1Z0EA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
198
structure length
195
Chain Sequence
b'KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 61
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0eA00
2UXDE 4LF7I 4Z7CA 4WUCA 3J80C 4GKJI 1Z0CA 4DV2I 2E1RA 2HK3A 4FW9A 1Z5BA 1N36E 4LFCE 1ZM3A 4JI0E 4YY3I 2VF3A 4DR5I 4MYUA 2J7KA 3WU3A 1N0UA 1IBLE 3K1JA 4JV5E 2LJPA 4NXMI 4LF4E 1HNXI 1XMQE 4JI1I 1EI1A 1NZ0A 1U2RA 5LMUE 4K0KE 4DR3E 1Z0TA 4DV5I 1Z0EA 4MYTA 1Z0GA 3ZKDA 4X65E 2V34A 2UXDI 4OX9E 4X66E 2AJ4A 4FN5A 3D4JA 1BKNA 4URLA 1QZRA 4DV6E 4B3MI 1XNRE 1Z0VA 4LF6E 2V2QA 4B3TI 1N0VC 2ZBKB 4KQVA 3LTOA 4LFAI 2HKJA 1FKAE 2A2CA 3PYFA 1N33E 2A2DA 4WUDA 3T1YI 3OTOI 2V8PA 4P7AA 4AQYE 4JI6E 4B3RI 5IWAE 4JI8E 4X65I 1S16A 4ZVIA 4OX9I 2DEJA 2UXCI 1DARA 3ZZTA 2UUAI 4DV3I 1XNQE 4DR7E 3QT7A 3V2UC 1I94I 3B8HA 4JI4E 1HR0I 4X64I 4DUYI 4DV1I 4JI7E 5BR8I 2UUCE 1NHHA 4USKA 4HY1A 4HACA 2WW4A 1N32I 1EA6A 2UUBI 3CWVA 4GKKI 2VQFE 4JYAI 1IBME 1HNWE 2DEIA 3J81Q 3PYGA 3ZKBA 1FWLA 4NXNE 4DUZI 1MG7A 4LF5E 4ED4A 3K17A 4WUBA 2VQEE 4DV4E 1RREA 5A2QQ 4JI5E 2HFUA 3ZZ0A 4HYMA 1FWKA 2E5LI 5L3JA 4FWDA 4LFBE 4DPYA 2UXBE 4DV7E 4DXLA 3ZM7A 4KHPI 4DR2E 4X62E 4UT4A 4DR6I 1IBKI 2HHHI 1Z59A 4B3SI 2BM0A 3H4LA 5GMDA 1HNWI 5LMNE 1UEKA 4LF8E 1ZM9A 3M6AA 2UU9E 2XEXA 2V2ZA 2HFSA 1N36I 4LFCI 4LF9E 4JI0I 4DV0E 5GMEA 4UTGA 3T1HE 4FWGA 4DPTA 1H72C 2BM1A 1IBLI 4JV5I 3LPSA 2BV3A 4JI3E 3WU6A 4LF4I 1PVGA 3PYEA 1XMQI 3J7AM 4LFBI 4YHHE 1PIEA 3V5RA 5LMUI 4DR2I 4K0KI 1XMOE 2X36A 4DR3I 2ZM6E 1MU5A 1HNZE 5LMNI 1H73A 2CZ9A 1KIJA 4DR4E 4X66I 2GS8A 3PYDA 4DPWA 3QT6A 1Z0WA 4HACB 1KVKA 2Q2EB 3J81C 4DR1E 4USMA 4DV6I 4LF7E 1XNRI 1VISA 4GKJE 4DV2E 4LF6I 4YY3E 1PKPA 4JG4A 5A2QC 1N33I 4YHHI 4DR5E 1D6TA 2HK2A 4NXME 3QT8A 1HNXE 4JI1E 1OJ4A 4AQYI 4JI6I 5IWAI 1K47A 4RPFA 4JI8I 4DU7A 4Z7YA 1NHIA 4PRVA 3WU5A 4DV5E 1FJGE 4JI2E 1MX0A 1ZXMA 4DR7I 1XNQI 3GONA 4DR1I 4JI4I 3HULA 1NHJA 3LNUA 4EMDA 4DPUA 4JI7I 2UUCI 2HKEA 1J5EE 1Z0BA 1Z5AA 4B3ME 4B3TE 2VQFI 4LFAE 1IBMI 1RR9A 3Q1QA 4NXNI 1N34E 3ZZUA 1ZM2A 3T1YE 3J7AG 3OTOE 4LF5I 3J80Q 1H7SA 2VQEI 4I3HA 4PRXA 4DV4I 1KTVA 4B3RE 4JI5I 1FJGI 4JI2I 1H7UA 2EFGA 4DPXA 3B82A 1B62A 4R1FA 2F4VE 1ELOA 3JAMC 4DV7I 2UXBI 2UXCE 5IT9C 2UUAE 4DV3E 1S4EA 1KKHA 1I94E 1J5EI 1Z5CA 4X62I 1HR0E 4X64E 4DUYE 4DV1E 4FWHA 4XTJA 5BR8E 3WU4A 1WUUA 4LF8I 1N32E 2UU9I 4P52A 1N34I 3QT5A 2UUBE 4DU8A 3JAMQ 4LF9I 4JYAE 4GKKE 5IT9Q 4DV0I 3T1HI 5LL6R 2R42A 4DUZE 2ZITA 4JI3I 1FI4A 5FLXC 4PU9A 2NPFA 1FNMA 2X7IA 2F4VI 1ZXNA 4M1KA 3F0NA 2OI2A 1XHKA 4HXZA 2E5LE 1XMOI 1B63A 2R3VA 2ZM6I 1H74A 4KHPE 1HNZI 4DR6E 1IBKE 2HHHE 5FLXQ 4DR4I 4B3SE 1ZM4A 3B78A 2V2VA 1A6FA
chains in the Genus database with same CATH superfamily
