4JI3E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji3E02
4LFAE 4WFTA 4DR1I 4EMDA 1J5EI 4JI6E 2N3GA 1T4LB 2L2MA 1FWKA 2L3JA 1WHNA 1PIEA 1A6FA 4M30A 1Z59A 4DU7A 4X64I 5LMUI 1FNMA 1N34I 1B62A 1KIJA 4JI6I 2B3TB 1X48A 4URLA 1QU6A 1B63A 5LMNE 1YYKA 1I94I 1Z5BA 2RSMA 1EKZA 4DXLA 1Z0CA 1IBLE 1HNWE 2HK3A 5BR8I 3QT6A 4WYQB 1XMQI 4WUBA 3C4TA 4PRXA 1IBLI 4FN5A 2DIXA 4DR2E 3ZKDA 4DV3E 4JYAI 1MX0A 2OI2A 3J81C 4M1KA 4P7AA 3ADLA 2B7TA 4FWGA 4WUDA 2UUBE 1Z0EA 4DR4E 1FWLA 3JAMQ 3Q1QA 4DR3I 4JI5I 4NXNI 1XNRI 3ZZUA 4JI8E 4JI1E 4USMA 2LTRA 1XMQE 4WUCA 3PYGA 4NXNE 1H7UA 4DR4I 5IWAI 4X62I 2AJ4A 2R3VA 1WUUA 1VISA 1HR0E 1GQEA 1Z0VA 3WU3A 1X47A 2RS7A 1KTVA 4B3TI 4DR5I 3QT5A 3WU6A 2E5LI 3ADJA 2A2DA 2V8PA 2X36A 1Z0BA 4GKJI 1NHJA 3T1YI 1HNZE 1PKPA 3VYYA 1ELOA 1NHIA 5IWAE 2R42A 4JYAE 1Z0WA 2RTXA 1ZBTA 2NUFA 2HKJA 3GONA 1Z5CA 2UU9E 4LF7E 4LF6E 2LUPB 3ADIA 2N3HA 1K47A 4JI7I 4UTGA 4HACA 2BM1A 4JI4I 3P1XA 1N36I 3PYEA 4AQYI 4DV0I 4YY3E 2NUEA 1N33E 3B8HA 3ZZTA 1FI4A 4JI1I 2JVAA 4JI7E 4YHHI 3ZZ0A 4B3RI 1XMOE 4DPUA 3LTOA 1ZM4A 2UXDE 4B3MI 4B3RE 4DV1E 4YHHE 1XNQE 4I3HA 2LTSA 4MYTA 1QZRA 2V2ZA 1STUA 4LF5E 4FW9A 2EZ6A 4KHPE 3PYDA 4X65I 2JY9A 4DU8A 4LFCI 4P52A 2EFGA 2L2KB 4JI4E 3B78A 3LNUA 5IT9Q 4DR7E 4DV5E 4LF8E 2L33A 4JI0E 1HNZI 4DR6E 4DV4I 1KVKA 4DV2I 2LUQA 2B7VA 5FLXC 1HNXI 1HNWI 1ZM3A 2V34A 1X49A 2NA2A 1KKHA 4DR7I 2HK2A 1YYOA 4X65E 2L2NA 4GKKE 4X62E 3ZM7A 1IBKI 2GS8A 2DEIA 3J7AG 4NXME 1RR9A 1IBMI 3WU5A 1H74A 1NZ0A 1D6TA 4DUZI 4DR6I 3J7Yp 1N33I 1N0VC 1YYWA 4RPFA 4YY3I 4DV0E 2UUCE 2BV3A 1ZM9A 3C4BA 1S16A 1IBKE 5A2QQ 4DR1E 2DB2A 4DV1I 1RQ0A 4B3ME 4MYUA 4DR2I 1T4NA 1IBME 4ZVIA 4LF4E 1XMOI 1Z0GA 5LL6R 4LF9E 1WHQA 2HFSA 4DV7I 3OTOE 4X8WA 4DV6I 3M6AA 3J80Q 1FKAE 3T1YE 2UUCI 3T1HI 1DARA 4B3SI 1Z0TA 2XEXA 2ZM6I 4JG4A 4XTJA 4USKA 2NPFA 2UXCI 1N34E 4M2ZA 4B3SE 5IT9C 3LLHA 2HHHI 5BR8E 4JI0I 1DI2A 4X64E 1MU5A 3VYXA 2UUAE 4DUYI 2LRSA 3WU4A 5LMNI 4JV5E 2MDRA 1ZXMA 3D4JA 3HTXA 1ZM2A 3OTOI 2IHR1 4DKKA 2CZ9A 1RC7A 3LPSA 1FJGE 2F4VE 4X66I 1U2RA 1N32E 1N36E 4LF9I 1XNQI 2NUGA 2UXBE 4JI3E 1HNXE 5GMEA 2ZBKB 4PRVA 1ZXNA 1O0WA 2HHHE 4OOGC 4HXZA 4DV4E 1UHZA 4DUZE 1HR0I 4LF7I 3V2UC 1XHKA 3ADGA 2HKEA 1H7SA 3CWVA 3JAMC 2VQFI 4HACB 4LFBE 3QT8A 2VQEI 3V5RA 4JV5I 4R1FA 2WW4A 3ZKBA 2V2QA 4FWDA 2UU9I 4UT4A 2Q2EB 4JI3I 2UXBI 4DPXA 1FJGI 4B3TE 4DV2E 3HULA 2HFUA 2VQFE 2L3CA 2A2CA 4DV6E 4DR5E 2X7IA 2V2VA 3J81Q 1YZ9A 3H4LA 2UXDI 4ED4A 2YT4A 1UEKA 4HYMA 4LFAI 4X66E 2F4VI 1NHHA 4JI5E 4HY1A 4KHPI 4LF5I 4Z7CA 4DPWA 3K17A 3QT7A 4KQVA 4FWHA 1T4OA 2UUAI 1XNRE 3PYFA 4PU9A 5FLXQ 2BM0A 4DR3E 5GMDA 1N0UA 4Z7YA 3F0NA 1S4EA 4AQYE 1EA6A 4DPYA 3J7AM 2KHXA 4NXMI 2VF3A 1N32I 3T1HE 4OX9I 5A2QC 2CPNA 2RS6A 2J7KA 5L3JA 4GKKI 4DV7E 4K0KE 1RREA 1MG7A 4JI2I 4DPTA 1J26A 4DUYE 1H72C 1EI1A 2LJHA 3K1JA 2ZM6E 5CFFE 1Z5AA 2ZITA 2DMYA 2UXCE 1OJ4A 1BKNA 3J80C 2LJPA 2UUBI 2VQEE 4LFBI 4OX9E 3B82A 2E1RA 4GKJE 1J5EE 4LFCE 1H73A 4DV3I 5LMUE 2E5LE 2DEJA 4JI2E 1PVGA 4LF6I 2LBSB 4K0KI 1UILA 4LF4I 4DV5I 4LF8I 4JI8I 1I94E
chains in the Genus database with same CATH superfamily
2YTFA 1A1LA 4WFTA 4LFAE 4DR1I 4EMDA 1J5EI 3L7ZB 2NN6A 4RH8A 2WP8B 4JI6E 2N3GA 1T4LB 2L2MA 1EH8A 2V8QB 1RMDA 2EMKA 3KWRA 1JK2A 1FWKA 5EL9A 4J8ZA 2J7JA 2JYAA 1WHNA 2L3JA 1PIEA 2JEBA 1A6FA 4WXDA 4M30A 2MKNA 1Z59A 4DU7A 4X64I 3HXLA 2EM7A 4R2PA 1IMUA 2IERA 3THOB 5LMUI 3EPJA 1FNMA 1N34I 1YUJA 2EMCA 1B62A 1KIJA 1X3CA 4JI6I 2B3TB 1X48A 4R8OA 5LLQA 2KONA 3BGHA 4URLA 2O1UA 3CDJA 1QU6A 5JEAC 1B63A 5LMNE 3AV0A 1YYKA 1OYRA 1I94I 1Z5BA 2RSMA 3Q6MA 2YRKA 2EMAA 2PNMA 1EKZA 1UDSA 4J3DA 1Z0CA 4MU0A 2YTOA 1IBLE 4DXLA 1HNWE 2HK3A 5BR8I 2DLQA 3GCMA 3QT6A 4P78A 4WYQB 5A69A 2ODRC 3PS1A 4WUBA 3M85G 2LV2A 1XMQI 2ODRD 4O5GA 3C4TA 4PRXA 1IBLI 4FN5A 2JEAB 2GO3A 2DIXA 1PJTA 4DR2E 3ZKDA 4DV3E 2YTEA 4JYAI 1MX0A 2OI2A 2EOMA 3KRNA 3J81C 1ZBQA 4M1KA 3P06A 2Z5EA 4P7AA 5EKWA 1A1HA 3ADLA 2EM2A 1P47A 2B7TA 4FWGA 4WUDA 2UUBE 2CGEA 1Z0EA 2LCEA 2EL5A 2WNRB 2V88A 5TSEA 5ADZA 1LLMC 2HGHA 4DR4E 1FWLA 3JAMQ 3Q1QA 2WZOA 2GHFA 5C0XD 3BBGA 2NABA 4DR3I 4JI5I 2EORA 4NXNI 3M7NG 4QNKA 2EM8A 1XNRI 3ZZUA 3P3EA 4LTYA 4JI8E 2EMGA 3RMPA 3L00A 2I13A 2EMBA 1L4SA 2RPCA 1Z1BA 4JI1E 2C39A 1SFEA 2PRTA 2JE6B 2LTRA 5KL2A 4USMA 1XMQE 4AIDA 4MDTA 4WUCA 2M1SA 2BR2B 3PYGA 5JEAE 2YRHA 2EMZA 