2UXDI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxdI00
3B82A 2E5LI 4LFCI 4FWDA 3B78A 2ZITA 4DV7E 4KHPE 1Z0WA 2BV3A 1A6FA 2UUAE 2V2VA 4JI5I 3WU3A 1J5EE 4JI7I 3Q1QA 2E1RA 3WU6A 2F4VI 5BR8I 4B3TE 1VISA 4X62E 4JV5I 4X66I 4HYMA 4Z7CA 1H74A 1KTVA 4DV2I 4USKA 2HK3A 1IBKI 2DEJA 1XNQE 1XNRI 4DPWA 1XMOE 1ZXMA 3OTOE 1XMQE 1MG7A 4X64I 3T1HI 1DARA 1N33E 1Z0CA 1N32I 1Z0EA 5IWAI 3QT6A 2HHHE 3JAMQ 4JYAI 3JAMC 4LF8I 4DU7A 4DR2I 2AJ4A 4GKJE 4NXNE 4WUDA 2OI2A 4JI8E 4JI1I 3ZM7A 5LMUI 2GS8A 4LF5E 4UT4A 2VQEE 4DR1E 1XHKA 1N0UA 1S4EA 1D6TA 3ZKDA 4JI4E 1I94I 2UXCE 2HKJA 2BM0A 3K17A 4DV3I 4NXME 4JI6E 2UXDE 4KQVA 4P52A 4LFBE 4YHHE 4DUZE 4HY1A 4DV0E 2UUCI 2UXBE 1IBLE 3V5RA 4Z7YA 4DR7I 2R3VA 1HR0E 1Z0TA 4FWGA 4M1KA 2BM1A 4I3HA 4AQYI 4DV4I 1H73A 4B3MI 3ZKBA 1Z0GA 4GKKE 4FWHA 1ZM2A 1N36E 1PVGA 5GMDA 4DV6E 1K47A 1IBMI 4LF7I 1N0VC 4B3SI 1Z5AA 5IT9Q 2ZBKB 5IT9C 3D4JA 2V34A 2J7KA 4DR3E 1N34I 1PIEA 4JI0E 4DR6I 4PRXA 1KVKA 4MYUA 1Z59A 3HULA 2UU9E 4OX9I 4LFAI 3WU4A 1FWLA 2V2QA 4HXZA 3T1YE 4DPXA 4DPUA 3M6AA 2VQFE 4DPYA 4LF9I 4X65E 1S16A 3ZZTA 1H7UA 4DV1E 4DV7I 4KHPI 1H7SA 2DEIA 2V2ZA 3F0NA 2UUAI 1HNZE 2X36A 3PYGA 2R42A 4PU9A 1J5EI 4JG4A 1BKNA 4FW9A 4B3TI 3LNUA 4ZVIA 3V2UC 4X62I 2UUBE 5IWAE 2NPFA 3QT7A 2HFUA 3CWVA 1NHHA 3LPSA 4EMDA 1HNWE 4DXLA 1XNQI 3H4LA 1NZ0A 3WU5A 1XMOI 3OTOI 1XMQI 4JI1E 3J81Q 4JI2E 3J80Q 3J81C 1ZM4A 3J80C 2HK2A 2EFGA 4B3RE 4K0KE 2A2DA 5L3JA 4DR4E 2HHHI 4R1FA 1MU5A 4GKJI 3QT8A 1B63A 4NXNI 2WW4A 3ZZUA 1B62A 1HNXE 4YY3E 4LF5I 4DV5E 2VQEI 4DR1I 4LF6E 4DU8A 5LMNE 4LF4E 3GONA 3B8HA 4JI4I 2ZM6E 4DUYE 1H72C 4NXMI 2V8PA 2CZ9A 5A2QQ 4HACB 4JI6I 2UXDI 4LFBI 4YHHI 5A2QC 4DUZI 1FJGI 4DV0I 1Z0BA 2UXBI 1IBLI 4DR5I 2E5LE 4LFCE 3J7AG 1Z5CA 1HR0I 1MX0A 1ZXNA 4JI5E 4JI3I 1ZM9A 4JI7E 2LJPA 3PYDA 4LFAE 1OJ4A 4GKKI 2F4VE 1KKHA 5BR8E 1N36I 4DV6I 2Q2EB 4LF9E 4JV5E 4X66E 1NHJA 4PRVA 4DV2E 3PYEA 1IBKE 5LL6R 4WUCA 1XNRE 4DR3I 4JI0I 3J7AM 2UU9I 4X64E 3T1HE 4URLA 3T1YI 1QZRA 1FWKA 3PYFA 4DPTA 5FLXQ 2VQFI 2A2CA 1N32E 2XEXA 4X65I 5FLXC 4DV1I 4ED4A 4JYAE 1HNZI 4LF8E 4RPFA 4MYTA 4DR2E 2X7IA 3LTOA 1EI1A 3K1JA 5LMUE 1ZM3A 1Z5BA 4HACA 1U2RA 2UUBI 1N33I 3ZZ0A 1I94E 2HFSA 1HNWI 4DV3E 1RR9A 4JI2I 1WUUA 4JI8I 1FNMA 1RREA 2UUCE 1FKAE 1EA6A 4B3RI 4K0KI 4DR7E 4P7AA 4WUBA 4DR4I 1Z0VA 2UXCI 4AQYE 3QT5A 4DV4E 1FI4A 4B3ME 4XTJA 1FJGE 1NHIA 1HNXI 4YY3I 4DV5I 4UTGA 4DR5E 4USMA 1KIJA 4LF6I 1IBME 4FN5A 4LF7E 5LMNI 4B3SE 4LF4I 2ZM6I 4JI3E 1UEKA 5GMEA 1PKPA 4DUYI 1N34E 2HKEA 4DR6E 4OX9E 2VF3A 1ELOA
chains in the Genus database with same CATH superfamily
