2UXDI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxdI00
2X7IA 3JAMQ 5FLXC 5A2QQ 1H72C 5LMUI 2V2VA 1IBLI 4RPFA 1Z0EA 4DUZE 4HACB 4GKJE 2HK2A 1RREA 3B8HA 5L3JA 4JI3E 4JI2I 2UUCE 2ZM6E 1N33E 4K0KI 4LF4E 2Q2EB 1HNZE 2DEIA 2HK3A 4DR3E 4DR2E 1KVKA 2J7KA 1IBKI 4LF5I 1OJ4A 1D6TA 1Z5AA 3LTOA 4DU7A 4GKJI 4DV7I 4OX9E 4X64E 1KIJA 1XMQE 4DXLA 1B62A 2HKEA 3PYFA 4X66I 4JI8E 5A2QC 1KKHA 1ZM9A 4DR6I 1FJGI 2UUBI 4FW9A 1Z0CA 4DUYE 4FWGA 1HNWI 3B78A 2V2QA 1N0VC 3J81Q 4DV7E 1H73A 1DARA 2HKJA 4B3TE 3B82A 1NHIA 4GKKI 4JI8I 1Z0WA 2UXDE 2VF3A 1FWKA 4DR6E 4AQYE 4B3SI 1N36I 2HHHI 1HR0E 1ZXMA 4DV2E 4DV6E 4DR4E 1XHKA 3QT6A 4PRXA 1XNQI 1WUUA 4DR5I 3V5RA 1IBMI 1Z5BA 4KHPE 2V34A 2BM0A 4USKA 4Z7CA 4JI5I 4LF8E 3J80C 1XNRE 4DR7E 3K1JA 1FI4A 4LF7I 1N34E 1N32I 4MYTA 4DPYA 3ZM7A 3PYEA 4LF6E 4DR5E 1ELOA 2A2DA 4DU8A 1IBKE 3ZKBA 1I94E 4JI1I 4X64I 4FN5A 2EFGA 5LMNE 5IT9Q 5BR8I 2NPFA 4LF9E 2UU9I 1MG7A 2BV3A 2CZ9A 3J81C 2E5LE 4JI4E 4HY1A 1QZRA 2UUBE 2DEJA 4USMA 3V2UC 2HFSA 4DPTA 4X65I 3T1YI 1EA6A 3WU6A 5LMUE 1FNMA 3WU4A 2LJPA 1EI1A 4JV5E 5GMDA 3LNUA 4DUZI 3J7AG 4JI1E 3ZZUA 1A6FA 2VQEE 4LFAI 4XTJA 3JAMC 4LF9I 2UU9E 2UXDI 3LPSA 4DR1I 4JI3I 4JI2E 3M6AA 4DV3E 2UUCI 2ZM6I 1N33I 4JYAE 1N36E 2HHHE 5FLXQ 2F4VE 4JI7I 1ZM2A 1FJGE 4DR2I 4DV2I 1Z59A 4DV6I 3OTOE 1BKNA 4DV4I 3ZZTA 1XNQE 2R42A 3GONA 4DV5I 4KHPI 4LFAE 4DV1I 4DV0E 4Z7YA 4LF8I 2WW4A 1H74A 4JYAI 2F4VI 4B3RI 3ZKDA 4DUYI 4URLA 1UEKA 1B63A 4PRVA 2VQFE 1MX0A 2UXBE 4FWHA 1NHJA 3J7AM 1H7SA 4ED4A 1Z0BA 4YHHE 1HNXI 4KQVA 1HR0I 4DR7I 1NZ0A 2E5LI 4JI4I 4B3RE 4YY3I 4PU9A 1N0UA 3D4JA 1N32E 1H7UA 4NXMI 1XMOI 4LFCI 4JG4A 2R3VA 2BM1A 3HULA 2V2ZA 1IBME 5IWAE 3Q1QA 3J80Q 1IBLE 1K47A 2UXCI 2VQEI 1S16A 5GMEA 1KTVA 2HFUA 1U2RA 1XNRI 4EMDA 4X62E 3K17A 1HNXE 1VISA 4UT4A 4LFBI 4LF7E 1N34I 4K0KE 2XEXA 3QT5A 4I3HA 4LF6I 4NXME 4LFCE 3OTOI 4X65E 3T1YE 1I94I 1PIEA 2E1RA 5LMNI 4DV1E 4DV0I 4JI6E 4WUCA 1XMQI 4WUDA 4DR1E 4LF4I 1FWLA 4DV3I 2X36A 1MU5A 4DR3I 4FWDA 4DPUA 1ZM4A 4HACA 4UTGA 1Z0GA 3QT7A 4JI0I 4R1FA 4JV5I 4M1KA 1Z5CA 1FKAE 4B3MI 2V8PA 2UXBI 4P7AA 1Z0TA 1NHHA 3CWVA 2ZITA 4DPWA 4JI7E 3F0NA 1J5EI 4YY3E 1HNZI 3H4LA 4DV4E 4JI0E 4LF5E 4DV5E 4P52A 5IWAI 4OX9I 2GS8A 2VQFI 4B3ME 1Z0VA 2AJ4A 1PVGA 4X66E 3T1HI 4NXNE 2UUAE 3WU5A 4AQYI 4X62I 4ZVIA 2ZBKB 5LL6R 4DPXA 5IT9C 1J5EE 4HYMA 4MYUA 3ZZ0A 1ZXNA 4DR4I 3PYGA 1RR9A 1HNWE 1XMOE 2OI2A 4WUBA 4B3TI 2A2CA 4JI5E 2UXCE 4NXNI 3T1HE 4GKKE 2UUAI 4JI6I 1ZM3A 5BR8E 4YHHI 4HXZA 4B3SE 3PYDA 1PKPA 4LFBE 3WU3A 3QT8A 1S4EA
chains in the Genus database with same CATH superfamily