4R2QA 1UDNA 2YZTA 2AE8A 2PO1A 5AE1A 4NXNE 4HTGA 1H7UA 2EL4A 5DRQA 4OO1E 4DR4I 2N8XA 2WBUA 5IWAI 4TUIA 2LE2A 2VRDA 4R2RA 2V89A 4X62I 2ENCA 2AJ4A 1N3GA 1WUUA 2R3VA 3Q6NA 1VISA 1HR0E 1GQEA 1Z0VA 3NZKA 3WU3A 5C0XC 1GTKA 4R2EA 1X47A 2RS7A 1KTVA 2NN6E 1PJSA 2Z5CA 5DNLA 4B3TI 3F6GA 3QT5A 5JEAD 4DR5I 4IFDD 3IWCA 3WU6A 2E5LI 3EQ1A 3ADJA 3FIGA 4F9AB 2A2DA 2V8PA 4R2SA 1IQSA 1Z0BA 1Y5YA 2PO0A 2X36A 4LCGA 2EPLX 2BA0G 2O1WA 4GKJI 1NHJA 4F9BB 3IWBA 3T1YI 2F8BA 1HNZE 1PKPA 4L5NC 1YH8A 4MLQA 3VYYA 1BBOA 2G7HA 2V83A 1ELOA 1Y60A 4BC7A 1NHIA 1VI7A 4OKGA 5IWAE 2NN6C 2YTIA 2R42A 4JYAE 2YSOA 5AC5A 1Z0WA 2RTXA 1ZBTA 2NUFA 3MHSC 2HKJA 2DSYA 2EPZA 4O43A 4GQUA 3GONA 1Z5CA 3GMEA 2UU9E 4LF7E 2EN4A 4F9CB 4LCHA 2EPPA 2EOHA 2JP9A 1QNTA 1OYSA 1YUIA 2YU8A 4LF6E 2M4IA 5AASA 5KL6A 2LUPB 1OYPA 4NBQA 3ADIA 2N3HA 3P76A 3JTZA 5JEAA 2JR1A 5A6BA 1K47A 4AIMA 4JI7I 2EPCA 1A1FA 3P3CA 1KJKA 2EPMX 4UTGA 5K36D 2JXPA 1ZAAC 2LVHA 2BM1A 4M9VC 4HACA 4JI4I 3P1XA 4FK5C 2JE6A 1N36I 2ADRA 4WSGA 3PYEA 4AQYI 1A1JA 4NHRA 4R03A 2EM5A 4DV0I 4KWYA 4YY3E 5DROA 2EMLA 3IWDA 3HPSA 5DRRA 2NUEA 1N33E 1RHYA 3B8HA 2EOJA 2PO1B 3ZZTA 2ENAA 1FI4A 4JI1I 2JVAA 4JI7E 4YHHI 3PRYA 1SR9A 3ZZ0A 4B3RI 2DLKA 1XMOE 4DPUA 2ENHA 3LTOA 2EMFA 2BB8A 1HK7A 1G2FC 1ZM4A 2UXDE 4B3MI 4YHHE 4DV1E 2JOXA 1XNQE 4B3RE 4I3HA 2LTSA 2YTDA 1JK1A 4MYTA 3GLLA 1QZRA 2V2ZA 2EQ3A 4M0VA 1STUA 2EN8A 2WP8A 3MHHC 1X6HA 5A6BD 4LF5E 1UDOA 2EZ6A 4N4RB 4KHPE 2CSHA 4F6MA 3PYDA 4FW9A 3U1KA 4X65I 2JY9A 4FW4A 4DU8A 2MC5A 4LFCI 4P52A 3EPLA 2EFGA 3KZZA 4F6NA 1X6EA 2L2KB 4JI4E 2M9AA 3B78A 3LNUA 4DR7E 5IT9Q 5IV8B 4DV5E 1DGCA 2L33A 4LF8E 5A6KA 4WX9A 4ZYHA 4JI0E 1MGTA 2MC6A 2IOQA 1HNZI 3PS3A 4DR6E 4DV4I 3L7ZA 5K36B 3PS2A 1KVKA 4DV2I 3CDIA 2LUQA 4GEQB 2B7VA 5FLXC 2EMIA 4MU1A 2EOEA 1TF6A 1HNXI 1HNWI 1ZM3A 2V34A 1X49A 2NA2A 1KKHA 1E3HA 2EWLA 4DR7I 2HK2A 2EJ4A 1YYOA 2CG9A 4MU3A 4OO1F 2EPKX 4BS9A 4X65E 2L2NA 4BBYA 4GKKE 4X62E 1PDAA 2V86A 3ZM7A 1IBKI 2L6MA 2GS8A 4GZNC 2DEIA 3H1CA 3J7AG 1TF3A 5FWKA 4RHBB 2B9DA 4NXME 1RR9A 5KL4A 1IBMI 2WBTA 3WU5A 3DF6A 2DGCA 1H74A 3F6HA 1NZ0A 1D6TA 5C0XB 5KL7A 2C39B 4DUZI 2C37B 2F1DA 4DR6I 3J7Yp 2J65A 3HJCA 2YU5A 1N33I 1N0VC 2EOFA 3ZOQB 2EM0A 1YYWA 5JEAB 3THNA 2MDGA 4RPFA 4YY3I 2E1MA 4DV0E 2UUCE 4R2AA 4F54A 2WBSA 2BV3A 1ZM9A 2EMYA 3C4BA 4OZEA 2EPNA 2EN3A 2C38A 3K85A 2EOOA 2FGGA 1S16A 5DNYA 2HJJA 1IBKE 5A2QQ 4DR1E 3DJWA 4BA2B 1B69A 3P3GA 1ZR9A 2EOQA 2DB2A 4DV1I 1RQ0A 2EOIA 4B3ME 4N3OA 5K36C 4LCFA 2BBGA 4MYUA 4DR2I 5K36A 1T4NA 1IQOA 3B4TA 2VF1A 3M99B 1IBME 4LF4E 4ZVIA 1XMOI 5ELWA 5LL6R 1Z0GA 4BHBA 4LF9E 2R1FA 1WHQA 3UHMA 2HFSA 5KL5A 4IZJB 4O24A 2D9HA 3OTOE 4X8WA 3EPKA 1MEYC 4DV7I 4DV6I 3M6AA 1Y4UA 3J80Q 1GZ6A 1FKAE 3T1YE 2UUCI 2O1VA 3T1HI 2I9IA 2V87A 5AE2A 2EN6A 4TUGA 1DARA 1NEIA 4B3SI 1UBDC 4FW6A 2EMXA 1Z0TA 2XEXA 2ZM6I 1F2IG 3VHTB 2C38B 4JG4A 4USKA 2EOYA 3LMLA 4XTJA 2NPFA 2UXCI 4IFDF 1N34E 4M2ZA 5IT9C 4B3SE 1A1KA 3LLHA 5C0XA 5BR8E 2HHHI 4JI0I 1DI2A 4X64E 1MU5A 3VYXA 2UUAE 2Z5BA 4IZJA 2EM9A 5K36F 2VE7C 4DUYI 2LRSA 2BR2A 2UUBI 3WU4A 2C37A 2PO0B 4BCAA 2LMZA 2MDRA 4JV5E 1ZXMA 3D4JA 5LMNI 3HTXA 1ZM2A 1Y4SA 3OTOI 4U3BA 5A6AA 2IHR1 3C6KA 4DKKA 1RC7A 2CZ9A 1FJGE 3LPSA 2F4VE 4X66I 4WSPA 1N32E 5AC4A 4IS1C 1N36E 2NUGA 2EMWA 1U2RA 2UXBE 4LF9I 3BF2A 4JI3E 1XNQI 4BA2A 1X6FA 1HNXE 5GMEA 2ZBKB 3AUZA 1ZXNA 4PRVA 3K6QA 2BA1D 2LT7A 2K7IA 1O0WA 2HHHE 4OOGC 4HXZA 4U3DA 4Q28A 4DV4E 1UHZA 2EM3A 4DUZE 1HR0I 4KZSA 2YTNA 2NN6B 4LF7I 2ELYA 3V2UC 1XHKA 4IFDA 3ADGA 3UK3C 2HKEA 1H7SA 4FW3A 4IS9A 2H36X 3CWVA 3M85D 3JAMC 2DRPA 1R6LA 2VQFI 4HACB 1WXRA 4LFBE 3QT8A 2VQEI 1BB8A 3V5RA 4JV5I 4IJDA 2WCC3 4R1FA 1WRJA 2WW4A 1A1IA 4R2DA 2JT2A 1G2DC 2PO2A 3ZKBA 4MLVA 2V2QA 4QNJA 2VESA 4FWDA 1EH6A 1AH5A 2CVEA 2UU9I 4UT4A 2Q2EB 2GLIA 4JI3I 2LJUA 1TN9A 2UXBI 4DPXA 4ZYDA 1XXEA 2YSPA 1FJGI 4B3TE 4OO1D 1YSAC 2EPRA 1YPNA 4DV2E 2K4VA 1USUA 4WXCA 2JEAA 2YWQA 3HULA 2HFUA 3TQMA 2VQFE 1YHCA 2YTPA 1R6MA 2L3CA 2L8TA 2IESA 2A2CA 3ECRA 5F3WA 5A6JA 3JU0A 4HEIA 4DV6E 3MSWA 2EM6A 2YPNA 1T39A 1T38A 2PO2B 4DR5E 1BBGA 4O4KA 2YTGA 4F2JC 3HQ1A 2X7IA 2V2VA 4Q35B 3J81Q 1YZ9A 4IZKB 2NN6F 2EN7A 3H4LA 4OO1B 2UXDI 4ED4A 2YT4A 2FTXB 5DNXA 4LOMA 2GQ0A 2GPIA 1UEKA 2WNRA 4FW7A 4HYMA 2V85A 4LU9A 2YTQA 1Y6ZA 4IFDB 2R76A 3U1YA 3VK6A 2EN2A 4X66E 4LFAI 2F4VI 