2UXDI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxdI00
2HKJA 4JI6I 4DR1I 4JI2E 4FWHA 1HNZI 3T1HI 3ZZTA 4PRVA 2DEIA 4LFBE 4JI4I 4X65I 3B8HA 3B82A 2V34A 3QT8A 1I94E 4WUDA 1PIEA 1QZRA 4P7AA 4DR4I 1FKAE 4LF5I 4HACA 2GS8A 1ZM3A 2Q2EB 1K47A 4MYTA 4LFAE 1B62A 2OI2A 3ZZ0A 2V2QA 4X66E 1IBKE 5LL6R 1N34I 4HACB 2UUCE 4P52A 4DUYE 2R42A 4DV1E 4WUCA 1Z5CA 1Z59A 1MU5A 4DR1E 2R3VA 3T1YI 2VQFE 1HNZE 4KHPI 1FNMA 3J80C 1S4EA 4DUZI 4DV2I 5LMNI 1XNQI 4K0KE 3V2UC 2V8PA 3J80Q 1XMQI 4ED4A 4DV6E 4DV0I 3PYDA 4HYMA 1FJGI 2BM0A 4RPFA 1NZ0A 4B3TI 1HNWE 1N33I 4UT4A 2ZM6I 4DR6E 4X64I 1RR9A 4FWDA 4JI1I 1J5EI 4YHHE 1N32E 4GKJI 4DV3I 5GMDA 4Z7CA 1ZXMA 4YY3I 1N36I 3GONA 1VISA 2HKEA 4DV7E 4JI7I 2HFSA 4X62I 2E5LI 4JG4A 4DUZE 4DV2E 4ZVIA 1HNXE 3F0NA 4DV0E 2CZ9A 1XNRI 1IBMI 4LF9E 3ZM7A 4AQYI 4DR7E 1N33E 1XMOI 3J7AM 1EA6A 4Z7YA 4B3RI 4OX9E 2BV3A 4DPWA 4GKKI 2X36A 3OTOI 4DV3E 3WU5A 1ZM4A 1EI1A 4JI0I 3WU4A 3V5RA 1Z0BA 4DR2E 4URLA 4DR5I 2HK3A 1IBLE 4JV5I 5FLXC 1B63A 2E5LE 2HHHI 1FI4A 2UXDE 2BM1A 4DPXA 5FLXQ 4NXME 4UTGA 4LF7E 1H72C 5IWAI 4DU7A 1KVKA 1IBME 1Z5AA 1MG7A 5LMUI 4I3HA 4DV4I 4B3SI 4JI8I 2UXBI 1NHIA 5L3JA 3OTOE 4JI6E 4JI0E 5BR8I 3T1HE 1A6FA 4DR5E 4JI4E 4X65E 4JV5E 1HR0I 1PVGA 2HK2A 4FW9A 2HHHE 4LF6I 1ZM2A 3K1JA 4DR4E 4LF5E 5IWAE 2E1RA 3PYEA 2ZBKB 1H7SA 1D6TA 1ZM9A 5LMUE 4USKA 4DV4E 1N34E 3K17A 2UXBE 3JAMQ 2EFGA 2J7KA 4MYUA 4M1KA 2UUAI 2UU9I 4DV5I 2F4VI 3M6AA 3T1YE 4LF4I 4KHPE 4JI5I 4B3MI 5LMNE 1XNQE 1Z0VA 4JI2I 1MX0A 1XMQE 4DXLA 2A2DA 1FJGE 3WU3A 4EMDA 2VQEI 4B3TE 4LF8I 4LFBI 2ZM6E 1N0UA 4X64E 1I94I 1J5EE 4JI1E 2UUBI 3ZKDA 4GKJE 4YY3E 3QT7A 1N36E 1Z0TA 4FN5A 1H7UA 3PYGA 4XTJA 2UUAE 4X66I 2F4VE 4JI7E 1RREA 1IBKI 4LF4E 4NXNI 4X62E 1NHJA 3LTOA 3B78A 4DPTA 2UUCI 4JI5E 1Z0EA 1Z0WA 4DUYI 4LFCI 1Z0CA 3CWVA 4B3ME 2ZITA 4DV1I 4JI3I 4USMA 4PU9A 2NPFA 2VQFI 3WU6A 1XNRE 4HXZA 2V2ZA 1N0VC 1WUUA 4AQYE 2VQEE 4LF8E 1XHKA 4PRXA 1XMOE 1H73A 4K0KI 5GMEA 4B3RE 1FWKA 4DV6I 2UUBE 3LPSA 4KQVA 1H74A 4DPYA 4GKKE 1HNWI 3QT6A 2HFUA 1DARA 4DR6I 2LJPA 4YHHI 4JYAI 1N32I 1U2RA 4NXNE 4DR3I 2DEJA 1Z5BA 4LFCE 2UXCI 1ELOA 4DV7I 4JI3E 2X7IA 4R1FA 1ZXNA 3LNUA 3JAMC 2AJ4A 4HY1A 1HNXI 4B3SE 2WW4A 1KIJA 4JI8E 4LF9I 3QT5A 1NHHA 3J7AG 4DR7I 3D4JA 4OX9I 5BR8E 5A2QC 2XEXA 4WUBA 4JYAE 5IT9C 1OJ4A 4DR3E 1HR0E 1FWLA 2V2VA 1Z0GA 4LF6E 5A2QQ 2UXCE 3J81C 4DR2I 5IT9Q 1KKHA 3ZZUA 1IBLI 1PKPA 1S16A 2VF3A 3J81Q 4DU8A 1UEKA 1KTVA 2UXDI 3ZKBA 3PYFA 3H4LA 3HULA 4NXMI 4LF7I 4DPUA 4LFAI 2UU9E 4DV5E 1BKNA 4FWGA 3Q1QA 2A2CA
chains in the Genus database with same CATH superfamily
