1Z0EA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords Putative protease La homolog type
total genus 61
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0eA00
1XNRI 5LMUI 4FWGA 2A2CA 2ZITA 4B3TI 1FJGI 4DU7A 1FWLA 1A6FA 1HNXI 1ZM3A 3JAMC 4DR1I 3V5RA 1PKPA 2UXDI 4KHPE 1OJ4A 1IBLI 4ED4A 2VQFE 3OTOI 4DV2I 4LF4E 4WUDA 4GKJE 4DR5E 3K1JA 1H73A 4JI8E 4YY3I 1BKNA 2GS8A 4X62I 4EMDA 4DXLA 1KIJA 2VQEI 1IBME 4K0KI 2HK3A 4DV6E 5GMDA 4JI6I 3J80C 4DV5E 1Z0CA 4DR6I 1N33I 4LF4I 1K47A 3ZM7A 1UEKA 4JI4E 2VQFI 2HFUA 1U2RA 4JI2E 4USMA 1IBKE 4P52A 4JV5I 3ZKBA 3T1YI 3J81Q 2UUAE 5IWAE 4JI7I 1Z0VA 2X7IA 1NHHA 4FWHA 4GKJI 4WUBA 4LF8E 1HNWE 2V34A 5LMUE 1HR0E 3K17A 1XNRE 2NPFA 4DPUA 2DEJA 1I94E 1H7SA 4WUCA 1N32I 2E1RA 3T1YE 2UXDE 5BR8E 4DV7I 4DUZE 5A2QQ 4DUYI 4AQYI 1Z5BA 4DU8A 4JI2I 2UUBE 4LFBE 1FNMA 4GKKI 4DV0I 1XMQE 4LFAE 2F4VE 1H74A 1XNQI 2V2ZA 4JI3E 2DEIA 4JI6E 5LL6R 2F4VI 4M1KA 1XMQI 4DR3I 4LFAI 1Z59A 4Z7CA 2UXCE 4RPFA 1Z0EA 2UUBI 2VQEE 4DPYA 2E5LE 1N34I 2HHHI 4B3RI 4DUZI 4HY1A 5BR8I 4XTJA 4DR3E 5IT9Q 4X64I 4LFCI 4YY3E 2UUCE 3JAMQ 3V2UC 3B78A 3ZZTA 1N36I 1ZM9A 4LF8I 1XMOE 4B3SE 3PYFA 4X65E 4DPXA 4JYAE 1IBLE 2WW4A 2V8PA 4DV7E 2UU9I 2CZ9A 1HNXE 4X65I 3ZKDA 4KQVA 2HK2A 1FJGE 2HFSA 1B63A 1N0UA 4R1FA 1HNWI 1Z0BA 3QT7A 4UT4A 4UTGA 4I3HA 1Z0WA 4FW9A 3J80Q 4DV6I 4JI0E 4Z7YA 3CWVA 1QZRA 1IBMI 2UXBI 2Q2EB 4LF9E 4LF9I 1DARA 2UXBE 1PVGA 1HNZE 4YHHI 4LF5E 4JI4I 1Z5CA 4LF7I 4HYMA 5LMNE 4JI5E 3Q1QA 4DR2I 3F0NA 3PYGA 4JI8I 4JI3I 2X36A 4DV4E 3J81C 4DR5I 4DV5I 1KVKA 4MYTA 5LMNI 3WU5A 4LF7E 3T1HI 4DV1I 4B3ME 1FI4A 1Z0GA 4NXMI 4DR7I 5FLXC 2ZM6E 3ZZUA 4KHPI 4MYUA 4DV3I 3LPSA 4JI1I 3B82A 3M6AA 3PYDA 4DPWA 4NXNE 1S16A 3LNUA 1H72C 4FN5A 1J5EI 1WUUA 2HKJA 1ELOA 4DV2E 1N36E 3OTOE 2OI2A 4NXNI 4PRVA 4DPTA 2UUAI 1RREA 4JI1E 4DV3E 2HKEA 3QT6A 4NXME 4X66I 3J7AM 2R42A 2AJ4A 4B3SI 4DV1E 1S4EA 1XMOI 2LJPA 4JG4A 1J5EE 4OX9I 1NZ0A 4DR4I 3QT8A 4B3TE 3HULA 2BM1A 3WU4A 5IT9C 2V2VA 4DV0E 4LFBI 1N34E 4YHHE 3ZZ0A 3GONA 2ZM6I 1FWKA 4DR7E 1ZM4A 4X62E 1ZM2A 2UXCI 1ZXMA 4JI0I 1N32E 1B62A 1I94I 4P7AA 2BV3A 2ZBKB 4USKA 1Z5AA 2A2DA 1HR0I 3LTOA 4ZVIA 4DR2E 4OX9E 2J7KA 4JI5I 1MU5A 4HACB 1D6TA 3PYEA 4X66E 1H7UA 5IWAI 4DUYE 4AQYE 4URLA 4LF6E 4DR1E 4FWDA 1IBKI 2VF3A 5L3JA 1NHIA 2BM0A 1NHJA 1KKHA 1XHKA 1EI1A 4DR6E 1ZXNA 2EFGA 4PRXA 1PIEA 4JI7E 2UUCI 5GMEA 3J7AG 2UU9E 4LF6I 4HXZA 4K0KE 4JV5E 2HHHE 2E5LI 4JYAI 3WU6A 3H4LA 1N0VC 3QT5A 4PU9A 3T1HE 1EA6A 1RR9A 1Z0TA 3B8HA 4B3MI 1VISA 1N33E 2XEXA 5FLXQ 4DV4I 5A2QC 4LFCE 4X64E 4DR4E 1MG7A 3D4JA 2V2QA 4GKKE 4B3RE 4LF5I 3WU3A 1HNZI 4HACA 2R3VA 1MX0A 1KTVA 1FKAE 1XNQE
chains in the Genus database with same CATH superfamily
