2UXDI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxdI00
5LMNE 1XNRI 2HK2A 2ZM6E 1MU5A 4USMA 4R1FA 4DUYE 3LNUA 2UXCI 5LMNI 5FLXQ 1HR0E 2NPFA 1NZ0A 1MG7A 4JYAE 1H72C 4FN5A 1RREA 4LF7E 4LF8I 5L3JA 4DPYA 3LTOA 4DUYI 3WU3A 2ZITA 1WUUA 4MYTA 4LFBI 5LMUE 1HNXI 4YHHE 4DUZE 3WU6A 1XNQE 4HYMA 4JYAI 4KHPE 4XTJA 4B3TE 4LF4I 1J5EI 1Z0CA 1A6FA 4B3SE 4DR1E 4PU9A 4DPWA 4YHHI 4DUZI 1XNQI 4KHPI 5LL6R 1EA6A 4YY3I 4WUCA 4AQYI 1IBME 4LF5I 4B3ME 1BKNA 1FWKA 4DV0I 1I94E 4DR4I 2OI2A 3JAMQ 4JI1E 4RPFA 3QT7A 3JAMC 3J80Q 1IBMI 4NXME 2DEJA 1KVKA 4DR6E 4GKKE 4MYUA 3B78A 2BM0A 2A2DA 1HNZI 4ED4A 4FWHA 4JI1I 4WUDA 4KQVA 4JI5E 5A2QQ 1ZM9A 4P52A 1XMOE 4P7AA 2F4VE 4DR6I 4DV4I 5A2QC 4JI6E 3B82A 2VQEE 2V2QA 2VQFI 2HFUA 2AJ4A 2E1RA 2X36A 4DPUA 4DV1E 1XMOI 4OX9E 2F4VI 1FI4A 2UXCE 4DR7I 1K47A 2V8PA 4DR3E 4X66E 4LF9E 4X64E 2UUBE 1IBKE 4DV1I 4LF8E 4OX9I 3ZZTA 3J7AM 4X65E 3ZZ0A 3OTOI 1FWLA 4DXLA 4LFBE 3QT8A 1HNXE 4DR3I 4LFAI 4X66I 1S4EA 4LF9I 3PYGA 2ZBKB 4X64I 2UUBI 1N32E 1IBKI 1FJGE 4LF4E 4X65I 1J5EE 1OJ4A 3J81Q 3ZKBA 3J81C 5IT9Q 1H7UA 1H74A 1Z5AA 1N32I 1FJGI 2WW4A 5IT9C 4YY3E 1ELOA 1HNWE 1QZRA 4FW9A 4AQYE 4LF5E 1IBLE 1NHIA 1PIEA 2HFSA 4JI4I 4DV0E 3F0NA 4Z7CA 4DR4E 3M6AA 4K0KE 3CWVA 4PRXA 4DV7I 1HNWI 1Z59A 1IBLI 4X62E 4UT4A 1N33E 1HNZE 2XEXA 2UXBE 4JV5I 4HACA 4K0KI 1MX0A 2R42A 2BM1A 3J7AG 3WU4A 4X62I 1FKAE 4DV4E 1N36E 4JI2E 1N33I 4Z7YA 2UXBI 2VQFE 4JI8E 2DEIA 3ZM7A 1D6TA 1B63A 4URLA 2HHHE 3D4JA 1N36I 1Z0BA 3PYDA 4JI2I 1XMQE 1ZXMA 4PRVA 4DR7E 1KTVA 4JI8I 4LF6E 1ZM2A 4JI0I 2UUCE 2E5LE 1KKHA 2HHHI 4DU8A 1Z0GA 2HKJA 4DPXA 4UTGA 3H4LA 1U2RA 3OTOE 4DV6E 3V2UC 1XMQI 1UEKA 1H7SA 4LF6I 4LFAE 2UUAE 2UUCI 2E5LI 3QT5A 2UXDE 2UU9I 4M1KA 2X7IA 2LJPA 3QT6A 1KIJA 4EMDA 1XHKA 1Z0WA 4NXNE 1N34E 4DV6I 2BV3A 4JG4A 3K1JA 2J7KA 2R3VA 3PYEA 4B3RE 2UUAI 1RR9A 1B62A 2UXDI 4DV5E 1H73A 4WUBA 4ZVIA 4NXNI 4DV3E 1N34I 5IWAE 4LFCI 4JI4E 4I3HA 4B3RI 1N0VC 5BR8E 2ZM6I 4DV5I 5FLXC 3V5RA 4DV7E 4DV3I 5IWAI 2V34A 3B8HA 5BR8I 2CZ9A 1HR0I 4FWGA 4USKA 4JV5E 1VISA 1PVGA 3ZZUA 3ZKDA 4LF7I 2VF3A 1Z5CA 1FNMA 3T1YE 1S16A 1ZM4A 1Z0VA 5LMUI 4DU7A 1NHHA 4B3TI 2A2CA 1DARA 3Q1QA 4JI7E 4FWDA 3T1YI 4B3SI 4DR1I 3PYFA 3T1HE 3GONA 4JI0E 4HXZA 4JI7I 4DR5E 4B3MI 2EFGA 2HK3A 3J80C 5GMEA 3LPSA 1I94I 3T1HI 2UU9E 3K17A 5GMDA 1N0UA 1ZM3A 4GKJE 4DR5I 4NXMI 4DPTA 4DV2E 4JI3E 2GS8A 3WU5A 4DR2E 4GKKI 2V2VA 2HKEA 1Z5BA 1XNRE 1PKPA 2V2ZA 2Q2EB 3HULA 4HY1A 1NHJA 4GKJI 4JI5I 1ZXNA 1EI1A 4DV2I 4JI3I 1Z0EA 4DR2I 4LFCE 4JI6I 4HACB 2VQEI 1Z0TA
chains in the Genus database with same CATH superfamily