3B82A 1Y5YA 2E5LI 2GQ0A 4LFCI 2Z5BB 4FWDA 3B78A 5C0XC 5K36E 2ZITA 4DV7E 4KHPE 1Z0WA 2BV3A 5C0XD 1A6FA 2UUAE 2V2VA 2O1WA 4JI5I 3WU3A 2PO1B 5FWKA 1J5EE 4JI7I 3Q1QA 2E1RA 1YH8A 3WU6A 4BA2B 4GQUA 2F4VI 3P76A 5BR8I 4B3TE 5JEAF 4FW6A 1VISA 4X62E 1RHYA 4JV5I 4X66I 4HYMA 4Z7CA 2BR2A 1H74A 1KTVA 4DV2I 4USKA 2HK3A 5C0XB 2WP8A 1IBKI 2DEJA 2NN6A 1XNQE 1XNRI 3P3GA 4DPWA 3L7ZB 1XMOE 1ZXMA 4MU3A 1USUA 3OTOE 1XMQE 1OYPA 1MG7A 2JT2A 4IFDF 4X64I 3T1HI 2NN6C 2CVEA 3CDJA 4FW4A 2NN6D 1DARA 1N33E 1Z0CA 1Y6ZA 1N32I 1Z0EA 5IWAI 3QT6A 2HHHE 3JAMQ 4JYAI 1OYRA 3JAMC 4LF8I 4DU7A 4DR2I 2AJ4A 4FW3A 4GKJE 4U3DA 5C0XF 4NXNE 4WUDA 2OI2A 3Q6NA 4JI8E 4JI1I 3ZM7A 5LMUI 2GS8A 4LF5E 3U1KA 2O1VA 2BR2B 4UT4A 2VQEE 4DR1E 1XHKA 1N0UA 1S4EA 2PO0A 1D6TA 2NN6B 3ZKDA 4LCGA 4JI4E 1I94I 2UXCE 2HKJA 2BM0A 3K17A 4DV3I 4MQYA 2F1DA 4NXME 4JI6E 2UXDE 4KQVA 4P52A 4LFBE 4YHHE 4DUZE 4HY1A 4DV0E 2UUCI 5EL9A 2UXBE 1IBLE 2JE6A 5DRPA 3V5RA 4MU0A 4Z7YA 1E3PA 4DR7I 2R3VA 2PNZA 1HR0E 1Z0TA 4FWGA 4M1KA 2BM1A 4I3HA 4AQYI 2PO2A 3Q6MA 4OO1E 4OO1A 4DV4I 4IZKA 1H73A 4B3MI 3ZKBA 2PO0B 3UHMA 1Z0GA 4GKKE 4FWHA 2BA1D 1ZM2A 1N36E 1PVGA 5GMDA 4DV6E 4OO1C 1K47A 1IBMI 4LF7I 1N0VC 3H1CA 4OO1D 4B3SI 5DRQA 1Z5AA 5IT9Q 2IOPA 5K36A 2ZBKB 4IS9A 5IT9C 3NZKA 3D4JA 2V34A 2J7KA 4DR3E 1N34I 2JEBA 1PIEA 4JI0E 4DR6I 4PRXA 1KVKA 4LPFA 5K36C 4MYUA 1Z59A 3HULA 2UU9E 2JE6B 4OX9I 4LFAI 5K36D 3WU4A 1UDNA 1FWLA 2V2QA 4HXZA 3T1YE 4DPXA 2PNZB 4DPUA 2IERA 3M6AA 2CG9A 2VQFE 4DPYA 4LF9I 4QNJA 4X65E 1S16A 3ZZTA 1H7UA 4DV1E 2PO2B 4DV7I 4OO1B 4FW7A 4KHPI 1H7SA 2DEIA 2V2ZA 3F0NA 4IZKB 2UUAI 1HNZE 2C39A 2BA1G 3HJCA 2X36A 3PYGA 2R42A 4PU9A 1J5EI 4JG4A 3P3EA 1BKNA 5ELWA 4BA1A 4FW9A 5K36B 4B3TI 3LNUA 2O1UA 4ZVIA 2GO3A 3V2UC 4X62I 2UUBE 5IWAE 1R6LA 1HK7A 2NPFA 4IZJA 3QT7A 2HFUA 4AIDA 2JEBB 2IESA 3CWVA 1NHHA 3LPSA 4EMDA 1HNWE 4DXLA 2GO4A 1XNQI 3H4LA 1NZ0A 3WU5A 1XMOI 4U3BA 3OTOI 1XMQI 4JI1E 3J81Q 3B4TA 4JI2E 3PS3A 3J80Q 3J81C 4IZJD 1ZM4A 3J80C 4MU4A 2HK2A 2EFGA 4B3RE 4K0KE 2A2DA 2C39B 4LOMA 5EKWA 5L3JA 4DR4E 2HHHI 4NBQA 2PNLA 2PNMA 4R1FA 1MU5A 4GKJI 3QT8A 4BA1B 1B63A 4NXNI 2WW4A 3ZZUA 1B62A 1HNXE 4YY3E 4LF5I 4DV5E 4IZJB 2VQEI 4DR1I 5JEAE 4LF6E 4DU8A 1XXEA 5LMNE 1YHCA 4LF4E 3GONA 3B8HA 4JI4I 2ZM6E 2NN6F 3P06A 5JEAC 4DUYE 1H72C 4NXMI 2V8PA 2CZ9A 5A2QQ 4HACB 4JI6I 2UXDI 4LFBI 4YHHI 5A2QC 2JEAA 4DUZI 1FJGI 4IFDE 4DV0I 1Z0BA 1UDOA 4MDTA 3K85A 2UXBI 1IBLI 4DR5I 2E5LE 4LFCE 4ISAA 3J7AG 1Z5CA 4OZEA 2BA0D 1P42A 1HR0I 4IFDC 1MX0A 1ZXNA 4JI5E 2WNRA 4JI3I 4J3DA 1R6MA 5C0XE 1ZM9A 4JI7E 2LJPA 3PYDA 5JEAB 4LFAE 1OJ4A 1Y4SA 3P3CA 4GKKI 2F4VE 1KKHA 1E3HA 5BR8E 1N36I 4DV6I 2Q2EB 4LF9E 2IOQA 4AIMA 4JV5E 4X66E 1NHJA 4PRVA 4DV2E 1UDQA 3PYEA 1IBKE 5LL6R 3GMEA 4WUCA 2JEAB 1XNRE 4DR3I 2C38A 2C37A 4IFDB 3M7ND 4JI0I 2Z5CA 4N3OA 2BA0G 3J7AM 2UU9I 3PRYA 3PS1A 4X64E 5DNLA 3T1HE 4URLA 3T1YI 1QZRA 1FWKA 3PYFA 4DPTA 5FLXQ 2VQFI 2WNRB 2A2CA 4QNKA 2XEXA 3KRNA 4X65I 1N32E 5FLXC 4DV1I 4ED4A 2NN6E 4JYAE 1HNZI 1OYSA 4RPFA 4LF8E 4MYTA 4DR2E 3HKMA 2X7IA 4OO1F 3LTOA 1EI1A 3K1JA 2CGEA 