2X7IA 2BA1G 4OKGA 3JAMQ 5FLXC 5A2QQ 1H72C 5LMUI 2V2VA 2AE8A 1IBLI 4RPFA 1Z0EA 2F1DA 4DUZE 4HACB 4GKJE 2HK2A 1RREA 4MU3A 1P42A 2PNLA 2IOQA 1YHCA 2NN6B 5DRRA 3B8HA 5L3JA 5C0XF 4JI3E 4JI2I 4QNJA 2UUCE 2ZM6E 1N33E 4K0KI 4LF4E 2Q2EB 1HNZE 2DEIA 2HK3A 2PO2A 4DR3E 4DR2E 1KVKA 2J7KA 1IBKI 4LF5I 1OJ4A 1D6TA 1Z5AA 5K36A 3LTOA 4GQUA 5K36C 4DU7A 4GKJI 4DV7I 4OX9E 4X64E 4LCFA 4OO1E 1KIJA 2PO1B 1XMQE 4DXLA 1B62A 2HKEA 3PYFA 4X66I 4JI8E 5A2QC 1UDNA 1KKHA 4MQYA 1ZM9A 4DR6I 4OO1F 3L7ZB 3PS2A 1FJGI 2UUBI 4FW9A 1Z0CA 4DUYE 3P06A 2O1WA 4OO1C 2BA0D 4FWGA 1HNWI 3B78A 1RHYA 3HJCA 2V2QA 1N0VC 3J81Q 4DV7E 1H73A 5DNLA 1DARA 2HKJA 4B3TE 4LOMA 3B82A 4AM3A 1NHIA 4GKKI 4JI8I 1Z0WA 5JEAB 2UXDE 1OYRA 1USUA 2VF3A 1FWKA 2Z5CB 4DR6E 2WP8A 4AQYE 4B3SI 1N36I 2HHHI 1HR0E 4BA1B 1ZXMA 2BA1D 4DV2E 4DV6E 4DR4E 1XHKA 2IERA 3B4TA 3QT6A 4PRXA 1R6MA 1XNQI 1WUUA 4DR5I 4IFDE 3V5RA 4U3DA 1IBMI 1Z5BA 1UDQA 2IOPA 3PRYA 2V34A 4KHPE 2BM0A 4USKA 4Z7CA 4JI5I 4LF8E 2PO2B 4LCGA 3J80C 1XNRE 4DR7E 2C37A 3K1JA 1FI4A 4NBQA 4LF7I 2NN6E 1N34E 1N32I 4MYTA 4DPYA 3ZM7A 3M85D 4FW3A 4LCHA 3PYEA 4LF6E 2WNRA 4DR5E 1ELOA 2A2DA 4DU8A 1IBKE 4MDTA 5DRPA 2GQ0A 3ZKBA 2C39A 5JEAF 1I94E 4JI1I 4X64I 5K36F 4FN5A 2EFGA 5LMNE 5IT9Q 5BR8I 2NPFA 4LF9E 2UU9I 1MG7A 3GCMA 2BV3A 2CZ9A 3J81C 2E5LE 3PS3A 4JI4E 1Y4UA 2O1VA 4HY1A 1QZRA 1UDOA 2UUBE 1Y60A 2DEJA 4USMA 3V2UC 2HFSA 4DPTA 3H1CA 3P3GA 4X65I 2CGEA 3T1YI 1EA6A 3WU6A 5LMUE 1FNMA 3WU4A 5JEAE 2O3ZA 2LJPA 1EI1A 4JV5E 5GMDA 2J65A 3LNUA 4DUZI 4MU0A 3J7AG 4JI1E 3KRNA 2NN6F 3ZZUA 1A6FA 2VQEE 4LFAI 3NZKA 4XTJA 3JAMC 4LF9I 2UU9E 3M85G 1R6LA 2UXDI 3LPSA 4DR1I 4JI3I 4JI2E 3M6AA 4DV3E 2UUCI 4FW4A 2ZM6I 1N33I 4JYAE 1N36E 2HHHE 5FLXQ 2F4VE 4IFDC 4JI7I 1ZM2A 1FJGE 2Z5BA 4DR2I 3M7NG 4DV2I 1Z59A 4DV6I 3OTOE 1BKNA 3P76A 4DV4I 4MU4A 3ZZTA 1XNQE 2R42A 3Q6NA 3GONA 4AIMA 3U1YA 4DV5I 2BR2B 2JEAB 2WNRB 4KHPI 4LFAE 4DV1I 4DV0E 4Z7YA 4FW7A 4LF8I 2WW4A 2JT2A 1H74A 4JYAI 2PO0B 2F4VI 4B3RI 3ZKDA 2Z5EA 4J3DA 4DUYI 4URLA 4OO1A 1UEKA 1B63A 5DRQA 4PRVA 4MU1A 3HKMA 2VESA 4AIDA 2VQFE 4FW6A 1MX0A 2BA0G 2UXBE 4FWHA 1VI7A 2PNZB 4IZJB 1NHJA 3J7AM 4BA2B 1Y5YA 1H7SA 2Z5BB 4ED4A 1Z0BA 4YHHE 4U3BA 1HNXI 4KQVA 1HR0I 4DR7I 2Z5CA 1YH8A 1NZ0A 2C38A 2E5LI 4JI4I 4B3RE 4YY3I 4PU9A 1N0UA 3D4JA 1N32E 1HK7A 1H7UA 5JEAD 4IZKA 5C0XA 5C0XC 1XMOI 4LFCI 4NXMI 4JG4A 2R3VA 2BM1A 3HULA 2V2ZA 3P3CA 4QNKA 1IBME 5EL9A 5IWAE 3Q1QA 3J80Q 1IBLE 1K47A 2UXCI 1OYPA 4IFDA 2VQEI 1S16A 5GMEA 2NN6C 4IFDD 1KTVA 2HFUA 2JE6B 3CDIA 1U2RA 2CVEA 3DD6A 1XNRI 4EMDA 3L7ZA 4X62E 3K17A 1HNXE 1VISA 4UT4A 5C0XE 4LFBI 3GMEA 2JEBA 4LF7E 1N34I 3Q6MA 4K0KE 2XEXA 3GLLA 3QT5A 4I3HA 4LF6I 4NXME 4LFCE 3OTOI 4IZJD 2NN6D 4X65E 3T1YE 5ELWA 5DNXA 5K36B 1I94I 2CG9A 1PIEA 1Y6ZA 2C39B 4BA2A 2E1RA 5LMNI 4IZJA 1Y4SA 2PNZA 5FWKA 4DV1E 4DV0I 4JI6E 1E3HA 4WUCA 1XMQI 4WUDA 3U1KA 3PS1A 4OZEA 4DR1E 4LF4I 1FWLA 4DV3I 2X36A 1MU5A 2IESA 2C37B 4DR3I 3K85A 4OO1B 3CDJA 4FWDA 4DPUA 1E3PA 1ZM4A 4HACA 4UTGA 1Z0GA 3QT7A 4JI0I 4R1FA 4JV5I 4FW5A 5DROA 1USVA 2O1UA 4M1KA 1Z5CA 5C0XD 5JEAA 