1Z0EA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 61
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0eA00
3ZKBA 1EI1A 1XMOE 2VQFI 1U2RA 3QT6A 1NZ0A 4JI3E 4LF6I 3PYDA 2UUCE 4DR3E 4AQYI 3ZZTA 2CZ9A 4DR1I 4LF4I 1H74A 4DU7A 2F4VI 1FWLA 4DUYI 3F0NA 4FWGA 1H7UA 4USKA 4DR5I 1ZM4A 4X65I 4JV5I 2VQEE 4DUZI 1N0UA 2UUAI 1RR9A 4B3MI 4HY1A 1IBME 1N34I 4URLA 1H72C 3T1HE 5IWAI 1XMQE 4JI8E 5A2QC 3M6AA 2HK2A 2V2VA 3B8HA 4R1FA 2DEIA 2HHHE 1HNZE 3LPSA 4DPWA 4LF7E 4JI0I 1FJGI 3CWVA 2UU9E 1NHJA 1KIJA 4GKJI 4B3TE 4NXNI 4JI5E 2HKEA 1XNRI 1Z0CA 3J7AM 3OTOI 2HKJA 1N33E 4ZVIA 4DV3E 4NXMI 5LMUI 1ZXNA 2V2QA 4YY3E 2A2DA 4OX9E 4FWDA 4LFAE 1HNXE 2BV3A 1MU5A 4UTGA 4JI1I 4DV5E 1ZM9A 1OJ4A 4AQYE 2ZBKB 4DR1E 4DV4E 2A2CA 2F4VE 4UT4A 1IBKI 4DUYE 4DR6E 1KTVA 4DR4E 4DV0E 4LF9I 1J5EE 2XEXA 4DR5E 2UUBI 1FKAE 4JV5E 4DU8A 2UUAE 1Z59A 2NPFA 1N34E 4USMA 4HACB 4KHPE 5L3JA 1N32E 5IWAE 1Z0BA 1Z0VA 1B63A 2E1RA 3T1YI 4DR2I 3PYEA 4X64I 4MYTA 4DPTA 5IT9Q 4JI0E 3LTOA 1MG7A 4X62I 4GKJE 4PRXA 4NXNE 4JI2E 2LJPA 1XNRE 4MYUA 1KVKA 3ZKDA 3OTOE 1A6FA 4JG4A 2UXDI 4X66I 2X36A 5LMUE 4DR7E 1HNWI 2E5LI 3HULA 1BKNA 1HR0I 4B3RE 4DPUA 3JAMC 2V34A 5FLXQ 2X7IA 4B3SI 4LF5I 2DEJA 1I94E 1MX0A 5BR8E 4JI1E 1ZXMA 3V2UC 1Z0WA 4JI6I 3J81Q 5LMNI 1Z0GA 1XNQE 1EA6A 4JI7E 2BM1A 4LF9E 1WUUA 4RPFA 4GKKE 4LFCI 2WW4A 4HACA 4DV2E 4KQVA 1XMOI 4M1KA 4YHHE 2V2ZA 2UXBE 2R42A 3QT5A 1KKHA 2ZM6I 4DR3I 1H73A 3PYFA 1IBLE 3ZM7A 1FNMA 3J80Q 1D6TA 4DR2E 4JI4E 4LFBE 3B82A 3LNUA 5FLXC 2VQFE 1N36I 4LF6E 1FWKA 1XMQI 3PYGA 4LF4E 1FI4A 2UXCI 4X65E 4DUZE 4B3ME 4X66E 3WU4A 4LF7I 4HXZA 1ZM2A 1HNWE 4DV6I 3QT7A 1H7SA 4K0KI 5GMEA 4B3TI 1NHIA 4XTJA 2BM0A 4DXLA 4B3SE 5A2QQ 3J80C 4JYAI 1FJGE 4JI6E 3D4JA 2ZITA 5LMNE 4P52A 1HNXI 4PU9A 4WUBA 1ELOA 1B62A 4DPYA 1DARA 1RREA 5GMDA 3V5RA 4DV5I 4NXME 4PRVA 2ZM6E 4DV1I 4FW9A 4DV4I 4LF8I 2GS8A 4DR6I 2HFSA 4DR4I 4DV0I 4WUDA 2J7KA 1J5EI 4FWHA 3WU3A 3WU5A 1N36E 3K17A 4KHPI 1N32I 2OI2A 4DV7I 2HK3A 5IT9C 1IBKE 1VISA 4I3HA 3K1JA 1S16A 1Z0TA 2UXCE 2EFGA 2UUBE 3J7AG 4Z7YA 1XNQI 4JI3I 2HFUA 4DV6E 2UUCI 4K0KE 4FN5A 1PIEA 1PVGA 3T1YE 4JI2I 4X64E 3ZZUA 2VQEI 1IBMI 2V8PA 4JYAE 4DR7I 1XHKA 3T1HI 1N0VC 4X62E 4JI8I 3QT8A 1Z5AA 4P7AA 4B3RI 1Z0EA 4WUCA 3J81C 3ZZ0A 1I94I 2VF3A 5BR8I 2HHHI 2AJ4A 1HNZI 2UXDE 1PKPA 1UEKA 2UU9I 1Z5CA 4DV1E 2E5LE 1ZM3A 4LF8E 4ED4A 1Z5BA 1HR0E 4JI7I 3H4LA 4EMDA 4JI5I 2R3VA 4DPXA 4GKKI 4LF5E 4HYMA 3B78A 1N33I 4DV2I 1NHHA 4DV3I 4YHHI 2UXBI 4YY3I 3JAMQ 4OX9I 1QZRA 1K47A 4DV7E 4LFAI 3GONA 1IBLI 3Q1QA 3WU6A 4Z7CA 5LL6R 1S4EA 4JI4I 2Q2EB 4LFBI 4LFCE
chains in the Genus database with same CATH superfamily