5DNLA 4OO1B 2UXDE 5DRPA 4LF7I 4Z7CA 5K36F 4WUCA 3J80C 4GKJI 1Z0CA 4DV2I 2E1RA 2HK3A 2IOPA 2PNMA 1Z5BA 4FW9A 1N36E 4LFCE 1ZM3A 4JI0E 4YY3I 2VF3A 4DR5I 1OYRA 4MYUA 2J7KA 3WU3A 1N0UA 4BA1A 3K1JA 1IBLE 4JV5E 3UHMA 2PO0B 2LJPA 4AIDA 4NXMI 4LF4E 1HNXI 1XMQE 2NN6E 4JI1I 2NN6A 1R6LA 5K36B 1E3PA 1EI1A 1NZ0A 1U2RA 5LMUE 4QNJA 4K0KE 4LOMA 4DR3E 1Z0TA 2WNRA 4DV5I 1OYSA 1Z0EA 5C0XF 4MYTA 1Z0GA 3ZKDA 4X65E 3M85G 2V34A 2UXDI 2NN6C 4OX9E 4X66E 2AJ4A 4FN5A 3D4JA 4MQYA 1Y4UA 1BKNA 4URLA 2Z5CB 1QZRA 2PO1B 3HJCA 2C38A 3K85A 5DROA 4DV6E 1Y6ZA 4B3MI 1XNRE 4IS9A 1Z0VA 5C0XB 2BA1D 4LF6E 2V2QA 4B3TI 1N0VC 2ZBKB 4KQVA 3LTOA 4LFAI 4MU1A 2HKJA 1FKAE 2A2CA 4AIMA 3PYFA 1N33E 3P3CA 2A2DA 2O1TA 4WUDA 3M7ND 3T1YI 3OTOI 1USVA 2V8PA 4MU4A 3P76A 4FW3A 4U3BA 4OO1D 2C39A 4LCFA 4P7AA 4AQYE 4JI6E 4B3RI 5IWAE 4JI8E 2O1WA 4X65I 1S16A 4ZVIA 1UDQA 4OX9I 3L7ZB 2DEJA 2Z5BB 1DARA 2UXCI 3ZZTA 2UUAI 4DV3I 1XNQE 4DR7E 3QT7A 3V2UC 1I94I 3B8HA 4JI4E 2CGEA 1HR0I 2PNZA 4X64I 4OO1F 4DUYI 4DV1I 5K36D 4JI7E 2PNLA 5BR8I 2UUCE 1NHHA 4FW4A 4USKA 2NN6F 4HY1A 3U1KA 4HACA 2WW4A 1N32I 4BA2A 1EA6A 2UUBI 5JEAE 5JEAA 3CWVA 4GKKI 2VQFE 4JYAI 1IBME 1HNWE 2JE6B 2DEIA 1UDSA 3J81Q 3PYGA 3ZKBA 4BA1B 2GO3A 1FWLA 3CDIA 4NXNE 4DUZI 3CDJA 1MG7A 3P3EA 4LF5E 4ED4A 3K17A 2NN6B 4WUBA 2VQEE 4DV4E 1RREA 2JE6A 5A2QQ 2HFUA 5C0XD 4JI5E 3ZZ0A 3HKMA 4IZJA 4HYMA 4IZKA 5JEAC 1FWKA 1HK7A 2E5LI 2WNRB 5L3JA 2IESA 4FWDA 4LFBE 2JEAA 4DPYA 2UXBE 4DV7E 4DXLA 4IFDE 3ZM7A 4IFDA 1UDNA 4KHPI 4DR2E 4X62E 4UT4A 4DR6I 1IBKI 4MU3A 2HHHI 1Z59A 2O3ZA 4B3SI 2BM0A 3H4LA 2C38B 4LCHA 5ELWA 3NZKA 5GMDA 1HNWI 3PS3A 5LMNE 1UEKA 2PO2A 2IERA 4LF8E 1ZM9A 3M6AA 2CG9A 2UU9E 2XEXA 2V2ZA 2CVEA 2HFSA 2VESA 4IFDC 1N36I 4LFCI 4LF9E 4JI0I 2GO4A 4DV0E 5GMEA 4UTGA 3T1HE 4FWGA 4DPTA 1H72C 3Q6NA 2BM1A 4OZEA 3H1CA 5K36E 2JEBA 1IBLI 4JV5I 3LPSA 2BV3A 4JI3E 3WU6A 2C39B 4LF4I 1PVGA 3PYEA 4ISAA 1XMQI 3J7AM 4LFBI 3PRYA 2O1UA 4YHHE 3M85D 1PIEA 2AE8A 5DRRA 4LCGA 3V5RA 5LMUI 4DR2I 4K0KI 4QNKA 1XMOE 2X36A 4FW6A 4J3DA 4DR3I 2ZM6E 5EL9A 1MU5A 2WP8A 1OYPA 2PNZB 2NN6D 1HNZE 5LMNI 1H73A 2CZ9A 1KIJA 4DR4E 4X66I 1XXEA 2GS8A 3PYDA 4DPWA 3QT6A 1Z0WA 4HACB 1KVKA 2Q2EB 3J81C 4DR1E 4USMA 4BA2B 4DV6I 4LF7E 1XNRI 3Q6MA 1VISA 5JEAB 3DD6A 4DV2E 4GKJE 4LF6I 4FW7A 2BA0G 4YY3E 2IOQA 1PKPA 4JG4A 5A2QC 1N33I 4YHHI 4DR5E 3GCMA 4N3OA 1D6TA 1USUA 2HK2A 4NXME 3QT8A 3KRNA 1HNXE 4JI1E 5DNXA 4IZJB 2BR2A 1OJ4A 4AQYI 4IZKB 5IWAI 4JI6I 3U1YA 1K47A 4RPFA 4JI8I 3PS1A 4DU7A 4Z7YA 2F1DA 1NHIA 4PRVA 3WU5A 2JEAB 1E3HA 4DV5E 1FJGE 4IFDB 4JI2E 1MX0A 2C37A 1ZXMA 4DR7I 1XNQI 3GONA 3P06A 4DR1I 4JI4I 3HULA 1NHJA 3LNUA 4EMDA 4DPUA 4JI7I 5FWKA 2UUCI 2HKEA 4MDTA 2PO2B 1J5EE 1Z0BA 1Z5AA 4B3ME 4OO1E 4OO1A 4B3TE 1RHYA 1UDOA 2VQFI 4LFAE 1IBMI 1RR9A 3Q1QA 2JEBB 2Z5EA 4NXNI 1N34E 3ZZUA 1ZM2A 3T1YE 3J7AG 3OTOE 4LF5I 3J80Q 1H7SA 2BA1G 2PO0A 2VQEI 4I3HA 4PRXA 4OO1C 4DV4I 1KTVA 4B3RE 4JI5I 1FJGI 4MU0A 4JI2I 1H7UA 