5LMNE 1XNRI 2HK2A 2ZM6E 1MU5A 5ELWA 4USMA 2F1DA 4FW7A 2CG9A 4QNKA 2IOPA 4R1FA 3M7NG 3DD6A 4DUYE 5JEAE 3HKMA 3LNUA 2UXCI 4OO1C 5LMNI 5FLXQ 5K36B 1HR0E 2PNMA 2NPFA 1NZ0A 1MG7A 2AE8A 4JYAE 1H72C 4FN5A 4MU4A 1RREA 2JE6A 4BA1A 4LF7E 4LF8I 5L3JA 2BA1G 3LTOA 4DPYA 1OYSA 4DUYI 3WU3A 2BA0G 2ZITA 1WUUA 4MYTA 4LFBI 2O3ZA 5LMUE 1HNXI 4YHHE 4DUZE 5DNLA 3WU6A 1XNQE 4HYMA 4JYAI 4KHPE 4XTJA 5FWKA 4B3TE 3NZKA 4LF4I 1J5EI 1Z0CA 1A6FA 2JEBB 4AIMA 4B3SE 4DR1E 4U3DA 2JT2A 4PU9A 4DPWA 2WP8B 4YHHI 4DUZI 1XNQI 4KHPI 5K36E 5LL6R 1EA6A 1P42A 4IZKA 4YY3I 4WUCA 4IFDD 4AQYI 1IBME 4LF5I 2NN6C 4B3ME 1BKNA 1FWKA 2CVEA 4DV0I 1Y4UA 4OO1A 3GCMA 1I94E 4BA2A 2GQ0A 4DR4I 5C0XD 1VI7A 2OI2A 3JAMQ 2C38A 1Y6ZA 4ISAA 4RPFA 4JI1E 3QT7A 3JAMC 3J80Q 1IBMI 4NXME 2IERA 5DRPA 2DEJA 1KVKA 4DR6E 4GKKE 4MYUA 3B78A 2BM0A 2A2DA 1UDNA 1HNZI 4ED4A 2O1TA 2PO1A 4FWHA 2JE6B 4JI1I 4WUDA 4KQVA 4AM3A 1YHCA 4JI5E 2Z5CA 5A2QQ 4OO1F 4GQUA 1ZM9A 4P52A 2BR2A 4P7AA 1XMOE 4IS9A 3K85A 2F4VE 4DR6I 4DV4I 5A2QC 4JI6E 3B82A 2VQEE 2V2QA 2C39A 2VQFI 2HFUA 5EKWA 1HK7A 5JEAD 2O1VA 2AJ4A 2E1RA 4N3OA 2X36A 4DPUA 4DV1E 1XMOI 4OX9E 2F4VI 2NN6A 1FI4A 2UXCE 4DR7I 5DROA 1K47A 4IFDA 2V8PA 2PO0A 4DR3E 4X66E 4LF9E 4U3BA 4X64E 2UUBE 1IBKE 4DV1I 4LF8E 4OX9I 3ZZTA 3J7AM 4X65E 3ZZ0A 4OO1B 2J65A 3Q6NA 3OTOI 1FWLA 4DXLA 4LFBE 3QT8A 1HNXE 4DR3I 4LFAI 4X66I 1USUA 1S4EA 4MU3A 4LF9I 3PYGA 4IZJD 2ZBKB 4X64I 2UUBI 2NN6F 1N32E 1IBKI 1FJGE 4LF4E 4X65I 1J5EE 2GO4A 1E3HA 1OJ4A 4IFDF 5K36D 3J81Q 1USVA 3ZKBA 2PO1B 3PRYA 3J81C 2WNRA 5IT9Q 1H7UA 1H74A 1Z5AA 1N32I 1FJGI 2WW4A 5IT9C 2BR2B 1ELOA 4YY3E 1R6MA 1Y60A 1HNWE 1QZRA 4FW9A 4AQYE 4LF5E 3P3EA 1IBLE 1NHIA 4QNJA 5JEAA 1PIEA 2HFSA 4JI4I 3CDIA 4OKGA 4DV0E 3F0NA 4Z7CA 1E3PA 4DR4E 4OO1E 3M6AA 4K0KE 2IESA 3CWVA 4MU1A 4PRXA 4DV7I 1HNWI 1Z59A 2NN6B 4AIDA 1IBLI 4X62E 2PO0B 4UT4A 4IFDC 1Y4SA 4LCGA 5DNXA 1N33E 1HNZE 2XEXA 2UXBE 4JV5I 4HACA 4K0KI 1MX0A 5DRRA 2R42A 5JEAF 2BM1A 3J7AG 3WU4A 5C0XC 4X62I 1FKAE 4LCHA 4DV4E 1N36E 4IZJA 4JI2E 3U1YA 1N33I 4Z7YA 2UXBI 2VQFE 4JI8E 2DEIA 2PNZA 3ZM7A 4BA1B 1D6TA 4J3DA 5K36A 3L7ZA 1B63A 4URLA 2HHHE 3D4JA 4NBQA 3M85D 4LCFA 2PNLA 1XXEA 1N36I 1Z0BA 3PYDA 4JI2I 2NN6E 1XMQE 1ZXMA 4PRVA 4DR7E 1KTVA 4JI8I 3H1CA 4LF6E 1ZM2A 4JI0I 2UUCE 2E5LE 4MU0A 1KKHA 2HHHI 4DU8A 1Z0GA 2HKJA 4DPXA 5JEAB 4UTGA 3H4LA 1UDQA 2BA0D 5JEAC 2JEAA 1U2RA 3OTOE 4DV6E 3V2UC 1XMQI 1UEKA 3GLLA 1H7SA 2JEBA 4LF6I 4LFAE 2UUAE 2UUCI 4IZKB 2E5LI 3QT5A 2UXDE 2UU9I 3PS1A 4M1KA 2WP8A 2X7IA 2LJPA 3GMEA 3QT6A 1KIJA 4EMDA 1XHKA 1Z0WA 2C37A 4NXNE 5C0XA 3HJCA 3PS2A 1N34E 4DV6I 4BA2B 2BV3A 4JG4A 3K1JA 4FW4A 2C38B 2J7KA 2R3VA 3PYEA 4B3RE 2UUAI 1RHYA 1RR9A 1B62A 2UXDI 1OYPA 4DV5E 1UDSA 5EL9A 1H73A 4WUBA 4ZVIA 4OO1D 4NXNI 3CDJA 4DV3E 4IZJB 1N34I 5IWAE 4LFCI 4JI4E 2PNZB 4I3HA 4FW6A 3M85G 3B4TA 4B3RI 4LPFA 1N0VC 4OZEA 5BR8E 2ZM6I 3L7ZB 5K36C 4DV5I 5C0XF 5FLXC 2Z5CB 3V5RA 4DV7E 4DV3I 3Q6MA 5IWAI 2GO3A 2PO2A 2C39B 2V34A 3B8HA 1UDOA 2Z5BA 5BR8I 2CZ9A 1HR0I 4FWGA 4USKA 4JV5E 1VISA 1PVGA 3ZZUA 3ZKDA 4LF7I 2JEAB 2VF3A 1Z5CA 