1Z0EA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords Putative protease La homolog type
total genus 61
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0eA00
4B3TI 1XHKA 4DR4E 3D4JA 4JI4I 4MYTA 2HK2A 4DR5E 4JI1I 4JG4A 4DR5I 4DR4I 1ZM9A 4JI4E 3J7AG 4B3ME 4JI8E 2R3VA 3J80C 1EI1A 5GMDA 3LPSA 4DR1E 1H7UA 4XTJA 4LF6I 1XMOE 3PYDA 1RR9A 2UUCI 4NXMI 1IBKI 4P52A 4DXLA 4GKJE 1MU5A 4YHHI 5LMNI 4B3SE 4LF7E 1HR0E 1NHJA 2X36A 4USMA 1B63A 1KTVA 4B3RE 4KHPE 4DR2I 1N36I 4JI6E 4DR3I 3QT6A 4WUDA 1N34I 4UT4A 1PVGA 2HHHE 4JV5E 3V2UC 4DR6E 4JI7E 1FI4A 1Z0GA 4X65I 4LF5I 4DR3E 5IT9C 4JI0I 4FWGA 1N36E 2ZBKB 1IBMI 3ZZUA 4DPWA 3J81C 2VQEE 4AQYE 4JI3I 3WU4A 1Z5BA 4X62I 4Z7YA 2F4VI 4B3SI 3ZZTA 2Q2EB 4DV7I 3QT8A 2UU9E 2UU9I 4DV5E 2UUCE 4GKJI 4DPTA 4FWHA 4Z7CA 3QT5A 3J81Q 4X64E 3HULA 3Q1QA 4K0KI 1PIEA 4RPFA 2BM1A 1Z0VA 4PRVA 1XNRE 4JI7I 3GONA 3F0NA 3PYEA 4DV0I 1Z0WA 5GMEA 5IWAE 1HNXI 4B3TE 3ZKDA 3K17A 4JI2E 4JI6I 1MX0A 2V2VA 4URLA 2XEXA 1XNQE 4DV6E 4DUYI 4DV4E 1FJGI 1QZRA 4DV2E 1S4EA 5FLXC 2UXBI 2AJ4A 1ZXNA 2UUBI 4OX9I 2A2DA 3WU5A 1ZM2A 3PYGA 3T1YI 5BR8E 4LFBI 1MG7A 4JI2I 4DV0E 4NXNI 4I3HA 4LF9I 3ZM7A 4YY3E 2E1RA 4LFCE 3OTOI 2V8PA 4USKA 1XMQE 5LL6R 1XNRI 1ZM3A 2HFSA 3LTOA 4GKKE 1NHIA 3ZZ0A 4K0KE 4X64I 1EA6A 3J80Q 2HK3A 4LF8E 1N0UA 1IBLI 2CZ9A 2BV3A 2UXDE 1DARA 3B82A 4DV5I 4DPXA 3CWVA 1N33I 3ZKBA 4DV7E 5IT9Q 3LNUA 1I94E 1IBLE 4JYAI 4FWDA 2VQEI 4AQYI 4PRXA 2LJPA 2DEIA 4GKKI 2UXCE 3PYFA 4JI5I 4LF4I 4JI0E 2V34A 1FWKA 4DPUA 1N0VC 5FLXQ 4X66I 4LF9E 1VISA 4JV5I 2NPFA 4LFBE 5BR8I 4M1KA 3V5RA 4HACB 2EFGA 4DUZE 1J5EI 3JAMC 4P7AA 4DU7A 1I94I 4HACA 1OJ4A 2BM0A 4PU9A 1D6TA 1HNWE 3QT7A 4WUCA 1HR0I 1A6FA 2R42A 4EMDA 1N33E 5LMNE 1H73A 5A2QC 4DV2I 4YHHE 1Z0CA 1UEKA 2DEJA 4KQVA 4DR1I 1FKAE 1HNZE 4DV3I 3M6AA 4B3MI 1Z0EA 4DV1I 1XMQI 2X7IA 1H74A 2HKJA 4DV1E 4YY3I 3OTOE 2ZITA 2V2ZA 1KKHA 3T1HI 1NHHA 1Z0BA 4DV3E 1HNZI 3T1YE 4FW9A 2E5LI 5LMUI 4DU8A 2UXBE 1NZ0A 2UUBE 2VQFI 4MYUA 2F4VE 2UUAI 1Z5AA 2WW4A 2VQFE 1FWLA 4X62E 2ZM6E 1N32E 4DUYE 4DV4I 2J7KA 1Z5CA 4LFAE 2E5LE 1IBME 5IWAI 4R1FA 1HNXE 4HY1A 2VF3A 4X66E 4ED4A 3K1JA 1B62A 1N34E 4JI5E 4DR7I 3WU3A 1Z59A 4HYMA 1FNMA 4FN5A 2V2QA 4B3RI 4WUBA 4KHPI 1Z0TA 1U2RA 1ELOA 2HFUA 1KIJA 4NXME 1PKPA 1XMOI 1H7SA 1HNWI 4LF8I 4UTGA 2UXDI 4JI3E 3H4LA 4JI8I 3B78A 1S16A 2GS8A 4DUZI 1J5EE 1K47A 3B8HA 4DR7E 1ZM4A 2HKEA 1KVKA 4DPYA 3J7AM 4DR6I 5A2QQ 4JI1E 4X65E 4LF5E 4ZVIA 3WU6A 2HHHI 4LFCI 4LF4E 4NXNE 2A2CA 3JAMQ 4LFAI 2UXCI 4DR2E 2ZM6I 1WUUA 1N32I 4JYAE 2UUAE 1H72C 4OX9E 1BKNA 1IBKE 1RREA 4LF7I 4HXZA 5LMUE 4LF6E 2OI2A 4DV6I 1ZXMA 1FJGE 1XNQI 5L3JA 3T1HE
chains in the Genus database with same CATH superfamily
