4GQUA

Crystal structure of hisb from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
191
structure length
191
Chain Sequence
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Imidazoleglycerol-phosphate dehydratase
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis
total genus 62
structure length 191
sequence length 191
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00475 IGPD Imidazoleglycerol-phosphate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4gquA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4gquA02
1RHYA 4LOMA 5DNLA 5EL9A 4GQUA 2AE8A 4QNJA 4QNKA 5ELWA 5EKWA 2F1DA 4MU4A 5DNXA 4MU0A 4MU1A 4LPFA 4MU3A
chains in the Genus database with same CATH superfamily
2UU9E 1FJGI 3CWVA 2F4VI 1UDNA 5DRPA 1IBME 2UU9I 2UUBE 1FNMA 5K36E 2A2DA 1ZM3A 3CDIA 1BKNA 1IBMI 2HFSA 3ZKBA 1UDOA 4X65E 2UUBI 3GMEA 3D4JA 1A6FA 2VESA 4X65I 4DR1E 3JAMC 4DR1I 4USKA 3PRYA 4DR3E 1XHKA 1H73A 3J80Q 1Y4SA 2CG9A 4LFAE 4DR3I 1ZM4A 2NN6A 2PNZA 4LF7I 1Z5AA 3B78A 5C0XB 2IESA 2PNLA 3ZM7A 4LFAI 1FWLA 2V2QA 5FLXC 3T1YE 3ZKDA 1P42A 4X66I 2IOPA 1Z0GA 3T1YI 4XTJA 4P52A 5DNXA 1N36E 4DPXA 2NN6F 1N34E 4DR7E 2HK3A 3GONA 4BA2B 3K85A 1N36I 4AIDA 1N34I 4DR7I 1E3PA 4FWHA 2PO1A 3V5RA 1OYRA 1N32E 4OO1C 3M85D 4HXZA 1N32I 4DPUA 2C37B 4BA1A 2JEAB 4GKJE 5C0XD 2PO2B 5JEAC 4GKJI 4DV7E 4IFDD 3M7NG 4JI5I 2BA0G 2C39B 2R42A 4DV7I 3M7ND 2BA0D 4NXNE 4DR6E 4U3DA 3P3GA 2BM0A 4NXNI 4LF4E 2BR2A 1ZM2A 3B4TA 4LCFA 4X64E 1XNRE 4LFBE 3Q1QA 4LF4I 2AE8A 4X64I 1XNRI 4LFBI 1DARA 4WUCA 1ZXNA 3UHMA 3Q6MA 2A2CA 1ZM9A 2C38B 4LCHA 4AQYE 1R6MA 2HFUA 4I3HA 1FKAE 2X36A 4AQYI 4IZJA 3B82A 2PNMA 4DU8A 3K1JA 4DUYE 1NHJA 4B3ME 2EFGA 1S4EA 5K36A 4DUYI 1Y60A 4B3MI 4DUZE 2GS8A 4OKGA 1HNXE 5JEAB 4LOMA 4IFDC 1Y6ZA 4ED4A 5IWAE 3PS1A 5LMNE 2PO0A 4DXLA 2BM1A 4DUZI 1HNXI 2Q2EB 1VISA 2JEBA 5IWAI 5LMNI 1XXEA 5K36F 1MX0A 2NN6C 3L7ZB 4OX9E 4JI2E 2ZM6E 1VI7A 2JE6B 3J81C 2O1UA 2CGEA 4OX9I 2J65A 4JI2I 2ZM6I 4DPTA 5FWKA 4OO1D 4DPWA 4MU0A 3P76A 1I94E 3QT6A 1PKPA 2HHHI 1Z59A 1I94I 1XMQE 4J3DA 3T1HE 3LPSA 1XMQI 5JEAD 1N0UA 4JYAE 3T1HI 3P06A 5L3JA 4LF7E 4IZJD 2V34A 4NXME 5FLXQ 