4GQUA

Crystal structure of hisb from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
191
structure length
191
Chain Sequence
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Imidazoleglycerol-phosphate dehydratase
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 62
structure length 191
sequence length 191
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00475 IGPD Imidazoleglycerol-phosphate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4gquA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4gquA02
5EL9A 4MU4A 5ELWA 4MU0A 1RHYA 5DNLA 4QNJA 4QNKA 4LOMA 5DNXA 4GQUA 4LPFA 5EKWA 2F1DA 4MU3A 4MU1A 2AE8A
chains in the Genus database with same CATH superfamily
3B8HA 4DR1I 4DR1E 3V5RA 2UU9I 3ZM7A 2UU9E 2CVEA 4DUZI 4DUZE 3DD6A 4IZJA 2E1RA 4IFDC 3T1HI 4QNKA 3T1HE 2PO1A 2Q2EB 2DEJA 5ELWA 2WNRA 4DPUA 3M85D 4AM3A 1PVGA 1H73A 1NHHA 5LL6R 4B3SE 4B3SI 1WUUA 2CGEA 4LF5I 4LF5E 1A6FA 1R6LA 2BM1A 2UUCI 4HY1A 2UUCE 1KVKA 1ZXMA 5IT9Q 1OYSA 3PS3A 2XEXA 5C0XB 5DRPA 2BM0A 4DV7I 4DV7E 4JI0I 4I3HA 1RR9A 4JI0E 3P06A 4OO1C 4DU7A 4DR6I 4DR6E 1XMOI 3WU5A 2O1UA 1XMOE 2JE6A 3HULA 4MYUA 2C39A 4ZVIA 1HNXI 1KIJA 1HNXE 3K17A 2NN6B 3PYGA 1OYRA 4OO1D 1Y5YA 4GKKI 1FNMA 4GKKE 4JI8I 2PO0A 4JI8E 2UXDI 2UXDE 4IZJB 4GKJI 1MX0A 4GKJE 2A2CA 2IOQA 3LPSA 3ZZ0A 5L3JA 1PIEA 4OX9I 5C0XE 4OX9E 2IOPA 5FLXQ 2WW4A 5A2QQ 3U1KA 4IS9A 4URLA 2HHHI 3V2UC 2PO2A 4YY3I 1B63A 1Z0EA 4YY3E 1ZM4A 1MU5A 3P76A 5FWKA 3GMEA 4JV5I 2JEBB 1ELOA 4AIMA 4JV5E 4RPFA 2UXCI 2UXCE 1Y60A 4R1FA 4ED4A 3U1YA 1H72C 1QZRA 3LTOA 1UDQA 3CDIA 5DNLA 4EMDA 2JEAA 4LF7I 1OJ4A 4LF7E 1NHJA 1Z0CA 5JEAE 2VESA 5DRRA 3ZZTA 3QT6A 4FW9A 1RREA 2ZITA 4JG4A 4DV3I 4DV3E 4JI4I 1NHIA 2IESA 4JI4E 2PO0B 1XHKA 2O3ZA 2UXBI 4MQYA 3QT7A 1Z0VA 4BA1B 1FWLA 2E5LI 2E5LE 3LNUA 1HNWI 1HNWE 5EL9A 1P42A 2GO4A 3CDJA 5IWAE 1UDOA 3WU3A 2HK2A 1HR0I 2OI2A 3Q6MA 1HR0E 1Y4SA 1Z0GA 5C0XC 2EFGA 4PU9A 3P3GA 1KKHA 1J5EI 2HKEA 1J5EE 4DXLA 4P7AA 1RHYA 4DV0I 4DV0E 5IT9C 4DR3I 2HKJA 4DR3E 1UDSA 4DU8A 2V8PA 2BA0D 5C0XD 4MU0A 4OO1F 4HXZA 5GMDA 3L7ZA 4AIDA 1H74A 2C37B 4HACA 4IFDD 3GCMA 4IFDA 1K47A 3M7NG 3ZKDA 