4DV7I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv7I00
1WUUA 1HNWI 4DXLA 1D6TA 1N36I 1HR0E 1ZM2A 2V2ZA 1Z5BA 4JI3I 4JI2I 4LF8I 4WUCA 4DR2I 1J5EE 2BV3A 4LFAI 4Z7CA 2V34A 4DR3E 4UT4A 2HFSA 1XMOE 3ZM7A 2HFUA 3M6AA 4NXMI 3ZZUA 4JI4I 5A2QC 1Z5AA 2X36A 2VQFE 3F0NA 4HYMA 1Z0CA 4ZVIA 4NXNI 1HNWE 1NHJA 4KQVA 1N36E 4X66I 1QZRA 1NZ0A 2WW4A 2XEXA 3D4JA 5L3JA 4JI1I 1B62A 2UUBE 3Q1QA 1N0UA 1XMQE 4LFAE 4GKJI 4RPFA 3QT7A 3WU4A 5LL6R 4JI0I 1FWLA 4USMA 1A6FA 4B3RE 3PYEA 3GONA 4I3HA 4NXME 4B3TI 4JI4E 4P7AA 3J81C 1N34E 4K0KI 4JI7I 1XNRE 1Z59A 4LFCI 1Z0VA 3H4LA 4JV5I 4JI8I 4LF6E 2R3VA 4NXNE 5IT9Q 5GMEA 4FWHA 1PVGA 1RR9A 1ZM9A 4DR1E 2F4VI 4LF7E 2UXBI 2R42A 4PU9A 4FW9A 2ZM6I 1S4EA 3V2UC 1FNMA 4DV0I 4LF5E 1FWKA 4DV1E 1FJGI 1H73A 1ZM3A 3J80Q 4DR4I 4DU8A 4JI7E 3WU3A 4DR6E 2UXDE 4URLA 4LFCE 4DV7E 1ZXMA 4JV5E 4DV6I 3LTOA 1PKPA 2HKJA 1IBLI 1UEKA 4FWGA 4JG4A 2VQEI 4DR7I 4DPWA 4DUYE 1HNZE 2BM0A 2ZM6E 1IBKI 4B3SE 4DR5I 4JI6I 1KVKA 2UUCI 5FLXQ 4OX9I 2OI2A 1FJGE 1I94I 4XTJA 1ZXNA 2NPFA 1XHKA 4YHHI 3T1YI 4X62I 4LF4I 2ZITA 4GKKI 2UUAI 4WUBA 4DV4I 2UU9I 1N33I 2DEJA 1NHIA 4X65I 4DV6E 4JI3E 4JI2E 4LF8E 1KKHA 1MG7A 1H72C 4DR2E 4AQYI 4DPTA 3JAMQ 1N0VC 2E5LI 3OTOI 4JI5I 2EFGA 3QT5A 2CZ9A 4DR5E 4JYAI 2UXCI 4JI6E 1U2RA 3B8HA 3ZKBA 2Q2EB 1MU5A 1HNXI 4FN5A 1N32I 3HULA 4HACA 3V5RA 5IWAI 1XNQI 1OJ4A 4YHHE 3T1YE 4LF9I 4GKKE 2HHHI 1N33E 3LNUA 4X66E 1Z0EA 4KHPI 1NHHA 2A2DA 1Z0GA 4JI1E 5A2QQ 1Z0TA 1H7UA 4YY3I 4GKJE 4P52A 3B78A 5FLXC 1MX0A 4DPXA 3PYGA 4JI0E 1J5EI 2BM1A 1Z0WA 2AJ4A 1PIEA 4DV3I 4DR3I 4JYAE 2UXCE 4Z7YA 4B3TE 4HACB 4B3MI 5GMDA 3PYDA 4K0KE 3K1JA 4M1KA 2HK2A 3CWVA 1FKAE 1ELOA 3WU6A 4USKA 4JI8E 4LF9E 3JAMC 2VQFI 1IBMI 1DARA 2V2VA 4KHPE 4DV5I 2F4VE 1H74A 3J81Q 2UXBE 4YY3E 3ZZ0A 4WUDA 2E1RA 4DV0E 1EA6A 3J7AG 3ZKDA 4FWDA 2LJPA 2UUBI 4DV3E 1XMQI 2VF3A 4PRVA 3J7AM 3QT6A 4B3ME 4MYUA 4DR4E 5IT9C 4LFBI 5LMUI 4B3RI 4DPYA 4HY1A 4DPUA 1KTVA 1N34I 4DUZI 1IBLE 4EMDA 4X64I 1XNRI 1IBME 2J7KA 2VQEE 3QT8A 4DV5E 2ZBKB 3PYFA 4LF6I 4DR7E 2V8PA 3J80C 1IBKE 5LMNI 1B63A 2DEIA 4DV2I 4DR1I 2UUCE 1RREA 4LF7I 5BR8I 1ZM4A 4OX9E 1I94E 1S16A 4HXZA 4LF5I 4R1FA 4LFBE 4ED4A 4X62E 4DV1I 4LF4E 2UUAE 5LMUE 4DV4E 3T1HI 1Z5CA 4PRXA 2UU9E 1H7SA 3ZZTA 4X65E 4DUZE 4X64E 4AQYE 2V2QA 4DR6I 4MYTA 2UXDI 1HR0I 3WU5A 4DV7I 2E5LE 2HK3A 3K17A 4UTGA 1VISA 3OTOE 4JI5E 1Z0BA 5LMNE 2GS8A 2A2CA 4DV2E 4DUYI 1KIJA 3LPSA 1XMOI 1HNZI 5BR8E 1HNXE 3B82A 1N32E 1EI1A 4B3SI 1K47A 5IWAE 1XNQE 2HKEA 4DU7A 3T1HE 1BKNA 2HHHE 1FI4A 2X7IA
chains in the Genus database with same CATH superfamily
