4GQUA

Crystal structure of hisb from mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
191
structure length
191
Chain Sequence
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Imidazoleglycerol-phosphate dehydratase
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 62
structure length 191
sequence length 191
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00475 IGPD Imidazoleglycerol-phosphate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4gquA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4gquA02
4MU4A 2AE8A 4GQUA 4MU0A 4MU1A 5EKWA 5EL9A 1RHYA 5ELWA 4MU3A 4LPFA 5DNLA 4QNKA 2F1DA 5DNXA 4QNJA 4LOMA
chains in the Genus database with same CATH superfamily
2O1TA 4X64E 1ZM9A 5JEAD 2ZM6E 2GQ0A 2UUCI 3B4TA 3M7NG 4KQVA 4NBQA 1ZM2A 1E3PA 3K85A 2X36A 4HXZA 2BA0D 3P06A 4BA1B 5JEAF 4LF6I 2ZBKB 4DU7A 1HNWI 5DRQA 4JI0I 1Z5BA 4WUCA 4JI6E 4OX9E 3ZZ0A 4USMA 2UUAI 3QT5A 4B3ME 1UEKA 4DV2E 5JEAB 2A2CA 4DPXA 4X65E 5LMNI 2IOPA 2BM0A 4JI4E 2JT2A 1RREA 1N33I 4DR1I 5FLXC 2BR2A 2CZ9A 4B3SE 4LF4I 4DUZI 2PO0B 2PO2B 4DV6E 3T1HI 2E1RA 1NZ0A 4FW4A 4YHHE 4OZEA 1XXEA 2BA0G 4JV5E 3L7ZA 1N32I 2J7KA 4ISAA 4B3TE 1HK7A 1ZM3A 4JYAE 1B63A 1I94E 4K0KE 2J65A 2A2DA 3Q6MA 4YY3I 4DR2E 2VQEE 4MYUA 4MU1A 1A6FA 2IESA 4WUDA 5DRPA 2WP8B 1H72C 2JE6A 1MU5A 5FWKA 2DEJA 2PO1B 5C0XA 4JI3E 3Q1QA 1P42A 4U3DA 4LF8E 3ZKBA 1VI7A 1OYSA 2NN6D 4OO1D 4JI7E 4URLA 4HYMA 4DR6I 4DV7E 2Z5EA 5GMEA 1S4EA 3PYFA 4IZJA 2C38A 4DUYE 4MQYA 4U3BA 2UXDE 2C39A 2NN6F 4BA2A 5IT9C 3HJCA 4DUYI 4LF9I 5LL6R 2VQFE 1HNXI 4P52A 3P3GA 2CVEA 2UUBE 1UDNA 1IBLI 4JI1E 3D4JA 4R1FA 2HK2A 5ELWA 2NN6B 4OKGA 4OO1B 3PYDA 1Z0GA 3JAMC 3PYGA 1IBMI 2Z5CA 3ZM7A 3NZKA 4X66E 2UXBE 1FJGI 1N0VC 4DV0E 4DR3I 4DR7E 4X62I 4AIMA 2UXBI 5LMUE 3M85D 4NXNE 1USUA 5K36E 4ED4A 4LCGA 5C0XC 1IBKI 2C37A 1XMQE 3QT6A 1NHJA 1XNRI 2CGEA 2WNRA 2JEBB 4MU4A 1Z59A 2AE8A 4LFCI 2UU9I 4DR5E 4JI5E 4X64I 4IFDE 2ZM6I 1XMOE 4ZVIA 3T1YE 5DROA 4GKKE 3ZZTA 2EFGA 1KVKA 4MYTA 4HACB 3J81C 2F4VE 1NHIA 3M85G 1D6TA 4JI6I 4OX9I 1H73A 3J7AG 5IWAE 4JI2E 4Z7CA 5FLXQ 1N34E 4IZKB 4DV2I 4B3MI 2Z5BA 4B3RE 3ZKDA 4NXME 4X65I 