A;  2BM0 A;  2V8P A;  4OO1 F;  3Q6N A;  1B63 A;  1Y4S A;  1ZM9 A;  3PRY A;  2BA1 D;  5JEA B;  4DV3 E;  5K36 E;  1HNX I;  3U1K A;  3PYG A;  4PU9 A;  1VI7 A;  3M6A A;  4WUD A;  4MU1 A;  4LF5 I;  1ZXM A;  3PS3 A;  5LMN E;  4DV2 E;  5DRP A;  2PO1 A;  4QNJ A;  2JE6 B;  3CDJ A;  4JI5 E;  1Y6Z A;  1Z5B A;  2PO0 A;  4JI0 I;  4JI3 I;  1IBM E;  3P76 A;  4DXL A;  1XNR I;  4HXZ A;  4ZVI A;  2JEB A;  3CWV A;  2IES A;  1B62 A;  3ZZ0 A;  4P52 A;  1S16 A;  4JYA I;  2WP8 B;  4BA1 B;  2IOP A;  1Z0B A;  3ZM7 A;  1A6F A;  4LF4 I;  2Z5C A;  1Z0V A;  1IBK I;  3LPS A;  4IFD E;  2O3Z A;  1HNX E;  5DNL A;  3PYE A;  2UXB I;  3HKM A;  5JEA D;  1MG7 A;  4USK A;  1PIE A;  1FWL A;  3GLL A;  2CVE A;  2BM1 A;  1XNQ I;  4LF7 I;  4LF5 E;  3PS2 A;  1FJG I;  1E3H A;  4KQV A;  1XMO I;  3P06 A;  4JI3 E;  4X65 I;  4DV0 I;  4NXM I;  1J5E I;  4R1F A;  4LFC I;  1XNR E;  3KRN A;  5C0X A;  1H7U A;  4IZJ A;  4GKK I;  4LF6 I;  3K85 A;  1XHK A;  2HKE A;  1ZM3 A;  4JYA E;  4WUC A;  4DV4 I;  4M1K A;  1UDO A;  1Z5A A;  3D4J A;  4LF4 E;  4FW6 A;  3QT8 A;  1IBK E;  4DR7 I;  2GO3 A;  5FLX Q;  1UDQ A;  1KIJ A;  1Z59 A;  1UDS A;  4LF8 I;  2C37 B;  5C0X C;  2UXB E;  2EFG A;  4FWD A;  1RR9 A;  4JI2 I;  3WU3 A;  2UUB I;  1XNQ E;  5LMU I;  4WUB A;  4LF7 E;  4X62 I;  1FJG E;  1ZM4 A;  2NN6 F;  4EMD A;  1N32 I;  5IT9 C;  3LNU A;  4JI5 I;  4DR2 I;  4LCF A;  1XMO E;  3J7A M;  5JEA C;  4X65 E;  4DV0 E;  4NXM E;  1J5E E;  3J80 C;  2Z5B B;  4FN5 A;  4LFC E;  1RRE A;  2CZ9 A;  5K36 F;  1FNM A;  4GKK E;  4LF6 E;  4FW7 A;  5C0X E;  2F1D A;  2LJP A;  2WP8 A;  4HY1 A;  2HK2 A;  1S4E A;  4JI6 I;  4DV4 E;  4IZK B;  1N0U A;  3T1Y I;  1KVK A;  1EA6 A;  1HK7 A;  5A2Q Q;  4AID A;  4DR7 E;  3QT7 A;  1Z0T A;  4HYM A;  4LF8 E;  3P3E A;  2C38 A;  2IOQ A;  4BA2 B;  2V34 A;  2ZIT A;  4JI2 E;  1VIS A;  1FI4 A;  1H72 C;  2UUB E;  5LMU E;  4YY3 I;  4X64 I;  4X62 E;  2NN6 B;  3ZZU A;  4Z7Y A;  1NHI A;  2BR2 B;  1N32 E;  4DR2 E;  4KHP I;  2UU9 I;  4AQY I;  1OYP A;  2ZBK B;  4MU0 A;  1FWK A;  3K17 A;  4IFD F;  3UHM A;  2XEX A;  5K36 B;  4U3D A;  3HJC A;  4DPX A;  1Z5C A;  2UXD I;  3ZKB A;  2WNR B;  2PNZ B;  4B3T I;  4DUY I;  4Z7C A;  1USV A;  4JI6 E;  2O1T A;  5EL9 A;  2JEA B;  3T1Y E;  4DR1 I;  2CG9 A;  3GON A;  1XXE A;  4OO1 B;  1P42 A;  2E1R A;  2CGE A;  4HAC A;  2O1W A;  4U3B A;  3ZZT A;  2C39 B;  4LFA I;  4DV1 I;  3J81 Q;  4FWG A;  4YY3 E;  4JI7 E;  2ZM6 I;  4X64 E;  1KKH A;  3L7Z A;  2A2C A;  4USM