2HKJA 2JEAB 2JT2A 4JI6I 4DR1I 4JI2E 1XXEA 3U1YA 4FWHA 1HNZI 1USUA 3T1HI 3ZZTA 4PRVA 4MU1A 2DEIA 2CVEA 4JI4I 4LFBE 4X65I 5K36F 4IZKA 3B8HA 5JEAF 5C0XE 3B82A 2V34A 3M7ND 3QT8A 1I94E 4WUDA 1PIEA 1Y4UA 1QZRA 4P7AA 4DR4I 4IZKB 1FKAE 4LF5I 4HACA 2GQ0A 3GCMA 2GS8A 1ZM3A 2Q2EB 1K47A 4MYTA 4LFAE 1B62A 2OI2A 3ZZ0A 2V2QA 4NBQA 4X66E 4LCFA 2PNZA 5LL6R 3PS3A 4HACB 1N34I 1IBKE 2UUCE 4P52A 4DUYE 2R42A 4IFDE 4DV1E 3PS1A 4WUCA 3P3GA 1Z5CA 1Z59A 1MU5A 4DR1E 2R3VA 4AM3A 5JEAE 3T1YI 2CGEA 2VQFE 1HNZE 4KHPI 1FNMA 4MU0A 3J80C 1S4EA 4DUZI 4DV2I 5LMNI 1XNQI 4K0KE 3V2UC 5C0XB 2IERA 2V8PA 3J80Q 1XMQI 4ED4A 2BA1D 4DV6E 4DV0I 3PYDA 4HYMA 1FJGI 2BM0A 4RPFA 1NZ0A 4B3TI 1HNWE 1N33I 4UT4A 2ZM6I 4DR6E 4X64I 1VI7A 1RR9A 3H1CA 4FWDA 3HKMA 4JI1I 1J5EI 4IFDA 4YHHE 4OO1F 1N32E 4GKJI 2Z5BA 4DV3I 5GMDA 2O3ZA 4Z7CA 1ZXMA 4YY3I 1N36I 3GONA 1VISA 4IFDB 2HKEA 4DV7E 2NN6D 4QNJA 2JEBB 2Z5EA 2O1UA 4JI7I 2GO3A 5K36C 5JEAB 2HFSA 1Y6ZA 4X62I 2E5LI 4JG4A 2PNMA 4DUZE 4DV2E 5DRRA 4ZVIA 1HNXE 2BA0D 1UDQA 3F0NA 4FW3A 4DV0E 4LPFA 2CZ9A 2NN6A 4U3BA 4FW5A 1IBMI 1XNRI 4LF9E 3ZM7A 1E3HA 4AQYI 4DR7E 1N33E 1HK7A 3PRYA 1XMOI 3J7AM 1EA6A 4LCHA 4OKGA 4Z7YA 4B3RI 4OX9E 2BV3A 2NN6B 2O1VA 4DPWA 4GKKI 2X36A 3OTOI 4DV3E 3WU5A 1ZM4A 1EI1A 4JI0I 3WU4A 3Q6NA 3V5RA 4N3OA 1Z0BA 5DNXA 4DR2E 4QNKA 3P3EA 2PO2B 4URLA 4DR5I 2HK3A 4FW6A 1IBLE 4JV5I 2J65A 5FLXC 1B63A 2E5LE 2HHHI 1FI4A 3P3CA 2Z5CA 2UXDE 2BM1A 2IOPA 4DPXA 5FLXQ 4NXME 4UTGA 3M85D 4LF7E 5C0XD 1H72C 5IWAI 1USVA 1KVKA 4DU7A 1IBME 3L7ZA 1Z5AA 2Z5CB 1MG7A 4MU4A 5LMUI 4I3HA 4OO1C 4DV4I 4B3SI 2BA0G 1UDSA 4JI8I 2UXBI 1R6MA 1NHIA 3KRNA 3L7ZB 2JE6A 5L3JA 4BA2A 3OTOE 4MDTA 4JI6E 5K36E 4JI0E 5C0XA 5ELWA 5BR8I 3T1HE 2C37B 1A6FA 2WNRB 4DR5E 2JE6B 4JI4E 2AE8A 4BA2B 4FW4A 4X65E 4IFDD 4JV5E 4OZEA 1HR0I 1PVGA 2HK2A 4FW9A 2HHHE 4LF6I 4AIDA 1ZM2A 5JEAD 3K1JA 2BR2A 3DD6A 2IOQA 1OYSA 4DR4E 4LF5E 5IWAE 2E1RA 3PYEA 2ZBKB 1H7SA 1D6TA 2BR2B 1ZM9A 5LMUE 4USKA 2JEBA 5K36A 4DV4E 1R6LA 1N34E 5JEAA 3K17A 2UXBE 1UDOA 1Y60A 3JAMQ 3M85G 2EFGA 2J7KA 4MYUA 4M1KA 2UUAI 2C39A 2UU9I 4DV5I 4IS9A 5K36B 2F4VI 3M6AA 3T1YE 4LF4I 4KHPE 4J3DA 4JI5I 4B3MI 3CDIA 5DNLA 5LMNE 1XNQE 2C39B 1Z0VA 4JI2I 1MX0A 1XMQE 4DXLA 2PO1A 2A2DA 1FJGE 4GQUA 3WU3A 4AIMA 4EMDA 2VQEI 4B3TE 4LF8I 4LFBI 2GO4A 2F1DA 2ZM6E 4OO1E 5DRQA 2PO0A 1N0UA 4X64E 4U3DA 2PO1B 1I94I 1YHCA 1J5EE 4JI1E 2UUBI 3ZKDA 2PO2A 4LOMA 5DROA 5C0XF 4GKJE 2PO0B 4YY3E 3QT7A 1N36E 1Z0TA 3B4TA 4FN5A 1H7UA 3PYGA 4XTJA 2UUAE 4X66I 2F4VE 4JI7E 1RREA 1IBKI 4LF4E 4NXNI 4X62E 1NHJA 3LTOA 3B78A 4DPTA 2UUCI 4JI5E 1Z0EA 1Z0WA 4DUYI 4LFCI 1Z0CA 3CWVA 4B3ME 2WP8B 2ZITA 3UHMA 4DV1I 4JI3I 4OO1A 4USMA 4PU9A 2NPFA 2VQFI 3WU6A 1XNRE 4IFDF 4HXZA 2V2ZA 1N0VC 2VESA 1WUUA 4AQYE 2VQEE 4LF8E 1Y4SA 1XHKA 4PRXA 1XMOE 1H73A 3P06A 4K0KI 4OO1B 5GMEA 4B3RE 1FWKA 4DV6I 1UDNA 2C37A 2UUBE 3LPSA 4KQVA 1H74A 2WNRA 4DPYA 4GKKE 1HNWI 3QT6A 2HFUA 1DARA 3NZKA 4DR6I 2O1TA 2LJPA 4YHHI 4LCGA 3HJCA 4JYAI 1E3PA 1N32I 3PS2A 1U2RA 3K85A 5EL9A 4DR3I 4NXNE 5K36D 2NN6F 2DEJA 3GMEA 1Z5BA 4LFCE 2UXCI 