4B3TI 1XHKA 4DR4E 2JEBA 4J3DA 2NN6A 5C0XF 3D4JA 4JI4I 2O3ZA 4MYTA 2HK2A 4DR5E 3Q6NA 4JI1I 4JG4A 4DR5I 1YHCA 4DR4I 1ZM9A 4JI4E 3J7AG 4B3ME 4JI8E 2R3VA 3J80C 1EI1A 1USUA 1Y6ZA 5GMDA 3LPSA 1UDSA 4DR1E 2VESA 2JE6A 1RHYA 1H7UA 4XTJA 4LF6I 1XMOE 3PYDA 1RR9A 2UUCI 4QNKA 4IFDC 1Y5YA 2C38A 4NXMI 2PO1A 4P52A 1IBKI 4DXLA 4GKJE 1MU5A 4YHHI 5LMNI 4B3SE 4FW6A 2C37A 1NHJA 1HR0E 4LF7E 4U3DA 4IFDF 2X36A 4USMA 1B63A 1KTVA 4B3RE 4KHPE 4DR2I 4ISAA 5K36F 5K36A 3PS1A 1N36I 4JI6E 4IZKA 4DR3I 4OO1D 4OO1B 4IFDE 3QT6A 4WUDA 1N34I 4UT4A 1PVGA 2HHHE 3L7ZA 4OO1A 4JV5E 3PRYA 3V2UC 2JEAB 5K36E 4DR6E 4JI7E 1FI4A 5JEAA 1Z0GA 4X65I 4LF5I 4IFDB 2O1UA 3GCMA 1OYRA 4DR3E 5IT9C 4JI0I 4FWGA 4IZJB 1N36E 2ZBKB 1IBMI 2CG9A 3ZZUA 4DPWA 3J81C 2VQEE 4AQYE 4JI3I 3WU4A 1Z5BA 4X62I 4IZJD 2Z5CB 4OO1F 4Z7YA 3NZKA 2BR2B 2F4VI 4B3SI 3ZZTA 2Q2EB 4DV7I 3QT8A 2UU9E 2UU9I 3GMEA 4N3OA 4DV5E 2UUCE 4GKJI 4DPTA 4MDTA 4FWHA 2NN6E 4Z7CA 3QT5A 3J81Q 3P3EA 4X64E 4MU3A 3HULA 1Y60A 3Q1QA 1YH8A 4K0KI 3DD6A 4IS9A 1PIEA 1OYSA 4RPFA 2BM1A 1Z0VA 2JT2A 4PRVA 2IOQA 3GLLA 2WP8B 4LCHA 1XNRE 4JI7I 1Y4SA 3GONA 5K36C 2PO0B 3HKMA 3F0NA 3PYEA 4DV0I 1P42A 1Z0WA 5GMEA 5IWAE 1HNXI 4B3TE 3ZKDA 3K17A 4JI2E 4JI6I 3PS2A 1MX0A 1R6LA 2V2VA 4URLA 2XEXA 5JEAB 2BA0G 1XNQE 4DV6E 4DUYI 4DV4E 1FJGI 4LCGA 1QZRA 5C0XA 4DV2E 2Z5EA 1S4EA 5FLXC 2UXBI 2AJ4A 1ZXNA 2UUBI 4OZEA 4OX9I 2A2DA 2CGEA 3WU5A 5C0XE 1ZM2A 3M85D 3PYGA 3T1YI 2GQ0A 5BR8E 4LFBI 2BR2A 1MG7A 4JI2I 4DV0E 4NXNI 2PNZB 4I3HA 2F1DA 4FW5A 4LF9I 3ZM7A 4YY3E 2E1RA 4LFCE 2C38B 1E3HA 3OTOI 1XXEA 2V8PA 4USKA 1XMQE 5LL6R 5C0XB 1XNRI 2NN6B 1ZM3A 2JEBB 2HFSA 3LTOA 4GKKE 1NHIA 5DNLA 3CDIA 3ZZ0A 3M85G 4MU0A 5DROA 5C0XC 4K0KE 4X64I 1EA6A 3J80Q 3UHMA 2HK3A 4LF8E 1N0UA 1IBLI 2CZ9A 2BV3A 2UXDE 1DARA 3B82A 4DV5I 4DPXA 3CWVA 1R6MA 4BA2A 1N33I 1VI7A 3ZKBA 4DV7E 5IT9Q 2CVEA 3LNUA 1I94E 1IBLE 4JYAI 2WNRA 4FWDA 2VQEI 4NBQA 4AQYI 4PRXA 2LJPA 2DEIA 4GKKI 4MU4A 2UXCE 3PYFA 4JI5I 4LF4I 4JI0E 2V34A 1FWKA 2GO3A 4DPUA 1N0VC 2BA1G 4GQUA 3U1YA 5FLXQ 4X66I 4LF9E 4OO1E 1VISA 4JV5I 2PNZA 4BA1A 2NPFA 2NN6C 4LFBE 5BR8I 1UDNA 4M1KA 3V5RA 4LPFA 4OKGA 4HACB 2EFGA 2Z5BA 4DUZE 1J5EI 2AE8A 3JAMC 4P7AA 4DU7A 1I94I 4HACA 1OJ4A 2BM0A 4PU9A 3P3CA 5ELWA 1D6TA 2NN6F 1HNWE 3QT7A 4WUCA 1HR0I 1A6FA 2R42A 4EMDA 1N33E 5LMNE 4FW7A 2BA1D 1H73A 5A2QC 2PNMA 4YHHE 4DV2I 1Z0CA 1UEKA 5EL9A 4OO1C 2DEJA 4KQVA 4DR1I 1FKAE 1HNZE 4DV3I 3M6AA 4B3MI 1Z0EA 4DV1I 1XMQI 2X7IA 1H74A 2PO2B 1E3PA 2HKJA 4DV1E 4YY3I 4AM3A 3OTOE 2ZITA 2V2ZA 5DRPA 1KKHA 3T1HI 4FW3A 1USVA 1NHHA 1Z0BA 4DV3E 1HNZI 5JEAC 5JEAD 3T1YE 4FW9A 2E5LI 2PO0A 4FW4A 5DRQA 5LMUI 4DU8A 5JEAF 2UXBE 1NZ0A 2UUBE 2VQFI 4MYUA 2JE6B 4IZJA 2F4VE 2IESA 2C39A 2UUAI 1Z5AA 1OYPA 2BA0D 2WW4A 2VQFE 4LOMA 1UDOA 1FWLA 2Z5CA 3Q6MA 4X62E 5JEAE 2ZM6E 1N32E 4DUYE 4DV4I 2J7KA 2PNLA 1Z5CA 4LFAE 2E5LE 1IBME 5DRRA 5IWAI 2C39B 4IZKB 4R1FA 3U1KA 1HNXE 4HY1A 2VF3A 2J65A 4BA2B 4X66E 2PO2A 2JEAA 4ED4A 3K1JA 1B62A 1N34E 4JI5E 2O1VA 