4DV7I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv7I00
4LF4I 3T1YI 4FW9A 4HACB 4DV3E 4DV2I 4ED4A 1XNRE 4DR5E 1IBLE 4JI4E 4X64E 4I3HA 1N33I 4JV5E 4DPXA 4GKJI 1Z59A 4JI8E 4X62E 5BR8E 4JI7I 1FWKA 4JYAE 4DR1E 4M1KA 4ZVIA 1HR0I 2UUBE 1ZM4A 1NHIA 1N36I 5LMNE 4AQYE 3V5RA 4B3SE 1Z0EA 2HKJA 4B3MI 1Z5AA 5FLXQ 2OI2A 4FWGA 3ZZ0A 4LFAE 4FWDA 1ELOA 4HXZA 2A2DA 1KKHA 1MU5A 2HKEA 2DEJA 4DUZE 5LMUI 3J80Q 1HNXE 4LFCI 2HHHE 2ZM6I 4DPYA 4JI2I 3QT7A 2A2CA 4LF9E 1Z5BA 1XNQI 1Z0TA 1FKAE 4FN5A 1Z0GA 1J5EI 2UUCE 2V2ZA 3T1HE 1H74A 2VQFI 1N32I 4DV4I 4B3TI 3F0NA 4X66E 1S16A 1XNRI 1B62A 1ZM3A 3J7AG 1KIJA 4DUYE 4JI4I 4JI1E 3GONA 4DR7I 3PYGA 2BV3A 2EFGA 1N34E 4LFBI 1EI1A 4YY3I 3H4LA 3M6AA 2UUAI 4JI3E 2LJPA 4DV7I 4K0KE 4DV1I 1I94I 2UXCI 4KHPI 4JI5E 1PVGA 4DR3E 1B63A 4JI6E 2GS8A 4AQYI 4UTGA 4R1FA 4LF5E 2ZITA 1HNZE 1U2RA 4JI0I 4PRVA 4DR6I 1RREA 4USKA 3B82A 5IWAI 3D4JA 3LNUA 3V2UC 3WU4A 3OTOE 2HFSA 4DR4E 4LF8I 4DV5E 1HNWI 3B8HA 4X65I 4YHHE 4PU9A 2VF3A 3J80C 4LF7E 4UT4A 2VQEE 2J7KA 2F4VE 4LF6E 3QT5A 3J81Q 2UXDI 1FJGI 1PIEA 2UXBE 2E1RA 1D6TA 1H7SA 4DPWA 4P7AA 2V34A 3ZZTA 4DU7A 4DV6E 4B3RE 1QZRA 1K47A 1ZM9A 1IBME 4URLA 1H72C 1H73A 3K1JA 2Q2EB 4K0KI 1N0VC 5A2QC 2WW4A 2DEIA 3QT8A 4OX9E 4KQVA 2HFUA 3T1YE 2NPFA 4NXMI 2UU9I 1IBKE 4DV2E 5IT9Q 2V8PA 4GKKI 4XTJA 4FWHA 1ZM2A 1KVKA 1NZ0A 4DV3I 1S4EA 4DU8A 4DR5I 4HY1A 1IBLI 3WU5A 4GKJE 1Z0BA 4JG4A 4X64I 3B78A 3HULA 4USMA 2R3VA 4JV5I 4DR4I 1HR0E 4JI8I 1N36E 2HK3A 4DPTA 4X62I 5BR8I 1KTVA 4B3ME 4MYTA 4EMDA 4JYAI 4DR1I 2UUBI 5LMNI 4PRXA 4B3SI 2E5LE 4LF6I 2CZ9A 4HYMA 5LMUE 4LFCE 4LFAI 3PYDA 1XMOE 2ZM6E 4JI2E 1EA6A 5LL6R 2ZBKB 4DUZI 1HNXI 3LTOA 3J7AM 1XNQE 2HHHI 1NHJA 5FLXC 3J81C 4LF9I 2V2QA 3ZKBA 2VQFE 2XEXA 1N32E 4DV4E 4B3TE 1IBKI 2UUCI 3Q1QA 1MG7A 1DARA 3T1HI 4DR7E 2V2VA 1WUUA 4LFBE 4X66I 3JAMQ 3ZKDA 1NHHA 4YY3E 1N0UA 1XMQE 4DUYI 4JI1I 4NXNE 2UUAE 1OJ4A 1N34I 2BM1A 1PKPA 4DV7E 4DV1E 5IT9C 4DV0E 1FI4A 1I94E 2UXCE 4KHPE 3PYFA 5GMEA 4P52A 4JI3I 1H7UA 4DR2E 2BM0A 4WUCA 1Z0VA 4JI5I 1ZXNA 1FNMA 4DR3I 4LF4E 4JI6I 4DXLA 4WUDA 2E5LI 4JI0E 4DR6E 4LF5I 5IWAE 2AJ4A 1XMOI 1HNZI 3WU3A 5L3JA 1N33E 2X7IA 3K17A 3LPSA 4WUBA 3CWVA 4Z7CA 4LF8E 1RR9A 1HNWE 1UEKA 4X65E 4JI7E 3OTOI 4Z7YA 3WU6A 4DV5I 2R42A 1BKNA 4YHHI 1Z0WA 5A2QQ 1Z0CA 1XHKA 2UXDE 1Z5CA 1FJGE 4LF7I 2VQEI 1A6FA 1MX0A 2HK2A 4DPUA 2F4VI 1XMQI 3QT6A 2UXBI 4NXNI 2X36A 3ZZUA 4DV6I 4B3RI 4DV0I 1IBMI 4MYUA 1FWLA 5GMDA 4RPFA 4NXME 4DR2I 2UU9E 3JAMC 3PYEA 3ZM7A 4GKKE 1VISA 1J5EE 4HACA 4OX9I 1ZXMA
chains in the Genus database with same CATH superfamily
