1Z0EA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 61
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0eA00
4NXNI 4JG4A 1ELOA 1NHIA 3HULA 1ZXNA 4R1FA 4AQYI 4DV0E 1OJ4A 4LFCI 1S16A 4Z7YA 4DPWA 4YY3I 1J5EE 3WU3A 5A2QC 2AJ4A 4X64E 3M6AA 4JI6I 4K0KE 1Z0BA 4DV2I 2HK3A 4OX9E 4JI4I 4DUZE 2LJPA 1RR9A 2V2VA 4LF8E 2HKJA 4DV6E 4YHHE 4JI2E 4WUBA 1K47A 4DV0I 4LF4E 1B62A 1XNRE 4X65I 4PRVA 4DR2I 1J5EI 4LFBE 1I94E 1Z5AA 4HACA 4LF6I 2VF3A 4OX9I 4DUZI 3J80C 2A2DA 4JI5E 3LNUA 4LF9I 4LF8I 1IBKE 4RPFA 3K1JA 4YHHI 4JI2I 1EA6A 5FLXC 1HNXE 3JAMQ 3PYFA 4LF4I 2F4VE 3OTOE 2HK2A 4KHPE 4HY1A 4LFBI 1I94I 2VQEI 4UT4A 2UU9E 4LF5E 2UXCI 4DV1E 2E5LE 4P7AA 4DR1I 3V2UC 2ZITA 4JI5I 1N34I 1KTVA 5BR8I 2HFSA 4DUYI 4UTGA 1FI4A 1NHHA 5LMUE 1FNMA 1HNXI 2WW4A 2F4VI 4DPUA 1H72C 3OTOI 4JI8E 3QT6A 3V5RA 1N32E 1XNQE 4KHPI 1HNZE 1FJGE 2EFGA 1Z0VA 3T1YI 4FWGA 2UU9I 4LF5I 1U2RA 2VQFI 1H7UA 2R42A 1PIEA 4DV1I 5IT9C 1Z0TA 1XMOE 4FWHA 4DR4E 4DV7E 4USKA 3LPSA 4DR3E 4JI8I 2ZM6I 4MYUA 3PYEA 1HNZI 4JI1E 1N0UA 1Z0GA 3WU5A 2UUCE 3WU6A 4DXLA 4JYAE 1XMOI 1KVKA 1HNWE 1FWKA 4DR4I 4DV7I 2A2CA 1B63A 4DR3I 3WU4A 4JV5I 4FW9A 4JI3E 1DARA 1Z0CA 4DV5E 4JI1I 2V2QA 4PRXA 5A2QQ 4X66E 4X64I 1HNWI 4K0KI 1XHKA 1UEKA 3ZZTA 2CZ9A 4JI3I 4DV6I 4DV5I 1PVGA 2ZBKB 3J81C 2GS8A 4B3SE 1XNRI 1H7SA 1FKAE 4URLA 3ZZ0A 4JI7E 1QZRA 5GMDA 1EI1A 3Q1QA 1IBKI 1N36E 2X36A 1XMQE 2UUBE 1MU5A 1IBME 4B3SI 4FWDA 4MYTA 1S4EA 1PKPA 3PYDA 2UUAE 2X7IA 4X62E 3QT7A 4B3TE 3F0NA 4JI7I 1ZM3A 3ZKDA 1KKHA 2BM1A 3QT8A 4B3RE 2E5LI 1Z59A 2HKEA 2XEXA 4EMDA 4FN5A 2UXDE 5IWAE 4DR6E 4Z7CA 1H74A 5LMUI 1XMQI 2UUBI 1IBLE 4LFAE 1HR0E 2E1RA 3T1HE 4AQYE 1XNQI 1N32I 2V2ZA 4X62I 4DPTA 4DV3E 1FJGI 4B3TI 3ZM7A 3GONA 4DR7E 2HHHE 4DV2E 4GKKE 4ED4A 5IWAI 3D4JA 4DR6I 1IBLI 5LMNE 5L3JA 4LFAI 1HR0I 3T1HI 1VISA 3PYGA 1BKNA 4X65E 4DV3I 2BM0A 4DR2E 5LL6R 2UUCI 4LF7E 4GKJE 4DR7I 4LF6E 2Q2EB 4DPYA 2HHHI 1H73A 4JYAI 1Z0EA 3B8HA 4GKKI 1Z5CA 1ZM2A 4DR5E 4KQVA 4LF9E 1N33E 5LMNI 5GMEA 3QT5A 4JI0E 1ZM9A 4B3ME 3JAMC 1KIJA 4P52A 4HYMA 4XTJA 2V34A 1MG7A 2VQEE 4LF7I 4GKJI 2BV3A 2UXCE 1Z0WA 4X66I 4DR1E 4DR5I 1N34E 4NXME 1N33I 5BR8E 3J80Q 4DUYE 3K17A 2UXBE 3ZKBA 4JI0I 4DV4E 4B3MI 4HXZA 2NPFA 5FLXQ 3J81Q 3J7AM 2OI2A 3H4LA 2HFUA 3T1YE 2VQFE 1NHJA 4I3HA 4M1KA 4NXMI 2DEIA 1D6TA 1N0VC 4WUDA 2UXBI 2J7KA 4USMA 4DV4I 4PU9A 2V8PA 4HACB 2ZM6E 4DU8A 1N36I 3B78A 4WUCA 4NXNE 1A6FA 1Z5BA 1IBMI 1WUUA 1MX0A 4LFCE 2UUAI 3LTOA 1ZM4A 4DPXA 3CWVA 4YY3E 1FWLA 2DEJA 2R3VA 4B3RI 1RREA 1ZXMA 4ZVIA 5IT9Q 4JI6E 3J7AG 4DU7A 4JI4E 1NZ0A 3B82A 2UXDI 3ZZUA 4JV5E
chains in the Genus database with same CATH superfamily