1RHYA 1ELOA 4DV7I 4MQYA 4JI3E 2X7IA 2PNZB 4R1FA 1ZXNA 2PNLA 3CDJA 3LNUA 2IESA 3JAMC 2AJ4A 4HY1A 1HNXI 5C0XC 4B3SE 4IZJD 2WW4A 1KIJA 4JI8E 4LF9I 3QT5A 1NHHA 3J7AG 4DR7I 1P42A 2CG9A 3D4JA 4OX9I 5BR8E 2NN6E 5A2QC 3M7NG 2XEXA 4WUBA 4JYAE 5IT9C 1OJ4A 4IZJA 4DR3E 1HR0E 1FWLA 2V2VA 2C38A 1Z0GA 4LF6E 5A2QQ 2O1WA 2UXCE 1Y5YA 1OYPA 1YH8A 3J81C 4DR2I 5IT9Q 4IFDC 1KKHA 3ZZUA 3U1KA 5EKWA 2Z5BB 1IBLI 4IZJB 4BA1A 1PKPA 1S16A 2C38B 2VF3A 5JEAC 3GLLA 3J81Q 4MU3A 4DU8A 5DRPA 1OYRA 4FW7A 1UEKA 1KTVA 2UXDI 3ZKBA 3PYFA 3H4LA 3HULA 4BA1B 4NXMI 5FWKA 4OO1D 4LF7I 4DPUA 2WP8A 3P76A 4LFAI 2JEAA 4ISAA 2UU9E 4DV5E 1BKNA 3Q6MA 4FWGA 3Q1QA 2A2CA 2NN6C 2BA1G
chains in the Genus database with same CATH topology
2HKJA 4JI6I 4DR1I 4JI2E 4FWHA 1HNZI 1USUA 3T1HI 3ZZTA 4PRVA 2DEIA 4LFBE 4JI4I 4X65I 4IZKA 3B8HA 3B82A 2V34A 3QT8A 1I94E 4WUDA 1PIEA 1Y4UA 1QZRA 4P7AA 4DR4I 4IZKB 1FKAE 4LF5I 4HACA 2GQ0A 2GS8A 1ZM3A 2Q2EB 1K47A 4MYTA 4LFAE 1B62A 2OI2A 3ZZ0A 2V2QA 4X66E 1IBKE 5LL6R 1N34I 4HACB 2UUCE 4P52A 4DUYE 2R42A 4DV1E 4WUCA 1Z5CA 1Z59A 1MU5A 4DR1E 2R3VA 3T1YI 2CGEA 2VQFE 1HNZE 4KHPI 1FNMA 3J80C 1S4EA 4DUZI 4DV2I 5LMNI 1XNQI 4K0KE 3V2UC 2V8PA 3J80Q 1XMQI 4ED4A 4DV6E 4DV0I 3PYDA 4HYMA 1FJGI 2BM0A 4RPFA 1NZ0A 4B3TI 1HNWE 1N33I 4UT4A 2ZM6I 4DR6E 4X64I 1RR9A 4FWDA 4JI1I 1J5EI 4YHHE 1N32E 4GKJI 2Z5BA 4DV3I 5GMDA 4Z7CA 1ZXMA 4YY3I 1N36I 3GONA 1VISA 2HKEA 4DV7E 2Z5EA 2O1UA 4JI7I 2HFSA 1Y6ZA 4X62I 2E5LI 4JG4A 2PNMA 4DUZE 4DV2E 4ZVIA 1HNXE 3F0NA 4DV0E 2CZ9A 1XNRI 1IBMI 4LF9E 3ZM7A 4AQYI 4DR7E 1N33E 1HK7A 3PRYA 1XMOI 3J7AM 1EA6A 4Z7YA 4B3RI 4OX9E 2BV3A 2O1VA 4DPWA 4GKKI 2X36A 3OTOI 4DV3E 3WU5A 1ZM4A 1EI1A 4JI0I 3WU4A 3Q6NA 3V5RA 4N3OA 1Z0BA 4DR2E 4URLA 4DR5I 2HK3A 1IBLE 4JV5I 5FLXC 1B63A 2E5LE 2HHHI 1FI4A 2Z5CA 2UXDE 2BM1A 2IOPA 4DPXA 5FLXQ 4NXME 4UTGA 4LF7E 1H72C 5IWAI 1USVA 1KVKA 4DU7A 1IBME 1Z5AA 2Z5CB 1MG7A 5LMUI 4I3HA 4DV4I 4B3SI 4JI8I 2UXBI 1NHIA 5L3JA 3OTOE 4JI6E 4JI0E 5BR8I 3T1HE 1A6FA 4DR5E 4JI4E 4X65E 4JV5E 1HR0I 1PVGA 2HK2A 4FW9A 2HHHE 4LF6I 1ZM2A 3K1JA 2IOQA 4DR4E 4LF5E 5IWAE 2E1RA 3PYEA 2ZBKB 1H7SA 1D6TA 1ZM9A 5LMUE 4USKA 4DV4E 1N34E 3K17A 2UXBE 3JAMQ 2EFGA 2J7KA 4MYUA 4M1KA 2UUAI 2UU9I 4DV5I 2F4VI 3M6AA 3T1YE 4LF4I 4KHPE 4JI5I 4B3MI 5LMNE 1XNQE 1Z0VA 4JI2I 1MX0A 1XMQE 4DXLA 2A2DA 1FJGE 3WU3A 4EMDA 2VQEI 4B3TE 4LF8I 4LFBI 2ZM6E 1N0UA 4X64E 1I94I 1J5EE 4JI1E 2UUBI 3ZKDA 4GKJE 4YY3E 3QT7A 1N36E 1Z0TA 4FN5A 1H7UA 3PYGA 4XTJA 2UUAE 4X66I 2F4VE 4JI7E 1RREA 1IBKI 4LF4E 4NXNI 4X62E 1NHJA 3LTOA 3B78A 4DPTA 2UUCI 4JI5E 1Z0EA 1Z0WA 4DUYI 4LFCI 1Z0CA 3CWVA 4B3ME 2ZITA 4DV1I 4JI3I 4USMA 4PU9A 2NPFA 2VQFI 3WU6A 1XNRE 4HXZA 2V2ZA 1N0VC 1WUUA 4AQYE 2VQEE 4LF8E 1Y4SA 1XHKA 4PRXA 1XMOE 1H73A 3P06A 4K0KI 5GMEA 4B3RE 1FWKA 4DV6I 2UUBE 3LPSA 4KQVA 1H74A 4DPYA 4GKKE 1HNWI 