1FNMA 4IFDB 3T1YE 1Y5YA 4FW3A 1S16A 1ZM4A 3UHMA 1Z0VA 5DRQA 5LMUI 4DU7A 2NN6D 1OYRA 1NHHA 2C37B 4B3TI 2A2CA 5C0XB 1DARA 3Q1QA 4JI7E 4FWDA 3P76A 3T1YI 4B3SI 4MDTA 4DR1I 3PYFA 3T1HE 3GONA 4JI0E 4HXZA 1YH8A 3M7ND 3U1KA 3P06A 4JI7I 4DR5E 2CGEA 4FW5A 4B3MI 2EFGA 3P3CA 2HK3A 3J80C 2WNRB 5GMEA 3LPSA 1I94I 3T1HI 2VESA 4IFDE 2UU9E 4LOMA 3K17A 2BA1D 2O1UA 5GMDA 1N0UA 2PO2B 1ZM3A 4GKJE 2Z5EA 4DR5I 4NXMI 4DPTA 4DV2E 4JI3E 2Z5BB 3KRNA 2GS8A 3WU5A 3PS3A 4DR2E 5C0XE 4GKKI 5K36F 2V2VA 2HKEA 1Z5BA 2O1WA 1XNRE 1PKPA 2V2ZA 2Q2EB 2IOQA 3HULA 4HY1A 1NHJA 4MQYA 4GKJI 4JI5I 1ZXNA 1EI1A 4DV2I 4JI3I 1Z0EA 4DR2I 3P3GA 4LFCE 1R6LA 4JI6I 4HACB 2VQEI 1Z0TA
chains in the Genus database with same CATH topology
5LMNE 1XNRI 2HK2A 2ZM6E 1MU5A 4USMA 2CG9A 2IOPA 4R1FA 4DUYE 3LNUA 2UXCI 5LMNI 5FLXQ 1HR0E 2PNMA 2NPFA 1NZ0A 1MG7A 4JYAE 1H72C 4FN5A 1RREA 4LF7E 4LF8I 5L3JA 4DPYA 3LTOA 4DUYI 3WU3A 2ZITA 1WUUA 4MYTA 4LFBI 5LMUE 1HNXI 4YHHE 4DUZE 3WU6A 1XNQE 4HYMA 4JYAI 4KHPE 4XTJA 5FWKA 4B3TE 4LF4I 1J5EI 1Z0CA 1A6FA 4B3SE 4DR1E 4PU9A 4DPWA 4YHHI 4DUZI 1XNQI 4KHPI 5LL6R 1EA6A 4IZKA 4YY3I 4WUCA 4AQYI 1IBME 4LF5I 4B3ME 1BKNA 1FWKA 4DV0I 1Y4UA 1I94E 2GQ0A 4DR4I 2OI2A 3JAMQ 1Y6ZA 4JI1E 4RPFA 3QT7A 3JAMC 3J80Q 1IBMI 4NXME 2DEJA 1KVKA 4DR6E 4GKKE 4MYUA 3B78A 2BM0A 2A2DA 1HNZI 4ED4A 2O1TA 4FWHA 4JI1I 4WUDA 4KQVA 4JI5E 2Z5CA 5A2QQ 1ZM9A 4P52A 1XMOE 4P7AA 3K85A 2F4VE 4DR6I 4DV4I 5A2QC 4JI6E 3B82A 2VQEE 2V2QA 2VQFI 2HFUA 1HK7A 2O1VA 2AJ4A 2E1RA 4N3OA 2X36A 4DPUA 4DV1E 1XMOI 4OX9E 2F4VI 1FI4A 2UXCE 4DR7I 1K47A 2V8PA 4DR3E 4X66E 4LF9E 4X64E 2UUBE 1IBKE 4DV1I 4LF8E 4OX9I 3ZZTA 3J7AM 4X65E 3ZZ0A 3Q6NA 3OTOI 1FWLA 4DXLA 4LFBE 3QT8A 1HNXE 4DR3I 4LFAI 4X66I 1USUA 1S4EA 4LF9I 3PYGA 4IZJD 2ZBKB 4X64I 2UUBI 1N32E 1IBKI 1FJGE 4LF4E 4X65I 1J5EE 1OJ4A 3J81Q 1USVA 3ZKBA 3PRYA 3J81C 5IT9Q 1H7UA 1H74A 1Z5AA 1N32I 1FJGI 2WW4A 5IT9C 4YY3E 1ELOA 1HNWE 1QZRA 4FW9A 4AQYE 4LF5E 1IBLE 1NHIA 1PIEA 2HFSA 4JI4I 4DV0E 3F0NA 4Z7CA 4DR4E 3M6AA 4K0KE 3CWVA 4PRXA 4DV7I 1HNWI 1Z59A 1IBLI 4X62E 4UT4A 1Y4SA 1N33E 1HNZE 2XEXA 2UXBE 4JV5I 4HACA 4K0KI 1MX0A 2R42A 2BM1A 3J7AG 3WU4A 4X62I 1FKAE 4DV4E 1N36E 4IZJA 4JI2E 1N33I 4Z7YA 2UXBI 2VQFE 4JI8E 2DEIA 3ZM7A 1D6TA 1B63A 4URLA 2HHHE 3D4JA 2PNLA 1N36I 1Z0BA 3PYDA 4JI2I 1XMQE 1ZXMA 4PRVA 4DR7E 1KTVA 4JI8I 4LF6E 1ZM2A 4JI0I 2UUCE 2E5LE 1KKHA 2HHHI 4DU8A 1Z0GA 2HKJA 4DPXA 4UTGA 3H4LA 1U2RA 3OTOE 4DV6E 3V2UC 1XMQI 1UEKA 1H7SA 4LF6I 4LFAE 2UUAE 2UUCI 4IZKB 2E5LI 3QT5A 2UXDE 2UU9I 4M1KA 2X7IA 2LJPA 3QT6A 1KIJA 4EMDA 1XHKA 1Z0WA 4NXNE 3HJCA 1N34E 4DV6I 2BV3A 4JG4A 3K1JA 2J7KA 2R3VA 3PYEA 4B3RE 2UUAI 1RR9A 1B62A 2UXDI 4DV5E 1H73A 4WUBA 4ZVIA 4NXNI 4DV3E 4IZJB 1N34I 5IWAE 4LFCI 4JI4E 4I3HA 4B3RI 1N0VC 5BR8E 2ZM6I 4DV5I 5FLXC 2Z5CB 3V5RA 4DV7E 4DV3I 3Q6MA 5IWAI 2V34A 