4DV1I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv1I00
2BM0A 1KVKA 3ZKBA 4X64E 3T1HI 4DV5I 4JI2I 1QZRA 2J7KA 1RR9A 2DEIA 1N36E 1XMOE 4YHHI 2HHHE 4DV2E 1N34E 5A2QC 4JYAE 1D6TA 4DXLA 1I94E 4JI3E 4LF7I 4DR6E 4PRXA 1XMQI 4K0KE 4LF6I 2UUBI 1HNWI 3WU5A 2ZBKB 2UU9I 4WUCA 4DR1I 1Z5AA 1FWLA 1H7SA 4DPTA 4DR7E 2ZITA 3ZZUA 2R3VA 2E5LE 1IBMI 3T1YI 4LF5I 2UUCI 3PYDA 5BR8I 1XNRI 4B3MI 2UUAE 4NXME 3LNUA 3QT8A 4JI6I 1HNZE 3J80Q 2BV3A 1HNXE 1ZM9A 4DU7A 5FLXC 5LMUE 1FJGE 4Z7YA 4LF8E 4OX9E 1FNMA 4MYTA 1ZM2A 4JV5E 2F4VI 4X65I 3Q1QA 1KKHA 4B3SI 3T1HE 4DV5E 4JI2E 4USMA 1IBLI 4JI1I 1S16A 4M1KA 4FWDA 1Z5CA 1MG7A 1BKNA 2AJ4A 4YHHE 3J7AG 4JI4I 5IT9Q 2A2CA 2CZ9A 4HACB 1XMQE 4LF9E 4LF6E 4DV7I 4JI0E 2UUBE 4KHPI 2X7IA 4JI7I 4DV6E 1HNWE 4FWHA 1H72C 1OJ4A 3H4LA 2UU9E 1IBKI 1N0UA 1Z5BA 1Z0TA 2Q2EB 4I3HA 4DUYI 1Z0BA 1H7UA 4X62I 1FI4A 4NXNI 5LMNI 1IBME 3ZKDA 1N32I 3J81Q 2UUCE 2BM1A 2X36A 1FWKA 4FN5A 4LF4I 2R42A 1XNRE 3J80C 4B3ME 2VQEI 1J5EE 4JI6E 3LTOA 3LPSA 4DV4I 1H74A 1ZXNA 2UXDI 4JI5I 4DV3I 1RREA 1HR0I 4JI8I 4DV0E 1Z0GA 4DUZI 2F4VE 4X65E 3PYFA 1N0VC 3OTOI 1N33I 4P52A 1IBLE 1MX0A 4URLA 4JI1E 1XNQI 2HKJA 1ZM4A 4DV1I 4HYMA 3B8HA 4KHPE 4JI7E 4DR2I 4JG4A 1VISA 1NHJA 2NPFA 1IBKE 5IWAI 1ZM3A 4DR3I 2ZM6I 4DR4E 4WUBA 4X62E 3B82A 4FWGA 4NXNE 5LMNE 1NHHA 1K47A 1N32E 4B3TI 1S4EA 2A2DA 1XMOI 4PU9A 4WUDA 4LF4E 5GMEA 4B3RI 2GS8A 1I94I 4JI3I 1MU5A 4DV4E 5A2QQ 2UXDE 4LF7E 4X66I 3WU4A 1HR0E 4HACA 3V5RA 1Z0EA 4PRVA 4DUZE 4ED4A 4GKKI 1U2RA 4R1FA 2HK2A 4Z7CA 1XHKA 4DR1E 3OTOE 2V8PA 4P7AA 1N33E 3PYEA 1XNQE 1A6FA 4YY3I 4LFBI 4DV1E 3T1YE 4LF5E 3JAMQ 3J7AM 3V2UC 1HNZI 4AQYI 2UXBI 3QT7A 5BR8E 4DR2E 1HNXI 3D4JA 3ZM7A 1ZXMA 4USKA 3ZZTA 3B78A 4KQVA 1Z59A 4LFAI 5IWAE 3K17A 2HK3A 3CWVA 4DR3E 2ZM6E 2V2QA 3HULA 4EMDA 2VF3A 4MYUA 1Z0VA 2HKEA 1EA6A 4B3TE 4UTGA 2E1RA 4HY1A 2VQFI 4GKJI 4B3SE 5GMDA 1DARA 4LFCI 1PIEA 5IT9C 2XEXA 4B3RE 1H73A 4LF9I 4DR5I 4JI0I 4JI4E 1PVGA 4DV6I 4X66E 4DV7E 4GKKE 1PKPA 3GONA 2UXCI 1EI1A 2V34A 1Z0WA 4DUYE 2V2VA 4DPUA 4RPFA 1KIJA 1WUUA 4DPXA 3JAMC 3J81C 4X64I 4XTJA 4YY3E 1KTVA 4LFBE 1J5EI 1NHIA 1N36I 4AQYE 2HHHI 2UXBE 4DV2I 2VQEE 1N34I 3M6AA 3QT5A 4JYAI 4FW9A 3QT6A 5L3JA 4DPWA 4DR6I 4LFAE 4K0KI 4DV0I 3PYGA 3K1JA 4JI5E 4DV3E 4JI8E 3WU6A 1B63A 3WU3A 2VQFE 4DR7I 4GKJE 4ZVIA 4UT4A 1Z0CA 2HFSA 4LFCE 4DPYA 2E5LI 2DEJA 3F0NA 4DR5E 5LL6R 2WW4A 1NZ0A 2UUAI 4NXMI 4HXZA 2HFUA 2OI2A 4DU8A 3ZZ0A 2UXCE 1UEKA 5LMUI 4DR4I 1FJGI 4LF8I 2V2ZA 4OX9I 5FLXQ 4JV5I 1FKAE 2LJPA 1ELOA 1B62A 2EFGA
chains in the Genus database with same CATH superfamily