4JYAI 2V2VA 1Z0VA 3CDJA 5DROA 1UEKA 3HULA 3QT7A 4NXMI 4X66E 4JI3E 4IFDB 3H4LA 1RR9A 3LTOA 4FW9A 4JV5I 1OJ4A 4MYUA 4QNKA 4JI3I 4LF8E 4DV2E 4M1KA 3B8HA 4U3BA 4LF8I 2Z5CA 4DV2I 4FW6A 2NN6B 2PNZB 2AJ4A 3F0NA 5DRRA 4BA2A 1H7SA 3WU6A 4B3SE 3WU5A 1USVA 2WP8A 4DR2E 1RREA 1WUUA 4JI8E 4B3SI 3HJCA 4DR2I 2WW4A 4DR4E 4UT4A 4DV6E 4JI8I 4X62E 2X7IA 4DU7A 2XEXA 5C0XE 1NHIA 1NHHA 3QT5A 1HK7A 4DR4I 2JEAA 1H74A 4UTGA 4DV6I 4X62I 4JI5E 5DNLA 4PRXA 3WU4A 2VF3A 5DRQA 3KRNA 4DV1E 2O1WA 1S16A 4R1FA 3J7AG 5EL9A 3QT8A 1EI1A 4BA1B 2Z5BA 5K36C 4DV1I 2NN6D 4NBQA 4JI6I 1QZRA 3PYEA 1XNQE 2V8PA 4HACA 4LPFA 5LL6R 4K0KE 1B62A 4JI0E 5EKWA 1FWKA 2UUCE 1XNQI 1KTVA 1HNWE 4Z7CA 4K0KI 4JI0I 2UUCI 1HNWI 1Z0EA 4LF9E 2O3ZA 1N33E 4FW5A 3P3CA 2J7KA 5A2QQ 2BR2B 3LNUA 4OO1B 4LF9I 1N33I 1KKHA 3PS3A 1OYSA 4URLA 1KIJA 3Q6NA 2HKEA 4JI4E 4IS9A 4ZVIA 1B63A 3ZZUA 4JI4I 4IZKA 2LJPA 4PU9A 4RPFA 4IZJB 1D6TA 3PYFA 1Z5CA 2WNRA 3J81Q 4LCGA 1Z5BA 4DV4E 3DD6A 4MU4A 5BR8E 4DV4I 4MU3A 1HNZE 5JEAF 2ZBKB 5GMEA 2PO0B 5BR8I 2HHHE 5IT9C 1HNZI 2O1VA 3ZZ0A 2JEBB 4JI7E 4OZEA 4YY3E 3JAMQ 4JI7I 5JEAE 4YY3I 1Y4UA 1Z0WA 4ISAA 4DV5E 4DV0E 1NZ0A 4LF6E 2JT2A 4DV5I 4DV0I 4JV5E 5K36D 2VQEE 2DEJA 5C0XA 3ZZTA 3K17A 4LF6I 3M6AA 4HY1A 2VQEI 4IFDA 2E1RA 1YHCA 2GO4A 4FWGA 4Z7YA 4GQUA 2F1DA 2BV3A 1PVGA 2GQ0A 5C0XF 2OI2A 2CVEA 1UDQA 4MDTA 1OYPA 1E3HA 3J80C 4IFDF 1PIEA 4WUBA 1KVKA 5LMUE 2IOQA 1MG7A 1FI4A 4DR5E 2Z5CB 2C37A 2R3VA 5LMUI 1HR0E 4DR5I 4IFDE 2UXBE 2NPFA 2PO1B 3U1KA 1H72C 1HR0I 3NZKA 2WP8B 2PO2A 2UXBI 3M85G 1Z0TA 1MU5A 5ELWA 4EMDA 4JI6E 2C39A 2NN6E 4FW3A 4AIMA 4YHHE 3U1YA 1IBLE 4JI1E 2GO3A 4YHHI 1IBLI 2DEIA 2HKJA 1UDSA 4JI1I 1XMOE 4N3OA 1IBKE 2E5LE 4B3TE 4LFCE 4DV3E 4B3TI 1XMOI 1IBKI 4LF5E 2UXCE 2E5LI 1EA6A 1RHYA 2CZ9A 4FW7A 4HYMA 4LFCI 2UUAE 4DV3I 2Z5BB 4LF5I 2UXCI 2BA1G 3PYGA 1J5EE 2UUAI 2C38A 3PS2A 2BA1D 4B3RE 4DR6I 4HACB 2IERA 4JG4A 4OO1A 3V2UC 1J5EI 4MQYA 2HK2A 4B3RI 4KHPE 3P3EA 4DPYA 4MU1A 1USUA 3H1CA 4AM3A 4FN5A 3GLLA 4KHPI 4GKKE 5JEAA 4OO1F 1H7UA 4FWDA 4GKKI 4WUDA 4USMA 1Z0BA 2VQFE 5K36B 1ELOA 2O1TA 3OTOE 1Z0CA 1K47A 3WU3A 5A2QC 2VQFI 2Z5EA 1R6LA 4PRVA 3L7ZA 3HKMA 5IT9Q 4OO1E 1YH8A 4QNJA 3OTOI 4KQVA 1U2RA 2JE6A 5C0XC 4IZKB 1ZXMA 2UXDE 4P7AA 4MYTA 1Y5YA 1N0VC 2V2ZA 3PYDA 2UXDI 2WNRB 4FW4A 3J7AM 1FJGE 2ZITA 3GCMA 5GMDA 2F4VE