1WUUA 4BA2B 1HNWI 4DXLA 1D6TA 1N36I 1HR0E 1ZM2A 4IFDB 2V2ZA 1Z5BA 4JI3I 4JI2I 4LF8I 4FW4A 4WUCA 4DR2I 4IS9A 1J5EE 2BV3A 2PO1A 2WP8A 4LFAI 4Z7CA 3B4TA 4FW6A 2V34A 4LPFA 4DR3E 4UT4A 5C0XD 1XXEA 2WNRB 2HFSA 4IFDE 1XMOE 4MDTA 3ZM7A 3PS3A 2HFUA 4BA1A 3M6AA 4NXMI 3ZZUA 3HKMA 4JI4I 5A2QC 1Z5AA 2X36A 2VQFE 3F0NA 4OO1E 4HYMA 5C0XC 3HJCA 1Z0CA 4ZVIA 2IERA 4NXNI 4QNKA 1HNWE 5JEAD 1NHJA 2NN6C 4KQVA 1N36E 4X66I 1QZRA 2C38A 2PO1B 1NZ0A 2WW4A 2WP8B 2XEXA 3D4JA 5L3JA 4JI1I 1B62A 2UUBE 3Q1QA 1N0UA 1XMQE 4LFAE 4GKJI 2BA1D 2CGEA 3GCMA 4RPFA 1YH8A 3QT7A 4BA1B 3WU4A 5LL6R 1VI7A 1R6MA 4JI0I 4MQYA 1FWLA 4USMA 1A6FA 4B3RE 3PYEA 3GONA 2JEAA 4I3HA 4NXME 4B3TI 4JI4E 4P7AA 3J81C 1N34E 4K0KI 2PNLA 4JI7I 1XNRE 3P76A 4OKGA 1Z59A 1OYPA 2Z5BA 4LFCI 1Y4UA 1Z0VA 3H4LA 2C38B 4JV5I 1UDSA 4JI8I 2JT2A 4LF6E 2R3VA 4NXNE 3KRNA 5IT9Q 4IZJA 2GO4A 4MU3A 5GMEA 4FWHA 3Q6MA 5K36C 1PVGA 1RR9A 4U3BA 1ZM9A 4DR1E 2F4VI 4LF7E 2UXBI 2R42A 4PU9A 1UDOA 4FW9A 3CDJA 2ZM6I 1S4EA 3V2UC 2JEAB 1FNMA 4OO1A 4DV0I 4LF5E 1FWKA 4DV1E 5C0XF 1FJGI 1H73A 1ZM3A 3J80Q 2Z5BB 3P3CA 2NN6F 4DR4I 1USVA 4DU8A 4JI7E 3WU3A 3GMEA 4DR6E 2UXDE 2IOQA 4IZJB 4URLA 4LFCE 4DV7E 1ZXMA 4JV5E 5DRQA 4DV6I 3LTOA 2AE8A 1PKPA 2HKJA 1IBLI 1UEKA 2Z5CA 4FWGA 4LOMA 4JG4A 2VQEI 4DR7I 2Z5EA 1E3PA 3PS1A 4DPWA 4DUYE 4OO1B 1HNZE 2BM0A 1HK7A 3M7ND 2ZM6E 1IBKI 4B3SE 4NBQA 4DR5I 4JI6I 1KVKA 4AIMA 3DD6A 5FLXQ 2UUCI 4OX9I 5ELWA 2OI2A 5C0XA 1FJGE 1I94I 4XTJA 1ZXNA 4QNJA 2NPFA 2NN6A 1XHKA 4YHHI 3T1YI 2PO2A 4X62I 2ZITA 4LF4I 2UUAI 4GKKI 5K36F 4WUBA 4DV4I 2UU9I 1N33I 1OYSA 2DEJA 2Z5CB 1NHIA 1USUA 4X65I 4DV6E 2GO3A 4JI3E 2VESA 4JI2E 4LF8E 1KKHA 1MG7A 1H72C 2J65A 4DR2E 4AQYI 4DPTA 3JAMQ 1N0VC 5DROA 2BR2A 2E5LI 3NZKA 2O1TA 1Y6ZA 2CG9A 4OZEA 3OTOI 2O3ZA 5JEAC 4JI5I 2EFGA 3QT5A 5C0XB 2CZ9A 4DR5E 4JYAI 2UXCI 4JI6E 1U2RA 3B8HA 3ZKBA 2Q2EB 2C37A 1UDNA 1MU5A 2NN6B 1HNXI 2PO2B 4FN5A 3M85D 1N32I 3HULA 4HACA 3V5RA 5IWAI 1XNQI 1OJ4A 4YHHE 3T1YE 4LF9I 5C0XE 4GKKE 5K36A 2HHHI 1N33E 3LNUA 4X66E 1Z0EA 4IZJD 4KHPI 1NHHA 2NN6E 4IFDD 2A2DA 2BR2B 1Z0GA 4JI1E 5A2QQ 1Z0TA 3UHMA 5DRRA 1H7UA 2JEBA 1YHCA 4YY3I 4GKJE 4P52A 3B78A 4AM3A 5FLXC 1MX0A 2O1WA 3PYGA 4DPXA 4LCFA 2C37B 4JI0E 4OO1D 1J5EI 2BM1A 1Z0WA 4N3OA 2AJ4A 1PIEA 4DV3I 5JEAE 4DR3I 4JYAE 4IFDC 2UXCE 4Z7YA 2BA0G 4B3TE 4HACB 4B3MI 5FWKA 2O1VA 5GMDA 1Y5YA 3PYDA 4K0KE 3K1JA 4M1KA 4GQUA 2HK2A 3CWVA 1FKAE 1ELOA 2IOPA 3P06A 3WU6A 5K36B 1E3HA 5EL9A 4USKA 4JI8E 4LF9E 4LCGA 4IZKA 4OO1C 3JAMC 2VQFI 1IBMI 1DARA 2O1UA 2V2VA 5JEAF 4KHPE 2JEBB 4DV5I 5K36E 2F4VE 1H74A 5DNXA 3J81Q 2UXBE 1P42A 4YY3E 3ZZ0A 3M7NG 4WUDA 3GLLA 2E1RA 4DV0E 1EA6A 3J7AG 1Y60A 3ZKDA 3K85A 4FWDA 2LJPA 2UUBI 4DV3E 1XMQI 2VF3A 2PO0A 3L7ZA 4PRVA 2GQ0A 3J7AM 3QT6A 2C39A 4B3ME 4MYUA 5DRPA 5IT9C 4DR4E 4LFBI 3P3GA 5LMUI 4B3RI 4IZKB 2NN6D 4ISAA 4DPYA 4HY1A 5DNLA 4DPUA 1KTVA 4J3DA 1N34I 4DUZI 1IBLE 4EMDA 4X64I 1XNRI 1IBME 3H1CA 3Q6NA 2J7KA 3CDIA 2VQEE 2PNZA 3QT8A 4DV5E 2ZBKB 5JEAA 3PYFA 2BA1G 4LF6I 4DR7E 2JE6A 4IFDF 2V8PA 4AIDA 3J80C 1IBKE 2IESA 5LMNI 1B63A 2CVEA 