1Z0EA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 61
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0eA00
3J7AG 4DR5E 4DPUA 4DR4E 4DUYE 4LF9E 1Z5CA 1ZXMA 2HFSA 2V2VA 4DR2I 4X64E 1ELOA 2UXCE 4B3RI 4DUZI 2VQEE 1A6FA 2VF3A 4FWDA 4X66I 4JI7E 4URLA 2X7IA 1Z0CA 3WU4A 3ZZTA 4DV7E 4Z7YA 4OX9I 3ZKDA 4M1KA 4X62I 3QT5A 5A2QC 3J81C 4B3TI 2ZBKB 4WUCA 1ZXNA 1B62A 3ZZ0A 4DPTA 4B3MI 4GKJE 2HK2A 1FI4A 1XNRE 1Z0BA 1KTVA 2ZM6E 4JI1E 1XMOI 4HXZA 1N36E 4JI6I 1Z59A 3M6AA 2HHHI 1H7SA 4USKA 5BR8E 3WU3A 4PRVA 1S4EA 4NXNE 2UXDE 1HNWE 4LF4I 4DV3E 1EI1A 1N33I 5FLXC 4JI0E 3PYGA 3J80Q 1Z0EA 4XTJA 2XEXA 1XNQE 3OTOI 2VQFI 2V34A 2F4VI 1K47A 4MYTA 3F0NA 4LFBE 4LF5I 1UEKA 4LFCE 5GMDA 4DPYA 4DU7A 4JI8I 4DV6I 3LTOA 1Z5BA 3T1HE 1ZM9A 2BV3A 1Z5AA 3PYFA 1XMQE 4JI2I 1MU5A 4JG4A 2WW4A 1Z0VA 1VISA 4LF8E 2AJ4A 4JI4I 2UXBE 2HFUA 4PRXA 1ZM4A 4DV4I 1WUUA 3H4LA 1N32E 1FJGI 2R42A 1MG7A 4DPWA 3JAMC 3B82A 4X65I 1HR0I 3J7AM 2UU9I 2OI2A 4LF6E 3LNUA 4YHHI 4DR3I 1ZM3A 4DV1I 3LPSA 4GKKI 4JYAI 4JI5E 4K0KI 1ZM2A 1IBMI 2HKEA 4DR6I 5IWAI 1FKAE 2UUAE 4P7AA 4JI3I 4DV2I 2UUCI 2A2CA 4DV0I 4JI6E 4DU8A 1FWLA 5L3JA 4FN5A 5LMNI 1NHIA 1OJ4A 1N34E 4DR7I 2X36A 4LF4E 4LFAI 4DR5I 5GMEA 5LMUI 4DUYI 2ZITA 4YY3E 1FNMA 1NHHA 1B63A 4KHPI 3PYDA 2UXCI 3V5RA 5A2QQ 1PKPA 2VQEI 3OTOE 2VQFE 1PVGA 3ZZUA 1NZ0A 2F4VE 2E5LE 2UUBE 3J80C 4DV7I 4LF5E 4USMA 1XHKA 2DEJA 4NXME 4HY1A 4JI2E 3B78A 4DR1E 1J5EI 3QT6A 1I94I 4JI1I 2ZM6I 4RPFA 3B8HA 1IBLI 3K17A 1HNZI 3WU6A 4AQYE 1FWKA 4UTGA 4X65E 4DV5I 4NXNI 1S16A 2UXDI 1HNWI 4FWGA 1HNXI 2A2DA 3V2UC 5IT9Q 1BKNA 4DR2E 1H72C 4LF7I 2Q2EB 1XNQI 2LJPA 4B3RE 4JYAE 4DUZE 4JV5I 3ZM7A 1IBME 4B3SI 1U2RA 4UT4A 5IWAE 1NHJA 4X66E 1IBKI 4HYMA 3ZKBA 4LFBI 4LFCI 2GS8A 2UUCE 4OX9E 3CWVA 2HKJA 4R1FA 3K1JA 4X62E 1PIEA 4B3TE 3T1HI 4KQVA 1XMQI 5LMNE 4B3ME 4DR7E 2EFGA 4LF8I 4LFAE 2BM0A 2E1RA 4HACB 5LMUE 2UXBI 1XMOE 3T1YI 1N0UA 1N32I 4KHPE 2HHHE 4FW9A 4EMDA 2DEIA 4LF6I 4DR4I 1N33E 4LF9I 4FWHA 1EA6A 3Q1QA 1KVKA 4X64I 4JI5I 3QT8A 3HULA 3J81Q 1J5EE 2UUAI 4JI7I 2V8PA 1I94E 1Z0GA 3WU5A 1IBLE 4JI8E 4DV6E 4MYUA 1HNZE 3D4JA 4GKJI 1N34I 1H74A 4DV5E 1DARA 1XNRI 4JI4E 1HNXE 1QZRA 4Z7CA 4DV4E 4YY3I 5FLXQ 1N36I 4LF7E 1FJGE 4JV5E 1KIJA 1MX0A 4WUBA 1N0VC 1RREA 5BR8I 4B3SE 1HR0E 2CZ9A 1IBKE 3PYEA 4DV3I 2UU9E 2E5LI 2UUBI 4ZVIA 2V2QA 5IT9C 4JI0I 1RR9A 1KKHA 4YHHE 4DR3E 1D6TA 4DV1E 4GKKE 3GONA 1H7UA 4NXMI 4K0KE 2J7KA 4DR1I 4ED4A 2V2ZA 4DXLA 4DR6E 4DPXA 2NPFA 1Z0WA 4P52A 4JI3E 4DV2E 2HK3A 4WUDA 1H73A 3T1YE 3QT7A 4DV0E 5LL6R 4HACA 2R3VA 2BM1A 1Z0TA 4AQYI 4I3HA 3JAMQ 4PU9A
chains in the Genus database with same CATH superfamily
