4JI3E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji3E02
3CWVA 1YYOA 2AJ4A 4USMA 1N34E 4LF5E 1EI1A 2LTRA 4PRXA 2UUBI 5LMUE 3ZZTA 4DUYI 4DV5E 3LTOA 1J5EI 2L2NA 2RS6A 1YYWA 4B3RI 5LMNI 1ZM2A 4LF9I 2F4VI 3Q1QA 2UXBI 1N34I 4JG4A 2NPFA 4LF8E 4GKKE 4DV5I 2L3CA 4JI3E 5FLXQ 4LF7I 2B7VA 4LFAI 4X62I 1HNWI 4USKA 4X66I 2HKJA 4DR6I 4GKKI 4EMDA 2DEJA 4HACB 4NXMI 4KQVA 1XMOE 1KTVA 1X49A 5IWAI 1Z0EA 2NA2A 4AQYI 1X48A 3ZZUA 4M30A 4DV7I 1T4OA 3K1JA 4DR2E 4DV6I 4DV4E 3PYFA 2N3GA 1Z0VA 4DPXA 1MU5A 1Z59A 4JI1E 1FJGE 4WUCA 3T1HI 4YHHE 1XMQI 1NHJA 2HHHI 4FN5A 2B3TB 1MG7A 3JAMC 3J80C 2VQEE 2NUGA 1NZ0A 3B8HA 1ZM9A 2LTSA 4YY3E 4DXLA 3QT6A 2ZITA 1H7UA 4DUZE 3C4TA 2UUCE 4JI5I 2WW4A 1T4NA 1ZXNA 1XNQI 2RSMA 4DR1I 2V8PA 1YZ9A 4NXNE 2L3JA 2CZ9A 3M6AA 1FWKA 3J81C 1H73A 2JY9A 2E5LE 2UXCE 4GKJI 2UUAI 2UU9E 5CFFE 1IBMI 4I3HA 4LFBI 4JI2E 3J7AG 4UTGA 1N32I 2V34A 1EA6A 4LF6I 2DIXA 3VYXA 1HNXE 2LUQA 1N33I 4X65E 4LFCE 2IHR1 3HULA 1FNMA 3OTOE 4JI8E 4DV0E 1KKHA 3T1YE 3J7Yp 3GONA 2YT4A 4RPFA 2UU9I 3QT8A 4LF5I 2E1RA 2Q2EB 1UHZA 1S4EA 5FLXC 4JI7E 2HK3A 1IBKE 4DV1E 2V2VA 5LMUI 1HNXI 4HACA 2VQFE 4JYAE 3K17A 1OJ4A 4DR7E 4M1KA 2A2CA 1HNZE 4DPYA 2KHXA 4JV5E 2GS8A 4MYUA 4DKKA 1FKAE 1T4LB 1GQEA 4DV2E 4LF8I 1IBKI 4DV1I 1QZRA 3H4LA 4JI0E 4JI3I 1A6FA 1DARA 4X64E 2HFUA 3ADLA 1DI2A 1H72C 4B3SE 4FWGA 1YYKA 2UXDE 4OOGC 1QU6A 4PU9A 1XMOI 1WHQA 1J26A 3LPSA 5IT9Q 3ADJA 4MYTA 1WUUA 4XTJA 1WHNA 4P7AA 3LLHA 4DR2I 2LRSA 4B3SI 4LF4E 1KIJA 2UXDI 4DV4I 2VF3A 4WUDA 5GMDA 5A2QQ 4JI1I 1FJGI 4DR5E 1ZBTA 4K0KE 4YHHI 3D4JA 4FWHA 4UT4A 1Z0TA 2R3VA 5GMEA 1RR9A 4ZVIA 4DPWA 4Z7CA 2LUPB 2VQEI 4OX9E 2EFGA 2NUEA 1U2RA 1I94E 2XEXA 4K0KI 3ADIA 1Z0WA 2ZM6E 4YY3I 1NHIA 4KHPE 4DPUA 3ZM7A 4DR4E 4DUZI 4WFTA 1X47A 2EZ6A 2UUCI 1IBLE 4B3ME 3V5RA 5LL6R 2J7KA 2HKEA 2HFSA 1RC7A 4JI6E 4R1FA 3PYDA 4NXNI 3C4BA 2UUBE 3F0NA 4WUBA 1D6TA 4ED4A 1J5EE 2E5LI 2A2DA 1BKNA 3LNUA 5L3JA 2UXCI 4B3RE 1KVKA 1IBLI 3J81Q 2RS7A 5LMNE 2MDRA 4LF9E 2F4VE 1MX0A 4JI2I 2UXBE 4JI6I 4DU8A 2X36A 1N36E 1N0VC 3PYGA 4PRVA 1N0UA 2N3HA 4X65I 1Z5BA 3ZKDA 4LFCI 3OTOI 4JI8I 4DV0I 3T1YI 1HR0E 4LF7E 4LFAE 1PVGA 4X62E 1N36I 1HNWE 4JI7I 4X66E 2VQFI 4DR6E 4JYAI 1H74A 2JVAA 5BR8E 1UEKA 4NXME 4DR7I 1HNZI 3P1XA 1VISA 3WU6A 3WU3A 4DV3E 5IWAE 4URLA 1HR0I 4JV5I 2B7TA 4AQYE 2BV3A 2ZBKB 1ZM3A 1RQ0A 3ZZ0A 3B82A 4DV7E 4HYMA 3VYYA 2LJPA 2V2QA 4DV2I 1Z5CA 3ADGA 1PKPA 3WU5A 5IT9C 4DV6E 2L2KB 3QT7A 2LJHA 3B78A 4JI0I 5BR8I 2X7IA 2HK2A 4X64I 1Z0BA 4DV3I 3WU4A 3QT5A 4HY1A 3T1HE 1RREA 1XMQE 1XNRE 4FWDA 2HHHE 4DU7A 2L2MA 1Z0GA 5A2QC 2OI2A 1B63A 2V2ZA 4JI4E 1ZM4A 2NUFA 1FI4A 4P52A 2L33A 1H7SA 1STUA 2CPNA 1S16A 2DB2A 1FWLA 1XNRI 1O0WA 4LF4I 2DEIA 4DR3E 1Z0CA 3PYEA 4JI4I 4JI5E 2DMYA 3V2UC 4FW9A 4DR5I 1K47A 2BM0A 1XNQE 3JAMQ 3J80Q 4DR1E 1PIEA 4DR3I 4M2ZA 4OX9I 4B3TE 4DPTA 4Z7YA 2LBSB 1ZXMA 4GKJE 3HTXA 2UUAE 2BM1A 1I94I 1IBME 2R42A 4LFBE 1N32E 4X8WA 1UILA 1NHHA 2RTXA 1Z5AA 2ZM6I 4LF6E 1ELOA 4DUYE 4KHPI 1XHKA 1N33E 4WYQB 4DR4I 3ZKBA 4B3TI 1B62A 4HXZA 4B3MI 1EKZA 3J7AM
chains in the Genus database with same CATH superfamily
3CWVA 2JXPA 3P3EA 4LU9A 2G7HA 5A6JA 1YYOA 1N34E 4LF5E 2AJ4A 3UHMA 4USMA 5K36B 1EI1A 2EN2A 2EOMA 2LTRA 4PRXA 4P78A 4M9VC 2UUBI 2GHFA 5LMUE 2WP8A 3ZZTA 4DUYI 2YSPA 4ZYHA 2PNZA 1WXRA 4DV5E 2J7JA 4IS9A 4OO1C 1F2IG 3LTOA 1J5EI 1X5WA 3OMLA 2L2NA 2RS6A 1YYWA 4B3RI 2EM6A 2EOFA 2LV2A 4OKGA 5LMNI 1ZM2A 4NBQA 4LF9I 2F4VI 3Q1QA 2HJJA 2JYAA 2EPUA 4OO1E 2UXBI 1N34I 4JG4A 2PO0B 5F3WA 2NPFA 2EMKA 2LO3A 2WBSA 1SFEA 3ZOQB 4LF8E 2VRDA 2NN6B 2ODRC 5KL7A 4GKKE 4DV5I 2BA1G 2C37A 2L3CA 4JI3E 5FLXQ 2EPRA 1PDAA 2LVHA 1G2DC 2VE7C 2PRTA 2O1UA 2L6MA 2BA1D 5DNXA 2B7VA 2EMWA 2CGEA 4LF7I 4LFAI 4MLVA 4X62I 2Q8UA 2CT1A 2YTNA 1HNWI 2EL6A 1Y4UA 4USKA 1GZ6A 4X66I 2HKJA 2PNLA 4DR6I 4GKKI 2EJ4A 2CSHA 4ZYEA 4EMDA 3KZZA 2DEJA 3THOB 2EOIA 4HACB 4NXMI 4KQVA 5DNLA 3Q6MA 1XMOE 1KTVA 4O24A 2EMBA 1X49A 2JE6A 5IWAI 4MU1A 4IZJA 2EN3A 2NA2A 1Z0EA 4AQYI 2O1TA 2K7IA 2BR2B 1X48A 4HTGA 3ZZUA 4M30A 2Z5CB 5C0XA 4DV7I 4F9CB 1T4OA 3K1JA 4DR2E 1MGTA 4LTYA 5DRQA 4M0VA 2JEBA 3M85G 4DV6I 1JK1A 1UDSA 1PJQA 4DV4E 3PYFA 2N3GA 1Z0VA 4DPXA 1MU5A 1XXEA 5JEAE 3L00A 1YHCA 3GCMA 2YTPA 2JR1A 5KL3A 2HGHA 2MKNA 4IZKB 4LOMA 1Z59A 3P76A 5JEAD 3EPJA 4GEQB 3M85D 3L7ZA 4OO1F 4BA2B 4JI1E 2YTDA 1FJGE 