chains in the Genus database with same CATH topology
1RHYA 4LOMA 5DNLA 5EL9A 4GQUA 2AE8A 4QNJA 4QNKA 5ELWA 5EKWA 2F1DA 4MU4A 5DNXA 4MU0A 4MU1A 4LPFA 4MU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHY A;  4LOM A;  5DNL A;  5EL9 A;  4GQU A;  2AE8 A;  4QNJ A;  4QNK A;  5ELW A;  5EKW A;  2F1D A;  4MU4 A;  5DNX A;  4MU0 A;  4MU1 A;  4LPF A;  4MU3 A; 
#chains in the Genus database with same CATH topology
 2UU9 E;  1FJG I;  3CWV A;  2F4V I;  1UDN A;  5DRP A;  1IBM E;  2UU9 I;  2UUB E;  1FNM A;  5K36 E;  2A2D A;  1ZM3 A;  3CDI A;  1BKN A;  1IBM I;  2HFS A;  3ZKB A;  1UDO A;  4X65 E;  2UUB I;  3GME A;  3D4J A;  1A6F A;  2VES A;  4X65 I;  4DR1 E;  3JAM C;  4DR1 I;  4USK A;  3PRY A;  4DR3 E;  1XHK A;  1H73 A;  3J80 Q;  1Y4S A;  2CG9 A;  4LFA E;  4DR3 I;  1ZM4 A;  2NN6 A;  2PNZ A;  4LF7 I;  1Z5A A;  3B78 A;  5C0X B;  2IES A;  2PNL A;  3ZM7 A;  4LFA I;  1FWL A;  2V2Q A;  5FLX C;  3T1Y E;  3ZKD A;  1P42 A;  4X66 I;  2IOP A;  1Z0G A;  3T1Y I;  4XTJ A;  4P52 A;  5DNX A;  1N36 E;  4DPX A;  2NN6 F;  1N34 E;  4DR7 E;  2HK3 A;  3GON A;  4BA2 B;  3K85 A;  1N36 I;  4AID A;  1N34 I;  4DR7 I;  1E3P A;  4FWH A;  2PO1 A;  3V5R A;  1OYR A;  1N32 E;  4OO1 C;  3M85 D;  4HXZ A;  1N32 I;  4DPU A;  2C37 B;  4BA1 A;  2JEA B;  4GKJ E;  5C0X D;  2PO2 B;  5JEA C;  4GKJ I;  4DV7 E;  4IFD D;  3M7N G;  4JI5 I;  2BA0 G;  2C39 B;  2R42 A;  4DV7 I;  3M7N D;  2BA0 D;  4NXN E;  4DR6 E;  4U3D A;  3P3G A;  2BM0 A;  4NXN I;  4LF4 E;  2BR2 A;  1ZM2 A;  3B4T A;  4LCF A;  4X64 E;  1XNR E;  4LFB E;  3Q1Q A;  4LF4 I;  2AE8 A;  4X64 I;  1XNR I;  4LFB I;  1DAR A;  4WUC A;  1ZXN A;  3UHM A;  3Q6M A;  2A2C A;  1ZM9 A;  2C38 B;  4LCH A;  4AQY E;  1R6M A;  2HFU A;  4I3H A;  1FKA E;  2X36 A;  4AQY I;  4IZJ A;  3B82 A;  2PNM A;  4DU8 A;  3K1J A;  4DUY E;  1NHJ A;  4B3M E;  2EFG A;  1S4E A;  5K36 A;  4DUY I;  1Y60 A;  4B3M I;  4DUZ E;  2GS8 A;  4OKG A;  1HNX E;  5JEA B;  4LOM A;  4IFD C;  1Y6Z A;  4ED4 