4DR7I 2O1TA 3WU3A 1Z59A 3PS3A 1FNMA 4HYMA 5DNXA 4U3BA 4FN5A 2V2QA 4B3RI 4WUBA 4KHPI 3HJCA 3H1CA 1Z0TA 1U2RA 1ELOA 2HFUA 5EKWA 1KIJA 4NXME 2C37B 4QNJA 1PKPA 4LCFA 1XMOI 3M7NG 1H7SA 1HK7A 1HNWI 4LF8I 4UTGA 2UXDI 4JI3E 3H4LA 3P3GA 4MQYA 4JI8I 2O1WA 3B78A 1S16A 2GS8A 4DUZI 1J5EE 1K47A 3B8HA 3K85A 4DR7E 1ZM4A 1Y4UA 2HKEA 4BA1B 1KVKA 3B4TA 2IOPA 4DPYA 4AIMA 3J7AM 4DR6I 5A2QQ 4JI1E 4AIDA 4X65E 4LF5E 5K36D 1UDQA 4ZVIA 2Z5BB 3WU6A 4IFDA 3CDJA 2HHHI 4LFCI 4LF4E 2A2CA 4NXNE 3JAMQ 4LFAI 4IFDD 2UXCI 4DR2E 2ZM6I 3L7ZB 1WUUA 1N32I 3M7ND 4JYAE 2NN6D 2UUAE 5C0XD 1H72C 5K36B 4OX9E 2WP8A 1BKNA 4MU1A 1IBKE 2GO4A 5FWKA 1RREA 4LF7I 4HXZA 5LMUE 3P76A 4LF6E 2OI2A 2IERA 4DV6I 3P06A 1ZXMA 2WNRB 1FJGE 1XNQI 2PO1B 5L3JA 3KRNA 3T1HE
chains in the Genus database with same CATH topology
4B3TI 1XHKA 4DR4E 3D4JA 4JI4I 4MYTA 2HK2A 4DR5E 3Q6NA 4JI1I 4JG4A 4DR5I 4DR4I 1ZM9A 4JI4E 3J7AG 4B3ME 4JI8E 2R3VA 3J80C 1EI1A 1USUA 1Y6ZA 5GMDA 3LPSA 4DR1E 1H7UA 4XTJA 4LF6I 1XMOE 3PYDA 1RR9A 2UUCI 4NXMI 1IBKI 4P52A 4DXLA 4GKJE 1MU5A 4YHHI 5LMNI 4B3SE 4LF7E 1HR0E 1NHJA 2X36A 4USMA 1B63A 1KTVA 4B3RE 4KHPE 4DR2I 1N36I 4JI6E 4IZKA 4DR3I 3QT6A 4WUDA 1N34I 4UT4A 1PVGA 2HHHE 4JV5E 3PRYA 3V2UC 4DR6E 4JI7E 1FI4A 1Z0GA 4X65I 4LF5I 2O1UA 4DR3E 5IT9C 4JI0I 4FWGA 4IZJB 1N36E 2ZBKB 1IBMI 2CG9A 3ZZUA 4DPWA 3J81C 2VQEE 4AQYE 4JI3I 3WU4A 1Z5BA 4X62I 4IZJD 2Z5CB 4Z7YA 2F4VI 4B3SI 3ZZTA 2Q2EB 4DV7I 3QT8A 2UU9E 2UU9I 4N3OA 4DV5E 2UUCE 4GKJI 4DPTA 4FWHA 4Z7CA 3QT5A 3J81Q 4X64E 3HULA 3Q1QA 4K0KI 1PIEA 4RPFA 2BM1A 1Z0VA 4PRVA 2IOQA 1XNRE 4JI7I 1Y4SA 3GONA 3F0NA 3PYEA 4DV0I 1Z0WA 5GMEA 5IWAE 1HNXI 4B3TE 3ZKDA 3K17A 4JI2E 4JI6I 1MX0A 2V2VA 4URLA 2XEXA 1XNQE 4DV6E 4DUYI 4DV4E 1FJGI 1QZRA 4DV2E 2Z5EA 1S4EA 5FLXC 2UXBI 2AJ4A 1ZXNA 2UUBI 4OX9I 2A2DA 2CGEA 3WU5A 1ZM2A 3PYGA 3T1YI 2GQ0A 5BR8E 4LFBI 1MG7A 4JI2I 4DV0E 4NXNI 4I3HA 4LF9I 3ZM7A 4YY3E 2E1RA 4LFCE 3OTOI 2V8PA 4USKA 1XMQE 5LL6R 1XNRI 1ZM3A 2HFSA 3LTOA 4GKKE 1NHIA 3ZZ0A 4K0KE 4X64I 1EA6A 3J80Q 2HK3A 4LF8E 1N0UA 1IBLI 2CZ9A 2BV3A 2UXDE 1DARA 3B82A 4DV5I 4DPXA 3CWVA 1N33I 3ZKBA 4DV7E 5IT9Q 3LNUA 1IBLE 1I94E 4JYAI 4FWDA 2VQEI 4AQYI 4PRXA 2LJPA 2DEIA 4GKKI 2UXCE 3PYFA 4JI5I 4LF4I 4JI0E 2V34A 1FWKA 4DPUA 1N0VC 5FLXQ 4X66I 4LF9E 1VISA 4JV5I 2NPFA 4LFBE 5BR8I 4M1KA 3V5RA 4HACB 2EFGA 2Z5BA 4DUZE 1J5EI 3JAMC 4P7AA 4DU7A 1I94I 4HACA 1OJ4A 2BM0A 4PU9A 1D6TA 1HNWE 3QT7A 4WUCA 1HR0I 1A6FA 2R42A 4EMDA 1N33E 5LMNE 1H73A 5A2QC 2PNMA 4YHHE 4DV2I 1Z0CA 1UEKA 2DEJA 4KQVA 4DR1I 1FKAE 1HNZE 4DV3I 3M6AA 4B3MI 1Z0EA 4DV1I 1XMQI 2X7IA 1H74A 2HKJA 4DV1E 4YY3I 3OTOE 2ZITA 2V2ZA 1KKHA 3T1HI 1USVA 1NHHA 1Z0BA 4DV3E 1HNZI 3T1YE 4FW9A 2E5LI 5LMUI 4DU8A 2UXBE 1NZ0A 2UUBE 2VQFI 4MYUA 4IZJA 2F4VE 2UUAI 1Z5AA 2WW4A 2VQFE 1FWLA 2Z5CA 3Q6MA 4X62E 2ZM6E 1N32E 4DUYE 4DV4I 2J7KA 2PNLA 