4JI3E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji3E02
2RSMA 4DPWA 1H72C 3J7AG 4Z7CA 2VF3A 1PKPA 2MDRA 2UXBI 2NA2A 1HR0I 4USMA 4LFBE 4DU8A 4DR7I 1J5EE 1Z0VA 1X47A 4X62E 2LTSA 2NUEA 3HULA 1ZM4A 2HHHE 1B62A 4JI2I 5GMDA 1J26A 4JI7E 2DEIA 1Z0BA 3GONA 2E5LI 4HACA 2UXCI 4OX9I 3HTXA 1I94E 1XMQI 2B3TB 4LF4I 1GQEA 3V5RA 4DV1E 1HNWI 4HY1A 3QT5A 4B3MI 1EA6A 3J7Yp 2LJHA 2UUAE 4LFCI 4DUZI 3Q1QA 1RR9A 3T1HI 1FJGI 5IT9Q 3OTOE 5LMUE 2CZ9A 2LTRA 3J81C 4NXME 4JI3E 4R1FA 1YYOA 2V8PA 4MYTA 2RS6A 1K47A 1H7SA 4LF5I 1UEKA 4B3TE 4JYAE 2NUFA 1IBLE 4DR4E 1O0WA 5GMEA 1Z5CA 1N36I 4P7AA 4KQVA 2RS7A 2F4VE 2UUBI 1ZM9A 3C4BA 4YY3I 4X66E 1DI2A 4OOGC 2L2KB 4DR6E 3ZKDA 4DR3E 1J5EI 1WUUA 3LLHA 4DV3I 3QT8A 4DR1E 4YHHE 4DV6E 2E1RA 4MYUA 2DEJA 1UILA 4DV2I 2LJPA 4LFAE 1Z5BA 2UUCI 4JV5E 4JI6E 1N33E 1X48A 3ADJA 2VQEE 1ZM3A 4EMDA 4WFTA 1EKZA 2GS8A 3J7AM 1IBMI 3QT6A 4X65I 1N34E 3WU6A 3K1JA 1QU6A 4Z7YA 4B3SE 2A2CA 1VISA 4LF6E 4DV7I 2L33A 4JI8I 1HNXI 2VQFE 3ZZTA 3B8HA 1KKHA 4FWHA 3PYFA 4GKKE 5BR8I 1XNRE 4DV5I 4GKJE 4WUDA 3M6AA 2V2ZA 2RTXA 3WU5A 2HKJA 1IBKE 4JI0I 2AJ4A 4KHPE 4LF9I 2UU9E 2B7TA 2HKEA 1S16A 1NHJA 4LF7I 3B78A 4URLA 4WUBA 1RREA 4LF8I 4JI5I 4WUCA 4DV0E 1Z0GA 2B7VA 2IHR1 4DV4E 5IWAE 4AQYI 1HNZI 1FKAE 4B3RI 1D6TA 3B82A 1XMOE 2LRSA 4WYQB 5L3JA 2LUQA 1N32E 2EZ6A 3T1YI 3WU3A 4JI4I 4FWGA 1H74A 4K0KI 3ADLA 2HFUA 4NXNE 2ZM6I 5IT9C 4JI1E 1PIEA 4DUYE 1ZXNA 4I3HA 2BM1A 2EFGA 2NPFA 4DR5I 4X64E 3LTOA 3PYDA 1X49A 1OJ4A 1T4OA 2L3CA 1XNQI 4DR2I 4PRVA 1Z59A 2BV3A 5LMNI 2L3JA 2LUPB 2V2QA 2UXBE 2UXDE 1HR0E 4HACB 4FW9A 1WHQA 4RPFA 1NHHA 4UTGA 4DR7E 2KHXA 4LFBI 1ZBTA 4FN5A 2V34A 1PVGA 4DKKA 4X62I 2ZITA 4FWDA 4JG4A 4JI2E 2L2NA 2HHHI 1T4NA 4M1KA 4JI7I 2E5LE 2UXCE 4DPXA 4OX9E 1XMQE 4DV0I 1MU5A 1I94I 4LF4E 3ZKBA 1T4LB 1HNWE 1YYWA 1UHZA 4DV1I 4B3ME 2DMYA 2Q2EB 4LFCE 4DUZE 1ELOA 2UUAI 1FWKA 3D4JA 3T1HE 2JY9A 2LBSB 1FJGE 3C4TA 2R42A 1DARA 3OTOI 5LMUI 3V2UC 4XTJA 1Z0EA 3K17A 3ZZUA 1Z0CA 4HXZA 4NXMI 4JI3I 4LF5E 3ZZ0A 4M30A 4B3TI 4JYAI 1Z0TA 1N36E 1IBLI 4DR4I 3P1XA 1KVKA 1Z5AA 2BM0A 1MG7A 3LNUA 2UUBE 2UXDI 4YY3E 4X8WA 5A2QQ 2F4VI 1EI1A 3CWVA 2HK3A 2DIXA 5A2QC 1Z0WA 4X66I 1KTVA 1S4EA 4DV3E 1XHKA 4DR6I 4DR3I 3F0NA 2X7IA 2R3VA 3PYGA 4DR1I 4YHHI 4DV6I 4HYMA 2OI2A 4DV2E 1YYKA 2UUCE 1FNMA 3WU4A 4LFAI 4JV5I 1H73A 4JI6I 5CFFE 1N33I 1IBME 2VQEI 3PYEA 4X65E 4ZVIA 1N34I 2X36A 2L2MA 1QZRA 2HK2A 3VYXA 1FWLA 4USKA 4B3SI 5LL6R 2NUGA 4DV7E 4JI8E 1HNXE 4LF6I 5BR8E 2VQFI 4DU7A 4M2ZA 1KIJA 2CPNA 2WW4A 4GKKI 4DV5E 3H4LA 1MX0A 1ZM2A 1XNRI 3J81Q 1B63A 4GKJI 1ZXMA 4DPTA 4DPYA 1FI4A 4JI0E 4PRXA 1IBKI 4LF9E 4KHPI 2UU9I 2XEXA 4LF7E 1N0UA 1RC7A 4P52A 1BKNA 4UT4A 2YT4A 1U2RA 4LF8E 3JAMQ 2N3GA 4JI5E 3JAMC 1STUA 1NHIA 2V2VA 2ZBKB 1H7UA 4AQYE 1HNZE 1NZ0A 3ADGA 4DV4I 4B3RE 5IWAI 3J80Q 2J7KA 1YZ9A 3VYYA 3J80C 1XMOI 1WHNA 3LPSA 4ED4A 3T1YE 2N3HA 5FLXQ 4JI4E 3QT7A 1N32I 2DB2A 5FLXC 2A2DA 1RQ0A 4K0KE 2ZM6E 2HFSA 4DXLA 4NXNI 4DPUA 4DR5E 3ZM7A 4JI1I 4DUYI 2JVAA 4X64I 1A6FA 1N0VC 1XNQE 4DR2E 3ADIA 4PU9A 5LMNE
chains in the Genus database with same CATH superfamily
2RSMA 1B69A 3F6GA 4BA2A 5K36E 4DPWA 3J7AG 1IQOA 2EM5A 1H72C 3THNA 3HJCA 5TSEA 3EPKA 2V89A 4ZYEA 4Z7CA 2VF3A 1PKPA 2M1SA 2MDRA 4L8NA 2UXBI 1Y4UA 5A6KA 3MSWA 2NA2A 1TF6A 1HR0I 4USMA 4F6MA 4LFBE 4BA1B 4DU8A 4DR7I 1J5EE 2EOHA 1A1LA 1Z0VA 4WXCA 1X47A 2GHFA 4RHBB 2V85A 1IQSA 1KYQA 3KWRA 4X62E 2EMHA 2EOSA 2LTSA 1DQ3A 4HEIA 1GTKA 2DMIA 2GPIA 2KONA 2RQLA 2NUEA 1WXRA 2BA1D 3HULA 1ZM4A 4M0VA 2HHHE 1B62A 2YU5A 2IOQA 3MHHC 4JI2I 2A25A 3P76A 1J26A 5GMDA 4JI7E 2DEIA 2YTNA 2JEAB 1Z0BA 3GONA 5JEAA 2E5LI 4HACA 1UBDC 3M85G 4OX9I 2MKDA 3HTXA 1I94E 3AUZA 4R8OA 2UXCI 1LLMC 1XMQI 3ECRA 2B3TB 2L92A 4LF4I 4HTGA 1Y6ZA 5A6BD 2NN6F 1GQEA 3V5RA 1YH8A 4DV1E 2PO1A 4O5GA 2EPNA 1HNWI 1A1GA 4HY1A 3QT5A 1USVA 4B3MI 2YSPA 5KL5A 4R2QA 1EA6A 4MU1A 4LOMA 3J7Yp 2PO0B 3KZZA 1R6MA 4LPFA 3CDIA 2LJHA 2UUAE 4LFCI 2MKNA 1R6LA 2F8BA 4DUZI 3Q1QA 2EM0A 3EPHA 2LE2A 1RR9A 2DGCA 4IS1C 3T1HI 4OO1D 1FJGI 5IT9Q 3OTOE 3EQ1A 4J3DA 5C0XC 1QNTA 5LMUE 2CZ9A 4MLQA 1BB8A 5K36B 3HPZA 2RPCA 4F9AB 2EMWA 5DRPA 2WP8A 2EPXA 2LTRA 3J81C 4Q35B 4F2JC 4NXME 1SR9A 4JI3E 2WNRB 2YTIA 4P78A 2PO2A 1YYOA 4R1FA 2EJ4A 1ZU1A 5AE3A 1JK1A 2C39A 2V8PA 5LLQA 4MYTA 4U3BA 4ZYGA 2RS6A 2YTPA 1H7SA 1K47A 4LF5I 