2EFGA 5EKWA 5JEAD 5K36A 4DPXA 3B82A 1B62A 4R1FA 2J65A 1Y60A 3M7NG 2F4VE 1ELOA 2WP8B 3GMEA 3JAMC 4DV7I 2UXBI 2UXCE 5IT9C 2UUAE 4DV3E 1S4EA 1KKHA 1I94E 1J5EI 1Z5CA 4X62I 2JT2A 4X64E 1HR0E 4DUYE 4DV1E 4IZJD 4FWHA 4XTJA 3B4TA 1YHCA 5BR8E 5K36C 5JEAF 1Y5YA 3WU4A 1WUUA 3GLLA 2Z5CA 2PO1A 4LF8I 1Y4SA 1N32E 2UU9I 4P52A 4IFDD 1N34I 3QT5A 5C0XE 5C0XA 2UUBE 1R6MA 4DU8A 3JAMQ 4LF9I 4JYAE 4GKKE 5IT9Q 4DV0I 3T1HI 5LL6R 5DRQA 2R42A 4DUZE 2ZITA 1YH8A 4JI3I 4GQUA 1FI4A 5FLXC 4PU9A 3P3GA 2NPFA 1FNMA 2X7IA 2BR2B 4LPFA 2F4VI 1ZXNA 4M1KA 3F0NA 2OI2A 4IFDF 5C0XC 1XHKA 4HXZA 2E5LE 1XMOI 3PS2A 1B63A 2R3VA 4AM3A 2C37B 2ZM6I 3L7ZA 1H74A 4OKGA 4U3DA 4KHPE 2Z5BA 1HNZI 4DR6E 1IBKE 2HHHE 5FLXQ 2O1VA 4NBQA 4DR4I 1VI7A 4B3SE 1P42A 2BA0D 1ZM4A 3B78A 2GQ0A 2V2VA 4FW5A 1A6FA
chains in the Genus database with same CATH topology
2UXDE 4LF7I 4Z7CA 4WUCA 3J80C 4GKJI 1Z0CA 4DV2I 2E1RA 2HK3A 2IOPA 2PNMA 1Z5BA 4FW9A 1N36E 4LFCE 1ZM3A 4JI0E 4YY3I 2VF3A 4DR5I 4MYUA 2J7KA 3WU3A 1N0UA 1IBLE 3K1JA 4JV5E 2LJPA 4NXMI 4LF4E 1HNXI 1XMQE 4JI1I 1EI1A 1NZ0A 1U2RA 5LMUE 4K0KE 4DR3E 1Z0TA 4DV5I 1Z0EA 4MYTA 1Z0GA 3ZKDA 4X65E 2V34A 2UXDI 4OX9E 4X66E 2AJ4A 4FN5A 3D4JA 1Y4UA 1BKNA 4URLA 2Z5CB 1QZRA 3HJCA 3K85A 4DV6E 1Y6ZA 4B3MI 1XNRE 1Z0VA 4LF6E 2V2QA 4B3TI 1N0VC 2ZBKB 4KQVA 3LTOA 4LFAI 2HKJA 1FKAE 2A2CA 3PYFA 1N33E 2A2DA 2O1TA 4WUDA 3T1YI 3OTOI 1USVA 2V8PA 4P7AA 4AQYE 4JI6E 4B3RI 5IWAE 4JI8E 2O1WA 4X65I 1S16A 4ZVIA 4OX9I 2DEJA 2Z5BB 1DARA 2UXCI 3ZZTA 2UUAI 4DV3I 1XNQE 4DR7E 3QT7A 3V2UC 1I94I 3B8HA 4JI4E 2CGEA 1HR0I 4X64I 4DUYI 4DV1I 4JI7E 2PNLA 5BR8I 2UUCE 1NHHA 4USKA 4HY1A 4HACA 2WW4A 1N32I 1EA6A 2UUBI 3CWVA 4GKKI 2VQFE 4JYAI 1IBME 1HNWE 2DEIA 3J81Q 3PYGA 3ZKBA 1FWLA 4NXNE 4DUZI 1MG7A 4LF5E 4ED4A 3K17A 4WUBA 2VQEE 4DV4E 1RREA 5A2QQ 4JI5E 2HFUA 3ZZ0A 4IZJA 4HYMA 4IZKA 1FWKA 1HK7A 2E5LI 5L3JA 4FWDA 4LFBE 4DPYA 2UXBE 4DV7E 4DXLA 3ZM7A 4KHPI 4DR2E 4X62E 4UT4A 4DR6I 1IBKI 2HHHI 1Z59A 4B3SI 2BM0A 3H4LA 5GMDA 1HNWI 5LMNE 1UEKA 4LF8E 1ZM9A 3M6AA 2CG9A 2UU9E 2XEXA 2V2ZA 2HFSA 1N36I 4LFCI 4LF9E 4JI0I 4DV0E 5GMEA 4UTGA 3T1HE 4FWGA 4DPTA 1H72C 3Q6NA 2BM1A 1IBLI 4JV5I 3LPSA 2BV3A 4JI3E 3WU6A 4LF4I 1PVGA 3PYEA 1XMQI 3J7AM 4LFBI 3PRYA 2O1UA 4YHHE 1PIEA 3V5RA 5LMUI 4DR2I 4K0KI 1XMOE 2X36A 4DR3I 2ZM6E 1MU5A 1HNZE 5LMNI 1H73A 2CZ9A 1KIJA 4DR4E 4X66I 2GS8A 3PYDA 4DPWA 3QT6A 1Z0WA 4HACB 1KVKA 2Q2EB 3J81C 4DR1E 4USMA 4DV6I 4LF7E 1XNRI 3Q6MA 1VISA 4GKJE 4DV2E 4LF6I 4YY3E 2IOQA 1PKPA 4JG4A 5A2QC 1N33I 4YHHI 4DR5E 4N3OA 1D6TA 1USUA 2HK2A 4NXME 3QT8A 1HNXE 4JI1E 4IZJB 1OJ4A 4AQYI 4IZKB 5IWAI 4JI6I 1K47A 4RPFA 4JI8I 4DU7A 4Z7YA 1NHIA 4PRVA 3WU5A 4DV5E 1FJGE 4JI2E 1MX0A 1ZXMA 4DR7I 1XNQI 3GONA 3P06A 4DR1I 4JI4I 3HULA 1NHJA 3LNUA 4EMDA 4DPUA 4JI7I 5FWKA 2UUCI 2HKEA 1J5EE 1Z0BA 1Z5AA 4B3ME 4B3TE 2VQFI 4LFAE 1IBMI 1RR9A 