3J7AG 4DR5E 4DPUA 3M7NG 4DR4E 4DUYE 4LF9E 1Z5CA 1ZXMA 2HFSA 2V2VA 4DR2I 4X64E 1ELOA 2UXCE 1OYPA 4B3RI 4DUZI 2VQEE 4AIDA 2WNRB 1A6FA 2VF3A 4FWDA 4X66I 4JI7E 4URLA 5C0XE 3PS2A 2X7IA 1Z0CA 3WU4A 2GO3A 3ZZTA 3B4TA 4DV7E 4Z7YA 4OX9I 3ZKDA 4M1KA 5K36D 2IOQA 4X62I 3QT5A 5A2QC 2BA1G 5C0XF 4MQYA 3J81C 4B3TI 2IESA 2ZBKB 4WUCA 1ZXNA 1B62A 3ZZ0A 4DPTA 4B3MI 4GKJE 1OYSA 4LPFA 2VESA 2HK2A 1FI4A 4IZKB 1XNRE 2O1VA 1Z0BA 1KTVA 2ZM6E 4JI1E 1XMOI 2PO0A 4HXZA 1N36E 5C0XD 4JI6I 1Z59A 3M6AA 1UDOA 2HHHI 1H7SA 4USKA 5BR8E 4FW3A 3WU3A 4PRVA 1S4EA 4NXNE 2UXDE 1HNWE 5DROA 5JEAC 4DV3E 4LF4I 1EI1A 1N33I 3CDIA 5FLXC 4JI0E 5JEAB 3PYGA 3J80Q 1Z0EA 1YH8A 4XTJA 4J3DA 2XEXA 1XNQE 2CGEA 3OTOI 2VQFI 2V34A 3PS3A 4IS9A 2F4VI 1K47A 4MYTA 3F0NA 2GQ0A 3HKMA 4LFBE 4LF5I 1UEKA 4LFCE 5GMDA 5DRRA 5JEAE 4DPYA 5K36A 4DU7A 4JI8I 4IZJB 2NN6C 4DV6I 3LTOA 1Z5BA 3T1HE 3L7ZA 1ZM9A 2BV3A 1Z5AA 3P3EA 2O1TA 3PYFA 3GMEA 5JEAF 1XMQE 4JI2I 1MU5A 4JG4A 2WW4A 1Z0VA 1VISA 4LF8E 3U1YA 2AJ4A 4JI4I 2UXBE 2HFUA 2C38B 4PRXA 1ZM4A 4DV4I 1WUUA 3H4LA 1N32E 1FJGI 5C0XA 4GQUA 2R42A 1MG7A 2PNMA 4DPWA 2C39B 5JEAD 3JAMC 3B82A 2IOPA 4X65I 3HJCA 2NN6E 1HR0I 3J7AM 3UHMA 2UU9I 4IFDC 2OI2A 4LF6E 2O1UA 3LNUA 1UDQA 5DNXA 4YHHI 2WNRA 4DR3I 4IFDB 1ZM3A 4DV1I 2NN6F 3LPSA 4GKKI 4JYAI 4JI5E 2JEAB 4K0KI 1ZM2A 1Y5YA 2Z5CB 1IBMI 2HKEA 4MU0A 4DR6I 5IWAI 3DD6A 5EKWA 1FKAE 2UUAE 4P7AA 4JI3I 4IZJD 4DV2I 1HK7A 2O3ZA 2J65A 2C37B 2UUCI 4IFDE 2A2CA 4DV0I 1USVA 4JI6E 4DU8A 1FWLA 5L3JA 1Y6ZA 4FN5A 3P06A 4IZKA 2CG9A 4NBQA 5LMNI 1NHIA 1OJ4A 1N34E 4DR7I 4IFDF 1UDSA 2X36A 4LF4E 4MDTA 4LFAI 4QNKA 4DR5I 5GMEA 2GO4A 5LMUI 4DUYI 2ZITA 4YY3E 1FNMA 2BA0D 1UDNA 1NHHA 4OO1C 2WP8B 1B63A 4QNJA 4KHPI 1R6LA 3PYDA 2UXCI 3V5RA 5A2QQ 1PKPA 2VQEI 3OTOE 2VQFE 1PVGA 4OO1B 4OZEA 3ZZUA 1NZ0A 2F4VE 2PNLA 5JEAA 4IFDD 2E5LE 2UUBE 3J80C 4DV7I 1RHYA 5DRPA 4LF5E 4USMA 1XHKA 5DNLA 3KRNA 4OKGA 2DEJA 4AM3A 3P3CA 2JT2A 4NXME 4OO1E 2O1WA 1Y4UA 4HY1A 4MU4A 4JI2E 3B78A 4DR1E 1J5EI 3GCMA 2JEBB 2JE6A 3QT6A 2BR2B 2F1DA 4IZJA 1I94I 4JI1I 2ZM6I 4OO1F 4RPFA 2PO1B 3B8HA 1IBLI 3K17A 5FWKA 1HNZI 2C38A 3WU6A 4AQYE 2NN6B 1FWKA 4UTGA 4X65E 4DV5I 4NXNI 1S16A 2UXDI 1HNWI 2PNZB 3H1CA 4BA1B 4FWGA 2BA0G 1HNXI 4U3DA 2A2DA 3V2UC 5IT9Q 1BKNA 4DR2E 2C39A 1H72C 3K85A 2Q2EB 4LF7I 1XNQI 2LJPA 4B3RE 4JYAE 4DUZE 1OYRA 4JV5I 3P76A 4N3OA 3ZM7A 1IBME 4B3SI 1U2RA 4UT4A 5IWAE 4IFDA 1E3HA 1NHJA 4X66E 1IBKI 4HYMA 3ZKBA 4LOMA 4LFBI 4LFCI 2GS8A 2JEAA 2UUCE 4OX9E 3CWVA 2HKJA 4R1FA 3K1JA 2Z5CA 2Z5BB 3U1KA 4X62E 1USUA 3NZKA 1PIEA 4B3TE 3T1HI 4KQVA 4BA2B 1XMQI 1E3PA 5LMNE 4B3ME 1P42A 2AE8A 2C37A 2PO2B 2EFGA 4DR7E 4LF8I 4LFAE 2BM0A 2E1RA 4HACB 2IERA 5LMUE 2UXBI 1XMOE 3T1YI 1N0UA 5K36F 1N32I 2NN6D 4KHPE 1R6MA 2HHHE 2Z5EA 4FW9A 4LCGA 3PRYA 2WP8A 4EMDA 3Q6MA 2DEIA 4LF6I 4DR4I 1N33E 4FW7A 4LF9I 4FWHA 4OO1A 1EA6A 3Q1QA 1KVKA 4X64I 4JI5I 2CVEA 3P3GA 3QT8A 3HULA 3J81Q 1J5EE 2UUAI 4JI7I 2V8PA 1I94E 1YHCA 3M85G 1Z0GA 5DRQA 3WU5A 1IBLE 4JI8E 2JEBA 4DV6E 2BR2A 4MYUA 1HNZE 3D4JA 