4GQUA

Crystal structure of hisb from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
191
structure length
191
Chain Sequence
b'SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Imidazoleglycerol-phosphate dehydratase
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 62
structure length 191
sequence length 191
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00475 IGPD Imidazoleglycerol-phosphate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4gquA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4gquA02
4MU4A 4LOMA 4MU0A 4QNJA 5ELWA 5EKWA 4MU1A 4GQUA 4MU3A 4LPFA 5DNLA 1RHYA 2F1DA 4QNKA 5EL9A 5DNXA 2AE8A
chains in the Genus database with same CATH superfamily
2IOPA 4IFDB 4NXMI 4MU0A 2GQ0A 1ZM2A 2CZ9A 4DR4E 3WU6A 4K0KI 1H73A 1I94I 3ZKDA 5FWKA 5GMDA 2O1WA 1N33I 3T1HE 4DV6I 4BA2B 4DR5I 3U1KA 4GKJE 2NN6D 2WP8B 2IESA 2UUCI 1VI7A 2F4VE 2BR2B 2J7KA 4B3RI 1Y4UA 5DROA 4M1KA 5K36E 2ZM6E 1USUA 1RR9A 4IS9A 5LMUE 1HNZE 2PO1B 4DV5E 3JAMC 4JI8I 5C0XE 2Z5EA 4XTJA 5LL6R 4LFCE 5K36B 4DPTA 4DUYE 4DV7E 4DV4E 2UXBE 5EL9A 5C0XB 3L7ZB 4DR7I 1N34E 4DR1E 4QNJA 2HK3A 4JI2I 2NN6F 1H7SA 2C37B 1RHYA 2BA0G 2X36A 4B3ME 4LFBE 4Z7CA 5DRQA 2PNZB 3T1YI 4JI7I 4LFAE 1MU5A 1Z0BA 3QT5A 4OO1E 4DR2I 4U3DA 4N3OA 1ZM3A 1DARA 1FWKA 4ZVIA 2UXDE 4BA1B 2C38B 2Q2EB 1R6MA 2Z5CB 4DUZI 4JI0E 4OO1B 1XHKA 4HY1A 1XNRI 3K1JA 2JE6B 3QT7A 4KQVA 4P7AA 2WNRB 1Z5AA 4GQUA 4IZJA 2GO4A 2UU9I 1D6TA 4JYAE 3CWVA 1KKHA 1IBLE 5LMNI 4DV2I 1EA6A 4YHHE 3H4LA 3P3EA 4LF5E 4NXNI 2E1RA 3OTOE 4X62I 1N0VC 3LTOA 2BV3A 4X64I 4IZKA 5C0XC 2UUBE 3P3CA 2E5LE 3M6AA 1KVKA 5ELWA 1N32I 3J7AG 5JEAE 4IFDD 2AJ4A 1PKPA 4DPXA 4X65I 4FWDA 3M85D 3HULA 4OZEA 4B3SE 4DR4I 1VISA 4FWGA 4HACB 1UDSA 4FW9A 2VF3A 5A2QQ 5JEAB 2O3ZA 4Z7YA 1U2RA 2HKJA 1UEKA 3LNUA 4MU4A 4LF7I 1NHHA 1Z5CA 3M7ND 4DR3E 2F4VI 4JI1E 3GMEA 2JEAA 5DNLA 2ZM6I 4NBQA 4DXLA 3CDIA 5EKWA 4OO1C 3H1CA 2V2ZA 1Z59A 2C39A 4DV5I 4DV1E 4DV3I 2HHHE 4JI6I 4JI4E 2BM1A 4DR6E 1S16A 4AIMA 3B78A 2VQFE 4IFDF 5K36D 4LFCI 2UXCE 4LF4E 1S4EA 4AQYE 3P06A 4DUYI 4UTGA 4DV7I 5C0XD 4DV4I 2UXBI 4JG4A 5DRRA 3HKMA 2A2CA 5FLXC 4X66E 