4NXNI 5K36D 4JG4A 1ELOA 1NHIA 3HULA 1ZXNA 4R1FA 2IERA 4AQYI 4DV0E 1OJ4A 4LFCI 1S16A 3P06A 4Z7YA 4DPWA 4U3DA 4YY3I 1J5EE 3WU3A 5A2QC 3K85A 2AJ4A 4X64E 1YH8A 2C39A 3M6AA 4JI6I 4K0KE 1Z0BA 4DV2I 2HK3A 4J3DA 3PS2A 4OX9E 4JI4I 4DUZE 2LJPA 1RR9A 2V2VA 3P3GA 4LF8E 2HKJA 4DV6E 4YHHE 4JI2E 4WUBA 1K47A 4DV0I 4LF4E 2J65A 3PRYA 2BR2B 1B62A 1XNRE 4X65I 2Z5BB 4PRVA 4DR2I 3P3CA 1J5EI 4LFBE 1I94E 1Z5AA 4HACA 2NN6F 4LF6I 4OO1A 2VF3A 1USUA 4OX9I 1UDSA 4DUZI 4BA1B 3J80C 2A2DA 4JI5E 3LNUA 2VESA 4LF9I 4LF8I 1IBKE 4RPFA 3K1JA 4YHHI 4JI2I 2IESA 5K36A 1EA6A 4AIMA 5FLXC 4OO1E 4BA2A 5EL9A 3JAMQ 1HNXE 4N3OA 3PYFA 4LF4I 2F4VE 2O1UA 3OTOE 2HK2A 4KHPE 4HY1A 2JE6B 1VI7A 3CDIA 4LFBI 3Q6NA 1I94I 3UHMA 2VQEI 4MU1A 4UT4A 5JEAF 2JEBA 2UU9E 4LF5E 5DNLA 5K36E 1UDQA 4DV1E 2UXCI 2E5LE 4AIDA 4P7AA 5FWKA 4DR1I 3V2UC 1Y6ZA 2ZITA 5C0XF 4JI5I 1N34I 1KTVA 5BR8I 2HFSA 3U1KA 4DUYI 4UTGA 1FI4A 1NHHA 5LMUE 1FNMA 1HNXI 2WW4A 2F4VI 4DPUA 1H72C 2O1WA 4NBQA 4JI8E 3QT6A 3V5RA 3OTOI 1N32E 1XNQE 4KHPI 1R6LA 1HNZE 1FJGE 2EFGA 1Z0VA 3T1YI 4FWGA 2UU9I 4LF5I 1U2RA 2VQFI 1H7UA 2R42A 1PIEA 4DV1I 3B4TA 2JEAA 5EKWA 4LOMA 5IT9C 2NN6C 1Z0TA 1XMOE 2BR2A 2O3ZA 4FWHA 2Z5BA 4DR4E 1UDOA 4DV7E 1E3HA 1OYSA 4MDTA 4USKA 3LPSA 4DR3E 4JI8I 2ZM6I 4MYUA 4FW5A 3L7ZB 3PYEA 1HNZI 1USVA 4BA1A 4JI1E 1N0UA 2O1TA 1Z0GA 3WU5A 2UUCE 4IFDC 3WU6A 2NN6B 4DXLA 5JEAC 2PNMA 5DROA 2BA1D 2PO2B 4JYAE 1XMOI 1KVKA 1HNWE 1FWKA 4DR4I 2JE6A 4DV7I 1Y4SA 2A2CA 2WP8B 3HKMA 5C0XC 1B63A 4DR3I 3WU4A 4IZKB 2Z5CA 4JV5I 4FW9A 4JI3E 1DARA 1Z0CA 4DV5E 4JI1I 3KRNA 2V2QA 2PO1B 2CVEA 3U1YA 3PS1A 4PRXA 2PNZB 2IOPA 5A2QQ 3NZKA 2O1VA 3GLLA 5DRRA 3M85D 4X66E 2C38B 4X64I 1HNWI 4K0KI 1XHKA 2WNRA 1UEKA 3ZZTA 5C0XB 2CZ9A 2PNLA 3M7ND 4JI3I 1OYRA 4DV6I 4DV5I 1PVGA 2ZBKB 3J81C 2GS8A 4B3SE 4U3BA 5C0XD 2BA0D 1XNRI 4IFDF 1H7SA 1FKAE 4LPFA 4URLA 3ZZ0A 4IS9A 4JI7E 2PO0A 1QZRA 3L7ZA 5GMDA 4QNKA 4FW6A 2IOQA 1EI1A 3Q1QA 3PS3A 2GQ0A 1IBKI 4OKGA 1N36E 2X36A 3GCMA 1XMQE 2UUBE 1MU5A 1IBME 4B3SI 4FWDA 2AE8A 4MYTA 1S4EA 1PKPA 3PYDA 5ELWA 2UUAE 2X7IA 4X62E 2WP8A 3QT7A 4MQYA 4B3TE 3F0NA 3GMEA 4IZKA 3M85G 4JI7I 1ZM3A 2NN6E 3ZKDA 1KKHA 2BM1A 3QT8A 4B3RE 2E5LI 1Z59A 2HKEA 4LCGA 2GO4A 2XEXA 4EMDA 4FN5A 2UXDE 2PNZA 4ISAA 3M7NG 5IWAE 4DR6E 4Z7CA 1H74A 5LMUI 1XMQI 4GQUA 2UUBI 1IBLE 2JT2A 4LFAE 1HR0E 2E1RA 3T1HE 4AQYE 1XNQI 5C0XA 1N32I 2BA0G 2V2ZA 4FW7A 4MU3A 4X62I 4DPTA 4DV3E 1FJGI 4B3TI 3ZM7A 3GONA 4AM3A 4MU0A 4DR7E 2F1DA 2HHHE 4DV2E 2GO3A 5C0XE 4GKKE 4ED4A 5IWAI 3D4JA 4DR6I 1HK7A 1IBLI 5LMNE 2CG9A 5L3JA 2C37B 4IZJB 1HR0I 4LFAI 3T1HI 4OO1F 4FW4A 1VISA 3PYGA 2NN6D 1P42A 1YHCA 1BKNA 5DRQA 4X65E 4DV3I 4OZEA 3P3EA 2BM0A 1E3PA 4DR2E 4IFDB 5LL6R 2UUCI 4LF7E 4GKJE 4DR7I 4LF6E 5JEAB 4QNJA 2Q2EB 4IZJD 4DPYA 2HHHI 5K36F 1H73A 4JYAI 1Z0EA 3B8HA 4GKKI 1Z5CA 4MU4A 1ZM2A 4DR5E 4KQVA 4LF9E 1Y60A 4IFDD 1N33E 5LMNI 2JEAB 5JEAD 5GMEA 3QT5A 4JI0E 1ZM9A 4B3ME 3JAMC 1KIJA 4P52A 4HYMA 4FW3A 4XTJA 2V34A 1MG7A 2VQEE 4LF7I 4GKJI 2BV3A 2UXCE 1Z0WA 2BA1G 3DD6A 4X66I 