3Q1QA 2Z5EA 4NXNI 1N34E 3ZZUA 1ZM2A 3T1YE 3J7AG 3OTOE 4LF5I 3J80Q 1H7SA 2VQEI 4I3HA 4PRXA 4DV4I 1KTVA 4B3RE 4JI5I 1FJGI 4JI2I 1H7UA 2EFGA 4DPXA 3B82A 1B62A 4R1FA 2F4VE 1ELOA 3JAMC 4DV7I 2UXBI 2UXCE 5IT9C 2UUAE 4DV3E 1S4EA 1KKHA 1I94E 1J5EI 1Z5CA 4X62I 1HR0E 4X64E 4DUYE 4DV1E 4IZJD 4FWHA 4XTJA 5BR8E 3WU4A 1WUUA 2Z5CA 4LF8I 1Y4SA 1N32E 2UU9I 4P52A 1N34I 3QT5A 2UUBE 4DU8A 3JAMQ 4LF9I 4JYAE 4GKKE 5IT9Q 4DV0I 3T1HI 5LL6R 2R42A 4DUZE 2ZITA 4JI3I 1FI4A 5FLXC 4PU9A 2NPFA 1FNMA 2X7IA 2F4VI 1ZXNA 4M1KA 3F0NA 2OI2A 1XHKA 4HXZA 2E5LE 1XMOI 1B63A 2R3VA 2ZM6I 1H74A 4KHPE 2Z5BA 1HNZI 4DR6E 1IBKE 2HHHE 5FLXQ 2O1VA 4DR4I 4B3SE 1ZM4A 3B78A 2GQ0A 2V2VA 1A6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD E;  4LF7 I;  4Z7C A;  4WUC A;  3J80 C;  4GKJ I;  1Z0C A;  4DV2 I;  2E1R A;  2HK3 A;  4FW9 A;  1Z5B A;  1N36 E;  4LFC E;  1ZM3 A;  4JI0 E;  4YY3 I;  2VF3 A;  4DR5 I;  4MYU A;  2J7K A;  3WU3 A;  1N0U A;  1IBL E;  3K1J A;  4JV5 E;  2LJP A;  4NXM I;  4LF4 E;  1HNX I;  1XMQ E;  4JI1 I;  1EI1 A;  1NZ0 A;  1U2R A;  5LMU E;  4K0K E;  4DR3 E;  1Z0T A;  4DV5 I;  1Z0E A;  4MYT A;  1Z0G A;  3ZKD A;  4X65 E;  2V34 A;  2UXD I;  4OX9 E;  4X66 E;  2AJ4 A;  4FN5 A;  3D4J A;  1BKN A;  4URL A;  1QZR A;  4DV6 E;  4B3M I;  1XNR E;  1Z0V A;  4LF6 E;  2V2Q A;  4B3T I;  1N0V C;  2ZBK B;  4KQV A;  3LTO A;  4LFA I;  2HKJ A;  1FKA E;  2A2C A;  3PYF A;  1N33 E;  2A2D A;  4WUD A;  3T1Y I;  3OTO I;  2V8P A;  4P7A A;  4AQY E;  4JI6 E;  4B3R I;  5IWA E;  4JI8 E;  4X65 I;  1S16 A;  4ZVI A;  4OX9 I;  2DEJ A;  2UXC I;  1DAR A;  3ZZT A;  2UUA I;  4DV3 I;  1XNQ E;  4DR7 E;  3QT7 A;  3V2U C;  1I94 I;  3B8H A;  4JI4 E;  1HR0 I;  4X64 I;  4DUY I;  4DV1 I;  4JI7 E;  5BR8 I;  2UUC E;  1NHH A;  4USK A;  4HY1 A;  4HAC A;  2WW4 A;  1N32 I;  1EA6 A;  2UUB I;  3CWV A;  4GKK I;  2VQF E;  4JYA I;  1IBM E;  1HNW E;  2DEI A;  3J81 Q;  3PYG A;  3ZKB A;  1FWL A;  4NXN E;  4DUZ I;  1MG7 A;  4LF5 E;  4ED4 A;  3K17 A;  4WUB A;  2VQE E;  4DV4 E;  1RRE A;  5A2Q Q;  4JI5 E;  2HFU A;  3ZZ0 A;  4HYM A;  1FWK A;  2E5L I;  5L3J A;  4FWD A;  4LFB E;  4DPY A;  2UXB E;  4DV7 E;  4DXL A;  3ZM7 A;  4KHP I;  4DR2 E;  4X62 E;  4UT4 A;  4DR6 I;  1IBK I;  2HHH I;  1Z59 A;  4B3S I;  2BM0 A;  3H4L A;  5GMD A;  1HNW I;  5LMN E;  1UEK A;  4LF8 E;  1ZM9 A;  3M6A A;  2UU9 E;  2XEX A;  2V2Z A;  2HFS A;  1N36 I;  4LFC I;  4LF9 E;  4JI0 I;  4DV0 E;  5GME A;  4UTG A;  3T1H E;  4FWG A;  4DPT A;  1H72 C;  2BM1 A;  1IBL I;  4JV5 I;  3LPS A;  2BV3 A;  4JI3 E;  3WU6 A;  4LF4 I;  1PVG A;  3PYE A;  1XMQ I;  3J7A M;  4LFB I;  4YHH E;  1PIE A;  3V5R A;  5LMU I;  4DR2 I;  4K0K I;  1XMO E;  2X36 A;  4DR3 I;  2ZM6 E;  1MU5 A;  1HNZ E;  5LMN I;  1H73 A;  2CZ9 A;  1KIJ A;  4DR4 E;  4X66 I;  2GS8 A;  3PYD A;  4DPW A;  3QT6 A;  1Z0W A;  4HAC