4ISAA 2F1DA 3M6AA 3UHMA 1XNRI 5JEAC 1XNRE 3J7AM 2R42A 3PS1A 1ZXNA 3KRNA 1N34I 1N34E 4DV4I 4LF9I 4DV4E 5EKWA 4LF9E 5JEAD 1FI4A 5FLXC 4LCFA 3P3EA 5A2QC 3QT8A 5K36C 2V34A 1XMQI 1R6MA 1USUA 4MDTA 1YHCA 3OTOI 1E3PA 3OTOE 1YH8A 4FWHA 3J80Q 1XXEA 2PO1B 1S4EA 4M1KA 5K36D 5K36A 4KQVA 4X62I 4X62E 4OO1A 1IBLI 1IBMI 1IBLE 1Y4UA 1IBME 2UUAI 2UUAE 4LCGA 1E3HA 3JAMQ 1UEKA 1H7UA 4QNJA 2R3VA 2WNRB 4YHHI 4YHHE 2LJPA 3J81Q 1BKNA 2HHHE 1DARA 1N0UA 2J65A 4DR7I 3GLLA 4DR7E 1NZ0A 1KTVA 1VISA 4BA2A 4LOMA 2NN6E 4JI2I 4JI2E 4OKGA 5DRQA 2J7KA 4FW3A 3WU6A 3B78A 2V2VA 2Z5EA 1Z0BA 4MU1A 1EA6A 2JT2A 5C0XF 2JE6B 3F0NA 4USKA 2UUBI 2UUBE 4JI7I 2C39B 4JI7E 3ZZUA 1ZM2A 2V2ZA 4OO1B 4DPWA 4FN5A 1FKAE 4B3MI 4B3ME 2ZM6I 2HFUA 2ZM6E 2UXBE 4IFDF 2VQEI 4N3OA 2VQEE 5DNXA 2ZBKB 4WUDA 2Z5CA 1Z5AA 2GQ0A 4U3DA 3M7ND 2PO2B 4DR5I 4DR5E 4DPXA 4JI5I 4U3BA 4JI5E 1OYPA 4WUCA 5JEAF 4PRXA 3GONA 1S16A 4B3RI 1D6TA 4Z7CA 4MU3A 4DV6I 4J3DA 4DV6E 4FW5A 3D4JA 2BA1G 2BR2A 1XNQI 4LCHA 1XNQE 2JEAB 5K36F 1VI7A 1B62A 5C0XA 4DV5I 4DV5E 2NPFA 1N33I 2IERA 4DPYA 2NN6C 2O1WA 2DEIA 1N0VC 2GO3A 3J80C 1HNZI 2PNLA 1HNZE 5BR8I 4B3TI 4B3TE 2Z5BA 2GS8A 4MU4A 4LFBI 4LFBE 3H4LA 3PYDA 2NN6D 2NN6A 4DUYI 4DUYE 3JAMC 4IZJD 4P52A 2VQFI 2Z5CB 2VQFE 4IZKA 1U2RA 2F4VI 4NXMI 2F4VE 4NXME 4WUBA 3WU4A 5JEAA 2PNZA 3J81C 4DR4I 4DR4E 1XMQE 3PYEA 4X64I 4NBQA 4X64E 4LF8I 4LF8E 4DV1I 4JI3I 2HFSA 3Q6NA 4DV1E 4JI3E 4LF4E 4LF4I 3HJCA 3ZKBA 2BR2B 4DV2I 1Y6ZA 2JEBA 3PS2A 3H1CA 4DV2E 3Q1QA 2AJ4A 1N36I 1N36E 4LFCI 3L7ZB 4LFCE 4HACB 2BA0G 2CZ9A 3HKMA 4LPFA 5LMUI 5LMUE 4IFDB 2Z5BB 3M85G 4DR2I 4DR2E 3CWVA 3B4TA 2O1VA 1HK7A 4FW7A 1USVA 4IZKB 4OZEA 1Z59A 2AE8A 2PNMA 5JEAB 2PNZB 4BA1A 2HK3A 3QT5A 1UDNA 1PKPA 1Z5CA 1FJGI 1FJGE 5GMEA 5K36B 4IFDE 2WP8A 4DPTA 2BA1D 1ZM3A 3PYFA 3PRYA 3P3CA 4MYTA 2C38A 2BV3A 4PRVA 4JYAI 4JYAE 4HYMA 1I94I 4X65I 2NN6F 4FW6A 2V2QA 4X65E 3T1YI 3T1YE 1I94E 5DROA 1N32E 1N32I 2C37A 3K1JA 4USMA 1FWKA 4LF6I 4LF6E 4X66I 1Z0TA 4AQYI 4X66E 4AQYE 4UTGA 1EI1A 4FWDA 4XTJA 3J7AG 4B3RE 4BA2B 2VF3A 5K36E 3K85A 4LFAI 1MG7A 4LFAE 4OO1E 1ZM9A 1IBKI 1IBKE 4NXNI 4Z7YA 4JI1I 4NXNE 4JI1E 1Z5BA 3NZKA 1Z0WA 5IWAI 1N33E 1H7SA 3B82A 4FWGA 4KHPI 4FW4A 4KHPE 2CG9A 2X36A 5LMNI 2WP8B 5LMNE 2X7IA 4UT4A 2A2DA 4K0KI 5BR8E 4K0KE 4GQUA 4JI6I 2O1TA 4JI6E 2C38B