3PS3A 2BM0A 1KVKA 3ZKBA 3B4TA 4X64E 2BR2B 4BA1A 3T1HI 2PO1B 4DV5I 4JI2I 5K36D 2CVEA 5DRRA 1QZRA 2J7KA 2PO1A 1RR9A 2DEIA 1N36E 1XMOE 4YHHI 2HHHE 4DV2E 1N34E 5A2QC 4JYAE 1D6TA 2Z5BA 4DXLA 1I94E 4JI3E 4LF7I 4DR6E 4PRXA 3PS2A 1XMQI 4K0KE 4LF6I 4IFDA 2UUBI 3Q6MA 1HNWI 3WU5A 2BA1G 2ZBKB 5FWKA 1E3HA 2UU9I 4WUCA 4IFDE 1XXEA 4DR1I 1Z5AA 1FWLA 4LCFA 1H7SA 4LCGA 4AM3A 4BA2B 5DROA 4DPTA 4DR7E 4BA2A 2ZITA 4ISAA 3M85G 3ZZUA 4MU4A 2R3VA 2E5LE 2JE6B 1IBMI 3T1YI 2JE6A 4LF5I 3P3CA 2UUCI 1P42A 3PYDA 1R6MA 5BR8I 1XNRI 4B3MI 2UUAE 4NXME 3LNUA 3QT8A 4JI6I 4LOMA 1HNZE 2NN6F 3J80Q 4IFDD 2BV3A 1HNXE 1ZM9A 3HKMA 4DU7A 5FLXC 5LMUE 1FJGE 4Z7YA 4LF8E 4OX9E 1FNMA 4MYTA 1ZM2A 4JV5E 2F4VI 4X65I 2JT2A 3Q1QA 1KKHA 2Z5CB 4B3SI 3T1HE 2Z5CA 4DV5E 4JI2E 4USMA 1IBLI 4JI1I 1S16A 4M1KA 4FWDA 1Z5CA 1MG7A 1BKNA 2AJ4A 2PO0A 5JEAF 4YHHE 3PRYA 3J7AG 1RHYA 4JI4I 5IT9Q 2A2CA 2CZ9A 4HACB 1XMQE 4LF9E 4LF6E 4DV7I 4JI0E 4MU1A 2UUBE 4KHPI 2X7IA 3HJCA 4JI7I 4DV6E 1HNWE 1Y4SA 1VI7A 2C38B 4FWHA 1H72C 1OJ4A 3H4LA 4OO1A 2UU9E 5JEAC 5DRQA 1IBKI 1N0UA 1Z5BA 4AIMA 4OO1E 3P3GA 2AE8A 1Z0TA 2Q2EB 2WNRA 2IOQA 4I3HA 4DUYI 1Z0BA 5DNXA 2EFGA 2J65A 1H7UA 4X62I 3PS1A 1FI4A 4NXNI 5LMNI 1IBME 3ZKDA 1YH8A 4OZEA 1N32I 5C0XA 3J81Q 2UUCE 2BM1A 2X36A 1FWKA 4FN5A 4LF4I 2R42A 1XNRE 3J80C 4B3ME 2VQEI 2BR2A 3M7NG 5C0XE 1J5EE 4JI6E 3LTOA 3UHMA 1Y6ZA 3LPSA 4DV4I 1H74A 2PNZB 1ZXNA 2UXDI 4JI5I 4DV3I 4OO1D 2PNZA 3P3EA 5K36C 1RREA 1HR0I 2VESA 4JI8I 2O1TA 4DV0E 1Z0GA 1UDQA 4DUZI 2F4VE 4X65E 3PYFA 4U3BA 1UDNA 3NZKA 1OYRA 3P76A 1N0VC 2WP8B 3OTOI 1N33I 4P52A 1IBLE 1MX0A 4URLA 4JI1E 5C0XD 1XNQI 1USUA 3H1CA 2HKJA 1ZM4A 4DV1I 5EKWA 2CG9A 4HYMA 4AIDA 4QNJA 3B8HA 4KHPE 1UDOA 4JI7E 4IFDF 2PNMA 4DR2I 4JG4A 1VISA 1NHJA 2C39B 2NPFA 1IBKE 5IWAI 1ZM3A 2C39A 4DR3I 2ZM6I 4DR4E 4FW5A 4IZKB 4WUBA 4X62E 4IZKA 3B82A 4FWGA 4IFDC 4NXNE 5LMNE 1NHHA 2PNLA 1K47A 1N32E 4B3TI 1S4EA 2NN6C 2A2DA 1XMOI 4PU9A 4WUDA 3Q6NA 4LF4E 5GMEA 3K85A 4N3OA 4B3RI 2GS8A 5ELWA 1I94I 4JI3I 1MU5A 4OKGA 3CDIA 4FW6A 4DV4E 5A2QQ 1Y5YA 2UXDE 4FW3A 4MDTA 4LF7E 4X66I 2GQ0A 3WU4A 1HR0E 4HACA 5DRPA 3V5RA 1Z0EA 4LPFA 4PRVA 4ED4A 4DUZE 4GKKI 4QNKA 1U2RA 4R1FA 2HK2A 4Z7CA 2C38A 1XHKA 4DR1E 3OTOE 2V8PA 4P7AA 5K36B 3GLLA 1N33E 1USVA 5K36A 4IZJB 2O3ZA 3PYEA 2O1UA 1XNQE 4IZJA 1A6FA 2IOPA 4YY3I 4LFBI 4DV1E 1HK7A 3T1YE 4LF5E 3JAMQ 3J7AM 3V2UC 1HNZI 4AQYI 2UXBI 3QT7A 5BR8E 2IESA 4DR2E 1HNXI 3GMEA 3D4JA 3ZM7A 1ZXMA 4USKA 4OO1F 3ZZTA 3B78A 4KQVA 3L7ZB 2CGEA 1Z59A 4LFAI 5IWAE 3K17A 2HK3A 3L7ZA 3CWVA 4DR3E 2ZM6E 1R6LA 2V2QA 1YHCA 3CDJA 3HULA 4EMDA 2VF3A 4MYUA 4BA1B 2GO4A 1Z0VA 2HKEA 1EA6A 4OO1C 4B3TE 4UTGA 2E1RA 4HY1A 2VQFI 4IZJD 4GKJI 5C0XF 4B3SE 5GMDA 1DARA 4LFCI 2WP8A 3KRNA 2Z5BB 1PIEA 5IT9C 2XEXA 4B3RE 1H73A 2JEBB 4FW4A 4IFDB 4U3DA 4LF9I 5EL9A 2JEBA 4DR5I 4JI0I 4JI4E 1PVGA 4DV6I 2NN6B 4X66E 2IERA 2NN6A 4DV7E 5C0XC 4GKKE 1PKPA 3GONA 2Z5EA 1E3PA 2UXCI 2NN6E 1EI1A 2PO2B 2PO2A 2V34A 1Z0WA 4DUYE 2V2VA 4FW7A 4DPUA 4RPFA 1KIJA 1WUUA 1OYSA 4DPXA 3JAMC 3J81C 4X64I 4XTJA 4YY3E 1KTVA 3DD6A 4LFBE 