1NHHA 4JI5E 4HY1A 2PNLA 4KHPI 4LF5I 5AE3A 4Z7CA 1PJQA 4NZVA 4P7DA 4L8NA 1NCSA 4DPWA 3K17A 2EQ1A 2JWOA 2ELZA 3QT7A 4KQVA 4BA1B 3DD6A 4FWHA 5C0XF 4AM3A 3H09A 3C6MA 2YRMA 1T4OA 2EM4A 2UUAI 1XNRE 1EH7A 2YTJA 3PYFA 1DQ3A 1KYQA 5JEAF 2DMIA 1UN6B 4OO1A 4PU9A 5FLXQ 4DR3E 2BM0A 2MKDA 5T6JA 4BMJA 4OO1C 5GMDA 4IFDE 2PNZB 1N0UA 5IXMB 2EP3A 4Z7YA 3F0NA 1S4EA 4AQYE 1EA6A 4DPYA 5C0XE 3J7AM 2KHXA 4NXMI 2VF3A 4R2CA 3T1HE 3EPHA 4MU4A 1N32I 4IZJD 4OX9I 3HPZA 2Z5CB 5A2QC 2E72A 4BHCA 1AAYA 2CPNA 2RSIA 2RS6A 2BA0D 2J7KA 5L3JA 4GKKI 2GO4A 4DV7E 2RQLA 4K0KE 1RREA 1MG7A 2JEBB 4DPTA 4JI2I 1J26A 4DUYE 1P42A 1H72C 4LPFA 3OMLA 2Q8UA 1EI1A 2O3ZA 2EOXA 2LJHA 3K1JA 4ZYGA 2ZM6E 2HC5A 5CFFE 2O1TA 2CT1A 1Z5AA 2ZITA 4IFDC 3M7ND 2EPAA 1UDQA 2DMYA 3KZYA 2UXCE 1OJ4A 3QG5C 4WPYA 1BKNA 4MQYA 3J80C 3BIDA 1USVA 2VQEE 2LJPA 2NN6D 1ZU1A 4ISAA 1X5WA 2Z5BB 4BA1A 4LFBI 2JPAA 2JOBA 4OX9E 5K36E 4X9JA 3B82A 2E1RA 4GKJE 2EOZA 1J5EE 1A1GA 4LFCE 1H73A 4DV3I 2CTDA 5LMUE 2E5LE 2DEJA 2A25A 2M7QA 3HKMA 2LO3A 2EL6A 2EOSA 4BC9A 2EPUA 2FV4B 2IOPA 4JI2E 1PVGA 2EE8A 4LF6I 2LBSB 4K0KI 1UILA 2EPOA 4DMIA 5KL3A 2PNZA 4FW5A 4IZKA 4LF4I 1YFHA 2EN1A 2EMHA 4DV5I 4LF8I 4JI8I 2EQ0A 4I8OA 2KOUA 1WJPA 1I94E 2L92A 5DRPA 2EPXA 1E3PA 4ZYEA 2BA1G
chains in the Genus database with same CATH topology
4LFAE 4WFTA 4DR1I 4EMDA 1J5EI 4JI6E 2N3GA 1T4LB 2L2MA 2V8QB 3KWRA 2CG9A 1FWKA 4J8ZA 2L3JA 1WHNA 1PIEA 1A6FA 4M30A 1Z59A 4DU7A 4X64I 3HXLA 5LMUI 1FNMA 1N34I 1B62A 1KIJA 4JI6I 2B3TB 1X48A 4R8OA 2KONA 4URLA 2O1UA 1QU6A 1B63A 5LMNE 3AV0A 1YYKA 1I94I 1Z5BA 2RSMA 3Q6MA 2PNMA 1EKZA 4DXLA 1Z0CA 1IBLE 1HNWE 2HK3A 5BR8I 3QT6A 4P78A 4WYQB 1XMQI 2ODRC 4WUBA 2ODRD 3C4TA 4PRXA 1IBLI 4FN5A 2DIXA 4DR2E 3ZKDA 4DV3E 4JYAI 1MX0A 2OI2A 3J81C 1ZBQA 4M1KA 3P06A 2Z5EA 4P7AA 3ADLA 2B7TA 4FWGA 4WUDA 2UUBE 2CGEA 1Z0EA 2V88A 5ADZA 4DR4E 1FWLA 3JAMQ 3Q1QA 2WZOA 4DR3I 4JI5I 4NXNI 1XNRI 3ZZUA 4LTYA 4JI8E 3RMPA 4JI1E 4USMA 2LTRA 1XMQE 4WUCA 2M1SA 3PYGA 2YZTA 5AE1A 4NXNE 1H7UA 4DR4I 5IWAI 4TUIA 2LE2A 2V89A 4X62I 2AJ4A 2R3VA 1WUUA 3Q6NA 1VISA 1HR0E 1GQEA 1Z0VA 3WU3A 1X47A 2RS7A 1KTVA 2Z5CA 4B3TI 3F6GA 3QT5A 4DR5I 3IWCA 3WU6A 2E5LI 3FIGA 3ADJA 4F9AB 2A2DA 2V8PA 2X36A 1Z0BA 2O1WA 4GKJI 1NHJA 4F9BB 3IWBA 3T1YI 2F8BA 1HNZE 1PKPA 4L5NC 3VYYA 2G7HA 2V83A 1ELOA 4BC7A 1NHIA 5IWAE 2R42A 4JYAE 1Z0WA 2RTXA 1ZBTA 2NUFA 2HKJA 2DSYA 3GONA 1Z5CA 2UU9E 4LF7E 4F9CB 4LF6E 2M4IA 5AASA 2LUPB 3ADIA 2N3HA 3JTZA 2JR1A 1K47A 4JI7I 4UTGA 4HACA 2BM1A 4JI4I 3P1XA 1N36I 3PYEA 4AQYI 4R03A 4DV0I 4YY3E 3IWDA 3HPSA 2NUEA 1N33E 3B8HA 3ZZTA 1FI4A 4JI1I 2JVAA 4JI7E 4YHHI 3PRYA 1SR9A 3ZZ0A 4B3RI 1XMOE 4DPUA 3LTOA 1HK7A 1ZM4A 2UXDE 4B3MI 4B3RE 4YHHE 2JOXA 1XNQE 4DV1E 4I3HA 2LTSA 4MYTA 1QZRA 2V2ZA 4M0VA 1STUA 4LF5E 4FW9A 2EZ6A 4KHPE 3PYDA 4X65I 2JY9A 4DU8A 2MC5A 4LFCI 4P52A 2EFGA 2L2KB 4JI4E 3B78A 3LNUA 5IT9Q 4DR7E 4DV5E 4LF8E 2L33A 4JI0E 2MC6A 2IOQA 1HNZI 4DR6E 4DV4I 1KVKA 4DV2I 2LUQA 4GEQB 2B7VA 5FLXC 1HNXI 1HNWI 1ZM3A 2V34A 1X49A 2NA2A 1KKHA 2EWLA 4DR7I 2HK2A 1YYOA 4BS9A 4X65E 2L2NA 4BBYA 4GKKE 4X62E 2V86A 3ZM7A 1IBKI 2L6MA 2GS8A 2DEIA 3J7AG 5FWKA 2B9DA 4NXME 1RR9A 1IBMI 3WU5A 3DF6A 1H74A 3F6HA 1NZ0A 1D6TA 4DUZI 4DR6I 3J7Yp 1N33I 3HJCA 1N0VC 3ZOQB 1YYWA 4RPFA 4YY3I 2E1MA 4DV0E 2UUCE 4F54A 2BV3A 1ZM9A 3C4BA 3K85A 2FGGA 1S16A 5DNYA 1IBKE 5A2QQ 4DR1E 3DJWA 2DB2A 4DV1I 1RQ0A 4B3ME 4N3OA 4MYUA 4DR2I 1T4NA 2VF1A 1IBME 4ZVIA 4LF4E 1XMOI 5LL6R 1Z0GA 4LF9E 1WHQA 2HFSA 4IZJB 4DV7I 3OTOE 4X8WA 4DV6I 3M6AA 1Y4UA 3J80Q 1GZ6A 1FKAE 3T1YE 2UUCI 2O1VA 3T1HI 2V87A 5AE2A 4TUGA 1DARA 4B3SI 1Z0TA 2XEXA 2ZM6I 4JG4A 4XTJA 4USKA 3LMLA 2NPFA 2UXCI 1N34E 4M2ZA 5IT9C 4B3SE 3LLHA 2HHHI 5BR8E 4JI0I 1DI2A 4X64E 1MU5A 3VYXA 2UUAE 2Z5BA 4IZJA 2VE7C 4DUYI 2LRSA 3WU4A 4BCAA 2LMZA 2MDRA 4JV5E 1ZXMA 3D4JA 5LMNI 3HTXA 1ZM2A 1Y4SA 3OTOI 2IHR1 4DKKA 2CZ9A 1RC7A 3LPSA 1FJGE 2F4VE 4X66I 1U2RA 4WSPA 1N36E 1N32E 4LF9I 2NUGA 1XNQI 2UXBE 4JI3E 1HNXE 5GMEA 2ZBKB 3AUZA 1ZXNA 4PRVA 3K6QA 1O0WA 2HHHE 4OOGC 4HXZA 4Q28A 4DV4E 1UHZA 4DUZE 1HR0I 4KZSA 4LF7I 3V2UC 1XHKA 3ADGA 2HKEA 1H7SA 2H36X 3CWVA 3JAMC 2VQFI 4HACB 1WXRA 4LFBE 3QT8A 2VQEI 3V5RA 4JV5I 4R1FA 2WW4A 3ZKBA 2V2QA 4FWDA 2UU9I 4UT4A 2Q2EB 4JI3I 2UXBI 4DPXA 1FJGI 4B3TE 4DV2E 2K4VA 1USUA 3HULA 2HFUA 2VQFE 2L3CA 2L8TA 2A2CA 5F3WA 