3B8HA 2Z5BA 5BR8I 2CZ9A 1HR0I 4FWGA 4USKA 4JV5E 1VISA 1PVGA 3ZZUA 3ZKDA 4LF7I 2VF3A 1Z5CA 1FNMA 3T1YE 1S16A 1ZM4A 1Z0VA 5LMUI 4DU7A 1NHHA 4B3TI 2A2CA 1DARA 3Q1QA 4JI7E 4FWDA 3T1YI 4B3SI 4DR1I 3PYFA 3T1HE 3GONA 4JI0E 4HXZA 3P06A 4JI7I 4DR5E 2CGEA 4B3MI 2EFGA 2HK3A 3J80C 5GMEA 3LPSA 1I94I 3T1HI 2UU9E 3K17A 2O1UA 5GMDA 1N0UA 1ZM3A 4GKJE 2Z5EA 4DR5I 4NXMI 4DPTA 4DV2E 4JI3E 2Z5BB 2GS8A 3WU5A 4DR2E 4GKKI 2V2VA 2HKEA 1Z5BA 2O1WA 1XNRE 1PKPA 2V2ZA 2Q2EB 2IOQA 3HULA 4HY1A 1NHJA 4GKJI 4JI5I 1ZXNA 1EI1A 4DV2I 4JI3I 1Z0EA 4DR2I 4LFCE 4JI6I 4HACB 2VQEI 1Z0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN E;  1XNR I;  2HK2 A;  2ZM6 E;  1MU5 A;  4USM A;  4R1F A;  4DUY E;  3LNU A;  2UXC I;  5LMN I;  5FLX Q;  1HR0 E;  2NPF A;  1NZ0 A;  1MG7 A;  4JYA E;  1H72 C;  4FN5 A;  1RRE A;  4LF7 E;  4LF8 I;  5L3J A;  4DPY A;  3LTO A;  4DUY I;  3WU3 A;  2ZIT A;  1WUU A;  4MYT A;  4LFB I;  5LMU E;  1HNX I;  4YHH E;  4DUZ E;  3WU6 A;  1XNQ E;  4HYM A;  4JYA I;  4KHP E;  4XTJ A;  4B3T E;  4LF4 I;  1J5E I;  1Z0C A;  1A6F A;  4B3S E;  4DR1 E;  4PU9 A;  4DPW A;  4YHH I;  4DUZ I;  1XNQ I;  4KHP I;  5LL6 R;  1EA6 A;  4YY3 I;  4WUC A;  4AQY I;  1IBM E;  4LF5 I;  4B3M E;  1BKN A;  1FWK A;  4DV0 I;  1I94 E;  4DR4 I;  2OI2 A;  3JAM Q;  4JI1 E;  4RPF A;  3QT7 A;  3JAM C;  3J80 Q;  1IBM I;  4NXM E;  2DEJ A;  1KVK A;  4DR6 E;  4GKK E;  4MYU A;  3B78 A;  2BM0 A;  2A2D A;  1HNZ I;  4ED4 A;  4FWH A;  4JI1 I;  4WUD A;  4KQV A;  4JI5 E;  5A2Q Q;  1ZM9 A;  4P52 A;  1XMO E;  4P7A A;  2F4V E;  4DR6 I;  4DV4 I;  5A2Q C;  4JI6 E;  3B82 A;  2VQE E;  2V2Q A;  2VQF I;  2HFU A;  2AJ4 A;  2E1R A;  2X36 A;  4DPU A;  4DV1 E;  1XMO I;  4OX9 E;  2F4V I;  1FI4 A;  2UXC E;  4DR7 I;  1K47 A;  2V8P A;  4DR3 E;  4X66 E;  4LF9 E;  4X64 E;  2UUB E;  1IBK E;  4DV1 I;  4LF8 E;  4OX9 I;  3ZZT A;  3J7A M;  4X65 E;  3ZZ0 A;  3OTO I;  1FWL A;  4DXL A;  4LFB E;  3QT8 A;  1HNX E;  4DR3 I;  4LFA I;  4X66 I;  1S4E A;  4LF9 I;  3PYG A;  2ZBK B;  4X64 I;  2UUB I;  1N32 E;  1IBK I;  1FJG E;  4LF4 E;  4X65 I;  1J5E E;  1OJ4 A;  3J81 Q;  3ZKB A;  3J81 C;  5IT9 Q;  1H7U A;  1H74 A;  1Z5A A;  1N32 I;  1FJG I;  2WW4 A;  5IT9 C;  4YY3 E;  1ELO A;  1HNW E;  1QZR A;  4FW9 A;  4AQY E;  4LF5 E;  1IBL E;  1NHI A;  1PIE A;  2HFS A;  4JI4 I;  4DV0 E;  3F0N A;  4Z7C A;  4DR4 E;  3M6A A;  4K0K E;  3CWV A;  4PRX A;  4DV7 I;  1HNW I;  1Z59 A;  1IBL I;  4X62 E;  4UT4 A;  1N33 E;  1HNZ E;  2XEX A;  2UXB E;  4JV5 I;  4HAC A;  4K0K I;  1MX0 A;  2R42 A;  2BM1 A;  3J7A G;  3WU4 A;  4X62 I;  1FKA E;  4DV4 E;  1N36 E;  4JI2 E;  1N33 I;  4Z7Y A;  2UXB I;  2VQF E;  4JI8 E;  2DEI A;  3ZM7 A;  1D6T A;  1B63 A;  4URL A;  2HHH E;  3D4J A;  1N36 I;  1Z0B A;  3PYD A;  4JI2 I;  1XMQ E;  1ZXM A;  4PRV A;  4DR7 E;  1KTV A;  