5DNYA 1UEKA 4IFDD 1N3GA 4B3TE 4JYAE 4MU3A 2WBUA 2EMIA 2M9AA 1IBLE 2NUFA 1P42A 4DR4E 4GQUA 1O0WA 4N4RB 5GMEA 1AAYA 1Z5CA 1N36I 4P7AA 4IZJB 1USUA 1TF3A 1EH7A 4KQVA 2RS7A 1UDOA 2F4VE 4LCHA 1ZBQA 2EN6A 4DMIA 3GCMA 3H09A 2WBSA 3U1KA 2UUBI 1ZM9A 3C4BA 4YY3I 4X66E 2YPNA 3RMPA 1DI2A 5EKWA 4OOGC 2K4VA 2L2KB 4DR6E 3P3CA 2JP9A 3ZKDA 4DR3E 3BF2A 2JE6A 2F1DA 1J5EI 1WUUA 3LLHA 4DV3I 3QT8A 2ADRA 1BBGA 4MU0A 3AV0A 2FV4B 4I8OA 4DR1E 4YHHE 2V86A 1OYPA 4DV6E 1YFHA 2E1RA 3L7ZA 2EPKX 2ODRC 4BBYA 2HJJA 4MYUA 4OO1E 2DEJA 3MHSC 2MC5A 4IS9A 2O1TA 1UILA 2V88A 2I13A 2LJPA 4LFAE 1Z5BA 4LCFA 2E72A 4DV2I 1UDSA 4JV5E 2UUCI 4BC9A 2BR2A 4JI6E 5IV8B 1E3HA 5JEAD 2LCEA 1N33E 1X48A 2CT1A 2NABA 3ADJA 2VQEE 1ZM3A 1X6HA 4WFTA 1EKZA 2GS8A 4EMDA 3J7AM 1IBMI 2LVHA 2EN1A 4FW3A 2YSOA 2EOYA 2YTJA 2LT7A 1N34E 3QT6A 4X65I 3WU6A 4IFDE 3K1JA 5C0XF 3KZYA 3UK3C 4FW7A 1QU6A 4Z7YA 3HXLA 2EMCA 2GQ0A 4B3SE 2A2CA 3P06A 1YPNA 1VISA 4LF6E 2JEBA 4KZSA 4IZKB 1T38A 4DV7I 2L33A 4R2CA 4JI8I 1HNXI 2VQFE 2PRTA 3B8HA 1KKHA 3PYFA 4FWHA 1SFEA 4GKKE 3ZZTA 5BR8I 5K36C 2EPOA 2JOXA 4F6NA 5IXMB 3EPLA 1XNRE 4DV5I 5AC4A 5KL3A 4GKJE 1UN6B 3M6AA 4WUDA 2V2ZA 4BHCA 2RTXA 5AE1A 2EOQA 3WU5A 2NN6A 1TN9A 2HKJA 4WSPA 1IBKE 2EM4A 5ADZA 2O3ZA 4BS9A 2AJ4A 4JI0I 3M85D 2YTDA 1YHCA 2M7QA 3QG5C 4KHPE 4WPYA 5JEAE 4LF9I 2UU9E 5DRRA 2B7TA 2VF1A 3M99B 2HKEA 4QNKA 4U3DA 2Z5BA 1S16A 4R2RA 1NHJA 2EL4A 1Y60A 2PNZB 2EOXA 4LF7I 4ZYDA 1E3PA 2EP3A 3B78A 4URLA 1OYSA 2O1UA 4BHBA 4WUBA 2EORA 3DJWA 2DRPA 2EM3A 1RREA 2CVEA 4LF8I 4OO1B 2EL6A 4WUCA 4DV0E 1Z0GA 4JI5I 4MLVA 2MC6A 3Q6NA 2B7VA 2K7IA 2YRKA 2J65A 1GZ6A 2IHR1 4DV4E 4AM3A 1YUJA 5IWAE 1L4SA 4AQYI 1HNZI 1FKAE 4B3RI 4GEQB 5DRQA 2EMBA 1D6TA 3B82A 4IJDA 1XMOE 4GZNC 4IFDB 2EM2A 2LRSA 3OMLA 2EMLA 4WYQB 1G2FC 2LUQA 2BA0D 3P3EA 4LCGA 1N32E 5L3JA 4BA2B 2EZ6A 4IZJA 3T1YI 3WU3A 4JI4I 4FWGA 2PNLA 2BBGA 1H74A 4K0KI 1Y4SA 5FWKA 3ADLA 1VI7A 2N8XA 4NXNE 2C38A 2HFUA 3TQMA 5IT9C 3B4TA 2ZM6I 5K36F 2EOJA 4JI1E 1PIEA 4DUYE 2LV2A 1ZXNA 2BM1A 1G2DC 2EFGA 2NPFA 4I3HA 2DLQA 4DR5I 5DNLA 4X64E 2BA0G 2EPZA 4R2DA 2WCC3 3LTOA 3PYDA 1X49A 2L8TA 1OJ4A 1T4OA 2RSIA 3CDJA 2HGHA 2FGGA 2DLKA 2L3CA 4Q28A 2GO3A 1RHYA 4DR2I 4PRVA 1XNQI 1Z59A 2BV3A 4R2EA 5LMNI 2L3JA 2LUPB 2EPRA 2V2QA 2UXBE 2Z5CA 2JXPA 5JEAB 1T39A 2UXDE 2M4IA 1HR0E 4HACB 2C37A 4FW9A 1WHQA 2EOFA 1NHHA 4RPFA 4UTGA 4DR7E 2NN6D 2V87A 2KHXA 4LFBI 3UHMA 5AE2A 5C0XA 2EPAA 1ZBTA 4FN5A 1ZAAC 2EPCA 1A1IA 2V34A 2PO1B 2G7HA 4OKGA 1PVGA 4FW4A 3M7NG 4DKKA 4MU4A 4X62I 2ZITA 2YTFA 4NBQA 2YZTA 4FWDA 4JG4A 2ENHA 4JI2E 2L2NA 3PRYA 1JK2A 2HHHI 4OO1C 1T4NA 4M1KA 4ZYHA 3HKMA 2FTXB 2E1MA 2CGEA 4JI7I 2E5LE 2UXCE 4DPXA 4OX9E 1KJKA 4AIDA 3PS1A 1XMQE 4DV0I 2EE8A 1Y5YA 1RMDA 1MU5A 1AH5A 2V8QB 2YTGA 3ZOQB 4OZEA 1ZR9A 4KWYA 4LF4E 4BA1A 1I94I 4FK5C 5KL7A 4AIMA 2WP8B 3ZKBA 1T4LB 4ISAA 1HNWE 4J8ZA 2B9DA 1YYWA 1UHZA 4M9VC 4IFDC 1F2IG 2JT2A 2PO2B 4DV1I 2C39B 2IERA 4B3ME 2DMYA 3H1CA 2EN4A 2EM8A 1PJSA 4LFCE 2ELZA 4DUZE 2Q2EB 3NZKA 3PS3A 5ELWA 2EN7A 2V83A 3JTZA 1ELOA 2UUAI 1FWKA 2NN6E 2JEAA 3D4JA 3T1HE 2JY9A 2LBSB 2D9HA 3C4TA 2J7JA 1FJGE 4WX9A 2VRDA 2R42A 1DARA 4MDTA 4FW5A 2Z5EA 3OTOI 1DGCA 2JOBA 3IWBA 2IESA 5LMUI 3V2UC 4XTJA 2EM9A 2CTDA 2EMXA 1Z0EA 3DD6A 3K17A 5DNXA 2JE6B 3ZZUA 1Z0CA 4HXZA 2EN2A 1PDAA 5A69A 1XXEA 1PJTA 5F3WA 4NXMI 2EQ3A 2I9IA 4JI3I 2EMKA 4LF5E 2H36X 3IWCA 1HK7A 4N3OA 2L6MA 3ZZ0A 4LU9A 3LMLA 4M30A 3L7ZB 3PS2A 2ENCA 2O1VA 2YTQA 4RH8A 2PO0A 4B3TI 4JYAI 1Z0TA 2EN8A 1N36E 1IBLI 1A1KA 5EL9A 5JEAC 4DR4I 3P1XA 2BR2B 1KVKA 1X5WA 1Z5AA 1A1JA 1MG7A 2BM0A 3LNUA 2UUBE 2UXDI 4YY3E 4X8WA 5A2QQ 2F4VI 2YRHA 1EI1A 4OO1F 1NEIA 3CWVA 5K36A 4R03A 2HK3A 2DIXA 5A2QC 1X6EA 2WBTA 1Z0WA 4X66I 5C0XD 1KTVA 4BCAA 2EMFA 2EWLA 4O24A 4DV3E 1BBOA 1S4EA 1XHKA 4DR6I 4DR3I 2O1WA 2EMGA 2WNRA 2AE8A 3F0NA 2X7IA 2R3VA 2DSYA 3C6KA 3PYGA 2CSHA 4DR1I 4YHHI 4FW6A 3HPSA 4DV6I 2EQ1A 1WRJA 2JEBB 2OI2A 3KRNA 2EPMX 4HYMA 4IFDF 2KOUA 4DV2E 1Z1BA 1YYKA 3P3GA 2UUCE 1FNMA 3WU4A 3C6MA 4P7DA 3GLLA 4NHRA 4LFAI 4JV5I 1H73A 4R2SA 2GLIA 3K85A 4JI6I 5T6JA 2EOMA 5CFFE 1N33I 1IBME 2BB8A 2VQEI 3PYEA 4X65E 4ZVIA 1NCSA 4O4KA 4R2PA 1A1HA 2YRMA 2CG9A 4F54A 1N34I 2X36A 5DROA 2NN6B 2L2MA 1EH8A 1QZRA 3F6HA 1YUIA 2BA1G 2HK2A 3VYXA 3Q6MA 1FWLA 2EPLX 4USKA 4B3SI 1UDQA 5LL6R 2YWQA 3VK6A 2NUGA 2EN3A 4DV7E 1X6FA 4JI8E 3BIDA 5KL4A 1HNXE 4LF6I 2ELYA 2ODRD 2Z5BB 5BR8E 2VQFI 4DU7A 4M2ZA 5C0XE 1KIJA 2CPNA 2WW4A 3M7ND 1EH6A 4X9JA 2EOZA 4GKKI 2EOOA 2EMZA 1PJQA 4DV5E 3H4LA 4NZVA 3BBGA 4F9CB 1MX0A 5JEAF 1ZM2A 2HC5A 4LTYA 1XNRI 3VHTB 3J81Q 3DF6A 1B63A 4GKJI 1ZXMA 4DPTA 3L00A 4DPYA 1FI4A 4JI0E 2JR1A 2VE7C 2R1FA 4PRXA 3IWDA 4F9BB 1IBKI 2YTEA 3BGHA 4WSGA 4LF9E 2LO3A 4KHPI 3GMEA 5LMNE 4IZKA 5KL2A 2UU9I 2XEXA 2YU8A 4LF7E 2GO4A 3HQ1A 5AC5A 2MDGA 2JWOA 1N0UA 2JYAA 1RC7A 1BKNA 4P52A 5AASA 4UT4A 2Q8UA 2VESA 2YT4A 3K6QA 1OYRA 1X3CA 1U2RA 4LF8E 3JAMQ 2N3GA 4JI5E 5K36D 4L5NC 3JAMC 1STUA 1P47A 1NHIA 2ENAA 2C38B 2V2VA 4BC7A 2ZBKB 2WZOA 1UDNA 1H7UA 4BMJA 5KL6A 3THOB 1A1FA 4AQYE 1HNZE 1NZ0A 5A6BA 3ADGA 4DV4I 2EMAA 4B3RE 5IWAI 2YTOA 3J80Q 2J7KA 2PNMA 1YZ9A 3VYYA 3J80C 4TUIA 4MQYA 1XMOI 1WHNA 1IMUA 3LPSA 4QNJA 2LMZA 2PNZA 4ED4A 3T1YE 2N3HA 2JPAA 4IZJD 4JI4E 3QT7A 2EM6A 5FLXQ 1N32I 2DB2A 2EPUA 5FLXC 3EPJA 2LJUA 4TUGA 2A2DA 1RQ0A 4K0KE 2Z5CB 2EL5A 4WXDA 2ZM6E 4OO1A 2NN6C 1WJPA 2HFSA 2C37B 4DXLA 2EPPA 4NXNI 2EM7A 4DPUA 4DR5E 3ZM7A 4JI1I 2EQ0A 5C0XB 2IOPA 4DUYI 2EMYA 3JU0A 1MEYC 2JVAA 2EOIA 5A6JA 4X64I 1MGTA 1A6FA 4R2AA 2EOEA 1YSAC 1N0VC 1XNQE 2R76A 5A6AA 4DR2E 3U1YA 4O43A 3ADIA 4PU9A 4IFDA 3FIGA
chains in the Genus database with same CATH topology
2RSMA 3F6GA 4DPWA 3J7AG 1H72C 3HJCA 2V89A 4Z7CA 2VF3A 1PKPA 2M1SA 2MDRA 4L8NA 2UXBI 1Y4UA 3MSWA 2NA2A 1HR0I 4USMA 4LFBE 4DU8A 4DR7I 1J5EE 1Z0VA 1X47A 2V85A 4X62E 3KWRA 2LTSA 1DQ3A 2NUEA 2KONA 3HULA 1WXRA 1ZM4A 4M0VA 2HHHE 1B62A 2IOQA 4JI2I 5GMDA 1J26A 4JI7E 2DEIA 1Z0BA 3GONA 2E5LI 4HACA 2UXCI 4OX9I 3HTXA 1I94E 3AUZA 4R8OA 1XMQI 2B3TB 2L92A 4LF4I 1Y6ZA 1GQEA 3V5RA 4DV1E 1HNWI 4HY1A 3QT5A 1USVA 4B3MI 1EA6A 3J7Yp 2LJHA 2UUAE 4LFCI 4DUZI 2F8BA 3Q1QA 2LE2A 1RR9A 3T1HI 1FJGI 5IT9Q 3OTOE 5LMUE 2CZ9A 3HPZA 4F9AB 2LTRA 3J81C 4NXME 1SR9A 4JI3E 4P78A 4R1FA 1YYOA 5AE3A 2V8PA 4MYTA 2RS6A 1K47A 1H7SA 4LF5I 5DNYA 1UEKA 4B3TE 4JYAE 2NUFA 1IBLE 4DR4E 1O0WA 5GMEA 1Z5CA 1N36I 4P7AA 4IZJB 1USUA 4KQVA 2RS7A 2F4VE 1ZBQA 4DMIA 3H09A 2UUBI 1ZM9A 3C4BA 4YY3I 4X66E 3RMPA 1DI2A 4OOGC 2K4VA 2L2KB 4DR6E 3ZKDA 4DR3E 1J5EI 1WUUA 3LLHA 4DV3I 3QT8A 3AV0A 2FV4B 4I8OA 4DR1E 4YHHE 2V86A 4DV6E 2E1RA 2ODRC 4MYUA 4BBYA 2DEJA 2MC5A 2O1TA 1UILA 2V88A 4DV2I 2LJPA 4LFAE 1Z5BA 2UUCI 4JV5E 4BC9A 4JI6E 1N33E 1X48A 3ADJA 2VQEE 1ZM3A 4EMDA 4WFTA 1EKZA 2GS8A 3J7AM 1IBMI 3QT6A 4X65I 1N34E 3WU6A 3K1JA 1QU6A 4Z7YA 3HXLA 2GQ0A 4B3SE 2A2CA 3P06A 1VISA 4LF6E 4KZSA 4IZKB 4DV7I 2L33A 4JI8I 1HNXI 2VQFE 3ZZTA 3B8HA 1KKHA 3PYFA 4FWHA 4GKKE 5BR8I 2JOXA 1XNRE 4DV5I 4GKJE 4WUDA 3M6AA 2V2ZA 2RTXA 5AE1A 3WU5A 2HKJA 4WSPA 1IBKE 5ADZA 4JI0I 4BS9A 2AJ4A 2M7QA 4KHPE 4WPYA 4LF9I 2UU9E 2B7TA 2VF1A 2HKEA 2Z5BA 1S16A 1NHJA 4LF7I 3B78A 4URLA 2O1UA 4WUBA 1RREA 3DJWA 4LF8I 4JI5I 4WUCA 4DV0E 1Z0GA 2MC6A 3Q6NA 2B7VA 1GZ6A 2IHR1 4DV4E 5IWAE 4AQYI 1HNZI 1FKAE 4B3RI 4GEQB 1D6TA 3B82A 1XMOE 2LRSA 3OMLA 4WYQB 5L3JA 2LUQA 1N32E 2EZ6A 4IZJA 3T1YI 3WU3A 4JI4I 4FWGA 2PNLA 1H74A 4K0KI 1Y4SA 5FWKA 3ADLA 2HFUA 4NXNE 2ZM6I 5IT9C 4JI1E 1PIEA 4DUYE 1ZXNA 4I3HA 2BM1A 2EFGA 2NPFA 4DR5I 4X64E 3LTOA 3PYDA 1X49A 2L8TA 1OJ4A 1T4OA 2FGGA 2L3CA 4Q28A 4DR2I 1XNQI 4PRVA 1Z59A 2BV3A 5LMNI 2L3JA 2LUPB 2V2QA 2UXBE 2Z5CA 2UXDE 2M4IA 1HR0E 4HACB 4FW9A 1WHQA 4RPFA 1NHHA 4UTGA 4DR7E 2V87A 2KHXA 4LFBI 5AE2A 1ZBTA 4FN5A 2V34A 2G7HA 1PVGA 4DKKA 4X62I 2ZITA 2YZTA 4FWDA 4JG4A 4JI2E 2L2NA 3PRYA 2HHHI 1T4NA 4M1KA 2FTXB 2E1MA 2CGEA 4JI7I 2E5LE 2UXCE 4DPXA 4OX9E 1XMQE 4DV0I 1MU5A 2V8QB 3ZOQB 1I94I 4LF4E 3ZKBA 1T4LB 1HNWE 4J8ZA 2B9DA 1YYWA 1UHZA 4DV1I 4B3ME 2DMYA 2Q2EB 4LFCE 4DUZE 2V83A 3JTZA 1ELOA 2UUAI 1FWKA 3D4JA 3T1HE 2JY9A 2LBSB 1FJGE 3C4TA 2R42A 1DARA 2Z5EA 3OTOI 2JOBA 3IWBA 5LMUI 3V2UC 4XTJA 1Z0EA 3K17A 3ZZUA 1Z0CA 4HXZA 5F3WA 4NXMI 4JI3I 4LF5E 2H36X 3IWCA 1HK7A 4N3OA 2L6MA 3ZZ0A 4LU9A 3LMLA 4M30A 2O1VA 4B3TI 4JYAI 1Z0TA 1N36E 1IBLI 4DR4I 3P1XA 1KVKA 1Z5AA 2BM0A 1MG7A 3LNUA 2UUBE 2UXDI 4YY3E 4X8WA 5A2QQ 2F4VI 1EI1A 3CWVA 4R03A 2HK3A 2DIXA 5A2QC 1Z0WA 4X66I 1KTVA 4BCAA 2EWLA 1S4EA 4DV3E 1XHKA 4DR6I 4DR3I 2O1WA 3F0NA 2X7IA 2R3VA 2DSYA 3PYGA 4DR1I 4YHHI 3HPSA 4DV6I 4HYMA 2OI2A 2KOUA 4DV2E 1YYKA 2UUCE 1FNMA 3WU4A 4P7DA 4LFAI 4JV5I 1H73A 3K85A 4JI6I 5T6JA 5CFFE 1N33I 1IBME 2VQEI 3PYEA 