B;  1KVK A;  2Q2E B;  3J81 C;  4DR1 E;  4USM A;  4DV6 I;  4LF7 E;  1XNR I;  1VIS A;  4GKJ E;  4DV2 E;  4LF6 I;  4YY3 E;  1PKP A;  4JG4 A;  5A2Q C;  1N33 I;  4YHH I;  4DR5 E;  1D6T A;  2HK2 A;  4NXM E;  3QT8 A;  1HNX E;  4JI1 E;  1OJ4 A;  4AQY I;  4JI6 I;  5IWA I;  1K47 A;  4RPF A;  4JI8 I;  4DU7 A;  4Z7Y A;  1NHI A;  4PRV A;  3WU5 A;  4DV5 E;  1FJG E;  4JI2 E;  1MX0 A;  1ZXM A;  4DR7 I;  1XNQ I;  3GON A;  4DR1 I;  4JI4 I;  3HUL A;  1NHJ A;  3LNU A;  4EMD A;  4DPU A;  4JI7 I;  2UUC I;  2HKE A;  1J5E E;  1Z0B A;  1Z5A A;  4B3M E;  4B3T E;  2VQF I;  4LFA E;  1IBM I;  1RR9 A;  3Q1Q A;  4NXN I;  1N34 E;  3ZZU A;  1ZM2 A;  3T1Y E;  3J7A G;  3OTO E;  4LF5 I;  3J80 Q;  1H7S A;  2VQE I;  4I3H A;  4PRX A;  4DV4 I;  1KTV A;  4B3R E;  4JI5 I;  1FJG I;  4JI2 I;  1H7U A;  2EFG A;  4DPX A;  3B82 A;  1B62 A;  4R1F A;  2F4V E;  1ELO A;  3JAM C;  4DV7 I;  2UXB I;  2UXC E;  5IT9 C;  2UUA E;  4DV3 E;  1S4E A;  1KKH A;  1I94 E;  1J5E I;  1Z5C A;  4X62 I;  1HR0 E;  4X64 E;  4DUY E;  4DV1 E;  4FWH A;  4XTJ A;  5BR8 E;  3WU4 A;  1WUU A;  4LF8 I;  1N32 E;  2UU9 I;  4P52 A;  1N34 I;  3QT5 A;  2UUB E;  4DU8 A;  3JAM Q;  4LF9 I;  4JYA E;  4GKK E;  5IT9 Q;  4DV0 I;  3T1H I;  5LL6 R;  2R42 A;  4DUZ E;  2ZIT A;  4JI3 I;  1FI4 A;  5FLX C;  4PU9 A;  2NPF A;  1FNM A;  2X7I A;  2F4V I;  1ZXN A;  4M1K A;  3F0N A;  2OI2 A;  1XHK A;  4HXZ A;  2E5L E;  1XMO I;  1B63 A;  2R3V A;  2ZM6 I;  1H74 A;  4KHP E;  1HNZ I;  4DR6 E;  1IBK E;  2HHH E;  5FLX Q;  4DR4 I;  4B3S E;  1ZM4 A;  3B78 A;  2V2V A;  1A6F A; 
#chains in the Genus database with same CATH topology
 5DNL A;  4OO1 B;  2UXD E;  5DRP A;  4LF7 I;  4Z7C A;  5K36 F;  4WUC A;  3J80 C;  4GKJ I;  1Z0C A;  4DV2 I;  2E1R A;  2HK3 A;  2IOP A;  2PNM A;  1Z5B A;  4FW9 A;  1N36 E;  4LFC E;  1ZM3 A;  4JI0 E;  4YY3 I;  2VF3 A;  4DR5 I;  1OYR A;  4MYU A;  2J7K A;  3WU3 A;  1N0U A;  4BA1 A;  3K1J A;  1IBL E;  4JV5 E;  3UHM A;  2PO0 B;  2LJP A;  4AID A;  4NXM I;  4LF4 E;  1HNX I;  1XMQ E;  2NN6 E;  4JI1 I;  2NN6 A;  1R6L A;  5K36 B;  1E3P A;  1EI1 A;  1NZ0 A;  1U2R A;  5LMU E;  4QNJ A;  4K0K E;  4LOM A;  4DR3 E;  1Z0T A;  2WNR A;  4DV5 I;  1OYS A;  1Z0E A;  5C0X F;  4MYT A;  1Z0G A;  3ZKD A;  4X65 E;  3M85 G;  2V34 A;  2UXD I;  2NN6 C;  4OX9 E;  4X66 E;  2AJ4 A;  4FN5 A;  3D4J A;  4MQY A;  1Y4U A;  1BKN A;  4URL A;  2Z5C B;  1QZR A;  2PO1 B;  3HJC A;  2C38 A;  3K85 A;  5DRO A;  4DV6 E;  1Y6Z A;  4B3M I;  1XNR E;  4IS9 A;  1Z0V A;  5C0X B;  2BA1 D;  4LF6 E;  2V2Q A;  4B3T I;  1N0V C;  2ZBK B;  4KQV A;  3LTO A;  4LFA I;  4MU1 A;  2HKJ A;  1FKA E;  2A2C A;  4AIM A;  3PYF A;  1N33 E;  3P3C A;  2A2D A;  2O1T A;  4WUD A;  3M7N D;  3T1Y I;  3OTO I;  1USV A;  2V8P A;  4MU4 A;  3P76 A;  4FW3 A;  4U3B A;  4OO1 D;  2C39 A;  4LCF A;  4P7A A;  