1XNRI 3L7ZA 5LMUI 4FWGA 4IFDC 2A2CA 2CG9A 2ZITA 4B3TI 2J65A 4IZKA 2JT2A 1Y60A 1FJGI 4DU7A 2O1TA 1FWLA 2C37A 1A6FA 4N3OA 1HNXI 1ZM3A 3NZKA 1VI7A 3JAMC 3V5RA 4DR1I 1PKPA 2UXDI 4FW4A 4KHPE 1OJ4A 1IBLI 2CVEA 4ED4A 2VQFE 4AM3A 3OTOI 4DV2I 5C0XE 4LF4E 4WUDA 4GKJE 4DR5E 3K1JA 1H73A 5K36A 1Y5YA 4JI8E 4YY3I 1BKNA 2O1WA 5EKWA 2GS8A 4X62I 2PNLA 4EMDA 2C39A 4DXLA 1KIJA 2VQEI 1IBME 2Z5CA 4K0KI 2GO4A 2BA1D 2HK3A 3M85G 4DV6E 5GMDA 2Z5BA 4JI6I 3J80C 4DV5E 4FW5A 2JEBA 3P3GA 1HK7A 5JEAD 1Z0CA 4DR6I 1N33I 4LF4I 1K47A 4IZJA 3ZM7A 4AIDA 5DNLA 1UEKA 1YH8A 4JI4E 2VQFI 2HFUA 1U2RA 4JI2E 1P42A 4USMA 1IBKE 4P52A 4JV5I 3KRNA 1OYRA 1XXEA 2IERA 2C37B 2PO0A 3ZKBA 3T1YI 3J81Q 2UUAE 4IFDE 5IWAE 4JI7I 1Z0VA 2X7IA 2JE6A 1NHHA 4LOMA 4FWHA 3P06A 4OO1E 2CGEA 4GKJI 4WUBA 4LF8E 1HNWE 2V34A 2IESA 5LMUE 1HR0E 3K17A 2IOQA 1XNRE 2NPFA 4DPUA 2PO1B 2DEJA 1I94E 1H7SA 4WUCA 1N32I 2E1RA 3T1YE 2UXDE 2NN6E 5BR8E 4DV7I 4DUZE 5A2QQ 3L7ZB 5K36B 4DUYI 4AQYI 1UDSA 1Z5BA 4DU8A 5JEAF 4JI2I 2UUBE 2F1DA 4LFBE 1FNMA 4GKKI 4DV0I 5C0XD 1XMQE 4LFAE 2F4VE 3PRYA 1H74A 5JEAB 2Z5CB 1XNQI 2V2ZA 3M7ND 4JI3E 2DEIA 2PO2B 4JI6E 5LL6R 2JEBB 2F4VI 4M1KA 1XMQI 4DR3I 4LFAI 5DRPA 1Z59A 4Z7CA 2UXCE 4QNKA 4RPFA 1Z0EA 2UUBI 2VQEE 4DPYA 4OKGA 2E5LE 1N34I 2HHHI 4OO1C 4B3RI 4FW3A 4DUZI 4HY1A 5EL9A 3M7NG 2PNZB 5BR8I 2BA0G 4XTJA 4DR3E 5IT9Q 4X64I 4LFCI 4YY3E 5DRQA 2UUCE 2VESA 4IFDD 3JAMQ 3V2UC 3B4TA 3B78A 3ZZTA 1N36I 4BA1A 1ZM9A 4U3BA 2C39B 4LF8I 3CDIA 1XMOE 4B3SE 3K85A 3PYFA 1UDOA 2BR2A 4X65E 2Z5BB 4DPXA 4JYAE 1IBLE 2WW4A 4MU1A 2V8PA 4DV7E 5K36D 5DROA 2UU9I 4IS9A 3DD6A 1RHYA 1Y4SA 2CZ9A 1HNXE 4X65I 4ISAA 3ZKDA 4KQVA 2HK2A 5DRRA 2JEAA 1FJGE 2HFSA 1B63A 1N0UA 4R1FA 1HNWI 1Z0BA 3QT7A 1E3PA 4MU3A 4UT4A 4UTGA 4I3HA 1Z0WA 2O3ZA 4FW9A 3J80Q 4DV6I 5JEAA 5DNXA 2JE6B 3U1KA 2IOPA 2NN6B 4JI0E 4IFDF 4Z7YA 3HKMA 3CWVA 1QZRA 2WNRA 1IBMI 3U1YA 2UXBI 2Q2EB 4LF9E 2WP8A 4LF9I 1DARA 2UXBE 1PVGA 1HNZE 4YHHI 4LF5E 4JI4I 1UDNA 1Z5CA 4LF7I 4HYMA 5LMNE 3P3EA 4JI5E 2PO1A 3Q1QA 4IFDB 3P76A 1E3HA 4DR2I 3F0NA 3PYGA 4JI8I 4JI3I 4LCFA 4BA2A 2X36A 4DV4E 3J81C 4DR5I 4DV5I 1KVKA 4MYTA 5C0XF 5FWKA 5LMNI 3WU5A 4LF7E 3T1HI 4DV1I 4B3ME 1FI4A 2NN6D 4BA1B 2BA1G 1Z0GA 5C0XA 4NXMI 4DR7I 1USVA 5FLXC 2ZM6E 3ZZUA 4KHPI 4MYUA 2Z5EA 2C38B 4DV3I 3LPSA 4JI1I 3B82A 5K36E 2BR2B 3M6AA 2PO2A 3PYDA 3CDJA 4DPWA 4NXNE 1S16A 3PS1A 3LNUA 1H72C 4FN5A 1J5EI 1WUUA 2HKJA 1ELOA 2GQ0A 2BA0D 2O1VA 4DV2E 1N36E 3OTOE 2OI2A 2PNZA 4NXNI 4PRVA 4DPTA 2UUAI 1RREA 4JI1E 2GO3A 4DV3E 2HKEA 3QT6A 3PS2A 1USUA 3H1CA 4MU0A 5C0XC 4NXME 4X66I 3HJCA 5ELWA 3J7AM 2R42A 4U3DA 2AJ4A 4B3SI 4DV1E 1S4EA 1XMOI 2LJPA 4JG4A 1J5EE 2WP8B 4OX9I 1NZ0A 4DR4I 2O1UA 3QT8A 4B3TE 4NBQA 3HULA 2BM1A 3WU4A 4IFDA 5IT9C 4FW6A 2V2VA 4MQYA 4DV0E 2JEAB 4OO1A 1N34E 4YHHE 3ZZ0A 3GONA 3P3CA 2ZM6I 4LFBI 1FWKA 4DR7E 4IZKB 1ZM4A 4X62E 4OO1F 1ZM2A 2UXCI 1ZXMA 4JI0I 2PNMA 5C0XB 4QNJA 1N32E 4IZJD 1B62A 1I94I 4LCGA 4P7AA 2C38A 2BV3A 2NN6A 2ZBKB 4USKA 1Z5AA 