3JU0A 4DV6E 3MSWA 4DR5E 3HQ1A 2X7IA 2V2VA 3J81Q 1YZ9A 4IZKB 3H4LA 2UXDI 4ED4A 2YT4A 2FTXB 2GQ0A 1UEKA 4HYMA 2V85A 4LU9A 1Y6ZA 4LFAI 3VK6A 4X66E 2F4VI 1NHHA 4JI5E 4HY1A 2PNLA 4KHPI 4LF5I 5AE3A 4Z7CA 4P7DA 4L8NA 4DPWA 3K17A 2JWOA 3QT7A 4KQVA 4FWHA 3H09A 1T4OA 2UUAI 1XNRE 3PYFA 1DQ3A 4PU9A 5FLXQ 4DR3E 2BM0A 4BMJA 5T6JA 5GMDA 1N0UA 4Z7YA 3F0NA 1S4EA 4AQYE 1EA6A 4DPYA 3J7AM 2KHXA 4NXMI 2VF3A 1N32I 3T1HE 4IZJD 4OX9I 3HPZA 2Z5CB 5A2QC 2CPNA 2RS6A 2J7KA 5L3JA 4GKKI 4DV7E 4K0KE 1RREA 1MG7A 4JI2I 4DPTA 1J26A 4DUYE 1H72C 3OMLA 1EI1A 2LJHA 3K1JA 2ZM6E 5CFFE 2O1TA 1Z5AA 2ZITA 2DMYA 2UXCE 1OJ4A 4WPYA 1BKNA 3J80C 2LJPA 1USVA 2VQEE 2UUBI 4LFBI 2Z5BB 2JOBA 4OX9E 3B82A 2E1RA 4GKJE 1J5EE 4LFCE 1H73A 4DV3I 5LMUE 2E5LE 2DEJA 2M7QA 4BC9A 2FV4B 2IOPA 4JI2E 1PVGA 4LF6I 2LBSB 4K0KI 1UILA 4DMIA 4IZKA 4LF4I 4DV5I 4LF8I 4JI8I 4I8OA 2KOUA 1I94E 2L92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA E;  4WFT A;  4DR1 I;  4EMD A;  1J5E I;  4JI6 E;  2N3G A;  1T4L B;  2L2M A;  1FWK A;  2L3J A;  1WHN A;  1PIE A;  1A6F A;  4M30 A;  1Z59 A;  4DU7 A;  4X64 I;  5LMU I;  1FNM A;  1N34 I;  1B62 A;  1KIJ A;  4JI6 I;  2B3T B;  1X48 A;  4URL A;  1QU6 A;  1B63 A;  5LMN E;  1YYK A;  1I94 I;  1Z5B A;  2RSM A;  1EKZ A;  4DXL A;  1Z0C A;  1IBL E;  1HNW E;  2HK3 A;  5BR8 I;  3QT6 A;  4WYQ B;  1XMQ I;  4WUB A;  3C4T A;  4PRX A;  1IBL I;  4FN5 A;  2DIX A;  4DR2 E;  3ZKD A;  4DV3 E;  4JYA I;  1MX0 A;  2OI2 A;  3J81 C;  4M1K A;  4P7A A;  3ADL A;  2B7T A;  4FWG A;  4WUD A;  2UUB E;  1Z0E A;  4DR4 E;  1FWL A;  3JAM Q;  3Q1Q A;  4DR3 I;  4JI5 I;  4NXN I;  1XNR I;  3ZZU A;  4JI8 E;  4JI1 E;  4USM A;  2LTR A;  1XMQ E;  4WUC A;  3PYG A;  4NXN E;  1H7U A;  4DR4 I;  5IWA I;  4X62 I;  2AJ4 A;  2R3V A;  1WUU A;  1VIS A;  1HR0 E;  1GQE A;  1Z0V A;  3WU3 A;  1X47 A;  2RS7 A;  1KTV A;  4B3T I;  4DR5 I;  3QT5 A;  3WU6 A;  2E5L I;  3ADJ A;  2A2D A;  2V8P A;  2X36 A;  1Z0B A;  4GKJ I;  1NHJ A;  3T1Y I;  1HNZ E;  1PKP A;  3VYY A;  1ELO A;  1NHI A;  5IWA E;  2R42 A;  4JYA E;  1Z0W A;  2RTX A;  1ZBT A;  2NUF A;  2HKJ A;  3GON A;  1Z5C A;  2UU9 E;  4LF7 E;  4LF6 E;  2LUP B;  3ADI A;  2N3H A;  1K47 A;  4JI7 I;  4UTG A;  4HAC A;  2BM1 A;  4JI4 I;  3P1X A;  1N36 I;  3PYE A;  4AQY I;  4DV0 I;  4YY3 E;  2NUE A;  1N33 E;  3B8H A;  3ZZT A;  1FI4 A;  4JI1 I;  2JVA A;  4JI7 E;  4YHH I;  3ZZ0 A;  4B3R I;  1XMO E;  4DPU A;  3LTO A;  1ZM4 A;  2UXD E;  4B3M I;  4B3R E;  4DV1 E;  4YHH E;  1XNQ E;  4I3H A;  2LTS A;  4MYT A;  1QZR A;  2V2Z A;  1STU A;  4LF5 E;  4FW9 A;  2EZ6 A;  4KHP E;  3PYD A;  4X65 I;  2JY9 A;  4DU8 A;  4LFC I;  4P52 A;  2EFG A;  2L2K B;  4JI4 E;  3B78 A;  3LNU A;  5IT9 Q;  4DR7 E;  4DV5 E;  4LF8 E;  2L33 A;  4JI0 E;  1HNZ I;  4DR6 E;  4DV4 I;  1KVK A;  4DV2 I;  2LUQ A;  2B7V A;  5FLX C;  1HNX I;  1HNW I;  1ZM3 A;  2V34 A;  1X49 A;  2NA2 A;  1KKH A;  4DR7 I;  2HK2 A;  1YYO A;  4X65 E;  2L2N A;  4GKK E;  4X62 E;  3ZM7 A;  1IBK I;  2GS8 A;  2DEI A;  3J7A G;  4NXM E;  1RR9 A;  1IBM I;  3WU5 A;  1H74 A;  1NZ0 A;  1D6T A;  4DUZ I;  4DR6 I;  3J7Y p;  1N33 I;  1N0V C;  1YYW A;  4RPF A;  4YY3 I;  4DV0 E;  2UUC E;  2BV3 A;  1ZM9 A;  3C4B A;  1S16 A;  1IBK E;  5A2Q Q;  4DR1 E;  2DB2 A;  4DV1 I;  1RQ0 A;  4B3M E;  4MYU A;  4DR2 I;  1T4N A;  1IBM E;  4ZVI A;  4LF4 E;  1XMO I;  1Z0G A;  5LL6 R;  4LF9 E;  1WHQ A;  2HFS A;  4DV7 I;  3OTO E;  4X8W A;  4DV6 I;  3M6A A;  3J80 Q;  1FKA E;  3T1Y E;  2UUC I;  3T1H I;  1DAR A;  4B3S I;  1Z0T A;  2XEX A;  2ZM6 I;  4JG4 A;  4XTJ A;  4USK A;  2NPF A;  2UXC I;  1N34 E;  4M2Z A;  4B3S E;  5IT9 C;  3LLH A;  2HHH I;  5BR8 E;  4JI0 I;  1DI2 A;  4X64 E;  1MU5 A;  3VYX A;  2UUA E;  4DUY I;  2LRS A;  3WU4 A;  5LMN I;  4JV5 E;  2MDR A;  1ZXM A;  3D4J A;  3HTX A;  1ZM2 A;  3OTO I;  2IHR 1;  4DKK A;  2CZ9 A;  1RC7 A;  3LPS A;  1FJG E;  2F4V E;  4X66 I;  1U2R A;  1N32 E;  1N36 E;  4LF9 I;  1XNQ I;  2NUG A;  2UXB E;  4JI3 E;  1HNX E;  5GME A;  2ZBK B;  4PRV A;  1ZXN A;  1O0W A;  2HHH E;  4OOG C;  4HXZ A;  4DV4 E;  1UHZ A;  4DUZ E;  1HR0 I;  4LF7 I;  3V2U C;  1XHK A;  3ADG A;  2HKE A;  1H7S A;  3CWV A;  3JAM C;  2VQF I;  4HAC B;  4LFB E;  3QT8 A;  2VQE I;  3V5R A;  4JV5 I;  4R1F A;  2WW4 A;  3ZKB A;  2V2Q A;  4FWD A;  2UU9 I;  4UT4 A;  