4AQY E;  4JI6 E;  4B3R I;  5IWA E;  4JI8 E;  2O1W A;  4X65 I;  1S16 A;  4ZVI A;  1UDQ A;  4OX9 I;  3L7Z B;  2DEJ A;  2Z5B B;  1DAR A;  2UXC I;  3ZZT A;  2UUA I;  4DV3 I;  1XNQ E;  4DR7 E;  3QT7 A;  3V2U C;  1I94 I;  3B8H A;  4JI4 E;  2CGE A;  1HR0 I;  2PNZ A;  4X64 I;  4OO1 F;  4DUY I;  4DV1 I;  5K36 D;  4JI7 E;  2PNL A;  5BR8 I;  2UUC E;  1NHH A;  4FW4 A;  4USK A;  2NN6 F;  4HY1 A;  3U1K A;  4HAC A;  2WW4 A;  1N32 I;  4BA2 A;  1EA6 A;  2UUB I;  5JEA E;  5JEA A;  3CWV A;  4GKK I;  2VQF E;  4JYA I;  1IBM E;  1HNW E;  2JE6 B;  2DEI A;  1UDS A;  3J81 Q;  3PYG A;  3ZKB A;  4BA1 B;  2GO3 A;  1FWL A;  3CDI A;  4NXN E;  4DUZ I;  3CDJ A;  1MG7 A;  3P3E A;  4LF5 E;  4ED4 A;  3K17 A;  2NN6 B;  4WUB A;  2VQE E;  4DV4 E;  1RRE A;  2JE6 A;  5A2Q Q;  2HFU A;  5C0X D;  4JI5 E;  3ZZ0 A;  3HKM A;  4IZJ A;  4HYM A;  4IZK A;  5JEA C;  1FWK A;  1HK7 A;  2E5L I;  2WNR B;  5L3J A;  2IES A;  4FWD A;  4LFB E;  2JEA A;  4DPY A;  2UXB E;  4DV7 E;  4DXL A;  4IFD E;  3ZM7 A;  4IFD A;  1UDN A;  4KHP I;  4DR2 E;  4X62 E;  4UT4 A;  4DR6 I;  1IBK I;  4MU3 A;  2HHH I;  1Z59 A;  2O3Z A;  4B3S I;  2BM0 A;  3H4L A;  2C38 B;  4LCH A;  5ELW A;  3NZK A;  5GMD A;  1HNW I;  3PS3 A;  5LMN E;  1UEK A;  2PO2 A;  2IER A;  4LF8 E;  1ZM9 A;  3M6A A;  2CG9 A;  2UU9 E;  2XEX A;  2V2Z A;  2CVE A;  2HFS A;  2VES A;  4IFD C;  1N36 I;  4LFC I;  4LF9 E;  4JI0 I;  2GO4 A;  4DV0 E;  5GME A;  4UTG A;  3T1H E;  4FWG A;  4DPT A;  1H72 C;  3Q6N A;  2BM1 A;  4OZE A;  3H1C A;  5K36 E;  2JEB A;  1IBL I;  4JV5 I;  3LPS A;  2BV3 A;  4JI3 E;  3WU6 A;  2C39 B;  4LF4 I;  1PVG A;  3PYE A;  4ISA A;  1XMQ I;  3J7A M;  4LFB I;  3PRY A;  2O1U A;  4YHH E;  3M85 D;  1PIE A;  2AE8 A;  5DRR A;  4LCG A;  3V5R A;  5LMU I;  4DR2 I;  4K0K I;  4QNK A;  1XMO E;  2X36 A;  4FW6 A;  4J3D A;  4DR3 I;  2ZM6 E;  5EL9 A;  1MU5 A;  2WP8 A;  1OYP A;  2PNZ B;  2NN6 D;  1HNZ E;  5LMN I;  1H73 A;  2CZ9 A;  1KIJ A;  4DR4 E;  4X66 I;  1XXE A;  2GS8 A;  3PYD A;  4DPW A;  3QT6 A;  1Z0W A;  4HAC B;  1KVK A;  2Q2E B;  3J81 C;  4DR1 E;  4USM A;  4BA2 B;  4DV6 I;  4LF7 E;  1XNR I;  3Q6M A;  1VIS A;  5JEA B;  3DD6 A;  4DV2 E;  4GKJ E;  4LF6 I;  4FW7 A;  2BA0 G;  4YY3 E;  2IOQ A;  1PKP A;  4JG4 A;  5A2Q C;  1N33 I;  4YHH I;  4DR5 E;  3GCM A;  4N3O A;  1D6T A;  1USU A;  2HK2 A;  4NXM E;  3QT8 A;  3KRN A;  1HNX E;  4JI1 E;  5DNX A;  4IZJ B;  2BR2 A;  1OJ4 A;  4AQY I;  4IZK B;  5IWA I;  4JI6 I;  3U1Y A;  1K47 A;  4RPF A;  4JI8 I;  3PS1 A;  4DU7 A;  4Z7Y A;  2F1D A;  1NHI A;  4PRV A;  3WU5 A;  2JEA B;  1E3H A;  4DV5 E;  1FJG E;  4IFD B;  4JI2 E;  1MX0 A;  2C37 A;  1ZXM A;  4DR7 I;  1XNQ I;  3GON A;  3P06 A;  4DR1 I;  4JI4 I;  3HUL A;  1NHJ A;  3LNU A;  4EMD A;  4DPU A;  4JI7 I;  5FWK A;  2UUC I;  2HKE A;  4MDT A;  2PO2 B;  1J5E E;  1Z0B A;  