2PO0A 4FWHA 3U1KA 1WUUA 3B78A 5DNLA 4QNKA 4DV1E 2XEXA 4JI4I 5JEAE 4EMDA 1N36E 1XNQE 4GQUA 3M6AA 3DD6A 4B3SI 1YH8A 1HR0E 4DPUA 5BR8E 4MU0A 4DV6I 4YHHI 1PIEA 4JV5I 2HKJA 4LF5E 2JEAA 2E5LE 2HFUA 3CDJA 4B3TI 4P7AA 4JYAI 1DARA 5DRRA 1I94I 4DR4E 3PS2A 1OYPA 1VISA 4K0KI 2R42A 4AIDA 3HULA 4JG4A 3OTOE 3H1CA 4LFBE 1UDQA 4DR2I 1N0UA 2VQEI 2PNZA 4AQYE 4MU3A 1U2RA 1Z0EA 4JI3I 4LF8I 3CDIA 4LFAE 1MX0A 1J5EE 4JI7I 2IERA 4DPWA 1QZRA 4JI8E 5C0XD 4DV7I 1PKPA 4LF7E 2NN6A 2O1WA 1HNZE 3H4LA 3L7ZB 1UDSA 3PS1A 4I3HA 4DV3E 4OO1F 1PVGA 3ZZUA 2UXDI 5K36A 2CG9A 1H74A 1FNMA 5EL9A 2VQFI 2DEIA 4IZJD 2UUBI 2V2ZA 2V2QA 4LCFA 4JI1I 4FW7A 1FKAE 2O1UA 3WU6A 2JE6B 5C0XB 2AJ4A 4IFDA 4FW6A 4X66I 1XHKA 1Z0TA 2NN6E 3B82A 2IOQA 2BV3A 4OO1E 2UXCE 4DV0I 4DR7I 3J80C 2LJPA 5LMUI 4NXNI 2GS8A 2O1VA 3P3EA 2PNMA 4DV4E 4FW3A 4M1KA 2GO4A 4IZJB 2C38B 3V5RA 4DV4I 2C39B 4BA2B 1XMQI 3HKMA 4GKJE 4BA1A 4XTJA 3CWVA 2NN6C 4DR5I 2HHHE 4DV5E 4JI5I 2HK3A 5A2QC 5K36C 3GONA 2Z5CB 1RR9A 4KHPE 5JEAA 1XMOI 2BM1A 3P76A 3T1YI 4DXLA 2V8PA 4GKKI 3WU5A 1BKNA 3B8HA 1K47A 1H7UA 2BA1D 4N3OA 2F4VI 3QT8A 2UUCE 4LPFA 4MDTA 2C37B 4FN5A 1MG7A 4IFDC 5IWAI 1ZXNA 4JI2I 4B3RI 2GO3A 3LNUA 2NPFA 1N34I 2PO2A 2WNRB 1OYRA 4LF6E 3QT7A 4NXMI 1HNWE 5EKWA 4JI0E 1KKHA 1Z5CA 3V2UC 4DV1I 4DPYA 4UT4A 4AM3A 3GCMA 1FI4A 2UUAE 1USVA 3K17A 1N36I 1XNQI 1Y5YA 5LMNE 4RPFA 2HFSA 1HR0I 1Z5AA 1Y4UA 3UHMA 2X7IA 2Q2EB 5BR8I 1N33E 4DR1E 2VESA 2WP8A 2PO1A 2BA1G 4LF5I 2E5LI 5JEAC 1R6MA 1ZXMA 4LF4E 4DR4I 4DUZE 2HKEA 2Z5BB 4J3DA 3T1HE 1ELOA 3OTOI 1E3HA 1UDOA 4UTGA 4LFBI 1N32E 4PRXA 3LPSA 5DNXA 3GLLA 4AQYI 2BR2B 3KRNA 2UU9E 3J7AM 2V34A 5IT9Q 3GMEA 2VF3A 4YY3E 4LFAI 4PU9A 1J5EI 1R6LA 4OO1A 4JI8I 1Z0VA 4WUBA 2ZITA 4Z7YA 2WW4A 4LF7I 3U1YA 1HNZI 2JEAB 3LTOA 4DV3I 3JAMQ 1KIJA 2R3VA 5C0XF 4FWGA 3WU4A 1OJ4A 4DR6E 1KTVA 3WU3A 5K36D 2F1DA 3J80Q 1S16A 2PNZB 4FWDA 4LF9E 1Y6ZA 2PNLA 1ZM4A 5L3JA 1HNXE 2JEBA 1IBLE 1FWKA 4FW5A 2UXCI 5K36F 1H7SA 5C0XE 2OI2A 4DPTA 3F0NA 4FW9A 2V2VA 1IBME 3M7ND 4IFDD 4LCHA 3PRYA 1Z0WA 1FJGE 1RHYA 1Y60A 5K36B 4DR3E 4X62E 5A2QQ 1Z0CA 1EA6A 4LOMA 4GKJI 5GMDA 1FWLA 3Q6NA 4HACA 4IS9A 1Y4SA 4IFDF 4OO1C 4QNJA 3PYEA 1EI1A 1NHHA 1YHCA 3J81Q 3K1JA 1IBKE 2HHHI 4HY1A 4DV5I 3PS3A 1B62A 4IZKA 2O3ZA 1XNRE 4KHPI 4PRVA 4IFDB 4LFCE 3P3CA 4USKA 4DU8A 1Z0BA