2A2DA 3Q6MA 1HR0I 3LTOA 2WNRB 4ZVIA 4DR2E 4OX9E 2J7KA 1Y6ZA 5JEAC 4JI5I 2NN6F 1R6MA 1MU5A 4HACB 1OYPA 1D6TA 3PYEA 4X66E 5K36C 1H7UA 5IWAI 5K36F 4MU4A 4DUYE 4AQYE 4URLA 4BA2B 4LF6E 4DR1E 4FWDA 3UHMA 1IBKI 2VF3A 5L3JA 1NHIA 2BM0A 1NHJA 1Y4UA 4J3DA 3PS3A 1KKHA 1XHKA 4FW7A 1EI1A 4DR6E 2AE8A 1ZXNA 3GCMA 2EFGA 4PRXA 1PIEA 1UDQA 4LPFA 3GMEA 4JI7E 2UUCI 5GMEA 4LCHA 3J7AG 2UU9E 4LF6I 4HXZA 3Q6NA 4K0KE 4MDTA 4JV5E 2HHHE 2E5LI 4JYAI 4AIMA 1YHCA 3WU6A 3H4LA 1N0VC 3QT5A 4OO1B 4PU9A 3T1HE 1EA6A 1Z0TA 1RR9A 3B8HA 4B3MI 1VISA 1N33E 2XEXA 5FLXQ 4DV4I 5A2QC 2PO0B 4LFCE 4X64E 4DR4E 1MG7A 2NN6C 3D4JA 3M85D 3GLLA 2V2QA 4GKKE 4B3RE 4LF5I 3WU3A 1HNZI 1R6LA 4HACA 2R3VA 1OYSA 1MX0A 1KTVA 1FKAE 4OZEA 4OO1D 5JEAE 4IZJB 4GQUA 1XNQE
chains in the Genus database with same CATH topology
1XNRI 5LMUI 4FWGA 2A2CA 2CG9A 2ZITA 4B3TI 4IZKA 1FJGI 4DU7A 2O1TA 1FWLA 1A6FA 4N3OA 1HNXI 1ZM3A 3JAMC 4DR1I 3V5RA 1PKPA 2UXDI 4KHPE 1OJ4A 1IBLI 4ED4A 2VQFE 3OTOI 4DV2I 4LF4E 4WUDA 4GKJE 4DR5E 3K1JA 1H73A 4JI8E 4YY3I 1BKNA 2O1WA 2GS8A 4X62I 2PNLA 4EMDA 4DXLA 1KIJA 2VQEI 1IBME 2Z5CA 4K0KI 2HK3A 4DV6E 5GMDA 2Z5BA 4JI6I 3J80C 4DV5E 1HK7A 1Z0CA 4DR6I 1N33I 4LF4I 1K47A 4IZJA 3ZM7A 1UEKA 4JI4E 2VQFI 2HFUA 1U2RA 4JI2E 4USMA 1IBKE 4P52A 4JV5I 3ZKBA 3T1YI 3J81Q 2UUAE 5IWAE 4JI7I 1Z0VA 2X7IA 1NHHA 4FWHA 3P06A 2CGEA 4GKJI 4WUBA 4LF8E 1HNWE 2V34A 5LMUE 1HR0E 3K17A 2IOQA 1XNRE 2NPFA 4DPUA 2DEJA 1I94E 1H7SA 4WUCA 1N32I 2E1RA 3T1YE 2UXDE 5BR8E 4DV7I 4DUZE 5A2QQ 4DUYI 4AQYI 1Z5BA 4DU8A 4JI2I 2UUBE 4LFBE 1FNMA 4GKKI 4DV0I 1XMQE 4LFAE 2F4VE 3PRYA 1H74A 2Z5CB 1XNQI 2V2ZA 4JI3E 2DEIA 4JI6E 5LL6R 2F4VI 4M1KA 1XMQI 4DR3I 4LFAI 1Z59A 4Z7CA 2UXCE 4RPFA 1Z0EA 2UUBI 2VQEE 4DPYA 2E5LE 1N34I 2HHHI 4B3RI 4DUZI 4HY1A 5BR8I 4XTJA 4DR3E 5IT9Q 4X64I 4LFCI 4YY3E 2UUCE 3JAMQ 3V2UC 3B78A 3ZZTA 1N36I 1ZM9A 4LF8I 1XMOE 4B3SE 3K85A 3PYFA 4X65E 2Z5BB 4DPXA 4JYAE 1IBLE 2WW4A 2V8PA 4DV7E 2UU9I 1Y4SA 2CZ9A 1HNXE 4X65I 3ZKDA 4KQVA 2HK2A 1FJGE 2HFSA 1B63A 1N0UA 4R1FA 1HNWI 1Z0BA 3QT7A 4UT4A 4UTGA 4I3HA 1Z0WA 4FW9A 3J80Q 4DV6I 2IOPA 4JI0E 4Z7YA 3CWVA 1QZRA 1IBMI 2UXBI 2Q2EB 4LF9E 4LF9I 1DARA 2UXBE 1PVGA 1HNZE 4YHHI 4LF5E 4JI4I 1Z5CA 4LF7I 4HYMA 5LMNE 4JI5E 3Q1QA 4DR2I 3F0NA 3PYGA 4JI8I 4JI3I 2X36A 4DV4E 3J81C 4DR5I 4DV5I 1KVKA 4MYTA 5FWKA 5LMNI 3WU5A 4LF7E 3T1HI 4DV1I 4B3ME 1FI4A 1Z0GA 4NXMI 4DR7I 1USVA 5FLXC 2ZM6E 3ZZUA 4KHPI 4MYUA 2Z5EA 4DV3I 3LPSA 4JI1I 3B82A 3M6AA 3PYDA 4DPWA 4NXNE 1S16A 3LNUA 1H72C 4FN5A 1J5EI 1WUUA 2HKJA 1ELOA 2GQ0A 2O1VA 4DV2E 1N36E 3OTOE 2OI2A 4NXNI 4PRVA 4DPTA 2UUAI 1RREA 4JI1E 4DV3E 2HKEA 3QT6A 1USUA 4NXME 4X66I 3HJCA 3J7AM 2R42A 2AJ4A 4B3SI 4DV1E 1S4EA 1XMOI 2LJPA 4JG4A 1J5EE 4OX9I 1NZ0A 4DR4I 2O1UA 3QT8A 4B3TE 3HULA 2BM1A 3WU4A 5IT9C 2V2VA 4DV0E 4LFBI 1N34E 4YHHE 3ZZ0A 3GONA 2ZM6I 1FWKA 4DR7E 