5JEAC 1FKAE 4B3MI 2V8PA 2UXBI 4ISAA 4P7AA 1Z0TA 5K36E 1NHHA 2JEBB 3CWVA 2ZITA 4BA1A 5K36D 4DPWA 4JI7E 3F0NA 2GO4A 2WP8B 4LPFA 1J5EI 4YY3E 2JE6A 3H4LA 1HNZI 4IFDB 4DV4E 4JI0E 4LF5E 2O1TA 4DV5E 4P52A 2BR2A 1UDSA 2JEAA 4IFDF 5IWAI 4OX9I 2GS8A 2GO3A 2VQFI 4IZKB 4B3ME 1Z0VA 2AJ4A 2PO1A 1PVGA 4X66E 3T1HI 1OYSA 4NXNE 2UUAE 4OO1D 3WU5A 4AQYI 2C38B 2PNMA 4X62I 4ZVIA 3P3EA 2ZBKB 5LL6R 4DPXA 5IT9C 1J5EE 4HYMA 4MYUA 3ZZ0A 1ZXNA 4DR4I 3PYGA 5C0XB 3M7ND 1RR9A 1HNWE 1XMOE 2OI2A 4WUBA 4B3TI 2NN6A 2A2CA 4N3OA 4JI5E 3UHMA 2UXCE 4NXNI 3T1HE 4GKKE 2UUAI 4JI6I 5EKWA 4IS9A 1ZM3A 5BR8E 4YHHI 2PO0A 4HXZA 4B3SE 3PYDA 1PKPA 4LFBE 3WU3A 3QT8A 1XXEA 1S4EA
chains in the Genus database with same CATH topology
2X7IA 3JAMQ 5FLXC 5A2QQ 1H72C 5LMUI 2V2VA 1IBLI 4RPFA 1Z0EA 4DUZE 4HACB 4GKJE 2HK2A 1RREA 2PNLA 2IOQA 3B8HA 5L3JA 4JI3E 4JI2I 2UUCE 2ZM6E 1N33E 4K0KI 4LF4E 2Q2EB 1HNZE 2DEIA 2HK3A 4DR3E 4DR2E 1KVKA 2J7KA 1IBKI 4LF5I 1OJ4A 1D6TA 1Z5AA 3LTOA 4DU7A 4GKJI 4DV7I 4OX9E 4X64E 1KIJA 1XMQE 4DXLA 1B62A 2HKEA 3PYFA 4X66I 4JI8E 5A2QC 1KKHA 1ZM9A 4DR6I 1FJGI 2UUBI 4FW9A 1Z0CA 4DUYE 3P06A 2O1WA 4FWGA 1HNWI 3B78A 3HJCA 2V2QA 1N0VC 3J81Q 4DV7E 1H73A 1DARA 2HKJA 4B3TE 3B82A 1NHIA 4GKKI 4JI8I 1Z0WA 2UXDE 1USUA 2VF3A 1FWKA 2Z5CB 4DR6E 4AQYE 4B3SI 1N36I 2HHHI 1HR0E 1ZXMA 4DV2E 4DV6E 4DR4E 1XHKA 3QT6A 4PRXA 1XNQI 1WUUA 4DR5I 3V5RA 1IBMI 1Z5BA 3PRYA 2IOPA 4KHPE 2V34A 2BM0A 4USKA 4Z7CA 4JI5I 4LF8E 3J80C 1XNRE 4DR7E 3K1JA 1FI4A 4LF7I 1N34E 1N32I 4MYTA 4DPYA 3ZM7A 3PYEA 4LF6E 4DR5E 1ELOA 2A2DA 4DU8A 1IBKE 3ZKBA 2GQ0A 1I94E 4JI1I 4X64I 4FN5A 2EFGA 5LMNE 5IT9Q 5BR8I 2NPFA 4LF9E 2UU9I 1MG7A 2BV3A 2CZ9A 3J81C 2E5LE 4JI4E 1Y4UA 2O1VA 4HY1A 1QZRA 2UUBE 2DEJA 4USMA 3V2UC 2HFSA 4DPTA 4X65I 2CGEA 3T1YI 1EA6A 3WU6A 5LMUE 1FNMA 3WU4A 2LJPA 1EI1A 4JV5E 5GMDA 3LNUA 4DUZI 3J7AG 4JI1E 3ZZUA 1A6FA 2VQEE 4LFAI 4XTJA 3JAMC 4LF9I 2UU9E 2UXDI 3LPSA 4DR1I 4JI3I 4JI2E 3M6AA 4DV3E 2UUCI 2ZM6I 1N33I 4JYAE 1N36E 2HHHE 5FLXQ 2F4VE 4JI7I 1ZM2A 1FJGE 2Z5BA 4DR2I 4DV2I 1Z59A 4DV6I 3OTOE 1BKNA 4DV4I 3ZZTA 1XNQE 2R42A 3Q6NA 3GONA 4DV5I 4KHPI 4LFAE 4DV1I 4DV0E 4Z7YA 4LF8I 2WW4A 1H74A 4JYAI 2F4VI 4B3RI 3ZKDA 2Z5EA 4DUYI 4URLA 1UEKA 1B63A 4PRVA 2VQFE 1MX0A 2UXBE 4FWHA 4IZJB 1NHJA 3J7AM 1H7SA 2Z5BB 4ED4A 1Z0BA 4YHHE 1HNXI 4KQVA 1HR0I 4DR7I 2Z5CA 1NZ0A 2E5LI 4JI4I 4B3RE 4YY3I 4PU9A 1N0UA 3D4JA 1N32E 1HK7A 1H7UA 4IZKA 4NXMI 1XMOI 4LFCI 4JG4A 2R3VA 2BM1A 3HULA 2V2ZA 1IBME 5IWAE 3Q1QA 3J80Q 1IBLE 1K47A 2UXCI 2VQEI 1S16A 5GMEA 1KTVA 2HFUA 1U2RA 1XNRI 4EMDA 4X62E 3K17A 1HNXE 1VISA 4UT4A 4LFBI 4LF7E 1N34I 3Q6MA 4K0KE 2XEXA 3QT5A 4I3HA 4LF6I 4NXME 4LFCE 3OTOI 4IZJD 4X65E 3T1YE 1I94I 2CG9A 1PIEA 1Y6ZA 2E1RA 5LMNI 4IZJA 1Y4SA 5FWKA 4DV1E 4DV0I 4JI6E 4WUCA 1XMQI 4WUDA 4DR1E 4LF4I 1FWLA 4DV3I 2X36A 1MU5A 4DR3I 