1Z5CA 4LFAE 2E5LE 1IBME 5IWAI 4IZKB 4R1FA 1HNXE 4HY1A 2VF3A 4X66E 4ED4A 3K1JA 1B62A 1N34E 4JI5E 2O1VA 4DR7I 2O1TA 3WU3A 1Z59A 4HYMA 1FNMA 4FN5A 2V2QA 4B3RI 4WUBA 4KHPI 3HJCA 1Z0TA 1U2RA 1ELOA 2HFUA 1KIJA 4NXME 1PKPA 1XMOI 1H7SA 1HK7A 1HNWI 4LF8I 4UTGA 2UXDI 4JI3E 3H4LA 4JI8I 2O1WA 3B78A 1S16A 2GS8A 4DUZI 1J5EE 1K47A 3B8HA 3K85A 4DR7E 1ZM4A 1Y4UA 2HKEA 1KVKA 2IOPA 4DPYA 3J7AM 4DR6I 5A2QQ 4JI1E 4X65E 4LF5E 4ZVIA 2Z5BB 3WU6A 2HHHI 4LFCI 4LF4E 2A2CA 4NXNE 3JAMQ 4LFAI 2UXCI 4DR2E 2ZM6I 1WUUA 1N32I 4JYAE 2UUAE 1H72C 4OX9E 1BKNA 1IBKE 5FWKA 1RREA 4LF7I 4HXZA 5LMUE 4LF6E 2OI2A 4DV6I 3P06A 1ZXMA 1FJGE 1XNQI 5L3JA 3T1HE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T I;  1XHK A;  4DR4 E;  3D4J A;  4JI4 I;  4MYT A;  2HK2 A;  4DR5 E;  4JI1 I;  4JG4 A;  4DR5 I;  4DR4 I;  1ZM9 A;  4JI4 E;  3J7A G;  4B3M E;  4JI8 E;  2R3V A;  3J80 C;  1EI1 A;  5GMD A;  3LPS A;  4DR1 E;  1H7U A;  4XTJ A;  4LF6 I;  1XMO E;  3PYD A;  1RR9 A;  2UUC I;  4NXM I;  1IBK I;  4P52 A;  4DXL A;  4GKJ E;  1MU5 A;  4YHH I;  5LMN I;  4B3S E;  4LF7 E;  1HR0 E;  1NHJ A;  2X36 A;  4USM A;  1B63 A;  1KTV A;  4B3R E;  4KHP E;  4DR2 I;  1N36 I;  4JI6 E;  4DR3 I;  3QT6 A;  4WUD A;  1N34 I;  4UT4 A;  1PVG A;  2HHH E;  4JV5 E;  3V2U C;  4DR6 E;  4JI7 E;  1FI4 A;  1Z0G A;  4X65 I;  4LF5 I;  4DR3 E;  5IT9 C;  4JI0 I;  4FWG A;  1N36 E;  2ZBK B;  1IBM I;  3ZZU A;  4DPW A;  3J81 C;  2VQE E;  4AQY E;  4JI3 I;  3WU4 A;  1Z5B A;  4X62 I;  4Z7Y A;  2F4V I;  4B3S I;  3ZZT A;  2Q2E B;  4DV7 I;  3QT8 A;  2UU9 E;  2UU9 I;  4DV5 E;  2UUC E;  4GKJ I;  4DPT A;  4FWH A;  4Z7C A;  3QT5 A;  3J81 Q;  4X64 E;  3HUL A;  3Q1Q A;  4K0K I;  1PIE A;  4RPF A;  2BM1 A;  1Z0V A;  4PRV A;  1XNR E;  4JI7 I;  3GON A;  3F0N A;  3PYE A;  4DV0 I;  1Z0W A;  5GME A;  5IWA E;  1HNX I;  4B3T E;  3ZKD A;  3K17 A;  4JI2 E;  4JI6 I;  1MX0 A;  2V2V A;  4URL A;  2XEX A;  1XNQ E;  4DV6 E;  4DUY I;  4DV4 E;  1FJG I;  1QZR A;  4DV2 E;  1S4E A;  5FLX C;  2UXB I;  2AJ4 A;  1ZXN A;  2UUB I;  4OX9 I;  2A2D A;  3WU5 A;  1ZM2 A;  3PYG A;  3T1Y I;  5BR8 E;  4LFB I;  1MG7 A;  4JI2 I;  4DV0 E;  4NXN I;  4I3H A;  4LF9 I;  3ZM7 A;  4YY3 E;  2E1R A;  4LFC E;  3OTO I;  2V8P A;  4USK A;  1XMQ E;  5LL6 R;  1XNR I;  1ZM3 A;  2HFS A;  3LTO A;  4GKK E;  1NHI A;  3ZZ0 A;  4K0K E;  4X64 I;  1EA6 A;  3J80 Q;  2HK3 A;  4LF8 E;  1N0U A;  1IBL I;  2CZ9 A;  2BV3 A;  2UXD E;  1DAR A;  3B82 A;  4DV5 I;  4DPX A;  3CWV A;  1N33 I;  3ZKB A;  4DV7 E;  5IT9 Q;  3LNU A;  1I94 E;  1IBL E;  4JYA I;  4FWD A;  2VQE I;  4AQY I;  4PRX A;  2LJP A;  2DEI A;  4GKK I;  2UXC E;  3PYF A;  4JI5 I;  4LF4 I;  4JI0 E;  2V34 A;  1FWK A;  4DPU A;  1N0V C;  5FLX Q;  4X66 I;  4LF9 E;  1VIS A;  4JV5 I;  2NPF A;  4LFB E;  5BR8 I;  4M1K A;  3V5R A;  4HAC B;  2EFG A;  4DUZ E;  