A;  1UDN A;  4MU3 A;  2NN6 D;  5FWK A;  3Q1Q A;  5IT9 Q;  1RHY A;  4KHP E;  5GME A;  2UU9 E;  2Z5B A;  4AQY E;  1DAR A;  3OTO I;  3M85 G;  4IFD B;  2Z5E A;  1N33 I;  4MYT A;  3GME A;  1Z0E A;  3M7N G;  2PO2 A;  5GMD A;  5K36 D;  2J7K A;  2F4V I;  4NBQ A;  2UXD E;  4B3T E;  4DUY E;  2GS8 A;  1H7S A;  4QNK A;  3P3G A;  4DPU A;  4DUZ I;  4DR3 I;  1Z0G A;  2HHH I;  2UUA I;  1YHC A;  1Z0W A;  1OYS A;  2IER A;  4DR1 E;  3DD6 A;  2PO0 B;  5JEA A;  4OO1 D;  1I94 I;  3K1J A;  4PRV A;  4LFA E;  4DU7 A;  4DV1 E;  5C0X F;  1PKP A;  2JEB B;  3JAM C;  2ZM6 E;  2JE6 A;  2V2Z A;  5LL6 R;  4GQU A;  2NPF A;  2PNL A;  2HKJ A;  2E5L E;  1KTV A;  3QT6 A;  3ZKD A;  3OTO E;  5L3J A;  1ZM2 A;  1U2R A;  5IWA E;  1UEK A;  2HK3 A;  4I3H A;  4FW4 A;  2Z5C B;  2BA0 G;  1N33 E;  1R6L A;  4IFD D;  4UT4 A;  4DPW A;  3Q6M A;  2F4V E;  2HFU A; 
#chains in the Genus database with same CATH homology
 4LF9 I;  4DUZ E;  2UUA E;  4DR3 E;  2HHH E;  4B3S I;  2VF3 A;  4B3R I;  4URL A;  2X7I A;  1N36 I;  1IBL I;  2AJ4 A;  1K47 A;  3WU4 A;  1NZ0 A;  1I94 E;  2R3V A;  1FKA E;  4DV7 I;  1NHJ A;  3B82 A;  3LTO A;  1ELO A;  3WU5 A;  4IZJ B;  4JI7 I;  1HR0 I;  2Q2E B;  2VQF E;  1N34 I;  4DR6 I;  2BV3 A;  4JG4 A;  3WU6 A;  5FLX C;  3QT5 A;  5BR8 I;  4DV6 I;  4K0K I;  4DV5 I;  3B78 A;  3HUL A;  4LF9 E;  3T1H E;  1BKN A;  2A2D A;  4OX9 I;  4B3S E;  4B3R E;  2V2V A;  1N0V C;  4B3M I;  1N36 E;  4DPY A;  1IBL E;  1HNZ I;  1OJ4 A;  2V2Q A;  4DV7 E;  4JV5 I;  2DEI A;  1ZXN A;  1QZR A;  2PNM A;  1HR0 E;  3JAM Q;  4IZJ D;  1XMQ I;  1N34 E;  4DR6 E;  4JI1 I;  1D6T A;  2GQ0 A;  4N3O A;  4MYU A;  5A2Q C;  3B8H A;  2E5L I;  2UXC I;  3PYF A;  1Y4U A;  5IWA I;  3J80 Q;  5BR8 E;  1Z0C A;  2OI2 A;  4DV6 E;  4K0K E;  4JI4 I;  4DV5 E;  1MX0 A;  4OX9 E;  3H4L A;  4IZK A;  2HFS A;  4B3M E;  4PRX A;  4DR5 I;  2UUC I;  2X36 A;  4X66 I;  1HNZ E;  4JI0 E;  2O1U A;  1HNW I;  4DR4 I;  4JV5 E;  4LFB I;  4YHH I;  1H74 A;  3PYD A;  1WUU A;  4GKJ I;  2VQE I;  3J7A G;  3F0N A;  1XMQ E;  2VQF I;  4JI8 I;  4JI1 E;  4NXN I;  1MU5 A;  4UTG A;  2UXC E;  3V5R A;  4DV3 I;  1EI1 A;  4HAC B;  4JI4 E;  3J81 C;  4RPF A;  3T1H I;  2WW4 A;  4FWH A;  5LMN I;  1USU A;  4DV2 I;  4FW9 A;  2DEJ A;  1NHH A;  4DR5 E;  2UUC E;  4X66 E;  1IBM I;  1HNW E;  4DPT A;  4DR4 E;  4LFB E;  4YHH E;  4ED4 A;  2R42 A;  4P7A A;  4XTJ A;  4GKJ E;  2VQE E;  4JI8 E;  4NXN E;  2O1V A;  1PVG A;  1H73 A;  4DU8 A;  3V2U C;  2BM0 A;  2V8P