5LMUE 1ZM3A 1Z5BA 4LCHA 3DD6A 4HACA 1U2RA 3M7NG 2UUBI 1N33I 5K36F 3ZZ0A 2O1TA 1I94E 2C38B 2C37B 2Z5CB 3M85D 2HFSA 1HNWI 4DV3E 4FW5A 1RR9A 4JI2I 1WUUA 3CDIA 4JI8I 2VESA 1FNMA 1RREA 2UUCE 4LCFA 1FKAE 1EA6A 2WP8B 1Y60A 5JEAA 4B3RI 4K0KI 4DR7E 4P7AA 4WUBA 4DR4I 1Z0VA 1USVA 2Z5EA 2Z5BA 2UXCI 2J65A 3GLLA 4MU1A 4AQYE 5DROA 3QT5A 4DV4E 1Y4UA 1FI4A 4B3ME 4XTJA 5JEAD 1FJGE 2PO1A 3M85G 1NHIA 4AM3A 1HNXI 4YY3I 4DV5I 4UTGA 4IFDA 3GCMA 4DR5E 5DRRA 4USMA 1KIJA 4LF6I 1IBME 4FN5A 4BA2A 4LF7E 5LMNI 1VI7A 4B3SE 4LF4I 3U1YA 2ZM6I 4JI3E 1UEKA 5GMEA 1PKPA 4DUYI 4IFDD 1N34E 1UDSA 5DNXA 2HKEA 4DR6E 2AE8A 5C0XA 4OX9E 3PS2A 4OKGA 2O3ZA 2VF3A 3L7ZA 1ELOA
chains in the Genus database with same CATH topology
3B82A 2E5LI 2GQ0A 4LFCI 2Z5BB 4FWDA 3B78A 2ZITA 4DV7E 4KHPE 1Z0WA 2BV3A 1A6FA 2UUAE 2V2VA 2O1WA 4JI5I 3WU3A 5FWKA 1J5EE 4JI7I 3Q1QA 2E1RA 3WU6A 2F4VI 5BR8I 4B3TE 1VISA 4X62E 4JV5I 4X66I 4HYMA 4Z7CA 1H74A 1KTVA 4DV2I 4USKA 2HK3A 1IBKI 2DEJA 1XNQE 1XNRI 4DPWA 1XMOE 1ZXMA 1USUA 3OTOE 1XMQE 1MG7A 4X64I 3T1HI 1DARA 1N33E 1Z0CA 1Y6ZA 1N32I 1Z0EA 5IWAI 3QT6A 2HHHE 3JAMQ 4JYAI 3JAMC 4LF8I 4DU7A 4DR2I 2AJ4A 4GKJE 4NXNE 4WUDA 2OI2A 3Q6NA 4JI8E 4JI1I 3ZM7A 5LMUI 2GS8A 4LF5E 2O1VA 4UT4A 2VQEE 4DR1E 1XHKA 1N0UA 1S4EA 1D6TA 3ZKDA 4JI4E 1I94I 2UXCE 2HKJA 2BM0A 3K17A 4DV3I 4NXME 4JI6E 2UXDE 4KQVA 4P52A 4LFBE 4YHHE 4DUZE 4HY1A 4DV0E 2UUCI 2UXBE 1IBLE 3V5RA 4Z7YA 4DR7I 2R3VA 1HR0E 1Z0TA 4FWGA 4M1KA 2BM1A 4I3HA 4AQYI 3Q6MA 4DV4I 4IZKA 1H73A 4B3MI 3ZKBA 1Z0GA 4GKKE 4FWHA 1ZM2A 1N36E 1PVGA 5GMDA 4DV6E 1K47A 1IBMI 4LF7I 1N0VC 4B3SI 1Z5AA 5IT9Q 2IOPA 2ZBKB 5IT9C 3D4JA 2V34A 2J7KA 4DR3E 1N34I 1PIEA 4JI0E 4DR6I 4PRXA 1KVKA 4MYUA 1Z59A 3HULA 2UU9E 4OX9I 4LFAI 3WU4A 1FWLA 2V2QA 4HXZA 3T1YE 4DPXA 4DPUA 3M6AA 2CG9A 2VQFE 4DPYA 4LF9I 4X65E 1S16A 3ZZTA 1H7UA 4DV1E 4DV7I 4KHPI 1H7SA 2DEIA 2V2ZA 3F0NA 4IZKB 2UUAI 1HNZE 3HJCA 2X36A 3PYGA 2R42A 4PU9A 1J5EI 4JG4A 1BKNA 4FW9A 4B3TI 3LNUA 2O1UA 4ZVIA 3V2UC 4X62I 2UUBE 5IWAE 1HK7A 2NPFA 4IZJA 3QT7A 2HFUA 3CWVA 1NHHA 3LPSA 4EMDA 1HNWE 4DXLA 1XNQI 3H4LA 1NZ0A 3WU5A 1XMOI 3OTOI 1XMQI 4JI1E 3J81Q 4JI2E 3J80Q 3J81C 4IZJD 1ZM4A 3J80C 2HK2A 2EFGA 4B3RE 4K0KE 2A2DA 5L3JA 4DR4E 2HHHI 2PNLA 2PNMA 4R1FA 1MU5A 4GKJI 3QT8A 1B63A 4NXNI 2WW4A 3ZZUA 1B62A 1HNXE 4YY3E 4LF5I 4DV5E 4IZJB 2VQEI 4DR1I 4LF6E 4DU8A 5LMNE 4LF4E 3GONA 3B8HA 4JI4I 2ZM6E 3P06A 4DUYE 1H72C 4NXMI 2V8PA 2CZ9A 5A2QQ 4HACB 4JI6I 2UXDI 4LFBI 4YHHI 5A2QC 4DUZI 1FJGI 4DV0I 1Z0BA 3K85A 2UXBI 1IBLI 4DR5I 2E5LE 4LFCE 3J7AG 1Z5CA 1HR0I 1MX0A 1ZXNA 4JI5E 4JI3I 1ZM9A 4JI7E 2LJPA 3PYDA 4LFAE 1OJ4A 1Y4SA 4GKKI 2F4VE 1KKHA 5BR8E 1N36I 4DV6I 2Q2EB 4LF9E 2IOQA 4JV5E 4X66E 1NHJA 4PRVA 4DV2E 3PYEA 1IBKE 5LL6R 4WUCA 1XNRE 4DR3I 4JI0I 2Z5CA 4N3OA 3J7AM 2UU9I 3PRYA 4X64E 3T1HE 4URLA 3T1YI 1QZRA 