3QT6A 2HFUA 1DARA 4DR6I 2O1TA 2LJPA 4YHHI 3HJCA 4JYAI 1N32I 1U2RA 3K85A 4DR3I 4NXNE 2DEJA 1Z5BA 4LFCE 2UXCI 1ELOA 4DV7I 4JI3E 2X7IA 4R1FA 1ZXNA 2PNLA 3LNUA 3JAMC 2AJ4A 4HY1A 1HNXI 4B3SE 4IZJD 2WW4A 1KIJA 4JI8E 4LF9I 3QT5A 1NHHA 3J7AG 4DR7I 2CG9A 3D4JA 4OX9I 5BR8E 5A2QC 2XEXA 4WUBA 4JYAE 5IT9C 1OJ4A 4IZJA 4DR3E 1HR0E 1FWLA 2V2VA 1Z0GA 4LF6E 5A2QQ 2O1WA 2UXCE 3J81C 4DR2I 5IT9Q 1KKHA 3ZZUA 2Z5BB 1IBLI 4IZJB 1PKPA 1S16A 2VF3A 3J81Q 4DU8A 1UEKA 1KTVA 2UXDI 3ZKBA 3PYFA 3H4LA 3HULA 4NXMI 5FWKA 4LF7I 4DPUA 4LFAI 2UU9E 4DV5E 1BKNA 3Q6MA 4FWGA 3Q1QA 2A2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKJ A;  4JI6 I;  4DR1 I;  4JI2 E;  4FWH A;  1HNZ I;  3T1H I;  3ZZT A;  4PRV A;  2DEI A;  4LFB E;  4JI4 I;  4X65 I;  3B8H A;  3B82 A;  2V34 A;  3QT8 A;  1I94 E;  4WUD A;  1PIE A;  1QZR A;  4P7A A;  4DR4 I;  1FKA E;  4LF5 I;  4HAC A;  2GS8 A;  1ZM3 A;  2Q2E B;  1K47 A;  4MYT A;  4LFA E;  1B62 A;  2OI2 A;  3ZZ0 A;  2V2Q A;  4X66 E;  1IBK E;  5LL6 R;  1N34 I;  4HAC B;  2UUC E;  4P52 A;  4DUY E;  2R42 A;  4DV1 E;  4WUC A;  1Z5C A;  1Z59 A;  1MU5 A;  4DR1 E;  2R3V A;  3T1Y I;  2VQF E;  1HNZ E;  4KHP I;  1FNM A;  3J80 C;  1S4E A;  4DUZ I;  4DV2 I;  5LMN I;  1XNQ I;  4K0K E;  3V2U C;  2V8P A;  3J80 Q;  1XMQ I;  4ED4 A;  4DV6 E;  4DV0 I;  3PYD A;  4HYM A;  1FJG I;  2BM0 A;  4RPF A;  1NZ0 A;  4B3T I;  1HNW E;  1N33 I;  4UT4 A;  2ZM6 I;  4DR6 E;  4X64 I;  1RR9 A;  4FWD A;  4JI1 I;  1J5E I;  4YHH E;  1N32 E;  4GKJ I;  4DV3 I;  5GMD A;  4Z7C A;  1ZXM A;  4YY3 I;  1N36 I;  3GON A;  1VIS A;  2HKE A;  4DV7 E;  4JI7 I;  2HFS A;  4X62 I;  2E5L I;  4JG4 A;  4DUZ E;  4DV2 E;  4ZVI A;  1HNX E;  3F0N A;  4DV0 E;  2CZ9 A;  1XNR I;  1IBM I;  4LF9 E;  3ZM7 A;  4AQY I;  4DR7 E;  1N33 E;  1XMO I;  3J7A M;  1EA6 A;  4Z7Y A;  4B3R I;  4OX9 E;  2BV3 A;  4DPW A;  4GKK I;  2X36 A;  3OTO I;  4DV3 E;  3WU5 A;  1ZM4 A;  1EI1 A;  4JI0 I;  3WU4 A;  3V5R A;  1Z0B A;  4DR2 E;  4URL A;  4DR5 I;  2HK3 A;  1IBL E;  4JV5 I;  5FLX C;  1B63 A;  2E5L E;  2HHH I;  1FI4 A;  2UXD E;  2BM1 A;  4DPX A;  5FLX Q;  4NXM E;  4UTG A;  4LF7 E;  1H72 C;  5IWA I;  4DU7 A;  1KVK A;  1IBM E;  1Z5A A;  1MG7 A;  5LMU I;  4I3H A;  4DV4 I;  4B3S I;  4JI8 I;  2UXB I;  1NHI A;  5L3J A;  3OTO E;  4JI6 E;  4JI0 E;  5BR8 I;  3T1H E;  1A6F A;  4DR5 E;  4JI4 E;  4X65 E;  4JV5 E;  1HR0 I;  1PVG A;  2HK2 A;  4FW9 A;  2HHH E;  4LF6 I;  1ZM2 A;  3K1J A;  4DR4 E;  4LF5 E;  5IWA E;  2E1R A;  3PYE A;  2ZBK B;  1H7S A;  1D6T A;  1ZM9 A;  5LMU E;  4USK A;  4DV4 E;  1N34 E;  3K17 A;  2UXB E;  3JAM Q;  2EFG A;  2J7K A;  4MYU A;  4M1K A;  2UUA I;  2UU9 I;  4DV5 I;  2F4V I;  3M6A A;  3T1Y E;  4LF4 I;  4KHP E;  4JI5 I;  4B3M I;  5LMN E;  1XNQ E;  1Z0V A;  4JI2 I;  1MX0 A;  1XMQ E;  4DXL A;  2A2D A;  1FJG E;  