5JEAB 3U1YA 3GCMA 1UDSA 1J5EI 1NHIA 5JEAA 1N36I 1Y60A 4AQYE 2O1VA 2HHHI 2UXBE 4DV2I 2VQEE 2C37B 1N34I 5JEAE 3M6AA 3QT5A 4JYAI 2C37A 2O1WA 4FW9A 2BA0D 3QT6A 2NN6D 4DPWA 5L3JA 4DR6I 4LFAE 4K0KI 4DV0I 3PYGA 2JEAB 3K1JA 1OYPA 4JI5E 4DV3E 2JEAA 4JI8E 4MQYA 3M7ND 4J3DA 5DNLA 3WU6A 2GO3A 1B63A 3U1KA 2PO0B 3WU3A 2VQFE 4DR7I 4GKJE 4ZVIA 4UT4A 1Z0CA 2HFSA 4LFCE 4GQUA 4DPYA 4MU0A 2E5LI 2DEJA 5JEAD 3F0NA 2BA1D 1Y4UA 4DR5E 5LL6R 5K36E 4OO1B 2F1DA 2WW4A 1NZ0A 2UUAI 4NXMI 4HXZA 2HFUA 2OI2A 3M85D 4IS9A 2WNRB 4MU3A 4DU8A 3ZZ0A 2UXCE 1UEKA 5LMUI 4DR4I 1FJGI 4LF8I 2V2ZA 4OX9I 5FLXQ 4JV5I 1FKAE 2LJPA 1ELOA 2BA0G 3P06A 5C0XB 5K36F 1B62A 4NBQA 4LCHA
chains in the Genus database with same CATH topology
2BM0A 1KVKA 3ZKBA 4X64E 3T1HI 4DV5I 4JI2I 1QZRA 2J7KA 1RR9A 2DEIA 1N36E 1XMOE 4YHHI 2HHHE 4DV2E 1N34E 5A2QC 4JYAE 1D6TA 2Z5BA 4DXLA 1I94E 4JI3E 4LF7I 4DR6E 4PRXA 1XMQI 4K0KE 4LF6I 2UUBI 3Q6MA 1HNWI 3WU5A 2ZBKB 5FWKA 2UU9I 4WUCA 4DR1I 1Z5AA 1FWLA 1H7SA 4DPTA 4DR7E 2ZITA 3ZZUA 2R3VA 2E5LE 1IBMI 3T1YI 4LF5I 2UUCI 3PYDA 5BR8I 1XNRI 4B3MI 2UUAE 4NXME 3LNUA 3QT8A 4JI6I 1HNZE 3J80Q 2BV3A 1HNXE 1ZM9A 4DU7A 5FLXC 5LMUE 1FJGE 4Z7YA 4LF8E 4OX9E 1FNMA 4MYTA 1ZM2A 4JV5E 2F4VI 4X65I 3Q1QA 1KKHA 2Z5CB 4B3SI 3T1HE 2Z5CA 4DV5E 4JI2E 4USMA 1IBLI 4JI1I 1S16A 4M1KA 4FWDA 1Z5CA 1MG7A 1BKNA 2AJ4A 4YHHE 3PRYA 3J7AG 4JI4I 5IT9Q 2A2CA 2CZ9A 4HACB 1XMQE 4LF9E 4LF6E 4DV7I 4JI0E 2UUBE 4KHPI 2X7IA 3HJCA 4JI7I 4DV6E 1HNWE 1Y4SA 4FWHA 1H72C 1OJ4A 3H4LA 2UU9E 1IBKI 1N0UA 1Z5BA 1Z0TA 2Q2EB 2IOQA 4I3HA 4DUYI 1Z0BA 1H7UA 4X62I 1FI4A 4NXNI 5LMNI 1IBME 3ZKDA 1N32I 3J81Q 2UUCE 2BM1A 2X36A 1FWKA 4FN5A 4LF4I 2R42A 1XNRE 3J80C 4B3ME 2VQEI 1J5EE 4JI6E 3LTOA 1Y6ZA 3LPSA 4DV4I 1H74A 1ZXNA 2UXDI 4JI5I 4DV3I 1RREA 1HR0I 4JI8I 2O1TA 4DV0E 1Z0GA 4DUZI 2F4VE 4X65E 3PYFA 1N0VC 3OTOI 1N33I 4P52A 1IBLE 1MX0A 4URLA 4JI1E 1XNQI 1USUA 2HKJA 1ZM4A 4DV1I 2CG9A 4HYMA 3B8HA 4KHPE 4JI7E 2PNMA 4DR2I 4JG4A 1VISA 1NHJA 2NPFA 1IBKE 5IWAI 1ZM3A 4DR3I 2ZM6I 4DR4E 4IZKB 4WUBA 4X62E 4IZKA 3B82A 4FWGA 4NXNE 5LMNE 1NHHA 2PNLA 1K47A 1N32E 4B3TI 1S4EA 2A2DA 1XMOI 4PU9A 4WUDA 3Q6NA 4LF4E 5GMEA 3K85A 4N3OA 4B3RI 2GS8A 1I94I 4JI3I 1MU5A 4DV4E 5A2QQ 2UXDE 4LF7E 4X66I 2GQ0A 3WU4A 1HR0E 4HACA 3V5RA 1Z0EA 4PRVA 4DUZE 4ED4A 4GKKI 1U2RA 4R1FA 2HK2A 4Z7CA 1XHKA 4DR1E 3OTOE 2V8PA 4P7AA 1N33E 1USVA 4IZJB 3PYEA 2O1UA 1XNQE 4IZJA 1A6FA 2IOPA 4YY3I 4LFBI 4DV1E 1HK7A 3T1YE 4LF5E 3JAMQ 3J7AM 3V2UC 1HNZI 4AQYI 2UXBI 3QT7A 5BR8E 4DR2E 1HNXI 3D4JA 3ZM7A 1ZXMA 4USKA 3ZZTA 3B78A 4KQVA 2CGEA 1Z59A 4LFAI 5IWAE 3K17A 2HK3A 3CWVA 4DR3E 2ZM6E 2V2QA 3HULA 4EMDA 2VF3A 4MYUA 1Z0VA 2HKEA 1EA6A 4B3TE 4UTGA 2E1RA 4HY1A 2VQFI 4IZJD 4GKJI 4B3SE 5GMDA 1DARA 4LFCI 2Z5BB 1PIEA 5IT9C 2XEXA 4B3RE 1H73A 4LF9I 4DR5I 4JI0I 4JI4E 1PVGA 4DV6I 4X66E 4DV7E 