1FWKA 3PYFA 4DPTA 5FLXQ 2VQFI 2A2CA 1N32E 2XEXA 4X65I 5FLXC 4DV1I 4ED4A 4JYAE 1HNZI 4LF8E 4RPFA 4MYTA 4DR2E 2X7IA 3LTOA 1EI1A 3K1JA 2CGEA 5LMUE 1ZM3A 1Z5BA 4HACA 1U2RA 2UUBI 1N33I 3ZZ0A 2O1TA 1I94E 2Z5CB 2HFSA 1HNWI 4DV3E 1RR9A 4JI2I 1WUUA 4JI8I 1FNMA 1RREA 2UUCE 1FKAE 1EA6A 4B3RI 4K0KI 4DR7E 4P7AA 4WUBA 4DR4I 1Z0VA 1USVA 2Z5EA 2Z5BA 2UXCI 4AQYE 3QT5A 4DV4E 1Y4UA 1FI4A 4B3ME 4XTJA 1FJGE 1NHIA 1HNXI 4YY3I 4DV5I 4UTGA 4DR5E 4USMA 1KIJA 4LF6I 1IBME 4FN5A 4LF7E 5LMNI 4B3SE 4LF4I 2ZM6I 4JI3E 1UEKA 5GMEA 1PKPA 4DUYI 1N34E 2HKEA 4DR6E 4OX9E 2VF3A 1ELOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B82 A;  2E5L I;  4LFC I;  4FWD A;  3B78 A;  2ZIT A;  4DV7 E;  4KHP E;  1Z0W A;  2BV3 A;  1A6F A;  2UUA E;  2V2V A;  4JI5 I;  3WU3 A;  1J5E E;  4JI7 I;  3Q1Q A;  2E1R A;  3WU6 A;  2F4V I;  5BR8 I;  4B3T E;  1VIS A;  4X62 E;  4JV5 I;  4X66 I;  4HYM A;  4Z7C A;  1H74 A;  1KTV A;  4DV2 I;  4USK A;  2HK3 A;  1IBK I;  2DEJ A;  1XNQ E;  1XNR I;  4DPW A;  1XMO E;  1ZXM A;  3OTO E;  1XMQ E;  1MG7 A;  4X64 I;  3T1H I;  1DAR A;  1N33 E;  1Z0C A;  1N32 I;  1Z0E A;  5IWA I;  3QT6 A;  2HHH E;  3JAM Q;  4JYA I;  3JAM C;  4LF8 I;  4DU7 A;  4DR2 I;  2AJ4 A;  4GKJ E;  4NXN E;  4WUD A;  2OI2 A;  4JI8 E;  4JI1 I;  3ZM7 A;  5LMU I;  2GS8 A;  4LF5 E;  4UT4 A;  2VQE E;  4DR1 E;  1XHK A;  1N0U A;  1S4E A;  1D6T A;  3ZKD A;  4JI4 E;  1I94 I;  2UXC E;  2HKJ A;  2BM0 A;  3K17 A;  4DV3 I;  4NXM E;  4JI6 E;  2UXD E;  4KQV A;  4P52 A;  4LFB E;  4YHH E;  4DUZ E;  4HY1 A;  4DV0 E;  2UUC I;  2UXB E;  1IBL E;  3V5R A;  4Z7Y A;  4DR7 I;  2R3V A;  1HR0 E;  1Z0T A;  4FWG A;  4M1K A;  2BM1 A;  4I3H A;  4AQY I;  4DV4 I;  1H73 A;  4B3M I;  3ZKB A;  1Z0G A;  4GKK E;  4FWH A;  1ZM2 A;  1N36 E;  1PVG A;  5GMD A;  4DV6 E;  1K47 A;  1IBM I;  4LF7 I;  1N0V C;  4B3S I;  1Z5A A;  5IT9 Q;  2ZBK B;  5IT9 C;  3D4J A;  2V34 A;  2J7K A;  4DR3 E;  1N34 I;  1PIE A;  4JI0 E;  4DR6 I;  4PRX A;  1KVK A;  4MYU A;  1Z59 A;  3HUL A;  2UU9 E;  4OX9 I;  4LFA I;  3WU4 A;  1FWL A;  2V2Q A;  4HXZ A;  3T1Y E;  4DPX A;  4DPU A;  3M6A A;  2VQF E;  4DPY A;  4LF9 I;  4X65 E;  1S16 A;  3ZZT A;  1H7U A;  4DV1 E;  4DV7 I;  4KHP I;  1H7S A;  2DEI A;  2V2Z A;  3F0N A;  2UUA I;  1HNZ E;  2X36 A;  3PYG A;  2R42 A;  4PU9 A;  1J5E I;  4JG4 A;  1BKN A;  4FW9 A;  4B3T I;  3LNU A;  4ZVI A;  3V2U C;  4X62 I;  2UUB E;  5IWA E;  2NPF A;  3QT7 A;  2HFU A;  3CWV A;  1NHH A;  3LPS A;  4EMD A;  1HNW E;  4DXL A;  1XNQ I;  3H4L A;  1NZ0 A;  3WU5 A;  1XMO I;  3OTO I;  1XMQ I;  4JI1 E;  3J81 Q;  4JI2 E;  3J80 Q;  3J81 C;  1ZM4 A;  3J80 C;  2HK2 A;  2EFG A;  4B3R E;  4K0K E;  2A2D A;  5L3J A;  4DR4 E;  2HHH I;  4R1F A;  1MU5 A;  4GKJ I;  3QT8 A;  1B63 A;  4NXN I;  2WW4 A;  3ZZU A;  1B62 A;  1HNX E;  4YY3 E;  4LF5 I;  