4IZKB 1ZM4A 4X62E 1ZM2A 2UXCI 1ZXMA 4JI0I 2PNMA 1N32E 4IZJD 1B62A 1I94I 4P7AA 2BV3A 2ZBKB 4USKA 1Z5AA 2A2DA 3Q6MA 1HR0I 3LTOA 4ZVIA 4DR2E 4OX9E 2J7KA 1Y6ZA 4JI5I 1MU5A 4HACB 1D6TA 3PYEA 4X66E 1H7UA 5IWAI 4DUYE 4AQYE 4URLA 4LF6E 4DR1E 4FWDA 1IBKI 2VF3A 5L3JA 1NHIA 2BM0A 1NHJA 1Y4UA 1KKHA 1XHKA 1EI1A 4DR6E 1ZXNA 2EFGA 4PRXA 1PIEA 4JI7E 2UUCI 5GMEA 3J7AG 2UU9E 4LF6I 4HXZA 3Q6NA 4K0KE 4JV5E 2HHHE 2E5LI 4JYAI 3WU6A 3H4LA 1N0VC 3QT5A 4PU9A 3T1HE 1EA6A 1RR9A 1Z0TA 3B8HA 4B3MI 1VISA 1N33E 2XEXA 5FLXQ 4DV4I 5A2QC 4LFCE 4X64E 4DR4E 1MG7A 3D4JA 2V2QA 4GKKE 4B3RE 4LF5I 3WU3A 1HNZI 4HACA 2R3VA 1MX0A 1KTVA 1FKAE 4IZJB 1XNQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR I;  5LMU I;  4FWG A;  2A2C A;  2ZIT A;  4B3T I;  1FJG I;  4DU7 A;  1FWL A;  1A6F A;  1HNX I;  1ZM3 A;  3JAM C;  4DR1 I;  3V5R A;  1PKP A;  2UXD I;  4KHP E;  1OJ4 A;  1IBL I;  4ED4 A;  2VQF E;  3OTO I;  4DV2 I;  4LF4 E;  4WUD A;  4GKJ E;  4DR5 E;  3K1J A;  1H73 A;  4JI8 E;  4YY3 I;  1BKN A;  2GS8 A;  4X62 I;  4EMD A;  4DXL A;  1KIJ A;  2VQE I;  1IBM E;  4K0K I;  2HK3 A;  4DV6 E;  5GMD A;  4JI6 I;  3J80 C;  4DV5 E;  1Z0C A;  4DR6 I;  1N33 I;  4LF4 I;  1K47 A;  3ZM7 A;  1UEK A;  4JI4 E;  2VQF I;  2HFU A;  1U2R A;  4JI2 E;  4USM A;  1IBK E;  4P52 A;  4JV5 I;  3ZKB A;  3T1Y I;  3J81 Q;  2UUA E;  5IWA E;  4JI7 I;  1Z0V A;  2X7I A;  1NHH A;  4FWH A;  4GKJ I;  4WUB A;  4LF8 E;  1HNW E;  2V34 A;  5LMU E;  1HR0 E;  3K17 A;  1XNR E;  2NPF A;  4DPU A;  2DEJ A;  1I94 E;  1H7S A;  4WUC A;  1N32 I;  2E1R A;  3T1Y E;  2UXD E;  5BR8 E;  4DV7 I;  4DUZ E;  5A2Q Q;  4DUY I;  4AQY I;  1Z5B A;  4DU8 A;  4JI2 I;  2UUB E;  4LFB E;  1FNM A;  4GKK I;  4DV0 I;  1XMQ E;  4LFA E;  2F4V E;  1H74 A;  1XNQ I;  2V2Z A;  4JI3 E;  2DEI A;  4JI6 E;  5LL6 R;  2F4V I;  4M1K A;  1XMQ I;  4DR3 I;  4LFA I;  1Z59 A;  4Z7C A;  2UXC E;  4RPF A;  1Z0E A;  2UUB I;  2VQE E;  4DPY A;  2E5L E;  1N34 I;  2HHH I;  4B3R I;  4DUZ I;  4HY1 A;  5BR8 I;  4XTJ A;  4DR3 E;  5IT9 Q;  4X64 I;  4LFC I;  4YY3 E;  2UUC E;  3JAM Q;  3V2U C;  3B78 A;  3ZZT A;  1N36 I;  1ZM9 A;  4LF8 I;  1XMO E;  4B3S E;  3PYF A;  4X65 E;  4DPX A;  4JYA E;  1IBL E;  2WW4 A;  2V8P A;  4DV7 E;  2UU9 I;  2CZ9 A;  1HNX E;  4X65 I;  3ZKD A;  4KQV A;  2HK2 A;  1FJG E;  2HFS A;  1B63 A;  1N0U A;  4R1F A;  1HNW I;  1Z0B A;  3QT7 A;  4UT4 A;  4UTG A;  4I3H A;  1Z0W A;  4FW9 A;  3J80 Q;  4DV6 I;  4JI0 E;  4Z7Y A;  3CWV A;  1QZR A;  1IBM I;  2UXB I;  2Q2E B;  4LF9 E;  4LF9 I;  1DAR A;  2UXB E;  1PVG A;  1HNZ E;  4YHH I;  4LF5 E;  4JI4 I;  1Z5C A;  4LF7 I;  4HYM A;  5LMN E;  4JI5 E;  3Q1Q A;  4DR2 I;  3F0N A;  3PYG A;  4JI8 I;  4JI3 I;  2X36 A;  4DV4 E;  3J81 C;  4DR5 I;  4DV5 I;  1KVK A;  4MYT A;  5LMN I;  3WU5 A;  4LF7 E;  3T1H I;  4DV1 I;  4B3M E;  1FI4 A;  