4GKJI 2PO0B 1H74A 3CDJA 1N34I 4DV5E 1DARA 2PO1A 4MU3A 1XNRI 4JI4E 1HNXE 1QZRA 4Z7CA 4DV4E 4YY3I 5FLXQ 3M7ND 1Y4SA 2NN6A 1N36I 4LF7E 1FJGE 2PNZA 4JV5E 4BA1A 1KIJA 1MX0A 3PS1A 4WUBA 4ISAA 1N0VC 1RREA 5BR8I 4B3SE 1HR0E 2CZ9A 1IBKE 3PYEA 4DV3I 2E5LI 2UU9E 4ZVIA 2UUBI 2V2QA 5IT9C 4JI0I 5ELWA 4OO1D 1RR9A 1KKHA 1XXEA 4FW6A 4YHHE 4DR3E 2JE6B 1D6TA 4FW5A 4DV1E 4GKKE 1Y60A 3GONA 5K36C 4LCFA 4FW4A 1H7UA 2BA1D 4NXMI 4K0KE 4U3BA 2J7KA 5K36B 4DR1I 4ED4A 2V2ZA 4DXLA 4DR6E 4AIMA 4DPXA 2Z5BA 4MU1A 2NPFA 1Z0WA 4P52A 4JI3E 4DV2E 2HK3A 3L7ZB 4WUDA 4LCHA 1H73A 3T1YE 4BA2A 5EL9A 3QT7A 2PO2A 4DV0E 3M85D 5C0XC 5LL6R 4HACA 2R3VA 2BM1A 1Z0TA 4PU9A 4AQYI 5K36E 4I3HA 5C0XB 3JAMQ 1VI7A 3Q6NA 3GLLA
chains in the Genus database with same CATH topology
3J7AG 4DR5E 4DPUA 4DR4E 4DUYE 4LF9E 1Z5CA 1ZXMA 2HFSA 2V2VA 4DR2I 4X64E 1ELOA 2UXCE 4B3RI 4DUZI 2VQEE 1A6FA 2VF3A 4FWDA 4X66I 4JI7E 4URLA 2X7IA 1Z0CA 3WU4A 3ZZTA 4DV7E 4Z7YA 4OX9I 3ZKDA 4M1KA 2IOQA 4X62I 3QT5A 5A2QC 3J81C 4B3TI 2ZBKB 4WUCA 1ZXNA 1B62A 3ZZ0A 4DPTA 4B3MI 4GKJE 2HK2A 1FI4A 4IZKB 1XNRE 2O1VA 1Z0BA 1KTVA 2ZM6E 4JI1E 1XMOI 4HXZA 1N36E 4JI6I 1Z59A 3M6AA 2HHHI 1H7SA 3Q6NA 4USKA 5BR8E 3WU3A 4PRVA 1S4EA 4NXNE 2UXDE 1HNWE 4LF4I 4DV3E 1EI1A 1N33I 5FLXC 4JI0E 3PYGA 3J80Q 1Z0EA 4XTJA 2XEXA 1XNQE 2CGEA 3OTOI 2VQFI 2V34A 2F4VI 1K47A 4MYTA 3F0NA 2GQ0A 4LFBE 4LF5I 1UEKA 4LFCE 5GMDA 4DPYA 4DU7A 4JI8I 4IZJB 4DV6I 3LTOA 1Z5BA 3T1HE 1ZM9A 2BV3A 1Z5AA 2O1TA 3PYFA 1XMQE 4JI2I 1MU5A 4JG4A 2WW4A 1Z0VA 1VISA 4LF8E 2AJ4A 4JI4I 2UXBE 2HFUA 4PRXA 1ZM4A 4DV4I 1WUUA 3H4LA 1N32E 1FJGI 2R42A 1MG7A 2PNMA 4DPWA 3JAMC 3B82A 2IOPA 4X65I 3HJCA 1HR0I 3J7AM 2UU9I 2OI2A 4LF6E 2O1UA 3LNUA 4YHHI 4DR3I 1ZM3A 4DV1I 3LPSA 4GKKI 4JYAI 4JI5E 4K0KI 1ZM2A 2Z5CB 1IBMI 2HKEA 4DR6I 5IWAI 1FKAE 2UUAE 4P7AA 4JI3I 4IZJD 4DV2I 1HK7A 2UUCI 2A2CA 4DV0I 1USVA 4JI6E 4DU8A 1FWLA 5L3JA 1Y6ZA 4FN5A 3P06A 4IZKA 2CG9A 5LMNI 1NHIA 1OJ4A 1N34E 4DR7I 2X36A 4LF4E 4LFAI 4DR5I 5GMEA 5LMUI 4DUYI 2ZITA 4YY3E 1FNMA 1NHHA 1B63A 4KHPI 3PYDA 2UXCI 3V5RA 5A2QQ 1PKPA 2VQEI 3OTOE 2VQFE 1PVGA 3ZZUA 1NZ0A 2F4VE 2PNLA 2E5LE 2UUBE 3J80C 4DV7I 4LF5E 4USMA 1XHKA 2DEJA 4NXME 2O1WA 1Y4UA 4HY1A 4JI2E 3B78A 4DR1E 1J5EI 3QT6A 4IZJA 1I94I 4JI1I 2ZM6I 4RPFA 3B8HA 1IBLI 3K17A 5FWKA 1HNZI 3WU6A 4AQYE 1FWKA 4UTGA 4X65E 4DV5I 4NXNI 1S16A 2UXDI 1HNWI 4FWGA 1HNXI 2A2DA 3V2UC 5IT9Q 1BKNA 4DR2E 1H72C 3K85A 2Q2EB 4LF7I 1XNQI 2LJPA 4B3RE 4JYAE 4DUZE 4JV5I 4N3OA 3ZM7A 1IBME 4B3SI 1U2RA 4UT4A 5IWAE 1NHJA 4X66E 1IBKI 4HYMA 3ZKBA 4LFBI 4LFCI 2GS8A 2UUCE 4OX9E 3CWVA 2HKJA 4R1FA 3K1JA 2Z5CA 2Z5BB 4X62E 1USUA 1PIEA 4B3TE 3T1HI 4KQVA 1XMQI 5LMNE 4B3ME 4DR7E 2EFGA 4LF8I 4LFAE 2BM0A 2E1RA 4HACB 5LMUE 2UXBI 1XMOE 3T1YI 1N0UA 1N32I 4KHPE 2HHHE 2Z5EA 4FW9A 3PRYA 4EMDA 3Q6MA 2DEIA 4LF6I 4DR4I 1N33E 4LF9I 