3K85A 4FWDA 4DPUA 1ZM4A 4HACA 4UTGA 1Z0GA 3QT7A 4JI0I 4R1FA 4JV5I 1USVA 2O1UA 4M1KA 1Z5CA 1FKAE 4B3MI 2V8PA 2UXBI 4P7AA 1Z0TA 1NHHA 3CWVA 2ZITA 4DPWA 4JI7E 3F0NA 1J5EI 4YY3E 1HNZI 3H4LA 4DV4E 4JI0E 4LF5E 2O1TA 4DV5E 4P52A 5IWAI 4OX9I 2GS8A 2VQFI 4IZKB 4B3ME 1Z0VA 2AJ4A 1PVGA 4X66E 3T1HI 4NXNE 2UUAE 3WU5A 4AQYI 2PNMA 4X62I 4ZVIA 2ZBKB 5LL6R 4DPXA 5IT9C 1J5EE 4HYMA 4MYUA 3ZZ0A 1ZXNA 4DR4I 3PYGA 1RR9A 1HNWE 1XMOE 2OI2A 4WUBA 4B3TI 4N3OA 2A2CA 4JI5E 2UXCE 4NXNI 3T1HE 4GKKE 2UUAI 4JI6I 1ZM3A 5BR8E 4YHHI 4HXZA 4B3SE 3PYDA 1PKPA 4LFBE 3WU3A 3QT8A 1S4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7I A;  3JAM Q;  5FLX C;  5A2Q Q;  1H72 C;  5LMU I;  2V2V A;  1IBL I;  4RPF A;  1Z0E A;  4DUZ E;  4HAC B;  4GKJ E;  2HK2 A;  1RRE A;  3B8H A;  5L3J A;  4JI3 E;  4JI2 I;  2UUC E;  2ZM6 E;  1N33 E;  4K0K I;  4LF4 E;  2Q2E B;  1HNZ E;  2DEI A;  2HK3 A;  4DR3 E;  4DR2 E;  1KVK A;  2J7K A;  1IBK I;  4LF5 I;  1OJ4 A;  1D6T A;  1Z5A A;  3LTO A;  4DU7 A;  4GKJ I;  4DV7 I;  4OX9 E;  4X64 E;  1KIJ A;  1XMQ E;  4DXL A;  1B62 A;  2HKE A;  3PYF A;  4X66 I;  4JI8 E;  5A2Q C;  1KKH A;  1ZM9 A;  4DR6 I;  1FJG I;  2UUB I;  4FW9 A;  1Z0C A;  4DUY E;  4FWG A;  1HNW I;  3B78 A;  2V2Q A;  1N0V C;  3J81 Q;  4DV7 E;  1H73 A;  1DAR A;  2HKJ A;  4B3T E;  3B82 A;  1NHI A;  4GKK I;  4JI8 I;  1Z0W A;  2UXD E;  2VF3 A;  1FWK A;  4DR6 E;  4AQY E;  4B3S I;  1N36 I;  2HHH I;  1HR0 E;  1ZXM A;  4DV2 E;  4DV6 E;  4DR4 E;  1XHK A;  3QT6 A;  4PRX A;  1XNQ I;  1WUU A;  4DR5 I;  3V5R A;  1IBM I;  1Z5B A;  4KHP E;  2V34 A;  2BM0 A;  4USK A;  4Z7C A;  4JI5 I;  4LF8 E;  3J80 C;  1XNR E;  4DR7 E;  3K1J A;  1FI4 A;  4LF7 I;  1N34 E;  1N32 I;  4MYT A;  4DPY A;  3ZM7 A;  3PYE A;  4LF6 E;  4DR5 E;  1ELO A;  2A2D A;  4DU8 A;  1IBK E;  3ZKB A;  1I94 E;  4JI1 I;  4X64 I;  4FN5 A;  2EFG A;  5LMN E;  5IT9 Q;  5BR8 I;  2NPF A;  4LF9 E;  2UU9 I;  1MG7 A;  2BV3 A;  2CZ9 A;  3J81 C;  2E5L E;  4JI4 E;  4HY1 A;  1QZR A;  2UUB E;  2DEJ A;  4USM A;  3V2U C;  2HFS A;  4DPT A;  4X65 I;  3T1Y I;  1EA6 A;  3WU6 A;  5LMU E;  1FNM A;  3WU4 A;  2LJP A;  1EI1 A;  4JV5 E;  5GMD A;  3LNU A;  4DUZ I;  3J7A G;  4JI1 E;  3ZZU A;  1A6F A;  2VQE E;  4LFA I;  4XTJ A;  3JAM C;  4LF9 I;  2UU9 E;  2UXD I;  3LPS A;  4DR1 I;  4JI3 I;  4JI2 E;  3M6A A;  4DV3 E;  2UUC I;  2ZM6 I;  1N33 I;  4JYA E;  1N36 E;  2HHH E;  5FLX Q;  2F4V E;  4JI7 I;  1ZM2 A;  1FJG E;  4DR2 I;  4DV2 I;  1Z59 A;  4DV6 I;  3OTO E;  1BKN A;  4DV4 I;  3ZZT A;  1XNQ E;  2R42 A;  3GON A;  4DV5 I;  4KHP I;  4LFA E;  4DV1 I;  4DV0 E;  4Z7Y A;  4LF8 I;  2WW4 A;  1H74 A;  4JYA I;  2F4V I;  4B3R I;  3ZKD A;  4DUY I;  4URL A;  1UEK A;  1B63 A;  4PRV A;  2VQF E;  1MX0 A;  2UXB E;  4FWH A;  1NHJ A;  3J7A M;  1H7S A;  4ED4 A;  1Z0B A;  4YHH E;  