1Z0G A;  4NXM I;  4DR7 I;  5FLX C;  2ZM6 E;  3ZZU A;  4KHP I;  4MYU A;  4DV3 I;  3LPS A;  4JI1 I;  3B82 A;  3M6A A;  3PYD A;  4DPW A;  4NXN E;  1S16 A;  3LNU A;  1H72 C;  4FN5 A;  1J5E I;  1WUU A;  2HKJ A;  1ELO A;  4DV2 E;  1N36 E;  3OTO E;  2OI2 A;  4NXN I;  4PRV A;  4DPT A;  2UUA I;  1RRE A;  4JI1 E;  4DV3 E;  2HKE A;  3QT6 A;  4NXM E;  4X66 I;  3J7A M;  2R42 A;  2AJ4 A;  4B3S I;  4DV1 E;  1S4E A;  1XMO I;  2LJP A;  4JG4 A;  1J5E E;  4OX9 I;  1NZ0 A;  4DR4 I;  3QT8 A;  4B3T E;  3HUL A;  2BM1 A;  3WU4 A;  5IT9 C;  2V2V A;  4DV0 E;  4LFB I;  1N34 E;  4YHH E;  3ZZ0 A;  3GON A;  2ZM6 I;  1FWK A;  4DR7 E;  1ZM4 A;  4X62 E;  1ZM2 A;  2UXC I;  1ZXM A;  4JI0 I;  1N32 E;  1B62 A;  1I94 I;  4P7A A;  2BV3 A;  2ZBK B;  4USK A;  1Z5A A;  2A2D A;  1HR0 I;  3LTO A;  4ZVI A;  4DR2 E;  4OX9 E;  2J7K A;  4JI5 I;  1MU5 A;  4HAC B;  1D6T A;  3PYE A;  4X66 E;  1H7U A;  5IWA I;  4DUY E;  4AQY E;  4URL A;  4LF6 E;  4DR1 E;  4FWD A;  1IBK I;  2VF3 A;  5L3J A;  1NHI A;  2BM0 A;  1NHJ A;  1KKH A;  1XHK A;  1EI1 A;  4DR6 E;  1ZXN A;  2EFG A;  4PRX A;  1PIE A;  4JI7 E;  2UUC I;  5GME A;  3J7A G;  2UU9 E;  4LF6 I;  4HXZ A;  4K0K E;  4JV5 E;  2HHH E;  2E5L I;  4JYA I;  3WU6 A;  3H4L A;  1N0V C;  3QT5 A;  4PU9 A;  3T1H E;  1EA6 A;  1RR9 A;  1Z0T A;  3B8H A;  4B3M I;  1VIS A;  1N33 E;  2XEX A;  5FLX Q;  4DV4 I;  5A2Q C;  4LFC E;  4X64 E;  4DR4 E;  1MG7 A;  3D4J A;  2V2Q A;  4GKK E;  4B3R E;  4LF5 I;  3WU3 A;  1HNZ I;  4HAC A;  2R3V A;  1MX0 A;  1KTV A;  1FKA E;  1XNQ E; 
#chains in the Genus database with same CATH topology
 1XNR I;  3L7Z A;  5LMU I;  4FWG A;  4IFD C;  2A2C A;  2CG9 A;  2ZIT A;  4B3T I;  2J65 A;  4IZK A;  2JT2 A;  1Y60 A;  1FJG I;  4DU7 A;  2O1T A;  1FWL A;  2C37 A;  1A6F A;  4N3O A;  1HNX I;  1ZM3 A;  3NZK A;  1VI7 A;  3JAM C;  3V5R A;  4DR1 I;  1PKP A;  2UXD I;  4FW4 A;  4KHP E;  1OJ4 A;  1IBL I;  2CVE A;  4ED4 A;  2VQF E;  4AM3 A;  3OTO I;  4DV2 I;  5C0X E;  4LF4 E;  4WUD A;  4GKJ E;  4DR5 E;  3K1J A;  1H73 A;  5K36 A;  1Y5Y A;  4JI8 E;  4YY3 I;  1BKN A;  2O1W A;  5EKW A;  2GS8 A;  4X62 I;  2PNL A;  4EMD A;  2C39 A;  4DXL A;  1KIJ A;  2VQE I;  1IBM E;  2Z5C A;  4K0K I;  2GO4 A;  2BA1 D;  2HK3 A;  3M85 G;  4DV6 E;  5GMD A;  2Z5B A;  4JI6 I;  3J80 C;  4DV5 E;  4FW5 A;  2JEB A;  3P3G A;  1HK7 A;  5JEA D;  1Z0C A;  4DR6 I;  1N33 I;  4LF4 I;  1K47 A;  4IZJ A;  3ZM7 A;  4AID A;  5DNL A;  1UEK A;  1YH8 A;  4JI4 E;  2VQF I;  2HFU A;  1U2R A;  4JI2 E;  1P42 A;  4USM A;  1IBK E;  4P52 A;  4JV5 I;  3KRN A;  1OYR A;  1XXE A;  2IER A;  2C37 B;  2PO0 A;  3ZKB A;  3T1Y I;  3J81 Q;  2UUA E;  4IFD E;  5IWA E;  4JI7 I;  1Z0V A;  2X7I A;  2JE6 A;  1NHH A;  4LOM A;  4FWH A;  3P06 A;  4OO1 E;  2CGE A;  4GKJ I;  4WUB A;  4LF8 E;  1HNW E;  2V34 A;  2IES A;  