4DV5 E;  2VQE I;  4DR1 I;  4LF6 E;  4DU8 A;  5LMN E;  4LF4 E;  3GON A;  3B8H A;  4JI4 I;  2ZM6 E;  4DUY E;  1H72 C;  4NXM I;  2V8P A;  2CZ9 A;  5A2Q Q;  4HAC B;  4JI6 I;  2UXD I;  4LFB I;  4YHH I;  5A2Q C;  4DUZ I;  1FJG I;  4DV0 I;  1Z0B A;  2UXB I;  1IBL I;  4DR5 I;  2E5L E;  4LFC E;  3J7A G;  1Z5C A;  1HR0 I;  1MX0 A;  1ZXN A;  4JI5 E;  4JI3 I;  1ZM9 A;  4JI7 E;  2LJP A;  3PYD A;  4LFA E;  1OJ4 A;  4GKK I;  2F4V E;  1KKH A;  5BR8 E;  1N36 I;  4DV6 I;  2Q2E B;  4LF9 E;  4JV5 E;  4X66 E;  1NHJ A;  4PRV A;  4DV2 E;  3PYE A;  1IBK E;  5LL6 R;  4WUC A;  1XNR E;  4DR3 I;  4JI0 I;  3J7A M;  2UU9 I;  4X64 E;  3T1H E;  4URL A;  3T1Y I;  1QZR A;  1FWK A;  3PYF A;  4DPT A;  5FLX Q;  2VQF I;  2A2C A;  1N32 E;  2XEX A;  4X65 I;  5FLX C;  4DV1 I;  4ED4 A;  4JYA E;  1HNZ I;  4LF8 E;  4RPF A;  4MYT A;  4DR2 E;  2X7I A;  3LTO A;  1EI1 A;  3K1J A;  5LMU E;  1ZM3 A;  1Z5B A;  4HAC A;  1U2R A;  2UUB I;  1N33 I;  3ZZ0 A;  1I94 E;  2HFS A;  1HNW I;  4DV3 E;  1RR9 A;  4JI2 I;  1WUU A;  4JI8 I;  1FNM A;  1RRE A;  2UUC E;  1FKA E;  1EA6 A;  4B3R I;  4K0K I;  4DR7 E;  4P7A A;  4WUB A;  4DR4 I;  1Z0V A;  2UXC I;  4AQY E;  3QT5 A;  4DV4 E;  1FI4 A;  4B3M E;  4XTJ A;  1FJG E;  1NHI A;  1HNX I;  4YY3 I;  4DV5 I;  4UTG A;  4DR5 E;  4USM A;  1KIJ A;  4LF6 I;  1IBM E;  4FN5 A;  4LF7 E;  5LMN I;  4B3S E;  4LF4 I;  2ZM6 I;  4JI3 E;  1UEK A;  5GME A;  1PKP A;  4DUY I;  1N34 E;  2HKE A;  4DR6 E;  4OX9 E;  2VF3 A;  1ELO A; 
#chains in the Genus database with same CATH topology
 3B82 A;  1Y5Y A;  2E5L I;  2GQ0 A;  4LFC I;  2Z5B B;  4FWD A;  3B78 A;  5C0X C;  5K36 E;  2ZIT A;  4DV7 E;  4KHP E;  1Z0W A;  2BV3 A;  5C0X D;  1A6F A;  2UUA E;  2V2V A;  2O1W A;  4JI5 I;  3WU3 A;  2PO1 B;  5FWK A;  1J5E E;  4JI7 I;  3Q1Q A;  2E1R A;  1YH8 A;  3WU6 A;  4BA2 B;  4GQU A;  2F4V I;  3P76 A;  5BR8 I;  4B3T E;  5JEA F;  4FW6 A;  1VIS A;  4X62 E;  1RHY A;  4JV5 I;  4X66 I;  4HYM A;  4Z7C A;  2BR2 A;  1H74 A;  1KTV A;  4DV2 I;  4USK A;  2HK3 A;  5C0X B;  2WP8 A;  1IBK I;  2DEJ A;  2NN6 A;  1XNQ E;  1XNR I;  3P3G A;  4DPW A;  3L7Z B;  1XMO E;  1ZXM A;  4MU3 A;  1USU A;  3OTO E;  1XMQ E;  1OYP A;  1MG7 A;  2JT2 A;  4IFD F;  4X64 I;  3T1H I;  2NN6 C;  2CVE A;  3CDJ A;  4FW4 A;  2NN6 D;  1DAR A;  1N33 E;  1Z0C A;  1Y6Z A;  1N32 I;  1Z0E A;  5IWA I;  3QT6 A;  2HHH E;  3JAM Q;  4JYA I;  1OYR A;  3JAM C;  4LF8 I;  4DU7 A;  4DR2 I;  2AJ4 A;  4FW3 A;  4GKJ E;  4U3D A;  5C0X F;  4NXN E;  4WUD A;  2OI2 A;  3Q6N A;  4JI8 E;  4JI1 I;  3ZM7 A;  5LMU I;  2GS8 A;  4LF5 E;  3U1K A;  2O1V A;  2BR2 B;  4UT4 A;  2VQE E;  4DR1 E;  1XHK A;  1N0U A;  1S4E A;  2PO0 A;  1D6T A;  2NN6 B;  3ZKD A;  4LCG A;  4JI4 E;  1I94 I;  2UXC E;  2HKJ A;  2BM0 A;  3K17 A;  4DV3 I;  4MQY A;  2F1D A;  4NXM