chains in the Genus database with same CATH topology
4MU4A 2AE8A 4GQUA 4MU0A 4MU1A 5EKWA 5EL9A 1RHYA 5ELWA 4MU3A 4LPFA 5DNLA 4QNKA 2F1DA 5DNXA 4QNJA 4LOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MU4 A;  2AE8 A;  4GQU A;  4MU0 A;  4MU1 A;  5EKW A;  5EL9 A;  1RHY A;  5ELW A;  4MU3 A;  4LPF A;  5DNL A;  4QNK A;  2F1D A;  5DNX A;  4QNJ A;  4LOM A; 
#chains in the Genus database with same CATH topology
 2O1T A;  4X64 E;  1ZM9 A;  5JEA D;  2ZM6 E;  2GQ0 A;  2UUC I;  3B4T A;  3M7N G;  4KQV A;  4NBQ A;  1ZM2 A;  1E3P A;  3K85 A;  2X36 A;  4HXZ A;  2BA0 D;  3P06 A;  4BA1 B;  5JEA F;  4LF6 I;  2ZBK B;  4DU7 A;  1HNW I;  5DRQ A;  4JI0 I;  1Z5B A;  4WUC A;  4JI6 E;  4OX9 E;  3ZZ0 A;  4USM A;  2UUA I;  3QT5 A;  4B3M E;  1UEK A;  4DV2 E;  5JEA B;  2A2C A;  4DPX A;  4X65 E;  5LMN I;  2IOP A;  2BM0 A;  4JI4 E;  2JT2 A;  1RRE A;  1N33 I;  4DR1 I;  5FLX C;  2BR2 A;  2CZ9 A;  4B3S E;  4LF4 I;  4DUZ I;  2PO0 B;  2PO2 B;  4DV6 E;  3T1H I;  2E1R A;  1NZ0 A;  4FW4 A;  4YHH E;  4OZE A;  1XXE A;  2BA0 G;  4JV5 E;  3L7Z A;  1N32 I;  2J7K A;  4ISA A;  4B3T E;  1HK7 A;  1ZM3 A;  4JYA E;  1B63 A;  1I94 E;  4K0K E;  2J65 A;  2A2D A;  3Q6M A;  4YY3 I;  4DR2 E;  2VQE E;  4MYU A;  4MU1 A;  1A6F A;  2IES A;  4WUD A;  5DRP A;  2WP8 B;  1H72 C;  2JE6 A;  1MU5 A;  5FWK A;  2DEJ A;  2PO1 B;  5C0X A;  4JI3 E;  3Q1Q A;  1P42 A;  4U3D A;  4LF8 E;  3ZKB A;  1VI7 A;  1OYS A;  2NN6 D;  4OO1 D;  4JI7 E;  4URL A;  4HYM A;  4DR6 I;  4DV7 E;  2Z5E A;  5GME A;  1S4E A;  3PYF A;  4IZJ A;  2C38 A;  4DUY E;  4MQY A;  4U3B A;  2UXD E;  2C39 A;  2NN6 F;  4BA2 A;  5IT9 C;  3HJC A;  4DUY I;  4LF9 I;  5LL6 R;  2VQF E;  1HNX I;  4P52 A;  3P3G A;  2CVE A;  2UUB E;  1UDN A;  1IBL I;  4JI1 E;  3D4J A;  4R1F A;  2HK2 A;  5ELW A;  2NN6 B;  4OKG A;  4OO1 B;  3PYD A;  1Z0G A;  3JAM C;  3PYG A;  1IBM I;  2Z5C A;  3ZM7 A;  3NZK A;  4X66 E;  2UXB E;  1FJG I;  1N0V C;  4DV0 E;  4DR3 I;  4DR7 E;  4X62 I;  4AIM A;  