5LMU E;  1HR0 E;  3K17 A;  2IOQ A;  1XNR E;  2NPF A;  4DPU A;  2PO1 B;  2DEJ A;  1I94 E;  1H7S A;  4WUC A;  1N32 I;  2E1R A;  3T1Y E;  2UXD E;  2NN6 E;  5BR8 E;  4DV7 I;  4DUZ E;  5A2Q Q;  3L7Z B;  5K36 B;  4DUY I;  4AQY I;  1UDS A;  1Z5B A;  4DU8 A;  5JEA F;  4JI2 I;  2UUB E;  2F1D A;  4LFB E;  1FNM A;  4GKK I;  4DV0 I;  5C0X D;  1XMQ E;  4LFA E;  2F4V E;  3PRY A;  1H74 A;  5JEA B;  2Z5C B;  1XNQ I;  2V2Z A;  3M7N D;  4JI3 E;  2DEI A;  2PO2 B;  4JI6 E;  5LL6 R;  2JEB B;  2F4V I;  4M1K A;  1XMQ I;  4DR3 I;  4LFA I;  5DRP A;  1Z59 A;  4Z7C A;  2UXC E;  4QNK A;  4RPF A;  1Z0E A;  2UUB I;  2VQE E;  4DPY A;  4OKG A;  2E5L E;  1N34 I;  2HHH I;  4OO1 C;  4B3R I;  4FW3 A;  4DUZ I;  4HY1 A;  5EL9 A;  3M7N G;  2PNZ B;  5BR8 I;  2BA0 G;  4XTJ A;  4DR3 E;  5IT9 Q;  4X64 I;  4LFC I;  4YY3 E;  5DRQ A;  2UUC E;  2VES A;  4IFD D;  3JAM Q;  3V2U C;  3B4T A;  3B78 A;  3ZZT A;  1N36 I;  4BA1 A;  1ZM9 A;  4U3B A;  2C39 B;  4LF8 I;  3CDI A;  1XMO E;  4B3S E;  3K85 A;  3PYF A;  1UDO A;  2BR2 A;  4X65 E;  2Z5B B;  4DPX A;  4JYA E;  1IBL E;  2WW4 A;  4MU1 A;  2V8P A;  4DV7 E;  5K36 D;  5DRO A;  2UU9 I;  4IS9 A;  3DD6 A;  1RHY A;  1Y4S A;  2CZ9 A;  1HNX E;  4X65 I;  4ISA A;  3ZKD A;  4KQV A;  2HK2 A;  5DRR A;  2JEA A;  1FJG E;  2HFS A;  1B63 A;  1N0U A;  4R1F A;  1HNW I;  1Z0B A;  3QT7 A;  1E3P A;  4MU3 A;  4UT4 A;  4UTG A;  4I3H A;  1Z0W A;  2O3Z A;  4FW9 A;  3J80 Q;  4DV6 I;  5JEA A;  5DNX A;  2JE6 B;  3U1K A;  2IOP A;  2NN6 B;  4JI0 E;  4IFD F;  4Z7Y A;  3HKM A;  3CWV A;  1QZR A;  2WNR A;  1IBM I;  3U1Y A;  2UXB I;  2Q2E B;  4LF9 E;  2WP8 A;  4LF9 I;  1DAR A;  2UXB E;  1PVG A;  1HNZ E;  4YHH I;  4LF5 E;  4JI4 I;  1UDN A;  1Z5C A;  4LF7 I;  4HYM A;  5LMN E;  3P3E A;  4JI5 E;  2PO1 A;  3Q1Q A;  4IFD B;  3P76 A;  1E3H A;  4DR2 I;  3F0N A;  3PYG A;  4JI8 I;  4JI3 I;  4LCF A;  4BA2 A;  2X36 A;  4DV4 E;  3J81 C;  4DR5 I;  4DV5 I;  1KVK A;  4MYT A;  5C0X F;  5FWK A;  5LMN I;  3WU5 A;  4LF7 E;  3T1H I;  4DV1 I;  4B3M E;  1FI4 A;  2NN6 D;  4BA1 B;  2BA1 G;  1Z0G A;  5C0X A;  4NXM I;  4DR7 I;  1USV A;  5FLX C;  2ZM6 E;  3ZZU A;  4KHP I;  4MYU A;  2Z5E A;  2C38 B;  4DV3 I;  3LPS A;  4JI1 I;  3B82 A;  5K36 E;  2BR2 B;  3M6A A;  2PO2 A;  3PYD A;  3CDJ A;  4DPW A;  4NXN E;  1S16 A;  3PS1 A;  3LNU A;  1H72 C;  4FN5 A;  1J5E I;  1WUU A;  2HKJ A;  1ELO A;  2GQ0 A;  2BA0 D;  2O1V A;  4DV2 E;  1N36 E;  3OTO E;  2OI2 A;  2PNZ A;  4NXN I;  4PRV A;  4DPT A;  2UUA I;  1RRE A;  4JI1 E;  2GO3 A;  4DV3 E;  2HKE A;  3QT6 A;  3PS2 A;  1USU A;  3H1C A;  4MU0 A;  5C0X C;  4NXM E;  4X66 I;  3HJC A;  5ELW A;  3J7A M;  2R42 A;  4U3D A;  2AJ4 A;  4B3S I;  4DV1 E;  1S4E A;  1XMO I;  2LJP A;  4JG4 A;  1J5E E;  2WP8 B;  4OX9 I;  1NZ0 A;  4DR4 I;  2O1U A;  3QT8 A;  4B3T E;  4NBQ A;  3HUL