2PO0B 2DEIA 3L7ZB 4DV2I 4FW7A 4DR1I 2UUCE 1RREA 4MU1A 4LF7I 2C39B 5BR8I 1ZM4A 4OX9E 1I94E 1S16A 3PRYA 3PS2A 3M85G 4OO1F 4HXZA 3U1YA 4LF5I 4R1FA 4LFBE 4ED4A 4X62E 4DV1I 4LF4E 2UUAE 3P3EA 5LMUE 4DV4E 3T1HI 1Z5CA 4PRXA 2UU9E 1H7SA 4U3DA 5K36D 3ZZTA 1RHYA 4X65E 2PNMA 2PNZB 5JEAB 4DUZE 4X64E 4AQYE 2V2QA 4DR6I 2JE6B 4MYTA 2UXDI 4FW5A 1HR0I 3WU5A 4DV7I 2E5LE 2HK3A 3K17A 4UTGA 4BA2A 1VISA 3OTOE 1Y4SA 4IFDA 4JI5E 1Z0BA 1R6LA 5LMNE 2GS8A 4FW3A 2A2CA 4DV2E 4DUYI 1KIJA 3LPSA 1XMOI 1HNZI 5EKWA 5BR8E 3U1KA 1HNXE 3B82A 2F1DA 1N32E 1EI1A 4B3SI 4LCHA 2WNRA 1K47A 5IWAE 1XNQE 4MU4A 2HKEA 4DU7A 1UDQA 3T1HE 1BKNA 2HHHE 1OYRA 1FI4A 2BA0D 4MU0A 2X7IA
chains in the Genus database with same CATH topology
1WUUA 1HNWI 4DXLA 1D6TA 1N36I 1HR0E 1ZM2A 2V2ZA 1Z5BA 4JI3I 4JI2I 4LF8I 4WUCA 4DR2I 1J5EE 2BV3A 4LFAI 4Z7CA 2V34A 4DR3E 4UT4A 2HFSA 1XMOE 3ZM7A 2HFUA 3M6AA 4NXMI 3ZZUA 4JI4I 5A2QC 1Z5AA 2X36A 2VQFE 3F0NA 4HYMA 3HJCA 1Z0CA 4ZVIA 4NXNI 1HNWE 1NHJA 4KQVA 1N36E 4X66I 1QZRA 1NZ0A 2WW4A 2XEXA 3D4JA 5L3JA 4JI1I 1B62A 2UUBE 3Q1QA 1N0UA 1XMQE 4LFAE 4GKJI 2CGEA 4RPFA 3QT7A 3WU4A 5LL6R 4JI0I 1FWLA 4USMA 1A6FA 4B3RE 3PYEA 3GONA 4I3HA 4NXME 4B3TI 4JI4E 4P7AA 3J81C 1N34E 4K0KI 2PNLA 4JI7I 1XNRE 1Z59A 2Z5BA 4LFCI 1Y4UA 1Z0VA 3H4LA 4JV5I 4JI8I 4LF6E 2R3VA 4NXNE 5IT9Q 4IZJA 5GMEA 4FWHA 3Q6MA 1PVGA 1RR9A 1ZM9A 4DR1E 2F4VI 4LF7E 2UXBI 2R42A 4PU9A 4FW9A 2ZM6I 1S4EA 3V2UC 1FNMA 4DV0I 4LF5E 1FWKA 4DV1E 1FJGI 1H73A 1ZM3A 3J80Q 2Z5BB 4DR4I 1USVA 4DU8A 4JI7E 3WU3A 4DR6E 2UXDE 2IOQA 4IZJB 4URLA 4LFCE 4DV7E 1ZXMA 4JV5E 4DV6I 3LTOA 1PKPA 2HKJA 1IBLI 1UEKA 2Z5CA 4FWGA 4JG4A 2VQEI 4DR7I 2Z5EA 4DPWA 4DUYE 1HNZE 2BM0A 1HK7A 2ZM6E 1IBKI 4B3SE 4DR5I 4JI6I 1KVKA 2UUCI 5FLXQ 4OX9I 2OI2A 1FJGE 1I94I 4XTJA 1ZXNA 2NPFA 1XHKA 4YHHI 3T1YI 4X62I 4LF4I 2ZITA 4GKKI 2UUAI 4WUBA 4DV4I 2UU9I 1N33I 2DEJA 2Z5CB 1NHIA 1USUA 4X65I 4DV6E 4JI3E 4JI2E 4LF8E 1KKHA 1MG7A 1H72C 4DR2E 4AQYI 4DPTA 3JAMQ 1N0VC 2E5LI 2O1TA 1Y6ZA 2CG9A 3OTOI 4JI5I 2EFGA 3QT5A 2CZ9A 4DR5E 4JYAI 2UXCI 4JI6E 1U2RA 3B8HA 3ZKBA 2Q2EB 1MU5A 1HNXI 4FN5A 1N32I 3HULA 4HACA 3V5RA 5IWAI 1XNQI 1OJ4A 4YHHE 3T1YE 4LF9I 4GKKE 2HHHI 1N33E 3LNUA 4X66E 1Z0EA 4IZJD 4KHPI 1NHHA 2A2DA 1Z0GA 4JI1E 5A2QQ 1Z0TA 1H7UA 4YY3I 4GKJE 4P52A 3B78A 5FLXC 1MX0A 2O1WA 3PYGA 4DPXA 4JI0E 1J5EI 2BM1A 1Z0WA 4N3OA 2AJ4A 1PIEA 4DV3I 4DR3I 4JYAE 2UXCE 4Z7YA 4B3TE 4HACB 4B3MI 5FWKA 2O1VA 5GMDA 3PYDA 4K0KE 3K1JA 4M1KA 2HK2A 3CWVA 1FKAE 1ELOA 2IOPA 3P06A 3WU6A 4USKA 4JI8E 4LF9E 4IZKA 3JAMC 2VQFI 1IBMI 1DARA 2O1UA 2V2VA 4KHPE 4DV5I 2F4VE 1H74A 3J81Q 2UXBE 4YY3E 3ZZ0A 4WUDA 2E1RA 4DV0E 1EA6A 3J7AG 3ZKDA 3K85A 4FWDA 2LJPA 2UUBI 4DV3E 1XMQI 2VF3A 4PRVA 2GQ0A 3J7AM 3QT6A 4B3ME 4MYUA 4DR4E 5IT9C 4LFBI 5LMUI 4B3RI 4IZKB 4DPYA 4HY1A 4DPUA 1KTVA 1N34I 4DUZI 1IBLE 4EMDA 