4AIMA 3ZKBA 1EI1A 1XMOE 2PNZA 2VQFI 1U2RA 2C38B 1NZ0A 3QT6A 1E3HA 4JI3E 4LF6I 4AM3A 3PYDA 3P3EA 2UUCE 4DR3E 4AQYI 3ZZTA 2CZ9A 2NN6B 4LOMA 4DR1I 4LF4I 1H74A 4DU7A 2F4VI 1FWLA 4DUYI 3F0NA 5K36C 5C0XC 4FWGA 1H7UA 4USKA 2WP8A 4DR5I 1ZM4A 4X65I 4JV5I 2VQEE 4DUZI 1N0UA 2UUAI 1RR9A 4B3MI 4HY1A 2C39B 4IFDE 1IBME 1N34I 3UHMA 4URLA 1H72C 2PO2B 3T1HE 5IWAI 4LCFA 5DROA 1XMQE 4BA1B 3H1CA 5K36F 4IZJB 2PO0B 4JI8E 5A2QC 1UDSA 5JEAC 3M6AA 5C0XD 2HK2A 4AIDA 2V2VA 3B8HA 4R1FA 2DEIA 2Z5CB 2HHHE 3LPSA 4DPWA 2IOQA 2GO4A 1HNZE 4IFDB 4LF7E 3PS2A 4JI0I 1FJGI 2BR2B 3CWVA 2UU9E 2PNZB 1NHJA 1KIJA 4GKJI 4IZKA 5DRPA 5JEAD 4B3TE 4NXNI 3M7NG 4JI5E 4BA2B 2HKEA 1XNRI 1Z0CA 3J7AM 3OTOI 2HKJA 1N33E 4ZVIA 4DV3E 2JEBA 4NXMI 5LMUI 1ZXNA 2V2QA 4YY3E 2A2DA 1P42A 4OX9E 1OYSA 4OO1E 4FWDA 4LFAE 1YH8A 2CGEA 1HNXE 3KRNA 2BV3A 2JEAB 3Q6NA 2J65A 1MU5A 4UTGA 4JI1I 4DV5E 1ZM9A 1OJ4A 2NN6A 4AQYE 2ZBKB 4DR1E 4OO1B 4DV4E 2A2CA 2F4VE 4UT4A 1IBKI 4DUYE 4DR6E 1KTVA 4DR4E 4DV0E 4LF9I 1Y60A 1J5EE 2XEXA 2C39A 4DR5E 2UUBI 1FKAE 4OZEA 4DU8A 4JV5E 2UUAE 3K85A 1Z59A 2NPFA 2CG9A 1N34E 4USMA 4HACB 4KHPE 5L3JA 2PO0A 4IZJA 1N32E 2NN6C 5IWAE 1Z0BA 1UDNA 3P3CA 1Z0VA 1B63A 4MU4A 2E1RA 3T1YI 2Z5CA 2GQ0A 5DRRA 4DR2I 3PYEA 4X64I 4IFDA 2NN6F 5DNLA 2BR2A 4MYTA 4DPTA 5IT9Q 4JI0E 3LTOA 2C37B 1MG7A 4X62I 4GKJE 2BA1G 4BA2A 2O1WA 4PRXA 4NXNE 3HJCA 4JI2E 2LJPA 1XNRE 4MYUA 2F1DA 1KVKA 2GO3A 3ZKDA 1E3PA 3OTOE 1A6FA 5DRQA 4IFDC 4JG4A 2UXDI 1RHYA 3GCMA 4X66I 2X36A 5LMUE 4DR7E 4LPFA 1HNWI 2VESA 2E5LI 3HULA 1BKNA 2JEAA 4GQUA 1HR0I 4B3RE 4DPUA 5K36D 3JAMC 2V34A 4IFDF 3M7ND 5FLXQ 2X7IA 5C0XE 4U3BA 2PO1A 4B3SI 4LF5I 2DEJA 1I94E 1MX0A 5BR8E 3GLLA 2IESA 4JI1E 3CDIA 4FW3A 1ZXMA 3V2UC 3CDJA 4OO1A 1Z0WA 4JI6I 3J81Q 4LCGA 4FW4A 5LMNI 1Z0GA 1XNQE 1EA6A 4JI7E 2BM1A 4LF9E 1WUUA 4RPFA 4GKKE 1Y5YA 1VI7A 3HKMA 4LFCI 2WW4A 4HACA 2CVEA 4DV2E 2PNMA 4KQVA 1XMOI 4M1KA 4YHHE 2V2ZA 4ISAA 2UXBE 2R42A 3QT5A 4OO1C 1KKHA 2ZM6I 5DNXA 4DR3I 1H73A 3PYFA 1IBLE 3ZM7A 3PS3A 1R6MA 1FNMA 3PRYA 3J80Q 1D6TA 4DR2E 4JI4E 4LFBE 3B82A 4OO1F 3LNUA 2C37A 2WNRA 2PO1B 5FLXC 2VQFE 1N36I 4LF6E 4N3OA 1Y4UA 1FWKA 2PNLA 1XMQI 3PYGA 4LF4E 1FI4A 3DD6A 2UXCI 4X65E 1USUA 1HK7A 4DUZE 4B3ME 4X66E 3WU4A 4LF7I 4HXZA 1ZM2A 1HNWE 4DV6I 3QT7A 1H7SA 4K0KI 4MU1A 2BA1D 5GMEA 1UDQA 4B3TI 1NHIA 3Q6MA 4XTJA 2BM0A 3GMEA 4DXLA 2Z5BA 3PS1A 4B3SE 3P76A 2BA0G 2Z5EA 1USVA 5A2QQ 3J80C 4JYAI 2NN6D 1FJGE 4JI6E 3D4JA 2WNRB 2ZITA 5LMNE 4P52A 1HNXI 4PU9A 4WUBA 3U1YA 1ELOA 5K36A 5C0XA 1B62A 4DPYA 1UDOA 1DARA 1RREA 5GMDA 4NBQA 3P06A 3B4TA 3U1KA 3M85G 3V5RA 4DV5I 4NXME 4IZJD 4PRVA 2ZM6E 3NZKA 4MU3A 4DV1I 4FW9A 5JEAA 4DV4I 4LF8I 2GS8A 4DR6I 2HFSA 4DR4I 4IS9A 4DV0I 4WUDA 2J7KA 2JE6A 5K36E 5EL9A 1J5EI 1Y4SA 4IFDD 4FWHA 2AE8A 2Z5BB 3WU3A 1OYPA 3WU5A 1N36E 3K17A 4KHPI 1N32I 4FW6A 2OI2A 4DV7I 5C0XF 2HK3A 5IT9C 1IBKE 1VISA 4I3HA 3K1JA 5JEAE 1S16A 1Z0TA 2UXCE 2EFGA 2UUBE 3J7AG 5K36B 5C0XB 4Z7YA 1XNQI 2JT2A 4JI3I 2HFUA 5JEAF 4DV6E 2UUCI 1YHCA 4K0KE 4FN5A 1PIEA 1PVGA 