2UXB I;  5LMU E;  3M85 D;  4NXN E;  1USU A;  5K36 E;  4ED4 A;  4LCG A;  5C0X C;  1IBK I;  2C37 A;  1XMQ E;  3QT6 A;  1NHJ A;  1XNR I;  2CGE A;  2WNR A;  2JEB B;  4MU4 A;  1Z59 A;  2AE8 A;  4LFC I;  2UU9 I;  4DR5 E;  4JI5 E;  4X64 I;  4IFD E;  2ZM6 I;  1XMO E;  4ZVI A;  3T1Y E;  5DRO A;  4GKK E;  3ZZT A;  2EFG A;  1KVK A;  4MYT A;  4HAC B;  3J81 C;  2F4V E;  1NHI A;  3M85 G;  1D6T A;  4JI6 I;  4OX9 I;  1H73 A;  3J7A G;  5IWA E;  4JI2 E;  4Z7C A;  5FLX Q;  1N34 E;  4IZK B;  4DV2 I;  4B3M I;  2Z5B A;  4B3R E;  3ZKD A;  4NXM E;  4X65 I;  2PO0 A;  4FWH A;  3U1K A;  1WUU A;  3B78 A;  5DNL A;  4QNK A;  4DV1 E;  2XEX A;  4JI4 I;  5JEA E;  4EMD A;  1N36 E;  1XNQ E;  4GQU A;  3M6A A;  3DD6 A;  4B3S I;  1YH8 A;  1HR0 E;  4DPU A;  5BR8 E;  4MU0 A;  4DV6 I;  4YHH I;  1PIE A;  4JV5 I;  2HKJ A;  4LF5 E;  2JEA A;  2E5L E;  2HFU A;  3CDJ A;  4B3T I;  4P7A A;  4JYA I;  1DAR A;  5DRR A;  1I94 I;  4DR4 E;  3PS2 A;  1OYP A;  1VIS A;  4K0K I;  2R42 A;  4AID A;  3HUL A;  4JG4 A;  3OTO E;  3H1C A;  4LFB E;  1UDQ A;  4DR2 I;  1N0U A;  2VQE I;  2PNZ A;  4AQY E;  4MU3 A;  1U2R A;  1Z0E A;  4JI3 I;  4LF8 I;  3CDI A;  4LFA E;  1MX0 A;  1J5E E;  4JI7 I;  2IER A;  4DPW A;  1QZR A;  4JI8 E;  5C0X D;  4DV7 I;  1PKP A;  4LF7 E;  2NN6 A;  2O1W A;  1HNZ E;  3H4L A;  3L7Z B;  1UDS A;  3PS1 A;  4I3H A;  4DV3 E;  4OO1 F;  1PVG A;  3ZZU A;  2UXD I;  5K36 A;  2CG9 A;  1H74 A;  1FNM A;  5EL9 A;  2VQF I;  2DEI A;  4IZJ D;  2UUB I;  2V2Z A;  2V2Q A;  4LCF A;  4JI1 I;  4FW7 A;  1FKA E;  2O1U A;  3WU6 A;  2JE6 B;  5C0X B;  2AJ4 A;  4IFD A;  4FW6 A;  4X66 I;  1XHK A;  1Z0T A;  2NN6 E;  3B82 A;  2IOQ A;  2BV3 A;  4OO1 E;  2UXC E;  4DV0 I;  4DR7 I;  3J80 C;  2LJP A;  5LMU I;  4NXN I;  2GS8 A;  2O1V A;  3P3E A;  2PNM A;  4DV4 E;  4FW3 A;  4M1K A;  2GO4 A;  4IZJ B;  2C38 B;  3V5R A;  4DV4 I;  2C39 B;  4BA2 B;  1XMQ I;  3HKM A;  4GKJ E;  4BA1 A;  4XTJ A;  3CWV A;  2NN6 C;  4DR5 I;  2HHH E;  4DV5 E;  4JI5 I;  2HK3 A;  5A2Q C;  5K36 C;  3GON A;  2Z5C B;  1RR9 A;  4KHP E;  5JEA A;  1XMO I;  2BM1 A;  3P76 A;  3T1Y I;  4DXL A;  2V8P A;  4GKK I;  3WU5 