2Q2E B;  4JI3 I;  2UXB I;  4DPX A;  1FJG I;  4B3T E;  4DV2 E;  3HUL A;  2HFU A;  2VQF E;  2L3C A;  2A2C A;  4DV6 E;  4DR5 E;  2X7I A;  2V2V A;  3J81 Q;  1YZ9 A;  3H4L A;  2UXD I;  4ED4 A;  2YT4 A;  1UEK A;  4HYM A;  4LFA I;  4X66 E;  2F4V I;  1NHH A;  4JI5 E;  4HY1 A;  4KHP I;  4LF5 I;  4Z7C A;  4DPW A;  3K17 A;  3QT7 A;  4KQV A;  4FWH A;  1T4O A;  2UUA I;  1XNR E;  3PYF A;  4PU9 A;  5FLX Q;  2BM0 A;  4DR3 E;  5GMD A;  1N0U A;  4Z7Y A;  3F0N A;  1S4E A;  4AQY E;  1EA6 A;  4DPY A;  3J7A M;  2KHX A;  4NXM I;  2VF3 A;  1N32 I;  3T1H E;  4OX9 I;  5A2Q C;  2CPN A;  2RS6 A;  2J7K A;  5L3J A;  4GKK I;  4DV7 E;  4K0K E;  1RRE A;  1MG7 A;  4JI2 I;  4DPT A;  1J26 A;  4DUY E;  1H72 C;  1EI1 A;  2LJH A;  3K1J A;  2ZM6 E;  5CFF E;  1Z5A A;  2ZIT A;  2DMY A;  2UXC E;  1OJ4 A;  1BKN A;  3J80 C;  2LJP A;  2UUB I;  2VQE E;  4LFB I;  4OX9 E;  3B82 A;  2E1R A;  4GKJ E;  1J5E E;  4LFC E;  1H73 A;  4DV3 I;  5LMU E;  2E5L E;  2DEJ A;  4JI2 E;  1PVG A;  4LF6 I;  2LBS B;  4K0K I;  1UIL A;  4LF4 I;  4DV5 I;  4LF8 I;  4JI8 I;  1I94 E; 
#chains in the Genus database with same CATH topology
 2YTF A;  1A1L A;  4WFT A;  4LFA E;  4DR1 I;  4EMD A;  1J5E I;  3L7Z B;  2NN6 A;  4RH8 A;  2WP8 B;  4JI6 E;  2N3G A;  1T4L B;  2L2M A;  1EH8 A;  2V8Q B;  1RMD A;  2EMK A;  3KWR A;  1JK2 A;  1FWK A;  5EL9 A;  4J8Z A;  2J7J A;  2JYA A;  1WHN A;  2L3J A;  1PIE A;  2JEB A;  1A6F A;  4WXD A;  4M30 A;  2MKN A;  1Z59 A;  4DU7 A;  4X64 I;  3HXL A;  2EM7 A;  4R2P A;  1IMU A;  2IER A;  3THO B;  5LMU I;  3EPJ A;  1FNM A;  1N34 I;  1YUJ A;  2EMC A;  1B62 A;  1KIJ A;  1X3C A;  4JI6 I;  2B3T B;  1X48 A;  4R8O A;  5LLQ A;  2KON A;  3BGH A;  4URL A;  2O1U A;  3CDJ A;  1QU6 A;  5JEA C;  1B63 A;  5LMN E;  3AV0 A;  1YYK A;  1OYR A;  1I94 I;  1Z5B A;  2RSM A;  3Q6M A;  2YRK A;  2EMA A;  2PNM A;  1EKZ A;  1UDS A;  4J3D A;  1Z0C A;  4MU0 A;  2YTO A;  1IBL E;  4DXL A;  1HNW E;  2HK3 A;  5BR8 I;  2DLQ A;  3GCM A;  3QT6 A;  4P78 A;  4WYQ B;  5A69 A;  2ODR C;  3PS1 A;  4WUB A;  3M85 G;  2LV2 A;  1XMQ I;  2ODR D;  4O5G A;  3C4T A;  4PRX A;  1IBL I;  4FN5 A;  2JEA B;  2GO3 A;  2DIX A;  1PJT A;  4DR2 E;  3ZKD A;  4DV3 E;  2YTE A;  4JYA I;  1MX0 A;  2OI2 A;  2EOM A;  3KRN A;  3J81 C;  1ZBQ A;  4M1K A;  3P06 A;  2Z5E A;  4P7A A;  5EKW A;  1A1H A;  3ADL A;  2EM2 A;  1P47 A;  2B7T A;  4FWG A;  4WUD A;  2UUB E;  2CGE A;  1Z0E A;  2LCE A;  2EL5 A;  2WNR B;  2V88 A;  5TSE A;  5ADZ A;  1LLM C;  2HGH A;  4DR4 E;  1FWL A;  3JAM Q;  3Q1Q A;  2WZO A;  2GHF A;  5C0X D;  3BBG A;  2NAB A;  4DR3 I;  4JI5 I;  2EOR A;  4NXN I;  3M7N G;  4QNK A;  2EM8 A;  1XNR I;  3ZZU A;  3P3E A;  4LTY A;  4JI8 E;  2EMG A;  3RMP A;  3L00 A;  2I13 A;  2EMB A;  1L4S A;  2RPC A;  1Z1B A;  4JI1 E;  2C39 A;  1SFE A;  2PRT A;  2JE6 B;  2LTR A;  5KL2 A;  4USM A;  1XMQ E;  4AID A;  4MDT A;  4WUC A;  2M1S A;  2BR2 B;  3PYG A;  5JEA E;  2YRH A;  2EMZ A;  4R2Q A;  1UDN A;  2YZT A;  2AE8 A;  2PO1 A;  5AE1 A;  4NXN E;  4HTG A;  1H7U A;  2EL4 A;  5DRQ A;  4OO1 E;  4DR4 I;  2N8X A;  2WBU A;  5IWA I;  4TUI A;  2LE2 A;  2VRD A;  4R2R A;  2V89 A;  4X62 I;  2ENC A;  2AJ4 A;  1N3G A;  1WUU A;  2R3V A;  3Q6N A;  1VIS A;  1HR0 E;  1GQE A;  1Z0V A;  3NZK A;  3WU3 A;  5C0X C;  1GTK A;  4R2E A;  1X47 A;  2RS7 A;  1KTV A;  2NN6 E;  1PJS A;  2Z5C A;  5DNL A;  4B3T I;  3F6G A;  3QT5 A;  5JEA D;  4DR5 I;  4IFD D;  3IWC A;  3WU6 A;  2E5L I;  3EQ1 A;  3ADJ A;  3FIG A;  4F9A B;  2A2D A;  2V8P A;  4R2S A;  1IQS A;  1Z0B A;  1Y5Y A;  2PO0 A;  2X36 A;  4LCG A;  2EPL X;  2BA0 G;  2O1W A;  4GKJ I;  1NHJ A;  4F9B B;  3IWB A;  3T1Y I;  2F8B A;  1HNZ E;  1PKP A;  4L5N C;  1YH8 A;  4MLQ A;  3VYY A;  1BBO A;  2G7H A;  2V83 A;  1ELO A;  1Y60 A;  4BC7 A;  1NHI A;  1VI7 A;  4OKG A;  5IWA E;  2NN6 C;  2YTI A;  2R42 A;  4JYA E;  2YSO A;  5AC5 A;  1Z0W A;  2RTX A;  1ZBT A;  2NUF A;  3MHS C;  2HKJ A;  2DSY A;  2EPZ A;  4O43 A;  4GQU A;  3GON A;  1Z5C A;  3GME A;  2UU9 E;  4LF7 E;  2EN4 A;  4F9C B;  4LCH A;  2EPP A;  2EOH A;  2JP9 A;  1QNT A;  1OYS A;  1YUI A;  2YU8 A;  4LF6 E;  2M4I A;  5AAS A;  5KL6 A;  2LUP B;  1OYP A;  4NBQ A;  3ADI A;  2N3H A;  3P76 A;  3JTZ A;  5JEA A;  2JR1 A;  5A6B A;  1K47 A;  4AIM A;  4JI7 I;  2EPC A;  1A1F A;  3P3C