E;  4JI6 E;  2UXD E;  4KQV A;  4P52 A;  4LFB E;  4YHH E;  4DUZ E;  4HY1 A;  4DV0 E;  2UUC I;  5EL9 A;  2UXB E;  1IBL E;  2JE6 A;  5DRP A;  3V5R A;  4MU0 A;  4Z7Y A;  1E3P A;  4DR7 I;  2R3V A;  2PNZ A;  1HR0 E;  1Z0T A;  4FWG A;  4M1K A;  2BM1 A;  4I3H A;  4AQY I;  2PO2 A;  3Q6M A;  4OO1 E;  4OO1 A;  4DV4 I;  4IZK A;  1H73 A;  4B3M I;  3ZKB A;  2PO0 B;  3UHM A;  1Z0G A;  4GKK E;  4FWH A;  2BA1 D;  1ZM2 A;  1N36 E;  1PVG A;  5GMD A;  4DV6 E;  4OO1 C;  1K47 A;  1IBM I;  4LF7 I;  1N0V C;  3H1C A;  4OO1 D;  4B3S I;  5DRQ A;  1Z5A A;  5IT9 Q;  2IOP A;  5K36 A;  2ZBK B;  4IS9 A;  5IT9 C;  3NZK A;  3D4J A;  2V34 A;  2J7K A;  4DR3 E;  1N34 I;  2JEB A;  1PIE A;  4JI0 E;  4DR6 I;  4PRX A;  1KVK A;  4LPF A;  5K36 C;  4MYU A;  1Z59 A;  3HUL A;  2UU9 E;  2JE6 B;  4OX9 I;  4LFA I;  5K36 D;  3WU4 A;  1UDN A;  1FWL A;  2V2Q A;  4HXZ A;  3T1Y E;  4DPX A;  2PNZ B;  4DPU A;  2IER A;  3M6A A;  2CG9 A;  2VQF E;  4DPY A;  4LF9 I;  4QNJ A;  4X65 E;  1S16 A;  3ZZT A;  1H7U A;  4DV1 E;  2PO2 B;  4DV7 I;  4OO1 B;  4FW7 A;  4KHP I;  1H7S A;  2DEI A;  2V2Z A;  3F0N A;  4IZK B;  2UUA I;  1HNZ E;  2C39 A;  2BA1 G;  3HJC A;  2X36 A;  3PYG A;  2R42 A;  4PU9 A;  1J5E I;  4JG4 A;  3P3E A;  1BKN A;  5ELW A;  4BA1 A;  4FW9 A;  5K36 B;  4B3T I;  3LNU A;  2O1U A;  4ZVI A;  2GO3 A;  3V2U C;  4X62 I;  2UUB E;  5IWA E;  1R6L A;  1HK7 A;  2NPF A;  4IZJ A;  3QT7 A;  2HFU A;  4AID A;  2JEB B;  2IES A;  3CWV A;  1NHH A;  3LPS A;  4EMD A;  1HNW E;  4DXL A;  2GO4 A;  1XNQ I;  3H4L A;  1NZ0 A;  3WU5 A;  1XMO I;  4U3B A;  3OTO I;  1XMQ I;  4JI1 E;  3J81 Q;  3B4T A;  4JI2 E;  3PS3 A;  3J80 Q;  3J81 C;  4IZJ D;  1ZM4 A;  3J80 C;  4MU4 A;  2HK2 A;  2EFG A;  4B3R E;  4K0K E;  2A2D A;  2C39 B;  4LOM A;  5EKW A;  5L3J A;  4DR4 E;  2HHH I;  4NBQ A;  2PNL A;  2PNM A;  4R1F A;  1MU5 A;  4GKJ I;  3QT8 A;  4BA1 B;  1B63 A;  4NXN I;  2WW4 A;  3ZZU A;  1B62 A;  1HNX E;  4YY3 E;  4LF5 I;  4DV5 E;  4IZJ B;  2VQE I;  4DR1 I;  5JEA E;  4LF6 E;  4DU8 A;  1XXE A;  5LMN E;  1YHC A;  4LF4 E;  3GON A;  3B8H A;  4JI4 I;  2ZM6 E;  2NN6 F;  3P06 A;  5JEA C;  4DUY E;  1H72 C;  4NXM I;  2V8P A;  2CZ9 A;  5A2Q Q;  4HAC B;  4JI6 I;  2UXD I;  4LFB I;  4YHH I;  5A2Q C;  2JEA A;  4DUZ I;  1FJG I;  4IFD E;  4DV0 I;  1Z0B A;  1UDO A;  4MDT A;  3K85 A;  2UXB I;  1IBL I;  4DR5 I;  2E5L E;  4LFC E;  4ISA A;  3J7A G;  1Z5C A;  4OZE A;  2BA0 D;  1P42 A;  1HR0 I;  4IFD C;  1MX0 A;  1ZXN A;  4JI5 E;  2WNR A;  4JI3 I;  4J3D A;  1R6M A;  5C0X E;  1ZM9 A;  4JI7 E;  2LJP A;  3PYD A;  5JEA B;  4LFA E;  1OJ4 A;  1Y4S A;  3P3C A;  4GKK I;  2F4V E;  1KKH A;  1E3H A;  5BR8 E;  1N36 I;  4DV6 I;  2Q2E B;  4LF9 E;  2IOQ A;  4AIM A;  4JV5 E;  4X66 E;  1NHJ A;  4PRV A;  4DV2 E;  1UDQ A;  3PYE A;  1IBK E;  5LL6 R;  