A;  2BM1 A;  3WU4 A;  4IFD A;  5IT9 C;  4FW6 A;  2V2V A;  4MQY A;  4DV0 E;  2JEA B;  4OO1 A;  1N34 E;  4YHH E;  3ZZ0 A;  3GON A;  3P3C A;  2ZM6 I;  4LFB I;  1FWK A;  4DR7 E;  4IZK B;  1ZM4 A;  4X62 E;  4OO1 F;  1ZM2 A;  2UXC I;  1ZXM A;  4JI0 I;  2PNM A;  5C0X B;  4QNJ A;  1N32 E;  4IZJ D;  1B62 A;  1I94 I;  4LCG A;  4P7A A;  2C38 A;  2BV3 A;  2NN6 A;  2ZBK B;  4USK A;  1Z5A A;  2A2D A;  3Q6M A;  1HR0 I;  3LTO A;  2WNR B;  4ZVI A;  4DR2 E;  4OX9 E;  2J7K A;  1Y6Z A;  5JEA C;  4JI5 I;  2NN6 F;  1R6M A;  1MU5 A;  4HAC B;  1OYP A;  1D6T A;  3PYE A;  4X66 E;  5K36 C;  1H7U A;  5IWA I;  5K36 F;  4MU4 A;  4DUY E;  4AQY E;  4URL A;  4BA2 B;  4LF6 E;  4DR1 E;  4FWD A;  3UHM A;  1IBK I;  2VF3 A;  5L3J A;  1NHI A;  2BM0 A;  1NHJ A;  1Y4U A;  4J3D A;  3PS3 A;  1KKH A;  1XHK A;  4FW7 A;  1EI1 A;  4DR6 E;  2AE8 A;  1ZXN A;  3GCM A;  2EFG A;  4PRX A;  1PIE A;  1UDQ A;  4LPF A;  3GME A;  4JI7 E;  2UUC I;  5GME A;  4LCH A;  3J7A G;  2UU9 E;  4LF6 I;  4HXZ A;  3Q6N A;  4K0K E;  4MDT A;  4JV5 E;  2HHH E;  2E5L I;  4JYA I;  4AIM A;  1YHC A;  3WU6 A;  3H4L A;  1N0V C;  3QT5 A;  4OO1 B;  4PU9 A;  3T1H E;  1EA6 A;  1Z0T A;  1RR9 A;  3B8H A;  4B3M I;  1VIS A;  1N33 E;  2XEX A;  5FLX Q;  4DV4 I;  5A2Q C;  2PO0 B;  4LFC E;  4X64 E;  4DR4 E;  1MG7 A;  2NN6 C;  3D4J A;  3M85 D;  3GLL A;  2V2Q A;  4GKK E;  4B3R E;  4LF5 I;  3WU3 A;  1HNZ I;  1R6L A;  4HAC A;  2R3V A;  1OYS A;  1MX0 A;  1KTV A;  1FKA E;  4OZE A;  4OO1 D;  5JEA E;  4IZJ B;  4GQU A;  1XNQ E; 
#chains in the Genus database with same CATH homology
 1XNR I;  5LMU I;  4FWG A;  2A2C A;  2CG9 A;  2ZIT A;  4B3T I;  4IZK A;  1FJG I;  4DU7 A;  2O1T A;  1FWL A;  1A6F A;  4N3O A;  1HNX I;  1ZM3 A;  3JAM C;  4DR1 I;  3V5R A;  1PKP A;  2UXD I;  4KHP E;  1OJ4 A;  1IBL I;  4ED4 A;  2VQF E;  3OTO I;  4DV2 I;  4LF4 E;  4WUD A;  4GKJ E;  4DR5 E;  3K1J A;  1H73 A;  4JI8 E;  4YY3 I;  1BKN A;  2O1W A;  2GS8 A;  4X62 I;  2PNL A;  4EMD A;  4DXL A;  1KIJ A;  2VQE I;  1IBM E;  2Z5C A;  4K0K I;  2HK3 A;  4DV6 E;  5GMD A;  2Z5B A;  4JI6 I;  3J80 C;  4DV5 E;  1HK7 A;  1Z0C A;  4DR6 I;  1N33 I;  4LF4 I;  1K47 A;  4IZJ A;  3ZM7 A;  1UEK A;  4JI4 E;  2VQF I;  2HFU A;  1U2R A;  4JI2 E;  4USM A;  1IBK E;  4P52 A;  4JV5 I;  3ZKB A;  3T1Y I;  3J81 Q;  2UUA E;  5IWA E;  4JI7 I;  1Z0V A;  2X7I A;  1NHH A;  4FWH A;  3P06 A;  2CGE A;  4GKJ I;  4WUB A;  4LF8 E;  1HNW E;  2V34 A;  5LMU E;  1HR0 E;  3K17 A;  2IOQ A;  1XNR E;  2NPF A;  4DPU A;  2DEJ A;  1I94 E;  1H7S A;  4WUC A;  1N32 I;  2E1R A;  3T1Y E;  2UXD E;  5BR8 E;  4DV7 I;  4DUZ E;  5A2Q Q;  4DUY I;  4AQY I;  1Z5B A;  4DU8 A;  4JI2 I;  2UUB E;  4LFB E;  1FNM A;  4GKK I;  4DV0 I;  1XMQ E;  4LFA E;  2F4V E;  3PRY A;  1H74 A;  2Z5C B;  1XNQ I;  2V2Z A;  4JI3 E;  2DEI A;  4JI6 