1J5E I;  3JAM C;  4P7A A;  4DU7 A;  1I94 I;  4HAC A;  1OJ4 A;  2BM0 A;  4PU9 A;  1D6T A;  1HNW E;  3QT7 A;  4WUC A;  1HR0 I;  1A6F A;  2R42 A;  4EMD A;  1N33 E;  5LMN E;  1H73 A;  5A2Q C;  4DV2 I;  4YHH E;  1Z0C A;  1UEK A;  2DEJ A;  4KQV A;  4DR1 I;  1FKA E;  1HNZ E;  4DV3 I;  3M6A A;  4B3M I;  1Z0E A;  4DV1 I;  1XMQ I;  2X7I A;  1H74 A;  2HKJ A;  4DV1 E;  4YY3 I;  3OTO E;  2ZIT A;  2V2Z A;  1KKH A;  3T1H I;  1NHH A;  1Z0B A;  4DV3 E;  1HNZ I;  3T1Y E;  4FW9 A;  2E5L I;  5LMU I;  4DU8 A;  2UXB E;  1NZ0 A;  2UUB E;  2VQF I;  4MYU A;  2F4V E;  2UUA I;  1Z5A A;  2WW4 A;  2VQF E;  1FWL A;  4X62 E;  2ZM6 E;  1N32 E;  4DUY E;  4DV4 I;  2J7K A;  1Z5C A;  4LFA E;  2E5L E;  1IBM E;  5IWA I;  4R1F A;  1HNX E;  4HY1 A;  2VF3 A;  4X66 E;  4ED4 A;  3K1J A;  1B62 A;  1N34 E;  4JI5 E;  4DR7 I;  3WU3 A;  1Z59 A;  4HYM A;  1FNM A;  4FN5 A;  2V2Q A;  4B3R I;  4WUB A;  4KHP I;  1Z0T A;  1U2R A;  1ELO A;  2HFU A;  1KIJ A;  4NXM E;  1PKP A;  1XMO I;  1H7S A;  1HNW I;  4LF8 I;  4UTG A;  2UXD I;  4JI3 E;  3H4L A;  4JI8 I;  3B78 A;  1S16 A;  2GS8 A;  4DUZ I;  1J5E E;  1K47 A;  3B8H A;  4DR7 E;  1ZM4 A;  2HKE A;  1KVK A;  4DPY A;  3J7A M;  4DR6 I;  5A2Q Q;  4JI1 E;  4X65 E;  4LF5 E;  4ZVI A;  3WU6 A;  2HHH I;  4LFC I;  4LF4 E;  4NXN E;  2A2C A;  3JAM Q;  4LFA I;  2UXC I;  4DR2 E;  2ZM6 I;  1WUU A;  1N32 I;  4JYA E;  2UUA E;  1H72 C;  4OX9 E;  1BKN A;  1IBK E;  1RRE A;  4LF7 I;  4HXZ A;  5LMU E;  4LF6 E;  2OI2 A;  4DV6 I;  1ZXM A;  1FJG E;  1XNQ I;  5L3J A;  3T1H E; 
#chains in the Genus database with same CATH topology
 4B3T I;  1XHK A;  4DR4 E;  2JEB A;  4J3D A;  2NN6 A;  5C0X F;  3D4J A;  4JI4 I;  2O3Z A;  4MYT A;  2HK2 A;  4DR5 E;  3Q6N A;  4JI1 I;  4JG4 A;  4DR5 I;  1YHC A;  4DR4 I;  1ZM9 A;  4JI4 E;  3J7A G;  4B3M E;  4JI8 E;  2R3V A;  3J80 C;  1EI1 A;  1USU A;  1Y6Z A;  5GMD A;  3LPS A;  1UDS A;  4DR1 E;  2VES A;  2JE6 A;  1RHY A;  1H7U A;  4XTJ A;  4LF6 I;  1XMO E;  3PYD A;  1RR9 A;  2UUC I;  4QNK A;  4IFD C;  1Y5Y A;  2C38 A;  4NXM I;  2PO1 A;  4P52 A;  1IBK I;  4DXL A;  4GKJ E;  1MU5 A;  4YHH I;  5LMN I;  4B3S E;  4FW6 A;  2C37 A;  1NHJ A;  1HR0 E;  4LF7 E;  4U3D A;  4IFD F;  2X36 A;  4USM A;  1B63 A;  1KTV A;  4B3R E;  4KHP E;  4DR2 I;  4ISA A;  5K36 F;  5K36 A;  3PS1 A;  1N36 I;  4JI6 E;  4IZK A;  4DR3 I;  4OO1 D;  4OO1 B;  4IFD E;  3QT6 A;  4WUD A;  1N34 I;  4UT4 A;  1PVG A;  2HHH E;  3L7Z A;  4OO1 A;  4JV5 E;  3PRY A;  3V2U C;  2JEA B;  5K36 E;  4DR6 E;  4JI7 E;  1FI4 A;  5JEA A;  1Z0G A;  4X65 I;  4LF5 I;  4IFD B;  2O1U A;  3GCM A;  1OYR A;  4DR3 E;  5IT9 C;  4JI0 I;  4FWG A;  4IZJ B;  1N36 E;  2ZBK B;  1IBM I;  2CG9 A;  3ZZU A;  4DPW A;  3J81 C;  2VQE E;  4AQY E;  4JI3 I;  3WU4 A;  1Z5B A;  4X62 I;  4IZJ D;  2Z5C B;  4OO1 F;  4Z7Y A;  