4JI8 I;  4LF6 E;  1ZM2 A;  4JI0 I;  2UUC E;  2E5L E;  1KKH A;  2HHH I;  4DU8 A;  1Z0G A;  2HKJ A;  4DPX A;  4UTG A;  3H4L A;  1U2R A;  3OTO E;  4DV6 E;  3V2U C;  1XMQ I;  1UEK A;  1H7S A;  4LF6 I;  4LFA E;  2UUA E;  2UUC I;  2E5L I;  3QT5 A;  2UXD E;  2UU9 I;  4M1K A;  2X7I A;  2LJP A;  3QT6 A;  1KIJ A;  4EMD A;  1XHK A;  1Z0W A;  4NXN E;  1N34 E;  4DV6 I;  2BV3 A;  4JG4 A;  3K1J A;  2J7K A;  2R3V A;  3PYE A;  4B3R E;  2UUA I;  1RR9 A;  1B62 A;  2UXD I;  4DV5 E;  1H73 A;  4WUB A;  4ZVI A;  4NXN I;  4DV3 E;  1N34 I;  5IWA E;  4LFC I;  4JI4 E;  4I3H A;  4B3R I;  1N0V C;  5BR8 E;  2ZM6 I;  4DV5 I;  5FLX C;  3V5R A;  4DV7 E;  4DV3 I;  5IWA I;  2V34 A;  3B8H A;  5BR8 I;  2CZ9 A;  1HR0 I;  4FWG A;  4USK A;  4JV5 E;  1VIS A;  1PVG A;  3ZZU A;  3ZKD A;  4LF7 I;  2VF3 A;  1Z5C A;  1FNM A;  3T1Y E;  1S16 A;  1ZM4 A;  1Z0V A;  5LMU I;  4DU7 A;  1NHH A;  4B3T I;  2A2C A;  1DAR A;  3Q1Q A;  4JI7 E;  4FWD A;  3T1Y I;  4B3S I;  4DR1 I;  3PYF A;  3T1H E;  3GON A;  4JI0 E;  4HXZ A;  4JI7 I;  4DR5 E;  4B3M I;  2EFG A;  2HK3 A;  3J80 C;  5GME A;  3LPS A;  1I94 I;  3T1H I;  2UU9 E;  3K17 A;  5GMD A;  1N0U A;  1ZM3 A;  4GKJ E;  4DR5 I;  4NXM I;  4DPT A;  4DV2 E;  4JI3 E;  2GS8 A;  3WU5 A;  4DR2 E;  4GKK I;  2V2V A;  2HKE A;  1Z5B A;  1XNR E;  1PKP A;  2V2Z A;  2Q2E B;  3HUL A;  4HY1 A;  1NHJ A;  4GKJ I;  4JI5 I;  1ZXN A;  1EI1 A;  4DV2 I;  4JI3 I;  1Z0E A;  4DR2 I;  4LFC E;  4JI6 I;  4HAC B;  2VQE I;  1Z0T A; 
#chains in the Genus database with same CATH topology
 5LMN E;  1XNR I;  2HK2 A;  2ZM6 E;  1MU5 A;  5ELW A;  4USM A;  2F1D A;  4FW7 A;  2CG9 A;  4QNK A;  2IOP A;  4R1F A;  3M7N G;  3DD6 A;  4DUY E;  5JEA E;  3HKM A;  3LNU A;  2UXC I;  4OO1 C;  5LMN I;  5FLX Q;  5K36 B;  1HR0 E;  2PNM A;  2NPF A;  1NZ0 A;  1MG7 A;  2AE8 A;  4JYA E;  1H72 C;  4FN5 A;  4MU4 A;  1RRE A;  2JE6 A;  4BA1 A;  4LF7 E;  4LF8 I;  5L3J A;  2BA1 G;  3LTO A;  4DPY A;  1OYS A;  4DUY I;  3WU3 A;  2BA0 G;  2ZIT A;  1WUU A;  4MYT A;  4LFB I;  2O3Z A;  5LMU E;  1HNX I;  4YHH E;  4DUZ E;  5DNL A;  3WU6 A;  1XNQ E;  4HYM A;  4JYA I;  4KHP E;  4XTJ A;  5FWK A;  4B3T E;  3NZK A;  4LF4 I;  1J5E I;  1Z0C A;  1A6F A;  2JEB B;  4AIM A;  4B3S E;  4DR1 E;  4U3D A;  2JT2 A;  4PU9 A;  4DPW A;  2WP8 B;  4YHH I;  4DUZ I;  1XNQ I;  4KHP I;  5K36 E;  5LL6 R;  1EA6 A;  1P42 A;  4IZK A;  4YY3 I;  4WUC A;  4IFD D;  4AQY I;  1IBM E;  4LF5 I;  2NN6 C;  4B3M E;  1BKN A;  1FWK A;  2CVE A;  4DV0 I;  1Y4U A;  4OO1 A;  3GCM A;  1I94 E;  4BA2 A;  2GQ0 A;  4DR4 I;  5C0X D;  1VI7 A;  2OI2 A;  3JAM Q;  2C38 A;  1Y6Z A;  4ISA A;  4RPF A;  4JI1 E;  3QT7 A;  3JAM C;  3J80 Q;  1IBM I;  4NXM E;  2IER A;  5DRP A;  2DEJ A;  1KVK A;  4DR6 E;  4GKK E;  4MYU A;  3B78 A;  2BM0 A;  2A2D A;  1UDN A;  1HNZ I;  4ED4 A;  2O1T A;  2PO1 A;  4FWH A;  2JE6 B;  4JI1 I;  4WUD A;  4KQV A;  4AM3 A;  1YHC A;  4JI5 E;  2Z5C A;  5A2Q Q;  4OO1 F;  4GQU A;  1ZM9 A;  4P52 A;  2BR2 A;  4P7A A;  1XMO E;  4IS9 A;  3K85 A;  2F4V E;  4DR6 I;  4DV4 I;  5A2Q C;  4JI6 E;  3B82 A;  2VQE E;  2V2Q A;  2C39 A;  2VQF I;  2HFU A;  5EKW A;  1HK7 A;  5JEA D;  2O1V A;  2AJ4 A;  2E1R A;  4N3O A;  2X36 A;  4DPU A;  4DV1 E;  1XMO I;  4OX9 E;  2F4V I;  2NN6 A;  1FI4 A;  2UXC E;  4DR7 I;  5DRO A;  1K47 A;  4IFD A;  2V8P A;  2PO0 A;  4DR3 E;  4X66 E;  4LF9 E;  4U3B A;  4X64 E;  2UUB E;  1IBK E;  4DV1 I;  4LF8 E;  4OX9 I;  3ZZT A;  3J7A M;  4X65 E;  3ZZ0 A;  4OO1 B;  2J65 A;  3Q6N A;  3OTO I;  1FWL A;  4DXL A;  4LFB E;  3QT8 A;  1HNX E;  4DR3 I;  4LFA I;  4X66 I;  1USU A;  1S4E A;  4MU3 A;  4LF9 I;  3PYG A;  4IZJ D;  2ZBK B;  4X64 I;  2UUB I;  2NN6 F;  1N32 E;  1IBK I;  1FJG E;  4LF4 E;  4X65 I;  1J5E E;  2GO4 A;  1E3H A;  1OJ4 A;  4IFD F;  5K36 D;  3J81 Q;  1USV A;  3ZKB A;  2PO1 B;  3PRY A;  3J81 C;  2WNR A;  5IT9 Q;  1H7U A;  1H74 A;  1Z5A A;  1N32 I;  1FJG I;  2WW4 A;  5IT9 C;  2BR2 B;  1ELO A;  4YY3 E;  1R6M A;  1Y60 A;  1HNW E;  1QZR A;  4FW9 A;  4AQY E;  4LF5 E;  3P3E A;  1IBL E;  1NHI A;  4QNJ A;  5JEA A;  1PIE A;  2HFS A;  4JI4 I;  3CDI A;  4OKG A;  4DV0 E;  3F0N A;  4Z7C A;  1E3P A;  4DR4 E;  4OO1 E;  3M6A A;  4K0K E;  2IES A;  3CWV A;  4MU1 A;  4PRX A;  4DV7 I;  1HNW I;  1Z59 A;  2NN6 B;  4AID A;  1IBL I;  4X62 E;  2PO0 B;  4UT4 A;  4IFD C;  1Y4S A;  4LCG A;  5DNX A;  1N33 E;  1HNZ E;  2XEX A;  2UXB E;  4JV5 I;  4HAC A;  4K0K I;  1MX0 A;  5DRR A;  2R42 A;  5JEA F;  2BM1 A;  3J7A G;  3WU4 A;  5C0X C;  4X62 I;  1FKA E;  4LCH A;  4DV4 E;  1N36 E;  4IZJ A;  4JI2 E;  3U1Y A;  1N33 I;  4Z7Y A;  2UXB I;  2VQF E;  4JI8 E;  2DEI A;  2PNZ A;  3ZM7 A;  4BA1 B;  1D6T A;  4J3D A;  5K36 A;  3L7Z A;  1B63 A;  4URL A;  2HHH E;  3D4J A;  4NBQ A;  3M85 D;  4LCF A;  2PNL A;  1XXE A;  1N36 I;  1Z0B A;  3PYD A;  4JI2 I;  2NN6 E;  1XMQ E;  1ZXM A;  4PRV A;  4DR7 E;  1KTV A;  4JI8 I;  3H1C A;  4LF6 E;  1ZM2 A;  4JI0 I;  2UUC E;  2E5L E;  4MU0 A;  1KKH A;  2HHH I;  4DU8 A;  1Z0G A;  2HKJ A;  4DPX A;  5JEA B;  4UTG A;  3H4L A;  1UDQ A;  2BA0 D;  5JEA C;  2JEA A;  1U2R A;  3OTO E;  4DV6 E;  3V2U C;  1XMQ I;  1UEK A;  3GLL A;  1H7S A;  2JEB A;  4LF6 I;  4LFA E;  2UUA E;  2UUC I;  4IZK B;  2E5L I;  3QT5 A;  2UXD E;  2UU9 I;  3PS1 A;  4M1K A;  2WP8 A;  2X7I A;  2LJP A;  3GME A;  3QT6 A;  1KIJ A;  4EMD A;  1XHK A;  1Z0W A;  2C37 A;  4NXN E;  5C0X A;  3HJC A;  3PS2 A;  1N34 E;  4DV6 I;  4BA2 B;  2BV3 A;  4JG4 A;  3K1J A;  4FW4 A;  2C38 B;  2J7K A;  2R3V A;  3PYE A;  4B3R E;  2UUA I;  1RHY A;  1RR9 A;  1B62 A;  2UXD I;  1OYP A;  4DV5 E;  1UDS A;  5EL9 A;  1H73 A;  4WUB A;  