4LF4I 3T1YI 4FW9A 4HACB 4DV3E 4DV2I 4ED4A 1XNRE 1HK7A 2PO2B 4DR5E 4IS9A 4FW4A 1IBLE 2WNRA 4JI4E 4AIMA 4X64E 4I3HA 4U3DA 1N33I 2GO4A 2WNRB 4OZEA 4JV5E 4J3DA 4IZJD 3M7NG 4DPXA 4GKJI 1Z59A 4JI8E 4X62E 5BR8E 4JI7I 1FWKA 4JYAE 5K36D 4DR1E 4M1KA 3H1CA 4ZVIA 1HR0I 2UUBE 1ZM4A 1NHIA 1N36I 5LMNE 2NN6E 4AQYE 3V5RA 4B3SE 1Z0EA 2HKJA 4B3MI 1Z5AA 1Y4SA 2OI2A 5FLXQ 4FWGA 5C0XA 3ZZ0A 5EKWA 4MU4A 4LFAE 2NN6A 4FWDA 1ELOA 2Z5CA 2PNZA 4HXZA 2A2DA 2NN6B 1KKHA 1MU5A 2HKEA 2DEJA 4DUZE 5LMUI 3J80Q 1HNXE 4LFCI 4IFDF 2HHHE 4GQUA 2ZM6I 4MU0A 2C39B 4DPYA 4JI2I 4LCHA 3QT7A 2A2CA 4LF9E 1Z5BA 2Z5BA 5DROA 4IFDC 3Q6NA 1XNQI 3L7ZA 1Z0TA 1FKAE 2Z5BB 4FN5A 1Z0GA 1J5EI 2UUCE 4BA1A 1Y4UA 3L7ZB 2V2ZA 3T1HE 1H74A 2VQFI 1N32I 4DV4I 4B3TI 3F0NA 2F1DA 4BA1B 3HJCA 4OKGA 4X66E 1S16A 3M85D 4BA2A 1XNRI 2GO3A 1B62A 5JEAE 2JEAA 2PNMA 1ZM3A 3J7AG 2Z5EA 1KIJA 4DUYE 4JI4I 4JI1E 3GONA 4DR7I 3DD6A 3PYGA 2BV3A 2EFGA 3CDJA 1N34E 2JEAB 4LFBI 1EI1A 5JEAA 5EL9A 4YY3I 4MU3A 3H4LA 5K36F 1R6LA 3M6AA 5JEAB 4OO1E 1UDSA 2UUAI 4JI3E 2LJPA 4DV7I 4K0KE 4DV1I 1I94I 2UXCI 4MDTA 4KHPI 4JI5E 4OO1A 2AE8A 5K36C 1PVGA 4IFDD 4DR3E 1B63A 1OYRA 4JI6E 2GS8A 4AQYI 4UTGA 4OO1B 4IZKA 2C37A 4R1FA 4LF5E 2ZITA 2O1TA 4IZKB 2CGEA 1HNZE 1U2RA 4JI0I 4PRVA 3M85G 4DR6I 1RREA 4USKA 3B82A 5IWAI 3D4JA 3LNUA 1UDQA 2O1WA 3V2UC 5DNLA 3WU4A 3GMEA 3OTOE 2HFSA 1YH8A 4DR4E 4LF8I 4DV5E 1HNWI 5DNXA 3B8HA 1R6MA 4X65I 4YHHE 4PU9A 2BA0D 2VF3A 3J80C 4LF7E 4UT4A 5C0XE 2VQEE 4AIDA 2J7KA 2F4VE 4LF6E 3QT5A 3J81Q 2UXDI 2IOPA 1FJGI 1PIEA 2UXBE 2E1RA 1D6TA 1H7SA 4DPWA 4P7AA 2V34A 3ZZTA 4DU7A 4DV6E 4B3RE 1QZRA 1K47A 5C0XB 1ZM9A 2NN6F 4URLA 1IBME 1H72C 1H73A 3K1JA 2Z5CB 2Q2EB 2PNZB 4K0KI 1N0VC 3P76A 2BA1D 5A2QC 2NN6C 2WW4A 1VI7A 4MQYA 2DEIA 3QT8A 1OYPA 4OX9E 4KQVA 2HFUA 3T1YE 2NPFA 4NXMI 2UU9I 1IBKE 4DV2E 5IT9Q 5DRQA 2V8PA 4GKKI 1XXEA 4XTJA 1E3PA 3K85A 4FW3A 2CG9A 1Y6ZA 4FWHA 1ZM2A 1KVKA 1NZ0A 4DV3I 1S4EA 4NBQA 4DU8A 4DR5I 4HY1A 1IBLI 3WU5A 4BA2B 4GKJE 1Z0BA 4LCFA 3P3EA 4JG4A 4X64I 4LPFA 3B78A 3HULA 4USMA 2R3VA 4QNKA 4JV5I 2BR2A 4DR4I 4FW5A 3GCMA 1HR0E 4JI8I 1N36E 2HK3A 4DPTA 2JEBA 2NN6D 4X62I 5BR8I 1KTVA 2PNLA 4B3ME 1YHCA 4MYTA 4EMDA 2O3ZA 4IZJA 4JYAI 5JEAC 5K36E 4DR1I 3PS1A 2UUBI 4OO1F 4IZJB 5LMNI 1OYSA 4PRXA 4B3SI 2E5LE 5K36A 4LF6I 3GLLA 3M7ND 2CZ9A 4HYMA 5LMUE 4LFCE 5K36B 2C37B 4ISAA 4LFAI 1USVA 4OO1C 3PYDA 1XMOE 2ZM6E 4JI2E 2WP8A 1EA6A 5LL6R 2IOQA 2ZBKB 5DRRA 4DUZI 2WP8B 1HNXI 2GQ0A 3LTOA 3J7AM 1XNQE 2HHHI 3U1KA 2JE6A 1NHJA 1UDOA 5ELWA 5FLXC 3J81C 3PRYA 4LF9I 2V2QA 2PO2A 3ZKBA 2VQFE 2XEXA 1N32E 4DV4E 4B3TE 1IBKI 2CVEA 2UUCI 5JEAD 3Q1QA 1MG7A 2C38A 1DARA 3T1HI 4FW6A 4DR7E 2V2VA 1WUUA 4LFBE 2C38B 4X66I 2VESA 2PO1A 3JAMQ 3ZKDA 1NHHA 4YY3E 1N0UA 1XMQE 4DUYI 2PO1B 4JI1I 4AM3A 4OO1D 1RHYA 4NXNE 2J65A 2UUAE 1UDNA 3P3GA 1OJ4A 5C0XF 2BM1A 1N34I 5FWKA 1PKPA 4DV7E 1E3HA 4DV1E 5IT9C 4DV0E 1FI4A 1I94E 2UXCE 4KHPE 1Y60A 3PYFA 5GMEA 4P52A 5C0XC 4JI3I 1H7UA 4DR2E 3NZKA 2BM0A 4WUCA 1Z0VA 3PS3A 3B4TA 4JI5I 1ZXNA 4IFDE 1FNMA 4DR3I 2IESA 4LF4E 4JI6I 4DXLA 4WUDA 