4FWHA 1EA6A 3Q1QA 1KVKA 4X64I 4JI5I 3QT8A 3HULA 3J81Q 1J5EE 2UUAI 4JI7I 2V8PA 1I94E 1Z0GA 3WU5A 1IBLE 4JI8E 4DV6E 4MYUA 1HNZE 3D4JA 4GKJI 1N34I 1H74A 4DV5E 1DARA 1XNRI 4JI4E 1HNXE 1QZRA 4Z7CA 4DV4E 4YY3I 5FLXQ 1Y4SA 1N36I 4LF7E 1FJGE 4JV5E 1KIJA 1MX0A 4WUBA 1N0VC 1RREA 5BR8I 4B3SE 1HR0E 2CZ9A 1IBKE 3PYEA 4DV3I 2E5LI 2UU9E 4ZVIA 2UUBI 2V2QA 5IT9C 4JI0I 1RR9A 1KKHA 4YHHE 4DR3E 1D6TA 4DV1E 4GKKE 3GONA 1H7UA 4NXMI 4K0KE 2J7KA 4DR1I 4ED4A 2V2ZA 4DXLA 4DR6E 4DPXA 2Z5BA 2NPFA 1Z0WA 4P52A 4JI3E 4DV2E 2HK3A 4WUDA 1H73A 3T1YE 3QT7A 4DV0E 5LL6R 4HACA 2R3VA 2BM1A 1Z0TA 4AQYI 4I3HA 3JAMQ 4PU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A G;  4DR5 E;  4DPU A;  4DR4 E;  4DUY E;  4LF9 E;  1Z5C A;  1ZXM A;  2HFS A;  2V2V A;  4DR2 I;  4X64 E;  1ELO A;  2UXC E;  4B3R I;  4DUZ I;  2VQE E;  1A6F A;  2VF3 A;  4FWD A;  4X66 I;  4JI7 E;  4URL A;  2X7I A;  1Z0C A;  3WU4 A;  3ZZT A;  4DV7 E;  4Z7Y A;  4OX9 I;  3ZKD A;  4M1K A;  4X62 I;  3QT5 A;  5A2Q C;  3J81 C;  4B3T I;  2ZBK B;  4WUC A;  1ZXN A;  1B62 A;  3ZZ0 A;  4DPT A;  4B3M I;  4GKJ E;  2HK2 A;  1FI4 A;  1XNR E;  1Z0B A;  1KTV A;  2ZM6 E;  4JI1 E;  1XMO I;  4HXZ A;  1N36 E;  4JI6 I;  1Z59 A;  3M6A A;  2HHH I;  1H7S A;  4USK A;  5BR8 E;  3WU3 A;  4PRV A;  1S4E A;  4NXN E;  2UXD E;  1HNW E;  4LF4 I;  4DV3 E;  1EI1 A;  1N33 I;  5FLX C;  4JI0 E;  3PYG A;  3J80 Q;  1Z0E A;  4XTJ A;  2XEX A;  1XNQ E;  3OTO I;  2VQF I;  2V34 A;  2F4V I;  1K47 A;  4MYT A;  3F0N A;  4LFB E;  4LF5 I;  1UEK A;  4LFC E;  5GMD A;  4DPY A;  4DU7 A;  4JI8 I;  4DV6 I;  3LTO A;  1Z5B A;  3T1H E;  1ZM9 A;  2BV3 A;  1Z5A A;  3PYF A;  1XMQ E;  4JI2 I;  1MU5 A;  4JG4 A;  2WW4 A;  1Z0V A;  1VIS A;  4LF8 E;  2AJ4 A;  4JI4 I;  2UXB E;  2HFU A;  4PRX A;  1ZM4 A;  4DV4 I;  1WUU A;  3H4L A;  1N32 E;  1FJG I;  2R42 A;  1MG7 A;  4DPW A;  3JAM C;  3B82 A;  4X65 I;  1HR0 I;  3J7A M;  2UU9 I;  2OI2 A;  4LF6 E;  3LNU A;  4YHH I;  4DR3 I;  1ZM3 A;  4DV1 I;  3LPS A;  4GKK I;  4JYA I;  4JI5 E;  4K0K I;  1ZM2 A;  1IBM I;  2HKE A;  4DR6 I;  5IWA I;  1FKA E;  2UUA E;  4P7A A;  4JI3 I;  4DV2 I;  2UUC I;  2A2C A;  4DV0 I;  4JI6 E;  4DU8 A;  1FWL A;  5L3J A;  4FN5 A;  5LMN I;  1NHI A;  1OJ4 A;  1N34 E;  4DR7 I;  2X36 A;  4LF4 E;  4LFA I;  4DR5 I;  5GME A;  5LMU I;  4DUY I;  2ZIT A;  4YY3 E;  1FNM A;  1NHH A;  1B63 A;  4KHP I;  3PYD A;  2UXC I;  3V5R A;  5A2Q Q;  1PKP A;  2VQE I;  3OTO E;  2VQF E;  1PVG A;  3ZZU A;  1NZ0 A;  2F4V E;  2E5L E;  2UUB E;  3J80 C;  4DV7 I;  4LF5 E;  4USM A;  1XHK A;  2DEJ A;  4NXM E;  4HY1 A;  4JI2 E;  3B78 A;  4DR1 E;  1J5E I;  3QT6 A;  1I94 I;  4JI1 I;  2ZM6 I;  4RPF A;  3B8H A;  1IBL I;  3K17 A;  1HNZ I;  3WU6 A;  4AQY E;  1FWK A;  4UTG A;  4X65 E;  4DV5 I;  4NXN I;  1S16 A;  2UXD I;  1HNW I;  4FWG A;  1HNX I;  