3DD6A 4MU3A 1XMQI 4JI3E 1Z0TA 2PO2A 1K47A 2R3VA 1FNMA 2PO0A 4FW7A 1XNQI 4LCHA 2DEJA 1E3HA 4DV6E 1OYRA 2O1UA 2PNMA 2NN6A 3GCMA 3KRNA 4WUBA 2ZBKB 3B8HA 4EMDA 4B3MI 2PO1A 3QT6A 2CVEA 1PIEA 3J81C 4FW3A 4DV0E 4LFBI 3B4TA 4USMA 2UUCE 1QZRA 2HFSA 4MQYA 4FW5A 1IBME 4LFAI 2LJPA 2JEBB 4LF8I 3JAMQ 3P3GA 1A6FA 4ED4A 5K36F 4YY3I 4URLA 1IBKE 4DPYA 5JEAC 2BA1G 2VQEE 4HXZA 4OO1D 3Q6NA 1Y60A 5C0XF 3UHMA 3Q6MA 1N36E 2BM0A 2PNLA 1OJ4A 1XMOE 4JI5E 4DPUA 3K17A 3J81Q 4PRXA 4R1FA 4LF9E 1FKAE 2GS8A 4JV5I 2F1DA 1HNWE 4OX9E 5IWAE 4MDTA 3M85G 3WU5A 4LF5I 3K85A 1HNXE 2O1TA 4IZJB 4B3TE 4PRVA 1ZXNA 3OTOI 4LF6I 1Z0WA 2R42A 3ZZTA 4USKA 5DRPA 3PYGA 1FJGE 1N0UA 2V2QA 1FWLA 1Y4SA 2AE8A 2UUBI 3F0NA 2WNRA 4DPWA 4OO1F 1HR0E 5IT9C 2A2DA 1WUUA 2BA0D 2DEIA 3GLLA 1Z0EA 2IOQA 4KHPI 1BKNA 1RREA 4IZKB 3QT8A 2NN6C 3ZZ0A 2UUAE 5JEAD 3P76A 4FW4A 1XXEA 4WUDA 1B63A 1MX0A 1H72C 1ZXMA 1OYSA 5LMNE 4DV2E 3T1HI 1Y6ZA 4GKJI 1H7UA 4FN5A 1Z5BA 4LPFA 2Z5BA 1UDNA 3PS1A 3U1YA 1FI4A 4IFDE 4LCFA 1YH8A 4DR6I 3PRYA 2VQFI 5BR8E 2V8PA 4FW6A 4IFDA 5LMUI 2UXCI 4LF4I 2JEAB 4ISAA 1J5EE 1HNZI 4GKKE 4AQYI 4X65E 2WW4A 3HJCA 4I3HA 3V2UC 5JEAF 2C39B 1NHJA 4X66I 4JI3I 4BA2A 1NZ0A 4P52A 2GO3A 4LCGA 3V5RA 1E3PA 4NXME 4DU8A 4J3DA 2WP8A 4WUCA 4MYTA 5L3JA 1N34I 4K0KE 4LF7E 4DR1I 2NN6E 1I94E 1KIJA 2V34A 2IERA 2BR2A 4DV0I 1N33E 1NHIA 2PO2B 4DR5E 2PO0B 1IBMI 3PYEA 2NN6B 4DV3E 1IBKI 4JI6E 3ZZUA 5K36A 1R6LA 2VQEI 4B3RE 2X7IA 5GMEA 1N36I 5C0XA 2HK2A 3L7ZA 4HYMA 5FLXQ 1XMOI 4JI5I 2UXDI 4JI8E 3D4JA 2HKEA 4OKGA 3J80C 2VESA 4JI0I 3ZM7A 1UDOA 2C37A 4LF9I 1XMQE 2NPFA 1ZM4A 3PYFA 1XNQE 3CDJA 1HNWI 2JEBA 4OX9I 3B82A 5IWAI 4DR7E 4IZJD 1HNXI 1KTVA 4B3TI 4JYAI 2HFUA 4MYUA 1IBLI 2PNZA 4JI2E 4QNKA 4YHHI 1FJGI 4IFDC 4U3BA 1EI1A 4LF8E 4BA1A 4LOMA 2C38A 3J80Q 1HR0I 4DU7A 1Z0GA 2Z5CA 4YY3E 3WU3A 4OO1A 3NZKA 3T1YE 2JE6A 4JI7E 3PYDA 4DR2E 2E5LI 3J7AM 1YHCA 2UUAI 2CG9A 1H74A 3PS3A 1UDQA 2O1VA 3M7NG 4PU9A 3ZKBA 2CGEA 4B3SI 4DUZE 5DNXA 1XNRE 1USVA 2EFGA 2J65A 4AM3A 4JV5E 1Y5YA 2BA1D 4MU1A 2UU9E 1Z0CA 5A2QC 4LF6E 5K36C 1Z0VA 4FWHA 4DR3I 3PS2A 1P42A 1PVGA 1MG7A 4JI1I 4NXNE 5IT9Q 4UT4A 5BR8I 1ZM9A 3WU4A 4X62E 4RPFA 1J5EI 1ELOA 4GKKI 4DV1I 3LPSA 2HHHI 3Q1QA 2Z5BB 4JI4I 2V2VA 4X64E 2OI2A 1HK7A 2XEXA 4HACA 2JT2A 4KHPE 5JEAA 3GONA 4AIDA 2ZITA 1N32E 1OYPA 1B62A