3UHMA 2E5LI 4JI0E 4DR6E 3HKMA 2IERA 4LF5I 5IWAE 2C39A 4IFDA 2BA0G 4N3OA 2AJ4A 3P06A 2JT2A 2O1UA 3KRNA 1XMOI 1HNZI 3WU3A 5L3JA 4IFDB 1N33E 2X7IA 3K17A 3LPSA 4WUBA 3CWVA 4Z7CA 1Y5YA 4LF8E 1RR9A 3PS2A 3P3CA 1HNWE 1UEKA 1USUA 3CDIA 4X65E 4JI7E 3OTOI 4Z7YA 5JEAF 3WU6A 5C0XD 4DV5I 4FW7A 2R42A 1BKNA 2BR2B 4YHHI 1Z0WA 5A2QQ 1Z0CA 2BA1G 4U3BA 1XHKA 2UXDE 1Z5CA 2JEBB 4LF7I 4MU1A 1FJGE 2VQEI 1A6FA 1MX0A 2PO0A 4QNJA 2HK2A 4DPUA 2F4VI 1XMQI 3QT6A 2PO0B 4LCGA 2O1VA 2UXBI 4NXNI 2X36A 3ZZUA 4DV6I 3Q6MA 4B3RI 4DV0I 1IBMI 4MYUA 4LOMA 1FWLA 5GMDA 4RPFA 1P42A 4NXME 4DR2I 2UU9E 3JAMC 3U1YA 3PYEA 3ZM7A 4GKKE 1VISA 1J5EE 4HACA 4OX9I 5DRPA 1ZXMA 2JE6B
chains in the Genus database with same CATH topology
4LF4I 3T1YI 4FW9A 4HACB 4DV3E 4DV2I 4ED4A 1XNRE 1HK7A 4DR5E 1IBLE 4JI4E 4X64E 4I3HA 1N33I 4JV5E 4IZJD 4DPXA 4GKJI 1Z59A 4JI8E 4X62E 5BR8E 4JI7I 1FWKA 4JYAE 4DR1E 4M1KA 4ZVIA 1HR0I 2UUBE 1ZM4A 1NHIA 1N36I 5LMNE 4AQYE 3V5RA 4B3SE 1Z0EA 2HKJA 4B3MI 1Z5AA 1Y4SA 2OI2A 5FLXQ 4FWGA 3ZZ0A 4LFAE 4FWDA 1ELOA 2Z5CA 4HXZA 2A2DA 1KKHA 1MU5A 2HKEA 2DEJA 4DUZE 5LMUI 3J80Q 1HNXE 4LFCI 2HHHE 2ZM6I 4DPYA 4JI2I 3QT7A 2A2CA 4LF9E 1Z5BA 2Z5BA 3Q6NA 1XNQI 1Z0TA 1FKAE 2Z5BB 4FN5A 1Z0GA 1J5EI 2UUCE 1Y4UA 2V2ZA 3T1HE 1H74A 2VQFI 1N32I 4DV4I 4B3TI 3F0NA 4X66E 3HJCA 1S16A 1XNRI 1B62A 2PNMA 1ZM3A 3J7AG 2Z5EA 1KIJA 4DUYE 4JI4I 4JI1E 3GONA 4DR7I 3PYGA 2BV3A 2EFGA 1N34E 4LFBI 1EI1A 4YY3I 3H4LA 3M6AA 2UUAI 4JI3E 2LJPA 4DV7I 4K0KE 4DV1I 1I94I 2UXCI 4KHPI 4JI5E 1PVGA 4DR3E 1B63A 4JI6E 2GS8A 4AQYI 4UTGA 4IZKA 4R1FA 4LF5E 2ZITA 2O1TA 4IZKB 2CGEA 1HNZE 1U2RA 4JI0I 4PRVA 4DR6I 1RREA 4USKA 3B82A 5IWAI 3D4JA 3LNUA 2O1WA 3V2UC 3WU4A 3OTOE 2HFSA 4DR4E 4LF8I 4DV5E 1HNWI 3B8HA 4X65I 4YHHE 4PU9A 2VF3A 3J80C 4LF7E 4UT4A 2VQEE 2J7KA 2F4VE 4LF6E 3QT5A 3J81Q 2UXDI 2IOPA 1FJGI 1PIEA 2UXBE 2E1RA 1D6TA 1H7SA 4DPWA 4P7AA 2V34A 3ZZTA 4DU7A 4DV6E 4B3RE 1QZRA 1K47A 1ZM9A 1IBME 4URLA 1H72C 1H73A 3K1JA 2Z5CB 2Q2EB 4K0KI 1N0VC 5A2QC 2WW4A 2DEIA 3QT8A 4OX9E 4KQVA 2HFUA 3T1YE 2NPFA 4NXMI 2UU9I 1IBKE 4DV2E 5IT9Q 2V8PA 4GKKI 4XTJA 3K85A 2CG9A 1Y6ZA 4FWHA 1ZM2A 1KVKA 1NZ0A 4DV3I 1S4EA 4DU8A 4DR5I 4HY1A 1IBLI 3WU5A 4GKJE 1Z0BA 4JG4A 4X64I 3B78A 3HULA 4USMA 2R3VA 4JV5I 4DR4I 1HR0E 4JI8I 1N36E 2HK3A 4DPTA 4X62I 5BR8I 1KTVA 2PNLA 4B3ME 4MYTA 4EMDA 4IZJA 4JYAI 4DR1I 2UUBI 4IZJB 5LMNI 4PRXA 4B3SI 2E5LE 4LF6I 2CZ9A 4HYMA 5LMUE 4LFCE 4LFAI 1USVA 3PYDA 1XMOE 2ZM6E 4JI2E 1EA6A 5LL6R 2IOQA 2ZBKB 4DUZI 1HNXI 2GQ0A 3LTOA 3J7AM 1XNQE 2HHHI 1NHJA 5FLXC 3J81C 3PRYA 4LF9I 2V2QA 3ZKBA 2VQFE 2XEXA 1N32E 4DV4E 4B3TE 1IBKI 2UUCI 3Q1QA 1MG7A 1DARA 3T1HI 4DR7E 2V2VA 1WUUA 4LFBE 4X66I 3JAMQ 3ZKDA 1NHHA 4YY3E 1N0UA 1XMQE 4DUYI 4JI1I 4NXNE 2UUAE 1OJ4A 1N34I 2BM1A 5FWKA 1PKPA 4DV7E 4DV1E 5IT9C 4DV0E 1FI4A 1I94E 2UXCE 4KHPE 3PYFA 