3NZK A;  2BR2 B;  2F4V I;  4B3S I;  3ZZT A;  2Q2E B;  4DV7 I;  3QT8 A;  2UU9 E;  2UU9 I;  3GME A;  4N3O A;  4DV5 E;  2UUC E;  4GKJ I;  4DPT A;  4MDT A;  4FWH A;  2NN6 E;  4Z7C A;  3QT5 A;  3J81 Q;  3P3E A;  4X64 E;  4MU3 A;  3HUL A;  1Y60 A;  3Q1Q A;  1YH8 A;  4K0K I;  3DD6 A;  4IS9 A;  1PIE A;  1OYS A;  4RPF A;  2BM1 A;  1Z0V A;  2JT2 A;  4PRV A;  2IOQ A;  3GLL A;  2WP8 B;  4LCH A;  1XNR E;  4JI7 I;  1Y4S A;  3GON A;  5K36 C;  2PO0 B;  3HKM A;  3F0N A;  3PYE A;  4DV0 I;  1P42 A;  1Z0W A;  5GME A;  5IWA E;  1HNX I;  4B3T E;  3ZKD A;  3K17 A;  4JI2 E;  4JI6 I;  3PS2 A;  1MX0 A;  1R6L A;  2V2V A;  4URL A;  2XEX A;  5JEA B;  2BA0 G;  1XNQ E;  4DV6 E;  4DUY I;  4DV4 E;  1FJG I;  4LCG A;  1QZR A;  5C0X A;  4DV2 E;  2Z5E A;  1S4E A;  5FLX C;  2UXB I;  2AJ4 A;  1ZXN A;  2UUB I;  4OZE A;  4OX9 I;  2A2D A;  2CGE A;  3WU5 A;  5C0X E;  1ZM2 A;  3M85 D;  3PYG A;  3T1Y I;  2GQ0 A;  5BR8 E;  4LFB I;  2BR2 A;  1MG7 A;  4JI2 I;  4DV0 E;  4NXN I;  2PNZ B;  4I3H A;  2F1D A;  4FW5 A;  4LF9 I;  3ZM7 A;  4YY3 E;  2E1R A;  4LFC E;  2C38 B;  1E3H A;  3OTO I;  1XXE A;  2V8P A;  4USK A;  1XMQ E;  5LL6 R;  5C0X B;  1XNR I;  2NN6 B;  1ZM3 A;  2JEB B;  2HFS A;  3LTO A;  4GKK E;  1NHI A;  5DNL A;  3CDI A;  3ZZ0 A;  3M85 G;  4MU0 A;  5DRO A;  5C0X C;  4K0K E;  4X64 I;  1EA6 A;  3J80 Q;  3UHM A;  2HK3 A;  4LF8 E;  1N0U A;  1IBL I;  2CZ9 A;  2BV3 A;  2UXD E;  1DAR A;  3B82 A;  4DV5 I;  4DPX A;  3CWV A;  1R6M A;  4BA2 A;  1N33 I;  1VI7 A;  3ZKB A;  4DV7 E;  5IT9 Q;  2CVE A;  3LNU A;  1I94 E;  1IBL E;  4JYA I;  2WNR A;  4FWD A;  2VQE I;  4NBQ A;  4AQY I;  4PRX A;  2LJP A;  2DEI A;  4GKK I;  4MU4 A;  2UXC E;  3PYF A;  4JI5 I;  4LF4 I;  4JI0 E;  2V34 A;  1FWK A;  2GO3 A;  4DPU A;  1N0V C;  2BA1 G;  4GQU A;  3U1Y A;  5FLX Q;  4X66 I;  4LF9 E;  4OO1 E;  1VIS A;  4JV5 I;  2PNZ A;  4BA1 A;  2NPF A;  2NN6 C;  4LFB E;  5BR8 I;  1UDN A;  4M1K A;  3V5R A;  4LPF A;  4OKG A;  4HAC B;  2EFG A;  2Z5B A;  4DUZ E;  1J5E I;  2AE8 A;  3JAM C;  4P7A A;  4DU7 A;  1I94 I;  4HAC A;  1OJ4 A;  2BM0 A;  4PU9 A;  3P3C A;  5ELW A;  1D6T A;  2NN6 F;  1HNW E;  3QT7 A;  4WUC A;  1HR0 I;  1A6F A;  2R42 A;  4EMD A;  1N33 E;  5LMN E;  4FW7 A;  2BA1 D;  1H73 A;  5A2Q C;  2PNM A;  4YHH E;  4DV2 I;  1Z0C A;  1UEK A;  5EL9 A;  4OO1 C;  2DEJ A;  4KQV A;  4DR1 I;  1FKA E;  1HNZ E;  4DV3 I;  3M6A A;  4B3M I;  1Z0E A;  4DV1 I;  1XMQ I;  2X7I A;  1H74 A;  2PO2 B;  1E3P A;  2HKJ A;  4DV1 E;  4YY3 I;  4AM3 A;  3OTO E;  2ZIT A;  2V2Z A;  5DRP A;  1KKH A;  3T1H I;  4FW3 A;  1USV A;  1NHH A;  1Z0B A;  4DV3 E;  1HNZ I;  5JEA C;  5JEA D;  3T1Y E;  4FW9 A;  2E5L I;  2PO0 A;  4FW4 A;  5DRQ A;  5LMU I;  4DU8 A;  5JEA F;  2UXB E;  1NZ0 A;  2UUB E;  2VQF I;  4MYU A;  2JE6 B;  4IZJ A;  2F4V E;  2IES A;  2C39 A;  2UUA