2O1UA 3L7ZA 3T1YE 5JEAB 4JI2I 4X64E 2O3ZA 2IERA 3ZZUA 2VQEI 2JE6B 5ELWA 2WP8B 1XXEA 1IBMI 2V8PA 4JYAE 4OO1D 4MU0A 4DR7I 1XHKA 3T1HI 1N0VC 4X62E 4JI8I 2O1TA 3QT8A 1Z5AA 4P7AA 4U3DA 4B3RI 1Z0EA 4WUCA 3J81C 4OKGA 3ZZ0A 1I94I 2VF3A 2C38A 2BA0D 5BR8I 2HHHI 2AJ4A 1HNZI 2UXDE 1R6LA 1PKPA 4J3DA 2IOPA 4QNJA 1UEKA 2UU9I 2O1VA 1Z5CA 4DV1E 2E5LE 1ZM3A 4FW5A 1OYRA 4ED4A 4LF8E 1Z5BA 1HR0E 4JI7I 3H4LA 4IZKB 4MDTA 4EMDA 4JI5I 2R3VA 4DPXA 4GKKI 4LF5E 4HYMA 3L7ZB 3B78A 1N33I 2PO2A 4DV2I 1NHHA 1Y6ZA 4BA1A 3M85D 4DV3I 4YHHI 2UXBI 4YY3I 3JAMQ 5EKWA 4OX9I 1QZRA 2NN6E 2JEBB 1K47A 4DV7E 4LFAI 4MQYA 3GONA 4QNKA 1IBLI 3Q1QA 3WU6A 4Z7CA 5LL6R 4LCHA 4FW7A 1S4EA 3P3GA 2Q2EB 5FWKA 4JI4I 4LFBI 4LFCE
chains in the Genus database with same CATH topology
3ZKBA 1EI1A 1XMOE 2VQFI 1U2RA 3QT6A 1NZ0A 4JI3E 4LF6I 3PYDA 2UUCE 4DR3E 4AQYI 3ZZTA 2CZ9A 4DR1I 4LF4I 1H74A 4DU7A 2F4VI 1FWLA 4DUYI 3F0NA 4FWGA 1H7UA 4USKA 4DR5I 1ZM4A 4X65I 4JV5I 2VQEE 4DUZI 1N0UA 2UUAI 1RR9A 4B3MI 4HY1A 1IBME 1N34I 4URLA 1H72C 3T1HE 5IWAI 1XMQE 4IZJB 4JI8E 5A2QC 3M6AA 2HK2A 2V2VA 3B8HA 4R1FA 2DEIA 2Z5CB 2HHHE 3LPSA 4DPWA 2IOQA 1HNZE 4LF7E 4JI0I 1FJGI 3CWVA 2UU9E 1NHJA 1KIJA 4GKJI 4IZKA 4B3TE 4NXNI 4JI5E 2HKEA 1XNRI 1Z0CA 3J7AM 3OTOI 2HKJA 1N33E 4ZVIA 4DV3E 4NXMI 5LMUI 1ZXNA 2V2QA 4YY3E 2A2DA 4OX9E 4FWDA 4LFAE 2CGEA 1HNXE 2BV3A 3Q6NA 1MU5A 4UTGA 4JI1I 4DV5E 1ZM9A 1OJ4A 4AQYE 2ZBKB 4DR1E 4DV4E 2A2CA 2F4VE 4UT4A 1IBKI 4DUYE 4DR6E 1KTVA 4DR4E 4DV0E 4LF9I 1J5EE 2XEXA 4DR5E 2UUBI 1FKAE 4JV5E 4DU8A 2UUAE 3K85A 1Z59A 2NPFA 2CG9A 1N34E 4USMA 4HACB 4KHPE 5L3JA 4IZJA 1N32E 5IWAE 1Z0BA 1Z0VA 1B63A 2E1RA 3T1YI 2Z5CA 2GQ0A 4DR2I 3PYEA 4X64I 4MYTA 4DPTA 5IT9Q 4JI0E 3LTOA 1MG7A 4X62I 4GKJE 2O1WA 4PRXA 4NXNE 3HJCA 4JI2E 2LJPA 1XNRE 4MYUA 1KVKA 3ZKDA 3OTOE 1A6FA 4JG4A 2UXDI 4X66I 2X36A 5LMUE 4DR7E 1HNWI 2E5LI 3HULA 1BKNA 1HR0I 4B3RE 4DPUA 3JAMC 2V34A 5FLXQ 2X7IA 4B3SI 4LF5I 2DEJA 1I94E 1MX0A 5BR8E 4JI1E 1ZXMA 3V2UC 1Z0WA 4JI6I 3J81Q 5LMNI 1Z0GA 1XNQE 1EA6A 4JI7E 2BM1A 4LF9E 1WUUA 4RPFA 4GKKE 4LFCI 2WW4A 4HACA 4DV2E 2PNMA 4KQVA 1XMOI 4M1KA 4YHHE 2V2ZA 2UXBE 2R42A 3QT5A 1KKHA 2ZM6I 4DR3I 1H73A 3PYFA 1IBLE 3ZM7A 1FNMA 3PRYA 3J80Q 1D6TA 4DR2E 4JI4E 4LFBE 3B82A 3LNUA 5FLXC 2VQFE 1N36I 4LF6E 4N3OA 1Y4UA 1FWKA 2PNLA 1XMQI 3PYGA 4LF4E 1FI4A 2UXCI 4X65E 1USUA 1HK7A 4DUZE 4B3ME 4X66E 3WU4A 4LF7I 4HXZA 1ZM2A 1HNWE 4DV6I 3QT7A 1H7SA 4K0KI 5GMEA 4B3TI 1NHIA 3Q6MA 4XTJA 2BM0A 4DXLA 2Z5BA 4B3SE 2Z5EA 1USVA 5A2QQ 3J80C 4JYAI 1FJGE 4JI6E 3D4JA 2ZITA 5LMNE 4P52A 1HNXI 4PU9A 4WUBA 1ELOA 1B62A 4DPYA 1DARA 1RREA 5GMDA 3P06A 3V5RA 4DV5I 4NXME 4IZJD 4PRVA 2ZM6E 4DV1I 4FW9A 4DV4I 4LF8I 2GS8A 4DR6I 2HFSA 4DR4I 4DV0I 4WUDA 2J7KA 1J5EI 1Y4SA 4FWHA 2Z5BB 3WU3A 3WU5A 1N36E 3K17A 4KHPI 1N32I 2OI2A 4DV7I 2HK3A 5IT9C 1IBKE 1VISA 4I3HA 