chains in the Genus database with same CATH topology
4MU4A 4LOMA 4MU0A 4QNJA 5ELWA 5EKWA 4MU1A 4GQUA 4MU3A 4LPFA 5DNLA 1RHYA 2F1DA 4QNKA 5EL9A 5DNXA 2AE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MU4 A;  4LOM A;  4MU0 A;  4QNJ A;  5ELW A;  5EKW A;  4MU1 A;  4GQU A;  4MU3 A;  4LPF A;  5DNL A;  1RHY A;  2F1D A;  4QNK A;  5EL9 A;  5DNX A;  2AE8 A; 
#chains in the Genus database with same CATH topology
 2IOP A;  4IFD B;  4NXM I;  4MU0 A;  2GQ0 A;  1ZM2 A;  2CZ9 A;  4DR4 E;  3WU6 A;  4K0K I;  1H73 A;  1I94 I;  3ZKD A;  5FWK A;  5GMD A;  2O1W A;  1N33 I;  3T1H E;  4DV6 I;  4BA2 B;  4DR5 I;  3U1K A;  4GKJ E;  2NN6 D;  2WP8 B;  2IES A;  2UUC I;  1VI7 A;  2F4V E;  2BR2 B;  2J7K A;  4B3R I;  1Y4U A;  5DRO A;  4M1K A;  5K36 E;  2ZM6 E;  1USU A;  1RR9 A;  4IS9 A;  5LMU E;  1HNZ E;  2PO1 B;  4DV5 E;  3JAM C;  4JI8 I;  5C0X E;  2Z5E A;  4XTJ A;  5LL6 R;  4LFC E;  5K36 B;  4DPT A;  4DUY E;  4DV7 E;  4DV4 E;  2UXB E;  5EL9 A;  5C0X B;  3L7Z B;  4DR7 I;  1N34 E;  4DR1 E;  4QNJ A;  2HK3 A;  4JI2 I;  2NN6 F;  1H7S A;  2C37 B;  1RHY A;  2BA0 G;  2X36 A;  4B3M E;  4LFB E;  4Z7C A;  5DRQ A;  2PNZ B;  3T1Y I;  4JI7 I;  4LFA E;  1MU5 A;  1Z0B A;  3QT5 A;  4OO1 E;  4DR2 I;  4U3D A;  4N3O A;  1ZM3 A;  1DAR A;  1FWK A;  4ZVI A;  2UXD E;  4BA1 B;  2C38 B;  2Q2E B;  1R6M A;  2Z5C B;  4DUZ I;  4JI0 E;  4OO1 B;  1XHK A;  4HY1 A;  1XNR I;  3K1J A;  2JE6 B;  3QT7 A;  4KQV A;  4P7A A;  2WNR B;  1Z5A A;  4GQU A;  4IZJ A;  2GO4 A;  2UU9 I;  1D6T A;  4JYA E;  3CWV A;  1KKH A;  1IBL E;  5LMN I;  4DV2 I;  1EA6 A;  4YHH E;  3H4L A;  3P3E A;  4LF5 E;  4NXN I;  2E1R A;  3OTO E;  4X62 I;  1N0V C;  3LTO A;  2BV3 A;  4X64 I;  4IZK A;  5C0X C;  2UUB E;  3P3C A;  2E5L E;  3M6A A;  1KVK A;  5ELW A;  1N32 I;  3J7A G;  5JEA E;  4IFD D;  2AJ4 A;  1PKP A;  4DPX A;  4X65 I;  4FWD A;  3M85 D;  3HUL A;  4OZE A;  4B3S E;  4DR4 I;  1VIS A;  4FWG A;  4HAC B;  1UDS A;  4FW9 A;  2VF3 A;  5A2Q Q;  5JEA