4WUCA 4QNJA 3T1HI 2EN7A 4YHHE 1OYPA 5DRPA 2BA0G 1NCSA 4WX9A 1XMQI 2Z5BB 1G2FC 1NHJA 2HHHI 4FN5A 1TF3A 2V83A 2VESA 2B3TB 1MG7A 1A1KA 4FW6A 2JEAA 2BA0D 3P06A 4IFDB 3PS2A 3JAMC 2MC6A 2EL4A 4BS9A 3J80C 2VQEE 2NUGA 2BBGA 2EM5A 3DD6A 4O4KA 1WJPA 1NZ0A 3B8HA 1ZM9A 1Y5YA 2EM2A 3HKMA 2EE8A 2LTSA 2EPXA 2YTEA 2EWLA 2FGGA 2MC5A 4F9BB 4YY3E 2EMFA 2EMGA 3KZYA 3H1CA 4DXLA 4OO1A 3QT6A 3EPLA 2ZITA 1H7UA 2ELZA 4DUZE 5EKWA 2ENHA 2GLIA 2L8TA 3C4TA 3F6HA 2UUCE 4I8OA 2C39A 4BA1A 2YTJA 4JI5I 2EOHA 1X6HA 1GTKA 1BB8A 3HJCA 2WW4A 2YRHA 1T4NA 5TSEA 2V87A 1ZXNA 1XNQI 2RSMA 5IV8B 1AAYA 4DR1I 2V8PA 1YZ9A 4NXNE 1P42A 4IFDE 2LCEA 2L3JA 2CZ9A 3M6AA 1FWKA 2ELYA 2PNMA 3J81C 2WNRB 4MU0A 2R1FA 1H73A 4J3DA 2JY9A 1A1GA 2E5LE 3C6MA 2UXCE 2V85A 2PO1B 2Z5EA 2EQ1A 4GKJI 2YTOA 2UUAI 2VF1A 2UU9E 5CFFE 1IBMI 4I3HA 4LFBI 4JI2E 1ZU1A 3J7AG 4IZJD 5AE3A 4UTGA 1N32I 4FW3A 2V34A 1EA6A 4LF6I 2DIXA 1IQSA 1TN9A 3VYXA 2EQ3A 3M7NG 1HNXE 2LUQA 5KL5A 1N33I 3P3CA 2BB8A 2R76A 4X65E 4LFCE 2IHR1 3HULA 4RHBB 3OTOE 1FNMA 2I9IA 4JI8E 3DJWA 4DV0E 2JP9A 4TUIA 1KKHA 3M7ND 3T1YE 5K36C 3J7Yp 3GONA 2IOPA 2YT4A 5AE1A 4RPFA 2UU9I 3QT8A 4LF5I 4F6MA 2E1RA 2YTFA 4WSGA 2Q2EB 1UHZA 2EPZA 2V88A 1S4EA 2LE2A 5FLXC 4JI7E 2HK3A 1IBKE 4WSPA 4DV1E 2V2VA 5LMUI 4HACA 2VQFE 1HNXI 4JYAE 2EPLX 2EN4A 5C0XF 3K17A 2O1VA 1OJ4A 4ISAA 4DR7E 5AE2A 4M1KA 2EPCA 2A2CA 2EM7A 1ZR9A 1HNZE 1RHYA 4DPYA 2C38B 2KHXA 4JV5E 2GS8A 4MYUA 5DRRA 5JEAB 4BHBA 4DKKA 1FKAE 3AUZA 2B9DA 1N3GA 1T4LB 3HPZA 2EM9A 1GQEA 5IXMB 2NN6C 3GLLA 4DV2E 2KOUA 1BBOA 2MKDA 1E3PA 4AIDA 2KONA 4LF8I 1IBKI 4DV1I 3JTZA 3LMLA 1MEYC 1QZRA 1X6FA 4Q35B 3H4LA 2EPMX 4OO1D 2WP8B 4JI0E 5FWKA 2PNZB 4R8OA 4JI3I 1USUA 1A6FA 1DARA 4FW5A 4X64E 4LCFA 2YU8A 2HFUA 4MLQA 4F9AB 2JOXA 3ADLA 1DI2A 2PO2A 1H72C 4B3SE 4FWGA 1YYKA 1A1FA 2UXDE 4OOGC 3Q6NA 4FK5C 4FW4A 1QU6A 5A6BA 1P47A 4PU9A 2RPCA 1XMOI 2CG9A 4BHCA 1BBGA 3M99B 1PJSA 2EMYA 1WHQA 1J26A 3LPSA 3VHTB 5IT9Q 2C37B 1KJKA 3ADJA 4MYTA 1WUUA 2EP3A 4XTJA 2FV4B 1VI7A 1WHNA 2EM8A 3LLHA 4P7AA 4DR2I 2EOSA 5K36F 2LRSA 4B3SI 1YUIA 4LF4E 3PS1A 1KIJA 2UXDI 5ADZA 4DV4I 2V8QB 2VF3A 4WUDA 3U1YA 3AV0A 1L4SA 1Y6ZA 2YRKA 4BMJA 3MHSC 3K85A 5KL2A 5GMDA 5A2QQ 4ZYGA 4JI1I 1FJGI 4BBYA 3QG5C 4DR5E 1ZBTA 4K0KE 2JE6B 4YHHI 3D4JA 4IZJB 2YRMA 4FWHA 2WCC3 2EM3A 1YUJA 4UT4A 1Z0TA 2R3VA 5GMEA 4X9JA 4IJDA 2EMLA 5AC4A 1JK2A 1NEIA 1RR9A 2O1WA 4ZVIA 4DPWA 4IFDC 3TQMA 4Z7CA 2LUPB 2NN6F 4BC9A 1A1JA 2JEBB 2EMIA 3HQ1A 2VQEI 2EOZA 4OX9E 5K36A 2EFGA 2NUEA 3BIDA 1U2RA 2JPAA 1I94E 2XEXA 4K0KI 3L7ZB 1QNTA 3ADIA 2IERA 1Z0WA 3KRNA 2E72A 2ZM6E 1ZAAC 1NHIA 4YY3I 5KL6A 2CVEA 1IMUA 2EPAA 4KHPE 4DPUA 3ZM7A 2F1DA 4TUGA 4DR4E 4DUZI 4U3DA 2DGCA 4WFTA 3IWDA 1X47A 2M7QA 2EZ6A 2UUCI 2EQ0A 4LCGA 2EOJA 1DQ3A 2JEAB 1IBLE 4B3ME 2EOXA 3V5RA 2PO0A 1DGCA 5C0XE 5LL6R 2GQ0A 3BBGA 4L5NC 3U1KA 2J7KA 2ADRA 1HK7A 2HKEA 4MQYA 2H36X 2HFSA 1RC7A 4JI6E 2NN6A 4Q28A 3PYDA 4R1FA 4NXNI 5C0XD 3C4BA 1AH5A 4WXCA 2UUBE 1UDQA 3F0NA 1EH6A 4WUBA 4BC7A 3MHHC 1EH7A 2RQLA 1D6TA 4ED4A 1OYRA 1J5EE 4MDTA 4QNKA 2WZOA 2E5LI 4OO1B 2A2DA 2EMZA 4R2DA 2YWQA 2WBTA 1BKNA 3LNUA 5L3JA 2UXCI 2DSYA 4B3RE 1TF6A 1KVKA 4LPFA 1ZBQA 4IS1C 1IBLI 4U3BA 3J81Q 3C6KA 4KWYA 4WPYA 2RS7A 2C39B 2MDRA 5LMNE 4LF9E 2F4VE 1MX0A 4BA1B 4JI2I 1IQOA 4P7DA 2GPIA 2UXBE 1A1LA 2EN1A 4JI6I 4DU8A 2EMCA 2EOQA 2LJUA 2YU5A 1N36E 1N0VC 2X36A 4MU3A 2E1MA 4DMIA 2EM0A 3PYGA 1UDNA 4PRVA 2MDGA 2RSIA 2GO4A 3NZKA 1N0UA 2CTDA 2N3HA 2YSOA 1Z5BA 4LFCI 3ZKDA 4X65I 3OTOI 1YH8A 4JI8I 4DV0I 4R2SA 4R2PA 1SR9A 4F6NA 3T1YI 2BR2A 4IFDF 3DF6A 1HR0E 2Z5CA 2LMZA 1UN6B 4LF7E 2HC5A 4HEIA 4LFAE 1B69A 1T38A 4R2AA 5T6JA 3BGHA 4X62E 1Z1BA 1PVGA 1YFHA 1N36I 4ZYDA 1HNWE 4JI7I 2DLQA 4X66E 1E3HA 2JT2A 2M9AA 4R03A 1LLMC 4DR6E 2VQFI 4JYAI 5LLQA 4IZKA 1X6EA 2ENAA 1H74A 4N3OA 2JVAA 2EN8A 2EN6A 5BR8E 1UEKA 3VK6A 4NXME 4DR7I 5JEAC 4BA2A 2EMHA 5K36E 1HNZI 3J7AM 3P1XA 3BF2A 4LCHA 5A6KA 1VISA 3WU6A 3JU0A 4DV3E 5IWAE 3WU3A 2L92A 4URLA 2B7TA 1HR0I 4JV5I 2Z5BA 4AQYE 2N8XA 2BV3A 2ZBKB 5K36D 1ZM3A 1RQ0A 3ZZ0A 3B82A 4O43A 4DV7E 4HYMA 3VYYA 2LJPA 2DMIA 3GMEA 3THNA 2V2QA 1Z5CA 1X3CA 3FIGA 5DNYA 4DV2I 3ADGA 1PKPA 2EOOA 5A69A 3WU5A 4IFDA 2M4IA 5IT9C 1A1IA 4DV6E 2DLKA 2L2KB 2ODRD 3QT7A 5EL9A 2LJHA 3B78A 4JI0I 1KYQA 5BR8I 2X7IA 2IESA 3IWCA 2YZTA 2HK2A 4X64I 1Z0BA 4WXDA 