5GMEA 4P52A 4JI3I 1H7UA 4DR2E 2BM0A 4WUCA 1Z0VA 4JI5I 1ZXNA 1FNMA 4DR3I 4LF4E 4JI6I 4DXLA 4WUDA 2E5LI 4JI0E 4DR6E 4LF5I 5IWAE 4N3OA 2AJ4A 3P06A 2O1UA 1XMOI 1HNZI 3WU3A 5L3JA 1N33E 2X7IA 3K17A 3LPSA 4WUBA 3CWVA 4Z7CA 4LF8E 1RR9A 1HNWE 1UEKA 1USUA 4X65E 4JI7E 3OTOI 4Z7YA 3WU6A 4DV5I 2R42A 1BKNA 4YHHI 1Z0WA 5A2QQ 1Z0CA 1XHKA 2UXDE 1Z5CA 1FJGE 4LF7I 2VQEI 1A6FA 1MX0A 2HK2A 4DPUA 2F4VI 1XMQI 3QT6A 2O1VA 2UXBI 4NXNI 2X36A 3ZZUA 4DV6I 3Q6MA 4B3RI 4DV0I 1IBMI 4MYUA 1FWLA 5GMDA 4RPFA 4NXME 4DR2I 2UU9E 3JAMC 3PYEA 3ZM7A 4GKKE 1VISA 1J5EE 4HACA 4OX9I 1ZXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 I;  3T1Y I;  4FW9 A;  4HAC B;  4DV3 E;  4DV2 I;  4ED4 A;  1XNR E;  4DR5 E;  1IBL E;  4JI4 E;  4X64 E;  4I3H A;  1N33 I;  4JV5 E;  4DPX A;  4GKJ I;  1Z59 A;  4JI8 E;  4X62 E;  5BR8 E;  4JI7 I;  1FWK A;  4JYA E;  4DR1 E;  4M1K A;  4ZVI A;  1HR0 I;  2UUB E;  1ZM4 A;  1NHI A;  1N36 I;  5LMN E;  4AQY E;  3V5R A;  4B3S E;  1Z0E A;  2HKJ A;  4B3M I;  1Z5A A;  5FLX Q;  2OI2 A;  4FWG A;  3ZZ0 A;  4LFA E;  4FWD A;  1ELO A;  4HXZ A;  2A2D A;  1KKH A;  1MU5 A;  2HKE A;  2DEJ A;  4DUZ E;  5LMU I;  3J80 Q;  1HNX E;  4LFC I;  2HHH E;  2ZM6 I;  4DPY A;  4JI2 I;  3QT7 A;  2A2C A;  4LF9 E;  1Z5B A;  1XNQ I;  1Z0T A;  1FKA E;  4FN5 A;  1Z0G A;  1J5E I;  2UUC E;  2V2Z A;  3T1H E;  1H74 A;  2VQF I;  1N32 I;  4DV4 I;  4B3T I;  3F0N A;  4X66 E;  1S16 A;  1XNR I;  1B62 A;  1ZM3 A;  3J7A G;  1KIJ A;  4DUY E;  4JI4 I;  4JI1 E;  3GON A;  4DR7 I;  3PYG A;  2BV3 A;  2EFG A;  1N34 E;  4LFB I;  1EI1 A;  4YY3 I;  3H4L A;  3M6A A;  2UUA I;  4JI3 E;  2LJP A;  4DV7 I;  4K0K E;  4DV1 I;  1I94 I;  2UXC I;  4KHP I;  4JI5 E;  1PVG A;  4DR3 E;  1B63 A;  4JI6 E;  2GS8 A;  4AQY I;  4UTG A;  4R1F A;  4LF5 E;  2ZIT A;  1HNZ E;  1U2R A;  4JI0 I;  4PRV A;  4DR6 I;  1RRE A;  4USK A;  3B82 A;  5IWA I;  3D4J A;  3LNU A;  3V2U C;  3WU4 A;  3OTO E;  2HFS A;  4DR4 E;  4LF8 I;  4DV5 E;  1HNW I;  3B8H A;  4X65 I;  4YHH E;  4PU9 A;  2VF3 A;  3J80 C;  4LF7 E;  4UT4 A;  2VQE E;  2J7K A;  2F4V E;  4LF6 E;  3QT5 A;  3J81 Q;  2UXD I;  1FJG I;  1PIE A;  2UXB E;  2E1R A;  1D6T A;  1H7S A;  4DPW A;  4P7A A;  2V34 A;  3ZZT A;  4DU7 A;  4DV6 E;  4B3R E;  1QZR A;  1K47 A;  1ZM9 A;  1IBM E;  4URL A;  1H72 C;  1H73 A;  3K1J A;  2Q2E B;  4K0K I;  1N0V C;  5A2Q C;  2WW4 A;  2DEI A;  3QT8 A;  4OX9 E;  4KQV A;  2HFU A;  3T1Y E;  2NPF A;  4NXM I;  2UU9 I;  1IBK E;  4DV2 E;  5IT9 Q;  2V8P A;  4GKK I;  4XTJ A;  4FWH A;  1ZM2 A;  1KVK A;  1NZ0 A;  4DV3 I;  1S4E A;  4DU8 A;  4DR5 I;  4HY1 A;  1IBL I;  3WU5 A;  4GKJ E;  1Z0B A;  4JG4 A;  4X64 I;  3B78 A;  3HUL A;  4USM A;  2R3V A;  4JV5 I;  4DR4 I;  1HR0 E;  4JI8 I;  1N36 E;  2HK3 A;  4DPT A;  4X62 I;  5BR8 I;  1KTV A;  4B3M E;  4MYT A;  4EMD A;  