B;  2O3Z A;  4Z7Y A;  1U2R A;  2HKJ A;  1UEK A;  3LNU A;  4MU4 A;  4LF7 I;  1NHH A;  1Z5C A;  3M7N D;  4DR3 E;  2F4V I;  4JI1 E;  3GME A;  2JEA A;  5DNL A;  2ZM6 I;  4NBQ A;  4DXL A;  3CDI A;  5EKW A;  4OO1 C;  3H1C A;  2V2Z A;  1Z59 A;  2C39 A;  4DV5 I;  4DV1 E;  4DV3 I;  2HHH E;  4JI6 I;  4JI4 E;  2BM1 A;  4DR6 E;  1S16 A;  4AIM A;  3B78 A;  2VQF E;  4IFD F;  5K36 D;  4LFC I;  2UXC E;  4LF4 E;  1S4E A;  4AQY E;  3P06 A;  4DUY I;  4UTG A;  4DV7 I;  5C0X D;  4DV4 I;  2UXB I;  4JG4 A;  5DRR A;  3HKM A;  2A2C A;  5FLX C;  4X66 E;  3DD6 A;  4MU3 A;  1XMQ I;  4JI3 E;  1Z0T A;  2PO2 A;  1K47 A;  2R3V A;  1FNM A;  2PO0 A;  4FW7 A;  1XNQ I;  4LCH A;  2DEJ A;  1E3H A;  4DV6 E;  1OYR A;  2O1U A;  2PNM A;  2NN6 A;  3GCM A;  3KRN A;  4WUB A;  2ZBK B;  3B8H A;  4EMD A;  4B3M I;  2PO1 A;  3QT6 A;  2CVE A;  1PIE A;  3J81 C;  4FW3 A;  4DV0 E;  4LFB I;  3B4T A;  4USM A;  2UUC E;  1QZR A;  2HFS A;  4MQY A;  4FW5 A;  1IBM E;  4LFA I;  2LJP A;  2JEB B;  4LF8 I;  3JAM Q;  3P3G A;  1A6F A;  4ED4 A;  5K36 F;  4YY3 I;  4URL A;  1IBK E;  4DPY A;  5JEA C;  2BA1 G;  2VQE E;  4HXZ A;  4OO1 D;  3Q6N A;  1Y60 A;  5C0X F;  3UHM A;  3Q6M A;  1N36 E;  2BM0 A;  2PNL A;  1OJ4 A;  1XMO E;  4JI5 E;  4DPU A;  3K17 A;  3J81 Q;  4PRX A;  4R1F A;  4LF9 E;  1FKA E;  2GS8 A;  4JV5 I;  2F1D A;  1HNW E;  4OX9 E;  5IWA E;  4MDT A;  3M85 G;  3WU5 A;  4LF5 I;  3K85 A;  1HNX E;  2O1T A;  4IZJ B;  4B3T E;  4PRV A;  1ZXN A;  3OTO I;  4LF6 I;  1Z0W A;  2R42 A;  3ZZT A;  4USK A;  5DRP A;  3PYG A;  1FJG E;  1N0U A;  2V2Q A;  1FWL A;  1Y4S A;  2AE8 A;  2UUB I;  3F0N A;  2WNR A;  4DPW A;  4OO1 F;  1HR0 E;  5IT9 C;  2A2D A;  1WUU A;  2BA0 D;  2DEI A;  3GLL A;  1Z0E A;  2IOQ A;  4KHP I;  1BKN A;  1RRE A;  4IZK B;  3QT8 A;  2NN6 C;  3ZZ0 A;  2UUA E;  5JEA D;  3P76 A;  4FW4 A;  1XXE A;  4WUD A;  1B63 A;  1MX0 A;  1H72 C;  1ZXM A;  1OYS A;  5LMN E;  4DV2 E;  3T1H I;  1Y6Z A;  4GKJ I;  1H7U A;  4FN5 A;  1Z5B A;  4LPF A;  2Z5B A;  1UDN A;  3PS1 A;  3U1Y A;  1FI4 A;  4IFD E;  4LCF A;  1YH8 A;  4DR6 I;  3PRY A;  2VQF I;  5BR8 E;  2V8P A;  4FW6 A;  4IFD A;  5LMU