4X64I 1XNRI 1IBME 3Q6NA 2J7KA 2VQEE 3QT8A 4DV5E 2ZBKB 3PYFA 4LF6I 4DR7E 2V8PA 3J80C 1IBKE 5LMNI 1B63A 2DEIA 4DV2I 4DR1I 2UUCE 1RREA 4LF7I 5BR8I 1ZM4A 4OX9E 1I94E 1S16A 3PRYA 4HXZA 4LF5I 4R1FA 4LFBE 4ED4A 4X62E 4DV1I 4LF4E 2UUAE 5LMUE 4DV4E 3T1HI 1Z5CA 4PRXA 2UU9E 1H7SA 3ZZTA 4X65E 2PNMA 4DUZE 4X64E 4AQYE 2V2QA 4DR6I 4MYTA 2UXDI 1HR0I 3WU5A 4DV7I 2E5LE 2HK3A 3K17A 4UTGA 1VISA 3OTOE 1Y4SA 4JI5E 1Z0BA 5LMNE 2GS8A 2A2CA 4DV2E 4DUYI 1KIJA 3LPSA 1XMOI 1HNZI 5BR8E 1HNXE 3B82A 1N32E 1EI1A 4B3SI 1K47A 5IWAE 1XNQE 2HKEA 4DU7A 3T1HE 1BKNA 2HHHE 1FI4A 2X7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUU A;  1HNW I;  4DXL A;  1D6T A;  1N36 I;  1HR0 E;  1ZM2 A;  2V2Z A;  1Z5B A;  4JI3 I;  4JI2 I;  4LF8 I;  4WUC A;  4DR2 I;  1J5E E;  2BV3 A;  4LFA I;  4Z7C A;  2V34 A;  4DR3 E;  4UT4 A;  2HFS A;  1XMO E;  3ZM7 A;  2HFU A;  3M6A A;  4NXM I;  3ZZU A;  4JI4 I;  5A2Q C;  1Z5A A;  2X36 A;  2VQF E;  3F0N A;  4HYM A;  1Z0C A;  4ZVI A;  4NXN I;  1HNW E;  1NHJ A;  4KQV A;  1N36 E;  4X66 I;  1QZR A;  1NZ0 A;  2WW4 A;  2XEX A;  3D4J A;  5L3J A;  4JI1 I;  1B62 A;  2UUB E;  3Q1Q A;  1N0U A;  1XMQ E;  4LFA E;  4GKJ I;  4RPF A;  3QT7 A;  3WU4 A;  5LL6 R;  4JI0 I;  1FWL A;  4USM A;  1A6F A;  4B3R E;  3PYE A;  3GON A;  4I3H A;  4NXM E;  4B3T I;  4JI4 E;  4P7A A;  3J81 C;  1N34 E;  4K0K I;  4JI7 I;  1XNR E;  1Z59 A;  4LFC I;  1Z0V A;  3H4L A;  4JV5 I;  4JI8 I;  4LF6 E;  2R3V A;  4NXN E;  5IT9 Q;  5GME A;  4FWH A;  1PVG A;  1RR9 A;  1ZM9 A;  4DR1 E;  2F4V I;  4LF7 E;  2UXB I;  2R42 A;  4PU9 A;  4FW9 A;  2ZM6 I;  1S4E A;  3V2U C;  1FNM A;  4DV0 I;  4LF5 E;  1FWK A;  4DV1 E;  1FJG I;  1H73 A;  1ZM3 A;  3J80 Q;  4DR4 I;  4DU8 A;  4JI7 E;  3WU3 A;  4DR6 E;  2UXD E;  4URL A;  4LFC E;  4DV7 E;  1ZXM A;  4JV5 E;  4DV6 I;  3LTO A;  1PKP A;  2HKJ A;  1IBL I;  1UEK A;  4FWG A;  4JG4 A;  2VQE I;  4DR7 I;  4DPW A;  4DUY E;  1HNZ E;  2BM0 A;  2ZM6 E;  1IBK I;  4B3S E;  4DR5 I;  4JI6 I;  1KVK A;  2UUC I;  5FLX Q;  4OX9 I;  2OI2 A;  1FJG E;  1I94 I;  4XTJ A;  1ZXN A;  2NPF A;  1XHK A;  4YHH I;  3T1Y I;  4X62 I;  4LF4 I;  2ZIT A;  4GKK I;  2UUA I;  4WUB A;  4DV4 I;  2UU9 I;  1N33 I;  2DEJ A;  1NHI A;  4X65 I;  4DV6 E;  4JI3 E;  4JI2 E;  4LF8 E;  1KKH A;  1MG7 A;  1H72 C;  4DR2 E;  4AQY I;  4DPT A;  3JAM Q;  1N0V C;  2E5L I;  3OTO I;  4JI5 I;  2EFG A;  3QT5 A;  2CZ9 A;  4DR5 E;  4JYA I;  2UXC I;  4JI6 E;  1U2R A;  3B8H A;  3ZKB A;  2Q2E B;  1MU5 A;  1HNX I;  4FN5 A;  1N32 I;  3HUL A;  4HAC A;  3V5R A;  5IWA I;  1XNQ I;  1OJ4 A;  4YHH E;  3T1Y E;  4LF9 I;  4GKK E;  2HHH I;  1N33 E;  3LNU A;  4X66 E;  1Z0E A;  4KHP I;  1NHH A;  2A2D A;  1Z0G A;  4JI1 E;  5A2Q Q;  1Z0T A;  1H7U A;  4YY3 I;  4GKJ E;  4P52 A;  3B78 A;  5FLX C;  1MX0 A;  4DPX A;  3PYG A;  4JI0 E;  