4DR1E 4DR5I 1N34E 4NXME 3H1CA 5BR8E 1N33I 3J80Q 1R6MA 1XXEA 4DUYE 3K17A 4LCFA 2UXBE 3ZKBA 4JI0I 2Z5EA 4DV4E 4B3MI 2NN6A 4HXZA 2NPFA 5FLXQ 2C39B 3J81Q 2PO2A 3Q6MA 3J7AM 4OO1C 2OI2A 3H4LA 2HFUA 1OYPA 3T1YE 2VQFE 2Z5CB 2C37A 1NHJA 4IZJA 4I3HA 4M1KA 4NXMI 1Y4UA 5K36C 2DEIA 1D6TA 1N0VC 4IFDA 2CGEA 4WUDA 2UXBI 3HJCA 2PO1A 2J7KA 4USMA 4DV4I 4PU9A 5JEAA 2V8PA 4HACB 2ZM6E 4DU8A 4OO1B 1N36I 3B78A 5DRPA 4WUCA 4NXNE 1A6FA 2WNRB 1Z5BA 2C38A 1UDNA 1IBMI 1Y5YA 3P76A 1RHYA 1WUUA 1MX0A 4LFCE 4IFDE 2UUAI 3LTOA 1ZM4A 4DPXA 3CWVA 4YY3E 1FWLA 2DEJA 5JEAE 5K36B 2R3VA 4OO1D 4BA2B 4B3RI 1RREA 1ZXMA 4ZVIA 5IT9Q 4JI6E 3CDJA 3J7AG 4DU7A 5DNXA 4JI4E 4LCHA 1NZ0A 3B82A 2UXDI 3ZZUA 2JEBB 4JV5E 2PO0B
chains in the Genus database with same CATH topology
4NXNI 4JG4A 1ELOA 1NHIA 3HULA 1ZXNA 4R1FA 4AQYI 4DV0E 1OJ4A 4LFCI 1S16A 3P06A 4Z7YA 4DPWA 4YY3I 1J5EE 3WU3A 5A2QC 3K85A 2AJ4A 4X64E 3M6AA 4JI6I 4K0KE 1Z0BA 4DV2I 2HK3A 4OX9E 4JI4I 4DUZE 2LJPA 1RR9A 2V2VA 4LF8E 2HKJA 4DV6E 4YHHE 4JI2E 4WUBA 1K47A 4DV0I 4LF4E 3PRYA 1B62A 1XNRE 4X65I 2Z5BB 4PRVA 4DR2I 1J5EI 4LFBE 1I94E 1Z5AA 4HACA 4LF6I 2VF3A 1USUA 4OX9I 4DUZI 3J80C 2A2DA 4JI5E 3LNUA 4LF9I 4LF8I 1IBKE 4RPFA 3K1JA 4YHHI 4JI2I 1EA6A 5FLXC 1HNXE 3JAMQ 4N3OA 3PYFA 4LF4I 2F4VE 2O1UA 3OTOE 2HK2A 4KHPE 4HY1A 4LFBI 3Q6NA 1I94I 2VQEI 4UT4A 2UU9E 4LF5E 2UXCI 4DV1E 2E5LE 4P7AA 5FWKA 4DR1I 3V2UC 1Y6ZA 2ZITA 4JI5I 1N34I 1KTVA 5BR8I 2HFSA 4DUYI 4UTGA 1FI4A 1NHHA 5LMUE 1FNMA 1HNXI 2WW4A 2F4VI 4DPUA 3OTOI 1H72C 2O1WA 4JI8E 3QT6A 3V5RA 1N32E 1XNQE 4KHPI 1HNZE 1FJGE 2EFGA 1Z0VA 3T1YI 4FWGA 2UU9I 4LF5I 1U2RA 2VQFI 1H7UA 2R42A 1PIEA 4DV1I 5IT9C 1Z0TA 1XMOE 4FWHA 2Z5BA 4DR4E 4DV7E 4USKA 3LPSA 4DR3E 4JI8I 2ZM6I 4MYUA 3PYEA 1HNZI 1USVA 4JI1E 1N0UA 2O1TA 1Z0GA 3WU5A 2UUCE 3WU6A 4DXLA 2PNMA 4JYAE 1XMOI 1KVKA 1HNWE 1FWKA 4DR4I 4DV7I 1Y4SA 2A2CA 1B63A 4DR3I 3WU4A 4IZKB 2Z5CA 4JV5I 4FW9A 4JI3E 1DARA 1Z0CA 4DV5E 4JI1I 2V2QA 4PRXA 2IOPA 5A2QQ 2O1VA 4X66E 4X64I 1HNWI 4K0KI 1XHKA 1UEKA 3ZZTA 2CZ9A 2PNLA 4JI3I 4DV6I 4DV5I 1PVGA 2ZBKB 3J81C 2GS8A 4B3SE 1XNRI 1H7SA 1FKAE 4URLA 3ZZ0A 4JI7E 1QZRA 5GMDA 2IOQA 1EI1A 3Q1QA 1IBKI 2GQ0A 1N36E 2X36A 1XMQE 2UUBE 1MU5A 1IBME 4B3SI 4FWDA 4MYTA 1S4EA 1PKPA 3PYDA 2UUAE 2X7IA 4X62E 3QT7A 4B3TE 3F0NA 4IZKA 4JI7I 1ZM3A 3ZKDA 1KKHA 2BM1A 3QT8A 4B3RE 2E5LI 1Z59A 2HKEA 2XEXA 4EMDA 4FN5A 2UXDE 5IWAE 4DR6E 4Z7CA 1H74A 5LMUI 1XMQI 2UUBI 1IBLE 4LFAE 1HR0E 2E1RA 3T1HE 4AQYE 1XNQI 1N32I 2V2ZA 4X62I 4DPTA 4DV3E 1FJGI 4B3TI 3ZM7A 3GONA 4DR7E 2HHHE 4DV2E 4GKKE 4ED4A 5IWAI 3D4JA 4DR6I 1HK7A 1IBLI 5LMNE 2CG9A 5L3JA 4LFAI 4IZJB 1HR0I 3T1HI 1VISA 3PYGA 1BKNA 4X65E 4DV3I 2BM0A 4DR2E 5LL6R 2UUCI 4LF7E 4GKJE 4DR7I 4LF6E 2Q2EB 4IZJD 4DPYA 2HHHI 1H73A 4JYAI 1Z0EA 3B8HA 4GKKI 1Z5CA 1ZM2A 4DR5E 4KQVA 4LF9E 1N33E 5LMNI 5GMEA 3QT5A 