I;  1Z5A A;  1OYP A;  2BA0 D;  2WW4 A;  2VQF E;  4LOM A;  1UDO A;  1FWL A;  2Z5C A;  3Q6M A;  4X62 E;  5JEA E;  2ZM6 E;  1N32 E;  4DUY E;  4DV4 I;  2J7K A;  2PNL A;  1Z5C A;  4LFA E;  2E5L E;  1IBM E;  5DRR A;  5IWA I;  2C39 B;  4IZK B;  4R1F A;  3U1K A;  1HNX E;  4HY1 A;  2VF3 A;  2J65 A;  4BA2 B;  4X66 E;  2PO2 A;  2JEA A;  4ED4 A;  3K1J A;  1B62 A;  1N34 E;  4JI5 E;  2O1V A;  4DR7 I;  2O1T A;  3WU3 A;  1Z59 A;  3PS3 A;  1FNM A;  4HYM A;  5DNX A;  4U3B A;  4FN5 A;  2V2Q A;  4B3R I;  4WUB A;  4KHP I;  3HJC A;  3H1C A;  1Z0T A;  1U2R A;  1ELO A;  2HFU A;  5EKW A;  1KIJ A;  4NXM E;  2C37 B;  4QNJ A;  1PKP A;  4LCF A;  1XMO I;  3M7N G;  1H7S A;  1HK7 A;  1HNW I;  4LF8 I;  4UTG A;  2UXD I;  4JI3 E;  3H4L A;  3P3G A;  4MQY A;  4JI8 I;  2O1W A;  3B78 A;  1S16 A;  2GS8 A;  4DUZ I;  1J5E E;  1K47 A;  3B8H A;  3K85 A;  4DR7 E;  1ZM4 A;  1Y4U A;  2HKE A;  4BA1 B;  1KVK A;  3B4T A;  2IOP A;  4DPY A;  4AIM A;  3J7A M;  4DR6 I;  5A2Q Q;  4JI1 E;  4AID A;  4X65 E;  4LF5 E;  5K36 D;  1UDQ A;  4ZVI A;  2Z5B B;  3WU6 A;  4IFD A;  3CDJ A;  2HHH I;  4LFC I;  4LF4 E;  2A2C A;  4NXN E;  3JAM Q;  4LFA I;  4IFD D;  2UXC I;  4DR2 E;  2ZM6 I;  3L7Z B;  1WUU A;  1N32 I;  3M7N D;  4JYA E;  2NN6 D;  2UUA E;  5C0X D;  1H72 C;  5K36 B;  4OX9 E;  2WP8 A;  1BKN A;  4MU1 A;  1IBK E;  2GO4 A;  5FWK A;  1RRE A;  4LF7 I;  4HXZ A;  5LMU E;  3P76 A;  4LF6 E;  2OI2 A;  2IER A;  4DV6 I;  3P06 A;  1ZXM A;  2WNR B;  1FJG E;  1XNQ I;  2PO1 B;  5L3J A;  3KRN A;  3T1H E; 
#chains in the Genus database with same CATH homology
 4B3T I;  1XHK A;  4DR4 E;  3D4J A;  4JI4 I;  4MYT A;  2HK2 A;  4DR5 E;  3Q6N A;  4JI1 I;  4JG4 A;  4DR5 I;  4DR4 I;  1ZM9 A;  4JI4 E;  3J7A G;  4B3M E;  4JI8 E;  2R3V A;  3J80 C;  1EI1 A;  1USU A;  1Y6Z A;  5GMD A;  3LPS A;  4DR1 E;  1H7U A;  4XTJ A;  4LF6 I;  1XMO E;  3PYD A;  1RR9 A;  2UUC I;  4NXM I;  1IBK I;  4P52 A;  4DXL A;  4GKJ E;  1MU5 A;  4YHH I;  5LMN I;  4B3S E;  4LF7 E;  1HR0 E;  1NHJ A;  2X36 A;  4USM A;  1B63 A;  1KTV A;  4B3R E;  4KHP E;  4DR2 I;  1N36 I;  4JI6 E;  4IZK A;  4DR3 I;  3QT6 A;  4WUD A;  1N34 I;  4UT4 A;  1PVG A;  2HHH E;  4JV5 E;  3PRY A;  3V2U C;  4DR6 E;  4JI7 E;  1FI4 A;  1Z0G A;  4X65 I;  4LF5 I;  2O1U A;  4DR3 E;  5IT9 C;  4JI0 I;  4FWG A;  4IZJ B;  1N36 E;  2ZBK B;  1IBM I;  2CG9 A;  3ZZU A;  4DPW A;  3J81 C;  2VQE E;  4AQY E;  4JI3 I;  3WU4 A;  1Z5B A;  4X62 I;  4IZJ D;  2Z5C B;  4Z7Y A;  2F4V I;  4B3S I;  3ZZT A;  2Q2E B;  4DV7 I;  3QT8 A;  2UU9 E;  2UU9 I;  4N3O A;  4DV5 E;  2UUC E;  4GKJ I;  4DPT A;  4FWH A;  4Z7C A;  3QT5 A;  3J81 Q;  4X64 E;  3HUL A;  3Q1Q A;  4K0K I;  1PIE A;  4RPF A;  2BM1 A;  1Z0V A;  4PRV A;  2IOQ A;  1XNR E;  4JI7 I;  1Y4S A;  3GON A;  3F0N A;  3PYE A;  4DV0 I;  1Z0W A;  5GME A;  5IWA