2A2D A;  3V2U C;  5IT9 Q;  1BKN A;  4DR2 E;  1H72 C;  4LF7 I;  2Q2E B;  1XNQ I;  2LJP A;  4B3R E;  4JYA E;  4DUZ E;  4JV5 I;  3ZM7 A;  1IBM E;  4B3S I;  1U2R A;  4UT4 A;  5IWA E;  1NHJ A;  4X66 E;  1IBK I;  4HYM A;  3ZKB A;  4LFB I;  4LFC I;  2GS8 A;  2UUC E;  4OX9 E;  3CWV A;  2HKJ A;  4R1F A;  3K1J A;  4X62 E;  1PIE A;  4B3T E;  3T1H I;  4KQV A;  1XMQ I;  5LMN E;  4B3M E;  4DR7 E;  2EFG A;  4LF8 I;  4LFA E;  2BM0 A;  2E1R A;  4HAC B;  5LMU E;  2UXB I;  1XMO E;  3T1Y I;  1N0U A;  1N32 I;  4KHP E;  2HHH E;  4FW9 A;  4EMD A;  2DEI A;  4LF6 I;  4DR4 I;  1N33 E;  4LF9 I;  4FWH A;  1EA6 A;  3Q1Q A;  1KVK A;  4X64 I;  4JI5 I;  3QT8 A;  3HUL A;  3J81 Q;  1J5E E;  2UUA I;  4JI7 I;  2V8P A;  1I94 E;  1Z0G A;  3WU5 A;  1IBL E;  4JI8 E;  4DV6 E;  4MYU A;  1HNZ E;  3D4J A;  4GKJ I;  1N34 I;  1H74 A;  4DV5 E;  1DAR A;  1XNR I;  4JI4 E;  1HNX E;  1QZR A;  4Z7C A;  4DV4 E;  4YY3 I;  5FLX Q;  1N36 I;  4LF7 E;  1FJG E;  4JV5 E;  1KIJ A;  1MX0 A;  4WUB A;  1N0V C;  1RRE A;  5BR8 I;  4B3S E;  1HR0 E;  2CZ9 A;  1IBK E;  3PYE A;  4DV3 I;  2UU9 E;  2E5L I;  2UUB I;  4ZVI A;  2V2Q A;  5IT9 C;  4JI0 I;  1RR9 A;  1KKH A;  4YHH E;  4DR3 E;  1D6T A;  4DV1 E;  4GKK E;  3GON A;  1H7U A;  4NXM I;  4K0K E;  2J7K A;  4DR1 I;  4ED4 A;  2V2Z A;  4DXL A;  4DR6 E;  4DPX A;  2NPF A;  1Z0W A;  4P52 A;  4JI3 E;  4DV2 E;  2HK3 A;  4WUD A;  1H73 A;  3T1Y E;  3QT7 A;  4DV0 E;  5LL6 R;  4HAC A;  2R3V A;  2BM1 A;  1Z0T A;  4AQY I;  4I3H A;  3JAM Q;  4PU9 A; 
#chains in the Genus database with same CATH topology
 3J7A G;  4DR5 E;  4DPU A;  3M7N G;  4DR4 E;  4DUY E;  4LF9 E;  1Z5C A;  1ZXM A;  2HFS A;  2V2V A;  4DR2 I;  4X64 E;  1ELO A;  2UXC E;  1OYP A;  4B3R I;  4DUZ I;  2VQE E;  4AID A;  2WNR B;  1A6F A;  2VF3 A;  4FWD A;  4X66 I;  4JI7 E;  4URL A;  5C0X E;  3PS2 A;  2X7I A;  1Z0C A;  3WU4 A;  2GO3 A;  3ZZT A;  3B4T A;  4DV7 E;  4Z7Y A;  4OX9 I;  3ZKD A;  4M1K A;  5K36 D;  2IOQ A;  4X62 I;  3QT5 A;  5A2Q C;  2BA1 G;  5C0X F;  4MQY A;  3J81 C;  4B3T I;  2IES A;  2ZBK B;  4WUC A;  1ZXN A;  1B62 A;  3ZZ0 A;  4DPT A;  4B3M I;  4GKJ E;  1OYS A;  4LPF A;  2VES A;  2HK2 A;  1FI4 A;  4IZK B;  1XNR E;  2O1V A;  1Z0B A;  1KTV A;  2ZM6 E;  4JI1 E;  1XMO I;  2PO0 A;  4HXZ A;  1N36 E;  5C0X D;  4JI6 I;  1Z59 A;  3M6A A;  1UDO A;  2HHH I;  1H7S A;  4USK A;  5BR8 E;  4FW3 A;  3WU3 A;  4PRV A;  1S4E A;  4NXN E;  2UXD E;  1HNW E;  5DRO A;  5JEA C;  4DV3 E;  4LF4 I;  1EI1 A;  1N33 I;  3CDI A;  5FLX C;  4JI0 E;  5JEA B;  3PYG A;  3J80 Q;  1Z0E A;  1YH8 A;  4XTJ A;  4J3D A;  2XEX A;  1XNQ E;  2CGE A;  3OTO I;  2VQF I;  2V34 A;  3PS3 A;  4IS9 A;  2F4V I;  1K47 A;  4MYT A;  3F0N A;  2GQ0 A;  3HKM A;  4LFB E;  4LF5 I;  1UEK A;  4LFC E;  5GMD A;  5DRR A;  5JEA E;  4DPY A;  5K36 A;  