4GKKE 1PKPA 3GONA 2Z5EA 2UXCI 1EI1A 2V34A 1Z0WA 4DUYE 2V2VA 4DPUA 4RPFA 1KIJA 1WUUA 4DPXA 3JAMC 3J81C 4X64I 4XTJA 4YY3E 1KTVA 4LFBE 1J5EI 1NHIA 1N36I 4AQYE 2O1VA 2HHHI 2UXBE 4DV2I 2VQEE 1N34I 3M6AA 3QT5A 4JYAI 4FW9A 2O1WA 3QT6A 5L3JA 4DPWA 4DR6I 4LFAE 4K0KI 4DV0I 3PYGA 3K1JA 4JI5E 4DV3E 4JI8E 3WU6A 1B63A 3WU3A 2VQFE 4DR7I 4GKJE 4ZVIA 4UT4A 1Z0CA 2HFSA 4LFCE 4DPYA 2E5LI 2DEJA 3F0NA 1Y4UA 4DR5E 5LL6R 2WW4A 1NZ0A 2UUAI 4NXMI 4HXZA 2HFUA 2OI2A 4DU8A 3ZZ0A 2UXCE 1UEKA 5LMUI 4DR4I 1FJGI 4LF8I 2V2ZA 4OX9I 5FLXQ 4JV5I 1FKAE 2LJPA 1ELOA 3P06A 1B62A 2EFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM0 A;  1KVK A;  3ZKB A;  4X64 E;  3T1H I;  4DV5 I;  4JI2 I;  1QZR A;  2J7K A;  1RR9 A;  2DEI A;  1N36 E;  1XMO E;  4YHH I;  2HHH E;  4DV2 E;  1N34 E;  5A2Q C;  4JYA E;  1D6T A;  4DXL A;  1I94 E;  4JI3 E;  4LF7 I;  4DR6 E;  4PRX A;  1XMQ I;  4K0K E;  4LF6 I;  2UUB I;  1HNW I;  3WU5 A;  2ZBK B;  2UU9 I;  4WUC A;  4DR1 I;  1Z5A A;  1FWL A;  1H7S A;  4DPT A;  4DR7 E;  2ZIT A;  3ZZU A;  2R3V A;  2E5L E;  1IBM I;  3T1Y I;  4LF5 I;  2UUC I;  3PYD A;  5BR8 I;  1XNR I;  4B3M I;  2UUA E;  4NXM E;  3LNU A;  3QT8 A;  4JI6 I;  1HNZ E;  3J80 Q;  2BV3 A;  1HNX E;  1ZM9 A;  4DU7 A;  5FLX C;  5LMU E;  1FJG E;  4Z7Y A;  4LF8 E;  4OX9 E;  1FNM A;  4MYT A;  1ZM2 A;  4JV5 E;  2F4V I;  4X65 I;  3Q1Q A;  1KKH A;  4B3S I;  3T1H E;  4DV5 E;  4JI2 E;  4USM A;  1IBL I;  4JI1 I;  1S16 A;  4M1K A;  4FWD A;  1Z5C A;  1MG7 A;  1BKN A;  2AJ4 A;  4YHH E;  3J7A G;  4JI4 I;  5IT9 Q;  2A2C A;  2CZ9 A;  4HAC B;  1XMQ E;  4LF9 E;  4LF6 E;  4DV7 I;  4JI0 E;  2UUB E;  4KHP I;  2X7I A;  4JI7 I;  4DV6 E;  1HNW E;  4FWH A;  1H72 C;  1OJ4 A;  3H4L A;  2UU9 E;  1IBK I;  1N0U A;  1Z5B A;  1Z0T A;  2Q2E B;  4I3H A;  4DUY I;  1Z0B A;  1H7U A;  4X62 I;  1FI4 A;  4NXN I;  5LMN I;  1IBM E;  3ZKD A;  1N32 I;  3J81 Q;  2UUC E;  2BM1 A;  2X36 A;  1FWK A;  4FN5 A;  4LF4 I;  2R42 A;  1XNR E;  3J80 C;  4B3M E;  2VQE I;  1J5E E;  4JI6 E;  3LTO A;  3LPS A;  4DV4 I;  1H74 A;  1ZXN A;  2UXD I;  4JI5 I;  4DV3 I;  1RRE A;  1HR0 I;  4JI8 I;  4DV0 E;  1Z0G A;  4DUZ I;  2F4V E;  4X65 E;  3PYF A;  1N0V C;  3OTO I;  1N33 I;  4P52 A;  1IBL E;  1MX0 A;  4URL A;  4JI1 E;  1XNQ I;  2HKJ A;  1ZM4 A;  4DV1 I;  4HYM A;  3B8H A;  4KHP E;  4JI7 E;  4DR2 I;  4JG4 A;  1VIS A;  1NHJ A;  2NPF A;  1IBK E;  5IWA I;  1ZM3 A;  4DR3 I;  2ZM6 I;  4DR4 E;  4WUB A;  4X62 E;  3B82 A;  4FWG A;  4NXN E;  5LMN E;  1NHH A;  1K47 A;  1N32 E;  4B3T I;  1S4E A;  2A2D A;  1XMO I;  4PU9 A;  4WUD A;  4LF4 E;  5GME A;  4B3R I;  2GS8 A;  1I94 I;  4JI3 I;  1MU5 A;  4DV4 E;  5A2Q Q;  2UXD E;  4LF7 E;  4X66 I;  3WU4 A;  1HR0 E;  4HAC A;  3V5R A;  1Z0E A;  4PRV A;  4DUZ E;  4ED4 A;  4GKK I;  1U2R A;  4R1F A;  2HK2 A;  4Z7C A;  