1J5E I;  2BM1 A;  1Z0W A;  2AJ4 A;  1PIE A;  4DV3 I;  4DR3 I;  4JYA E;  2UXC E;  4Z7Y A;  4B3T E;  4HAC B;  4B3M I;  5GMD A;  3PYD A;  4K0K E;  3K1J A;  4M1K A;  2HK2 A;  3CWV A;  1FKA E;  1ELO A;  3WU6 A;  4USK A;  4JI8 E;  4LF9 E;  3JAM C;  2VQF I;  1IBM I;  1DAR A;  2V2V A;  4KHP E;  4DV5 I;  2F4V E;  1H74 A;  3J81 Q;  2UXB E;  4YY3 E;  3ZZ0 A;  4WUD A;  2E1R A;  4DV0 E;  1EA6 A;  3J7A G;  3ZKD A;  4FWD A;  2LJP A;  2UUB I;  4DV3 E;  1XMQ I;  2VF3 A;  4PRV A;  3J7A M;  3QT6 A;  4B3M E;  4MYU A;  4DR4 E;  5IT9 C;  4LFB I;  5LMU I;  4B3R I;  4DPY A;  4HY1 A;  4DPU A;  1KTV A;  1N34 I;  4DUZ I;  1IBL E;  4EMD A;  4X64 I;  1XNR I;  1IBM E;  2J7K A;  2VQE E;  3QT8 A;  4DV5 E;  2ZBK B;  3PYF A;  4LF6 I;  4DR7 E;  2V8P A;  3J80 C;  1IBK E;  5LMN I;  1B63 A;  2DEI A;  4DV2 I;  4DR1 I;  2UUC E;  1RRE A;  4LF7 I;  5BR8 I;  1ZM4 A;  4OX9 E;  1I94 E;  1S16 A;  4HXZ A;  4LF5 I;  4R1F A;  4LFB E;  4ED4 A;  4X62 E;  4DV1 I;  4LF4 E;  2UUA E;  5LMU E;  4DV4 E;  3T1H I;  1Z5C A;  4PRX A;  2UU9 E;  1H7S A;  3ZZT A;  4X65 E;  4DUZ E;  4X64 E;  4AQY E;  2V2Q A;  4DR6 I;  4MYT A;  2UXD I;  1HR0 I;  3WU5 A;  4DV7 I;  2E5L E;  2HK3 A;  3K17 A;  4UTG A;  1VIS A;  3OTO E;  4JI5 E;  1Z0B A;  5LMN E;  2GS8 A;  2A2C A;  4DV2 E;  4DUY I;  1KIJ A;  3LPS A;  1XMO I;  1HNZ I;  5BR8 E;  1HNX E;  3B82 A;  1N32 E;  1EI1 A;  4B3S I;  1K47 A;  5IWA E;  1XNQ E;  2HKE A;  4DU7 A;  3T1H E;  1BKN A;  2HHH E;  1FI4 A;  2X7I A; 
#chains in the Genus database with same CATH topology
 1WUU A;  4BA2 B;  1HNW I;  4DXL A;  1D6T A;  1N36 I;  1HR0 E;  1ZM2 A;  4IFD B;  2V2Z A;  1Z5B A;  4JI3 I;  4JI2 I;  4LF8 I;  4FW4 A;  4WUC A;  4DR2 I;  4IS9 A;  1J5E E;  2BV3 A;  2PO1 A;  2WP8 A;  4LFA I;  4Z7C A;  3B4T A;  4FW6 A;  2V34 A;  4LPF A;  4DR3 E;  4UT4 A;  5C0X D;  1XXE A;  2WNR B;  2HFS A;  4IFD E;  1XMO E;  4MDT A;  3ZM7 A;  3PS3 A;  2HFU A;  4BA1 A;  3M6A A;  4NXM I;  3ZZU A;  3HKM A;  4JI4 I;  5A2Q C;  1Z5A A;  2X36 A;  2VQF E;  3F0N A;  4OO1 E;  4HYM A;  5C0X C;  3HJC A;  1Z0C A;  4ZVI A;  2IER A;  4NXN I;  4QNK A;  1HNW E;  5JEA D;  1NHJ A;  2NN6 C;  4KQV A;  1N36 E;  4X66 I;  1QZR A;  2C38 A;  2PO1 B;  1NZ0 A;  2WW4 A;  2WP8 B;  2XEX A;  3D4J A;  5L3J A;  4JI1 I;  1B62 A;  2UUB E;  3Q1Q A;  1N0U A;  1XMQ E;  4LFA E;  4GKJ I;  2BA1 D;  2CGE A;  3GCM A;  4RPF A;  1YH8 A;  3QT7 A;  4BA1 B;  3WU4 A;  5LL6 R;  1VI7 A;  1R6M A;  4JI0 I;  4MQY A;  1FWL A;  4USM A;  1A6F A;  4B3R E;  3PYE A;  3GON A;  2JEA A;  4I3H A;  4NXM E;  4B3T I;  4JI4 E;  4P7A A;  3J81 C;  1N34 E;  4K0K I;  2PNL A;  4JI7 I;  1XNR E;  3P76 A;  4OKG A;  1Z59 A;  1OYP A;  2Z5B A;  4LFC I;  1Y4U A;  1Z0V A;  3H4L A;  2C38 B;  4JV5 I;  1UDS A;  4JI8 I;  2JT2 A;  4LF6 E;  2R3V A;  4NXN E;  3KRN