3GME A;  4WUC A;  2JEA B;  1XNR E;  4DR3 I;  2C38 A;  2C37 A;  4IFD B;  3M7N D;  4JI0 I;  2Z5C A;  4N3O A;  2BA0 G;  3J7A M;  2UU9 I;  3PRY A;  3PS1 A;  4X64 E;  5DNL A;  3T1H E;  4URL A;  3T1Y I;  1QZR A;  1FWK A;  3PYF A;  4DPT A;  5FLX Q;  2VQF I;  2WNR B;  2A2C A;  4QNK A;  2XEX A;  3KRN A;  4X65 I;  1N32 E;  5FLX C;  4DV1 I;  4ED4 A;  2NN6 E;  4JYA E;  1HNZ I;  1OYS A;  4RPF A;  4LF8 E;  4MYT A;  4DR2 E;  3HKM A;  2X7I A;  4OO1 F;  3LTO A;  1EI1 A;  3K1J A;  2CGE A;  5LMU E;  1ZM3 A;  1Z5B A;  4LCH A;  3DD6 A;  4HAC A;  1U2R A;  3M7N G;  2UUB I;  1N33 I;  5K36 F;  3ZZ0 A;  2O1T A;  1I94 E;  2C38 B;  2C37 B;  2Z5C B;  3M85 D;  2HFS A;  1HNW I;  4DV3 E;  4FW5 A;  1RR9 A;  4JI2 I;  1WUU A;  3CDI A;  4JI8 I;  2VES A;  1FNM A;  1RRE A;  2UUC E;  4LCF A;  1FKA E;  1EA6 A;  2WP8 B;  1Y60 A;  5JEA A;  4B3R I;  4K0K I;  4DR7 E;  4P7A A;  4WUB A;  4DR4 I;  1Z0V A;  1USV A;  2Z5E A;  2Z5B A;  2UXC I;  2J65 A;  3GLL A;  4MU1 A;  4AQY E;  5DRO A;  3QT5 A;  4DV4 E;  1Y4U A;  1FI4 A;  4B3M E;  4XTJ A;  5JEA D;  1FJG E;  2PO1 A;  3M85 G;  1NHI A;  4AM3 A;  1HNX I;  4YY3 I;  4DV5 I;  4UTG A;  4IFD A;  3GCM A;  4DR5 E;  5DRR A;  4USM A;  1KIJ A;  4LF6 I;  1IBM E;  4FN5 A;  4BA2 A;  4LF7 E;  5LMN I;  1VI7 A;  4B3S E;  4LF4 I;  3U1Y A;  2ZM6 I;  4JI3 E;  1UEK A;  5GME A;  1PKP A;  4DUY I;  4IFD D;  1N34 E;  1UDS A;  5DNX A;  2HKE A;  4DR6 E;  2AE8 A;  5C0X A;  4OX9 E;  3PS2 A;  4OKG A;  2O3Z A;  2VF3 A;  3L7Z A;  1ELO A; 
#chains in the Genus database with same CATH homology
 3B82 A;  2E5L I;  2GQ0 A;  4LFC I;  2Z5B B;  4FWD A;  3B78 A;  2ZIT A;  4DV7 E;  4KHP E;  1Z0W A;  2BV3 A;  1A6F A;  2UUA E;  2V2V A;  2O1W A;  4JI5 I;  3WU3 A;  5FWK A;  1J5E E;  4JI7 I;  3Q1Q A;  2E1R A;  3WU6 A;  2F4V I;  5BR8 I;  4B3T E;  1VIS A;  4X62 E;  4JV5 I;  4X66 I;  4HYM A;  4Z7C A;  1H74 A;  1KTV A;  4DV2 I;  4USK A;  2HK3 A;  1IBK I;  2DEJ A;  1XNQ E;  1XNR I;  4DPW A;  1XMO E;  1ZXM A;  1USU A;  3OTO E;  1XMQ E;  1MG7 A;  4X64 I;  3T1H I;  1DAR A;  1N33 E;  1Z0C A;  1Y6Z A;  1N32 I;  1Z0E A;  5IWA I;  3QT6 A;  2HHH E;  3JAM Q;  4JYA I;  3JAM C;  4LF8 I;  4DU7 A;  4DR2 I;  2AJ4 A;  4GKJ E;  4NXN E;  4WUD A;  2OI2 A;  3Q6N A;  4JI8 E;  4JI1 I;  3ZM7 A;  5LMU I;  2GS8 A;  4LF5 E;  2O1V A;  4UT4 A;  2VQE E;  4DR1 E;  1XHK A;  1N0U A;  1S4E A;  1D6T A;  3ZKD A;  4JI4 E;  1I94 I;  2UXC E;  2HKJ A;  2BM0 A;  3K17 A;  4DV3 I;  4NXM E;  4JI6 E;  2UXD E;  4KQV A;  4P52 A;  4LFB E;  4YHH E;  4DUZ E;  4HY1 A;  4DV0 E;  2UUC I;  2UXB E;  1IBL E;  3V5R A;  4Z7Y A;  4DR7 I;  2R3V A;  1HR0 E;  1Z0T A;  4FWG A;  4M1K A;  2BM1 A;  4I3H A;  4AQY I;  3Q6M A;  4DV4 I;  4IZK A;  1H73 A;  4B3M I;  3ZKB A;  1Z0G A;  4GKK E;  4FWH A;  1ZM2 A;  1N36 E;  1PVG A;  5GMD A;  