3K1JA 1S16A 1Z0TA 2UXCE 2EFGA 2UUBE 3J7AG 4Z7YA 1XNQI 4JI3I 2HFUA 4DV6E 2UUCI 4K0KE 4FN5A 1PIEA 1PVGA 2O1UA 3T1YE 4JI2I 4X64E 3ZZUA 2VQEI 1IBMI 2V8PA 4JYAE 4DR7I 1XHKA 3T1HI 1N0VC 4X62E 4JI8I 2O1TA 3QT8A 1Z5AA 4P7AA 4B3RI 1Z0EA 4WUCA 3J81C 3ZZ0A 1I94I 2VF3A 5BR8I 2HHHI 2AJ4A 1HNZI 2UXDE 1PKPA 2IOPA 1UEKA 2UU9I 2O1VA 1Z5CA 4DV1E 2E5LE 1ZM3A 4LF8E 4ED4A 1Z5BA 1HR0E 4JI7I 3H4LA 4IZKB 4EMDA 4JI5I 2R3VA 4DPXA 4GKKI 4LF5E 4HYMA 3B78A 1N33I 4DV2I 1NHHA 1Y6ZA 4DV3I 4YHHI 2UXBI 4YY3I 3JAMQ 4OX9I 1QZRA 1K47A 4DV7E 4LFAI 3GONA 1IBLI 3Q1QA 3WU6A 4Z7CA 5LL6R 1S4EA 5FWKA 2Q2EB 4JI4I 4LFBI 4LFCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZKB A;  1EI1 A;  1XMO E;  2VQF I;  1U2R A;  3QT6 A;  1NZ0 A;  4JI3 E;  4LF6 I;  3PYD A;  2UUC E;  4DR3 E;  4AQY I;  3ZZT A;  2CZ9 A;  4DR1 I;  4LF4 I;  1H74 A;  4DU7 A;  2F4V I;  1FWL A;  4DUY I;  3F0N A;  4FWG A;  1H7U A;  4USK A;  4DR5 I;  1ZM4 A;  4X65 I;  4JV5 I;  2VQE E;  4DUZ I;  1N0U A;  2UUA I;  1RR9 A;  4B3M I;  4HY1 A;  1IBM E;  1N34 I;  4URL A;  1H72 C;  3T1H E;  5IWA I;  1XMQ E;  4JI8 E;  5A2Q C;  3M6A A;  2HK2 A;  2V2V A;  3B8H A;  4R1F A;  2DEI A;  2HHH E;  1HNZ E;  3LPS A;  4DPW A;  4LF7 E;  4JI0 I;  1FJG I;  3CWV A;  2UU9 E;  1NHJ A;  1KIJ A;  4GKJ I;  4B3T E;  4NXN I;  4JI5 E;  2HKE A;  1XNR I;  1Z0C A;  3J7A M;  3OTO I;  2HKJ A;  1N33 E;  4ZVI A;  4DV3 E;  4NXM I;  5LMU I;  1ZXN A;  2V2Q A;  4YY3 E;  2A2D A;  4OX9 E;  4FWD A;  4LFA E;  1HNX E;  2BV3 A;  1MU5 A;  4UTG A;  4JI1 I;  4DV5 E;  1ZM9 A;  1OJ4 A;  4AQY E;  2ZBK B;  4DR1 E;  4DV4 E;  2A2C A;  2F4V E;  4UT4 A;  1IBK I;  4DUY E;  4DR6 E;  1KTV A;  4DR4 E;  4DV0 E;  4LF9 I;  1J5E E;  2XEX A;  4DR5 E;  2UUB I;  1FKA E;  4JV5 E;  4DU8 A;  2UUA E;  1Z59 A;  2NPF A;  1N34 E;  4USM A;  4HAC B;  4KHP E;  5L3J A;  1N32 E;  5IWA E;  1Z0B A;  1Z0V A;  1B63 A;  2E1R A;  3T1Y I;  4DR2 I;  3PYE A;  4X64 I;  4MYT A;  4DPT A;  5IT9 Q;  4JI0 E;  3LTO A;  1MG7 A;  4X62 I;  4GKJ E;  4PRX A;  4NXN E;  4JI2 E;  2LJP A;  1XNR E;  4MYU A;  1KVK A;  3ZKD A;  3OTO E;  1A6F A;  4JG4 A;  2UXD I;  4X66 I;  2X36 A;  5LMU E;  4DR7 E;  1HNW I;  2E5L I;  3HUL A;  1BKN A;  1HR0 I;  4B3R E;  4DPU A;  3JAM C;  2V34 A;  5FLX Q;  2X7I A;  4B3S I;  4LF5 I;  2DEJ A;  1I94 E;  1MX0 A;  5BR8 E;  4JI1 E;  1ZXM A;  3V2U C;  1Z0W A;  4JI6 I;  3J81 Q;  5LMN I;  1Z0G A;  1XNQ E;  1EA6 A;  4JI7 E;  2BM1 A;  4LF9 E;  1WUU A;  4RPF A;  4GKK E;  4LFC I;  2WW4 A;  4HAC A;  4DV2 E;  4KQV A;  1XMO I;  4M1K A;  4YHH E;  2V2Z A;  2UXB E;  2R42 A;  3QT5 A;  1KKH A;  2ZM6 I;  4DR3 I;  1H73 A;  3PYF A;  1IBL E;  3ZM7 A;  1FNM A;  3J80 Q;  1D6T A;  4DR2 E;  4JI4 E;  4LFB E;  3B82 A;  3LNU A;  5FLX C;  2VQF E;  1N36 I;  4LF6 E;  1FWK A;  1XMQ I;  3PYG A;  4LF4 E;  1FI4 A;  2UXC