4X65E 4ZVIA 2CG9A 4F54A 1N34I 2X36A 2L2MA 1QZRA 3F6HA 2HK2A 3VYXA 3Q6MA 1FWLA 4USKA 4B3SI 5LL6R 3VK6A 2NUGA 4DV7E 4JI8E 1HNXE 4LF6I 2ODRD 2Z5BB 5BR8E 2VQFI 4DU7A 4M2ZA 1KIJA 2CPNA 2WW4A 4GKKI 4DV5E 3H4LA 4F9CB 1MX0A 1ZM2A 4LTYA 1XNRI 3J81Q 3DF6A 1B63A 4GKJI 1ZXMA 4DPTA 4DPYA 1FI4A 4JI0E 2JR1A 2VE7C 4PRXA 3IWDA 4F9BB 1IBKI 4LF9E 4KHPI 4IZKA 2UU9I 2XEXA 4LF7E 3HQ1A 2JWOA 1N0UA 1RC7A 4P52A 1BKNA 4UT4A 5AASA 2YT4A 3K6QA 1U2RA 4LF8E 3JAMQ 2N3GA 4JI5E 4L5NC 3JAMC 1STUA 1NHIA 3FIGA 2V2VA 4BC7A 2ZBKB 2WZOA 1H7UA 4BMJA 4AQYE 1HNZE 1NZ0A 3ADGA 4DV4I 4B3RE 5IWAI 3J80Q 2J7KA 2PNMA 1YZ9A 3VYYA 3J80C 4TUIA 1XMOI 1WHNA 3LPSA 4ED4A 2LMZA 3T1YE 2N3HA 4IZJD 5FLXQ 4JI4E 3QT7A 1N32I 2DB2A 5FLXC 4TUGA 2A2DA 1RQ0A 4K0KE 2Z5CB 2ZM6E 2HFSA 4DXLA 4NXNI 4DPUA 4DR5E 3ZM7A 4JI1I 2IOPA 4DUYI 3JU0A 2JVAA 4X64I 1A6FA 1N0VC 1XNQE 4DR2E 3ADIA 4PU9A 5LMNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSM A;  4DPW A;  1H72 C;  3J7A G;  4Z7C A;  2VF3 A;  1PKP A;  2MDR A;  2UXB I;  2NA2 A;  1HR0 I;  4USM A;  4LFB E;  4DU8 A;  4DR7 I;  1J5E E;  1Z0V A;  1X47 A;  4X62 E;  2LTS A;  2NUE A;  3HUL A;  1ZM4 A;  2HHH E;  1B62 A;  4JI2 I;  5GMD A;  1J26 A;  4JI7 E;  2DEI A;  1Z0B A;  3GON A;  2E5L I;  4HAC A;  2UXC I;  4OX9 I;  3HTX A;  1I94 E;  1XMQ I;  2B3T B;  4LF4 I;  1GQE A;  3V5R A;  4DV1 E;  1HNW I;  4HY1 A;  3QT5 A;  4B3M I;  1EA6 A;  3J7Y p;  2LJH A;  2UUA E;  4LFC I;  4DUZ I;  3Q1Q A;  1RR9 A;  3T1H I;  1FJG I;  5IT9 Q;  3OTO E;  5LMU E;  2CZ9 A;  2LTR A;  3J81 C;  4NXM E;  4JI3 E;  4R1F A;  1YYO A;  2V8P A;  4MYT A;  2RS6 A;  1K47 A;  1H7S A;  4LF5 I;  1UEK A;  4B3T E;  4JYA E;  2NUF A;  1IBL E;  4DR4 E;  1O0W A;  5GME A;  1Z5C A;  1N36 I;  4P7A A;  4KQV A;  2RS7 A;  2F4V E;  2UUB I;  1ZM9 A;  3C4B A;  4YY3 I;  4X66 E;  1DI2 A;  4OOG C;  2L2K B;  4DR6 E;  3ZKD A;  4DR3 E;  1J5E I;  1WUU A;  3LLH A;  4DV3 I;  3QT8 A;  4DR1 E;  4YHH E;  4DV6 E;  2E1R A;  4MYU A;  2DEJ A;  1UIL A;  4DV2 I;  2LJP A;  4LFA E;  1Z5B A;  2UUC I;  4JV5 E;  4JI6 E;  1N33 E;  1X48 A;  3ADJ A;  2VQE E;  1ZM3 A;  4EMD A;  4WFT A;  1EKZ A;  2GS8 A;  3J7A M;  1IBM I;  3QT6 A;  4X65 I;  1N34 E;  3WU6 A;  3K1J A;  1QU6 A;  4Z7Y A;  4B3S E;  2A2C A;  1VIS A;  4LF6 E;  4DV7 I;  2L33 A;  4JI8 I;  1HNX I;  2VQF E;  3ZZT A;  3B8H A;  1KKH A;  4FWH A;  3PYF A;  4GKK E;  5BR8 I;  1XNR E;  4DV5 I;  4GKJ E;  4WUD A;  3M6A A;  2V2Z A;  2RTX A;  3WU5 A;  2HKJ A;  1IBK E;  4JI0 I;  2AJ4 A;  4KHP E;  4LF9 I;  2UU9 E;  2B7T A;  2HKE A;  1S16 A;  1NHJ A;  4LF7 I;  3B78 A;  4URL A;  4WUB A;  1RRE A;  4LF8 I;  4JI5 I;  4WUC A;  4DV0 E;  1Z0G A;  2B7V A;  2IHR 1;  4DV4 E;  5IWA E;  4AQY I;  1HNZ I;  1FKA E;  4B3R I;  1D6T A;  3B82 A;  1XMO E;  2LRS A;  4WYQ B;  5L3J A;  2LUQ A;  1N32 E;  2EZ6 A;  3T1Y I;  3WU3 A;  4JI4 I;  4FWG A;  1H74 A;  4K0K I;  3ADL A;  2HFU A;  4NXN E;  2ZM6 I;  5IT9 C;  4JI1 E;  1PIE A;  4DUY E;  1ZXN A;  4I3H A;  2BM1 A;  2EFG A;  2NPF A;  4DR5 I;  4X64 E;  3LTO A;  3PYD A;  1X49 A;  1OJ4 A;  1T4O A;  2L3C A;  1XNQ I;  4DR2 I;  4PRV A;  1Z59 A;  2BV3 A;  5LMN I;  2L3J A;  2LUP B;  2V2Q A;  2UXB E;  2UXD E;  1HR0 E;  4HAC B;  4FW9 A;  1WHQ A;  4RPF A;  1NHH A;  4UTG A;  4DR7 E;  2KHX A;  4LFB I;  1ZBT A;  4FN5 A;  2V34 A;  1PVG A;  4DKK A;  4X62 I;  2ZIT A;  4FWD A;  4JG4 A;  4JI2 E;  2L2N A;  2HHH I;  1T4N A;  4M1K A;  4JI7 I;  2E5L E;  2UXC E;  4DPX A;  4OX9 E;  1XMQ E;  4DV0 I;  1MU5 A;  1I94 I;  4LF4 E;  3ZKB A;  1T4L B;  1HNW E;  1YYW A;  1UHZ A;  4DV1 I;  4B3M E;  2DMY A;  2Q2E B;  4LFC E;  4DUZ E;  1ELO A;  2UUA I;  1FWK A;  3D4J A;  3T1H E;  2JY9 A;  2LBS B;  1FJG E;  3C4T A;  2R42 A;  1DAR A;  3OTO I;  5LMU I;  3V2U C;  4XTJ A;  1Z0E A;  3K17 A;  3ZZU A;  1Z0C A;  4HXZ A;  4NXM I;  4JI3 I;  4LF5 E;  3ZZ0 A;  4M30 A;  4B3T I;  4JYA I;  1Z0T A;  1N36 E;  1IBL I;  4DR4 I;  3P1X A;  1KVK A;  1Z5A A;  2BM0 A;  1MG7 A;  3LNU A;  2UUB E;  2UXD I;  4YY3 E;  4X8W A;  5A2Q Q;  2F4V I;  1EI1 A;  3CWV A;  2HK3 A;  2DIX A;  5A2Q C;  1Z0W A;  4X66 I;  1KTV A;  1S4E A;  4DV3 E;  1XHK A;  4DR6 I;  4DR3 I;  3F0N A;  2X7I A;  2R3V A;  3PYG A;  4DR1 I;  4YHH I;  4DV6 I;  4HYM A;  2OI2 A;  4DV2 E;  1YYK A;  2UUC E;  1FNM A;  3WU4 A;  4LFA I;  4JV5 I;  