1Z5A A;  4B3M E;  4OO1 E;  4OO1 A;  4B3T E;  1RHY A;  1UDO A;  2VQF I;  4LFA E;  1IBM I;  1RR9 A;  3Q1Q A;  2JEB B;  2Z5E A;  4NXN I;  1N34 E;  3ZZU A;  1ZM2 A;  3T1Y E;  3J7A G;  3OTO E;  4LF5 I;  3J80 Q;  1H7S A;  2BA1 G;  2PO0 A;  2VQE I;  4I3H A;  4PRX A;  4OO1 C;  4DV4 I;  1KTV A;  4B3R E;  4JI5 I;  1FJG I;  4MU0 A;  4JI2 I;  1H7U A;  2EFG A;  5EKW A;  5JEA D;  5K36 A;  4DPX A;  3B82 A;  1B62 A;  4R1F A;  2J65 A;  1Y60 A;  3M7N G;  2F4V E;  1ELO A;  2WP8 B;  3GME A;  3JAM C;  4DV7 I;  2UXB I;  2UXC E;  5IT9 C;  2UUA E;  4DV3 E;  1S4E A;  1KKH A;  1I94 E;  1J5E I;  1Z5C A;  4X62 I;  2JT2 A;  4X64 E;  1HR0 E;  4DUY E;  4DV1 E;  4IZJ D;  4FWH A;  4XTJ A;  3B4T A;  1YHC A;  5BR8 E;  5K36 C;  5JEA F;  1Y5Y A;  3WU4 A;  1WUU A;  3GLL A;  2Z5C A;  2PO1 A;  4LF8 I;  1Y4S A;  1N32 E;  2UU9 I;  4P52 A;  4IFD D;  1N34 I;  3QT5 A;  5C0X E;  5C0X A;  2UUB E;  1R6M A;  4DU8 A;  3JAM Q;  4LF9 I;  4JYA E;  4GKK E;  5IT9 Q;  4DV0 I;  3T1H I;  5LL6 R;  5DRQ A;  2R42 A;  4DUZ E;  2ZIT A;  1YH8 A;  4JI3 I;  4GQU A;  1FI4 A;  5FLX C;  4PU9 A;  3P3G A;  2NPF A;  1FNM A;  2X7I A;  2BR2 B;  4LPF A;  2F4V I;  1ZXN A;  4M1K A;  3F0N A;  2OI2 A;  4IFD F;  5C0X C;  1XHK A;  4HXZ A;  2E5L E;  1XMO I;  3PS2 A;  1B63 A;  2R3V A;  4AM3 A;  2C37 B;  2ZM6 I;  3L7Z A;  1H74 A;  4OKG A;  4U3D A;  4KHP E;  2Z5B A;  1HNZ I;  4DR6 E;  1IBK E;  2HHH E;  5FLX Q;  2O1V A;  4NBQ A;  4DR4 I;  1VI7 A;  4B3S E;  1P42 A;  2BA0 D;  1ZM4 A;  3B78 A;  2GQ0 A;  2V2V A;  4FW5 A;  1A6F A; 
#chains in the Genus database with same CATH homology
 2UXD E;  4LF7 I;  4Z7C A;  4WUC A;  3J80 C;  4GKJ I;  1Z0C A;  4DV2 I;  2E1R A;  2HK3 A;  2IOP A;  2PNM A;  1Z5B A;  4FW9 A;  1N36 E;  4LFC E;  1ZM3 A;  4JI0 E;  4YY3 I;  2VF3 A;  4DR5 I;  4MYU A;  2J7K A;  3WU3 A;  1N0U A;  1IBL E;  3K1J A;  4JV5 E;  2LJP A;  4NXM I;  4LF4 E;  1HNX I;  1XMQ E;  4JI1 I;  1EI1 A;  1NZ0 A;  1U2R A;  5LMU E;  4K0K E;  4DR3 E;  1Z0T A;  4DV5 I;  1Z0E A;  4MYT A;  1Z0G A;  3ZKD A;  4X65 E;  2V34 A;  2UXD I;  4OX9 E;  4X66 E;  2AJ4 A;  4FN5 A;  3D4J A;  1Y4U A;  1BKN A;  4URL A;  2Z5C B;  1QZR A;  3HJC A;  3K85 A;  4DV6 E;  1Y6Z A;  4B3M I;  1XNR E;  1Z0V A;  4LF6 E;  2V2Q A;  4B3T I;  1N0V C;  2ZBK B;  4KQV A;  3LTO A;  4LFA I;  2HKJ A;  1FKA E;  2A2C A;  3PYF A;  1N33 E;  2A2D A;  2O1T A;  4WUD A;  3T1Y I;  3OTO I;  1USV A;  2V8P A;  4P7A A;  4AQY E;  4JI6 E;  4B3R I;  5IWA E;  4JI8 E;  2O1W A;  4X65 I;  1S16 A;  4ZVI A;  4OX9 I;  2DEJ A;  2Z5B B;  1DAR A;  2UXC I;  3ZZT A;  2UUA I;  4DV3 I;  1XNQ E;  4DR7 E;  3QT7 A;  3V2U C;  1I94 I;  3B8H A;  4JI4 E;  2CGE A;  1HR0 I;  4X64 I;  4DUY I;  4DV1 I;  4JI7 E;  2PNL A;  5BR8 I;  2UUC E;  1NHH A;  4USK A;  4HY1 A;  4HAC A;  2WW4 A;  1N32 I;  1EA6 A;  2UUB I;  3CWV