I;  4X65 E;  4DUZ E;  4B3M E;  4X66 E;  3WU4 A;  4LF7 I;  4HXZ A;  1ZM2 A;  1HNW E;  4DV6 I;  3QT7 A;  1H7S A;  4K0K I;  5GME A;  4B3T I;  1NHI A;  4XTJ A;  2BM0 A;  4DXL A;  4B3S E;  5A2Q Q;  3J80 C;  4JYA I;  1FJG E;  4JI6 E;  3D4J A;  2ZIT A;  5LMN E;  4P52 A;  1HNX I;  4PU9 A;  4WUB A;  1ELO A;  1B62 A;  4DPY A;  1DAR A;  1RRE A;  5GMD A;  3V5R A;  4DV5 I;  4NXM E;  4PRV A;  2ZM6 E;  4DV1 I;  4FW9 A;  4DV4 I;  4LF8 I;  2GS8 A;  4DR6 I;  2HFS A;  4DR4 I;  4DV0 I;  4WUD A;  2J7K A;  1J5E I;  4FWH A;  3WU3 A;  3WU5 A;  1N36 E;  3K17 A;  4KHP I;  1N32 I;  2OI2 A;  4DV7 I;  2HK3 A;  5IT9 C;  1IBK E;  1VIS A;  4I3H A;  3K1J A;  1S16 A;  1Z0T A;  2UXC E;  2EFG A;  2UUB E;  3J7A G;  4Z7Y A;  1XNQ I;  4JI3 I;  2HFU A;  4DV6 E;  2UUC I;  4K0K E;  4FN5 A;  1PIE A;  1PVG A;  3T1Y E;  4JI2 I;  4X64 E;  3ZZU A;  2VQE I;  1IBM I;  2V8P A;  4JYA E;  4DR7 I;  1XHK A;  3T1H I;  1N0V C;  4X62 E;  4JI8 I;  3QT8 A;  1Z5A A;  4P7A A;  4B3R I;  1Z0E A;  4WUC A;  3J81 C;  3ZZ0 A;  1I94 I;  2VF3 A;  5BR8 I;  2HHH I;  2AJ4 A;  1HNZ I;  2UXD E;  1PKP A;  1UEK A;  2UU9 I;  1Z5C A;  4DV1 E;  2E5L E;  1ZM3 A;  4LF8 E;  4ED4 A;  1Z5B A;  1HR0 E;  4JI7 I;  3H4L A;  4EMD A;  4JI5 I;  2R3V A;  4DPX A;  4GKK I;  4LF5 E;  4HYM A;  3B78 A;  1N33 I;  4DV2 I;  1NHH A;  4DV3 I;  4YHH I;  2UXB I;  4YY3 I;  3JAM Q;  4OX9 I;  1QZR A;  1K47 A;  4DV7 E;  4LFA I;  3GON A;  1IBL I;  3Q1Q A;  3WU6 A;  4Z7C A;  5LL6 R;  1S4E A;  4JI4 I;  2Q2E B;  4LFB I;  4LFC E; 
#chains in the Genus database with same CATH topology
 4AIM A;  3ZKB A;  1EI1 A;  1XMO E;  2PNZ A;  2VQF I;  1U2R A;  2C38 B;  1NZ0 A;  3QT6 A;  1E3H A;  4JI3 E;  4LF6 I;  4AM3 A;  3PYD A;  3P3E A;  2UUC E;  4DR3 E;  4AQY I;  3ZZT A;  2CZ9 A;  2NN6 B;  4LOM A;  4DR1 I;  4LF4 I;  1H74 A;  4DU7 A;  2F4V I;  1FWL A;  4DUY I;  3F0N A;  5K36 C;  5C0X C;  4FWG A;  1H7U A;  4USK A;  2WP8 A;  4DR5 I;  1ZM4 A;  4X65 I;  4JV5 I;  2VQE E;  4DUZ I;  1N0U A;  2UUA I;  1RR9 A;  4B3M I;  4HY1 A;  2C39 B;  4IFD E;  1IBM E;  1N34 I;  3UHM A;  4URL A;  1H72 C;  2PO2 B;  3T1H E;  5IWA I;  4LCF A;  5DRO A;  1XMQ E;  4BA1 B;  3H1C A;  5K36 F;  4IZJ B;  2PO0 B;  4JI8 E;  5A2Q C;  1UDS A;  5JEA C;  3M6A A;  5C0X D;  2HK2 A;  4AID A;  2V2V A;  3B8H A;  4R1F A;  2DEI A;  2Z5C B;  2HHH E;  3LPS A;  4DPW A;  2IOQ A;  2GO4 A;  1HNZ E;  4IFD B;  4LF7 E;  3PS2 A;  4JI0 I;  1FJG I;  2BR2 B;  3CWV A;  2UU9 E;  2PNZ B;  1NHJ A;  1KIJ A;  4GKJ I;  4IZK A;  5DRP A;  5JEA D;  4B3T E;  4NXN I;  3M7N G;  4JI5 E;  4BA2 B;  2HKE A;  1XNR I;  1Z0C A;  3J7A M;  3OTO I;  2HKJ A;  1N33 E;  4ZVI A;  4DV3 E;  2JEB A;  4NXM I;  5LMU I;  1ZXN A;  2V2Q A;  4YY3 E;  2A2D A;  1P42 A;  4OX9 E;  1OYS A;  4OO1 E;  4FWD A;  4LFA E;  1YH8 A;  2CGE A;  1HNX E;  