2EPKX 3CDJA 3B4TA 4DV3I 3WU4A 1YPNA 3QT5A 4HY1A 4R2RA 2NN6E 3T1HE 2EPNA 1RMDA 1RREA 1XMQE 5DROA 2EORA 1XNRE 4KZSA 4FWDA 4MU4A 2HHHE 4DU7A 3EQ1A 2EPPA 4OZEA 4O5GA 1R6LA 1Y60A 2NN6D 3IWBA 2D9HA 2L2MA 3F6GA 1Z0GA 5A2QC 4R2EA 1B63A 2OI2A 2YTGA 4N4RB 4NZVA 2NABA 3PRYA 2M1SA 2GO3A 2V2ZA 2EMAA 4AIMA 4JI4E 1ZM4A 4F54A 2NUFA 4BCAA 1PJTA 3H09A 1FI4A 3ECRA 3UK3C 2L33A 4P52A 1H7SA 5KL4A 1STUA 3PS3A 2V86A 2CPNA 3EPKA 1S16A 1UDOA 2YTQA 1Y4SA 2DB2A 3K6QA 1FWLA 2WNRA 1XNRI 1OYSA 1O0WA 2YTIA 2EMXA 2IOQA 5C0XB 2DEIA 4RH8A 4LF4I 2PO2B 4DR3E 1UBDC 2PO1A 2EL5A 2EM4A 1Z0CA 3PYEA 4F2JC 4JI4I 4R2QA 3HXLA 4JI5E 2YPNA 2DMYA 5AC5A 4FW9A 3V2UC 4DR5I 1K47A 2BM0A 3P3GA 1XNQE 5JEAF 2DRPA 3JAMQ 5C0XC 3J80Q 3EPHA 4DR1E 4GZNC 1PIEA 2EOEA 2FTXB 1R6MA 5AASA 2JOBA 1T39A 2J65A 4DR3I 4M2ZA 4J8ZA 4B3TE 4DPTA 4OX9I 3KWRA 4Z7YA 2AE8A 4GQUA 2LBSB 1ZXMA 4GKJE 3HTXA 2UUAE 2BM1A 2A25A 2WBUA 5A6AA 1IBME 2R42A 1I94I 4LFBE 1EH8A 1N32E 4X8WA 2F8BA 1UILA 1NHHA 2RTXA 1Z5AA 2ZM6I 3RMPA 4LF6E 2O3ZA 1ELOA 1USVA 2LT7A 2ENCA 4DUYE 2EPOA 4KHPI 4NHRA 1XHKA 1N33E 4WYQB 2V89A 4DR4I 4IFDD 2K4VA 3HPSA 2I13A 4R2CA 2C38A 4FW7A 5ELWA 5JEAA 4AM3A 1WRJA 1A1HA 1YSAC 3ZKBA 5A6BD 4B3TI 2JWOA 1B62A 4HXZA 3MSWA 4B3MI 1EKZA 3CDIA 4L8NA 2EOYA
chains in the Genus database with same CATH topology
3CWVA 4LU9A 2G7HA 1YYOA 1N34E 4LF5E 2AJ4A 4USMA 1EI1A 2LTRA 4PRXA 4P78A 2UUBI 5LMUE 3ZZTA 4DUYI 1WXRA 4DV5E 3LTOA 1J5EI 3OMLA 2L2NA 2RS6A 1YYWA 4B3RI 5LMNI 1ZM2A 4LF9I 2F4VI 3Q1QA 2UXBI 1N34I 4JG4A 5F3WA 2NPFA 3ZOQB 4LF8E 2ODRC 4GKKE 4DV5I 2L3CA 4JI3E 5FLXQ 2VE7C 2O1UA 2L6MA 4LF7I 2B7VA 2CGEA 4LFAI 4X62I 1HNWI 1Y4UA 4USKA 1GZ6A 4X66I 2HKJA 2PNLA 4DR6I 4GKKI 4EMDA 2DEJA 4HACB 4NXMI 4KQVA 3Q6MA 1XMOE 1KTVA 1X49A 5IWAI 4IZJA 1Z0EA 2NA2A 4AQYI 2O1TA 1X48A 3ZZUA 4M30A 2Z5CB 4DV7I 4F9CB 1T4OA 3K1JA 4DR2E 4LTYA 4M0VA 4DV6I 4DV4E 3PYFA 2N3GA 1Z0VA 4DPXA 1MU5A 2JR1A 4IZKB 1Z59A 4GEQB 4JI1E 1FJGE 4WUCA 3T1HI 4YHHE 1XMQI 2Z5BB 1NHJA 2HHHI 4FN5A 2V83A 2B3TB 1MG7A 3P06A 3JAMC 2MC6A 4BS9A 3J80C 2VQEE 2NUGA 1NZ0A 3B8HA 1ZM9A 2LTSA 2EWLA 2FGGA 2MC5A 4F9BB 4YY3E 4DXLA 3QT6A 2ZITA 1H7UA 4DUZE 2L8TA 3C4TA 3F6HA 2UUCE 4I8OA 4JI5I 3HJCA 2WW4A 1T4NA 2V87A 1ZXNA 1XNQI 2RSMA 4DR1I 2V8PA 1YZ9A 4NXNE 2L3JA 2CZ9A 3M6AA 1FWKA 2PNMA 3J81C 1H73A 2JY9A 2E5LE 2UXCE 2V85A 2Z5EA 4GKJI 2UUAI 2VF1A 2UU9E 5CFFE 1IBMI 4I3HA 4LFBI 4JI2E 3J7AG 4IZJD 4UTGA 5AE3A 1N32I 2V34A 1EA6A 4LF6I 2DIXA 3VYXA 1HNXE 2LUQA 1N33I 4X65E 4LFCE 2IHR1 3HULA 1FNMA 3OTOE 4JI8E 3DJWA 4DV0E 4TUIA 1KKHA 3T1YE 3J7Yp 3GONA 2IOPA 2YT4A 5AE1A 4RPFA 2UU9I 3QT8A 4LF5I 2E1RA 2Q2EB 1UHZA 2V88A 1S4EA 2LE2A 5FLXC 4JI7E 2HK3A 1IBKE 4WSPA 4DV1E 2V2VA 5LMUI 4HACA 2VQFE 1HNXI 4JYAE 3K17A 2O1VA 1OJ4A 4DR7E 5AE2A 4M1KA 2A2CA 1HNZE 4DPYA 2KHXA 4JV5E 2GS8A 4MYUA 4DKKA 1FKAE 3AUZA 2B9DA 1T4LB 3HPZA 1GQEA 4DV2E 2KOUA 4LF8I 2KONA 1IBKI 4DV1I 3JTZA 3LMLA 1QZRA 3H4LA 4JI0E 5FWKA 4R8OA 4JI3I 1USUA 1A6FA 1DARA 4X64E 2HFUA 4F9AB 2JOXA 3ADLA 1DI2A 1H72C 4B3SE 4FWGA 1YYKA 2UXDE 4OOGC 3Q6NA 1QU6A 4PU9A 1XMOI 2CG9A 1WHQA 1J26A 3LPSA 5IT9Q 3ADJA 4MYTA 1WUUA 4XTJA 2FV4B 1WHNA 4P7AA 3LLHA 4DR2I 2LRSA 4B3SI 4LF4E 1KIJA 2UXDI 5ADZA 4DV4I 2V8QB 2VF3A 4WUDA 3AV0A 1Y6ZA 4BMJA 3K85A 5GMDA 5A2QQ 4JI1I 1FJGI 4BBYA 4DR5E 1ZBTA 4K0KE 4YHHI 3D4JA 4IZJB 4FWHA 4UT4A 1Z0TA 2R3VA 5GMEA 2O1WA 1RR9A 4ZVIA 4DPWA 4Z7CA 2LUPB 4BC9A 3HQ1A 2VQEI 4OX9E 2EFGA 2NUEA 1U2RA 1I94E 2XEXA 4K0KI 3ADIA 1Z0WA 2ZM6E 4YY3I 1NHIA 4KHPE 4DPUA 3ZM7A 4TUGA 4DR4E 4DUZI 4WFTA 3IWDA 1X47A 2M7QA 2EZ6A 2UUCI 1DQ3A 1IBLE 4B3ME 3V5RA 5LL6R 2GQ0A 4L5NC 2J7KA 1HK7A 2HKEA 2H36X 2HFSA 1RC7A 4JI6E 4R1FA 4Q28A 3PYDA 4NXNI 3C4BA 2UUBE 3F0NA 4WUBA 4BC7A 1D6TA 4ED4A 1J5EE 2E5LI 2WZOA 2A2DA 1BKNA 3LNUA 5L3JA 2UXCI 2DSYA 4B3RE 1KVKA 1IBLI 1ZBQA 3J81Q 4WPYA 2RS7A 2MDRA 5LMNE 4LF9E 2F4VE 1MX0A 4JI2I 4P7DA 2UXBE 4JI6I 4DU8A 2X36A 1N36E 1N0VC 2E1MA 4DMIA 3PYGA 4PRVA 1N0UA 2N3HA 4X65I 1Z5BA 3ZKDA 4LFCI 3OTOI 4JI8I 4DV0I 3T1YI 1SR9A 3DF6A 1HR0E 2Z5CA 2LMZA 4LF7E 4LFAE 1PVGA 5T6JA 4X62E 1N36I 1HNWE 4JI7I 4X66E 2VQFI 4R03A 4DR6E 4JYAI 4IZKA 1H74A 4N3OA 2JVAA 5BR8E 1UEKA 3VK6A 4NXME 4DR7I 1HNZI 3P1XA 1VISA 3WU6A 3JU0A 4DV3E 5IWAE 3WU3A 2L92A 4URLA 2B7TA 1HR0I 4JV5I 2Z5BA 4AQYE 2BV3A 2ZBKB 1ZM3A 1RQ0A 3ZZ0A 3B82A 4DV7E 4HYMA 3VYYA 