A;  4GKK I;  2VQF E;  4JYA I;  1IBM E;  1HNW E;  2DEI A;  3J81 Q;  3PYG A;  3ZKB A;  1FWL A;  4NXN E;  4DUZ I;  1MG7 A;  4LF5 E;  4ED4 A;  3K17 A;  4WUB A;  2VQE E;  4DV4 E;  1RRE A;  5A2Q Q;  4JI5 E;  2HFU A;  3ZZ0 A;  4IZJ A;  4HYM A;  4IZK A;  1FWK A;  1HK7 A;  2E5L I;  5L3J A;  4FWD A;  4LFB E;  4DPY A;  2UXB E;  4DV7 E;  4DXL A;  3ZM7 A;  4KHP I;  4DR2 E;  4X62 E;  4UT4 A;  4DR6 I;  1IBK I;  2HHH I;  1Z59 A;  4B3S I;  2BM0 A;  3H4L A;  5GMD A;  1HNW I;  5LMN E;  1UEK A;  4LF8 E;  1ZM9 A;  3M6A A;  2CG9 A;  2UU9 E;  2XEX A;  2V2Z A;  2HFS A;  1N36 I;  4LFC I;  4LF9 E;  4JI0 I;  4DV0 E;  5GME A;  4UTG A;  3T1H E;  4FWG A;  4DPT A;  1H72 C;  3Q6N A;  2BM1 A;  1IBL I;  4JV5 I;  3LPS A;  2BV3 A;  4JI3 E;  3WU6 A;  4LF4 I;  1PVG A;  3PYE A;  1XMQ I;  3J7A M;  4LFB I;  3PRY A;  2O1U A;  4YHH E;  1PIE A;  3V5R A;  5LMU I;  4DR2 I;  4K0K I;  1XMO E;  2X36 A;  4DR3 I;  2ZM6 E;  1MU5 A;  1HNZ E;  5LMN I;  1H73 A;  2CZ9 A;  1KIJ A;  4DR4 E;  4X66 I;  2GS8 A;  3PYD A;  4DPW A;  3QT6 A;  1Z0W A;  4HAC B;  1KVK A;  2Q2E B;  3J81 C;  4DR1 E;  4USM A;  4DV6 I;  4LF7 E;  1XNR I;  3Q6M A;  1VIS A;  4GKJ E;  4DV2 E;  4LF6 I;  4YY3 E;  2IOQ A;  1PKP A;  4JG4 A;  5A2Q C;  1N33 I;  4YHH I;  4DR5 E;  4N3O A;  1D6T A;  1USU A;  2HK2 A;  4NXM E;  3QT8 A;  1HNX E;  4JI1 E;  4IZJ B;  1OJ4 A;  4AQY I;  4IZK B;  5IWA I;  4JI6 I;  1K47 A;  4RPF A;  4JI8 I;  4DU7 A;  4Z7Y A;  1NHI A;  4PRV A;  3WU5 A;  4DV5 E;  1FJG E;  4JI2 E;  1MX0 A;  1ZXM A;  4DR7 I;  1XNQ I;  3GON A;  3P06 A;  4DR1 I;  4JI4 I;  3HUL A;  1NHJ A;  3LNU A;  4EMD A;  4DPU A;  4JI7 I;  5FWK A;  2UUC I;  2HKE A;  1J5E E;  1Z0B A;  1Z5A A;  4B3M E;  4B3T E;  2VQF I;  4LFA E;  1IBM I;  1RR9 A;  3Q1Q A;  2Z5E A;  4NXN I;  1N34 E;  3ZZU A;  1ZM2 A;  3T1Y E;  3J7A G;  3OTO E;  4LF5 I;  3J80 Q;  1H7S A;  2VQE I;  4I3H A;  4PRX A;  4DV4 I;  1KTV A;  4B3R E;  4JI5 I;  1FJG I;  4JI2 I;  1H7U A;  2EFG A;  4DPX A;  3B82 A;  1B62 A;  4R1F A;  2F4V E;  1ELO A;  3JAM C;  4DV7 I;  2UXB I;  2UXC E;  5IT9 C;  2UUA E;  4DV3 E;  1S4E A;  1KKH A;  1I94 E;  1J5E I;  1Z5C A;  4X62 I;  1HR0 E;  4X64 E;  4DUY E;  4DV1 E;  4IZJ D;  4FWH A;  4XTJ A;  5BR8 E;  3WU4 A;  1WUU A;  2Z5C A;  4LF8 I;  1Y4S A;  1N32 E;  2UU9 I;  4P52 A;  1N34 I;  3QT5 A;  2UUB E;  4DU8 A;  3JAM Q;  4LF9 I;  4JYA E;  4GKK E;  5IT9 Q;  4DV0 I;  3T1H I;  5LL6 R;  2R42 A;  4DUZ E;  2ZIT A;  4JI3 I;  1FI4 A;  5FLX C;  4PU9 A;  2NPF A;  1FNM A;  2X7I A;  2F4V I;  1ZXN A;  4M1K A;  3F0N A;  2OI2 A;  1XHK A;  4HXZ A;  2E5L E;  1XMO I;  1B63 A;  2R3V A;  2ZM6 I;  1H74 A;  4KHP E;  2Z5B A;  1HNZ I;  4DR6 E;  1IBK E;  2HHH E;  5FLX Q;  2O1V A;  4DR4 I;  4B3S E;  1ZM4 A;  3B78 A;  2GQ0 A;  2V2V A;  1A6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...