4DU7 A;  4JI8 I;  4IZJ B;  2NN6 C;  4DV6 I;  3LTO A;  1Z5B A;  3T1H E;  3L7Z A;  1ZM9 A;  2BV3 A;  1Z5A A;  3P3E A;  2O1T A;  3PYF A;  3GME A;  5JEA F;  1XMQ E;  4JI2 I;  1MU5 A;  4JG4 A;  2WW4 A;  1Z0V A;  1VIS A;  4LF8 E;  3U1Y A;  2AJ4 A;  4JI4 I;  2UXB E;  2HFU A;  2C38 B;  4PRX A;  1ZM4 A;  4DV4 I;  1WUU A;  3H4L A;  1N32 E;  1FJG I;  5C0X A;  4GQU A;  2R42 A;  1MG7 A;  2PNM A;  4DPW A;  2C39 B;  5JEA D;  3JAM C;  3B82 A;  2IOP A;  4X65 I;  3HJC A;  2NN6 E;  1HR0 I;  3J7A M;  3UHM A;  2UU9 I;  4IFD C;  2OI2 A;  4LF6 E;  2O1U A;  3LNU A;  1UDQ A;  5DNX A;  4YHH I;  2WNR A;  4DR3 I;  4IFD B;  1ZM3 A;  4DV1 I;  2NN6 F;  3LPS A;  4GKK I;  4JYA I;  4JI5 E;  2JEA B;  4K0K I;  1ZM2 A;  1Y5Y A;  2Z5C B;  1IBM I;  2HKE A;  4MU0 A;  4DR6 I;  5IWA I;  3DD6 A;  5EKW A;  1FKA E;  2UUA E;  4P7A A;  4JI3 I;  4IZJ D;  4DV2 I;  1HK7 A;  2O3Z A;  2J65 A;  2C37 B;  2UUC I;  4IFD E;  2A2C A;  4DV0 I;  1USV A;  4JI6 E;  4DU8 A;  1FWL A;  5L3J A;  1Y6Z A;  4FN5 A;  3P06 A;  4IZK A;  2CG9 A;  4NBQ A;  5LMN I;  1NHI A;  1OJ4 A;  1N34 E;  4DR7 I;  4IFD F;  1UDS A;  2X36 A;  4LF4 E;  4MDT A;  4LFA I;  4QNK A;  4DR5 I;  5GME A;  2GO4 A;  5LMU I;  4DUY I;  2ZIT A;  4YY3 E;  1FNM A;  2BA0 D;  1UDN A;  1NHH A;  4OO1 C;  2WP8 B;  1B63 A;  4QNJ A;  4KHP I;  1R6L A;  3PYD A;  2UXC I;  3V5R A;  5A2Q Q;  1PKP A;  2VQE I;  3OTO E;  2VQF E;  1PVG A;  4OO1 B;  4OZE A;  3ZZU A;  1NZ0 A;  2F4V E;  2PNL A;  5JEA A;  4IFD D;  2E5L E;  2UUB E;  3J80 C;  4DV7 I;  1RHY A;  5DRP A;  4LF5 E;  4USM A;  1XHK A;  5DNL A;  3KRN A;  4OKG A;  2DEJ A;  4AM3 A;  3P3C A;  2JT2 A;  4NXM E;  4OO1 E;  2O1W A;  1Y4U A;  4HY1 A;  4MU4 A;  4JI2 E;  3B78 A;  4DR1 E;  1J5E I;  3GCM A;  2JEB B;  2JE6 A;  3QT6 A;  2BR2 B;  2F1D A;  4IZJ A;  1I94 I;  4JI1 I;  2ZM6 I;  4OO1 F;  4RPF A;  2PO1 B;  3B8H A;  1IBL I;  3K17 A;  5FWK A;  1HNZ I;  2C38 A;  3WU6 A;  4AQY E;  2NN6 B;  1FWK A;  4UTG A;  4X65 E;  4DV5 I;  4NXN I;  1S16 A;  2UXD I;  1HNW I;  2PNZ B;  3H1C A;  4BA1 B;  4FWG A;  2BA0 G;  1HNX I;  4U3D A;  2A2D A;  3V2U C;  5IT9 Q;  1BKN A;  4DR2 E;  2C39 A;  1H72 C;  3K85 A;  2Q2E B;  4LF7 I;  1XNQ I;  2LJP A;  4B3R E;  4JYA E;  4DUZ E;  1OYR A;  4JV5 I;  3P76 A;  4N3O A;  3ZM7 A;  1IBM E;  4B3S I;  1U2R A;  4UT4 A;  5IWA E;  4IFD A;  1E3H A;  1NHJ A;  4X66 E;  1IBK I;  4HYM A;  3ZKB A;  4LOM A;  4LFB I;  4LFC I;  2GS8 A;  2JEA A;  2UUC E;  4OX9 E;  3CWV A;  2HKJ A;  4R1F A;  3K1J A;  2Z5C A;  2Z5B B;  3U1K A;  4X62 E;  1USU A;  3NZK A;  1PIE A;  4B3T E;  3T1H I;  4KQV A;  4BA2 B;  1XMQ I;  1E3P A;  5LMN E;  4B3M E;  1P42 A;  2AE8 A;  2C37 A;  2PO2 B;  2EFG A;  4DR7 E;  4LF8 I;  4LFA E;  2BM0 A;  2E1R A;  4HAC B;  2IER A;  5LMU E;  2UXB I;  1XMO E;  3T1Y I;  1N0U A;  5K36 F;  1N32 