3WU3 A;  4EMD A;  2VQE I;  4B3T E;  4LF8 I;  4LFB I;  2ZM6 E;  1N0U A;  4X64 E;  1I94 I;  1J5E E;  4JI1 E;  2UUB I;  3ZKD A;  4GKJ E;  4YY3 E;  3QT7 A;  1N36 E;  1Z0T A;  4FN5 A;  1H7U A;  3PYG A;  4XTJ A;  2UUA E;  4X66 I;  2F4V E;  4JI7 E;  1RRE A;  1IBK I;  4LF4 E;  4NXN I;  4X62 E;  1NHJ A;  3LTO A;  3B78 A;  4DPT A;  2UUC I;  4JI5 E;  1Z0E A;  1Z0W A;  4DUY I;  4LFC I;  1Z0C A;  3CWV A;  4B3M E;  2ZIT A;  4DV1 I;  4JI3 I;  4USM A;  4PU9 A;  2NPF A;  2VQF I;  3WU6 A;  1XNR E;  4HXZ A;  2V2Z A;  1N0V C;  1WUU A;  4AQY E;  2VQE E;  4LF8 E;  1XHK A;  4PRX A;  1XMO E;  1H73 A;  4K0K I;  5GME A;  4B3R E;  1FWK A;  4DV6 I;  2UUB E;  3LPS A;  4KQV A;  1H74 A;  4DPY A;  4GKK E;  1HNW I;  3QT6 A;  2HFU A;  1DAR A;  4DR6 I;  2LJP A;  4YHH I;  4JYA I;  1N32 I;  1U2R A;  4NXN E;  4DR3 I;  2DEJ A;  1Z5B A;  4LFC E;  2UXC I;  1ELO A;  4DV7 I;  4JI3 E;  2X7I A;  4R1F A;  1ZXN A;  3LNU A;  3JAM C;  2AJ4 A;  4HY1 A;  1HNX I;  4B3S E;  2WW4 A;  1KIJ A;  4JI8 E;  4LF9 I;  3QT5 A;  1NHH A;  3J7A G;  4DR7 I;  3D4J A;  4OX9 I;  5BR8 E;  5A2Q C;  2XEX A;  4WUB A;  4JYA E;  5IT9 C;  1OJ4 A;  4DR3 E;  1HR0 E;  1FWL A;  2V2V A;  1Z0G A;  4LF6 E;  5A2Q Q;  2UXC E;  3J81 C;  4DR2 I;  5IT9 Q;  1KKH A;  3ZZU A;  1IBL I;  1PKP A;  1S16 A;  2VF3 A;  3J81 Q;  4DU8 A;  1UEK A;  1KTV A;  2UXD I;  3ZKB A;  3PYF A;  3H4L A;  3HUL A;  4NXM I;  4LF7 I;  4DPU A;  4LFA I;  2UU9 E;  4DV5 E;  1BKN A;  4FWG A;  3Q1Q A;  2A2C A; 
#chains in the Genus database with same CATH topology
 2HKJ A;  2JEA B;  2JT2 A;  4JI6 I;  4DR1 I;  4JI2 E;  1XXE A;  3U1Y A;  4FWH A;  1HNZ I;  1USU A;  3T1H I;  3ZZT A;  4PRV A;  4MU1 A;  2DEI A;  2CVE A;  4JI4 I;  4LFB E;  4X65 I;  5K36 F;  4IZK A;  3B8H A;  5JEA F;  5C0X E;  3B82 A;  2V34 A;  3M7N D;  3QT8 A;  1I94 E;  4WUD A;  1PIE A;  1Y4U A;  1QZR A;  4P7A A;  4DR4 I;  4IZK B;  1FKA E;  4LF5 I;  4HAC A;  2GQ0 A;  3GCM A;  2GS8 A;  1ZM3 A;  2Q2E B;  1K47 A;  4MYT A;  4LFA E;  1B62 A;  2OI2 A;  3ZZ0 A;  2V2Q A;  4NBQ A;  4X66 E;  4LCF A;  2PNZ A;  5LL6 R;  3PS3 A;  4HAC B;  1N34 I;  1IBK E;  2UUC E;  4P52 A;  4DUY E;  2R42 A;  4IFD E;  4DV1 E;  3PS1 A;  4WUC A;  3P3G A;  1Z5C A;  1Z59 A;  1MU5 A;  4DR1 E;  2R3V A;  4AM3 A;  5JEA E;  3T1Y I;  2CGE A;  2VQF E;  1HNZ E;  4KHP I;  1FNM A;  4MU0 A;  3J80 C;  1S4E A;  4DUZ I;  4DV2 I;  5LMN I;  1XNQ I;  4K0K E;  3V2U C;  5C0X B;  2IER A;  2V8P A;  3J80 Q;  1XMQ I;  4ED4 A;  2BA1 D;  4DV6 E;  4DV0 I;  3PYD A;  4HYM A;  1FJG I;  2BM0 A;  4RPF A;  1NZ0 A;  4B3T I;  1HNW E;  1N33 I;  4UT4 A;  2ZM6 I;  4DR6 E;  4X64 I;  1VI7 A;  1RR9 A;  3H1C A;  4FWD A;  3HKM A;  4JI1 I;  1J5E I;  4IFD A;  4YHH E;  4OO1 F;  1N32 E;  4GKJ I;  2Z5B A;  4DV3 I;  5GMD A;  2O3Z A;  4Z7C A;  1ZXM A;  4YY3 