2LJPA 2V2QA 4DV2I 1Z5CA 3FIGA 5DNYA 3ADGA 1PKPA 3WU5A 2M4IA 5IT9C 4DV6E 2L2KB 2ODRD 3QT7A 2LJHA 3B78A 4JI0I 5BR8I 2X7IA 3IWCA 2YZTA 2HK2A 4X64I 1Z0BA 4DV3I 3WU4A 3QT5A 4HY1A 3T1HE 1RREA 1XMQE 1XNRE 4KZSA 4FWDA 2HHHE 4DU7A 3IWBA 2L2MA 3F6GA 1Z0GA 5A2QC 2OI2A 1B63A 3PRYA 2M1SA 2V2ZA 4JI4E 1ZM4A 4F54A 2NUFA 4BCAA 3H09A 1FI4A 4P52A 2L33A 1H7SA 1STUA 2V86A 2CPNA 1S16A 1Y4SA 2DB2A 3K6QA 1FWLA 1XNRI 1O0WA 2IOQA 4LF4I 2DEIA 4DR3E 1Z0CA 3PYEA 4JI4I 3HXLA 4JI5E 2DMYA 3V2UC 4FW9A 4DR5I 1K47A 2BM0A 1XNQE 3JAMQ 3J80Q 4DR1E 1PIEA 2FTXB 5AASA 2JOBA 4DR3I 4M2ZA 4J8ZA 4B3TE 4DPTA 4OX9I 3KWRA 4Z7YA 2LBSB 1ZXMA 4GKJE 3HTXA 2UUAE 2BM1A 1I94I 1IBME 2R42A 4LFBE 1N32E 4X8WA 2F8BA 1UILA 1NHHA 2RTXA 1Z5AA 2ZM6I 3RMPA 4LF6E 1ELOA 1USVA 4DUYE 4KHPI 1XHKA 1N33E 4WYQB 2V89A 4DR4I 2K4VA 3HPSA 3ZKBA 4B3TI 2JWOA 1B62A 4HXZA 3MSWA 4B3MI 1EKZA 3J7AM 4L8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWV A;  1YYO A;  2AJ4 A;  4USM A;  1N34 E;  4LF5 E;  1EI1 A;  2LTR A;  4PRX A;  2UUB I;  5LMU E;  3ZZT A;  4DUY I;  4DV5 E;  3LTO A;  1J5E I;  2L2N A;  2RS6 A;  1YYW A;  4B3R I;  5LMN I;  1ZM2 A;  4LF9 I;  2F4V I;  3Q1Q A;  2UXB I;  1N34 I;  4JG4 A;  2NPF A;  4LF8 E;  4GKK E;  4DV5 I;  2L3C A;  4JI3 E;  5FLX Q;  4LF7 I;  2B7V A;  4LFA I;  4X62 I;  1HNW I;  4USK A;  4X66 I;  2HKJ A;  4DR6 I;  4GKK I;  4EMD A;  2DEJ A;  4HAC B;  4NXM I;  4KQV A;  1XMO E;  1KTV A;  1X49 A;  5IWA I;  1Z0E A;  2NA2 A;  4AQY I;  1X48 A;  3ZZU A;  4M30 A;  4DV7 I;  1T4O A;  3K1J A;  4DR2 E;  4DV6 I;  4DV4 E;  3PYF A;  2N3G A;  1Z0V A;  4DPX A;  1MU5 A;  1Z59 A;  4JI1 E;  1FJG E;  4WUC A;  3T1H I;  4YHH E;  1XMQ I;  1NHJ A;  2HHH I;  4FN5 A;  2B3T B;  1MG7 A;  3JAM C;  3J80 C;  2VQE E;  2NUG A;  1NZ0 A;  3B8H A;  1ZM9 A;  2LTS A;  4YY3 E;  4DXL A;  3QT6 A;  2ZIT A;  1H7U A;  4DUZ E;  3C4T A;  2UUC E;  4JI5 I;  2WW4 A;  1T4N A;  1ZXN A;  1XNQ I;  2RSM A;  4DR1 I;  2V8P A;  1YZ9 A;  4NXN E;  2L3J A;  2CZ9 A;  3M6A A;  1FWK A;  3J81 C;  1H73 A;  2JY9 A;  2E5L E;  2UXC E;  4GKJ I;  2UUA I;  2UU9 E;  5CFF E;  1IBM I;  4I3H A;  4LFB I;  4JI2 E;  3J7A G;  4UTG A;  1N32 I;  2V34 A;  1EA6 A;  4LF6 I;  2DIX A;  3VYX A;  1HNX E;  2LUQ A;  1N33 I;  4X65 E;  4LFC E;  2IHR 1;  3HUL A;  1FNM A;  3OTO E;  4JI8 E;  4DV0 E;  1KKH A;  3T1Y E;  3J7Y p;  3GON A;  2YT4 A;  4RPF A;  2UU9 I;  3QT8 A;  4LF5 I;  2E1R A;  2Q2E B;  1UHZ A;  1S4E A;  5FLX C;  4JI7 E;  2HK3 A;  1IBK E;  4DV1 E;  2V2V A;  5LMU I;  1HNX I;  4HAC A;  2VQF E;  4JYA E;  3K17 A;  1OJ4 A;  4DR7 E;  4M1K A;  2A2C A;  1HNZ E;  4DPY A;  2KHX A;  4JV5 E;  2GS8 A;  4MYU A;  4DKK A;  1FKA E;  1T4L B;  1GQE A;  4DV2 E;  4LF8 I;  1IBK I;  4DV1 I;  1QZR A;  3H4L A;  4JI0 E;  4JI3 I;  1A6F A;  1DAR A;  4X64 E;  2HFU A;  3ADL A;  1DI2 A;  1H72 C;  4B3S E;  4FWG A;  1YYK A;  2UXD E;  4OOG C;  1QU6 A;  4PU9 A;  1XMO I;  1WHQ A;  1J26 A;  3LPS A;  5IT9 Q;  3ADJ A;  4MYT A;  1WUU A;  4XTJ A;  1WHN A;  4P7A A;  3LLH A;  4DR2 I;  2LRS A;  4B3S I;  4LF4 E;  1KIJ A;  2UXD I;  4DV4 I;  2VF3 A;  4WUD A;  5GMD A;  5A2Q Q;  4JI1 I;  1FJG I;  4DR5 E;  1ZBT A;  4K0K E;  4YHH I;  3D4J A;  4FWH A;  4UT4 A;  1Z0T A;  2R3V A;  5GME A;  1RR9 A;  4ZVI A;  4DPW A;  4Z7C A;  2LUP B;  2VQE I;  4OX9 E;  2EFG A;  2NUE A;  1U2R A;  1I94 E;  2XEX A;  4K0K I;  3ADI A;  1Z0W A;  2ZM6 E;  4YY3 I;  1NHI A;  4KHP E;  4DPU A;  3ZM7 A;  4DR4 E;  4DUZ I;  4WFT A;  1X47 A;  2EZ6 A;  2UUC I;  1IBL E;  4B3M E;  3V5R A;  5LL6 R;  2J7K A;  2HKE A;  2HFS A;  1RC7 A;  4JI6 E;  4R1F A;  3PYD A;  4NXN I;  3C4B A;  2UUB E;  3F0N A;  4WUB A;  1D6T A;  4ED4 A;  1J5E E;  2E5L I;  2A2D A;  1BKN A;  3LNU A;  5L3J A;  2UXC I;  4B3R E;  1KVK A;  1IBL I;  3J81 Q;  2RS7 A;  5LMN E;  2MDR A;  4LF9 E;  2F4V E;  1MX0 A;  4JI2 I;  2UXB E;  4JI6 I;  4DU8 A;  2X36 A;  1N36 E;  1N0V C;  3PYG A;  4PRV A;  1N0U A;  2N3H A;  4X65 I;  1Z5B A;  3ZKD A;  4LFC I;  3OTO I;  4JI8 I;  4DV0 I;  3T1Y I;  1HR0 E;  4LF7 E;  4LFA E;  1PVG A;  4X62 E;  1N36 I;  1HNW E;  4JI7 I;  4X66 E;  2VQF I;  4DR6 E;  4JYA I;  1H74 A;  2JVA A;  5BR8 E;  1UEK A;  4NXM E;  4DR7 I;  1HNZ I;  3P1X A;  1VIS A;  3WU6 A;  3WU3 A;  4DV3 E;  5IWA E;  4URL A;  1HR0 I;  4JV5 I;  2B7T A;  4AQY E;  2BV3 A;  