1HNX I;  4KQV A;  1HR0 I;  4DR7 I;  1NZ0 A;  2E5L I;  4JI4 I;  4B3R E;  4YY3 I;  4PU9 A;  1N0U A;  3D4J A;  1N32 E;  1H7U A;  4NXM I;  1XMO I;  4LFC I;  4JG4 A;  2R3V A;  2BM1 A;  3HUL A;  2V2Z A;  1IBM E;  5IWA E;  3Q1Q A;  3J80 Q;  1IBL E;  1K47 A;  2UXC I;  2VQE I;  1S16 A;  5GME A;  1KTV A;  2HFU A;  1U2R A;  1XNR I;  4EMD A;  4X62 E;  3K17 A;  1HNX E;  1VIS A;  4UT4 A;  4LFB I;  4LF7 E;  1N34 I;  4K0K E;  2XEX A;  3QT5 A;  4I3H A;  4LF6 I;  4NXM E;  4LFC E;  3OTO I;  4X65 E;  3T1Y E;  1I94 I;  1PIE A;  2E1R A;  5LMN I;  4DV1 E;  4DV0 I;  4JI6 E;  4WUC A;  1XMQ I;  4WUD A;  4DR1 E;  4LF4 I;  1FWL A;  4DV3 I;  2X36 A;  1MU5 A;  4DR3 I;  4FWD A;  4DPU A;  1ZM4 A;  4HAC A;  4UTG A;  1Z0G A;  3QT7 A;  4JI0 I;  4R1F A;  4JV5 I;  4M1K A;  1Z5C A;  1FKA E;  4B3M I;  2V8P A;  2UXB I;  4P7A A;  1Z0T A;  1NHH A;  3CWV A;  2ZIT A;  4DPW A;  4JI7 E;  3F0N A;  1J5E I;  4YY3 E;  1HNZ I;  3H4L A;  4DV4 E;  4JI0 E;  4LF5 E;  4DV5 E;  4P52 A;  5IWA I;  4OX9 I;  2GS8 A;  2VQF I;  4B3M E;  1Z0V A;  2AJ4 A;  1PVG A;  4X66 E;  3T1H I;  4NXN E;  2UUA E;  3WU5 A;  4AQY I;  4X62 I;  4ZVI A;  2ZBK B;  5LL6 R;  4DPX A;  5IT9 C;  1J5E E;  4HYM A;  4MYU A;  3ZZ0 A;  1ZXN A;  4DR4 I;  3PYG A;  1RR9 A;  1HNW E;  1XMO E;  2OI2 A;  4WUB A;  4B3T I;  2A2C A;  4JI5 E;  2UXC E;  4NXN I;  3T1H E;  4GKK E;  2UUA I;  4JI6 I;  1ZM3 A;  5BR8 E;  4YHH I;  4HXZ A;  4B3S E;  3PYD A;  1PKP A;  4LFB E;  3WU3 A;  3QT8 A;  1S4E A; 
#chains in the Genus database with same CATH topology
 2X7I A;  2BA1 G;  4OKG A;  3JAM Q;  5FLX C;  5A2Q Q;  1H72 C;  5LMU I;  2V2V A;  2AE8 A;  1IBL I;  4RPF A;  1Z0E A;  2F1D A;  4DUZ E;  4HAC B;  4GKJ E;  2HK2 A;  1RRE A;  4MU3 A;  1P42 A;  2PNL A;  2IOQ A;  1YHC A;  2NN6 B;  5DRR A;  3B8H A;  5L3J A;  5C0X F;  4JI3 E;  4JI2 I;  4QNJ A;  2UUC E;  2ZM6 E;  1N33 E;  4K0K I;  4LF4 E;  2Q2E B;  1HNZ E;  2DEI A;  2HK3 A;  2PO2 A;  4DR3 E;  4DR2 E;  1KVK A;  2J7K A;  1IBK I;  4LF5 I;  1OJ4 A;  1D6T A;  1Z5A A;  5K36 A;  3LTO A;  4GQU A;  5K36 C;  4DU7 A;  4GKJ I;  4DV7 I;  4OX9 E;  4X64 E;  4LCF A;  4OO1 E;  1KIJ A;  2PO1 B;  1XMQ E;  4DXL A;  1B62 A;  2HKE A;  3PYF A;  4X66 I;  4JI8 E;  5A2Q C;  1UDN A;  1KKH A;  4MQY A;  1ZM9 A;  4DR6 I;  4OO1 F;  3L7Z B;  3PS2 A;  1FJG I;  2UUB I;  4FW9 A;  1Z0C A;  4DUY E;  3P06 A;  2O1W A;  4OO1 C;  2BA0 D;  4FWG A;  1HNW I;  3B78 A;  1RHY A;  3HJC A;  2V2Q A;  1N0V C;  3J81 Q;  4DV7 E;  1H73 A;  5DNL A;  1DAR A;  2HKJ A;  4B3T E;  4LOM A;  3B82 A;  4AM3 A;  1NHI A;  4GKK I;  4JI8 I;  1Z0W A;  5JEA B;  2UXD E;  1OYR A;  1USU A;  2VF3 A;  1FWK A;  2Z5C B;  4DR6 E;  2WP8 A;  4AQY E;  4B3S I;  1N36 I;  2HHH I;  1HR0 E;  4BA1 B;  1ZXM A;  2BA1 D;  4DV2 E;  4DV6 E;  4DR4 E;  1XHK A;  2IER A;  3B4T