1H73 A;  4JI6 I;  5CFF E;  1N33 I;  1IBM E;  2VQE I;  3PYE A;  4X65 E;  4ZVI A;  1N34 I;  2X36 A;  2L2M A;  1QZR A;  2HK2 A;  3VYX A;  1FWL A;  4USK A;  4B3S I;  5LL6 R;  2NUG A;  4DV7 E;  4JI8 E;  1HNX E;  4LF6 I;  5BR8 E;  2VQF I;  4DU7 A;  4M2Z A;  1KIJ A;  2CPN A;  2WW4 A;  4GKK I;  4DV5 E;  3H4L A;  1MX0 A;  1ZM2 A;  1XNR I;  3J81 Q;  1B63 A;  4GKJ I;  1ZXM A;  4DPT A;  4DPY A;  1FI4 A;  4JI0 E;  4PRX A;  1IBK I;  4LF9 E;  4KHP I;  2UU9 I;  2XEX A;  4LF7 E;  1N0U A;  1RC7 A;  4P52 A;  1BKN A;  4UT4 A;  2YT4 A;  1U2R A;  4LF8 E;  3JAM Q;  2N3G A;  4JI5 E;  3JAM C;  1STU A;  1NHI A;  2V2V A;  2ZBK B;  1H7U A;  4AQY E;  1HNZ E;  1NZ0 A;  3ADG A;  4DV4 I;  4B3R E;  5IWA I;  3J80 Q;  2J7K A;  1YZ9 A;  3VYY A;  3J80 C;  1XMO I;  1WHN A;  3LPS A;  4ED4 A;  3T1Y E;  2N3H A;  5FLX Q;  4JI4 E;  3QT7 A;  1N32 I;  2DB2 A;  5FLX C;  2A2D A;  1RQ0 A;  4K0K E;  2ZM6 E;  2HFS A;  4DXL A;  4NXN I;  4DPU A;  4DR5 E;  3ZM7 A;  4JI1 I;  4DUY I;  2JVA A;  4X64 I;  1A6F A;  1N0V C;  1XNQ E;  4DR2 E;  3ADI A;  4PU9 A;  5LMN E; 
#chains in the Genus database with same CATH topology
 2RSM A;  1B69 A;  3F6G A;  4BA2 A;  5K36 E;  4DPW A;  3J7A G;  1IQO A;  2EM5 A;  1H72 C;  3THN A;  3HJC A;  5TSE A;  3EPK A;  2V89 A;  4ZYE A;  4Z7C A;  2VF3 A;  1PKP A;  2M1S A;  2MDR A;  4L8N A;  2UXB I;  1Y4U A;  5A6K A;  3MSW A;  2NA2 A;  1TF6 A;  1HR0 I;  4USM A;  4F6M A;  4LFB E;  4BA1 B;  4DU8 A;  4DR7 I;  1J5E E;  2EOH A;  1A1L A;  1Z0V A;  4WXC A;  1X47 A;  2GHF A;  4RHB B;  2V85 A;  1IQS A;  1KYQ A;  3KWR A;  4X62 E;  2EMH A;  2EOS A;  2LTS A;  1DQ3 A;  4HEI A;  1GTK A;  2DMI A;  2GPI A;  2KON A;  2RQL A;  2NUE A;  1WXR A;  2BA1 D;  3HUL A;  1ZM4 A;  4M0V A;  2HHH E;  1B62 A;  2YU5 A;  2IOQ A;  3MHH C;  4JI2 I;  2A25 A;  3P76 A;  1J26 A;  5GMD A;  4JI7 E;  2DEI A;  2YTN A;  2JEA B;  1Z0B A;  3GON A;  5JEA A;  2E5L I;  4HAC A;  1UBD C;  3M85 G;  4OX9 I;  2MKD A;  3HTX A;  1I94 E;  3AUZ A;  4R8O A;  2UXC I;  1LLM C;  1XMQ I;  3ECR A;  2B3T B;  2L92 A;  4LF4 I;  4HTG A;  1Y6Z A;  5A6B D;  2NN6 F;  1GQE A;  3V5R A;  1YH8 A;  4DV1 E;  2PO1 A;  4O5G A;  2EPN A;  1HNW I;  1A1G A;  4HY1 A;  3QT5 A;  1USV A;  4B3M I;  2YSP A;  5KL5 A;  4R2Q A;  1EA6 A;  4MU1 A;  4LOM A;  3J7Y p;  2PO0 B;  3KZZ A;  1R6M A;  4LPF A;  3CDI A;  2LJH A;  2UUA E;  4LFC I;  2MKN A;  1R6L A;  2F8B A;  4DUZ I;  3Q1Q A;  2EM0 A;  3EPH A;  2LE2 A;  1RR9 A;  2DGC A;  4IS1 C;  3T1H I;  4OO1 D;  1FJG I;  5IT9 Q;  3OTO E;  3EQ1 A;  4J3D A;  5C0X C;  1QNT A;  5LMU E;  2CZ9 A;  4MLQ A;  1BB8 A;  5K36 B;  3HPZ A;  2RPC A;  4F9A B;  2EMW A;  5DRP A;  2WP8 A;  2EPX A;  2LTR A;  3J81 C;  4Q35 B;  4F2J C;  4NXM E;  1SR9 A;  4JI3 E;  2WNR B;  2YTI A;  4P78 A;  2PO2 A;  1YYO A;  4R1F A;  2EJ4 A;  1ZU1 A;  5AE3 A;  1JK1 A;  2C39 A;  2V8P A;  5LLQ A;  4MYT A;  4U3B A;  4ZYG A;  2RS6 A;  2YTP A;  1H7S A;  1K47 A;  4LF5 I;  5DNY A;  1UEK A;  4IFD D;  1N3G A;  4B3T E;  4JYA E;  4MU3 A;  2WBU A;  2EMI A;  2M9A A;  1IBL E;  2NUF A;  1P42 A;  4DR4 E;  4GQU A;  1O0W A;  4N4R B;  5GME A;  1AAY A;  1Z5C A;  1N36 I;  4P7A A;  4IZJ B;  1USU A;  1TF3 A;  1EH7 A;  4KQV A;  2RS7 A;  1UDO A;  2F4V E;  4LCH A;  1ZBQ A;  2EN6 A;  4DMI A;  3GCM A;  3H09 A;  2WBS A;  3U1K A;  2UUB I;  1ZM9 A;  3C4B A;  4YY3 I;  4X66 E;  2YPN A;  3RMP A;  1DI2 A;  5EKW A;  4OOG C;  2K4V A;  2L2K B;  4DR6 E;  3P3C A;  2JP9 A;  3ZKD A;  4DR3 E;  3BF2 A;  2JE6 A;  2F1D A;  1J5E I;  1WUU A;  3LLH A;  4DV3 I;  3QT8 A;  2ADR A;  1BBG A;  4MU0 A;  3AV0 A;  2FV4 B;  4I8O A;  4DR1 E;  4YHH E;  2V86 A;  1OYP A;  4DV6 E;  1YFH A;  2E1R A;  3L7Z A;  2EPK X;  2ODR C;  4BBY A;  2HJJ A;  4MYU A;  4OO1 E;  2DEJ A;  3MHS C;  2MC5 A;  4IS9 A;  2O1T A;  1UIL A;  2V88 A;  2I13 A;  2LJP A;  4LFA E;  1Z5B A;  4LCF A;  2E72 A;  4DV2 I;  1UDS A;  4JV5 E;  2UUC I;  4BC9 A;  2BR2 A;  4JI6 E;  5IV8 B;  1E3H A;  5JEA D;  2LCE A;  1N33 E;  1X48 A;  2CT1 A;  2NAB A;  3ADJ A;  2VQE E;  1ZM3 A;  1X6H A;  4WFT A;  1EKZ A;  2GS8 A;  4EMD A;  3J7A M;  1IBM I;  2LVH A;  2EN1 A;  4FW3 A;  2YSO A;  2EOY A;  2YTJ A;  2LT7 A;  1N34 E;  3QT6 A;  4X65 I;  3WU6 A;  4IFD E;  3K1J A;  5C0X F;  3KZY A;  3UK3 C;  4FW7 A;  1QU6 A;  4Z7Y A;  3HXL A;  