2ZBK B;  1ZM3 A;  1RQ0 A;  3ZZ0 A;  3B82 A;  4DV7 E;  4HYM A;  3VYY A;  2LJP A;  2V2Q A;  4DV2 I;  1Z5C A;  3ADG A;  1PKP A;  3WU5 A;  5IT9 C;  4DV6 E;  2L2K B;  3QT7 A;  2LJH A;  3B78 A;  4JI0 I;  5BR8 I;  2X7I A;  2HK2 A;  4X64 I;  1Z0B A;  4DV3 I;  3WU4 A;  3QT5 A;  4HY1 A;  3T1H E;  1RRE A;  1XMQ E;  1XNR E;  4FWD A;  2HHH E;  4DU7 A;  2L2M A;  1Z0G A;  5A2Q C;  2OI2 A;  1B63 A;  2V2Z A;  4JI4 E;  1ZM4 A;  2NUF A;  1FI4 A;  4P52 A;  2L33 A;  1H7S A;  1STU A;  2CPN A;  1S16 A;  2DB2 A;  1FWL A;  1XNR I;  1O0W A;  4LF4 I;  2DEI A;  4DR3 E;  1Z0C A;  3PYE A;  4JI4 I;  4JI5 E;  2DMY A;  3V2U C;  4FW9 A;  4DR5 I;  1K47 A;  2BM0 A;  1XNQ E;  3JAM Q;  3J80 Q;  4DR1 E;  1PIE A;  4DR3 I;  4M2Z A;  4OX9 I;  4B3T E;  4DPT A;  4Z7Y A;  2LBS B;  1ZXM A;  4GKJ E;  3HTX A;  2UUA E;  2BM1 A;  1I94 I;  1IBM E;  2R42 A;  4LFB E;  1N32 E;  4X8W A;  1UIL A;  1NHH A;  2RTX A;  1Z5A A;  2ZM6 I;  4LF6 E;  1ELO A;  4DUY E;  4KHP I;  1XHK A;  1N33 E;  4WYQ B;  4DR4 I;  3ZKB A;  4B3T I;  1B62 A;  4HXZ A;  4B3M I;  1EKZ A;  3J7A M; 
#chains in the Genus database with same CATH topology
 3CWV A;  2JXP A;  3P3E A;  4LU9 A;  2G7H A;  5A6J A;  1YYO A;  1N34 E;  4LF5 E;  2AJ4 A;  3UHM A;  4USM A;  5K36 B;  1EI1 A;  2EN2 A;  2EOM A;  2LTR A;  4PRX A;  4P78 A;  4M9V C;  2UUB I;  2GHF A;  5LMU E;  2WP8 A;  3ZZT A;  4DUY I;  2YSP A;  4ZYH A;  2PNZ A;  1WXR A;  4DV5 E;  2J7J A;  4IS9 A;  4OO1 C;  1F2I G;  3LTO A;  1J5E I;  1X5W A;  3OML A;  2L2N A;  2RS6 A;  1YYW A;  4B3R I;  2EM6 A;  2EOF A;  2LV2 A;  4OKG A;  5LMN I;  1ZM2 A;  4NBQ A;  4LF9 I;  2F4V I;  3Q1Q A;  2HJJ A;  2JYA A;  2EPU A;  4OO1 E;  2UXB I;  1N34 I;  4JG4 A;  2PO0 B;  5F3W A;  2NPF A;  2EMK A;  2LO3 A;  2WBS A;  1SFE A;  3ZOQ B;  4LF8 E;  2VRD A;  2NN6 B;  2ODR C;  5KL7 A;  4GKK E;  4DV5 I;  2BA1 G;  2C37 A;  2L3C A;  4JI3 E;  5FLX Q;  2EPR A;  1PDA A;  2LVH A;  1G2D C;  2VE7 C;  2PRT A;  2O1U A;  2L6M A;  2BA1 D;  5DNX A;  2B7V A;  2EMW A;  2CGE A;  4LF7 I;  4LFA I;  4MLV A;  4X62 I;  2Q8U A;  2CT1 A;  2YTN A;  1HNW I;  2EL6 A;  1Y4U A;  4USK A;  1GZ6 A;  4X66 I;  2HKJ A;  2PNL A;  4DR6 I;  4GKK I;  2EJ4 A;  2CSH A;  4ZYE A;  4EMD A;  3KZZ A;  2DEJ A;  3THO B;  2EOI A;  4HAC B;  4NXM I;  4KQV A;  5DNL A;  3Q6M A;  1XMO E;  1KTV A;  4O24 A;  2EMB A;  1X49 A;  2JE6 A;  5IWA I;  4MU1 A;  4IZJ A;  2EN3 A;  2NA2 A;  1Z0E A;  4AQY I;  2O1T A;  2K7I A;  2BR2 B;  1X48 A;  4HTG A;  3ZZU A;  4M30 A;  2Z5C B;  5C0X A;  4DV7 I;  4F9C B;  1T4O A;  3K1J A;  4DR2 E;  1MGT A;  4LTY A;  5DRQ A;  4M0V A;  2JEB A;  3M85 G;  4DV6 I;  1JK1 A;  1UDS A;  1PJQ A;  4DV4 E;  3PYF A;  2N3G A;  1Z0V A;  4DPX A;  1MU5 A;  1XXE A;  5JEA E;  3L00 A;  1YHC A;  3GCM A;  2YTP A;  2JR1 A;  5KL3 A;  2HGH A;  2MKN A;  4IZK B;  4LOM A;  1Z59 A;  3P76 A;  5JEA D;  3EPJ A;  4GEQ B;  3M85 D;  3L7Z A;  4OO1 F;  4BA2 B;  4JI1 E;  2YTD A;  1FJG E;  4WUC A;  4QNJ A;  3T1H I;  2EN7 A;  4YHH E;  1OYP A;  5DRP A;  2BA0 G;  1NCS A;  4WX9 A;  1XMQ I;  2Z5B B;  1G2F C;  1NHJ A;  2HHH I;  4FN5 A;  1TF3 A;  2V83 A;  2VES A;  2B3T B;  1MG7 A;  1A1K A;  4FW6 A;  2JEA A;  2BA0 D;  3P06 A;  4IFD B;  3PS2 A;  3JAM C;  2MC6 A;  2EL4 A;  4BS9 A;  3J80 C;  2VQE E;  2NUG A;  2BBG A;  2EM5 A;  3DD6 A;  4O4K A;  1WJP A;  1NZ0 A;  3B8H A;  1ZM9 A;  1Y5Y A;  2EM2 A;  3HKM A;  2EE8 A;  2LTS A;  2EPX A;  2YTE A;  2EWL A;  2FGG A;  2MC5 A;  4F9B B;  4YY3 E;  2EMF A;  2EMG A;  3KZY A;  3H1C A;  4DXL A;  4OO1 A;  3QT6 A;  3EPL A;  2ZIT A;  1H7U A;  2ELZ A;  4DUZ E;  5EKW A;  2ENH A;  2GLI A;  2L8T A;  3C4T A;  3F6H A;  2UUC E;  4I8O A;  2C39 A;  4BA1 A;  2YTJ A;  4JI5 I;  2EOH A;  1X6H A;  1GTK A;  1BB8 A;  3HJC A;  2WW4 A;  2YRH A;  1T4N A;  5TSE A;  2V87 A;  1ZXN A;  1XNQ I;  2RSM A;  5IV8 B;  1AAY A;  4DR1 I;  2V8P A;  1YZ9 A;  4NXN E;  1P42 A;  4IFD E;  2LCE A;  2L3J A;  2CZ9 A;  3M6A A;  1FWK A;  2ELY A;  2PNM A;  3J81 C;  2WNR B;  4MU0 A;  2R1F A;  1H73 A;  4J3D A;  2JY9 A;  1A1G A;  2E5L E;  3C6M A;  2UXC E;  2V85 A;  2PO1 B;  2Z5E A;  2EQ1 A;  4GKJ I;  2YTO A;  2UUA I;  2VF1 A;  2UU9 E;  5CFF E;  1IBM I;  4I3H A;  4LFB I;  4JI2 E;  1ZU1 A;  3J7A G;  4IZJ D;  5AE3 A;  4UTG A;  1N32 I;  4FW3 A;  2V34 A;  1EA6 A;  