A;  1KJK A;  2EPM X;  4UTG A;  5K36 D;  2JXP A;  1ZAA C;  2LVH A;  2BM1 A;  4M9V C;  4HAC A;  4JI4 I;  3P1X A;  4FK5 C;  2JE6 A;  1N36 I;  2ADR A;  4WSG A;  3PYE A;  4AQY I;  1A1J A;  4NHR A;  4R03 A;  2EM5 A;  4DV0 I;  4KWY A;  4YY3 E;  5DRO A;  2EML A;  3IWD A;  3HPS A;  5DRR A;  2NUE A;  1N33 E;  1RHY A;  3B8H A;  2EOJ A;  2PO1 B;  3ZZT A;  2ENA A;  1FI4 A;  4JI1 I;  2JVA A;  4JI7 E;  4YHH I;  3PRY A;  1SR9 A;  3ZZ0 A;  4B3R I;  2DLK A;  1XMO E;  4DPU A;  2ENH A;  3LTO A;  2EMF A;  2BB8 A;  1HK7 A;  1G2F C;  1ZM4 A;  2UXD E;  4B3M I;  4YHH E;  4DV1 E;  2JOX A;  1XNQ E;  4B3R E;  4I3H A;  2LTS A;  2YTD A;  1JK1 A;  4MYT A;  3GLL A;  1QZR A;  2V2Z A;  2EQ3 A;  4M0V A;  1STU A;  2EN8 A;  2WP8 A;  3MHH C;  1X6H A;  5A6B D;  4LF5 E;  1UDO A;  2EZ6 A;  4N4R B;  4KHP E;  2CSH A;  4F6M A;  3PYD A;  4FW9 A;  3U1K A;  4X65 I;  2JY9 A;  4FW4 A;  4DU8 A;  2MC5 A;  4LFC I;  4P52 A;  3EPL A;  2EFG A;  3KZZ A;  4F6N A;  1X6E A;  2L2K B;  4JI4 E;  2M9A A;  3B78 A;  3LNU A;  4DR7 E;  5IT9 Q;  5IV8 B;  4DV5 E;  1DGC A;  2L33 A;  4LF8 E;  5A6K A;  4WX9 A;  4ZYH A;  4JI0 E;  1MGT A;  2MC6 A;  2IOQ A;  1HNZ I;  3PS3 A;  4DR6 E;  4DV4 I;  3L7Z A;  5K36 B;  3PS2 A;  1KVK A;  4DV2 I;  3CDI A;  2LUQ A;  4GEQ B;  2B7V A;  5FLX C;  2EMI A;  4MU1 A;  2EOE A;  1TF6 A;  1HNX I;  1HNW I;  1ZM3 A;  2V34 A;  1X49 A;  2NA2 A;  1KKH A;  1E3H A;  2EWL A;  4DR7 I;  2HK2 A;  2EJ4 A;  1YYO A;  2CG9 A;  4MU3 A;  4OO1 F;  2EPK X;  4BS9 A;  4X65 E;  2L2N A;  4BBY A;  4GKK E;  4X62 E;  1PDA A;  2V86 A;  3ZM7 A;  1IBK I;  2L6M A;  2GS8 A;  4GZN C;  2DEI A;  3H1C A;  3J7A G;  1TF3 A;  5FWK A;  4RHB B;  2B9D A;  4NXM E;  1RR9 A;  5KL4 A;  1IBM I;  2WBT A;  3WU5 A;  3DF6 A;  2DGC A;  1H74 A;  3F6H A;  1NZ0 A;  1D6T A;  5C0X B;  5KL7 A;  2C39 B;  4DUZ I;  2C37 B;  2F1D A;  4DR6 I;  3J7Y p;  2J65 A;  3HJC A;  2YU5 A;  1N33 I;  1N0V C;  2EOF A;  3ZOQ B;  2EM0 A;  1YYW A;  5JEA B;  3THN A;  2MDG A;  4RPF A;  4YY3 I;  2E1M A;  4DV0 E;  2UUC E;  4R2A A;  4F54 A;  2WBS A;  2BV3 A;  1ZM9 A;  2EMY A;  3C4B A;  4OZE A;  2EPN A;  2EN3 A;  2C38 A;  3K85 A;  2EOO A;  2FGG A;  1S16 A;  5DNY A;  2HJJ A;  1IBK E;  5A2Q Q;  4DR1 E;  3DJW A;  4BA2 B;  1B69 A;  3P3G A;  1ZR9 A;  2EOQ A;  2DB2 A;  4DV1 I;  1RQ0 A;  2EOI A;  4B3M E;  4N3O A;  5K36 C;  4LCF A;  2BBG A;  4MYU A;  4DR2 I;  5K36 A;  1T4N A;  1IQO A;  3B4T A;  2VF1 A;  3M99 B;  1IBM E;  4LF4 E;  4ZVI A;  1XMO I;  5ELW A;  5LL6 R;  1Z0G A;  4BHB A;  4LF9 E;  2R1F A;  1WHQ A;  3UHM A;  2HFS A;  5KL5 A;  4IZJ B;  4O24 A;  2D9H A;  3OTO E;  4X8W A;  3EPK A;  1MEY C;  4DV7 I;  4DV6 I;  3M6A A;  1Y4U A;  3J80 Q;  1GZ6 A;  1FKA E;  3T1Y E;  2UUC I;  2O1V A;  3T1H I;  2I9I A;  2V87 A;  5AE2 A;  2EN6 A;  4TUG A;  1DAR A;  1NEI A;  4B3S I;  1UBD C;  4FW6 A;  2EMX A;  1Z0T A;  2XEX A;  2ZM6 I;  1F2I G;  3VHT B;  2C38 B;  4JG4 A;  4USK A;  2EOY A;  3LML A;  4XTJ A;  2NPF A;  2UXC I;  4IFD F;  1N34 E;  4M2Z A;  5IT9 C;  4B3S E;  1A1K A;  3LLH A;  5C0X A;  5BR8 E;  2HHH I;  4JI0 I;  1DI2 A;  4X64 E;  1MU5 A;  3VYX A;  2UUA E;  2Z5B A;  4IZJ A;  2EM9 A;  5K36 F;  2VE7 C;  4DUY I;  2LRS A;  2BR2 A;  2UUB I;  3WU4 A;  2C37 A;  2PO0 B;  4BCA A;  2LMZ A;  2MDR A;  4JV5 E;  1ZXM A;  3D4J A;  5LMN I;  3HTX A;  1ZM2 A;  1Y4S A;  3OTO I;  4U3B A;  5A6A A;  2IHR 1;  3C6K A;  4DKK A;  1RC7 A;  2CZ9 A;  1FJG E;  3LPS A;  2F4V E;  4X66 I;  4WSP A;  1N32 E;  5AC4 A;  4IS1 C;  1N36 E;  2NUG A;  2EMW A;  1U2R A;  2UXB E;  4LF9 I;  3BF2 A;  4JI3 E;  1XNQ I;  4BA2 A;  1X6F A;  1HNX E;  5GME A;  2ZBK B;  3AUZ A;  1ZXN A;  4PRV A;  3K6Q A;  2BA1 D;  2LT7 A;  2K7I A;  1O0W A;  2HHH E;  4OOG C;  4HXZ A;  4U3D A;  4Q28 A;  4DV4 E;  1UHZ A;  2EM3 A;  4DUZ E;  1HR0 I;  4KZS A;  2YTN A;  2NN6 B;  4LF7 I;  2ELY A;  3V2U C;  1XHK A;  4IFD A;  3ADG A;  3UK3 C;  2HKE A;  1H7S A;  4FW3 A;  4IS9 A;  2H36 X;  3CWV A;  3M85 D;  3JAM C;  2DRP A;  1R6L A;  2VQF I;  4HAC B;  1WXR A;  4LFB E;  3QT8 A;  2VQE I;  1BB8 A;  3V5R A;  4JV5 I;  4IJD A;  2WCC 3;  4R1F A;  1WRJ A;  2WW4 A;  1A1I A;  4R2D A;  2JT2 A;  1G2D C;  2PO2 A;  3ZKB A;  4MLV A;  2V2Q A;  4QNJ A;  2VES A;  4FWD A;  1EH6 A;  1AH5 A;  2CVE A;  2UU9 I;  4UT4 A;  2Q2E B;  2GLI