A;  5IWA E;  3PS1 A;  5LMN E;  2PO0 A;  4DXL A;  2BM1 A;  4DUZ I;  1HNX I;  2Q2E B;  1VIS A;  2JEB A;  5IWA I;  5LMN I;  1XXE A;  5K36 F;  1MX0 A;  2NN6 C;  3L7Z B;  4OX9 E;  4JI2 E;  2ZM6 E;  1VI7 A;  2JE6 B;  3J81 C;  2O1U A;  2CGE A;  4OX9 I;  2J65 A;  4JI2 I;  2ZM6 I;  4DPT A;  5FWK A;  4OO1 D;  4DPW A;  4MU0 A;  3P76 A;  1I94 E;  3QT6 A;  1PKP A;  2HHH I;  1Z59 A;  1I94 I;  1XMQ E;  4J3D A;  3T1H E;  3LPS A;  1XMQ I;  5JEA D;  1N0U A;  4JYA E;  3T1H I;  3P06 A;  5L3J A;  4LF7 E;  4IZJ D;  2V34 A;  4NXM E;  5FLX Q;  4JYA I;  2V2V A;  1Z0V A;  3CDJ A;  5DRO A;  1UEK A;  3HUL A;  3QT7 A;  4NXM I;  4X66 E;  4JI3 E;  4IFD B;  3H4L A;  1RR9 A;  3LTO A;  4FW9 A;  4JV5 I;  1OJ4 A;  4MYU A;  4QNK A;  4JI3 I;  4LF8 E;  4DV2 E;  4M1K A;  3B8H A;  4U3B A;  4LF8 I;  2Z5C A;  4DV2 I;  4FW6 A;  2NN6 B;  2PNZ B;  2AJ4 A;  3F0N A;  5DRR A;  4BA2 A;  1H7S A;  3WU6 A;  4B3S E;  3WU5 A;  1USV A;  2WP8 A;  4DR2 E;  1RRE A;  1WUU A;  4JI8 E;  4B3S I;  3HJC A;  4DR2 I;  2WW4 A;  4DR4 E;  4UT4 A;  4DV6 E;  4JI8 I;  4X62 E;  2X7I A;  4DU7 A;  2XEX A;  5C0X E;  1NHI A;  1NHH A;  3QT5 A;  1HK7 A;  4DR4 I;  2JEA A;  1H74 A;  4UTG A;  4DV6 I;  4X62 I;  4JI5 E;  5DNL A;  4PRX A;  3WU4 A;  2VF3 A;  5DRQ A;  3KRN A;  4DV1 E;  2O1W A;  1S16 A;  4R1F A;  3J7A G;  5EL9 A;  3QT8 A;  1EI1 A;  4BA1 B;  2Z5B A;  5K36 C;  4DV1 I;  2NN6 D;  4NBQ A;  4JI6 I;  1QZR A;  3PYE A;  1XNQ E;  2V8P A;  4HAC A;  4LPF A;  5LL6 R;  4K0K E;  1B62 A;  4JI0 E;  5EKW A;  1FWK A;  2UUC E;  1XNQ I;  1KTV A;  1HNW E;  4Z7C A;  4K0K I;  4JI0 I;  2UUC I;  1HNW I;  1Z0E A;  4LF9 E;  2O3Z A;  1N33 E;  4FW5 A;  3P3C A;  2J7K A;  5A2Q Q;  2BR2 B;  3LNU A;  4OO1 B;  4LF9 I;  1N33 I;  1KKH A;  3PS3 A;  1OYS A;  4URL A;  1KIJ A;  3Q6N A;  2HKE A;  4JI4 E;  4IS9 A;  4ZVI A;  1B63 A;  3ZZU A;  4JI4 I;  4IZK A;  2LJP A;  4PU9 A;  4RPF A;  4IZJ B;  1D6T A;  3PYF A;  1Z5C A;  2WNR A;  3J81 Q;  4LCG A;  1Z5B A;  4DV4 E;  3DD6 A;  4MU4 A;  5BR8 E;  4DV4 I;  4MU3 A;  1HNZ E;  5JEA F;  2ZBK B;  5GME A;  2PO0 B;  5BR8 I;  2HHH E;  5IT9 C;  1HNZ I;  2O1V A;  3ZZ0 A;  2JEB