4JI0E 1ZM9A 4B3ME 3JAMC 1KIJA 4P52A 4HYMA 4XTJA 2V34A 1MG7A 2VQEE 4LF7I 4GKJI 2BV3A 2UXCE 1Z0WA 4X66I 4DR1E 4DR5I 1N34E 4NXME 1N33I 5BR8E 3J80Q 4DUYE 3K17A 2UXBE 3ZKBA 4JI0I 2Z5EA 4DV4E 4B3MI 4HXZA 2NPFA 5FLXQ 3J81Q 3Q6MA 3J7AM 2OI2A 3H4LA 2HFUA 3T1YE 2VQFE 2Z5CB 1NHJA 4IZJA 4I3HA 4M1KA 4NXMI 1Y4UA 2DEIA 1D6TA 1N0VC 2CGEA 4WUDA 2UXBI 3HJCA 2J7KA 4USMA 4DV4I 4PU9A 2V8PA 4HACB 2ZM6E 4DU8A 1N36I 3B78A 4WUCA 4NXNE 1A6FA 1Z5BA 1IBMI 1WUUA 1MX0A 4LFCE 2UUAI 3LTOA 1ZM4A 4DPXA 3CWVA 4YY3E 1FWLA 2DEJA 2R3VA 4B3RI 1RREA 1ZXMA 4ZVIA 5IT9Q 4JI6E 3J7AG 4DU7A 4JI4E 1NZ0A 3B82A 2UXDI 3ZZUA 4JV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN I;  4JG4 A;  1ELO A;  1NHI A;  3HUL A;  1ZXN A;  4R1F A;  4AQY I;  4DV0 E;  1OJ4 A;  4LFC I;  1S16 A;  4Z7Y A;  4DPW A;  4YY3 I;  1J5E E;  3WU3 A;  5A2Q C;  2AJ4 A;  4X64 E;  3M6A A;  4JI6 I;  4K0K E;  1Z0B A;  4DV2 I;  2HK3 A;  4OX9 E;  4JI4 I;  4DUZ E;  2LJP A;  1RR9 A;  2V2V A;  4LF8 E;  2HKJ A;  4DV6 E;  4YHH E;  4JI2 E;  4WUB A;  1K47 A;  4DV0 I;  4LF4 E;  1B62 A;  1XNR E;  4X65 I;  4PRV A;  4DR2 I;  1J5E I;  4LFB E;  1I94 E;  1Z5A A;  4HAC A;  4LF6 I;  2VF3 A;  4OX9 I;  4DUZ I;  3J80 C;  2A2D A;  4JI5 E;  3LNU A;  4LF9 I;  4LF8 I;  1IBK E;  4RPF A;  3K1J A;  4YHH I;  4JI2 I;  1EA6 A;  5FLX C;  1HNX E;  3JAM Q;  3PYF A;  4LF4 I;  2F4V E;  3OTO E;  2HK2 A;  4KHP E;  4HY1 A;  4LFB I;  1I94 I;  2VQE I;  4UT4 A;  2UU9 E;  4LF5 E;  2UXC I;  4DV1 E;  2E5L E;  4P7A A;  4DR1 I;  3V2U C;  2ZIT A;  4JI5 I;  1N34 I;  1KTV A;  5BR8 I;  2HFS A;  4DUY I;  4UTG A;  1FI4 A;  1NHH A;  5LMU E;  1FNM A;  1HNX I;  2WW4 A;  2F4V I;  4DPU A;  1H72 C;  3OTO I;  4JI8 E;  3QT6 A;  3V5R A;  1N32 E;  1XNQ E;  4KHP I;  1HNZ E;  1FJG E;  2EFG A;  1Z0V A;  3T1Y I;  4FWG A;  2UU9 I;  4LF5 I;  1U2R A;  2VQF I;  1H7U A;  2R42 A;  1PIE A;  4DV1 I;  5IT9 C;  1Z0T A;  1XMO E;  4FWH A;  4DR4 E;  4DV7 E;  4USK A;  3LPS A;  4DR3 E;  4JI8 I;  2ZM6 I;  4MYU A;  3PYE A;  1HNZ I;  4JI1 E;  1N0U A;  1Z0G A;  3WU5 A;  2UUC E;  3WU6 A;  4DXL A;  4JYA E;  1XMO I;  1KVK A;  1HNW E;  1FWK A;  4DR4 I;  4DV7 I;  2A2C A;  1B63 A;  4DR3 I;  3WU4 A;  4JV5 I;  4FW9 A;  4JI3 E;  1DAR A;  1Z0C A;  4DV5 E;  4JI1 I;  2V2Q A;  4PRX A;  5A2Q Q;  4X66 E;  4X64 I;  1HNW I;  4K0K I;  1XHK A;  1UEK A;  3ZZT A;  2CZ9 A;  4JI3 I;  4DV6 I;  4DV5 I;  1PVG A;  2ZBK B;  3J81 C;  2GS8 A;  4B3S E;  1XNR I;  1H7S A;  1FKA E;  4URL A;  3ZZ0 A;  4JI7 E;  1QZR A;  5GMD A;  1EI1 A;  3Q1Q A;  1IBK I;  1N36 E;  2X36 A;  1XMQ E;  2UUB E;  1MU5 A;  1IBM E;  4B3S I;  4FWD A;  4MYT A;  1S4E A;  1PKP A;  3PYD A;  2UUA E;  2X7I A;  4X62 E;  3QT7 A;  4B3T E;  3F0N A;  4JI7 I;  1ZM3 A;  3ZKD A;  1KKH A;  2BM1 A;  3QT8 A;  4B3R E;  2E5L I;  1Z59 A;  2HKE A;  2XEX A;  4EMD A;  