A;  4JI3 I;  2LJU A;  1TN9 A;  2UXB I;  4DPX A;  4ZYD A;  1XXE A;  2YSP A;  1FJG I;  4B3T E;  4OO1 D;  1YSA C;  2EPR A;  1YPN A;  4DV2 E;  2K4V A;  1USU A;  4WXC A;  2JEA A;  2YWQ A;  3HUL A;  2HFU A;  3TQM A;  2VQF E;  1YHC A;  2YTP A;  1R6M A;  2L3C A;  2L8T A;  2IES A;  2A2C A;  3ECR A;  5F3W A;  5A6J A;  3JU0 A;  4HEI A;  4DV6 E;  3MSW A;  2EM6 A;  2YPN A;  1T39 A;  1T38 A;  2PO2 B;  4DR5 E;  1BBG A;  4O4K A;  2YTG A;  4F2J C;  3HQ1 A;  2X7I A;  2V2V A;  4Q35 B;  3J81 Q;  1YZ9 A;  4IZK B;  2NN6 F;  2EN7 A;  3H4L A;  4OO1 B;  2UXD I;  4ED4 A;  2YT4 A;  2FTX B;  5DNX A;  4LOM A;  2GQ0 A;  2GPI A;  1UEK A;  2WNR A;  4FW7 A;  4HYM A;  2V85 A;  4LU9 A;  2YTQ A;  1Y6Z A;  4IFD B;  2R76 A;  3U1Y A;  3VK6 A;  2EN2 A;  4X66 E;  4LFA I;  2F4V I;  1NHH A;  4JI5 E;  4HY1 A;  2PNL A;  4KHP I;  4LF5 I;  5AE3 A;  4Z7C A;  1PJQ A;  4NZV A;  4P7D A;  4L8N A;  1NCS A;  4DPW A;  3K17 A;  2EQ1 A;  2JWO A;  2ELZ A;  3QT7 A;  4KQV A;  4BA1 B;  3DD6 A;  4FWH A;  5C0X F;  4AM3 A;  3H09 A;  3C6M A;  2YRM A;  1T4O A;  2EM4 A;  2UUA I;  1XNR E;  1EH7 A;  2YTJ A;  3PYF A;  1DQ3 A;  1KYQ A;  5JEA F;  2DMI A;  1UN6 B;  4OO1 A;  4PU9 A;  5FLX Q;  4DR3 E;  2BM0 A;  2MKD A;  5T6J A;  4BMJ A;  4OO1 C;  5GMD A;  4IFD E;  2PNZ B;  1N0U A;  5IXM B;  2EP3 A;  4Z7Y A;  3F0N A;  1S4E A;  4AQY E;  1EA6 A;  4DPY A;  5C0X E;  3J7A M;  2KHX A;  4NXM I;  2VF3 A;  4R2C A;  3T1H E;  3EPH A;  4MU4 A;  1N32 I;  4IZJ D;  4OX9 I;  3HPZ A;  2Z5C B;  5A2Q C;  2E72 A;  4BHC A;  1AAY A;  2CPN A;  2RSI A;  2RS6 A;  2BA0 D;  2J7K A;  5L3J A;  4GKK I;  2GO4 A;  4DV7 E;  2RQL A;  4K0K E;  1RRE A;  1MG7 A;  2JEB B;  4DPT A;  4JI2 I;  1J26 A;  4DUY E;  1P42 A;  1H72 C;  4LPF A;  3OML A;  2Q8U A;  1EI1 A;  2O3Z A;  2EOX A;  2LJH A;  3K1J A;  4ZYG A;  2ZM6 E;  2HC5 A;  5CFF E;  2O1T A;  2CT1 A;  1Z5A A;  2ZIT A;  4IFD C;  3M7N D;  2EPA A;  1UDQ A;  2DMY A;  3KZY A;  2UXC E;  1OJ4 A;  3QG5 C;  4WPY A;  1BKN A;  4MQY A;  3J80 C;  3BID A;  1USV A;  2VQE E;  2LJP A;  2NN6 D;  1ZU1 A;  4ISA A;  1X5W A;  2Z5B B;  4BA1 A;  4LFB I;  2JPA A;  2JOB A;  4OX9 E;  5K36 E;  4X9J A;  3B82 A;  2E1R A;  4GKJ E;  2EOZ A;  1J5E E;  1A1G A;  4LFC E;  1H73 A;  4DV3 I;  2CTD A;  5LMU E;  2E5L E;  2DEJ A;  2A25 A;  2M7Q A;  3HKM A;  2LO3 A;  2EL6 A;  2EOS A;  4BC9 A;  2EPU A;  2FV4 B;  2IOP A;  4JI2 E;  1PVG A;  2EE8 A;  4LF6 I;  2LBS B;  4K0K I;  1UIL A;  2EPO A;  4DMI A;  5KL3 A;  2PNZ A;  4FW5 A;  4IZK A;  4LF4 I;  1YFH A;  2EN1 A;  2EMH A;  4DV5 I;  4LF8 I;  4JI8 I;  2EQ0 A;  4I8O A;  2KOU A;  1WJP A;  1I94 E;  2L92 A;  5DRP A;  2EPX A;  1E3P A;  4ZYE A;  2BA1 G; 
#chains in the Genus database with same CATH homology
 4LFA E;  4WFT A;  4DR1 I;  4EMD A;  1J5E I;  4JI6 E;  2N3G A;  1T4L B;  2L2M A;  2V8Q B;  3KWR A;  2CG9 A;  1FWK A;  4J8Z A;  2L3J A;  1WHN A;  1PIE A;  1A6F A;  4M30 A;  1Z59 A;  4DU7 A;  4X64 I;  3HXL A;  5LMU I;  1FNM A;  1N34 I;  1B62 A;  1KIJ A;  4JI6 I;  2B3T B;  1X48 A;  4R8O A;  2KON A;  4URL A;  2O1U A;  1QU6 A;  1B63 A;  5LMN E;  3AV0 A;  1YYK A;  1I94 I;  1Z5B A;  2RSM A;  3Q6M A;  2PNM A;  1EKZ A;  4DXL A;  1Z0C A;  1IBL E;  1HNW E;  2HK3 A;  5BR8 I;  3QT6 A;  4P78 A;  4WYQ B;  1XMQ I;  2ODR C;  4WUB A;  2ODR D;  3C4T A;  4PRX A;  1IBL I;  4FN5 A;  2DIX A;  4DR2 E;  3ZKD A;  4DV3 E;  4JYA I;  1MX0 A;  2OI2 A;  3J81 C;  1ZBQ A;  4M1K A;  3P06 A;  2Z5E A;  4P7A A;  3ADL A;  2B7T A;  4FWG A;  4WUD A;  2UUB E;  2CGE A;  1Z0E A;  2V88 A;  5ADZ A;  4DR4 E;  1FWL A;  3JAM Q;  3Q1Q A;  2WZO A;  4DR3 I;  4JI5 I;  4NXN I;  1XNR I;  3ZZU A;  4LTY A;  4JI8 E;  3RMP A;  4JI1 E;  4USM A;  2LTR A;  1XMQ E;  4WUC A;  2M1S A;  3PYG A;  2YZT A;  5AE1 A;  4NXN E;  1H7U A;  4DR4 I;  5IWA I;  4TUI A;  2LE2 A;  2V89 A;  4X62 I;  2AJ4 A;  2R3V A;  1WUU A;  3Q6N A;  1VIS A;  1HR0 E;  1GQE A;  1Z0V A;  3WU3 A;  1X47 A;  2RS7 A;  1KTV A;  2Z5C A;  4B3T I;  3F6G A;  3QT5 A;  4DR5 I;  3IWC A;  3WU6 A;  2E5L I;  3FIG A;  3ADJ A;  4F9A B;  2A2D A;  2V8P A;  2X36 A;  1Z0B A;  2O1W A;  4GKJ I;  1NHJ A;  4F9B B;  3IWB A;  3T1Y I;  2F8B A;  1HNZ E;  1PKP A;  4L5N C;  3VYY A;  2G7H A;  2V83 A;  1ELO A;  4BC7 A;  1NHI A;  5IWA E;  2R42 A;  4JYA E;  1Z0W A;  2RTX A;  1ZBT