4ZVI A;  4OO1 D;  4NXN I;  3CDJ A;  4DV3 E;  4IZJ B;  1N34 I;  5IWA E;  4LFC I;  4JI4 E;  2PNZ B;  4I3H A;  4FW6 A;  3M85 G;  3B4T A;  4B3R I;  4LPF A;  1N0V C;  4OZE A;  5BR8 E;  2ZM6 I;  3L7Z B;  5K36 C;  4DV5 I;  5C0X F;  5FLX C;  2Z5C B;  3V5R A;  4DV7 E;  4DV3 I;  3Q6M A;  5IWA I;  2GO3 A;  2PO2 A;  2C39 B;  2V34 A;  3B8H A;  1UDO A;  2Z5B A;  5BR8 I;  2CZ9 A;  1HR0 I;  4FWG A;  4USK A;  4JV5 E;  1VIS A;  1PVG A;  3ZZU A;  3ZKD A;  4LF7 I;  2JEA B;  2VF3 A;  1Z5C A;  1FNM A;  4IFD B;  3T1Y E;  1Y5Y A;  4FW3 A;  1S16 A;  1ZM4 A;  3UHM A;  1Z0V A;  5DRQ A;  5LMU I;  4DU7 A;  2NN6 D;  1OYR A;  1NHH A;  2C37 B;  4B3T I;  2A2C A;  5C0X B;  1DAR A;  3Q1Q A;  4JI7 E;  4FWD A;  3P76 A;  3T1Y I;  4B3S I;  4MDT A;  4DR1 I;  3PYF A;  3T1H E;  3GON A;  4JI0 E;  4HXZ A;  1YH8 A;  3M7N D;  3U1K A;  3P06 A;  4JI7 I;  4DR5 E;  2CGE A;  4FW5 A;  4B3M I;  2EFG A;  3P3C A;  2HK3 A;  3J80 C;  2WNR B;  5GME A;  3LPS A;  1I94 I;  3T1H I;  2VES A;  4IFD E;  2UU9 E;  4LOM A;  3K17 A;  2BA1 D;  2O1U A;  5GMD A;  1N0U A;  2PO2 B;  1ZM3 A;  4GKJ E;  2Z5E A;  4DR5 I;  4NXM I;  4DPT A;  4DV2 E;  4JI3 E;  2Z5B B;  3KRN A;  2GS8 A;  3WU5 A;  3PS3 A;  4DR2 E;  5C0X E;  4GKK I;  5K36 F;  2V2V A;  2HKE A;  1Z5B A;  2O1W A;  1XNR E;  1PKP A;  2V2Z A;  2Q2E B;  2IOQ A;  3HUL A;  4HY1 A;  1NHJ A;  4MQY A;  4GKJ I;  4JI5 I;  1ZXN A;  1EI1 A;  4DV2 I;  4JI3 I;  1Z0E A;  4DR2 I;  3P3G A;  4LFC E;  1R6L A;  4JI6 I;  4HAC B;  2VQE I;  1Z0T A; 
#chains in the Genus database with same CATH homology
 5LMN E;  1XNR I;  2HK2 A;  2ZM6 E;  1MU5 A;  4USM A;  2CG9 A;  2IOP A;  4R1F A;  4DUY E;  3LNU A;  2UXC I;  5LMN I;  5FLX Q;  1HR0 E;  2PNM A;  2NPF A;  1NZ0 A;  1MG7 A;  4JYA E;  1H72 C;  4FN5 A;  1RRE A;  4LF7 E;  4LF8 I;  5L3J A;  4DPY A;  3LTO A;  4DUY I;  3WU3 A;  2ZIT A;  1WUU A;  4MYT A;  4LFB I;  5LMU E;  1HNX I;  4YHH E;  4DUZ E;  3WU6 A;  1XNQ E;  4HYM A;  4JYA I;  4KHP E;  4XTJ A;  5FWK A;  4B3T E;  4LF4 I;  1J5E I;  1Z0C A;  1A6F A;  4B3S E;  4DR1 E;  4PU9 A;  4DPW A;  4YHH I;  4DUZ I;  1XNQ I;  4KHP I;  5LL6 R;  1EA6 A;  4IZK A;  4YY3 I;  4WUC A;  4AQY I;  1IBM E;  4LF5 I;  4B3M E;  1BKN A;  1FWK A;  4DV0 I;  1Y4U A;  1I94 E;  2GQ0 A;  4DR4 I;  2OI2 A;  3JAM Q;  1Y6Z A;  4JI1 E;  4RPF A;  3QT7 A;  3JAM C;  3J80 Q;  1IBM I;  4NXM E;  2DEJ A;  1KVK A;  4DR6 E;  4GKK E;  4MYU A;  3B78 A;  2BM0 A;  2A2D A;  1HNZ I;  4ED4 A;  2O1T A;  4FWH A;  4JI1 I;  4WUD A;  4KQV A;  4JI5 E;  2Z5C A;  5A2Q Q;  1ZM9 A;  4P52 A;  1XMO E;  4P7A A;  3K85 A;  2F4V E;  4DR6 I;  4DV4 I;  5A2Q C;  4JI6 E;  3B82 A;  2VQE E;  2V2Q A;  2VQF I;  2HFU A;  1HK7 A;  2O1V A;  2AJ4 A;  2E1R A;  4N3O A;  2X36 A;  4DPU A;  4DV1 E;  1XMO I;  4OX9 E;  2F4V I;  1FI4 A;  2UXC E;  4DR7 I;  