4JYA I;  4DR1 I;  2UUB I;  5LMN I;  4PRX A;  4B3S I;  2E5L E;  4LF6 I;  2CZ9 A;  4HYM A;  5LMU E;  4LFC E;  4LFA I;  3PYD A;  1XMO E;  2ZM6 E;  4JI2 E;  1EA6 A;  5LL6 R;  2ZBK B;  4DUZ I;  1HNX I;  3LTO A;  3J7A M;  1XNQ E;  2HHH I;  1NHJ A;  5FLX C;  3J81 C;  4LF9 I;  2V2Q A;  3ZKB A;  2VQF E;  2XEX A;  1N32 E;  4DV4 E;  4B3T E;  1IBK I;  2UUC I;  3Q1Q A;  1MG7 A;  1DAR A;  3T1H I;  4DR7 E;  2V2V A;  1WUU A;  4LFB E;  4X66 I;  3JAM Q;  3ZKD A;  1NHH A;  4YY3 E;  1N0U A;  1XMQ E;  4DUY I;  4JI1 I;  4NXN E;  2UUA E;  1OJ4 A;  1N34 I;  2BM1 A;  1PKP A;  4DV7 E;  4DV1 E;  5IT9 C;  4DV0 E;  1FI4 A;  1I94 E;  2UXC E;  4KHP E;  3PYF A;  5GME A;  4P52 A;  4JI3 I;  1H7U A;  4DR2 E;  2BM0 A;  4WUC A;  1Z0V A;  4JI5 I;  1ZXN A;  1FNM A;  4DR3 I;  4LF4 E;  4JI6 I;  4DXL A;  4WUD A;  2E5L I;  4JI0 E;  4DR6 E;  4LF5 I;  5IWA E;  2AJ4 A;  1XMO I;  1HNZ I;  3WU3 A;  5L3J A;  1N33 E;  2X7I A;  3K17 A;  3LPS A;  4WUB A;  3CWV A;  4Z7C A;  4LF8 E;  1RR9 A;  1HNW E;  1UEK A;  4X65 E;  4JI7 E;  3OTO I;  4Z7Y A;  3WU6 A;  4DV5 I;  2R42 A;  1BKN A;  4YHH I;  1Z0W A;  5A2Q Q;  1Z0C A;  1XHK A;  2UXD E;  1Z5C A;  1FJG E;  4LF7 I;  2VQE I;  1A6F A;  1MX0 A;  2HK2 A;  4DPU A;  2F4V I;  1XMQ I;  3QT6 A;  2UXB I;  4NXN I;  2X36 A;  3ZZU A;  4DV6 I;  4B3R I;  4DV0 I;  1IBM I;  4MYU A;  1FWL A;  5GMD A;  4RPF A;  4NXM E;  4DR2 I;  2UU9 E;  3JAM C;  3PYE A;  3ZM7 A;  4GKK E;  1VIS A;  1J5E E;  4HAC A;  4OX9 I;  1ZXM A; 
#chains in the Genus database with same CATH topology
 4LF4 I;  3T1Y I;  4FW9 A;  4HAC B;  4DV3 E;  4DV2 I;  4ED4 A;  1XNR E;  1HK7 A;  2PO2 B;  4DR5 E;  4IS9 A;  4FW4 A;  1IBL E;  2WNR A;  4JI4 E;  4AIM A;  4X64 E;  4I3H A;  4U3D A;  1N33 I;  2GO4 A;  2WNR B;  4OZE A;  4JV5 E;  4J3D A;  4IZJ D;  3M7N G;  4DPX A;  4GKJ I;  1Z59 A;  4JI8 E;  4X62 E;  5BR8 E;  4JI7 I;  1FWK A;  4JYA E;  5K36 D;  4DR1 E;  4M1K A;  3H1C A;  4ZVI A;  1HR0 I;  2UUB E;  1ZM4 A;  1NHI A;  1N36 I;  5LMN E;  2NN6 E;  4AQY E;  3V5R A;  4B3S E;  1Z0E A;  2HKJ A;  4B3M I;  1Z5A A;  1Y4S A;  2OI2 A;  5FLX Q;  4FWG A;  5C0X A;  3ZZ0 A;  5EKW A;  4MU4 A;  4LFA E;  2NN6 A;  4FWD A;  1ELO A;  2Z5C A;  2PNZ A;  4HXZ A;  2A2D A;  2NN6 B;  1KKH A;  1MU5 A;  2HKE A;  2DEJ A;  4DUZ E;  5LMU I;  3J80 Q;  1HNX E;  4LFC I;  4IFD F;  2HHH E;  4GQU A;  2ZM6 I;  4MU0 A;  2C39 B;  4DPY A;  4JI2 I;  4LCH A;  3QT7 A;  2A2C A;  4LF9 E;  1Z5B A;  2Z5B A;  5DRO A;  4IFD C;  3Q6N A;  1XNQ I;  3L7Z A;  1Z0T A;  1FKA E;  2Z5B B;  4FN5 A;  1Z0G A;  1J5E I;  2UUC E;  4BA1 A;  1Y4U A;  3L7Z B;  2V2Z A;  3T1H E;  1H74 A;  2VQF I;  1N32 I;  4DV4 I;  4B3T I;  3F0N A;  2F1D A;  4BA1 B;  3HJC A;  4OKG A;  4X66 E;  1S16 A;  3M85 D;  4BA2 A;  1XNR I;  2GO3 A;  1B62 A;  5JEA E;  2JEA A;  2PNM