1XHK A;  4DR1 E;  3OTO E;  2V8P A;  4P7A A;  1N33 E;  3PYE A;  1XNQ E;  1A6F A;  4YY3 I;  4LFB I;  4DV1 E;  3T1Y E;  4LF5 E;  3JAM Q;  3J7A M;  3V2U C;  1HNZ I;  4AQY I;  2UXB I;  3QT7 A;  5BR8 E;  4DR2 E;  1HNX I;  3D4J A;  3ZM7 A;  1ZXM A;  4USK A;  3ZZT A;  3B78 A;  4KQV A;  1Z59 A;  4LFA I;  5IWA E;  3K17 A;  2HK3 A;  3CWV A;  4DR3 E;  2ZM6 E;  2V2Q A;  3HUL A;  4EMD A;  2VF3 A;  4MYU A;  1Z0V A;  2HKE A;  1EA6 A;  4B3T E;  4UTG A;  2E1R A;  4HY1 A;  2VQF I;  4GKJ I;  4B3S E;  5GMD A;  1DAR A;  4LFC I;  1PIE A;  5IT9 C;  2XEX A;  4B3R E;  1H73 A;  4LF9 I;  4DR5 I;  4JI0 I;  4JI4 E;  1PVG A;  4DV6 I;  4X66 E;  4DV7 E;  4GKK E;  1PKP A;  3GON A;  2UXC I;  1EI1 A;  2V34 A;  1Z0W A;  4DUY E;  2V2V A;  4DPU A;  4RPF A;  1KIJ A;  1WUU A;  4DPX A;  3JAM C;  3J81 C;  4X64 I;  4XTJ A;  4YY3 E;  1KTV A;  4LFB E;  1J5E I;  1NHI A;  1N36 I;  4AQY E;  2HHH I;  2UXB E;  4DV2 I;  2VQE E;  1N34 I;  3M6A A;  3QT5 A;  4JYA I;  4FW9 A;  3QT6 A;  5L3J A;  4DPW A;  4DR6 I;  4LFA E;  4K0K I;  4DV0 I;  3PYG A;  3K1J A;  4JI5 E;  4DV3 E;  4JI8 E;  3WU6 A;  1B63 A;  3WU3 A;  2VQF E;  4DR7 I;  4GKJ E;  4ZVI A;  4UT4 A;  1Z0C A;  2HFS A;  4LFC E;  4DPY A;  2E5L I;  2DEJ A;  3F0N A;  4DR5 E;  5LL6 R;  2WW4 A;  1NZ0 A;  2UUA I;  4NXM I;  4HXZ A;  2HFU A;  2OI2 A;  4DU8 A;  3ZZ0 A;  2UXC E;  1UEK A;  5LMU I;  4DR4 I;  1FJG I;  4LF8 I;  2V2Z A;  4OX9 I;  5FLX Q;  4JV5 I;  1FKA E;  2LJP A;  1ELO A;  1B62 A;  2EFG A; 
#chains in the Genus database with same CATH topology
 3PS3 A;  2BM0 A;  1KVK A;  3ZKB A;  3B4T A;  4X64 E;  2BR2 B;  4BA1 A;  3T1H I;  2PO1 B;  4DV5 I;  4JI2 I;  5K36 D;  2CVE A;  5DRR A;  1QZR A;  2J7K A;  2PO1 A;  1RR9 A;  2DEI A;  1N36 E;  1XMO E;  4YHH I;  2HHH E;  4DV2 E;  1N34 E;  5A2Q C;  4JYA E;  1D6T A;  2Z5B A;  4DXL A;  1I94 E;  4JI3 E;  4LF7 I;  4DR6 E;  4PRX A;  3PS2 A;  1XMQ I;  4K0K E;  4LF6 I;  4IFD A;  2UUB I;  3Q6M A;  1HNW I;  3WU5 A;  2BA1 G;  2ZBK B;  5FWK A;  1E3H A;  2UU9 I;  4WUC A;  4IFD E;  1XXE A;  4DR1 I;  1Z5A A;  1FWL A;  4LCF A;  1H7S A;  4LCG A;  4AM3 A;  4BA2 B;  5DRO A;  4DPT A;  4DR7 E;  4BA2 A;  2ZIT A;  4ISA A;  3M85 G;  3ZZU A;  4MU4 A;  2R3V A;  2E5L E;  2JE6 B;  1IBM I;  3T1Y I;  2JE6 A;  4LF5 I;  3P3C A;  2UUC I;  1P42 A;  3PYD A;  1R6M A;  5BR8 I;  1XNR I;  4B3M I;  2UUA E;  4NXM E;  3LNU A;  3QT8 A;  4JI6 I;  4LOM A;  1HNZ E;  2NN6 F;  3J80 Q;  4IFD D;  2BV3 A;  1HNX E;  1ZM9 A;  3HKM A;  4DU7 A;  5FLX C;  5LMU E;  1FJG E;  4Z7Y A;  4LF8 E;  4OX9 E;  1FNM A;  4MYT A;  1ZM2 A;  4JV5 E;  2F4V I;  4X65 I;  2JT2 A;  3Q1Q A;  1KKH A;  2Z5C B;  4B3S I;  3T1H E;  2Z5C A;  4DV5 E;  4JI2 E;  4USM A;  1IBL I;  4JI1 I;  1S16 A;  4M1K A;  4FWD A;  1Z5C A;  1MG7 A;  1BKN A;  2AJ4 A;  2PO0 A;  5JEA