chains in the Genus database with same CATH topology
5EL9A 4MU4A 5ELWA 4MU0A 1RHYA 5DNLA 4QNJA 4QNKA 4LOMA 5DNXA 4GQUA 4LPFA 5EKWA 2F1DA 4MU3A 4MU1A 2AE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EL9 A;  4MU4 A;  5ELW A;  4MU0 A;  1RHY A;  5DNL A;  4QNJ A;  4QNK A;  4LOM A;  5DNX A;  4GQU A;  4LPF A;  5EKW A;  2F1D A;  4MU3 A;  4MU1 A;  2AE8 A; 
#chains in the Genus database with same CATH topology
 3B8H A;  4DR1 I;  4DR1 E;  3V5R A;  2UU9 I;  3ZM7 A;  2UU9 E;  2CVE A;  4DUZ I;  4DUZ E;  3DD6 A;  4IZJ A;  2E1R A;  4IFD C;  3T1H I;  4QNK A;  3T1H E;  2PO1 A;  2Q2E B;  2DEJ A;  5ELW A;  2WNR A;  4DPU A;  3M85 D;  4AM3 A;  1PVG A;  1H73 A;  1NHH A;  5LL6 R;  4B3S E;  4B3S I;  1WUU A;  2CGE A;  4LF5 I;  4LF5 E;  1A6F A;  1R6L A;  2BM1 A;  2UUC I;  4HY1 A;  2UUC E;  1KVK A;  1ZXM A;  5IT9 Q;  1OYS A;  3PS3 A;  2XEX A;  5C0X B;  5DRP A;  2BM0 A;  4DV7 I;  4DV7 E;  4JI0 I;  4I3H A;  1RR9 A;  4JI0 E;  3P06 A;  4OO1 C;  4DU7 A;  4DR6 I;  4DR6 E;  1XMO I;  3WU5 A;  2O1U A;  1XMO E;  2JE6 A;  3HUL A;  4MYU A;  2C39 A;  4ZVI A;  1HNX I;  1KIJ A;  1HNX E;  3K17 A;  2NN6 B;  3PYG A;  1OYR A;  4OO1 D;  1Y5Y A;  4GKK I;  1FNM A;  4GKK E;  4JI8 I;  2PO0 A;  4JI8 E;  2UXD I;  2UXD E;  4IZJ B;  4GKJ I;  1MX0 A;  4GKJ E;  2A2C A;  2IOQ A;  3LPS A;  3ZZ0 A;  5L3J A;  1PIE A;  4OX9 I;  5C0X E;  4OX9 E;  2IOP A;  5FLX Q;  2WW4 A;  5A2Q Q;  3U1K A;  4IS9 A;  4URL A;  2HHH I;  3V2U C;  2PO2 A;  4YY3 I;  1B63 A;  1Z0E A;  4YY3 E;  1ZM4 A;  1MU5 A;  3P76 A;  5FWK A;  3GME A;  4JV5 I;  2JEB B;  1ELO A;  4AIM A;  4JV5 E;  4RPF A;  2UXC I;  2UXC E;  1Y60 A;  4R1F A;  4ED4 A;  3U1Y A;  1H72 C;  1QZR A;  3LTO A;  1UDQ A;  3CDI A;  5DNL A;  4EMD A;  2JEA A;  4LF7 I;  1OJ4 A;  4LF7 E;  1NHJ A;  1Z0C A;  5JEA E;  2VES A;  5DRR A;  3ZZT A;  3QT6 A;  4FW9 A;  1RRE A;  2ZIT A;  4JG4 A;  4DV3 I;  4DV3 E;  4JI4 I;  1NHI A;  2IES A;  4JI4 E;  2PO0 B;  1XHK A;  2O3Z A;  2UXB I;  4MQY A;  