3KRN A;  2BV3 A;  2JEA B;  3Q6N A;  2J65 A;  1MU5 A;  4UTG A;  4JI1 I;  4DV5 E;  1ZM9 A;  1OJ4 A;  2NN6 A;  4AQY E;  2ZBK B;  4DR1 E;  4OO1 B;  4DV4 E;  2A2C A;  2F4V E;  4UT4 A;  1IBK I;  4DUY E;  4DR6 E;  1KTV A;  4DR4 E;  4DV0 E;  4LF9 I;  1Y60 A;  1J5E E;  2XEX A;  2C39 A;  4DR5 E;  2UUB I;  1FKA E;  4OZE A;  4DU8 A;  4JV5 E;  2UUA E;  3K85 A;  1Z59 A;  2NPF A;  2CG9 A;  1N34 E;  4USM A;  4HAC B;  4KHP E;  5L3J A;  2PO0 A;  4IZJ A;  1N32 E;  2NN6 C;  5IWA E;  1Z0B A;  1UDN A;  3P3C A;  1Z0V A;  1B63 A;  4MU4 A;  2E1R A;  3T1Y I;  2Z5C A;  2GQ0 A;  5DRR A;  4DR2 I;  3PYE A;  4X64 I;  4IFD A;  2NN6 F;  5DNL A;  2BR2 A;  4MYT A;  4DPT A;  5IT9 Q;  4JI0 E;  3LTO A;  2C37 B;  1MG7 A;  4X62 I;  4GKJ E;  2BA1 G;  4BA2 A;  2O1W A;  4PRX A;  4NXN E;  3HJC A;  4JI2 E;  2LJP A;  1XNR E;  4MYU A;  2F1D A;  1KVK A;  2GO3 A;  3ZKD A;  1E3P A;  3OTO E;  1A6F A;  5DRQ A;  4IFD C;  4JG4 A;  2UXD I;  1RHY A;  3GCM A;  4X66 I;  2X36 A;  5LMU E;  4DR7 E;  4LPF A;  1HNW I;  2VES A;  2E5L I;  3HUL A;  1BKN A;  2JEA A;  4GQU A;  1HR0 I;  4B3R E;  4DPU A;  5K36 D;  3JAM C;  2V34 A;  4IFD F;  3M7N D;  5FLX Q;  2X7I A;  5C0X E;  4U3B A;  2PO1 A;  4B3S I;  4LF5 I;  2DEJ A;  1I94 E;  1MX0 A;  5BR8 E;  3GLL A;  2IES A;  4JI1 E;  3CDI A;  4FW3 A;  1ZXM A;  3V2U C;  3CDJ A;  4OO1 A;  1Z0W A;  4JI6 I;  3J81 Q;  4LCG A;  4FW4 A;  5LMN I;  1Z0G A;  1XNQ E;  1EA6 A;  4JI7 E;  2BM1 A;  4LF9 E;  1WUU A;  4RPF A;  4GKK E;  1Y5Y A;  1VI7 A;  3HKM A;  4LFC I;  2WW4 A;  4HAC A;  2CVE A;  4DV2 E;  2PNM A;  4KQV A;  1XMO I;  4M1K A;  4YHH E;  2V2Z A;  4ISA A;  2UXB E;  2R42 A;  3QT5 A;  4OO1 C;  1KKH A;  2ZM6 I;  5DNX A;  4DR3 I;  1H73 A;  3PYF A;  1IBL E;  3ZM7 A;  3PS3 A;  1R6M A;  1FNM A;  3PRY A;  3J80 Q;  1D6T A;  4DR2 E;  4JI4 E;  4LFB E;  3B82 A;  4OO1 F;  3LNU A;  2C37 A;  2WNR A;  2PO1 B;  5FLX C;  2VQF E;  1N36 I;  4LF6 E;  4N3O A;  1Y4U A;  1FWK A;  2PNL A;  1XMQ I;  3PYG A;  4LF4 E;  1FI4 A;  3DD6 A;  2UXC I;  4X65 E;  1USU A;  1HK7 A;  4DUZ E;  4B3M E;  4X66 E;  3WU4 A;  4LF7 I;  4HXZ A;  1ZM2 A;  1HNW E;  4DV6 I;  3QT7 A;  1H7S A;  4K0K I;  4MU1 A;  2BA1 D;  5GME A;  1UDQ A;  4B3T I;  1NHI A;  3Q6M A;  4XTJ A;  2BM0 A;  3GME A;  4DXL A;  2Z5B A;  3PS1 A;  4B3S E;  3P76 A;  2BA0 G;  2Z5E A;  1USV A;  5A2Q Q;  3J80 C;  4JYA I;  2NN6 D;  1FJG E;  4JI6 E;  3D4J A;  2WNR B;  2ZIT A;  5LMN E;  4P52 A;  1HNX I;  4PU9 A;  4WUB A;  3U1Y A;  1ELO A;  5K36 A;  5C0X A;  1B62 A;  4DPY A;  1UDO A;  1DAR A;  1RRE A;  5GMD A;  4NBQ A;  3P06 A;  3B4T A;  3U1K A;  3M85 G;  3V5R A;  4DV5 I;  4NXM E;  4IZJ D;  4PRV A;  2ZM6 E;  3NZK A;  4MU3 A;  4DV1 I;  4FW9 A;  5JEA A;  4DV4 I;  4LF8 I;  2GS8 A;  4DR6 I;  2HFS A;  4DR4 I;  4IS9 A;  4DV0 I;  4WUD A;  2J7K A;  2JE6 