4LF6 I;  2DIX A;  1IQS A;  1TN9 A;  3VYX A;  2EQ3 A;  3M7N G;  1HNX E;  2LUQ A;  5KL5 A;  1N33 I;  3P3C A;  2BB8 A;  2R76 A;  4X65 E;  4LFC E;  2IHR 1;  3HUL A;  4RHB B;  3OTO E;  1FNM A;  2I9I A;  4JI8 E;  3DJW A;  4DV0 E;  2JP9 A;  4TUI A;  1KKH A;  3M7N D;  3T1Y E;  5K36 C;  3J7Y p;  3GON A;  2IOP A;  2YT4 A;  5AE1 A;  4RPF A;  2UU9 I;  3QT8 A;  4LF5 I;  4F6M A;  2E1R A;  2YTF A;  4WSG A;  2Q2E B;  1UHZ A;  2EPZ A;  2V88 A;  1S4E A;  2LE2 A;  5FLX C;  4JI7 E;  2HK3 A;  1IBK E;  4WSP A;  4DV1 E;  2V2V A;  5LMU I;  4HAC A;  2VQF E;  1HNX I;  4JYA E;  2EPL X;  2EN4 A;  5C0X F;  3K17 A;  2O1V A;  1OJ4 A;  4ISA A;  4DR7 E;  5AE2 A;  4M1K A;  2EPC A;  2A2C A;  2EM7 A;  1ZR9 A;  1HNZ E;  1RHY A;  4DPY A;  2C38 B;  2KHX A;  4JV5 E;  2GS8 A;  4MYU A;  5DRR A;  5JEA B;  4BHB A;  4DKK A;  1FKA E;  3AUZ A;  2B9D A;  1N3G A;  1T4L B;  3HPZ A;  2EM9 A;  1GQE A;  5IXM B;  2NN6 C;  3GLL A;  4DV2 E;  2KOU A;  1BBO A;  2MKD A;  1E3P A;  4AID A;  2KON A;  4LF8 I;  1IBK I;  4DV1 I;  3JTZ A;  3LML A;  1MEY C;  1QZR A;  1X6F A;  4Q35 B;  3H4L A;  2EPM X;  4OO1 D;  2WP8 B;  4JI0 E;  5FWK A;  2PNZ B;  4R8O A;  4JI3 I;  1USU A;  1A6F A;  1DAR A;  4FW5 A;  4X64 E;  4LCF A;  2YU8 A;  2HFU A;  4MLQ A;  4F9A B;  2JOX A;  3ADL A;  1DI2 A;  2PO2 A;  1H72 C;  4B3S E;  4FWG A;  1YYK A;  1A1F A;  2UXD E;  4OOG C;  3Q6N A;  4FK5 C;  4FW4 A;  1QU6 A;  5A6B A;  1P47 A;  4PU9 A;  2RPC A;  1XMO I;  2CG9 A;  4BHC A;  1BBG A;  3M99 B;  1PJS A;  2EMY A;  1WHQ A;  1J26 A;  3LPS A;  3VHT B;  5IT9 Q;  2C37 B;  1KJK A;  3ADJ A;  4MYT A;  1WUU A;  2EP3 A;  4XTJ A;  2FV4 B;  1VI7 A;  1WHN A;  2EM8 A;  3LLH A;  4P7A A;  4DR2 I;  2EOS A;  5K36 F;  2LRS A;  4B3S I;  1YUI A;  4LF4 E;  3PS1 A;  1KIJ A;  2UXD I;  5ADZ A;  4DV4 I;  2V8Q B;  2VF3 A;  4WUD A;  3U1Y A;  3AV0 A;  1L4S A;  1Y6Z A;  2YRK A;  4BMJ A;  3MHS C;  3K85 A;  5KL2 A;  5GMD A;  5A2Q Q;  4ZYG A;  4JI1 I;  1FJG I;  4BBY A;  3QG5 C;  4DR5 E;  1ZBT A;  4K0K E;  2JE6 B;  4YHH I;  3D4J A;  4IZJ B;  2YRM A;  4FWH A;  2WCC 3;  2EM3 A;  1YUJ A;  4UT4 A;  1Z0T A;  2R3V A;  5GME A;  4X9J A;  4IJD A;  2EML A;  5AC4 A;  1JK2 A;  1NEI A;  1RR9 A;  2O1W A;  4ZVI A;  4DPW A;  4IFD C;  3TQM A;  4Z7C A;  2LUP B;  2NN6 F;  4BC9 A;  1A1J A;  2JEB B;  2EMI A;  3HQ1 A;  2VQE I;  2EOZ A;  4OX9 E;  5K36 A;  2EFG A;  2NUE A;  3BID A;  1U2R A;  2JPA A;  1I94 E;  2XEX A;  4K0K I;  3L7Z B;  1QNT A;  3ADI A;  2IER A;  1Z0W A;  3KRN A;  2E72 A;  2ZM6 E;  1ZAA C;  1NHI A;  4YY3 I;  5KL6 A;  2CVE A;  1IMU A;  2EPA A;  4KHP E;  4DPU A;  3ZM7 A;  2F1D A;  4TUG A;  4DR4 E;  4DUZ I;  4U3D A;  2DGC A;  4WFT A;  3IWD A;  1X47 A;  2M7Q A;  2EZ6 A;  2UUC I;  2EQ0 A;  4LCG A;  2EOJ A;  1DQ3 A;  2JEA B;  1IBL E;  4B3M E;  2EOX A;  3V5R A;  2PO0 A;  1DGC A;  5C0X E;  5LL6 R;  2GQ0 A;  3BBG A;  4L5N C;  3U1K A;  2J7K A;  2ADR A;  1HK7 A;  2HKE A;  4MQY A;  2H36 X;  2HFS A;  1RC7 A;  4JI6 E;  2NN6 A;  4Q28 A;  3PYD A;  4R1F A;  4NXN I;  5C0X D;  3C4B A;  1AH5 A;  4WXC A;  2UUB E;  1UDQ A;  3F0N A;  1EH6 A;  4WUB A;  4BC7 A;  3MHH C;  1EH7 A;  2RQL A;  1D6T A;  4ED4 A;  1OYR A;  1J5E E;  4MDT A;  4QNK A;  2WZO A;  2E5L I;  4OO1 B;  2A2D A;  2EMZ A;  4R2D A;  2YWQ A;  2WBT A;  1BKN A;  3LNU A;  5L3J A;  2UXC I;  2DSY A;  4B3R E;  1TF6 A;  1KVK A;  4LPF A;  1ZBQ A;  4IS1 C;  1IBL I;  4U3B A;  3J81 Q;  3C6K A;  4KWY A;  4WPY A;  2RS7 A;  2C39 B;  2MDR A;  5LMN E;  4LF9 E;  2F4V E;  1MX0 A;  4BA1 B;  4JI2 I;  1IQO A;  4P7D A;  2GPI A;  2UXB E;  1A1L A;  2EN1 A;  4JI6 I;  4DU8 A;  2EMC A;  2EOQ A;  2LJU A;  2YU5 A;  1N36 E;  1N0V C;  2X36 A;  4MU3 A;  2E1M A;  4DMI A;  2EM0 A;  3PYG A;  1UDN A;  4PRV A;  2MDG A;  2RSI A;  2GO4 A;  3NZK A;  1N0U A;  2CTD A;  2N3H A;  2YSO A;  1Z5B A;  4LFC I;  3ZKD A;  4X65 I;  3OTO I;  1YH8 A;  4JI8 I;  4DV0 I;  4R2S A;  4R2P A;  1SR9 A;  4F6N A;  3T1Y I;  2BR2 A;  4IFD F;  3DF6 A;  1HR0 E;  2Z5C A;  2LMZ A;  1UN6 B;  4LF7 E;  2HC5 A;  4HEI A;  4LFA E;  1B69 A;  1T38 A;  4R2A A;  5T6J A;  3BGH A;  4X62 E;  1Z1B A;  1PVG A;  1YFH A;  1N36 I;  4ZYD A;  1HNW E;  4JI7 I;  2DLQ A;  4X66 E;  1E3H A;  2JT2 A;  2M9A A;  4R03 A;  1LLM C;  4DR6 E;  2VQF I;  4JYA I;  5LLQ A;  4IZK A;  1X6E A;  2ENA