I;  2UXC I;  4LF4 I;  2JEA B;  4ISA A;  1J5E E;  1HNZ I;  4GKK E;  4AQY I;  4X65 E;  2WW4 A;  3HJC A;  4I3H A;  3V2U C;  5JEA F;  2C39 B;  1NHJ A;  4X66 I;  4JI3 I;  4BA2 A;  1NZ0 A;  4P52 A;  2GO3 A;  4LCG A;  3V5R A;  1E3P A;  4NXM E;  4DU8 A;  4J3D A;  2WP8 A;  4WUC A;  4MYT A;  5L3J A;  1N34 I;  4K0K E;  4LF7 E;  4DR1 I;  2NN6 E;  1I94 E;  1KIJ A;  2V34 A;  2IER A;  2BR2 A;  4DV0 I;  1N33 E;  1NHI A;  2PO2 B;  4DR5 E;  2PO0 B;  1IBM I;  3PYE A;  2NN6 B;  4DV3 E;  1IBK I;  4JI6 E;  3ZZU A;  5K36 A;  1R6L A;  2VQE I;  4B3R E;  2X7I A;  5GME A;  1N36 I;  5C0X A;  2HK2 A;  3L7Z A;  4HYM A;  5FLX Q;  1XMO I;  4JI5 I;  2UXD I;  4JI8 E;  3D4J A;  2HKE A;  4OKG A;  3J80 C;  2VES A;  4JI0 I;  3ZM7 A;  1UDO A;  2C37 A;  4LF9 I;  1XMQ E;  2NPF A;  1ZM4 A;  3PYF A;  1XNQ E;  3CDJ A;  1HNW I;  2JEB A;  4OX9 I;  3B82 A;  5IWA I;  4DR7 E;  4IZJ D;  1HNX I;  1KTV A;  4B3T I;  4JYA I;  2HFU A;  4MYU A;  1IBL I;  2PNZ A;  4JI2 E;  4QNK A;  4YHH I;  1FJG I;  4IFD C;  4U3B A;  1EI1 A;  4LF8 E;  4BA1 A;  4LOM A;  2C38 A;  3J80 Q;  1HR0 I;  4DU7 A;  1Z0G A;  2Z5C A;  4YY3 E;  3WU3 A;  4OO1 A;  3NZK A;  3T1Y E;  2JE6 A;  4JI7 E;  3PYD A;  4DR2 E;  2E5L I;  3J7A M;  1YHC A;  2UUA I;  2CG9 A;  1H74 A;  3PS3 A;  1UDQ A;  2O1V A;  3M7N G;  4PU9 A;  3ZKB A;  2CGE A;  4B3S I;  4DUZ E;  5DNX A;  1XNR E;  1USV A;  2EFG A;  2J65 A;  4AM3 A;  4JV5 E;  1Y5Y A;  2BA1 D;  4MU1 A;  2UU9 E;  1Z0C A;  5A2Q C;  4LF6 E;  5K36 C;  1Z0V A;  4FWH A;  4DR3 I;  3PS2 A;  1P42 A;  1PVG A;  1MG7 A;  4JI1 I;  4NXN E;  5IT9 Q;  4UT4 A;  5BR8 I;  1ZM9 A;  3WU4 A;  4X62 E;  4RPF A;  1J5E I;  1ELO A;  4GKK I;  4DV1 I;  3LPS A;  2HHH I;  3Q1Q A;  2Z5B B;  4JI4 I;  2V2V A;  4X64 E;  2OI2 A;  1HK7 A;  2XEX A;  4HAC A;  2JT2 A;  4KHP E;  5JEA A;  3GON A;  4AID A;  2ZIT A;  1N32 E;  1OYP A;  1B62 A; 
#chains in the Genus database with same CATH homology
 4MU4 A;  4LOM A;  4MU0 A;  4QNJ A;  5ELW A;  5EKW A;  4MU1 A;  4GQU A;  4MU3 A;  4LPF A;  5DNL A;  1RHY A;  2F1D A;  4QNK A;  5EL9 A;  5DNX A;  2AE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...