4DV6 E;  1K47 A;  1IBM I;  4LF7 I;  1N0V C;  4B3S I;  1Z5A A;  5IT9 Q;  2IOP A;  2ZBK B;  5IT9 C;  3D4J A;  2V34 A;  2J7K A;  4DR3 E;  1N34 I;  1PIE A;  4JI0 E;  4DR6 I;  4PRX A;  1KVK A;  4MYU A;  1Z59 A;  3HUL A;  2UU9 E;  4OX9 I;  4LFA I;  3WU4 A;  1FWL A;  2V2Q A;  4HXZ A;  3T1Y E;  4DPX A;  4DPU A;  3M6A A;  2CG9 A;  2VQF E;  4DPY A;  4LF9 I;  4X65 E;  1S16 A;  3ZZT A;  1H7U A;  4DV1 E;  4DV7 I;  4KHP I;  1H7S A;  2DEI A;  2V2Z A;  3F0N A;  4IZK B;  2UUA I;  1HNZ E;  3HJC A;  2X36 A;  3PYG A;  2R42 A;  4PU9 A;  1J5E I;  4JG4 A;  1BKN A;  4FW9 A;  4B3T I;  3LNU A;  2O1U A;  4ZVI A;  3V2U C;  4X62 I;  2UUB E;  5IWA E;  1HK7 A;  2NPF A;  4IZJ A;  3QT7 A;  2HFU A;  3CWV A;  1NHH A;  3LPS A;  4EMD A;  1HNW E;  4DXL A;  1XNQ I;  3H4L A;  1NZ0 A;  3WU5 A;  1XMO I;  3OTO I;  1XMQ I;  4JI1 E;  3J81 Q;  4JI2 E;  3J80 Q;  3J81 C;  4IZJ D;  1ZM4 A;  3J80 C;  2HK2 A;  2EFG A;  4B3R E;  4K0K E;  2A2D A;  5L3J A;  4DR4 E;  2HHH I;  2PNL A;  2PNM A;  4R1F A;  1MU5 A;  4GKJ I;  3QT8 A;  1B63 A;  4NXN I;  2WW4 A;  3ZZU A;  1B62 A;  1HNX E;  4YY3 E;  4LF5 I;  4DV5 E;  4IZJ B;  2VQE I;  4DR1 I;  4LF6 E;  4DU8 A;  5LMN E;  4LF4 E;  3GON A;  3B8H A;  4JI4 I;  2ZM6 E;  3P06 A;  4DUY E;  1H72 C;  4NXM I;  2V8P A;  2CZ9 A;  5A2Q Q;  4HAC B;  4JI6 I;  2UXD I;  4LFB I;  4YHH I;  5A2Q C;  4DUZ I;  1FJG I;  4DV0 I;  1Z0B A;  3K85 A;  2UXB I;  1IBL I;  4DR5 I;  2E5L E;  4LFC E;  3J7A G;  1Z5C A;  1HR0 I;  1MX0 A;  1ZXN A;  4JI5 E;  4JI3 I;  1ZM9 A;  4JI7 E;  2LJP A;  3PYD A;  4LFA E;  1OJ4 A;  1Y4S A;  4GKK I;  2F4V E;  1KKH A;  5BR8 E;  1N36 I;  4DV6 I;  2Q2E B;  4LF9 E;  2IOQ A;  4JV5 E;  4X66 E;  1NHJ A;  4PRV A;  4DV2 E;  3PYE A;  1IBK E;  5LL6 R;  4WUC A;  1XNR E;  4DR3 I;  4JI0 I;  2Z5C A;  4N3O A;  3J7A M;  2UU9 I;  3PRY A;  4X64 E;  3T1H E;  4URL A;  3T1Y I;  1QZR A;  1FWK A;  3PYF A;  4DPT A;  5FLX Q;  2VQF I;  2A2C A;  1N32 E;  2XEX A;  4X65 I;  5FLX C;  4DV1 I;  4ED4 A;  4JYA E;  1HNZ I;  4LF8 E;  4RPF A;  4MYT A;  4DR2 E;  2X7I A;  3LTO A;  1EI1 A;  3K1J A;  2CGE A;  5LMU E;  1ZM3 A;  1Z5B A;  4HAC A;  1U2R A;  2UUB I;  1N33 I;  3ZZ0 A;  2O1T A;  1I94 E;  2Z5C B;  2HFS A;  1HNW I;  4DV3 E;  1RR9 A;  4JI2 I;  1WUU A;  4JI8 I;  1FNM A;  1RRE A;  2UUC E;  1FKA E;  1EA6 A;  4B3R I;  4K0K I;  4DR7 E;  4P7A A;  4WUB A;  4DR4 I;  1Z0V A;  1USV A;  2Z5E A;  2Z5B A;  2UXC I;  4AQY E;  3QT5 A;  4DV4 E;  1Y4U A;  1FI4 A;  4B3M E;  4XTJ A;  1FJG E;  1NHI A;  1HNX I;  4YY3 I;  4DV5 I;  4UTG A;  4DR5 E;  4USM A;  1KIJ A;  4LF6 I;  1IBM E;  4FN5 A;  4LF7 E;  5LMN I;  4B3S E;  4LF4 I;  2ZM6 I;  4JI3 E;  1UEK A;  5GME A;  1PKP A;  4DUY I;  1N34 E;  2HKE A;  4DR6 E;  4OX9 E;  2VF3 A;  1ELO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...