A;  5K36 E;  5EL9 A;  1J5E I;  1Y4S A;  4IFD D;  4FWH A;  2AE8 A;  2Z5B B;  3WU3 A;  1OYP A;  3WU5 A;  1N36 E;  3K17 A;  4KHP I;  1N32 I;  4FW6 A;  2OI2 A;  4DV7 I;  5C0X F;  2HK3 A;  5IT9 C;  1IBK E;  1VIS A;  4I3H A;  3K1J A;  5JEA E;  1S16 A;  1Z0T A;  2UXC E;  2EFG A;  2UUB E;  3J7A G;  5K36 B;  5C0X B;  4Z7Y A;  1XNQ I;  2JT2 A;  4JI3 I;  2HFU A;  5JEA F;  4DV6 E;  2UUC I;  1YHC A;  4K0K E;  4FN5 A;  1PIE A;  1PVG A;  2O1U A;  3L7Z A;  3T1Y E;  5JEA B;  4JI2 I;  4X64 E;  2O3Z A;  2IER A;  3ZZU A;  2VQE I;  2JE6 B;  5ELW A;  2WP8 B;  1XXE A;  1IBM I;  2V8P A;  4JYA E;  4OO1 D;  4MU0 A;  4DR7 I;  1XHK A;  3T1H I;  1N0V C;  4X62 E;  4JI8 I;  2O1T A;  3QT8 A;  1Z5A A;  4P7A A;  4U3D A;  4B3R I;  1Z0E A;  4WUC A;  3J81 C;  4OKG A;  3ZZ0 A;  1I94 I;  2VF3 A;  2C38 A;  2BA0 D;  5BR8 I;  2HHH I;  2AJ4 A;  1HNZ I;  2UXD E;  1R6L A;  1PKP A;  4J3D A;  2IOP A;  4QNJ A;  1UEK A;  2UU9 I;  2O1V A;  1Z5C A;  4DV1 E;  2E5L E;  1ZM3 A;  4FW5 A;  1OYR A;  4ED4 A;  4LF8 E;  1Z5B A;  1HR0 E;  4JI7 I;  3H4L A;  4IZK B;  4MDT A;  4EMD A;  4JI5 I;  2R3V A;  4DPX A;  4GKK I;  4LF5 E;  4HYM A;  3L7Z B;  3B78 A;  1N33 I;  2PO2 A;  4DV2 I;  1NHH A;  1Y6Z A;  4BA1 A;  3M85 D;  4DV3 I;  4YHH I;  2UXB I;  4YY3 I;  3JAM Q;  5EKW A;  4OX9 I;  1QZR A;  2NN6 E;  2JEB B;  1K47 A;  4DV7 E;  4LFA I;  4MQY A;  3GON A;  4QNK A;  1IBL I;  3Q1Q A;  3WU6 A;  4Z7C A;  5LL6 R;  4LCH A;  4FW7 A;  1S4E A;  3P3G A;  2Q2E B;  5FWK A;  4JI4 I;  4LFB I;  4LFC E; 
#chains in the Genus database with same CATH homology
 3ZKB A;  1EI1 A;  1XMO E;  2VQF I;  1U2R A;  3QT6 A;  1NZ0 A;  4JI3 E;  4LF6 I;  3PYD A;  2UUC E;  4DR3 E;  4AQY I;  3ZZT A;  2CZ9 A;  4DR1 I;  4LF4 I;  1H74 A;  4DU7 A;  2F4V I;  1FWL A;  4DUY I;  3F0N A;  4FWG A;  1H7U A;  4USK A;  4DR5 I;  1ZM4 A;  4X65 I;  4JV5 I;  2VQE E;  4DUZ I;  1N0U A;  2UUA I;  1RR9 A;  4B3M I;  4HY1 A;  1IBM E;  1N34 I;  4URL A;  1H72 C;  3T1H E;  5IWA I;  1XMQ E;  4IZJ B;  4JI8 E;  5A2Q C;  3M6A A;  2HK2 A;  2V2V A;  3B8H A;  4R1F A;  2DEI A;  2Z5C B;  2HHH E;  3LPS A;  4DPW A;  2IOQ A;  1HNZ E;  4LF7 E;  4JI0 I;  1FJG I;  3CWV A;  2UU9 E;  1NHJ A;  1KIJ A;  4GKJ I;  4IZK A;  4B3T E;  4NXN I;  4JI5 E;  2HKE A;  1XNR I;  1Z0C A;  3J7A M;  3OTO I;  2HKJ A;  1N33 E;  4ZVI A;  4DV3 E;  4NXM I;  5LMU I;  1ZXN A;  2V2Q A;  4YY3 E;  2A2D A;  4OX9 E;  4FWD A;  4LFA E;  2CGE A;  1HNX E;  2BV3 A;  3Q6N A;  1MU5 A;  4UTG A;  4JI1 I;  4DV5 E;  1ZM9 A;  1OJ4 A;  4AQY E;  2ZBK B;  4DR1 E;  4DV4 E;  2A2C A;  2F4V E;  4UT4 A;  1IBK I;  4DUY E;  4DR6 E;  1KTV A;  4DR4 E;  4DV0 E;  4LF9 I;  1J5E E;  2XEX A;  4DR5 E;  2UUB I;  1FKA E;  4JV5 E;  4DU8 A;  2UUA E;  3K85 A;  1Z59 A;  2NPF A;  2CG9 A;  1N34 E;  4USM A;  4HAC B;  4KHP E;  5L3J A;  