F;  4YHH E;  3PRY A;  3J7A G;  1RHY A;  4JI4 I;  5IT9 Q;  2A2C A;  2CZ9 A;  4HAC B;  1XMQ E;  4LF9 E;  4LF6 E;  4DV7 I;  4JI0 E;  4MU1 A;  2UUB E;  4KHP I;  2X7I A;  3HJC A;  4JI7 I;  4DV6 E;  1HNW E;  1Y4S A;  1VI7 A;  2C38 B;  4FWH A;  1H72 C;  1OJ4 A;  3H4L A;  4OO1 A;  2UU9 E;  5JEA C;  5DRQ A;  1IBK I;  1N0U A;  1Z5B A;  4AIM A;  4OO1 E;  3P3G A;  2AE8 A;  1Z0T A;  2Q2E B;  2WNR A;  2IOQ A;  4I3H A;  4DUY I;  1Z0B A;  5DNX A;  2EFG A;  2J65 A;  1H7U A;  4X62 I;  3PS1 A;  1FI4 A;  4NXN I;  5LMN I;  1IBM E;  3ZKD A;  1YH8 A;  4OZE A;  1N32 I;  5C0X A;  3J81 Q;  2UUC E;  2BM1 A;  2X36 A;  1FWK A;  4FN5 A;  4LF4 I;  2R42 A;  1XNR E;  3J80 C;  4B3M E;  2VQE I;  2BR2 A;  3M7N G;  5C0X E;  1J5E E;  4JI6 E;  3LTO A;  3UHM A;  1Y6Z A;  3LPS A;  4DV4 I;  1H74 A;  2PNZ B;  1ZXN A;  2UXD I;  4JI5 I;  4DV3 I;  4OO1 D;  2PNZ A;  3P3E A;  5K36 C;  1RRE A;  1HR0 I;  2VES A;  4JI8 I;  2O1T A;  4DV0 E;  1Z0G A;  1UDQ A;  4DUZ I;  2F4V E;  4X65 E;  3PYF A;  4U3B A;  1UDN A;  3NZK A;  1OYR A;  3P76 A;  1N0V C;  2WP8 B;  3OTO I;  1N33 I;  4P52 A;  1IBL E;  1MX0 A;  4URL A;  4JI1 E;  5C0X D;  1XNQ I;  1USU A;  3H1C A;  2HKJ A;  1ZM4 A;  4DV1 I;  5EKW A;  2CG9 A;  4HYM A;  4AID A;  4QNJ A;  3B8H A;  4KHP E;  1UDO A;  4JI7 E;  4IFD F;  2PNM A;  4DR2 I;  4JG4 A;  1VIS A;  1NHJ A;  2C39 B;  2NPF A;  1IBK E;  5IWA I;  1ZM3 A;  2C39 A;  4DR3 I;  2ZM6 I;  4DR4 E;  4FW5 A;  4IZK B;  4WUB A;  4X62 E;  4IZK A;  3B82 A;  4FWG A;  4IFD C;  4NXN E;  5LMN E;  1NHH A;  2PNL A;  1K47 A;  1N32 E;  4B3T I;  1S4E A;  2NN6 C;  2A2D A;  1XMO I;  4PU9 A;  4WUD A;  3Q6N A;  4LF4 E;  5GME A;  3K85 A;  4N3O A;  4B3R I;  2GS8 A;  5ELW A;  1I94 I;  4JI3 I;  1MU5 A;  4OKG A;  3CDI A;  4FW6 A;  4DV4 E;  5A2Q Q;  1Y5Y A;  2UXD E;  4FW3 A;  4MDT A;  4LF7 E;  4X66 I;  2GQ0 A;  3WU4 A;  1HR0 E;  4HAC A;  5DRP A;  3V5R A;  1Z0E A;  4LPF A;  4PRV A;  4ED4 A;  4DUZ E;  4GKK I;  4QNK A;  1U2R A;  4R1F A;  2HK2 A;  4Z7C A;  2C38 A;  1XHK A;  4DR1 E;  3OTO E;  2V8P A;  4P7A A;  5K36 B;  3GLL A;  1N33 E;  1USV A;  5K36 A;  4IZJ B;  2O3Z A;  3PYE A;  2O1U A;  1XNQ E;  4IZJ A;  1A6F A;  2IOP A;  4YY3 I;  4LFB I;  4DV1 E;  1HK7 A;  3T1Y E;  4LF5 E;  3JAM Q;  3J7A M;  3V2U C;  1HNZ I;  4AQY I;  2UXB I;  3QT7 A;  5BR8 E;  2IES A;  4DR2 E;  1HNX I;  3GME A;  3D4J A;  3ZM7 A;  1ZXM A;  4USK A;  4OO1 F;  3ZZT A;  3B78 A;  4KQV A;  3L7Z B;  2CGE A;  1Z59 A;  4LFA I;  5IWA E;  3K17 A;  2HK3 A;  3L7Z A;  3CWV A;  4DR3 E;  2ZM6 E;  1R6L A;  2V2Q A;  1YHC A;  3CDJ A;  3HUL A;  4EMD A;  2VF3 A;  4MYU A;  4BA1 B;  2GO4 A;  1Z0V A;  2HKE A;  1EA6 A;  4OO1 C;  4B3T E;  4UTG A;  2E1R A;  4HY1 A;  2VQF I;  4IZJ D;  4GKJ I;  5C0X F;  4B3S E;  5GMD A;  1DAR A;  4LFC I;  2WP8 A;  3KRN A;  