1K47 A;  2V8P A;  4DR3 E;  4X66 E;  4LF9 E;  4X64 E;  2UUB E;  1IBK E;  4DV1 I;  4LF8 E;  4OX9 I;  3ZZT A;  3J7A M;  4X65 E;  3ZZ0 A;  3Q6N A;  3OTO I;  1FWL A;  4DXL A;  4LFB E;  3QT8 A;  1HNX E;  4DR3 I;  4LFA I;  4X66 I;  1USU A;  1S4E A;  4LF9 I;  3PYG A;  4IZJ D;  2ZBK B;  4X64 I;  2UUB I;  1N32 E;  1IBK I;  1FJG E;  4LF4 E;  4X65 I;  1J5E E;  1OJ4 A;  3J81 Q;  1USV A;  3ZKB A;  3PRY A;  3J81 C;  5IT9 Q;  1H7U A;  1H74 A;  1Z5A A;  1N32 I;  1FJG I;  2WW4 A;  5IT9 C;  4YY3 E;  1ELO A;  1HNW E;  1QZR A;  4FW9 A;  4AQY E;  4LF5 E;  1IBL E;  1NHI A;  1PIE A;  2HFS A;  4JI4 I;  4DV0 E;  3F0N A;  4Z7C A;  4DR4 E;  3M6A A;  4K0K E;  3CWV A;  4PRX A;  4DV7 I;  1HNW I;  1Z59 A;  1IBL I;  4X62 E;  4UT4 A;  1Y4S A;  1N33 E;  1HNZ E;  2XEX A;  2UXB E;  4JV5 I;  4HAC A;  4K0K I;  1MX0 A;  2R42 A;  2BM1 A;  3J7A G;  3WU4 A;  4X62 I;  1FKA E;  4DV4 E;  1N36 E;  4IZJ A;  4JI2 E;  1N33 I;  4Z7Y A;  2UXB I;  2VQF E;  4JI8 E;  2DEI A;  3ZM7 A;  1D6T A;  1B63 A;  4URL A;  2HHH E;  3D4J A;  2PNL A;  1N36 I;  1Z0B A;  3PYD A;  4JI2 I;  1XMQ E;  1ZXM A;  4PRV A;  4DR7 E;  1KTV A;  4JI8 I;  4LF6 E;  1ZM2 A;  4JI0 I;  2UUC E;  2E5L E;  1KKH A;  2HHH I;  4DU8 A;  1Z0G A;  2HKJ A;  4DPX A;  4UTG A;  3H4L A;  1U2R A;  3OTO E;  4DV6 E;  3V2U C;  1XMQ I;  1UEK A;  1H7S A;  4LF6 I;  4LFA E;  2UUA E;  2UUC I;  4IZK B;  2E5L I;  3QT5 A;  2UXD E;  2UU9 I;  4M1K A;  2X7I A;  2LJP A;  3QT6 A;  1KIJ A;  4EMD A;  1XHK A;  1Z0W A;  4NXN E;  3HJC A;  1N34 E;  4DV6 I;  2BV3 A;  4JG4 A;  3K1J A;  2J7K A;  2R3V A;  3PYE A;  4B3R E;  2UUA I;  1RR9 A;  1B62 A;  2UXD I;  4DV5 E;  1H73 A;  4WUB A;  4ZVI A;  4NXN I;  4DV3 E;  4IZJ B;  1N34 I;  5IWA E;  4LFC I;  4JI4 E;  4I3H A;  4B3R I;  1N0V C;  5BR8 E;  2ZM6 I;  4DV5 I;  5FLX C;  2Z5C B;  3V5R A;  4DV7 E;  4DV3 I;  3Q6M A;  5IWA I;  2V34 A;  3B8H A;  2Z5B A;  5BR8 I;  2CZ9 A;  1HR0 I;  4FWG A;  4USK A;  4JV5 E;  1VIS A;  1PVG A;  3ZZU A;  3ZKD A;  4LF7 I;  2VF3 A;  1Z5C A;  1FNM A;  3T1Y E;  1S16 A;  1ZM4 A;  1Z0V A;  5LMU I;  4DU7 A;  1NHH A;  4B3T I;  2A2C A;  1DAR A;  3Q1Q A;  4JI7 E;  4FWD A;  3T1Y I;  4B3S I;  4DR1 I;  3PYF A;  3T1H E;  3GON A;  4JI0 E;  4HXZ A;  3P06 A;  4JI7 I;  4DR5 E;  2CGE A;  4B3M I;  2EFG A;  2HK3 A;  3J80 C;  5GME A;  3LPS A;  1I94 I;  3T1H I;  2UU9 E;  3K17 A;  2O1U A;  5GMD A;  1N0U A;  1ZM3 A;  4GKJ E;  2Z5E A;  4DR5 I;  4NXM I;  4DPT A;  4DV2 E;  4JI3 E;  2Z5B B;  2GS8 A;  3WU5 A;  4DR2 E;  4GKK I;  2V2V A;  2HKE A;  1Z5B A;  2O1W A;  1XNR E;  1PKP A;  2V2Z A;  2Q2E B;  2IOQ A;  3HUL A;  4HY1 A;  1NHJ A;  4GKJ I;  4JI5 I;  1ZXN A;  1EI1 A;  4DV2 I;  4JI3 I;  1Z0E A;  4DR2 I;  4LFC E;  4JI6 I;  4HAC B;  2VQE I;  1Z0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...