4FN5 A;  2UXD E;  5IWA E;  4DR6 E;  4Z7C A;  1H74 A;  5LMU I;  1XMQ I;  2UUB I;  1IBL E;  4LFA E;  1HR0 E;  2E1R A;  3T1H E;  4AQY E;  1XNQ I;  1N32 I;  2V2Z A;  4X62 I;  4DPT A;  4DV3 E;  1FJG I;  4B3T I;  3ZM7 A;  3GON A;  4DR7 E;  2HHH E;  4DV2 E;  4GKK E;  4ED4 A;  5IWA I;  3D4J A;  4DR6 I;  1IBL I;  5LMN E;  5L3J A;  4LFA I;  1HR0 I;  3T1H I;  1VIS A;  3PYG A;  1BKN A;  4X65 E;  4DV3 I;  2BM0 A;  4DR2 E;  5LL6 R;  2UUC I;  4LF7 E;  4GKJ E;  4DR7 I;  4LF6 E;  2Q2E B;  4DPY A;  2HHH I;  1H73 A;  4JYA I;  1Z0E A;  3B8H A;  4GKK I;  1Z5C A;  1ZM2 A;  4DR5 E;  4KQV A;  4LF9 E;  1N33 E;  5LMN I;  5GME A;  3QT5 A;  4JI0 E;  1ZM9 A;  4B3M E;  3JAM C;  1KIJ A;  4P52 A;  4HYM A;  4XTJ A;  2V34 A;  1MG7 A;  2VQE E;  4LF7 I;  4GKJ I;  2BV3 A;  2UXC E;  1Z0W A;  4X66 I;  4DR1 E;  4DR5 I;  1N34 E;  4NXM E;  1N33 I;  5BR8 E;  3J80 Q;  4DUY E;  3K17 A;  2UXB E;  3ZKB A;  4JI0 I;  4DV4 E;  4B3M I;  4HXZ A;  2NPF A;  5FLX Q;  3J81 Q;  3J7A M;  2OI2 A;  3H4L A;  2HFU A;  3T1Y E;  2VQF E;  1NHJ A;  4I3H A;  4M1K A;  4NXM I;  2DEI A;  1D6T A;  1N0V C;  4WUD A;  2UXB I;  2J7K A;  4USM A;  4DV4 I;  4PU9 A;  2V8P A;  4HAC B;  2ZM6 E;  4DU8 A;  1N36 I;  3B78 A;  4WUC A;  4NXN E;  1A6F A;  1Z5B A;  1IBM I;  1WUU A;  1MX0 A;  4LFC E;  2UUA I;  3LTO A;  1ZM4 A;  4DPX A;  3CWV A;  4YY3 E;  1FWL A;  2DEJ A;  2R3V A;  4B3R I;  1RRE A;  1ZXM A;  4ZVI A;  5IT9 Q;  4JI6 E;  3J7A G;  4DU7 A;  4JI4 E;  1NZ0 A;  3B82 A;  2UXD I;  3ZZU A;  4JV5 E; 
#chains in the Genus database with same CATH topology
 4NXN I;  5K36 D;  4JG4 A;  1ELO A;  1NHI A;  3HUL A;  1ZXN A;  4R1F A;  2IER A;  4AQY I;  4DV0 E;  1OJ4 A;  4LFC I;  1S16 A;  3P06 A;  4Z7Y A;  4DPW A;  4U3D A;  4YY3 I;  1J5E E;  3WU3 A;  5A2Q C;  3K85 A;  2AJ4 A;  4X64 E;  1YH8 A;  2C39 A;  3M6A A;  4JI6 I;  4K0K E;  1Z0B A;  4DV2 I;  2HK3 A;  4J3D A;  3PS2 A;  4OX9 E;  4JI4 I;  4DUZ E;  2LJP A;  1RR9 A;  2V2V A;  3P3G A;  4LF8 E;  2HKJ A;  4DV6 E;  4YHH E;  4JI2 E;  4WUB A;  1K47 A;  4DV0 I;  4LF4 E;  2J65 A;  3PRY A;  2BR2 B;  1B62 A;  1XNR E;  4X65 I;  2Z5B B;  4PRV A;  4DR2 I;  3P3C A;  1J5E I;  4LFB E;  1I94 E;  1Z5A A;  4HAC A;  2NN6 F;  4LF6 I;  4OO1 A;  2VF3 A;  1USU A;  4OX9 I;  1UDS A;  4DUZ I;  4BA1 B;  3J80 C;  2A2D A;  4JI5 E;  3LNU A;  2VES A;  4LF9 I;  4LF8 I;  1IBK E;  4RPF A;  3K1J A;  4YHH I;  4JI2 I;  2IES A;  5K36 A;  1EA6 A;  4AIM A;  5FLX C;  4OO1 E;  4BA2 A;  5EL9 A;  3JAM Q;  1HNX E;  4N3O A;  3PYF A;  4LF4 I;  2F4V E;  2O1U A;  3OTO E;  2HK2 A;  4KHP E;  4HY1 A;  2JE6 B;  1VI7 A;  3CDI A;  4LFB I;  3Q6N A;  1I94 I;  3UHM A;  2VQE I;  4MU1 A;  4UT4 A;  5JEA F;  2JEB A;  2UU9 E;  4LF5 E;  5DNL A;  5K36 E;  1UDQ A;  4DV1 E;  2UXC I;  2E5L E;  4AID A;  4P7A A;  5FWK A;  4DR1 I;  