A;  3QT6 A;  4PRX A;  1R6M A;  1XNQ I;  1WUU A;  4DR5 I;  4IFD E;  3V5R A;  4U3D A;  1IBM I;  1Z5B A;  1UDQ A;  2IOP A;  3PRY A;  2V34 A;  4KHP E;  2BM0 A;  4USK A;  4Z7C A;  4JI5 I;  4LF8 E;  2PO2 B;  4LCG A;  3J80 C;  1XNR E;  4DR7 E;  2C37 A;  3K1J A;  1FI4 A;  4NBQ A;  4LF7 I;  2NN6 E;  1N34 E;  1N32 I;  4MYT A;  4DPY A;  3ZM7 A;  3M85 D;  4FW3 A;  4LCH A;  3PYE A;  4LF6 E;  2WNR A;  4DR5 E;  1ELO A;  2A2D A;  4DU8 A;  1IBK E;  4MDT A;  5DRP A;  2GQ0 A;  3ZKB A;  2C39 A;  5JEA F;  1I94 E;  4JI1 I;  4X64 I;  5K36 F;  4FN5 A;  2EFG A;  5LMN E;  5IT9 Q;  5BR8 I;  2NPF A;  4LF9 E;  2UU9 I;  1MG7 A;  3GCM A;  2BV3 A;  2CZ9 A;  3J81 C;  2E5L E;  3PS3 A;  4JI4 E;  1Y4U A;  2O1V A;  4HY1 A;  1QZR A;  1UDO A;  2UUB E;  1Y60 A;  2DEJ A;  4USM A;  3V2U C;  2HFS A;  4DPT A;  3H1C A;  3P3G A;  4X65 I;  2CGE A;  3T1Y I;  1EA6 A;  3WU6 A;  5LMU E;  1FNM A;  3WU4 A;  5JEA E;  2O3Z A;  2LJP A;  1EI1 A;  4JV5 E;  5GMD A;  2J65 A;  3LNU A;  4DUZ I;  4MU0 A;  3J7A G;  4JI1 E;  3KRN A;  2NN6 F;  3ZZU A;  1A6F A;  2VQE E;  4LFA I;  3NZK A;  4XTJ A;  3JAM C;  4LF9 I;  2UU9 E;  3M85 G;  1R6L A;  2UXD I;  3LPS A;  4DR1 I;  4JI3 I;  4JI2 E;  3M6A A;  4DV3 E;  2UUC I;  4FW4 A;  2ZM6 I;  1N33 I;  4JYA E;  1N36 E;  2HHH E;  5FLX Q;  2F4V E;  4IFD C;  4JI7 I;  1ZM2 A;  1FJG E;  2Z5B A;  4DR2 I;  3M7N G;  4DV2 I;  1Z59 A;  4DV6 I;  3OTO E;  1BKN A;  3P76 A;  4DV4 I;  4MU4 A;  3ZZT A;  1XNQ E;  2R42 A;  3Q6N A;  3GON A;  4AIM A;  3U1Y A;  4DV5 I;  2BR2 B;  2JEA B;  2WNR B;  4KHP I;  4LFA E;  4DV1 I;  4DV0 E;  4Z7Y A;  4FW7 A;  4LF8 I;  2WW4 A;  2JT2 A;  1H74 A;  4JYA I;  2PO0 B;  2F4V I;  4B3R I;  3ZKD A;  2Z5E A;  4J3D A;  4DUY I;  4URL A;  4OO1 A;  1UEK A;  1B63 A;  5DRQ A;  4PRV A;  4MU1 A;  3HKM A;  2VES A;  4AID A;  2VQF E;  4FW6 A;  1MX0 A;  2BA0 G;  2UXB E;  4FWH A;  1VI7 A;  2PNZ B;  4IZJ B;  1NHJ A;  3J7A M;  4BA2 B;  1Y5Y A;  1H7S A;  2Z5B B;  4ED4 A;  1Z0B A;  4YHH E;  4U3B A;  1HNX I;  4KQV A;  1HR0 I;  4DR7 I;  2Z5C A;  1YH8 A;  1NZ0 A;  2C38 A;  2E5L I;  4JI4 I;  4B3R E;  4YY3 I;  4PU9 A;  1N0U A;  3D4J A;  1N32 E;  1HK7 A;  1H7U A;  5JEA D;  4IZK A;  5C0X A;  5C0X C;  1XMO I;  4LFC I;  4NXM I;  4JG4 A;  2R3V A;  2BM1 A;  3HUL A;  2V2Z A;  3P3C A;  4QNK A;  1IBM E;  5EL9 A;  5IWA E;  3Q1Q A;  3J80 Q;  1IBL E;  1K47 A;  2UXC I;  1OYP A;  4IFD A;  2VQE I;  1S16 A;  5GME A;  2NN6 C;  4IFD D;  1KTV A;  2HFU A;  2JE6 B;  3CDI A;  1U2R A;  2CVE A;  3DD6 A;  1XNR I;  4EMD A;  3L7Z A;  4X62 E;  3K17 A;  1HNX E;  1VIS A;  4UT4 A;  5C0X E;  4LFB I;  3GME A;  2JEB A;  4LF7 E;  1N34 I;  3Q6M A;  4K0K E;  2XEX A;  3GLL A;  3QT5 A;  4I3H A;  4LF6 I;  4NXM E;  4LFC E;  3OTO I;  4IZJ D;  2NN6 D;  4X65 E;  3T1Y E;  5ELW A;  5DNX A;  5K36 B;  