3QT7 A;  1Z0V A;  4BA1 B;  1FWL A;  2E5L I;  2E5L E;  3LNU A;  1HNW I;  1HNW E;  5EL9 A;  1P42 A;  2GO4 A;  3CDJ A;  5IWA E;  1UDO A;  3WU3 A;  2HK2 A;  1HR0 I;  2OI2 A;  3Q6M A;  1HR0 E;  1Y4S A;  1Z0G A;  5C0X C;  2EFG A;  4PU9 A;  3P3G A;  1KKH A;  1J5E I;  2HKE A;  1J5E E;  4DXL A;  4P7A A;  1RHY A;  4DV0 I;  4DV0 E;  5IT9 C;  4DR3 I;  2HKJ A;  4DR3 E;  1UDS A;  4DU8 A;  2V8P A;  2BA0 D;  5C0X D;  4MU0 A;  4OO1 F;  4HXZ A;  5GMD A;  3L7Z A;  4AID A;  1H74 A;  2C37 B;  4HAC A;  4IFD D;  3GCM A;  4IFD A;  1K47 A;  3M7N G;  3ZKD A;  4ISA A;  2F1D A;  3M6A A;  3UHM A;  1XNR I;  5JEA C;  1XNR E;  3J7A M;  2R42 A;  3PS1 A;  1ZXN A;  3KRN A;  1N34 I;  1N34 E;  4DV4 I;  4LF9 I;  4DV4 E;  5EKW A;  4LF9 E;  5JEA D;  1FI4 A;  5FLX C;  4LCF A;  3P3E A;  5A2Q C;  3QT8 A;  5K36 C;  2V34 A;  1XMQ I;  1R6M A;  1USU A;  4MDT A;  1YHC A;  3OTO I;  1E3P A;  3OTO E;  1YH8 A;  4FWH A;  3J80 Q;  1XXE A;  2PO1 B;  1S4E A;  4M1K A;  5K36 D;  5K36 A;  4KQV A;  4X62 I;  4X62 E;  4OO1 A;  1IBL I;  1IBM I;  1IBL E;  1Y4U A;  1IBM E;  2UUA I;  2UUA E;  4LCG A;  1E3H A;  3JAM Q;  1UEK A;  1H7U A;  4QNJ A;  2R3V A;  2WNR B;  4YHH I;  4YHH E;  2LJP A;  3J81 Q;  1BKN A;  2HHH E;  1DAR A;  1N0U A;  2J65 A;  4DR7 I;  3GLL A;  4DR7 E;  1NZ0 A;  1KTV A;  1VIS A;  4BA2 A;  4LOM A;  2NN6 E;  4JI2 I;  4JI2 E;  4OKG A;  5DRQ A;  2J7K A;  4FW3 A;  3WU6 A;  3B78 A;  2V2V A;  2Z5E A;  1Z0B A;  4MU1 A;  1EA6 A;  2JT2 A;  5C0X F;  2JE6 B;  3F0N A;  4USK A;  2UUB I;  2UUB E;  4JI7 I;  2C39 B;  4JI7 E;  3ZZU A;  1ZM2 A;  2V2Z A;  4OO1 B;  4DPW A;  4FN5 A;  1FKA E;  4B3M I;  4B3M E;  2ZM6 I;  2HFU A;  2ZM6 E;  2UXB E;  4IFD F;  2VQE I;  4N3O A;  2VQE E;  5DNX A;  2ZBK B;  4WUD A;  2Z5C A;  1Z5A A;  2GQ0 A;  4U3D A;  3M7N D;  2PO2 B;  4DR5 I;  4DR5 E;  4DPX A;  4JI5 I;  4U3B A;  4JI5 E;  1OYP A;  4WUC A;  5JEA F;  4PRX A;  3GON A;  1S16 A;  4B3R I;  1D6T A;  4Z7C A;  4MU3 A;  4DV6 I;  4J3D A;  4DV6 E;  4FW5 A;  3D4J A;  2BA1 G;  2BR2 A;  1XNQ I;  4LCH A;  1XNQ E;  2JEA B;  5K36 F;  1VI7 A;  1B62 A;  5C0X A;  4DV5 I;  4DV5 E;  2NPF A;  1N33 