3V2U C;  1Y6Z A;  2ZIT A;  5C0X F;  4JI5 I;  1N34 I;  1KTV A;  5BR8 I;  2HFS A;  3U1K A;  4DUY I;  4UTG A;  1FI4 A;  1NHH A;  5LMU E;  1FNM A;  1HNX I;  2WW4 A;  2F4V I;  4DPU A;  1H72 C;  2O1W A;  4NBQ A;  4JI8 E;  3QT6 A;  3V5R A;  3OTO I;  1N32 E;  1XNQ E;  4KHP I;  1R6L A;  1HNZ E;  1FJG E;  2EFG A;  1Z0V A;  3T1Y I;  4FWG A;  2UU9 I;  4LF5 I;  1U2R A;  2VQF I;  1H7U A;  2R42 A;  1PIE A;  4DV1 I;  3B4T A;  2JEA A;  5EKW A;  4LOM A;  5IT9 C;  2NN6 C;  1Z0T A;  1XMO E;  2BR2 A;  2O3Z A;  4FWH A;  2Z5B A;  4DR4 E;  1UDO A;  4DV7 E;  1E3H A;  1OYS A;  4MDT A;  4USK A;  3LPS A;  4DR3 E;  4JI8 I;  2ZM6 I;  4MYU A;  4FW5 A;  3L7Z B;  3PYE A;  1HNZ I;  1USV A;  4BA1 A;  4JI1 E;  1N0U A;  2O1T A;  1Z0G A;  3WU5 A;  2UUC E;  4IFD C;  3WU6 A;  2NN6 B;  4DXL A;  5JEA C;  2PNM A;  5DRO A;  2BA1 D;  2PO2 B;  4JYA E;  1XMO I;  1KVK A;  1HNW E;  1FWK A;  4DR4 I;  2JE6 A;  4DV7 I;  1Y4S A;  2A2C A;  2WP8 B;  3HKM A;  5C0X C;  1B63 A;  4DR3 I;  3WU4 A;  4IZK B;  2Z5C A;  4JV5 I;  4FW9 A;  4JI3 E;  1DAR A;  1Z0C A;  4DV5 E;  4JI1 I;  3KRN A;  2V2Q A;  2PO1 B;  2CVE A;  3U1Y A;  3PS1 A;  4PRX A;  2PNZ B;  2IOP A;  5A2Q Q;  3NZK A;  2O1V A;  3GLL A;  5DRR A;  3M85 D;  4X66 E;  2C38 B;  4X64 I;  1HNW I;  4K0K I;  1XHK A;  2WNR A;  1UEK A;  3ZZT A;  5C0X B;  2CZ9 A;  2PNL A;  3M7N D;  4JI3 I;  1OYR A;  4DV6 I;  4DV5 I;  1PVG A;  2ZBK B;  3J81 C;  2GS8 A;  4B3S E;  4U3B A;  5C0X D;  2BA0 D;  1XNR I;  4IFD F;  1H7S A;  1FKA E;  4LPF A;  4URL A;  3ZZ0 A;  4IS9 A;  4JI7 E;  2PO0 A;  1QZR A;  3L7Z A;  5GMD A;  4QNK A;  4FW6 A;  2IOQ A;  1EI1 A;  3Q1Q A;  3PS3 A;  2GQ0 A;  1IBK I;  4OKG A;  1N36 E;  2X36 A;  3GCM A;  1XMQ E;  2UUB E;  1MU5 A;  1IBM E;  4B3S I;  4FWD A;  2AE8 A;  4MYT A;  1S4E A;  1PKP A;  3PYD A;  5ELW A;  2UUA E;  2X7I A;  4X62 E;  2WP8 A;  3QT7 A;  4MQY A;  4B3T E;  3F0N A;  3GME A;  4IZK A;  3M85 G;  4JI7 I;  1ZM3 A;  2NN6 E;  3ZKD A;  1KKH A;  2BM1 A;  3QT8 A;  4B3R E;  2E5L I;  1Z59 A;  2HKE A;  4LCG A;  2GO4 A;  2XEX A;  4EMD A;  4FN5 A;  2UXD E;  2PNZ A;  4ISA A;  3M7N G;  5IWA E;  4DR6 E;  4Z7C A;  1H74 A;  5LMU I;  1XMQ I;  4GQU A;  2UUB I;  1IBL E;  2JT2 A;  4LFA E;  1HR0 E;  2E1R A;  3T1H E;  4AQY E;  1XNQ I;  5C0X A;  1N32 I;  2BA0 G;  2V2Z A;  4FW7 A;  4MU3 A;  4X62 I;  4DPT A;  4DV3 E;  1FJG I;  4B3T I;  3ZM7 A;  3GON A;  4AM3 A;  4MU0 A;  4DR7 E;  2F1D A;  2HHH E;  4DV2 E;  2GO3 A;  5C0X E;  4GKK E;  4ED4 A;  5IWA I;  3D4J A;  4DR6 I;  1HK7 A;  1IBL I;  5LMN E;  2CG9 A;  5L3J A;  2C37 B;  4IZJ B;  1HR0 I;  4LFA I;  3T1H I;  4OO1 F;  4FW4 A;  1VIS A;  3PYG A;  2NN6 D;  1P42 A;  1YHC A;  1BKN A;  5DRQ A;  4X65 E;  4DV3 I;  4OZE A;  3P3E A;  2BM0 A;  1E3P A;  4DR2 E;  4IFD B;  5LL6 R;  2UUC I;  4LF7 E;  4GKJ E;  4DR7 