A;  1ZM3 A;  3J7A G;  2Z5E A;  1KIJ A;  4DUY E;  4JI4 I;  4JI1 E;  3GON A;  4DR7 I;  3DD6 A;  3PYG A;  2BV3 A;  2EFG A;  3CDJ A;  1N34 E;  2JEA B;  4LFB I;  1EI1 A;  5JEA A;  5EL9 A;  4YY3 I;  4MU3 A;  3H4L A;  5K36 F;  1R6L A;  3M6A A;  5JEA B;  4OO1 E;  1UDS A;  2UUA I;  4JI3 E;  2LJP A;  4DV7 I;  4K0K E;  4DV1 I;  1I94 I;  2UXC I;  4MDT A;  4KHP I;  4JI5 E;  4OO1 A;  2AE8 A;  5K36 C;  1PVG A;  4IFD D;  4DR3 E;  1B63 A;  1OYR A;  4JI6 E;  2GS8 A;  4AQY I;  4UTG A;  4OO1 B;  4IZK A;  2C37 A;  4R1F A;  4LF5 E;  2ZIT A;  2O1T A;  4IZK B;  2CGE A;  1HNZ E;  1U2R A;  4JI0 I;  4PRV A;  3M85 G;  4DR6 I;  1RRE A;  4USK A;  3B82 A;  5IWA I;  3D4J A;  3LNU A;  1UDQ A;  2O1W A;  3V2U C;  5DNL A;  3WU4 A;  3GME A;  3OTO E;  2HFS A;  1YH8 A;  4DR4 E;  4LF8 I;  4DV5 E;  1HNW I;  5DNX A;  3B8H A;  1R6M A;  4X65 I;  4YHH E;  4PU9 A;  2BA0 D;  2VF3 A;  3J80 C;  4LF7 E;  4UT4 A;  5C0X E;  2VQE E;  4AID A;  2J7K A;  2F4V E;  4LF6 E;  3QT5 A;  3J81 Q;  2UXD I;  2IOP A;  1FJG I;  1PIE A;  2UXB E;  2E1R A;  1D6T A;  1H7S A;  4DPW A;  4P7A A;  2V34 A;  3ZZT A;  4DU7 A;  4DV6 E;  4B3R E;  1QZR A;  1K47 A;  5C0X B;  1ZM9 A;  2NN6 F;  4URL A;  1IBM E;  1H72 C;  1H73 A;  3K1J A;  2Z5C B;  2Q2E B;  2PNZ B;  4K0K I;  1N0V C;  3P76 A;  2BA1 D;  5A2Q C;  2NN6 C;  2WW4 A;  1VI7 A;  4MQY A;  2DEI A;  3QT8 A;  1OYP A;  4OX9 E;  4KQV A;  2HFU A;  3T1Y E;  2NPF A;  4NXM I;  2UU9 I;  1IBK E;  4DV2 E;  5IT9 Q;  5DRQ A;  2V8P A;  4GKK I;  1XXE A;  4XTJ A;  1E3P A;  3K85 A;  4FW3 A;  2CG9 A;  1Y6Z A;  4FWH A;  1ZM2 A;  1KVK A;  1NZ0 A;  4DV3 I;  1S4E A;  4NBQ A;  4DU8 A;  4DR5 I;  4HY1 A;  1IBL I;  3WU5 A;  4BA2 B;  4GKJ E;  1Z0B A;  4LCF A;  3P3E A;  4JG4 A;  4X64 I;  4LPF A;  3B78 A;  3HUL A;  4USM A;  2R3V A;  4QNK A;  4JV5 I;  2BR2 A;  4DR4 I;  4FW5 A;  3GCM A;  1HR0 E;  4JI8 I;  1N36 E;  2HK3 A;  4DPT A;  2JEB A;  2NN6 D;  4X62 I;  5BR8 I;  1KTV A;  2PNL A;  4B3M E;  1YHC A;  4MYT A;  4EMD A;  2O3Z A;  4IZJ A;  4JYA I;  5JEA C;  5K36 E;  4DR1 I;  3PS1 A;  2UUB I;  4OO1 F;  4IZJ B;  5LMN I;  1OYS A;  4PRX A;  4B3S I;  2E5L E;  5K36 A;  4LF6 I;  3GLL A;  3M7N D;  2CZ9 A;  4HYM A;  5LMU E;  4LFC E;  5K36 B;  2C37 B;  4ISA A;  4LFA I;  1USV A;  4OO1 C;  3PYD A;  1XMO E;  2ZM6 E;  4JI2 E;  2WP8 A;  1EA6 A;  5LL6 R;  2IOQ A;  2ZBK B;  5DRR A;  4DUZ I;  2WP8 B;  1HNX I;  2GQ0 A;  3LTO A;  3J7A M;  1XNQ E;  2HHH I;  3U1K A;  2JE6 A;  1NHJ A;  1UDO A;  5ELW A;  5FLX C;  3J81 C;  3PRY A;  4LF9 I;  2V2Q A;  2PO2 A;  3ZKB A;  2VQF E;  2XEX A;  1N32 E;  4DV4 E;  4B3T E;  1IBK I;  2CVE A;  2UUC I;  5JEA D;  3Q1Q A;  1MG7 A;  2C38 A;  1DAR A;  3T1H I;  4FW6 A;  4DR7 E;  2V2V A;  1WUU A;  4LFB E;  2C38 B;  4X66 I;  2VES A;  2PO1 A;  3JAM Q;  3ZKD A;  1NHH A;  4YY3 