A;  1BKN A;  3B8H A;  1K47 A;  1H7U A;  2BA1 D;  4N3O A;  2F4V I;  3QT8 A;  2UUC E;  4LPF A;  4MDT A;  2C37 B;  4FN5 A;  1MG7 A;  4IFD C;  5IWA I;  1ZXN A;  4JI2 I;  4B3R I;  2GO3 A;  3LNU A;  2NPF A;  1N34 I;  2PO2 A;  2WNR B;  1OYR A;  4LF6 E;  3QT7 A;  4NXM I;  1HNW E;  5EKW A;  4JI0 E;  1KKH A;  1Z5C A;  3V2U C;  4DV1 I;  4DPY A;  4UT4 A;  4AM3 A;  3GCM A;  1FI4 A;  2UUA E;  1USV A;  3K17 A;  1N36 I;  1XNQ I;  1Y5Y A;  5LMN E;  4RPF A;  2HFS A;  1HR0 I;  1Z5A A;  1Y4U A;  3UHM A;  2X7I A;  2Q2E B;  5BR8 I;  1N33 E;  4DR1 E;  2VES A;  2WP8 A;  2PO1 A;  2BA1 G;  4LF5 I;  2E5L I;  5JEA C;  1R6M A;  1ZXM A;  4LF4 E;  4DR4 I;  4DUZ E;  2HKE A;  2Z5B B;  4J3D A;  3T1H E;  1ELO A;  3OTO I;  1E3H A;  1UDO A;  4UTG A;  4LFB I;  1N32 E;  4PRX A;  3LPS A;  5DNX A;  3GLL A;  4AQY I;  2BR2 B;  3KRN A;  2UU9 E;  3J7A M;  2V34 A;  5IT9 Q;  3GME A;  2VF3 A;  4YY3 E;  4LFA I;  4PU9 A;  1J5E I;  1R6L A;  4OO1 A;  4JI8 I;  1Z0V A;  4WUB A;  2ZIT A;  4Z7Y A;  2WW4 A;  4LF7 I;  3U1Y A;  1HNZ I;  2JEA B;  3LTO A;  4DV3 I;  3JAM Q;  1KIJ A;  2R3V A;  5C0X F;  4FWG A;  3WU4 A;  1OJ4 A;  4DR6 E;  1KTV A;  3WU3 A;  5K36 D;  2F1D A;  3J80 Q;  1S16 A;  2PNZ B;  4FWD A;  4LF9 E;  1Y6Z A;  2PNL A;  1ZM4 A;  5L3J A;  1HNX E;  2JEB A;  1IBL E;  1FWK A;  4FW5 A;  2UXC I;  5K36 F;  1H7S A;  5C0X E;  2OI2 A;  4DPT A;  3F0N A;  4FW9 A;  2V2V A;  1IBM E;  3M7N D;  4IFD D;  4LCH A;  3PRY A;  1Z0W A;  1FJG E;  1RHY A;  1Y60 A;  5K36 B;  4DR3 E;  4X62 E;  5A2Q Q;  1Z0C A;  1EA6 A;  4LOM A;  4GKJ I;  5GMD A;  1FWL A;  3Q6N A;  4HAC A;  4IS9 A;  1Y4S A;  4IFD F;  4OO1 C;  4QNJ A;  3PYE A;  1EI1 A;  1NHH A;  1YHC A;  3J81 Q;  3K1J A;  1IBK E;  2HHH I;  4HY1 A;  4DV5 I;  3PS3 A;  1B62 A;  4IZK A;  2O3Z A;  1XNR E;  4KHP I;  4PRV A;  4IFD B;  4LFC E;  3P3C A;  4USK A;  4DU8 A;  1Z0B A; 
#chains in the Genus database with same CATH homology
 4MU4 A;  2AE8 A;  4GQU A;  4MU0 A;  4MU1 A;  5EKW A;  5EL9 A;  1RHY A;  5ELW A;  4MU3 A;  4LPF A;  5DNL A;  4QNK A;  2F1D A;  5DNX A;  4QNJ A;  4LOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...