4IZJ A;  1N32 E;  5IWA E;  1Z0B A;  1Z0V A;  1B63 A;  2E1R A;  3T1Y I;  2Z5C A;  2GQ0 A;  4DR2 I;  3PYE A;  4X64 I;  4MYT A;  4DPT A;  5IT9 Q;  4JI0 E;  3LTO A;  1MG7 A;  4X62 I;  4GKJ E;  2O1W A;  4PRX A;  4NXN E;  3HJC A;  4JI2 E;  2LJP A;  1XNR E;  4MYU A;  1KVK A;  3ZKD A;  3OTO E;  1A6F A;  4JG4 A;  2UXD I;  4X66 I;  2X36 A;  5LMU E;  4DR7 E;  1HNW I;  2E5L I;  3HUL A;  1BKN A;  1HR0 I;  4B3R E;  4DPU A;  3JAM C;  2V34 A;  5FLX Q;  2X7I A;  4B3S I;  4LF5 I;  2DEJ A;  1I94 E;  1MX0 A;  5BR8 E;  4JI1 E;  1ZXM A;  3V2U C;  1Z0W A;  4JI6 I;  3J81 Q;  5LMN I;  1Z0G A;  1XNQ E;  1EA6 A;  4JI7 E;  2BM1 A;  4LF9 E;  1WUU A;  4RPF A;  4GKK E;  4LFC I;  2WW4 A;  4HAC A;  4DV2 E;  2PNM A;  4KQV A;  1XMO I;  4M1K A;  4YHH E;  2V2Z A;  2UXB E;  2R42 A;  3QT5 A;  1KKH A;  2ZM6 I;  4DR3 I;  1H73 A;  3PYF A;  1IBL E;  3ZM7 A;  1FNM A;  3PRY A;  3J80 Q;  1D6T A;  4DR2 E;  4JI4 E;  4LFB E;  3B82 A;  3LNU A;  5FLX C;  2VQF E;  1N36 I;  4LF6 E;  4N3O A;  1Y4U A;  1FWK A;  2PNL A;  1XMQ I;  3PYG A;  4LF4 E;  1FI4 A;  2UXC I;  4X65 E;  1USU A;  1HK7 A;  4DUZ E;  4B3M E;  4X66 E;  3WU4 A;  4LF7 I;  4HXZ A;  1ZM2 A;  1HNW E;  4DV6 I;  3QT7 A;  1H7S A;  4K0K I;  5GME A;  4B3T I;  1NHI A;  3Q6M A;  4XTJ A;  2BM0 A;  4DXL A;  2Z5B A;  4B3S E;  2Z5E A;  1USV A;  5A2Q Q;  3J80 C;  4JYA I;  1FJG E;  4JI6 E;  3D4J A;  2ZIT A;  5LMN E;  4P52 A;  1HNX I;  4PU9 A;  4WUB A;  1ELO A;  1B62 A;  4DPY A;  1DAR A;  1RRE A;  5GMD A;  3P06 A;  3V5R A;  4DV5 I;  4NXM E;  4IZJ D;  4PRV A;  2ZM6 E;  4DV1 I;  4FW9 A;  4DV4 I;  4LF8 I;  2GS8 A;  4DR6 I;  2HFS A;  4DR4 I;  4DV0 I;  4WUD A;  2J7K A;  1J5E I;  1Y4S A;  4FWH A;  2Z5B B;  3WU3 A;  3WU5 A;  1N36 E;  3K17 A;  4KHP I;  1N32 I;  2OI2 A;  4DV7 I;  2HK3 A;  5IT9 C;  1IBK E;  1VIS A;  4I3H A;  3K1J A;  1S16 A;  1Z0T A;  2UXC E;  2EFG A;  2UUB E;  3J7A G;  4Z7Y A;  1XNQ I;  4JI3 I;  2HFU A;  4DV6 E;  2UUC I;  4K0K E;  4FN5 A;  1PIE A;  1PVG A;  2O1U A;  3T1Y E;  4JI2 I;  4X64 E;  3ZZU A;  2VQE I;  1IBM I;  2V8P A;  4JYA E;  4DR7 I;  1XHK A;  3T1H I;  1N0V C;  4X62 E;  4JI8 I;  2O1T A;  3QT8 A;  1Z5A A;  4P7A A;  4B3R I;  1Z0E A;  4WUC A;  3J81 C;  3ZZ0 A;  1I94 I;  2VF3 A;  5BR8 I;  2HHH I;  2AJ4 A;  1HNZ I;  2UXD E;  1PKP A;  2IOP A;  1UEK A;  2UU9 I;  2O1V A;  1Z5C A;  4DV1 E;  2E5L E;  1ZM3 A;  4LF8 E;  4ED4 A;  1Z5B A;  1HR0 E;  4JI7 I;  3H4L A;  4IZK B;  4EMD A;  4JI5 I;  2R3V A;  4DPX A;  4GKK I;  4LF5 E;  4HYM A;  3B78 A;  1N33 I;  4DV2 I;  1NHH A;  1Y6Z A;  4DV3 I;  4YHH I;  2UXB I;  4YY3 I;  3JAM Q;  4OX9 I;  1QZR A;  1K47 A;  4DV7 E;  4LFA I;  3GON A;  1IBL I;  3Q1Q A;  3WU6 A;  4Z7C A;  5LL6 R;  1S4E A;  5FWK A;  2Q2E B;  4JI4 I;  4LFB I;  4LFC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...