2EMC A;  2GQ0 A;  4B3S E;  2A2C A;  3P06 A;  1YPN A;  1VIS A;  4LF6 E;  2JEB A;  4KZS A;  4IZK B;  1T38 A;  4DV7 I;  2L33 A;  4R2C A;  4JI8 I;  1HNX I;  2VQF E;  2PRT A;  3B8H A;  1KKH A;  3PYF A;  4FWH A;  1SFE A;  4GKK E;  3ZZT A;  5BR8 I;  5K36 C;  2EPO A;  2JOX A;  4F6N A;  5IXM B;  3EPL A;  1XNR E;  4DV5 I;  5AC4 A;  5KL3 A;  4GKJ E;  1UN6 B;  3M6A A;  4WUD A;  2V2Z A;  4BHC A;  2RTX A;  5AE1 A;  2EOQ A;  3WU5 A;  2NN6 A;  1TN9 A;  2HKJ A;  4WSP A;  1IBK E;  2EM4 A;  5ADZ A;  2O3Z A;  4BS9 A;  2AJ4 A;  4JI0 I;  3M85 D;  2YTD A;  1YHC A;  2M7Q A;  3QG5 C;  4KHP E;  4WPY A;  5JEA E;  4LF9 I;  2UU9 E;  5DRR A;  2B7T A;  2VF1 A;  3M99 B;  2HKE A;  4QNK A;  4U3D A;  2Z5B A;  1S16 A;  4R2R A;  1NHJ A;  2EL4 A;  1Y60 A;  2PNZ B;  2EOX A;  4LF7 I;  4ZYD A;  1E3P A;  2EP3 A;  3B78 A;  4URL A;  1OYS A;  2O1U A;  4BHB A;  4WUB A;  2EOR A;  3DJW A;  2DRP A;  2EM3 A;  1RRE A;  2CVE A;  4LF8 I;  4OO1 B;  2EL6 A;  4WUC A;  4DV0 E;  1Z0G A;  4JI5 I;  4MLV A;  2MC6 A;  3Q6N A;  2B7V A;  2K7I A;  2YRK A;  2J65 A;  1GZ6 A;  2IHR 1;  4DV4 E;  4AM3 A;  1YUJ A;  5IWA E;  1L4S A;  4AQY I;  1HNZ I;  1FKA E;  4B3R I;  4GEQ B;  5DRQ A;  2EMB A;  1D6T A;  3B82 A;  4IJD A;  1XMO E;  4GZN C;  4IFD B;  2EM2 A;  2LRS A;  3OML A;  2EML A;  4WYQ B;  1G2F C;  2LUQ A;  2BA0 D;  3P3E A;  4LCG A;  1N32 E;  5L3J A;  4BA2 B;  2EZ6 A;  4IZJ A;  3T1Y I;  3WU3 A;  4JI4 I;  4FWG A;  2PNL A;  2BBG A;  1H74 A;  4K0K I;  1Y4S A;  5FWK A;  3ADL A;  1VI7 A;  2N8X A;  4NXN E;  2C38 A;  2HFU A;  3TQM A;  5IT9 C;  3B4T A;  2ZM6 I;  5K36 F;  2EOJ A;  4JI1 E;  1PIE A;  4DUY E;  2LV2 A;  1ZXN A;  2BM1 A;  1G2D C;  2EFG A;  2NPF A;  4I3H A;  2DLQ A;  4DR5 I;  5DNL A;  4X64 E;  2BA0 G;  2EPZ A;  4R2D A;  2WCC 3;  3LTO A;  3PYD A;  1X49 A;  2L8T A;  1OJ4 A;  1T4O A;  2RSI A;  3CDJ A;  2HGH A;  2FGG A;  2DLK A;  2L3C A;  4Q28 A;  2GO3 A;  1RHY A;  4DR2 I;  4PRV A;  1XNQ I;  1Z59 A;  2BV3 A;  4R2E A;  5LMN I;  2L3J A;  2LUP B;  2EPR A;  2V2Q A;  2UXB E;  2Z5C A;  2JXP A;  5JEA B;  1T39 A;  2UXD E;  2M4I A;  1HR0 E;  4HAC B;  2C37 A;  4FW9 A;  1WHQ A;  2EOF A;  1NHH A;  4RPF A;  4UTG A;  4DR7 E;  2NN6 D;  2V87 A;  2KHX A;  4LFB I;  3UHM A;  5AE2 A;  5C0X A;  2EPA A;  1ZBT A;  4FN5 A;  1ZAA C;  2EPC A;  1A1I A;  2V34 A;  2PO1 B;  2G7H A;  4OKG A;  1PVG A;  4FW4 A;  3M7N G;  4DKK A;  4MU4 A;  4X62 I;  2ZIT A;  2YTF A;  4NBQ A;  2YZT A;  4FWD A;  4JG4 A;  2ENH A;  4JI2 E;  2L2N A;  3PRY A;  1JK2 A;  2HHH I;  4OO1 C;  1T4N A;  4M1K A;  4ZYH A;  3HKM A;  2FTX B;  2E1M A;  2CGE A;  4JI7 I;  2E5L E;  2UXC E;  4DPX A;  4OX9 E;  1KJK A;  4AID A;  3PS1 A;  1XMQ E;  4DV0 I;  2EE8 A;  1Y5Y A;  1RMD A;  1MU5 A;  1AH5 A;  2V8Q B;  2YTG A;  3ZOQ B;  4OZE A;  1ZR9 A;  4KWY A;  4LF4 E;  4BA1 A;  1I94 I;  4FK5 C;  5KL7 A;  4AIM A;  2WP8 B;  3ZKB A;  1T4L B;  4ISA A;  1HNW E;  4J8Z A;  2B9D A;  1YYW A;  1UHZ A;  4M9V C;  4IFD C;  1F2I G;  2JT2 A;  2PO2 B;  4DV1 I;  2C39 B;  2IER A;  4B3M E;  2DMY A;  3H1C A;  2EN4 A;  2EM8 A;  1PJS A;  4LFC E;  2ELZ A;  4DUZ E;  2Q2E B;  3NZK A;  3PS3 A;  5ELW A;  2EN7 A;  2V83 A;  3JTZ A;  1ELO A;  2UUA I;  1FWK A;  2NN6 E;  2JEA A;  3D4J A;  3T1H E;  2JY9 A;  2LBS B;  2D9H A;  3C4T A;  2J7J A;  1FJG E;  4WX9 A;  2VRD A;  2R42 A;  1DAR A;  4MDT A;  4FW5 A;  2Z5E A;  3OTO I;  1DGC A;  2JOB A;  3IWB A;  2IES A;  5LMU I;  3V2U C;  4XTJ A;  2EM9 A;  2CTD A;  2EMX A;  1Z0E A;  3DD6 A;  3K17 A;  5DNX A;  2JE6 B;  3ZZU A;  1Z0C A;  4HXZ A;  2EN2 A;  1PDA A;  5A69 A;  1XXE A;  1PJT A;  5F3W A;  4NXM I;  2EQ3 A;  2I9I A;  4JI3 I;  2EMK A;  4LF5 E;  2H36 X;  3IWC A;  1HK7 A;  4N3O A;  2L6M A;  3ZZ0 A;  4LU9 A;  3LML A;  4M30 A;  3L7Z B;  3PS2 A;  2ENC A;  2O1V A;  2YTQ A;  4RH8 A;  2PO0 A;  4B3T I;  4JYA I;  1Z0T A;  2EN8 A;  1N36 E;  1IBL I;  1A1K A;  5EL9 A;  5JEA C;  4DR4 I;  3P1X A;  2BR2 B;  1KVK A;  1X5W A;  1Z5A A;  1A1J A;  1MG7 A;  2BM0 A;  3LNU A;  2UUB E;  2UXD I;  4YY3 E;  4X8W A;  5A2Q Q;  2F4V I;  2YRH A;  1EI1 A;  4OO1 F;  1NEI A;  3CWV A;  5K36 A;  4R03 A;  2HK3 A;  2DIX A;  5A2Q C;  1X6E A;  2WBT A;  1Z0W A;  4X66 I;  5C0X D;  1KTV A;  4BCA A;  2EMF A;  2EWL A;  4O24 A;  4DV3 E;  1BBO A;  1S4E A;  1XHK A;  4DR6 I;  4DR3 