I;  2NN6 D;  4KHP E;  1R6M A;  2HHH E;  2Z5E A;  4FW9 A;  4LCG A;  3PRY A;  2WP8 A;  4EMD A;  3Q6M A;  2DEI A;  4LF6 I;  4DR4 I;  1N33 E;  4FW7 A;  4LF9 I;  4FWH A;  4OO1 A;  1EA6 A;  3Q1Q A;  1KVK A;  4X64 I;  4JI5 I;  2CVE A;  3P3G A;  3QT8 A;  3HUL A;  3J81 Q;  1J5E E;  2UUA I;  4JI7 I;  2V8P A;  1I94 E;  1YHC A;  3M85 G;  1Z0G A;  5DRQ A;  3WU5 A;  1IBL E;  4JI8 E;  2JEB A;  4DV6 E;  2BR2 A;  4MYU A;  1HNZ E;  3D4J A;  4GKJ I;  2PO0 B;  1H74 A;  3CDJ A;  1N34 I;  4DV5 E;  1DAR A;  2PO1 A;  4MU3 A;  1XNR I;  4JI4 E;  1HNX E;  1QZR A;  4Z7C A;  4DV4 E;  4YY3 I;  5FLX Q;  3M7N D;  1Y4S A;  2NN6 A;  1N36 I;  4LF7 E;  1FJG E;  2PNZ A;  4JV5 E;  4BA1 A;  1KIJ A;  1MX0 A;  3PS1 A;  4WUB A;  4ISA A;  1N0V C;  1RRE A;  5BR8 I;  4B3S E;  1HR0 E;  2CZ9 A;  1IBK E;  3PYE A;  4DV3 I;  2E5L I;  2UU9 E;  4ZVI A;  2UUB I;  2V2Q A;  5IT9 C;  4JI0 I;  5ELW A;  4OO1 D;  1RR9 A;  1KKH A;  1XXE A;  4FW6 A;  4YHH E;  4DR3 E;  2JE6 B;  1D6T A;  4FW5 A;  4DV1 E;  4GKK E;  1Y60 A;  3GON A;  5K36 C;  4LCF A;  4FW4 A;  1H7U A;  2BA1 D;  4NXM I;  4K0K E;  4U3B A;  2J7K A;  5K36 B;  4DR1 I;  4ED4 A;  2V2Z A;  4DXL A;  4DR6 E;  4AIM A;  4DPX A;  2Z5B A;  4MU1 A;  2NPF A;  1Z0W A;  4P52 A;  4JI3 E;  4DV2 E;  2HK3 A;  3L7Z B;  4WUD A;  4LCH A;  1H73 A;  3T1Y E;  4BA2 A;  5EL9 A;  3QT7 A;  2PO2 A;  4DV0 E;  3M85 D;  5C0X C;  5LL6 R;  4HAC A;  2R3V A;  2BM1 A;  1Z0T A;  4PU9 A;  4AQY I;  5K36 E;  4I3H A;  5C0X B;  3JAM Q;  1VI7 A;  3Q6N A;  3GLL A; 
#chains in the Genus database with same CATH homology
 3J7A G;  4DR5 E;  4DPU A;  4DR4 E;  4DUY E;  4LF9 E;  1Z5C A;  1ZXM A;  2HFS A;  2V2V A;  4DR2 I;  4X64 E;  1ELO A;  2UXC E;  4B3R I;  4DUZ I;  2VQE E;  1A6F A;  2VF3 A;  4FWD A;  4X66 I;  4JI7 E;  4URL A;  2X7I A;  1Z0C A;  3WU4 A;  3ZZT A;  4DV7 E;  4Z7Y A;  4OX9 I;  3ZKD A;  4M1K A;  2IOQ A;  4X62 I;  3QT5 A;  5A2Q C;  3J81 C;  4B3T I;  2ZBK B;  4WUC A;  1ZXN A;  1B62 A;  3ZZ0 A;  4DPT A;  4B3M I;  4GKJ E;  2HK2 A;  1FI4 A;  4IZK B;  1XNR E;  2O1V A;  1Z0B A;  1KTV A;  2ZM6 E;  4JI1 E;  1XMO I;  4HXZ A;  1N36 E;  4JI6 I;  1Z59 A;  3M6A A;  2HHH I;  1H7S A;  3Q6N A;  4USK A;  5BR8 E;  3WU3 A;  4PRV A;  1S4E A;  4NXN E;  2UXD E;  1HNW E;  4LF4 I;  4DV3 E;  1EI1 A;  1N33 I;  5FLX C;  4JI0 E;  3PYG A;  3J80 Q;  1Z0E A;  4XTJ A;  2XEX A;  1XNQ E;  2CGE A;  3OTO I;  2VQF I;  2V34 A;  2F4V I;  1K47 A;  4MYT A;  3F0N A;  2GQ0 A;  4LFB E;  4LF5 I;  1UEK A;  4LFC E;  5GMD A;  4DPY A;  4DU7 A;  4JI8 I;  4IZJ B;  4DV6 I;  3LTO A;  1Z5B A;  3T1H E;  1ZM9 A;  2BV3 A;  1Z5A A;  2O1T A;  3PYF A;  1XMQ E;  4JI2 I;  1MU5 A;  4JG4 A;  2WW4 A;  1Z0V A;  1VIS A;  4LF8 E;  2AJ4 A;  4JI4 I;  2UXB E;  2HFU A;  4PRX A;  1ZM4 A;  4DV4 I;  1WUU A;  3H4L A;  1N32 E;  1FJG I;  