2Z5B B;  1PIE A;  5IT9 C;  2XEX A;  4B3R E;  1H73 A;  2JEB B;  4FW4 A;  4IFD B;  4U3D A;  4LF9 I;  5EL9 A;  2JEB A;  4DR5 I;  4JI0 I;  4JI4 E;  1PVG A;  4DV6 I;  2NN6 B;  4X66 E;  2IER A;  2NN6 A;  4DV7 E;  5C0X C;  4GKK E;  1PKP A;  3GON A;  2Z5E A;  1E3P A;  2UXC I;  2NN6 E;  1EI1 A;  2PO2 B;  2PO2 A;  2V34 A;  1Z0W A;  4DUY E;  2V2V A;  4FW7 A;  4DPU A;  4RPF A;  1KIJ A;  1WUU A;  1OYS A;  4DPX A;  3JAM C;  3J81 C;  4X64 I;  4XTJ A;  4YY3 E;  1KTV A;  3DD6 A;  4LFB E;  5JEA B;  3U1Y A;  3GCM A;  1UDS A;  1J5E I;  1NHI A;  5JEA A;  1N36 I;  1Y60 A;  4AQY E;  2O1V A;  2HHH I;  2UXB E;  4DV2 I;  2VQE E;  2C37 B;  1N34 I;  5JEA E;  3M6A A;  3QT5 A;  4JYA I;  2C37 A;  2O1W A;  4FW9 A;  2BA0 D;  3QT6 A;  2NN6 D;  4DPW A;  5L3J A;  4DR6 I;  4LFA E;  4K0K I;  4DV0 I;  3PYG A;  2JEA B;  3K1J A;  1OYP A;  4JI5 E;  4DV3 E;  2JEA A;  4JI8 E;  4MQY A;  3M7N D;  4J3D A;  5DNL A;  3WU6 A;  2GO3 A;  1B63 A;  3U1K A;  2PO0 B;  3WU3 A;  2VQF E;  4DR7 I;  4GKJ E;  4ZVI A;  4UT4 A;  1Z0C A;  2HFS A;  4LFC E;  4GQU A;  4DPY A;  4MU0 A;  2E5L I;  2DEJ A;  5JEA D;  3F0N A;  2BA1 D;  1Y4U A;  4DR5 E;  5LL6 R;  5K36 E;  4OO1 B;  2F1D A;  2WW4 A;  1NZ0 A;  2UUA I;  4NXM I;  4HXZ A;  2HFU A;  2OI2 A;  3M85 D;  4IS9 A;  2WNR B;  4MU3 A;  4DU8 A;  3ZZ0 A;  2UXC E;  1UEK A;  5LMU I;  4DR4 I;  1FJG I;  4LF8 I;  2V2Z A;  4OX9 I;  5FLX Q;  4JV5 I;  1FKA E;  2LJP A;  1ELO A;  2BA0 G;  3P06 A;  5C0X B;  5K36 F;  1B62 A;  4NBQ A;  4LCH A; 
#chains in the Genus database with same CATH homology
 2BM0 A;  1KVK A;  3ZKB A;  4X64 E;  3T1H I;  4DV5 I;  4JI2 I;  1QZR A;  2J7K A;  1RR9 A;  2DEI A;  1N36 E;  1XMO E;  4YHH I;  2HHH E;  4DV2 E;  1N34 E;  5A2Q C;  4JYA E;  1D6T A;  2Z5B A;  4DXL A;  1I94 E;  4JI3 E;  4LF7 I;  4DR6 E;  4PRX A;  1XMQ I;  4K0K E;  4LF6 I;  2UUB I;  3Q6M A;  1HNW I;  3WU5 A;  2ZBK B;  5FWK A;  2UU9 I;  4WUC A;  4DR1 I;  1Z5A A;  1FWL A;  1H7S A;  4DPT A;  4DR7 E;  2ZIT A;  3ZZU A;  2R3V A;  2E5L E;  1IBM I;  3T1Y I;  4LF5 I;  2UUC I;  3PYD A;  5BR8 I;  1XNR I;  4B3M I;  2UUA E;  4NXM E;  3LNU A;  3QT8 A;  4JI6 I;  1HNZ E;  3J80 Q;  2BV3 A;  1HNX E;  1ZM9 A;  4DU7 A;  5FLX C;  5LMU E;  1FJG E;  4Z7Y A;  4LF8 E;  4OX9 E;  1FNM A;  4MYT A;  1ZM2 A;  4JV5 E;  2F4V I;  4X65 I;  3Q1Q A;  1KKH A;  2Z5C B;  4B3S I;  3T1H E;  2Z5C A;  4DV5 E;  4JI2 E;  4USM A;  1IBL I;  4JI1 I;  1S16 A;  4M1K A;  4FWD A;  1Z5C A;  1MG7 A;  1BKN A;  2AJ4 A;  4YHH E;  3PRY A;  3J7A G;  4JI4 I;  5IT9 Q;  2A2C A;  2CZ9 A;  4HAC B;  1XMQ E;  4LF9 E;  4LF6 E;  4DV7 I;  4JI0 E;  2UUB E;  4KHP I;  2X7I A;  3HJC A;  4JI7 I;  4DV6 E;  1HNW E;  1Y4S A;  4FWH A;  1H72 C;  1OJ4 A;  3H4L A;  2UU9 E;  1IBK I;  1N0U A;  1Z5B A;  1Z0T A;  2Q2E B;  2IOQ A;  4I3H A;  4DUY I;  