1I94 I;  2CG9 A;  1PIE A;  1Y6Z A;  2C39 B;  4BA2 A;  2E1R A;  5LMN I;  4IZJ A;  1Y4S A;  2PNZ A;  5FWK A;  4DV1 E;  4DV0 I;  4JI6 E;  1E3H A;  4WUC A;  1XMQ I;  4WUD A;  3U1K A;  3PS1 A;  4OZE A;  4DR1 E;  4LF4 I;  1FWL A;  4DV3 I;  2X36 A;  1MU5 A;  2IES A;  2C37 B;  4DR3 I;  3K85 A;  4OO1 B;  3CDJ A;  4FWD A;  4DPU A;  1E3P A;  1ZM4 A;  4HAC A;  4UTG A;  1Z0G A;  3QT7 A;  4JI0 I;  4R1F A;  4JV5 I;  4FW5 A;  5DRO A;  1USV A;  2O1U A;  4M1K A;  1Z5C A;  5C0X D;  5JEA A;  5JEA C;  1FKA E;  4B3M I;  2V8P A;  2UXB I;  4ISA A;  4P7A A;  1Z0T A;  5K36 E;  1NHH A;  2JEB B;  3CWV A;  2ZIT A;  4BA1 A;  5K36 D;  4DPW A;  4JI7 E;  3F0N A;  2GO4 A;  2WP8 B;  4LPF A;  1J5E I;  4YY3 E;  2JE6 A;  3H4L A;  1HNZ I;  4IFD B;  4DV4 E;  4JI0 E;  4LF5 E;  2O1T A;  4DV5 E;  4P52 A;  2BR2 A;  1UDS A;  2JEA A;  4IFD F;  5IWA I;  4OX9 I;  2GS8 A;  2GO3 A;  2VQF I;  4IZK B;  4B3M E;  1Z0V A;  2AJ4 A;  2PO1 A;  1PVG A;  4X66 E;  3T1H I;  1OYS A;  4NXN E;  2UUA E;  4OO1 D;  3WU5 A;  4AQY I;  2C38 B;  2PNM A;  4X62 I;  4ZVI A;  3P3E A;  2ZBK B;  5LL6 R;  4DPX A;  5IT9 C;  1J5E E;  4HYM A;  4MYU A;  3ZZ0 A;  1ZXN A;  4DR4 I;  3PYG A;  5C0X B;  3M7N D;  1RR9 A;  1HNW E;  1XMO E;  2OI2 A;  4WUB A;  4B3T I;  2NN6 A;  2A2C A;  4N3O A;  4JI5 E;  3UHM A;  2UXC E;  4NXN I;  3T1H E;  4GKK E;  2UUA I;  4JI6 I;  5EKW A;  4IS9 A;  1ZM3 A;  5BR8 E;  4YHH I;  2PO0 A;  4HXZ A;  4B3S E;  3PYD A;  1PKP A;  4LFB E;  3WU3 A;  3QT8 A;  1XXE A;  1S4E A; 
#chains in the Genus database with same CATH homology
 2X7I A;  3JAM Q;  5FLX C;  5A2Q Q;  1H72 C;  5LMU I;  2V2V A;  1IBL I;  4RPF A;  1Z0E A;  4DUZ E;  4HAC B;  4GKJ E;  2HK2 A;  1RRE A;  2PNL A;  2IOQ A;  3B8H A;  5L3J A;  4JI3 E;  4JI2 I;  2UUC E;  2ZM6 E;  1N33 E;  4K0K I;  4LF4 E;  2Q2E B;  1HNZ E;  2DEI A;  2HK3 A;  4DR3 E;  4DR2 E;  1KVK A;  2J7K A;  1IBK I;  4LF5 I;  1OJ4 A;  1D6T A;  1Z5A A;  3LTO A;  4DU7 A;  4GKJ I;  4DV7 I;  4OX9 E;  4X64 E;  1KIJ A;  1XMQ E;  4DXL A;  1B62 A;  2HKE A;  3PYF A;  4X66 I;  4JI8 E;  5A2Q C;  1KKH A;  1ZM9 A;  4DR6 I;  1FJG I;  2UUB I;  4FW9 A;  1Z0C A;  4DUY E;  3P06 A;  2O1W A;  4FWG A;  1HNW I;  3B78 A;  3HJC A;  2V2Q A;  1N0V C;  3J81 Q;  4DV7 E;  1H73 A;  1DAR A;  2HKJ A;  4B3T E;  3B82 A;  1NHI A;  4GKK I;  4JI8 I;  1Z0W A;  2UXD E;  1USU A;  2VF3 A;  1FWK A;  2Z5C B;  4DR6 E;  4AQY E;  4B3S I;  1N36 I;  2HHH I;  1HR0 E;  1ZXM A;  4DV2 E;  4DV6 E;  4DR4 E;  1XHK A;  3QT6 A;  4PRX A;  1XNQ I;  1WUU A;  4DR5 I;  3V5R A;  1IBM I;  1Z5B A;  3PRY A;  2IOP A;  4KHP E;  2V34 A;  2BM0 A;  4USK A;  4Z7C A;  4JI5 I;  4LF8 E;  3J80 C;  1XNR E;  4DR7 E;  3K1J A;  1FI4 A;  4LF7 I;  1N34 E;  1N32 I;  4MYT A;  4DPY A;  3ZM7 A;  3PYE A;  4LF6 E;  4DR5 E;  1ELO A;  2A2D A;  4DU8 A;  