A;  5IT9 Q;  4IZJ A;  2GO4 A;  4MU3 A;  5GME A;  4FWH A;  3Q6M A;  5K36 C;  1PVG A;  1RR9 A;  4U3B A;  1ZM9 A;  4DR1 E;  2F4V I;  4LF7 E;  2UXB I;  2R42 A;  4PU9 A;  1UDO A;  4FW9 A;  3CDJ A;  2ZM6 I;  1S4E A;  3V2U C;  2JEA B;  1FNM A;  4OO1 A;  4DV0 I;  4LF5 E;  1FWK A;  4DV1 E;  5C0X F;  1FJG I;  1H73 A;  1ZM3 A;  3J80 Q;  2Z5B B;  3P3C A;  2NN6 F;  4DR4 I;  1USV A;  4DU8 A;  4JI7 E;  3WU3 A;  3GME A;  4DR6 E;  2UXD E;  2IOQ A;  4IZJ B;  4URL A;  4LFC E;  4DV7 E;  1ZXM A;  4JV5 E;  5DRQ A;  4DV6 I;  3LTO A;  2AE8 A;  1PKP A;  2HKJ A;  1IBL I;  1UEK A;  2Z5C A;  4FWG A;  4LOM A;  4JG4 A;  2VQE I;  4DR7 I;  2Z5E A;  1E3P A;  3PS1 A;  4DPW A;  4DUY E;  4OO1 B;  1HNZ E;  2BM0 A;  1HK7 A;  3M7N D;  2ZM6 E;  1IBK I;  4B3S E;  4NBQ A;  4DR5 I;  4JI6 I;  1KVK A;  4AIM A;  3DD6 A;  5FLX Q;  2UUC I;  4OX9 I;  5ELW A;  2OI2 A;  5C0X A;  1FJG E;  1I94 I;  4XTJ A;  1ZXN A;  4QNJ A;  2NPF A;  2NN6 A;  1XHK A;  4YHH I;  3T1Y I;  2PO2 A;  4X62 I;  2ZIT A;  4LF4 I;  2UUA I;  4GKK I;  5K36 F;  4WUB A;  4DV4 I;  2UU9 I;  1N33 I;  1OYS A;  2DEJ A;  2Z5C B;  1NHI A;  1USU A;  4X65 I;  4DV6 E;  2GO3 A;  4JI3 E;  2VES A;  4JI2 E;  4LF8 E;  1KKH A;  1MG7 A;  1H72 C;  2J65 A;  4DR2 E;  4AQY I;  4DPT A;  3JAM Q;  1N0V C;  5DRO A;  2BR2 A;  2E5L I;  3NZK A;  2O1T A;  1Y6Z A;  2CG9 A;  4OZE A;  3OTO I;  2O3Z A;  5JEA C;  4JI5 I;  2EFG A;  3QT5 A;  5C0X B;  2CZ9 A;  4DR5 E;  4JYA I;  2UXC I;  4JI6 E;  1U2R A;  3B8H A;  3ZKB A;  2Q2E B;  2C37 A;  1UDN A;  1MU5 A;  2NN6 B;  1HNX I;  2PO2 B;  4FN5 A;  3M85 D;  1N32 I;  3HUL A;  4HAC A;  3V5R A;  5IWA I;  1XNQ I;  1OJ4 A;  4YHH E;  3T1Y E;  4LF9 I;  5C0X E;  4GKK E;  5K36 A;  2HHH I;  1N33 E;  3LNU A;  4X66 E;  1Z0E A;  4IZJ D;  4KHP I;  1NHH A;  2NN6 E;  4IFD D;  2A2D A;  2BR2 B;  1Z0G A;  4JI1 E;  5A2Q Q;  1Z0T A;  3UHM A;  5DRR A;  1H7U A;  2JEB A;  1YHC A;  4YY3 I;  4GKJ E;  4P52 A;  3B78 A;  4AM3 A;  5FLX C;  1MX0 A;  2O1W A;  3PYG A;  4DPX A;  4LCF A;  2C37 B;  4JI0 E;  4OO1 D;  1J5E I;  2BM1 A;  1Z0W A;  4N3O A;  2AJ4 A;  1PIE A;  4DV3 I;  5JEA E;  4DR3 I;  4JYA E;  4IFD C;  2UXC E;  4Z7Y A;  2BA0 G;  4B3T E;  4HAC B;  4B3M I;  5FWK A;  2O1V A;  5GMD A;  1Y5Y A;  3PYD A;  4K0K E;  3K1J A;  4M1K A;  4GQU A;  2HK2 A;  3CWV A;  1FKA E;  1ELO A;  2IOP A;  3P06 A;  3WU6 A;  5K36 B;  1E3H A;  5EL9 A;  4USK A;  4JI8 E;  4LF9 E;  4LCG A;  4IZK A;  4OO1 C;  3JAM C;  2VQF I;  1IBM I;  1DAR A;  2O1U A;  2V2V A;  5JEA F;  4KHP E;  2JEB B;  4DV5 I;  5K36 E;  2F4V E;  1H74 A;  5DNX A;  3J81 Q;  2UXB E;  1P42 A;  4YY3 E;  3ZZ0 A;  3M7N G;  4WUD A;  3GLL A;  2E1R A;  4DV0 E;  1EA6 A;  3J7A G;  1Y60 A;  3ZKD A;  3K85 A;  4FWD A;  2LJP A;  2UUB I;  4DV3 E;  1XMQ I;  2VF3 A;  2PO0 A;  3L7Z A;  4PRV A;  