2R42 A;  1MG7 A;  2PNM A;  4DPW A;  3JAM C;  3B82 A;  2IOP A;  4X65 I;  3HJC A;  1HR0 I;  3J7A M;  2UU9 I;  2OI2 A;  4LF6 E;  2O1U A;  3LNU A;  4YHH I;  4DR3 I;  1ZM3 A;  4DV1 I;  3LPS A;  4GKK I;  4JYA I;  4JI5 E;  4K0K I;  1ZM2 A;  2Z5C B;  1IBM I;  2HKE A;  4DR6 I;  5IWA I;  1FKA E;  2UUA E;  4P7A A;  4JI3 I;  4IZJ D;  4DV2 I;  1HK7 A;  2UUC I;  2A2C A;  4DV0 I;  1USV A;  4JI6 E;  4DU8 A;  1FWL A;  5L3J A;  1Y6Z A;  4FN5 A;  3P06 A;  4IZK A;  2CG9 A;  5LMN I;  1NHI A;  1OJ4 A;  1N34 E;  4DR7 I;  2X36 A;  4LF4 E;  4LFA I;  4DR5 I;  5GME A;  5LMU I;  4DUY I;  2ZIT A;  4YY3 E;  1FNM A;  1NHH A;  1B63 A;  4KHP I;  3PYD A;  2UXC I;  3V5R A;  5A2Q Q;  1PKP A;  2VQE I;  3OTO E;  2VQF E;  1PVG A;  3ZZU A;  1NZ0 A;  2F4V E;  2PNL A;  2E5L E;  2UUB E;  3J80 C;  4DV7 I;  4LF5 E;  4USM A;  1XHK A;  2DEJ A;  4NXM E;  2O1W A;  1Y4U A;  4HY1 A;  4JI2 E;  3B78 A;  4DR1 E;  1J5E I;  3QT6 A;  4IZJ A;  1I94 I;  4JI1 I;  2ZM6 I;  4RPF A;  3B8H A;  1IBL I;  3K17 A;  5FWK A;  1HNZ I;  3WU6 A;  4AQY E;  1FWK A;  4UTG A;  4X65 E;  4DV5 I;  4NXN I;  1S16 A;  2UXD I;  1HNW I;  4FWG A;  1HNX I;  2A2D A;  3V2U C;  5IT9 Q;  1BKN A;  4DR2 E;  1H72 C;  3K85 A;  2Q2E B;  4LF7 I;  1XNQ I;  2LJP A;  4B3R E;  4JYA E;  4DUZ E;  4JV5 I;  4N3O A;  3ZM7 A;  1IBM E;  4B3S I;  1U2R A;  4UT4 A;  5IWA E;  1NHJ A;  4X66 E;  1IBK I;  4HYM A;  3ZKB A;  4LFB I;  4LFC I;  2GS8 A;  2UUC E;  4OX9 E;  3CWV A;  2HKJ A;  4R1F A;  3K1J A;  2Z5C A;  2Z5B B;  4X62 E;  1USU A;  1PIE A;  4B3T E;  3T1H I;  4KQV A;  1XMQ I;  5LMN E;  4B3M E;  4DR7 E;  2EFG A;  4LF8 I;  4LFA E;  2BM0 A;  2E1R A;  4HAC B;  5LMU E;  2UXB I;  1XMO E;  3T1Y I;  1N0U A;  1N32 I;  4KHP E;  2HHH E;  2Z5E A;  4FW9 A;  3PRY A;  4EMD A;  3Q6M A;  2DEI A;  4LF6 I;  4DR4 I;  1N33 E;  4LF9 I;  4FWH A;  1EA6 A;  3Q1Q A;  1KVK A;  4X64 I;  4JI5 I;  3QT8 A;  3HUL A;  3J81 Q;  1J5E E;  2UUA I;  4JI7 I;  2V8P A;  1I94 E;  1Z0G A;  3WU5 A;  1IBL E;  4JI8 E;  4DV6 E;  4MYU A;  1HNZ E;  3D4J A;  4GKJ I;  1N34 I;  1H74 A;  4DV5 E;  1DAR A;  1XNR I;  4JI4 E;  1HNX E;  1QZR A;  4Z7C A;  4DV4 E;  4YY3 I;  5FLX Q;  1Y4S A;  1N36 I;  4LF7 E;  1FJG E;  4JV5 E;  1KIJ A;  1MX0 A;  4WUB A;  1N0V C;  1RRE A;  5BR8 I;  4B3S E;  1HR0 E;  2CZ9 A;  1IBK E;  3PYE A;  4DV3 I;  2E5L I;  2UU9 E;  4ZVI A;  2UUB I;  2V2Q A;  5IT9 C;  4JI0 I;  1RR9 A;  1KKH A;  4YHH E;  4DR3 E;  1D6T A;  4DV1 E;  4GKK E;  3GON A;  1H7U A;  4NXM I;  4K0K E;  2J7K A;  4DR1 I;  4ED4 A;  2V2Z A;  4DXL A;  4DR6 E;  4DPX A;  2Z5B A;  2NPF A;  1Z0W A;  4P52 A;  4JI3 E;  4DV2 E;  2HK3 A;  4WUD A;  1H73 A;  3T1Y E;  3QT7 A;  4DV0 E;  5LL6 R;  4HAC A;  2R3V A;  2BM1 A;  1Z0T A;  4AQY I;  4I3H A;  3JAM Q;  4PU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...