I;  1N36 I;  3GON A;  1VIS A;  4IFD B;  2HKE A;  4DV7 E;  2NN6 D;  4QNJ A;  2JEB B;  2Z5E A;  2O1U A;  4JI7 I;  2GO3 A;  5K36 C;  5JEA B;  2HFS A;  1Y6Z A;  4X62 I;  2E5L I;  4JG4 A;  2PNM A;  4DUZ E;  4DV2 E;  5DRR A;  4ZVI A;  1HNX E;  2BA0 D;  1UDQ A;  3F0N A;  4FW3 A;  4DV0 E;  4LPF A;  2CZ9 A;  2NN6 A;  4U3B A;  4FW5 A;  1IBM I;  1XNR I;  4LF9 E;  3ZM7 A;  1E3H A;  4AQY I;  4DR7 E;  1N33 E;  1HK7 A;  3PRY A;  1XMO I;  3J7A M;  1EA6 A;  4LCH A;  4OKG A;  4Z7Y A;  4B3R I;  4OX9 E;  2BV3 A;  2NN6 B;  2O1V A;  4DPW A;  4GKK I;  2X36 A;  3OTO I;  4DV3 E;  3WU5 A;  1ZM4 A;  1EI1 A;  4JI0 I;  3WU4 A;  3Q6N A;  3V5R A;  4N3O A;  1Z0B A;  5DNX A;  4DR2 E;  4QNK A;  3P3E A;  2PO2 B;  4URL A;  4DR5 I;  2HK3 A;  4FW6 A;  1IBL E;  4JV5 I;  2J65 A;  5FLX C;  1B63 A;  2E5L E;  2HHH I;  1FI4 A;  3P3C A;  2Z5C A;  2UXD E;  2BM1 A;  2IOP A;  4DPX A;  5FLX Q;  4NXM E;  4UTG A;  3M85 D;  4LF7 E;  5C0X D;  1H72 C;  5IWA I;  1USV A;  1KVK A;  4DU7 A;  1IBM E;  3L7Z A;  1Z5A A;  2Z5C B;  1MG7 A;  4MU4 A;  5LMU I;  4I3H A;  4OO1 C;  4DV4 I;  4B3S I;  2BA0 G;  1UDS A;  4JI8 I;  2UXB I;  1R6M A;  1NHI A;  3KRN A;  3L7Z B;  2JE6 A;  5L3J A;  4BA2 A;  3OTO E;  4MDT A;  4JI6 E;  5K36 E;  4JI0 E;  5C0X A;  5ELW A;  5BR8 I;  3T1H E;  2C37 B;  1A6F A;  2WNR B;  4DR5 E;  2JE6 B;  4JI4 E;  2AE8 A;  4BA2 B;  4FW4 A;  4X65 E;  4IFD D;  4JV5 E;  4OZE A;  1HR0 I;  1PVG A;  2HK2 A;  4FW9 A;  2HHH E;  4LF6 I;  4AID A;  1ZM2 A;  5JEA D;  3K1J A;  2BR2 A;  3DD6 A;  2IOQ A;  1OYS A;  4DR4 E;  4LF5 E;  5IWA E;  2E1R A;  3PYE A;  2ZBK B;  1H7S A;  1D6T A;  2BR2 B;  1ZM9 A;  5LMU E;  4USK A;  2JEB A;  5K36 A;  4DV4 E;  1R6L A;  1N34 E;  5JEA A;  3K17 A;  2UXB E;  1UDO A;  1Y60 A;  3JAM Q;  3M85 G;  2EFG A;  2J7K A;  4MYU A;  4M1K A;  2UUA I;  2C39 A;  2UU9 I;  4DV5 I;  4IS9 A;  5K36 B;  2F4V I;  3M6A A;  3T1Y E;  4LF4 I;  4KHP E;  4J3D A;  4JI5 I;  4B3M I;  3CDI A;  5DNL A;  5LMN E;  1XNQ E;  2C39 B;  1Z0V A;  4JI2 I;  1MX0 A;  1XMQ E;  4DXL A;  2PO1 A;  2A2D A;  1FJG E;  4GQU A;  3WU3 A;  4AIM A;  4EMD A;  2VQE I;  4B3T E;  4LF8 I;  4LFB I;  2GO4 A;  2F1D A;  2ZM6 E;  4OO1 E;  5DRQ A;  2PO0 A;  1N0U A;  4X64 E;  4U3D A;  2PO1 B;  1I94 I;  1YHC A;  1J5E E;  4JI1 E;  2UUB I;  3ZKD A;  2PO2 A;  4LOM A;  5DRO A;  5C0X F;  4GKJ E;  2PO0 B;  4YY3 E;  3QT7 A;  1N36 E;  1Z0T A;  3B4T A;  4FN5 A;  1H7U A;  3PYG A;  4XTJ A;  2UUA E;  4X66 I;  2F4V E;  4JI7 E;  1RRE A;  1IBK I;  4LF4 E;  4NXN I;  4X62 E;  1NHJ A;  3LTO A;  3B78 A;  4DPT A;  2UUC I;  4JI5 E;  1Z0E A;  1Z0W A;  4DUY I;  4LFC I;  1Z0C A;  3CWV A;  4B3M E;  2WP8 B;  2ZIT A;  3UHM A;  4DV1 I;  4JI3 I;  4OO1 A;  4USM A;  4PU9 A;  2NPF A;  2VQF I;  3WU6 A;  1XNR E;  4IFD F;  4HXZ A;  2V2Z A;  1N0V C;  