2GQ0 A;  3J7A M;  3QT6 A;  2C39 A;  4B3M E;  4MYU A;  5DRP A;  5IT9 C;  4DR4 E;  4LFB I;  3P3G A;  5LMU I;  4B3R I;  4IZK B;  2NN6 D;  4ISA A;  4DPY A;  4HY1 A;  5DNL A;  4DPU A;  1KTV A;  4J3D A;  1N34 I;  4DUZ I;  1IBL E;  4EMD A;  4X64 I;  1XNR I;  1IBM E;  3H1C A;  3Q6N A;  2J7K A;  3CDI A;  2VQE E;  2PNZ A;  3QT8 A;  4DV5 E;  2ZBK B;  5JEA A;  3PYF A;  2BA1 G;  4LF6 I;  4DR7 E;  2JE6 A;  4IFD F;  2V8P A;  4AID A;  3J80 C;  1IBK E;  2IES A;  5LMN I;  1B63 A;  2CVE A;  2PO0 B;  2DEI A;  3L7Z B;  4DV2 I;  4FW7 A;  4DR1 I;  2UUC E;  1RRE A;  4MU1 A;  4LF7 I;  2C39 B;  5BR8 I;  1ZM4 A;  4OX9 E;  1I94 E;  1S16 A;  3PRY A;  3PS2 A;  3M85 G;  4OO1 F;  4HXZ A;  3U1Y A;  4LF5 I;  4R1F A;  4LFB E;  4ED4 A;  4X62 E;  4DV1 I;  4LF4 E;  2UUA E;  3P3E A;  5LMU E;  4DV4 E;  3T1H I;  1Z5C A;  4PRX A;  2UU9 E;  1H7S A;  4U3D A;  5K36 D;  3ZZT A;  1RHY A;  4X65 E;  2PNM A;  2PNZ B;  5JEA B;  4DUZ E;  4X64 E;  4AQY E;  2V2Q A;  4DR6 I;  2JE6 B;  4MYT A;  2UXD I;  4FW5 A;  1HR0 I;  3WU5 A;  4DV7 I;  2E5L E;  2HK3 A;  3K17 A;  4UTG A;  4BA2 A;  1VIS A;  3OTO E;  1Y4S A;  4IFD A;  4JI5 E;  1Z0B A;  1R6L A;  5LMN E;  2GS8 A;  4FW3 A;  2A2C A;  4DV2 E;  4DUY I;  1KIJ A;  3LPS A;  1XMO I;  1HNZ I;  5EKW A;  5BR8 E;  3U1K A;  1HNX E;  3B82 A;  2F1D A;  1N32 E;  1EI1 A;  4B3S I;  4LCH A;  2WNR A;  1K47 A;  5IWA E;  1XNQ E;  4MU4 A;  2HKE A;  4DU7 A;  1UDQ A;  3T1H E;  1BKN A;  2HHH E;  1OYR A;  1FI4 A;  2BA0 D;  4MU0 A;  2X7I A; 
#chains in the Genus database with same CATH homology
 1WUU A;  1HNW I;  4DXL A;  1D6T A;  1N36 I;  1HR0 E;  1ZM2 A;  2V2Z A;  1Z5B A;  4JI3 I;  4JI2 I;  4LF8 I;  4WUC A;  4DR2 I;  1J5E E;  2BV3 A;  4LFA I;  4Z7C A;  2V34 A;  4DR3 E;  4UT4 A;  2HFS A;  1XMO E;  3ZM7 A;  2HFU A;  3M6A A;  4NXM I;  3ZZU A;  4JI4 I;  5A2Q C;  1Z5A A;  2X36 A;  2VQF E;  3F0N A;  4HYM A;  3HJC A;  1Z0C A;  4ZVI A;  4NXN I;  1HNW E;  1NHJ A;  4KQV A;  1N36 E;  4X66 I;  1QZR A;  1NZ0 A;  2WW4 A;  2XEX A;  3D4J A;  5L3J A;  4JI1 I;  1B62 A;  2UUB E;  3Q1Q A;  1N0U A;  1XMQ E;  4LFA E;  4GKJ I;  2CGE A;  4RPF A;  3QT7 A;  3WU4 A;  5LL6 R;  4JI0 I;  1FWL A;  4USM A;  1A6F A;  4B3R E;  3PYE A;  3GON A;  4I3H A;  4NXM E;  4B3T I;  4JI4 E;  4P7A A;  3J81 C;  1N34 E;  4K0K I;  2PNL A;  4JI7 I;  1XNR E;  1Z59 A;  2Z5B A;  4LFC I;  1Y4U A;  1Z0V A;  3H4L A;  4JV5 I;  4JI8 I;  4LF6 E;  2R3V A;  4NXN E;  5IT9 Q;  4IZJ A;  5GME A;  4FWH A;  3Q6M A;  1PVG A;  1RR9 A;  1ZM9 A;  4DR1 E;  2F4V I;  4LF7 E;  2UXB I;  2R42 A;  4PU9 A;  4FW9 A;  2ZM6 I;  1S4E A;  3V2U C;  1FNM A;  4DV0 I;  4LF5 E;  1FWK A;  4DV1 E;  1FJG I;  1H73 A;  1ZM3 A;  3J80 Q;  2Z5B B;  4DR4 I;  1USV A;  4DU8 A;  4JI7 E;  3WU3 A;  4DR6 E;  2UXD E;  2IOQ A;  4IZJ B;  4URL A;  4LFC E;  