E;  1N0U A;  1XMQ E;  4DUY I;  2PO1 B;  4JI1 I;  4AM3 A;  4OO1 D;  1RHY A;  4NXN E;  2J65 A;  2UUA E;  1UDN A;  3P3G A;  1OJ4 A;  5C0X F;  2BM1 A;  1N34 I;  5FWK A;  1PKP A;  4DV7 E;  1E3H A;  4DV1 E;  5IT9 C;  4DV0 E;  1FI4 A;  1I94 E;  2UXC E;  4KHP E;  1Y60 A;  3PYF A;  5GME A;  4P52 A;  5C0X C;  4JI3 I;  1H7U A;  4DR2 E;  3NZK A;  2BM0 A;  4WUC A;  1Z0V A;  3PS3 A;  3B4T A;  4JI5 I;  1ZXN A;  4IFD E;  1FNM A;  4DR3 I;  2IES A;  4LF4 E;  4JI6 I;  4DXL A;  4WUD A;  3UHM A;  2E5L I;  4JI0 E;  4DR6 E;  3HKM A;  2IER A;  4LF5 I;  5IWA E;  2C39 A;  4IFD A;  2BA0 G;  4N3O A;  2AJ4 A;  3P06 A;  2JT2 A;  2O1U A;  3KRN A;  1XMO I;  1HNZ I;  3WU3 A;  5L3J A;  4IFD B;  1N33 E;  2X7I A;  3K17 A;  3LPS A;  4WUB A;  3CWV A;  4Z7C A;  1Y5Y A;  4LF8 E;  1RR9 A;  3PS2 A;  3P3C A;  1HNW E;  1UEK A;  1USU A;  3CDI A;  4X65 E;  4JI7 E;  3OTO I;  4Z7Y A;  5JEA F;  3WU6 A;  5C0X D;  4DV5 I;  4FW7 A;  2R42 A;  1BKN A;  2BR2 B;  4YHH I;  1Z0W A;  5A2Q Q;  1Z0C A;  2BA1 G;  4U3B A;  1XHK A;  2UXD E;  1Z5C A;  2JEB B;  4LF7 I;  4MU1 A;  1FJG E;  2VQE I;  1A6F A;  1MX0 A;  2PO0 A;  4QNJ A;  2HK2 A;  4DPU A;  2F4V I;  1XMQ I;  3QT6 A;  2PO0 B;  4LCG A;  2O1V A;  2UXB I;  4NXN I;  2X36 A;  3ZZU A;  4DV6 I;  3Q6M A;  4B3R I;  4DV0 I;  1IBM I;  4MYU A;  4LOM A;  1FWL A;  5GMD A;  4RPF A;  1P42 A;  4NXM E;  4DR2 I;  2UU9 E;  3JAM C;  3U1Y A;  3PYE A;  3ZM7 A;  4GKK E;  1VIS A;  1J5E E;  4HAC A;  4OX9 I;  5DRP A;  1ZXM A;  2JE6 B; 
#chains in the Genus database with same CATH homology
 4LF4 I;  3T1Y I;  4FW9 A;  4HAC B;  4DV3 E;  4DV2 I;  4ED4 A;  1XNR E;  1HK7 A;  4DR5 E;  1IBL E;  4JI4 E;  4X64 E;  4I3H A;  1N33 I;  4JV5 E;  4IZJ D;  4DPX A;  4GKJ I;  1Z59 A;  4JI8 E;  4X62 E;  5BR8 E;  4JI7 I;  1FWK A;  4JYA E;  4DR1 E;  4M1K A;  4ZVI A;  1HR0 I;  2UUB E;  1ZM4 A;  1NHI A;  1N36 I;  5LMN E;  4AQY E;  3V5R A;  4B3S E;  1Z0E A;  2HKJ A;  4B3M I;  1Z5A A;  1Y4S A;  2OI2 A;  5FLX Q;  4FWG A;  3ZZ0 A;  4LFA E;  4FWD A;  1ELO A;  2Z5C A;  4HXZ A;  2A2D A;  1KKH A;  1MU5 A;  2HKE A;  2DEJ A;  4DUZ E;  5LMU I;  3J80 Q;  1HNX E;  4LFC I;  2HHH E;  2ZM6 I;  4DPY A;  4JI2 I;  3QT7 A;  2A2C A;  4LF9 E;  1Z5B A;  2Z5B A;  3Q6N A;  1XNQ I;  1Z0T A;  1FKA E;  2Z5B B;  4FN5 A;  1Z0G A;  1J5E I;  2UUC E;  1Y4U A;  2V2Z A;  3T1H E;  1H74 A;  2VQF I;  1N32 I;  4DV4 I;  4B3T I;  3F0N A;  4X66 E;  3HJC A;  1S16 A;  1XNR I;  1B62 A;  2PNM A;  1ZM3 A;  3J7A G;  2Z5E A;  1KIJ A;  4DUY E;  4JI4 I;  4JI1 E;  3GON A;  4DR7 I;  3PYG A;  2BV3 A;  2EFG A;  1N34 E;  4LFB I;  1EI1 A;  4YY3 I;  3H4L A;  3M6A A;  2UUA I;  4JI3 E;  2LJP A;  4DV7 I;  4K0K E;  4DV1 I;  1I94 I;  2UXC I;  4KHP I;  4JI5 E;  1PVG A;  4DR3 E;  1B63 A;  4JI6 E;  2GS8 A;  4AQY I;  4UTG A;  4IZK A;  