1IBK E;  3ZKB A;  2GQ0 A;  1I94 E;  4JI1 I;  4X64 I;  4FN5 A;  2EFG A;  5LMN E;  5IT9 Q;  5BR8 I;  2NPF A;  4LF9 E;  2UU9 I;  1MG7 A;  2BV3 A;  2CZ9 A;  3J81 C;  2E5L E;  4JI4 E;  1Y4U A;  2O1V A;  4HY1 A;  1QZR A;  2UUB E;  2DEJ A;  4USM A;  3V2U C;  2HFS A;  4DPT A;  4X65 I;  2CGE A;  3T1Y I;  1EA6 A;  3WU6 A;  5LMU E;  1FNM A;  3WU4 A;  2LJP A;  1EI1 A;  4JV5 E;  5GMD A;  3LNU A;  4DUZ I;  3J7A G;  4JI1 E;  3ZZU A;  1A6F A;  2VQE E;  4LFA I;  4XTJ A;  3JAM C;  4LF9 I;  2UU9 E;  2UXD I;  3LPS A;  4DR1 I;  4JI3 I;  4JI2 E;  3M6A A;  4DV3 E;  2UUC I;  2ZM6 I;  1N33 I;  4JYA E;  1N36 E;  2HHH E;  5FLX Q;  2F4V E;  4JI7 I;  1ZM2 A;  1FJG E;  2Z5B A;  4DR2 I;  4DV2 I;  1Z59 A;  4DV6 I;  3OTO E;  1BKN A;  4DV4 I;  3ZZT A;  1XNQ E;  2R42 A;  3Q6N A;  3GON A;  4DV5 I;  4KHP I;  4LFA E;  4DV1 I;  4DV0 E;  4Z7Y A;  4LF8 I;  2WW4 A;  1H74 A;  4JYA I;  2F4V I;  4B3R I;  3ZKD A;  2Z5E A;  4DUY I;  4URL A;  1UEK A;  1B63 A;  4PRV A;  2VQF E;  1MX0 A;  2UXB E;  4FWH A;  4IZJ B;  1NHJ A;  3J7A M;  1H7S A;  2Z5B B;  4ED4 A;  1Z0B A;  4YHH E;  1HNX I;  4KQV A;  1HR0 I;  4DR7 I;  2Z5C A;  1NZ0 A;  2E5L I;  4JI4 I;  4B3R E;  4YY3 I;  4PU9 A;  1N0U A;  3D4J A;  1N32 E;  1HK7 A;  1H7U A;  4IZK A;  4NXM I;  1XMO I;  4LFC I;  4JG4 A;  2R3V A;  2BM1 A;  3HUL A;  2V2Z A;  1IBM E;  5IWA E;  3Q1Q A;  3J80 Q;  1IBL E;  1K47 A;  2UXC I;  2VQE I;  1S16 A;  5GME A;  1KTV A;  2HFU A;  1U2R A;  1XNR I;  4EMD A;  4X62 E;  3K17 A;  1HNX E;  1VIS A;  4UT4 A;  4LFB I;  4LF7 E;  1N34 I;  3Q6M A;  4K0K E;  2XEX A;  3QT5 A;  4I3H A;  4LF6 I;  4NXM E;  4LFC E;  3OTO I;  4IZJ D;  4X65 E;  3T1Y E;  1I94 I;  2CG9 A;  1PIE A;  1Y6Z A;  2E1R A;  5LMN I;  4IZJ A;  1Y4S A;  5FWK A;  4DV1 E;  4DV0 I;  4JI6 E;  4WUC A;  1XMQ I;  4WUD A;  4DR1 E;  4LF4 I;  1FWL A;  4DV3 I;  2X36 A;  1MU5 A;  4DR3 I;  3K85 A;  4FWD A;  4DPU A;  1ZM4 A;  4HAC A;  4UTG A;  1Z0G A;  3QT7 A;  4JI0 I;  4R1F A;  4JV5 I;  1USV A;  2O1U A;  4M1K A;  1Z5C A;  1FKA E;  4B3M I;  2V8P A;  2UXB I;  4P7A A;  1Z0T A;  1NHH A;  3CWV A;  2ZIT A;  4DPW A;  4JI7 E;  3F0N A;  1J5E I;  4YY3 E;  1HNZ I;  3H4L A;  4DV4 E;  4JI0 E;  4LF5 E;  2O1T A;  4DV5 E;  4P52 A;  5IWA I;  4OX9 I;  2GS8 A;  2VQF I;  4IZK B;  4B3M E;  1Z0V A;  2AJ4 A;  1PVG A;  4X66 E;  3T1H I;  4NXN E;  2UUA E;  3WU5 A;  4AQY I;  2PNM A;  4X62 I;  4ZVI A;  2ZBK B;  5LL6 R;  4DPX A;  5IT9 C;  1J5E E;  4HYM A;  4MYU A;  3ZZ0 A;  1ZXN A;  4DR4 I;  3PYG A;  1RR9 A;  1HNW E;  1XMO E;  2OI2 A;  4WUB A;  4B3T I;  4N3O A;  2A2C A;  4JI5 E;  2UXC E;  4NXN I;  3T1H E;  4GKK E;  2UUA I;  4JI6 I;  1ZM3 A;  5BR8 E;  4YHH I;  4HXZ A;  4B3S E;  3PYD A;  1PKP A;  4LFB E;  3WU3 A;  3QT8 A;  1S4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...