I;  4LF6 E;  5JEA B;  4QNJ A;  2Q2E B;  4IZJ D;  4DPY A;  2HHH I;  5K36 F;  1H73 A;  4JYA I;  1Z0E A;  3B8H A;  4GKK I;  1Z5C A;  4MU4 A;  1ZM2 A;  4DR5 E;  4KQV A;  4LF9 E;  1Y60 A;  4IFD D;  1N33 E;  5LMN I;  2JEA B;  5JEA D;  5GME A;  3QT5 A;  4JI0 E;  1ZM9 A;  4B3M E;  3JAM C;  1KIJ A;  4P52 A;  4HYM A;  4FW3 A;  4XTJ A;  2V34 A;  1MG7 A;  2VQE E;  4LF7 I;  4GKJ I;  2BV3 A;  2UXC E;  1Z0W A;  2BA1 G;  3DD6 A;  4X66 I;  4DR1 E;  4DR5 I;  1N34 E;  4NXM E;  3H1C A;  5BR8 E;  1N33 I;  3J80 Q;  1R6M A;  1XXE A;  4DUY E;  3K17 A;  4LCF A;  2UXB E;  3ZKB A;  4JI0 I;  2Z5E A;  4DV4 E;  4B3M I;  2NN6 A;  4HXZ A;  2NPF A;  5FLX Q;  2C39 B;  3J81 Q;  2PO2 A;  3Q6M A;  3J7A M;  4OO1 C;  2OI2 A;  3H4L A;  2HFU A;  1OYP A;  3T1Y E;  2VQF E;  2Z5C B;  2C37 A;  1NHJ A;  4IZJ A;  4I3H A;  4M1K A;  4NXM I;  1Y4U A;  5K36 C;  2DEI A;  1D6T A;  1N0V C;  4IFD A;  2CGE A;  4WUD A;  2UXB I;  3HJC A;  2PO1 A;  2J7K A;  4USM A;  4DV4 I;  4PU9 A;  5JEA A;  2V8P A;  4HAC B;  2ZM6 E;  4DU8 A;  4OO1 B;  1N36 I;  3B78 A;  5DRP A;  4WUC A;  4NXN E;  1A6F A;  2WNR B;  1Z5B A;  2C38 A;  1UDN A;  1IBM I;  1Y5Y A;  3P76 A;  1RHY A;  1WUU A;  1MX0 A;  4LFC E;  4IFD E;  2UUA I;  3LTO A;  1ZM4 A;  4DPX A;  3CWV A;  4YY3 E;  1FWL A;  2DEJ A;  5JEA E;  5K36 B;  2R3V A;  4OO1 D;  4BA2 B;  4B3R I;  1RRE A;  1ZXM A;  4ZVI A;  5IT9 Q;  4JI6 E;  3CDJ A;  3J7A G;  4DU7 A;  5DNX A;  4JI4 E;  4LCH A;  1NZ0 A;  3B82 A;  2UXD I;  3ZZU A;  2JEB B;  4JV5 E;  2PO0 B; 
#chains in the Genus database with same CATH homology
 4NXN I;  4JG4 A;  1ELO A;  1NHI A;  3HUL A;  1ZXN A;  4R1F A;  4AQY I;  4DV0 E;  1OJ4 A;  4LFC I;  1S16 A;  3P06 A;  4Z7Y A;  4DPW A;  4YY3 I;  1J5E E;  3WU3 A;  5A2Q C;  3K85 A;  2AJ4 A;  4X64 E;  3M6A A;  4JI6 I;  4K0K E;  1Z0B A;  4DV2 I;  2HK3 A;  4OX9 E;  4JI4 I;  4DUZ E;  2LJP A;  1RR9 A;  2V2V A;  4LF8 E;  2HKJ A;  4DV6 E;  4YHH E;  4JI2 E;  4WUB A;  1K47 A;  4DV0 I;  4LF4 E;  3PRY A;  1B62 A;  1XNR E;  4X65 I;  2Z5B B;  4PRV A;  4DR2 I;  1J5E I;  4LFB E;  1I94 E;  1Z5A A;  4HAC A;  4LF6 I;  2VF3 A;  1USU A;  4OX9 I;  4DUZ I;  3J80 C;  2A2D A;  4JI5 E;  3LNU A;  4LF9 I;  4LF8 I;  1IBK E;  4RPF A;  3K1J A;  4YHH I;  4JI2 I;  1EA6 A;  5FLX C;  1HNX E;  3JAM Q;  4N3O A;  3PYF A;  4LF4 I;  2F4V E;  2O1U A;  3OTO E;  2HK2 A;  4KHP E;  4HY1 A;  4LFB I;  3Q6N A;  1I94 I;  2VQE I;  4UT4 A;  2UU9 E;  4LF5 E;  2UXC I;  4DV1 E;  2E5L E;  4P7A A;  5FWK A;  4DR1 I;  3V2U C;  1Y6Z A;  2ZIT A;  4JI5 I;  1N34 I;  1KTV A;  5BR8 I;  2HFS A;  4DUY I;  4UTG A;  1FI4 A;  1NHH A;  5LMU E;  1FNM A;  1HNX I;  2WW4 A;  2F4V I;  4DPU A;  3OTO I;  1H72 C;  2O1W A;  4JI8 E;  3QT6 A;  3V5R A;  1N32 E;  1XNQ E;  4KHP I;  1HNZ E;  1FJG E;  2EFG A;  1Z0V A;  3T1Y I;  4FWG A;  