2VES A;  1WUU A;  4AQY E;  2VQE E;  4LF8 E;  1Y4S A;  1XHK A;  4PRX A;  1XMO E;  1H73 A;  3P06 A;  4K0K I;  4OO1 B;  5GME A;  4B3R E;  1FWK A;  4DV6 I;  1UDN A;  2C37 A;  2UUB E;  3LPS A;  4KQV A;  1H74 A;  2WNR A;  4DPY A;  4GKK E;  1HNW I;  3QT6 A;  2HFU A;  1DAR A;  3NZK A;  4DR6 I;  2O1T A;  2LJP A;  4YHH I;  4LCG A;  3HJC A;  4JYA I;  1E3P A;  1N32 I;  3PS2 A;  1U2R A;  3K85 A;  5EL9 A;  4DR3 I;  4NXN E;  5K36 D;  2NN6 F;  2DEJ A;  3GME A;  1Z5B A;  4LFC E;  2UXC I;  1RHY A;  1ELO A;  4DV7 I;  4MQY A;  4JI3 E;  2X7I A;  2PNZ B;  4R1F A;  1ZXN A;  2PNL A;  3CDJ A;  3LNU A;  2IES A;  3JAM C;  2AJ4 A;  4HY1 A;  1HNX I;  5C0X C;  4B3S E;  4IZJ D;  2WW4 A;  1KIJ A;  4JI8 E;  4LF9 I;  3QT5 A;  1NHH A;  3J7A G;  4DR7 I;  1P42 A;  2CG9 A;  3D4J A;  4OX9 I;  5BR8 E;  2NN6 E;  5A2Q C;  3M7N G;  2XEX A;  4WUB A;  4JYA E;  5IT9 C;  1OJ4 A;  4IZJ A;  4DR3 E;  1HR0 E;  1FWL A;  2V2V A;  2C38 A;  1Z0G A;  4LF6 E;  5A2Q Q;  2O1W A;  2UXC E;  1Y5Y A;  1OYP A;  1YH8 A;  3J81 C;  4DR2 I;  5IT9 Q;  4IFD C;  1KKH A;  3ZZU A;  3U1K A;  5EKW A;  2Z5B B;  1IBL I;  4IZJ B;  4BA1 A;  1PKP A;  1S16 A;  2C38 B;  2VF3 A;  5JEA C;  3GLL A;  3J81 Q;  4MU3 A;  4DU8 A;  5DRP A;  1OYR A;  4FW7 A;  1UEK A;  1KTV A;  2UXD I;  3ZKB A;  3PYF A;  3H4L A;  3HUL A;  4BA1 B;  4NXM I;  5FWK A;  4OO1 D;  4LF7 I;  4DPU A;  2WP8 A;  3P76 A;  4LFA I;  2JEA A;  4ISA A;  2UU9 E;  4DV5 E;  1BKN A;  3Q6M A;  4FWG A;  3Q1Q A;  2A2C A;  2NN6 C;  2BA1 G; 
#chains in the Genus database with same CATH homology
 2HKJ A;  4JI6 I;  4DR1 I;  4JI2 E;  4FWH A;  1HNZ I;  1USU A;  3T1H I;  3ZZT A;  4PRV A;  2DEI A;  4LFB E;  4JI4 I;  4X65 I;  4IZK A;  3B8H A;  3B82 A;  2V34 A;  3QT8 A;  1I94 E;  4WUD A;  1PIE A;  1Y4U A;  1QZR A;  4P7A A;  4DR4 I;  4IZK B;  1FKA E;  4LF5 I;  4HAC A;  2GQ0 A;  2GS8 A;  1ZM3 A;  2Q2E B;  1K47 A;  4MYT A;  4LFA E;  1B62 A;  2OI2 A;  3ZZ0 A;  2V2Q A;  4X66 E;  1IBK E;  5LL6 R;  1N34 I;  4HAC B;  2UUC E;  4P52 A;  4DUY E;  2R42 A;  4DV1 E;  4WUC A;  1Z5C A;  1Z59 A;  1MU5 A;  4DR1 E;  2R3V A;  3T1Y I;  2CGE A;  2VQF E;  1HNZ E;  4KHP I;  1FNM A;  3J80 C;  1S4E A;  4DUZ I;  4DV2 I;  5LMN I;  1XNQ I;  4K0K E;  3V2U C;  2V8P A;  3J80 Q;  1XMQ I;  4ED4 A;  4DV6 E;  4DV0 I;  3PYD A;  4HYM A;  1FJG I;  2BM0 A;  4RPF A;  1NZ0 A;  4B3T I;  1HNW E;  1N33 I;  4UT4 A;  2ZM6 I;  4DR6 E;  4X64 I;  1RR9 A;  4FWD A;  4JI1 I;  1J5E I;  4YHH E;  1N32 E;  4GKJ I;  2Z5B A;  4DV3 I;  5GMD A;  4Z7C A;  1ZXM A;  4YY3 I;  1N36 I;  3GON A;  1VIS A;  2HKE A;  4DV7 E;  2Z5E A;  2O1U A;  4JI7 I;  2HFS A;  1Y6Z A;  4X62 I;  2E5L I;  4JG4 A;  2PNM A;  4DUZ E;  4DV2 E;  4ZVI A;  1HNX E;  3F0N A;  4DV0 E;  2CZ9 A;  1XNR I;  1IBM I;  4LF9 E;  3ZM7 A;  4AQY I;  4DR7 E;  1N33 E;  