A;  2NUF A;  2HKJ A;  2DSY A;  3GON A;  1Z5C A;  2UU9 E;  4LF7 E;  4F9C B;  4LF6 E;  2M4I A;  5AAS A;  2LUP B;  3ADI A;  2N3H A;  3JTZ A;  2JR1 A;  1K47 A;  4JI7 I;  4UTG A;  4HAC A;  2BM1 A;  4JI4 I;  3P1X A;  1N36 I;  3PYE A;  4AQY I;  4R03 A;  4DV0 I;  4YY3 E;  3IWD A;  3HPS A;  2NUE A;  1N33 E;  3B8H A;  3ZZT A;  1FI4 A;  4JI1 I;  2JVA A;  4JI7 E;  4YHH I;  3PRY A;  1SR9 A;  3ZZ0 A;  4B3R I;  1XMO E;  4DPU A;  3LTO A;  1HK7 A;  1ZM4 A;  2UXD E;  4B3M I;  4B3R E;  4YHH E;  2JOX A;  1XNQ E;  4DV1 E;  4I3H A;  2LTS A;  4MYT A;  1QZR A;  2V2Z A;  4M0V A;  1STU A;  4LF5 E;  4FW9 A;  2EZ6 A;  4KHP E;  3PYD A;  4X65 I;  2JY9 A;  4DU8 A;  2MC5 A;  4LFC I;  4P52 A;  2EFG A;  2L2K B;  4JI4 E;  3B78 A;  3LNU A;  5IT9 Q;  4DR7 E;  4DV5 E;  4LF8 E;  2L33 A;  4JI0 E;  2MC6 A;  2IOQ A;  1HNZ I;  4DR6 E;  4DV4 I;  1KVK A;  4DV2 I;  2LUQ A;  4GEQ B;  2B7V A;  5FLX C;  1HNX I;  1HNW I;  1ZM3 A;  2V34 A;  1X49 A;  2NA2 A;  1KKH A;  2EWL A;  4DR7 I;  2HK2 A;  1YYO A;  4BS9 A;  4X65 E;  2L2N A;  4BBY A;  4GKK E;  4X62 E;  2V86 A;  3ZM7 A;  1IBK I;  2L6M A;  2GS8 A;  2DEI A;  3J7A G;  5FWK A;  2B9D A;  4NXM E;  1RR9 A;  1IBM I;  3WU5 A;  3DF6 A;  1H74 A;  3F6H A;  1NZ0 A;  1D6T A;  4DUZ I;  4DR6 I;  3J7Y p;  1N33 I;  3HJC A;  1N0V C;  3ZOQ B;  1YYW A;  4RPF A;  4YY3 I;  2E1M A;  4DV0 E;  2UUC E;  4F54 A;  2BV3 A;  1ZM9 A;  3C4B A;  3K85 A;  2FGG A;  1S16 A;  5DNY A;  1IBK E;  5A2Q Q;  4DR1 E;  3DJW A;  2DB2 A;  4DV1 I;  1RQ0 A;  4B3M E;  4N3O A;  4MYU A;  4DR2 I;  1T4N A;  2VF1 A;  1IBM E;  4ZVI A;  4LF4 E;  1XMO I;  5LL6 R;  1Z0G A;  4LF9 E;  1WHQ A;  2HFS A;  4IZJ B;  4DV7 I;  3OTO E;  4X8W A;  4DV6 I;  3M6A A;  1Y4U A;  3J80 Q;  1GZ6 A;  1FKA E;  3T1Y E;  2UUC I;  2O1V A;  3T1H I;  2V87 A;  5AE2 A;  4TUG A;  1DAR A;  4B3S I;  1Z0T A;  2XEX A;  2ZM6 I;  4JG4 A;  4XTJ A;  4USK A;  3LML A;  2NPF A;  2UXC I;  1N34 E;  4M2Z A;  5IT9 C;  4B3S E;  3LLH A;  2HHH I;  5BR8 E;  4JI0 I;  1DI2 A;  4X64 E;  1MU5 A;  3VYX A;  2UUA E;  2Z5B A;  4IZJ A;  2VE7 C;  4DUY I;  2LRS A;  3WU4 A;  4BCA A;  2LMZ A;  2MDR A;  4JV5 E;  1ZXM A;  3D4J A;  5LMN I;  3HTX A;  1ZM2 A;  1Y4S A;  3OTO I;  2IHR 1;  4DKK A;  2CZ9 A;  1RC7 A;  3LPS A;  1FJG E;  2F4V E;  4X66 I;  1U2R A;  4WSP A;  1N36 E;  1N32 E;  4LF9 I;  2NUG A;  1XNQ I;  2UXB E;  4JI3 E;  1HNX E;  5GME A;  2ZBK B;  3AUZ A;  1ZXN A;  4PRV A;  3K6Q A;  1O0W A;  2HHH E;  4OOG C;  4HXZ A;  4Q28 A;  4DV4 E;  1UHZ A;  4DUZ E;  1HR0 I;  4KZS A;  4LF7 I;  3V2U C;  1XHK A;  3ADG A;  2HKE A;  1H7S A;  2H36 X;  3CWV A;  3JAM C;  2VQF I;  4HAC B;  1WXR A;  4LFB E;  3QT8 A;  2VQE I;  3V5R A;  4JV5 I;  4R1F A;  2WW4 A;  3ZKB A;  2V2Q A;  4FWD A;  2UU9 I;  4UT4 A;  2Q2E B;  4JI3 I;  2UXB I;  4DPX A;  1FJG I;  4B3T E;  4DV2 E;  2K4V A;  1USU A;  3HUL A;  2HFU A;  2VQF E;  2L3C A;  2L8T A;  2A2C A;  5F3W A;  3JU0 A;  4DV6 E;  3MSW A;  4DR5 E;  3HQ1 A;  2X7I A;  2V2V A;  3J81 Q;  1YZ9 A;  4IZK B;  3H4L A;  2UXD I;  4ED4 A;  2YT4 A;  2FTX B;  2GQ0 A;  1UEK A;  4HYM A;  2V85 A;  4LU9 A;  1Y6Z A;  4LFA I;  3VK6 A;  4X66 E;  2F4V I;  1NHH A;  4JI5 E;  4HY1 A;  2PNL A;  4KHP I;  4LF5 I;  5AE3 A;  4Z7C A;  4P7D A;  4L8N A;  4DPW A;  3K17 A;  2JWO A;  3QT7 A;  4KQV A;  4FWH A;  3H09 A;  1T4O A;  2UUA I;  1XNR E;  3PYF A;  1DQ3 A;  4PU9 A;  5FLX Q;  4DR3 E;  2BM0 A;  4BMJ A;  5T6J A;  5GMD A;  1N0U A;  4Z7Y A;  3F0N A;  1S4E A;  4AQY E;  1EA6 A;  4DPY A;  3J7A M;  2KHX A;  4NXM I;  2VF3 A;  1N32 I;  3T1H E;  4IZJ D;  4OX9 I;  3HPZ A;  2Z5C B;  5A2Q C;  2CPN A;  2RS6 A;  2J7K A;  5L3J A;  4GKK I;  4DV7 E;  4K0K E;  1RRE A;  1MG7 A;  4JI2 I;  4DPT A;  1J26 A;  4DUY E;  1H72 C;  3OML A;  1EI1 A;  2LJH A;  3K1J A;  2ZM6 E;  5CFF E;  2O1T A;  1Z5A A;  2ZIT A;  2DMY A;  2UXC E;  1OJ4 A;  4WPY A;  1BKN A;  3J80 C;  2LJP A;  1USV A;  2VQE E;  2UUB I;  4LFB I;  2Z5B B;  2JOB A;  4OX9 E;  3B82 A;  2E1R A;  4GKJ E;  1J5E E;  4LFC E;  1H73 A;  4DV3 I;  5LMU E;  2E5L E;  2DEJ A;  2M7Q A;  4BC9 A;  2FV4 B;  2IOP A;  4JI2 E;  1PVG A;  4LF6 I;  2LBS B;  4K0K I;  1UIL A;  4DMI A;  4IZK A;  4LF4 I;  4DV5 I;  4LF8 I;  4JI8 I;  4I8O A;  2KOU A;  1I94 E;  2L92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...