4R1F A;  4LF5 E;  2ZIT A;  2O1T A;  4IZK B;  2CGE A;  1HNZ E;  1U2R A;  4JI0 I;  4PRV A;  4DR6 I;  1RRE A;  4USK A;  3B82 A;  5IWA I;  3D4J A;  3LNU A;  2O1W A;  3V2U C;  3WU4 A;  3OTO E;  2HFS A;  4DR4 E;  4LF8 I;  4DV5 E;  1HNW I;  3B8H A;  4X65 I;  4YHH E;  4PU9 A;  2VF3 A;  3J80 C;  4LF7 E;  4UT4 A;  2VQE E;  2J7K A;  2F4V E;  4LF6 E;  3QT5 A;  3J81 Q;  2UXD I;  2IOP A;  1FJG I;  1PIE A;  2UXB E;  2E1R A;  1D6T A;  1H7S A;  4DPW A;  4P7A A;  2V34 A;  3ZZT A;  4DU7 A;  4DV6 E;  4B3R E;  1QZR A;  1K47 A;  1ZM9 A;  1IBM E;  4URL A;  1H72 C;  1H73 A;  3K1J A;  2Z5C B;  2Q2E B;  4K0K I;  1N0V C;  5A2Q C;  2WW4 A;  2DEI A;  3QT8 A;  4OX9 E;  4KQV A;  2HFU A;  3T1Y E;  2NPF A;  4NXM I;  2UU9 I;  1IBK E;  4DV2 E;  5IT9 Q;  2V8P A;  4GKK I;  4XTJ A;  3K85 A;  2CG9 A;  1Y6Z A;  4FWH A;  1ZM2 A;  1KVK A;  1NZ0 A;  4DV3 I;  1S4E A;  4DU8 A;  4DR5 I;  4HY1 A;  1IBL I;  3WU5 A;  4GKJ E;  1Z0B A;  4JG4 A;  4X64 I;  3B78 A;  3HUL A;  4USM A;  2R3V A;  4JV5 I;  4DR4 I;  1HR0 E;  4JI8 I;  1N36 E;  2HK3 A;  4DPT A;  4X62 I;  5BR8 I;  1KTV A;  2PNL A;  4B3M E;  4MYT A;  4EMD A;  4IZJ A;  4JYA I;  4DR1 I;  2UUB I;  4IZJ B;  5LMN I;  4PRX A;  4B3S I;  2E5L E;  4LF6 I;  2CZ9 A;  4HYM A;  5LMU E;  4LFC E;  4LFA I;  1USV A;  3PYD A;  1XMO E;  2ZM6 E;  4JI2 E;  1EA6 A;  5LL6 R;  2IOQ A;  2ZBK B;  4DUZ I;  1HNX I;  2GQ0 A;  3LTO A;  3J7A M;  1XNQ E;  2HHH I;  1NHJ A;  5FLX C;  3J81 C;  3PRY A;  4LF9 I;  2V2Q A;  3ZKB A;  2VQF E;  2XEX A;  1N32 E;  4DV4 E;  4B3T E;  1IBK I;  2UUC I;  3Q1Q A;  1MG7 A;  1DAR A;  3T1H I;  4DR7 E;  2V2V A;  1WUU A;  4LFB E;  4X66 I;  3JAM Q;  3ZKD A;  1NHH A;  4YY3 E;  1N0U A;  1XMQ E;  4DUY I;  4JI1 I;  4NXN E;  2UUA E;  1OJ4 A;  1N34 I;  2BM1 A;  5FWK A;  1PKP A;  4DV7 E;  4DV1 E;  5IT9 C;  4DV0 E;  1FI4 A;  1I94 E;  2UXC E;  4KHP E;  3PYF A;  5GME A;  4P52 A;  4JI3 I;  1H7U A;  4DR2 E;  2BM0 A;  4WUC A;  1Z0V A;  4JI5 I;  1ZXN A;  1FNM A;  4DR3 I;  4LF4 E;  4JI6 I;  4DXL A;  4WUD A;  2E5L I;  4JI0 E;  4DR6 E;  4LF5 I;  5IWA E;  4N3O A;  2AJ4 A;  3P06 A;  2O1U A;  1XMO I;  1HNZ I;  3WU3 A;  5L3J A;  1N33 E;  2X7I A;  3K17 A;  3LPS A;  4WUB A;  3CWV A;  4Z7C A;  4LF8 E;  1RR9 A;  1HNW E;  1UEK A;  1USU A;  4X65 E;  4JI7 E;  3OTO I;  4Z7Y A;  3WU6 A;  4DV5 I;  2R42 A;  1BKN A;  4YHH I;  1Z0W A;  5A2Q Q;  1Z0C A;  1XHK A;  2UXD E;  1Z5C A;  1FJG E;  4LF7 I;  2VQE I;  1A6F A;  1MX0 A;  2HK2 A;  4DPU A;  2F4V I;  1XMQ I;  3QT6 A;  2O1V A;  2UXB I;  4NXN I;  2X36 A;  3ZZU A;  4DV6 I;  3Q6M A;  4B3R I;  4DV0 I;  1IBM I;  4MYU A;  1FWL A;  5GMD A;  4RPF A;  4NXM E;  4DR2 I;  2UU9 E;  3JAM C;  3PYE A;  3ZM7 A;  4GKK E;  1VIS A;  1J5E E;  4HAC A;  4OX9 I;  1ZXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...