1HK7 A;  3PRY A;  1XMO I;  3J7A M;  1EA6 A;  4Z7Y A;  4B3R I;  4OX9 E;  2BV3 A;  2O1V A;  4DPW A;  4GKK I;  2X36 A;  3OTO I;  4DV3 E;  3WU5 A;  1ZM4 A;  1EI1 A;  4JI0 I;  3WU4 A;  3Q6N A;  3V5R A;  4N3O A;  1Z0B A;  4DR2 E;  4URL A;  4DR5 I;  2HK3 A;  1IBL E;  4JV5 I;  5FLX C;  1B63 A;  2E5L E;  2HHH I;  1FI4 A;  2Z5C A;  2UXD E;  2BM1 A;  2IOP A;  4DPX A;  5FLX Q;  4NXM E;  4UTG A;  4LF7 E;  1H72 C;  5IWA I;  1USV A;  1KVK A;  4DU7 A;  1IBM E;  1Z5A A;  2Z5C B;  1MG7 A;  5LMU I;  4I3H A;  4DV4 I;  4B3S I;  4JI8 I;  2UXB I;  1NHI A;  5L3J A;  3OTO E;  4JI6 E;  4JI0 E;  5BR8 I;  3T1H E;  1A6F A;  4DR5 E;  4JI4 E;  4X65 E;  4JV5 E;  1HR0 I;  1PVG A;  2HK2 A;  4FW9 A;  2HHH E;  4LF6 I;  1ZM2 A;  3K1J A;  2IOQ A;  4DR4 E;  4LF5 E;  5IWA E;  2E1R A;  3PYE A;  2ZBK B;  1H7S A;  1D6T A;  1ZM9 A;  5LMU E;  4USK A;  4DV4 E;  1N34 E;  3K17 A;  2UXB E;  3JAM Q;  2EFG A;  2J7K A;  4MYU A;  4M1K A;  2UUA I;  2UU9 I;  4DV5 I;  2F4V I;  3M6A A;  3T1Y E;  4LF4 I;  4KHP E;  4JI5 I;  4B3M I;  5LMN E;  1XNQ E;  1Z0V A;  4JI2 I;  1MX0 A;  1XMQ E;  4DXL A;  2A2D A;  1FJG E;  3WU3 A;  4EMD A;  2VQE I;  4B3T E;  4LF8 I;  4LFB I;  2ZM6 E;  1N0U A;  4X64 E;  1I94 I;  1J5E E;  4JI1 E;  2UUB I;  3ZKD A;  4GKJ E;  4YY3 E;  3QT7 A;  1N36 E;  1Z0T A;  4FN5 A;  1H7U A;  3PYG A;  4XTJ A;  2UUA E;  4X66 I;  2F4V E;  4JI7 E;  1RRE A;  1IBK I;  4LF4 E;  4NXN I;  4X62 E;  1NHJ A;  3LTO A;  3B78 A;  4DPT A;  2UUC I;  4JI5 E;  1Z0E A;  1Z0W A;  4DUY I;  4LFC I;  1Z0C A;  3CWV A;  4B3M E;  2ZIT A;  4DV1 I;  4JI3 I;  4USM A;  4PU9 A;  2NPF A;  2VQF I;  3WU6 A;  1XNR E;  4HXZ A;  2V2Z A;  1N0V C;  1WUU A;  4AQY E;  2VQE E;  4LF8 E;  1Y4S A;  1XHK A;  4PRX A;  1XMO E;  1H73 A;  3P06 A;  4K0K I;  5GME A;  4B3R E;  1FWK A;  4DV6 I;  2UUB E;  3LPS A;  4KQV A;  1H74 A;  4DPY A;  4GKK E;  1HNW I;  3QT6 A;  2HFU A;  1DAR A;  4DR6 I;  2O1T A;  2LJP A;  4YHH I;  3HJC A;  4JYA I;  1N32 I;  1U2R A;  3K85 A;  4DR3 I;  4NXN E;  2DEJ A;  1Z5B A;  4LFC E;  2UXC I;  1ELO A;  4DV7 I;  4JI3 E;  2X7I A;  4R1F A;  1ZXN A;  2PNL A;  3LNU A;  3JAM C;  2AJ4 A;  4HY1 A;  1HNX I;  4B3S E;  4IZJ D;  2WW4 A;  1KIJ A;  4JI8 E;  4LF9 I;  3QT5 A;  1NHH A;  3J7A G;  4DR7 I;  2CG9 A;  3D4J A;  4OX9 I;  5BR8 E;  5A2Q C;  2XEX A;  4WUB A;  4JYA E;  5IT9 C;  1OJ4 A;  4IZJ A;  4DR3 E;  1HR0 E;  1FWL A;  2V2V A;  1Z0G A;  4LF6 E;  5A2Q Q;  2O1W A;  2UXC E;  3J81 C;  4DR2 I;  5IT9 Q;  1KKH A;  3ZZU A;  2Z5B B;  1IBL I;  4IZJ B;  1PKP A;  1S16 A;  2VF3 A;  3J81 Q;  4DU8 A;  1UEK A;  1KTV A;  2UXD I;  3ZKB A;  3PYF A;  3H4L A;  3HUL A;  4NXM I;  5FWK A;  4LF7 I;  4DPU A;  4LFA I;  2UU9 E;  4DV5 E;  1BKN A;  3Q6M A;  4FWG A;  3Q1Q A;  2A2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...