I;  2IER A;  4DPY A;  2NN6 C;  2O1W A;  2DEI A;  1N0V C;  2GO3 A;  3J80 C;  1HNZ I;  2PNL A;  1HNZ E;  5BR8 I;  4B3T I;  4B3T E;  2Z5B A;  2GS8 A;  4MU4 A;  4LFB I;  4LFB E;  3H4L A;  3PYD A;  2NN6 D;  2NN6 A;  4DUY I;  4DUY E;  3JAM C;  4IZJ D;  4P52 A;  2VQF I;  2Z5C B;  2VQF E;  4IZK A;  1U2R A;  2F4V I;  4NXM I;  2F4V E;  4NXM E;  4WUB A;  3WU4 A;  5JEA A;  2PNZ A;  3J81 C;  4DR4 I;  4DR4 E;  1XMQ E;  3PYE A;  4X64 I;  4NBQ A;  4X64 E;  4LF8 I;  4LF8 E;  4DV1 I;  4JI3 I;  2HFS A;  3Q6N A;  4DV1 E;  4JI3 E;  4LF4 E;  4LF4 I;  3HJC A;  3ZKB A;  2BR2 B;  4DV2 I;  1Y6Z A;  2JEB A;  3PS2 A;  3H1C A;  4DV2 E;  3Q1Q A;  2AJ4 A;  1N36 I;  1N36 E;  4LFC I;  3L7Z B;  4LFC E;  4HAC B;  2BA0 G;  2CZ9 A;  3HKM A;  4LPF A;  5LMU I;  5LMU E;  4IFD B;  2Z5B B;  3M85 G;  4DR2 I;  4DR2 E;  3CWV A;  3B4T A;  2O1V A;  1HK7 A;  4FW7 A;  1USV A;  4IZK B;  4OZE A;  1Z59 A;  2AE8 A;  2PNM A;  5JEA B;  2PNZ B;  4BA1 A;  2HK3 A;  3QT5 A;  1UDN A;  1PKP A;  1Z5C A;  1FJG I;  1FJG E;  5GME A;  5K36 B;  4IFD E;  2WP8 A;  4DPT A;  2BA1 D;  1ZM3 A;  3PYF A;  3PRY A;  3P3C A;  4MYT A;  2C38 A;  2BV3 A;  4PRV A;  4JYA I;  4JYA E;  4HYM A;  1I94 I;  4X65 I;  2NN6 F;  4FW6 A;  2V2Q A;  4X65 E;  3T1Y I;  3T1Y E;  1I94 E;  5DRO A;  1N32 E;  1N32 I;  2C37 A;  3K1J A;  4USM A;  1FWK A;  4LF6 I;  4LF6 E;  4X66 I;  1Z0T A;  4AQY I;  4X66 E;  4AQY E;  4UTG A;  1EI1 A;  4FWD A;  4XTJ A;  3J7A G;  4B3R E;  4BA2 B;  2VF3 A;  5K36 E;  3K85 A;  4LFA I;  1MG7 A;  4LFA E;  4OO1 E;  1ZM9 A;  1IBK I;  1IBK E;  4NXN I;  4Z7Y A;  4JI1 I;  4NXN E;  4JI1 E;  1Z5B A;  3NZK A;  1Z0W A;  5IWA I;  1N33 E;  1H7S A;  3B82 A;  4FWG A;  4KHP I;  4FW4 A;  4KHP E;  2CG9 A;  2X36 A;  5LMN I;  2WP8 B;  5LMN E;  2X7I A;  4UT4 A;  2A2D A;  4K0K I;  5BR8 E;  4K0K E;  4GQU A;  4JI6 I;  2O1T A;  4JI6 E;  2C38 B; 
#chains in the Genus database with same CATH homology
 5EL9 A;  4MU4 A;  5ELW A;  4MU0 A;  1RHY A;  5DNL A;  4QNJ A;  4QNK A;  4LOM A;  5DNX A;  4GQU A;  4LPF A;  5EKW A;  2F1D A;  4MU3 A;  4MU1 A;  2AE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...