A;  3Q6N A;  1B63 A;  1Y4S A;  1ZM9 A;  3PRY A;  4DV3 E;  1HNX I;  3PYG A;  4PU9 A;  3M6A A;  4WUD A;  4LF5 I;  1ZXM A;  5LMN E;  4DV2 E;  4JI5 E;  1Y6Z A;  1Z5B A;  4JI0 I;  4JI3 I;  1IBM E;  4DXL A;  1XNR I;  4HXZ A;  4ZVI A;  3CWV A;  1B62 A;  3ZZ0 A;  4P52 A;  1S16 A;  4JYA I;  2IOP A;  1Z0B A;  3ZM7 A;  1A6F A;  4LF4 I;  2Z5C A;  1Z0V A;  1IBK I;  3LPS A;  1HNX E;  3PYE A;  2UXB I;  1MG7 A;  4USK A;  1PIE A;  1FWL A;  2BM1 A;  1XNQ I;  4LF7 I;  4LF5 E;  1FJG I;  4KQV A;  1XMO I;  3P06 A;  4JI3 E;  4X65 I;  4DV0 I;  4NXM I;  1J5E I;  4R1F A;  4LFC I;  1XNR E;  1H7U A;  4IZJ A;  4GKK I;  4LF6 I;  3K85 A;  1XHK A;  2HKE A;  1ZM3 A;  4JYA E;  4WUC A;  4DV4 I;  4M1K A;  1Z5A A;  3D4J A;  4LF4 E;  3QT8 A;  1IBK E;  4DR7 I;  5FLX Q;  1KIJ A;  1Z59 A;  4LF8 I;  2UXB E;  2EFG A;  4FWD A;  1RR9 A;  4JI2 I;  3WU3 A;  2UUB I;  1XNQ E;  5LMU I;  4WUB A;  4LF7 E;  4X62 I;  1FJG E;  1ZM4 A;  4EMD A;  1N32 I;  5IT9 C;  3LNU A;  4JI5 I;  4DR2 I;  1XMO E;  3J7A M;  4X65 E;  4DV0 E;  4NXM E;  1J5E E;  3J80 C;  2Z5B B;  4FN5 A;  4LFC E;  1RRE A;  2CZ9 A;  1FNM A;  4GKK E;  4LF6 E;  2LJP A;  4HY1 A;  2HK2 A;  1S4E A;  4JI6 I;  4DV4 E;  4IZK B;  1N0U A;  3T1Y I;  1KVK A;  1EA6 A;  1HK7 A;  5A2Q Q;  4DR7 E;  3QT7 A;  1Z0T A;  4HYM A;  4LF8 E;  2IOQ A;  2V34 A;  2ZIT A;  4JI2 E;  1VIS A;  1FI4 A;  1H72 C;  2UUB E;  5LMU E;  4YY3 I;  4X64 I;  4X62 E;  3ZZU A;  4Z7Y A;  1NHI A;  1N32 E;  4DR2 E;  4KHP I;  2UU9 I;  4AQY I;  2ZBK B;  1FWK A;  3K17 A;  2XEX A;  3HJC A;  4DPX A;  1Z5C A;  2UXD I;  3ZKB A;  4B3T I;  4DUY I;  4Z7C A;  1USV A;  4JI6 E;  2O1T A;  3T1Y E;  4DR1 I;  2CG9 A;  3GON A;  2E1R A;  2CGE A;  4HAC A;  2O1W A;  3ZZT A;  4LFA I;  4DV1 I;  3J81 Q;  4FWG A;  4YY3 E;  4JI7 E;  2ZM6 I;  4X64 E;  1KKH A;  2A2C A;  4USM A;  5FWK A;  3Q1Q A;  5IT9 Q;  4KHP E;  5GME A;  2UU9 E;  2Z5B A;  4AQY E;  1DAR A;  3OTO I;  2Z5E A;  1N33 I;  4MYT A;  1Z0E A;  5GMD A;  2J7K A;  2F4V I;  2UXD E;  4B3T E;  4DUY E;  2GS8 A;  1H7S A;  4DUZ I;  4DPU A;  4DR3 I;  2HHH I;  2UUA I;  1Z0G A;  1Z0W A;  4DR1 E;  1I94 I;  3K1J A;  4PRV A;  4LFA E;  4DU7 A;  4DV1 E;  1PKP A;  3JAM C;  2ZM6 E;  2V2Z A;  5LL6 R;  2NPF A;  2PNL A;  2HKJ A;  2E5L E;  1KTV A;  3QT6 A;  3ZKD A;  3OTO E;  5L3J A;  1ZM2 A;  1U2R A;  5IWA E;  1UEK A;  2HK3 A;  4I3H A;  2Z5C B;  1N33 E;  4UT4 A;  4DPW A;  3Q6M A;  2F4V E;  2HFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...