A;  1H74 A;  4N3O A;  2JVA A;  2EN8 A;  2EN6 A;  5BR8 E;  1UEK A;  3VK6 A;  4NXM E;  4DR7 I;  5JEA C;  4BA2 A;  2EMH A;  5K36 E;  1HNZ I;  3J7A M;  3P1X A;  3BF2 A;  4LCH A;  5A6K A;  1VIS A;  3WU6 A;  3JU0 A;  4DV3 E;  5IWA E;  3WU3 A;  2L92 A;  4URL A;  2B7T A;  1HR0 I;  4JV5 I;  2Z5B A;  4AQY E;  2N8X A;  2BV3 A;  2ZBK B;  5K36 D;  1ZM3 A;  1RQ0 A;  3ZZ0 A;  3B82 A;  4O43 A;  4DV7 E;  4HYM A;  3VYY A;  2LJP A;  2DMI A;  3GME A;  3THN A;  2V2Q A;  1Z5C A;  1X3C A;  3FIG A;  5DNY A;  4DV2 I;  3ADG A;  1PKP A;  2EOO A;  5A69 A;  3WU5 A;  4IFD A;  2M4I A;  5IT9 C;  1A1I A;  4DV6 E;  2DLK A;  2L2K B;  2ODR D;  3QT7 A;  5EL9 A;  2LJH A;  3B78 A;  4JI0 I;  1KYQ A;  5BR8 I;  2X7I A;  2IES A;  3IWC A;  2YZT A;  2HK2 A;  4X64 I;  1Z0B A;  4WXD A;  2EPK X;  3CDJ A;  3B4T A;  4DV3 I;  3WU4 A;  1YPN A;  3QT5 A;  4HY1 A;  4R2R A;  2NN6 E;  3T1H E;  2EPN A;  1RMD A;  1RRE A;  1XMQ E;  5DRO A;  2EOR A;  1XNR E;  4KZS A;  4FWD A;  4MU4 A;  2HHH E;  4DU7 A;  3EQ1 A;  2EPP A;  4OZE A;  4O5G A;  1R6L A;  1Y60 A;  2NN6 D;  3IWB A;  2D9H A;  2L2M A;  3F6G A;  1Z0G A;  5A2Q C;  4R2E A;  1B63 A;  2OI2 A;  2YTG A;  4N4R B;  4NZV A;  2NAB A;  3PRY A;  2M1S A;  2GO3 A;  2V2Z A;  2EMA A;  4AIM A;  4JI4 E;  1ZM4 A;  4F54 A;  2NUF A;  4BCA A;  1PJT A;  3H09 A;  1FI4 A;  3ECR A;  3UK3 C;  2L33 A;  4P52 A;  1H7S A;  5KL4 A;  1STU A;  3PS3 A;  2V86 A;  2CPN A;  3EPK A;  1S16 A;  1UDO A;  2YTQ A;  1Y4S A;  2DB2 A;  3K6Q A;  1FWL A;  2WNR A;  1XNR I;  1OYS A;  1O0W A;  2YTI A;  2EMX A;  2IOQ A;  5C0X B;  2DEI A;  4RH8 A;  4LF4 I;  2PO2 B;  4DR3 E;  1UBD C;  2PO1 A;  2EL5 A;  2EM4 A;  1Z0C A;  3PYE A;  4F2J C;  4JI4 I;  4R2Q A;  3HXL A;  4JI5 E;  2YPN A;  2DMY A;  5AC5 A;  4FW9 A;  3V2U C;  4DR5 I;  1K47 A;  2BM0 A;  3P3G A;  1XNQ E;  5JEA F;  2DRP A;  3JAM Q;  5C0X C;  3J80 Q;  3EPH A;  4DR1 E;  4GZN C;  1PIE A;  2EOE A;  2FTX B;  1R6M A;  5AAS A;  2JOB A;  1T39 A;  2J65 A;  4DR3 I;  4M2Z A;  4J8Z A;  4B3T E;  4DPT A;  4OX9 I;  3KWR A;  4Z7Y A;  2AE8 A;  4GQU A;  2LBS B;  1ZXM A;  4GKJ E;  3HTX A;  2UUA E;  2BM1 A;  2A25 A;  2WBU A;  5A6A A;  1IBM E;  2R42 A;  1I94 I;  4LFB E;  1EH8 A;  1N32 E;  4X8W A;  2F8B A;  1UIL A;  1NHH A;  2RTX A;  1Z5A A;  2ZM6 I;  3RMP A;  4LF6 E;  2O3Z A;  1ELO A;  1USV A;  2LT7 A;  2ENC A;  4DUY E;  2EPO A;  4KHP I;  4NHR A;  1XHK A;  1N33 E;  4WYQ B;  2V89 A;  4DR4 I;  4IFD D;  2K4V A;  3HPS A;  2I13 A;  4R2C A;  2C38 A;  4FW7 A;  5ELW A;  5JEA A;  4AM3 A;  1WRJ A;  1A1H A;  1YSA C;  3ZKB A;  5A6B D;  4B3T I;  2JWO A;  1B62 A;  4HXZ A;  3MSW A;  4B3M I;  1EKZ A;  3CDI A;  4L8N A;  2EOY A; 
#chains in the Genus database with same CATH homology
 3CWV A;  4LU9 A;  2G7H A;  1YYO A;  1N34 E;  4LF5 E;  2AJ4 A;  4USM A;  1EI1 A;  2LTR A;  4PRX A;  4P78 A;  2UUB I;  5LMU E;  3ZZT A;  4DUY I;  1WXR A;  4DV5 E;  3LTO A;  1J5E I;  3OML A;  2L2N A;  2RS6 A;  1YYW A;  4B3R I;  5LMN I;  1ZM2 A;  4LF9 I;  2F4V I;  3Q1Q A;  2UXB I;  1N34 I;  4JG4 A;  5F3W A;  2NPF A;  3ZOQ B;  4LF8 E;  2ODR C;  4GKK E;  4DV5 I;  2L3C A;  4JI3 E;  5FLX Q;  2VE7 C;  2O1U A;  2L6M A;  4LF7 I;  2B7V A;  2CGE A;  4LFA I;  4X62 I;  1HNW I;  1Y4U A;  4USK A;  1GZ6 A;  4X66 I;  2HKJ A;  2PNL A;  4DR6 I;  4GKK I;  4EMD A;  2DEJ A;  4HAC B;  4NXM I;  4KQV A;  3Q6M A;  1XMO E;  1KTV A;  1X49 A;  5IWA I;  4IZJ A;  1Z0E A;  2NA2 A;  4AQY I;  2O1T A;  1X48 A;  3ZZU A;  4M30 A;  2Z5C B;  4DV7 I;  4F9C B;  1T4O A;  3K1J A;  4DR2 E;  4LTY A;  4M0V A;  4DV6 I;  4DV4 E;  3PYF A;  2N3G A;  1Z0V A;  4DPX A;  1MU5 A;  2JR1 A;  4IZK B;  1Z59 A;  4GEQ B;  4JI1 E;  1FJG E;  4WUC A;  3T1H I;  4YHH E;  1XMQ I;  2Z5B B;  1NHJ A;  2HHH I;  4FN5 A;  2V83 A;  2B3T B;  1MG7 A;  3P06 A;  3JAM C;  2MC6 A;  4BS9 A;  3J80 C;  2VQE E;  2NUG A;  1NZ0 A;  3B8H A;  1ZM9 A;  2LTS A;  2EWL A;  2FGG A;  2MC5 A;  4F9B B;  4YY3 E;  4DXL A;  3QT6 A;  2ZIT A;  1H7U A;  4DUZ E;  2L8T A;  3C4T A;  3F6H A;  2UUC E;  4I8O A;  4JI5 I;  3HJC A;  2WW4 A;  1T4N A;  2V87 A;  1ZXN A;  1XNQ I;  2RSM A;  4DR1 I;  2V8P A;  1YZ9 A;  4NXN E;  2L3J A;  2CZ9 A;  3M6A A;  1FWK A;  2PNM A;  3J81 C;  1H73 A;  2JY9 A;  2E5L E;  2UXC E;  2V85 A;  2Z5E A;  4GKJ I;  2UUA I;  2VF1 A;  2UU9 