I;  2O1W A;  2EMG A;  2WNR A;  2AE8 A;  3F0N A;  2X7I A;  2R3V A;  2DSY A;  3C6K A;  3PYG A;  2CSH A;  4DR1 I;  4YHH I;  4FW6 A;  3HPS A;  4DV6 I;  2EQ1 A;  1WRJ A;  2JEB B;  2OI2 A;  3KRN A;  2EPM X;  4HYM A;  4IFD F;  2KOU A;  4DV2 E;  1Z1B A;  1YYK A;  3P3G A;  2UUC E;  1FNM A;  3WU4 A;  3C6M A;  4P7D A;  3GLL A;  4NHR A;  4LFA I;  4JV5 I;  1H73 A;  4R2S A;  2GLI A;  3K85 A;  4JI6 I;  5T6J A;  2EOM A;  5CFF E;  1N33 I;  1IBM E;  2BB8 A;  2VQE I;  3PYE A;  4X65 E;  4ZVI A;  1NCS A;  4O4K A;  4R2P A;  1A1H A;  2YRM A;  2CG9 A;  4F54 A;  1N34 I;  2X36 A;  5DRO A;  2NN6 B;  2L2M A;  1EH8 A;  1QZR A;  3F6H A;  1YUI A;  2BA1 G;  2HK2 A;  3VYX A;  3Q6M A;  1FWL A;  2EPL X;  4USK A;  4B3S I;  1UDQ A;  5LL6 R;  2YWQ A;  3VK6 A;  2NUG A;  2EN3 A;  4DV7 E;  1X6F A;  4JI8 E;  3BID A;  5KL4 A;  1HNX E;  4LF6 I;  2ELY A;  2ODR D;  2Z5B B;  5BR8 E;  2VQF I;  4DU7 A;  4M2Z A;  5C0X E;  1KIJ A;  2CPN A;  2WW4 A;  3M7N D;  1EH6 A;  4X9J A;  2EOZ A;  4GKK I;  2EOO A;  2EMZ A;  1PJQ A;  4DV5 E;  3H4L A;  4NZV A;  3BBG A;  4F9C B;  1MX0 A;  5JEA F;  1ZM2 A;  2HC5 A;  4LTY A;  1XNR I;  3VHT B;  3J81 Q;  3DF6 A;  1B63 A;  4GKJ I;  1ZXM A;  4DPT A;  3L00 A;  4DPY A;  1FI4 A;  4JI0 E;  2JR1 A;  2VE7 C;  2R1F A;  4PRX A;  3IWD A;  4F9B B;  1IBK I;  2YTE A;  3BGH A;  4WSG A;  4LF9 E;  2LO3 A;  4KHP I;  3GME A;  5LMN E;  4IZK A;  5KL2 A;  2UU9 I;  2XEX A;  2YU8 A;  4LF7 E;  2GO4 A;  3HQ1 A;  5AC5 A;  2MDG A;  2JWO A;  1N0U A;  2JYA A;  1RC7 A;  1BKN A;  4P52 A;  5AAS A;  4UT4 A;  2Q8U A;  2VES A;  2YT4 A;  3K6Q A;  1OYR A;  1X3C A;  1U2R A;  4LF8 E;  3JAM Q;  2N3G A;  4JI5 E;  5K36 D;  4L5N C;  3JAM C;  1STU A;  1P47 A;  1NHI A;  2ENA A;  2C38 B;  2V2V A;  4BC7 A;  2ZBK B;  2WZO A;  1UDN A;  1H7U A;  4BMJ A;  5KL6 A;  3THO B;  1A1F A;  4AQY E;  1HNZ E;  1NZ0 A;  5A6B A;  3ADG A;  4DV4 I;  2EMA A;  4B3R E;  5IWA I;  2YTO A;  3J80 Q;  2J7K A;  2PNM A;  1YZ9 A;  3VYY A;  3J80 C;  4TUI A;  4MQY A;  1XMO I;  1WHN A;  1IMU A;  3LPS A;  4QNJ A;  2LMZ A;  2PNZ A;  4ED4 A;  3T1Y E;  2N3H A;  2JPA A;  4IZJ D;  4JI4 E;  3QT7 A;  2EM6 A;  5FLX Q;  1N32 I;  2DB2 A;  2EPU A;  5FLX C;  3EPJ A;  2LJU A;  4TUG A;  2A2D A;  1RQ0 A;  4K0K E;  2Z5C B;  2EL5 A;  4WXD A;  2ZM6 E;  4OO1 A;  2NN6 C;  1WJP A;  2HFS A;  2C37 B;  4DXL A;  2EPP A;  4NXN I;  2EM7 A;  4DPU A;  4DR5 E;  3ZM7 A;  4JI1 I;  2EQ0 A;  5C0X B;  2IOP A;  4DUY I;  2EMY A;  3JU0 A;  1MEY C;  2JVA A;  2EOI A;  5A6J A;  4X64 I;  1MGT A;  1A6F A;  4R2A A;  2EOE A;  1YSA C;  1N0V C;  1XNQ E;  2R76 A;  5A6A A;  4DR2 E;  3U1Y A;  4O43 A;  3ADI A;  4PU9 A;  4IFD A;  3FIG A; 
#chains in the Genus database with same CATH homology
 2RSM A;  3F6G A;  4DPW A;  3J7A G;  1H72 C;  3HJC A;  2V89 A;  4Z7C A;  2VF3 A;  1PKP A;  2M1S A;  2MDR A;  4L8N A;  2UXB I;  1Y4U A;  3MSW A;  2NA2 A;  1HR0 I;  4USM A;  4LFB E;  4DU8 A;  4DR7 I;  1J5E E;  1Z0V A;  1X47 A;  2V85 A;  4X62 E;  3KWR A;  2LTS A;  1DQ3 A;  2NUE A;  2KON A;  3HUL A;  1WXR A;  1ZM4 A;  4M0V A;  2HHH E;  1B62 A;  2IOQ A;  4JI2 I;  5GMD A;  1J26 A;  4JI7 E;  2DEI A;  1Z0B A;  3GON A;  2E5L I;  4HAC A;  2UXC I;  4OX9 I;  3HTX A;  1I94 E;  3AUZ A;  4R8O A;  1XMQ I;  2B3T B;  2L92 A;  4LF4 I;  1Y6Z A;  1GQE A;  3V5R A;  4DV1 E;  1HNW I;  4HY1 A;  3QT5 A;  1USV A;  4B3M I;  1EA6 A;  3J7Y p;  2LJH A;  2UUA E;  4LFC I;  4DUZ I;  2F8B A;  3Q1Q A;  2LE2 A;  1RR9 A;  3T1H I;  1FJG I;  5IT9 Q;  3OTO E;  5LMU E;  2CZ9 A;  3HPZ A;  4F9A B;  2LTR A;  3J81 C;  4NXM E;  1SR9 A;  4JI3 E;  4P78 A;  4R1F A;  1YYO A;  5AE3 A;  2V8P A;  4MYT A;  2RS6 A;  1K47 A;  1H7S A;  4LF5 I;  5DNY A;  1UEK A;  4B3T E;  4JYA E;  2NUF A;  1IBL E;  4DR4 E;  1O0W A;  5GME A;  1Z5C A;  1N36 I;  4P7A A;  4IZJ B;  1USU A;  4KQV A;  2RS7 A;  2F4V E;  1ZBQ A;  4DMI A;  3H09 A;  2UUB I;  1ZM9 A;  3C4B A;  4YY3 I;  4X66 E;  3RMP A;  1DI2 A;  4OOG C;  2K4V A;  2L2K B;  4DR6 E;  3ZKD A;  4DR3 E;  1J5E I;  1WUU A;  3LLH A;  4DV3 I;  3QT8 A;  3AV0 A;  2FV4 B;  4I8O A;  4DR1 E;  4YHH E;  2V86 A;  4DV6 E;  2E1R A;  2ODR C;  4MYU A;  4BBY A;  2DEJ A;  2MC5 A;  2O1T A;  1UIL A;  2V88 A;  4DV2 I;  2LJP A;  4LFA E;  1Z5B A;  2UUC I;  4JV5 E;  4BC9 A;  4JI6 E;  1N33 E;  1X48 