E;  5LL6 R;  2F4V I;  4M1K A;  1XMQ I;  4DR3 I;  4LFA I;  1Z59 A;  4Z7C A;  2UXC E;  4RPF A;  1Z0E A;  2UUB I;  2VQE E;  4DPY A;  2E5L E;  1N34 I;  2HHH I;  4B3R I;  4DUZ I;  4HY1 A;  5BR8 I;  4XTJ A;  4DR3 E;  5IT9 Q;  4X64 I;  4LFC I;  4YY3 E;  2UUC E;  3JAM Q;  3V2U C;  3B78 A;  3ZZT A;  1N36 I;  1ZM9 A;  4LF8 I;  1XMO E;  4B3S E;  3K85 A;  3PYF A;  4X65 E;  2Z5B B;  4DPX A;  4JYA E;  1IBL E;  2WW4 A;  2V8P A;  4DV7 E;  2UU9 I;  1Y4S A;  2CZ9 A;  1HNX E;  4X65 I;  3ZKD A;  4KQV A;  2HK2 A;  1FJG E;  2HFS A;  1B63 A;  1N0U A;  4R1F A;  1HNW I;  1Z0B A;  3QT7 A;  4UT4 A;  4UTG A;  4I3H A;  1Z0W A;  4FW9 A;  3J80 Q;  4DV6 I;  2IOP A;  4JI0 E;  4Z7Y A;  3CWV A;  1QZR A;  1IBM I;  2UXB I;  2Q2E B;  4LF9 E;  4LF9 I;  1DAR A;  2UXB E;  1PVG A;  1HNZ E;  4YHH I;  4LF5 E;  4JI4 I;  1Z5C A;  4LF7 I;  4HYM A;  5LMN E;  4JI5 E;  3Q1Q A;  4DR2 I;  3F0N A;  3PYG A;  4JI8 I;  4JI3 I;  2X36 A;  4DV4 E;  3J81 C;  4DR5 I;  4DV5 I;  1KVK A;  4MYT A;  5FWK A;  5LMN I;  3WU5 A;  4LF7 E;  3T1H I;  4DV1 I;  4B3M E;  1FI4 A;  1Z0G A;  4NXM I;  4DR7 I;  1USV A;  5FLX C;  2ZM6 E;  3ZZU A;  4KHP I;  4MYU A;  2Z5E A;  4DV3 I;  3LPS A;  4JI1 I;  3B82 A;  3M6A A;  3PYD A;  4DPW A;  4NXN E;  1S16 A;  3LNU A;  1H72 C;  4FN5 A;  1J5E I;  1WUU A;  2HKJ A;  1ELO A;  2GQ0 A;  2O1V A;  4DV2 E;  1N36 E;  3OTO E;  2OI2 A;  4NXN I;  4PRV A;  4DPT A;  2UUA I;  1RRE A;  4JI1 E;  4DV3 E;  2HKE A;  3QT6 A;  1USU A;  4NXM E;  4X66 I;  3HJC A;  3J7A M;  2R42 A;  2AJ4 A;  4B3S I;  4DV1 E;  1S4E A;  1XMO I;  2LJP A;  4JG4 A;  1J5E E;  4OX9 I;  1NZ0 A;  4DR4 I;  2O1U A;  3QT8 A;  4B3T E;  3HUL A;  2BM1 A;  3WU4 A;  5IT9 C;  2V2V A;  4DV0 E;  4LFB I;  1N34 E;  4YHH E;  3ZZ0 A;  3GON A;  2ZM6 I;  1FWK A;  4DR7 E;  4IZK B;  1ZM4 A;  4X62 E;  1ZM2 A;  2UXC I;  1ZXM A;  4JI0 I;  2PNM A;  1N32 E;  4IZJ D;  1B62 A;  1I94 I;  4P7A A;  2BV3 A;  2ZBK B;  4USK A;  1Z5A A;  2A2D A;  3Q6M A;  1HR0 I;  3LTO A;  4ZVI A;  4DR2 E;  4OX9 E;  2J7K A;  1Y6Z A;  4JI5 I;  1MU5 A;  4HAC B;  1D6T A;  3PYE A;  4X66 E;  1H7U A;  5IWA I;  4DUY E;  4AQY E;  4URL A;  4LF6 E;  4DR1 E;  4FWD A;  1IBK I;  2VF3 A;  5L3J A;  1NHI A;  2BM0 A;  1NHJ A;  1Y4U A;  1KKH A;  1XHK A;  1EI1 A;  4DR6 E;  1ZXN A;  2EFG A;  4PRX A;  1PIE A;  4JI7 E;  2UUC I;  5GME A;  3J7A G;  2UU9 E;  4LF6 I;  4HXZ A;  3Q6N A;  4K0K E;  4JV5 E;  2HHH E;  2E5L I;  4JYA I;  3WU6 A;  3H4L A;  1N0V C;  3QT5 A;  4PU9 A;  3T1H E;  1EA6 A;  1RR9 A;  1Z0T A;  3B8H A;  4B3M I;  1VIS A;  1N33 E;  2XEX A;  5FLX Q;  4DV4 I;  5A2Q C;  4LFC E;  4X64 E;  4DR4 E;  1MG7 A;  3D4J A;  2V2Q A;  4GKK E;  4B3R E;  4LF5 I;  3WU3 A;  1HNZ I;  4HAC A;  2R3V A;  1MX0 A;  1KTV A;  1FKA E;  4IZJ B;  1XNQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...