E;  5CFF E;  1IBM I;  4I3H A;  4LFB I;  4JI2 E;  3J7A G;  4IZJ D;  4UTG A;  5AE3 A;  1N32 I;  2V34 A;  1EA6 A;  4LF6 I;  2DIX A;  3VYX A;  1HNX E;  2LUQ A;  1N33 I;  4X65 E;  4LFC E;  2IHR 1;  3HUL A;  1FNM A;  3OTO E;  4JI8 E;  3DJW A;  4DV0 E;  4TUI A;  1KKH A;  3T1Y E;  3J7Y p;  3GON A;  2IOP A;  2YT4 A;  5AE1 A;  4RPF A;  2UU9 I;  3QT8 A;  4LF5 I;  2E1R A;  2Q2E B;  1UHZ A;  2V88 A;  1S4E A;  2LE2 A;  5FLX C;  4JI7 E;  2HK3 A;  1IBK E;  4WSP A;  4DV1 E;  2V2V A;  5LMU I;  4HAC A;  2VQF E;  1HNX I;  4JYA E;  3K17 A;  2O1V A;  1OJ4 A;  4DR7 E;  5AE2 A;  4M1K A;  2A2C A;  1HNZ E;  4DPY A;  2KHX A;  4JV5 E;  2GS8 A;  4MYU A;  4DKK A;  1FKA E;  3AUZ A;  2B9D A;  1T4L B;  3HPZ A;  1GQE A;  4DV2 E;  2KOU A;  4LF8 I;  2KON A;  1IBK I;  4DV1 I;  3JTZ A;  3LML A;  1QZR A;  3H4L A;  4JI0 E;  5FWK A;  4R8O A;  4JI3 I;  1USU A;  1A6F A;  1DAR A;  4X64 E;  2HFU A;  4F9A B;  2JOX A;  3ADL A;  1DI2 A;  1H72 C;  4B3S E;  4FWG A;  1YYK A;  2UXD E;  4OOG C;  3Q6N A;  1QU6 A;  4PU9 A;  1XMO I;  2CG9 A;  1WHQ A;  1J26 A;  3LPS A;  5IT9 Q;  3ADJ A;  4MYT A;  1WUU A;  4XTJ A;  2FV4 B;  1WHN A;  4P7A A;  3LLH A;  4DR2 I;  2LRS A;  4B3S I;  4LF4 E;  1KIJ A;  2UXD I;  5ADZ A;  4DV4 I;  2V8Q B;  2VF3 A;  4WUD A;  3AV0 A;  1Y6Z A;  4BMJ A;  3K85 A;  5GMD A;  5A2Q Q;  4JI1 I;  1FJG I;  4BBY A;  4DR5 E;  1ZBT A;  4K0K E;  4YHH I;  3D4J A;  4IZJ B;  4FWH A;  4UT4 A;  1Z0T A;  2R3V A;  5GME A;  2O1W A;  1RR9 A;  4ZVI A;  4DPW A;  4Z7C A;  2LUP B;  4BC9 A;  3HQ1 A;  2VQE I;  4OX9 E;  2EFG A;  2NUE A;  1U2R A;  1I94 E;  2XEX A;  4K0K I;  3ADI A;  1Z0W A;  2ZM6 E;  4YY3 I;  1NHI A;  4KHP E;  4DPU A;  3ZM7 A;  4TUG A;  4DR4 E;  4DUZ I;  4WFT A;  3IWD A;  1X47 A;  2M7Q A;  2EZ6 A;  2UUC I;  1DQ3 A;  1IBL E;  4B3M E;  3V5R A;  5LL6 R;  2GQ0 A;  4L5N C;  2J7K A;  1HK7 A;  2HKE A;  2H36 X;  2HFS A;  1RC7 A;  4JI6 E;  4R1F A;  4Q28 A;  3PYD A;  4NXN I;  3C4B A;  2UUB E;  3F0N A;  4WUB A;  4BC7 A;  1D6T A;  4ED4 A;  1J5E E;  2E5L I;  2WZO A;  2A2D A;  1BKN A;  3LNU A;  5L3J A;  2UXC I;  2DSY A;  4B3R E;  1KVK A;  1IBL I;  1ZBQ A;  3J81 Q;  4WPY A;  2RS7 A;  2MDR A;  5LMN E;  4LF9 E;  2F4V E;  1MX0 A;  4JI2 I;  4P7D A;  2UXB E;  4JI6 I;  4DU8 A;  2X36 A;  1N36 E;  1N0V C;  2E1M A;  4DMI A;  3PYG A;  4PRV A;  1N0U A;  2N3H A;  4X65 I;  1Z5B A;  3ZKD A;  4LFC I;  3OTO I;  4JI8 I;  4DV0 I;  3T1Y I;  1SR9 A;  3DF6 A;  1HR0 E;  2Z5C A;  2LMZ A;  4LF7 E;  4LFA E;  1PVG A;  5T6J A;  4X62 E;  1N36 I;  1HNW E;  4JI7 I;  4X66 E;  2VQF I;  4R03 A;  4DR6 E;  4JYA I;  4IZK A;  1H74 A;  4N3O A;  2JVA A;  5BR8 E;  1UEK A;  3VK6 A;  4NXM E;  4DR7 I;  1HNZ I;  3P1X A;  1VIS A;  3WU6 A;  3JU0 A;  4DV3 E;  5IWA E;  3WU3 A;  2L92 A;  4URL A;  2B7T A;  1HR0 I;  4JV5 I;  2Z5B A;  4AQY E;  2BV3 A;  2ZBK B;  1ZM3 A;  1RQ0 A;  3ZZ0 A;  3B82 A;  4DV7 E;  4HYM A;  3VYY A;  2LJP A;  2V2Q A;  4DV2 I;  1Z5C A;  3FIG A;  5DNY A;  3ADG A;  1PKP A;  3WU5 A;  2M4I A;  5IT9 C;  4DV6 E;  2L2K B;  2ODR D;  3QT7 A;  2LJH A;  3B78 A;  4JI0 I;  5BR8 I;  2X7I A;  3IWC A;  2YZT A;  2HK2 A;  4X64 I;  1Z0B A;  4DV3 I;  3WU4 A;  3QT5 A;  4HY1 A;  3T1H E;  1RRE A;  1XMQ E;  1XNR E;  4KZS A;  4FWD A;  2HHH E;  4DU7 A;  3IWB A;  2L2M A;  3F6G A;  1Z0G A;  5A2Q C;  2OI2 A;  1B63 A;  3PRY A;  2M1S A;  2V2Z A;  4JI4 E;  1ZM4 A;  4F54 A;  2NUF A;  4BCA A;  3H09 A;  1FI4 A;  4P52 A;  2L33 A;  1H7S A;  1STU A;  2V86 A;  2CPN A;  1S16 A;  1Y4S A;  2DB2 A;  3K6Q A;  1FWL A;  1XNR I;  1O0W A;  2IOQ A;  4LF4 I;  2DEI A;  4DR3 E;  1Z0C A;  3PYE A;  4JI4 I;  3HXL A;  4JI5 E;  2DMY A;  3V2U C;  4FW9 A;  4DR5 I;  1K47 A;  2BM0 A;  1XNQ E;  3JAM Q;  3J80 Q;  4DR1 E;  1PIE A;  2FTX B;  5AAS A;  2JOB A;  4DR3 I;  4M2Z A;  4J8Z A;  4B3T E;  4DPT A;  4OX9 I;  3KWR A;  4Z7Y A;  2LBS B;  1ZXM A;  4GKJ E;  3HTX A;  2UUA E;  2BM1 A;  1I94 I;  1IBM E;  2R42 A;  4LFB E;  1N32 E;  4X8W A;  2F8B A;  1UIL A;  1NHH A;  2RTX A;  1Z5A A;  2ZM6 I;  3RMP A;  4LF6 E;  1ELO A;  1USV A;  4DUY E;  4KHP I;  1XHK A;  1N33 E;  4WYQ B;  2V89 A;  4DR4 I;  2K4V A;  3HPS A;  3ZKB A;  4B3T I;  2JWO A;  1B62 A;  4HXZ A;  3MSW A;  4B3M I;  1EKZ A;  3J7A M;  4L8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...