2UU9 I;  4LF5 I;  1U2R A;  2VQF I;  1H7U A;  2R42 A;  1PIE A;  4DV1 I;  5IT9 C;  1Z0T A;  1XMO E;  4FWH A;  2Z5B A;  4DR4 E;  4DV7 E;  4USK A;  3LPS A;  4DR3 E;  4JI8 I;  2ZM6 I;  4MYU A;  3PYE A;  1HNZ I;  1USV A;  4JI1 E;  1N0U A;  2O1T A;  1Z0G A;  3WU5 A;  2UUC E;  3WU6 A;  4DXL A;  2PNM A;  4JYA E;  1XMO I;  1KVK A;  1HNW E;  1FWK A;  4DR4 I;  4DV7 I;  1Y4S A;  2A2C A;  1B63 A;  4DR3 I;  3WU4 A;  4IZK B;  2Z5C A;  4JV5 I;  4FW9 A;  4JI3 E;  1DAR A;  1Z0C A;  4DV5 E;  4JI1 I;  2V2Q A;  4PRX A;  2IOP A;  5A2Q Q;  2O1V A;  4X66 E;  4X64 I;  1HNW I;  4K0K I;  1XHK A;  1UEK A;  3ZZT A;  2CZ9 A;  2PNL A;  4JI3 I;  4DV6 I;  4DV5 I;  1PVG A;  2ZBK B;  3J81 C;  2GS8 A;  4B3S E;  1XNR I;  1H7S A;  1FKA E;  4URL A;  3ZZ0 A;  4JI7 E;  1QZR A;  5GMD A;  2IOQ A;  1EI1 A;  3Q1Q A;  1IBK I;  2GQ0 A;  1N36 E;  2X36 A;  1XMQ E;  2UUB E;  1MU5 A;  1IBM E;  4B3S I;  4FWD A;  4MYT A;  1S4E A;  1PKP A;  3PYD A;  2UUA E;  2X7I A;  4X62 E;  3QT7 A;  4B3T E;  3F0N A;  4IZK A;  4JI7 I;  1ZM3 A;  3ZKD A;  1KKH A;  2BM1 A;  3QT8 A;  4B3R E;  2E5L I;  1Z59 A;  2HKE A;  2XEX A;  4EMD A;  4FN5 A;  2UXD E;  5IWA E;  4DR6 E;  4Z7C A;  1H74 A;  5LMU I;  1XMQ I;  2UUB I;  1IBL E;  4LFA E;  1HR0 E;  2E1R A;  3T1H E;  4AQY E;  1XNQ I;  1N32 I;  2V2Z A;  4X62 I;  4DPT A;  4DV3 E;  1FJG I;  4B3T I;  3ZM7 A;  3GON A;  4DR7 E;  2HHH E;  4DV2 E;  4GKK E;  4ED4 A;  5IWA I;  3D4J A;  4DR6 I;  1HK7 A;  1IBL I;  5LMN E;  2CG9 A;  5L3J A;  4LFA I;  4IZJ B;  1HR0 I;  3T1H I;  1VIS A;  3PYG A;  1BKN A;  4X65 E;  4DV3 I;  2BM0 A;  4DR2 E;  5LL6 R;  2UUC I;  4LF7 E;  4GKJ E;  4DR7 I;  4LF6 E;  2Q2E B;  4IZJ D;  4DPY A;  2HHH I;  1H73 A;  4JYA I;  1Z0E A;  3B8H A;  4GKK I;  1Z5C A;  1ZM2 A;  4DR5 E;  4KQV A;  4LF9 E;  1N33 E;  5LMN I;  5GME A;  3QT5 A;  4JI0 E;  1ZM9 A;  4B3M E;  3JAM C;  1KIJ A;  4P52 A;  4HYM A;  4XTJ A;  2V34 A;  1MG7 A;  2VQE E;  4LF7 I;  4GKJ I;  2BV3 A;  2UXC E;  1Z0W A;  4X66 I;  4DR1 E;  4DR5 I;  1N34 E;  4NXM E;  1N33 I;  5BR8 E;  3J80 Q;  4DUY E;  3K17 A;  2UXB E;  3ZKB A;  4JI0 I;  2Z5E A;  4DV4 E;  4B3M I;  4HXZ A;  2NPF A;  5FLX Q;  3J81 Q;  3Q6M A;  3J7A M;  2OI2 A;  3H4L A;  2HFU A;  3T1Y E;  2VQF E;  2Z5C B;  1NHJ A;  4IZJ A;  4I3H A;  4M1K A;  4NXM I;  1Y4U A;  2DEI A;  1D6T A;  1N0V C;  2CGE A;  4WUD A;  2UXB I;  3HJC A;  2J7K A;  4USM A;  4DV4 I;  4PU9 A;  2V8P A;  4HAC B;  2ZM6 E;  4DU8 A;  1N36 I;  3B78 A;  4WUC A;  4NXN E;  1A6F A;  1Z5B A;  1IBM I;  1WUU A;  1MX0 A;  4LFC E;  2UUA I;  3LTO A;  1ZM4 A;  4DPX A;  3CWV A;  4YY3 E;  1FWL A;  2DEJ A;  2R3V A;  4B3R I;  1RRE A;  1ZXM A;  4ZVI A;  5IT9 Q;  4JI6 E;  3J7A G;  4DU7 A;  4JI4 E;  1NZ0 A;  3B82 A;  2UXD I;  3ZZU A;  4JV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...