E;  1HNX I;  4B3T E;  3ZKD A;  3K17 A;  4JI2 E;  4JI6 I;  1MX0 A;  2V2V A;  4URL A;  2XEX A;  1XNQ E;  4DV6 E;  4DUY I;  4DV4 E;  1FJG I;  1QZR A;  4DV2 E;  2Z5E A;  1S4E A;  5FLX C;  2UXB I;  2AJ4 A;  1ZXN A;  2UUB I;  4OX9 I;  2A2D A;  2CGE A;  3WU5 A;  1ZM2 A;  3PYG A;  3T1Y I;  2GQ0 A;  5BR8 E;  4LFB I;  1MG7 A;  4JI2 I;  4DV0 E;  4NXN I;  4I3H A;  4LF9 I;  3ZM7 A;  4YY3 E;  2E1R A;  4LFC E;  3OTO I;  2V8P A;  4USK A;  1XMQ E;  5LL6 R;  1XNR I;  1ZM3 A;  2HFS A;  3LTO A;  4GKK E;  1NHI A;  3ZZ0 A;  4K0K E;  4X64 I;  1EA6 A;  3J80 Q;  2HK3 A;  4LF8 E;  1N0U A;  1IBL I;  2CZ9 A;  2BV3 A;  2UXD E;  1DAR A;  3B82 A;  4DV5 I;  4DPX A;  3CWV A;  1N33 I;  3ZKB A;  4DV7 E;  5IT9 Q;  3LNU A;  1IBL E;  1I94 E;  4JYA I;  4FWD A;  2VQE I;  4AQY I;  4PRX A;  2LJP A;  2DEI A;  4GKK I;  2UXC E;  3PYF A;  4JI5 I;  4LF4 I;  4JI0 E;  2V34 A;  1FWK A;  4DPU A;  1N0V C;  5FLX Q;  4X66 I;  4LF9 E;  1VIS A;  4JV5 I;  2NPF A;  4LFB E;  5BR8 I;  4M1K A;  3V5R A;  4HAC B;  2EFG A;  2Z5B A;  4DUZ E;  1J5E I;  3JAM C;  4P7A A;  4DU7 A;  1I94 I;  4HAC A;  1OJ4 A;  2BM0 A;  4PU9 A;  1D6T A;  1HNW E;  3QT7 A;  4WUC A;  1HR0 I;  1A6F A;  2R42 A;  4EMD A;  1N33 E;  5LMN E;  1H73 A;  5A2Q C;  2PNM A;  4YHH E;  4DV2 I;  1Z0C A;  1UEK A;  2DEJ A;  4KQV A;  4DR1 I;  1FKA E;  1HNZ E;  4DV3 I;  3M6A A;  4B3M I;  1Z0E A;  4DV1 I;  1XMQ I;  2X7I A;  1H74 A;  2HKJ A;  4DV1 E;  4YY3 I;  3OTO E;  2ZIT A;  2V2Z A;  1KKH A;  3T1H I;  1USV A;  1NHH A;  1Z0B A;  4DV3 E;  1HNZ I;  3T1Y E;  4FW9 A;  2E5L I;  5LMU I;  4DU8 A;  2UXB E;  1NZ0 A;  2UUB E;  2VQF I;  4MYU A;  4IZJ A;  2F4V E;  2UUA I;  1Z5A A;  2WW4 A;  2VQF E;  1FWL A;  2Z5C A;  3Q6M A;  4X62 E;  2ZM6 E;  1N32 E;  4DUY E;  4DV4 I;  2J7K A;  2PNL A;  1Z5C A;  4LFA E;  2E5L E;  1IBM E;  5IWA I;  4IZK B;  4R1F A;  1HNX E;  4HY1 A;  2VF3 A;  4X66 E;  4ED4 A;  3K1J A;  1B62 A;  1N34 E;  4JI5 E;  2O1V A;  4DR7 I;  2O1T A;  3WU3 A;  1Z59 A;  4HYM A;  1FNM A;  4FN5 A;  2V2Q A;  4B3R I;  4WUB A;  4KHP I;  3HJC A;  1Z0T A;  1U2R A;  1ELO A;  2HFU A;  1KIJ A;  4NXM E;  1PKP A;  1XMO I;  1H7S A;  1HK7 A;  1HNW I;  4LF8 I;  4UTG A;  2UXD I;  4JI3 E;  3H4L A;  4JI8 I;  2O1W A;  3B78 A;  1S16 A;  2GS8 A;  4DUZ I;  1J5E E;  1K47 A;  3B8H A;  3K85 A;  4DR7 E;  1ZM4 A;  1Y4U A;  2HKE A;  1KVK A;  2IOP A;  4DPY A;  3J7A M;  4DR6 I;  5A2Q Q;  4JI1 E;  4X65 E;  4LF5 E;  4ZVI A;  2Z5B B;  3WU6 A;  2HHH I;  4LFC I;  4LF4 E;  2A2C A;  4NXN E;  3JAM Q;  4LFA I;  2UXC I;  4DR2 E;  2ZM6 I;  1WUU A;  1N32 I;  4JYA E;  2UUA E;  1H72 C;  4OX9 E;  1BKN A;  1IBK E;  5FWK A;  1RRE A;  4LF7 I;  4HXZ A;  5LMU E;  4LF6 E;  2OI2 A;  4DV6 I;  3P06 A;  1ZXM A;  1FJG E;  1XNQ I;  5L3J A;  3T1H E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...