4DV7 E;  1ZXM A;  4JV5 E;  4DV6 I;  3LTO A;  1PKP A;  2HKJ A;  1IBL I;  1UEK A;  2Z5C A;  4FWG A;  4JG4 A;  2VQE I;  4DR7 I;  2Z5E A;  4DPW A;  4DUY E;  1HNZ E;  2BM0 A;  1HK7 A;  2ZM6 E;  1IBK I;  4B3S E;  4DR5 I;  4JI6 I;  1KVK A;  2UUC I;  5FLX Q;  4OX9 I;  2OI2 A;  1FJG E;  1I94 I;  4XTJ A;  1ZXN A;  2NPF A;  1XHK A;  4YHH I;  3T1Y I;  4X62 I;  4LF4 I;  2ZIT A;  4GKK I;  2UUA I;  4WUB A;  4DV4 I;  2UU9 I;  1N33 I;  2DEJ A;  2Z5C B;  1NHI A;  1USU A;  4X65 I;  4DV6 E;  4JI3 E;  4JI2 E;  4LF8 E;  1KKH A;  1MG7 A;  1H72 C;  4DR2 E;  4AQY I;  4DPT A;  3JAM Q;  1N0V C;  2E5L I;  2O1T A;  1Y6Z A;  2CG9 A;  3OTO I;  4JI5 I;  2EFG A;  3QT5 A;  2CZ9 A;  4DR5 E;  4JYA I;  2UXC I;  4JI6 E;  1U2R A;  3B8H A;  3ZKB A;  2Q2E B;  1MU5 A;  1HNX I;  4FN5 A;  1N32 I;  3HUL A;  4HAC A;  3V5R A;  5IWA I;  1XNQ I;  1OJ4 A;  4YHH E;  3T1Y E;  4LF9 I;  4GKK E;  2HHH I;  1N33 E;  3LNU A;  4X66 E;  1Z0E A;  4IZJ D;  4KHP I;  1NHH A;  2A2D A;  1Z0G A;  4JI1 E;  5A2Q Q;  1Z0T A;  1H7U A;  4YY3 I;  4GKJ E;  4P52 A;  3B78 A;  5FLX C;  1MX0 A;  2O1W A;  3PYG A;  4DPX A;  4JI0 E;  1J5E I;  2BM1 A;  1Z0W A;  4N3O A;  2AJ4 A;  1PIE A;  4DV3 I;  4DR3 I;  4JYA E;  2UXC E;  4Z7Y A;  4B3T E;  4HAC B;  4B3M I;  5FWK A;  2O1V A;  5GMD A;  3PYD A;  4K0K E;  3K1J A;  4M1K A;  2HK2 A;  3CWV A;  1FKA E;  1ELO A;  2IOP A;  3P06 A;  3WU6 A;  4USK A;  4JI8 E;  4LF9 E;  4IZK A;  3JAM C;  2VQF I;  1IBM I;  1DAR A;  2O1U A;  2V2V A;  4KHP E;  4DV5 I;  2F4V E;  1H74 A;  3J81 Q;  2UXB E;  4YY3 E;  3ZZ0 A;  4WUD A;  2E1R A;  4DV0 E;  1EA6 A;  3J7A G;  3ZKD A;  3K85 A;  4FWD A;  2LJP A;  2UUB I;  4DV3 E;  1XMQ I;  2VF3 A;  4PRV A;  2GQ0 A;  3J7A M;  3QT6 A;  4B3M E;  4MYU A;  4DR4 E;  5IT9 C;  4LFB I;  5LMU I;  4B3R I;  4IZK B;  4DPY A;  4HY1 A;  4DPU A;  1KTV A;  1N34 I;  4DUZ I;  1IBL E;  4EMD A;  4X64 I;  1XNR I;  1IBM E;  3Q6N A;  2J7K A;  2VQE E;  3QT8 A;  4DV5 E;  2ZBK B;  3PYF A;  4LF6 I;  4DR7 E;  2V8P A;  3J80 C;  1IBK E;  5LMN I;  1B63 A;  2DEI A;  4DV2 I;  4DR1 I;  2UUC E;  1RRE A;  4LF7 I;  5BR8 I;  1ZM4 A;  4OX9 E;  1I94 E;  1S16 A;  3PRY A;  4HXZ A;  4LF5 I;  4R1F A;  4LFB E;  4ED4 A;  4X62 E;  4DV1 I;  4LF4 E;  2UUA E;  5LMU E;  4DV4 E;  3T1H I;  1Z5C A;  4PRX A;  2UU9 E;  1H7S A;  3ZZT A;  4X65 E;  2PNM A;  4DUZ E;  4X64 E;  4AQY E;  2V2Q A;  4DR6 I;  4MYT A;  2UXD I;  1HR0 I;  3WU5 A;  4DV7 I;  2E5L E;  2HK3 A;  3K17 A;  4UTG A;  1VIS A;  3OTO E;  1Y4S A;  4JI5 E;  1Z0B A;  5LMN E;  2GS8 A;  2A2C A;  4DV2 E;  4DUY I;  1KIJ A;  3LPS A;  1XMO I;  1HNZ I;  5BR8 E;  1HNX E;  3B82 A;  1N32 E;  1EI1 A;  4B3S I;  1K47 A;  5IWA E;  1XNQ E;  2HKE A;  4DU7 A;  3T1H E;  1BKN A;  2HHH E;  1FI4 A;  2X7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...