A;  3ADJ A;  2VQE E;  1ZM3 A;  4EMD A;  4WFT A;  1EKZ A;  2GS8 A;  3J7A M;  1IBM I;  3QT6 A;  4X65 I;  1N34 E;  3WU6 A;  3K1J A;  1QU6 A;  4Z7Y A;  3HXL A;  2GQ0 A;  4B3S E;  2A2C A;  3P06 A;  1VIS A;  4LF6 E;  4KZS A;  4IZK B;  4DV7 I;  2L33 A;  4JI8 I;  1HNX I;  2VQF E;  3ZZT A;  3B8H A;  1KKH A;  3PYF A;  4FWH A;  4GKK E;  5BR8 I;  2JOX A;  1XNR E;  4DV5 I;  4GKJ E;  4WUD A;  3M6A A;  2V2Z A;  2RTX A;  5AE1 A;  3WU5 A;  2HKJ A;  4WSP A;  1IBK E;  5ADZ A;  4JI0 I;  4BS9 A;  2AJ4 A;  2M7Q A;  4KHP E;  4WPY A;  4LF9 I;  2UU9 E;  2B7T A;  2VF1 A;  2HKE A;  2Z5B A;  1S16 A;  1NHJ A;  4LF7 I;  3B78 A;  4URL A;  2O1U A;  4WUB A;  1RRE A;  3DJW A;  4LF8 I;  4JI5 I;  4WUC A;  4DV0 E;  1Z0G A;  2MC6 A;  3Q6N A;  2B7V A;  1GZ6 A;  2IHR 1;  4DV4 E;  5IWA E;  4AQY I;  1HNZ I;  1FKA E;  4B3R I;  4GEQ B;  1D6T A;  3B82 A;  1XMO E;  2LRS A;  3OML A;  4WYQ B;  5L3J A;  2LUQ A;  1N32 E;  2EZ6 A;  4IZJ A;  3T1Y I;  3WU3 A;  4JI4 I;  4FWG A;  2PNL A;  1H74 A;  4K0K I;  1Y4S A;  5FWK A;  3ADL A;  2HFU A;  4NXN E;  2ZM6 I;  5IT9 C;  4JI1 E;  1PIE A;  4DUY E;  1ZXN A;  4I3H A;  2BM1 A;  2EFG A;  2NPF A;  4DR5 I;  4X64 E;  3LTO A;  3PYD A;  1X49 A;  2L8T A;  1OJ4 A;  1T4O A;  2FGG A;  2L3C A;  4Q28 A;  4DR2 I;  1XNQ I;  4PRV A;  1Z59 A;  2BV3 A;  5LMN I;  2L3J A;  2LUP B;  2V2Q A;  2UXB E;  2Z5C A;  2UXD E;  2M4I A;  1HR0 E;  4HAC B;  4FW9 A;  1WHQ A;  4RPF A;  1NHH A;  4UTG A;  4DR7 E;  2V87 A;  2KHX A;  4LFB I;  5AE2 A;  1ZBT A;  4FN5 A;  2V34 A;  2G7H A;  1PVG A;  4DKK A;  4X62 I;  2ZIT A;  2YZT A;  4FWD A;  4JG4 A;  4JI2 E;  2L2N A;  3PRY A;  2HHH I;  1T4N A;  4M1K A;  2FTX B;  2E1M A;  2CGE A;  4JI7 I;  2E5L E;  2UXC E;  4DPX A;  4OX9 E;  1XMQ E;  4DV0 I;  1MU5 A;  2V8Q B;  3ZOQ B;  1I94 I;  4LF4 E;  3ZKB A;  1T4L B;  1HNW E;  4J8Z A;  2B9D A;  1YYW A;  1UHZ A;  4DV1 I;  4B3M E;  2DMY A;  2Q2E B;  4LFC E;  4DUZ E;  2V83 A;  3JTZ A;  1ELO A;  2UUA I;  1FWK A;  3D4J A;  3T1H E;  2JY9 A;  2LBS B;  1FJG E;  3C4T A;  2R42 A;  1DAR A;  2Z5E A;  3OTO I;  2JOB A;  3IWB A;  5LMU I;  3V2U C;  4XTJ A;  1Z0E A;  3K17 A;  3ZZU A;  1Z0C A;  4HXZ A;  5F3W A;  4NXM I;  4JI3 I;  4LF5 E;  2H36 X;  3IWC A;  1HK7 A;  4N3O A;  2L6M A;  3ZZ0 A;  4LU9 A;  3LML A;  4M30 A;  2O1V A;  4B3T I;  4JYA I;  1Z0T A;  1N36 E;  1IBL I;  4DR4 I;  3P1X A;  1KVK A;  1Z5A A;  2BM0 A;  1MG7 A;  3LNU A;  2UUB E;  2UXD I;  4YY3 E;  4X8W A;  5A2Q Q;  2F4V I;  1EI1 A;  3CWV A;  4R03 A;  2HK3 A;  2DIX A;  5A2Q C;  1Z0W A;  4X66 I;  1KTV A;  4BCA A;  2EWL A;  1S4E A;  4DV3 E;  1XHK A;  4DR6 I;  4DR3 I;  2O1W A;  3F0N A;  2X7I A;  2R3V A;  2DSY A;  3PYG A;  4DR1 I;  4YHH I;  3HPS A;  4DV6 I;  4HYM A;  2OI2 A;  2KOU A;  4DV2 E;  1YYK A;  2UUC E;  1FNM A;  3WU4 A;  4P7D A;  4LFA I;  4JV5 I;  1H73 A;  3K85 A;  4JI6 I;  5T6J A;  5CFF E;  1N33 I;  1IBM E;  2VQE I;  3PYE A;  4X65 E;  4ZVI A;  2CG9 A;  4F54 A;  1N34 I;  2X36 A;  2L2M A;  1QZR A;  3F6H A;  2HK2 A;  3VYX A;  3Q6M A;  1FWL A;  4USK A;  4B3S I;  5LL6 R;  3VK6 A;  2NUG A;  4DV7 E;  4JI8 E;  1HNX E;  4LF6 I;  2ODR D;  2Z5B B;  5BR8 E;  2VQF I;  4DU7 A;  4M2Z A;  1KIJ A;  2CPN A;  2WW4 A;  4GKK I;  4DV5 E;  3H4L A;  4F9C B;  1MX0 A;  1ZM2 A;  4LTY A;  1XNR I;  3J81 Q;  3DF6 A;  1B63 A;  4GKJ I;  1ZXM A;  4DPT A;  4DPY A;  1FI4 A;  4JI0 E;  2JR1 A;  2VE7 C;  4PRX A;  3IWD A;  4F9B B;  1IBK I;  4LF9 E;  4KHP I;  4IZK A;  2UU9 I;  2XEX A;  4LF7 E;  3HQ1 A;  2JWO A;  1N0U A;  1RC7 A;  4P52 A;  1BKN A;  4UT4 A;  5AAS A;  2YT4 A;  3K6Q A;  1U2R A;  4LF8 E;  3JAM Q;  2N3G A;  4JI5 E;  4L5N C;  3JAM C;  1STU A;  1NHI A;  3FIG A;  2V2V A;  4BC7 A;  2ZBK B;  2WZO A;  1H7U A;  4BMJ A;  4AQY E;  1HNZ E;  1NZ0 A;  3ADG A;  4DV4 I;  4B3R E;  5IWA I;  3J80 Q;  2J7K A;  2PNM A;  1YZ9 A;  3VYY A;  3J80 C;  4TUI A;  1XMO I;  1WHN A;  3LPS A;  4ED4 A;  2LMZ A;  3T1Y E;  2N3H A;  4IZJ D;  5FLX Q;  4JI4 E;  3QT7 A;  1N32 I;  2DB2 A;  5FLX C;  4TUG A;  2A2D A;  1RQ0 A;  4K0K E;  2Z5C B;  2ZM6 E;  2HFS A;  4DXL A;  4NXN I;  4DPU A;  4DR5 E;  3ZM7 A;  4JI1 I;  2IOP A;  4DUY I;  3JU0 A;  2JVA A;  4X64 I;  1A6F A;  1N0V C;  1XNQ E;  4DR2 E;  3ADI A;  4PU9 A;  5LMN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...