1Z0B A;  1H7U A;  4X62 I;  1FI4 A;  4NXN I;  5LMN I;  1IBM E;  3ZKD A;  1N32 I;  3J81 Q;  2UUC E;  2BM1 A;  2X36 A;  1FWK A;  4FN5 A;  4LF4 I;  2R42 A;  1XNR E;  3J80 C;  4B3M E;  2VQE I;  1J5E E;  4JI6 E;  3LTO A;  1Y6Z A;  3LPS A;  4DV4 I;  1H74 A;  1ZXN A;  2UXD I;  4JI5 I;  4DV3 I;  1RRE A;  1HR0 I;  4JI8 I;  2O1T A;  4DV0 E;  1Z0G A;  4DUZ I;  2F4V E;  4X65 E;  3PYF A;  1N0V C;  3OTO I;  1N33 I;  4P52 A;  1IBL E;  1MX0 A;  4URL A;  4JI1 E;  1XNQ I;  1USU A;  2HKJ A;  1ZM4 A;  4DV1 I;  2CG9 A;  4HYM A;  3B8H A;  4KHP E;  4JI7 E;  2PNM A;  4DR2 I;  4JG4 A;  1VIS A;  1NHJ A;  2NPF A;  1IBK E;  5IWA I;  1ZM3 A;  4DR3 I;  2ZM6 I;  4DR4 E;  4IZK B;  4WUB A;  4X62 E;  4IZK A;  3B82 A;  4FWG A;  4NXN E;  5LMN E;  1NHH A;  2PNL A;  1K47 A;  1N32 E;  4B3T I;  1S4E A;  2A2D A;  1XMO I;  4PU9 A;  4WUD A;  3Q6N A;  4LF4 E;  5GME A;  3K85 A;  4N3O A;  4B3R I;  2GS8 A;  1I94 I;  4JI3 I;  1MU5 A;  4DV4 E;  5A2Q Q;  2UXD E;  4LF7 E;  4X66 I;  2GQ0 A;  3WU4 A;  1HR0 E;  4HAC A;  3V5R A;  1Z0E A;  4PRV A;  4DUZ E;  4ED4 A;  4GKK I;  1U2R A;  4R1F A;  2HK2 A;  4Z7C A;  1XHK A;  4DR1 E;  3OTO E;  2V8P A;  4P7A A;  1N33 E;  1USV A;  4IZJ B;  3PYE A;  2O1U A;  1XNQ E;  4IZJ A;  1A6F A;  2IOP A;  4YY3 I;  4LFB I;  4DV1 E;  1HK7 A;  3T1Y E;  4LF5 E;  3JAM Q;  3J7A M;  3V2U C;  1HNZ I;  4AQY I;  2UXB I;  3QT7 A;  5BR8 E;  4DR2 E;  1HNX I;  3D4J A;  3ZM7 A;  1ZXM A;  4USK A;  3ZZT A;  3B78 A;  4KQV A;  2CGE A;  1Z59 A;  4LFA I;  5IWA E;  3K17 A;  2HK3 A;  3CWV A;  4DR3 E;  2ZM6 E;  2V2Q A;  3HUL A;  4EMD A;  2VF3 A;  4MYU A;  1Z0V A;  2HKE A;  1EA6 A;  4B3T E;  4UTG A;  2E1R A;  4HY1 A;  2VQF I;  4IZJ D;  4GKJ I;  4B3S E;  5GMD A;  1DAR A;  4LFC I;  2Z5B B;  1PIE A;  5IT9 C;  2XEX A;  4B3R E;  1H73 A;  4LF9 I;  4DR5 I;  4JI0 I;  4JI4 E;  1PVG A;  4DV6 I;  4X66 E;  4DV7 E;  4GKK E;  1PKP A;  3GON A;  2Z5E A;  2UXC I;  1EI1 A;  2V34 A;  1Z0W A;  4DUY E;  2V2V A;  4DPU A;  4RPF A;  1KIJ A;  1WUU A;  4DPX A;  3JAM C;  3J81 C;  4X64 I;  4XTJ A;  4YY3 E;  1KTV A;  4LFB E;  1J5E I;  1NHI A;  1N36 I;  4AQY E;  2O1V A;  2HHH I;  2UXB E;  4DV2 I;  2VQE E;  1N34 I;  3M6A A;  3QT5 A;  4JYA I;  4FW9 A;  2O1W A;  3QT6 A;  5L3J A;  4DPW A;  4DR6 I;  4LFA E;  4K0K I;  4DV0 I;  3PYG A;  3K1J A;  4JI5 E;  4DV3 E;  4JI8 E;  3WU6 A;  1B63 A;  3WU3 A;  2VQF E;  4DR7 I;  4GKJ E;  4ZVI A;  4UT4 A;  1Z0C A;  2HFS A;  4LFC E;  4DPY A;  2E5L I;  2DEJ A;  3F0N A;  1Y4U A;  4DR5 E;  5LL6 R;  2WW4 A;  1NZ0 A;  2UUA I;  4NXM I;  4HXZ A;  2HFU A;  2OI2 A;  4DU8 A;  3ZZ0 A;  2UXC E;  1UEK A;  5LMU I;  4DR4 I;  1FJG I;  4LF8 I;  2V2Z A;  4OX9 I;  5FLX Q;  4JV5 I;  1FKA E;  2LJP A;  1ELO A;  3P06 A;  1B62 A;  2EFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...