B;  4JI7 E;  4OZE A;  4YY3 E;  3JAM Q;  4JI7 I;  5JEA E;  4YY3 I;  1Y4U A;  1Z0W A;  4ISA A;  4DV5 E;  4DV0 E;  1NZ0 A;  4LF6 E;  2JT2 A;  4DV5 I;  4DV0 I;  4JV5 E;  5K36 D;  2VQE E;  2DEJ A;  5C0X A;  3ZZT A;  3K17 A;  4LF6 I;  3M6A A;  4HY1 A;  2VQE I;  4IFD A;  2E1R A;  1YHC A;  2GO4 A;  4FWG A;  4Z7Y A;  4GQU A;  2F1D A;  2BV3 A;  1PVG A;  2GQ0 A;  5C0X F;  2OI2 A;  2CVE A;  1UDQ A;  4MDT A;  1OYP A;  1E3H A;  3J80 C;  4IFD F;  1PIE A;  4WUB A;  1KVK A;  5LMU E;  2IOQ A;  1MG7 A;  1FI4 A;  4DR5 E;  2Z5C B;  2C37 A;  2R3V A;  5LMU I;  1HR0 E;  4DR5 I;  4IFD E;  2UXB E;  2NPF A;  2PO1 B;  3U1K A;  1H72 C;  1HR0 I;  3NZK A;  2WP8 B;  2PO2 A;  2UXB I;  3M85 G;  1Z0T A;  1MU5 A;  5ELW A;  4EMD A;  4JI6 E;  2C39 A;  2NN6 E;  4FW3 A;  4AIM A;  4YHH E;  3U1Y A;  1IBL E;  4JI1 E;  2GO3 A;  4YHH I;  1IBL I;  2DEI A;  2HKJ A;  1UDS A;  4JI1 I;  1XMO E;  4N3O A;  1IBK E;  2E5L E;  4B3T E;  4LFC E;  4DV3 E;  4B3T I;  1XMO I;  1IBK I;  4LF5 E;  2UXC E;  2E5L I;  1EA6 A;  1RHY A;  2CZ9 A;  4FW7 A;  4HYM A;  4LFC I;  2UUA E;  4DV3 I;  2Z5B B;  4LF5 I;  2UXC I;  2BA1 G;  3PYG A;  1J5E E;  2UUA I;  2C38 A;  3PS2 A;  2BA1 D;  4B3R E;  4DR6 I;  4HAC B;  2IER A;  4JG4 A;  4OO1 A;  3V2U C;  1J5E I;  4MQY A;  2HK2 A;  4B3R I;  4KHP E;  3P3E A;  4DPY A;  4MU1 A;  1USU A;  3H1C A;  4AM3 A;  4FN5 A;  3GLL A;  4KHP I;  4GKK E;  5JEA A;  4OO1 F;  1H7U A;  4FWD A;  4GKK I;  4WUD A;  4USM A;  1Z0B A;  2VQF E;  5K36 B;  1ELO A;  2O1T A;  3OTO E;  1Z0C A;  1K47 A;  3WU3 A;  5A2Q C;  2VQF I;  2Z5E A;  1R6L A;  4PRV A;  3L7Z A;  3HKM A;  5IT9 Q;  4OO1 E;  1YH8 A;  4QNJ A;  3OTO I;  4KQV A;  1U2R A;  2JE6 A;  5C0X C;  4IZK B;  1ZXM A;  2UXD E;  4P7A A;  4MYT A;  1Y5Y A;  1N0V C;  2V2Z A;  3PYD A;  2UXD I;  2WNR B;  4FW4 A;  3J7A M;  1FJG E;  2ZIT A;  3GCM A;  5GMD A;  2F4V E; 
#chains in the Genus database with same CATH homology
 1RHY A;  4LOM A;  5DNL A;  5EL9 A;  4GQU A;  2AE8 A;  4QNJ A;  4QNK A;  5ELW A;  5EKW A;  2F1D A;  4MU4 A;  5DNX A;  4MU0 A;  4MU1 A;  4LPF A;  4MU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...