1N34E

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n34E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n34E02
4LF5I 2L2NA 2B7VA 2BM1A 4JYAI 3J80Q 1NHJA 2F4VE 2NUGA 4FWGA 4DPUA 2CPNA 1H7UA 1J26A 1IBME 2ZITA 1FJGE 4DU7A 1Z0WA 1H73A 3K17A 3K1JA 1I94I 1Z0VA 1D6TA 4DKKA 1KTVA 3ADLA 3H4LA 4P7AA 1IBKI 4DR5E 2CZ9A 4LF7I 4JV5E 1X49A 5IT9Q 1STUA 2L3JA 2AJ4A 2NUEA 4JI6E 4YY3I 4JI0E 2UUCI 2B7TA 3OTOI 2HHHI 4JI4I 4HXZA 2VQEI 4DUYE 3V5RA 3LPSA 3C4BA 4P52A 4JI3E 5LMNI 1J5EI 3B82A 1RR9A 1XNRI 1WHQA 2UU9I 4ED4A 5BR8I 5GMEA 4B3TI 1HNWE 4AQYE 2LRSA 1GQEA 1N0UA 1N36E 2HFUA 4GKJI 4FWHA 4DR2E 1WUUA 2V34A 4DR4E 1OJ4A 3QT8A 4DV5E 1KKHA 1T4LB 2NUFA 2LTRA 3Q1QA 3T1HI 1DARA 2HFSA 5LL6R 1K47A 4LF4I 1RQ0A 4FWDA 4LF9E 4DV1E 2RTXA 3ZKDA 3QT7A 1MU5A 3CWVA 3QT5A 2IHR1 3F0NA 2DMYA 4DV6E 4ZVIA 2UUBI 1N34E 4JI1E 4DV2I 2A2DA 1UHZA 1HNXE 2KHXA 1ZM9A 4DV0I 4X66I 3ADIA 2ZM6I 4R1FA 3JAMC 1HR0E 1XMQE 1N0VC 2OI2A 4DR6I 1EI1A 1HNZE 4LFBI 3VYYA 2E5LE 4WUDA 4DR1I 4KQVA 5A2QC 2R3VA 2N3GA 2UXBI 2VQFE 2F4VI 4DV4E 2V2QA 5GMDA 1ZBTA 1UILA 1IBMI 3HTXA 4PRXA 4UT4A 1EKZA 1S4EA 2L2KB 4DR3I 4B3MI 1IBLI 4X64E 4DR5I 3PYFA 4JV5I 4M30A 1Z59A 4DV7E 4DU8A 4DR7E 2UXDE 4EMDA 4JI6I 2EFGA 4JI0I 1RREA 1B63A 4GKKI 2RS6A 1VISA 1XNQE 4X65E 4JI8I 3LLHA 4UTGA 4JI3I 3ZZUA 4JI2E 4HACA 4YHHE 1Z0GA 5FLXC 3J7AM 3WU4A 4JI5I 4B3SI 4MYTA 4WYQB 4AQYI 1ZXMA 3V2UC 1N36I 1FI4A 2RSMA 4KHPE 2X36A 4DR4I 1I94E 2WW4A 1Z5CA 1N33E 1H72C 2XEXA 1KIJA 4X8WA 1PKPA 4M1KA 4DUZE 1DI2A 1H74A 3J7AG 4LF9I 2BM0A 1MX0A 4JI7E 2ZBKB 2UUCE 1X48A 4DV3E 4NXNE 1N34I 2DB2A 3PYGA 3ZZTA 2DIXA 4WUBA 4LF6E 3P1XA 4LFAE 4OX9E 1J5EE 4LFCI 2LJPA 2UUAE 1Z0EA 2J7KA 1Z5AA 1HR0I 3LNUA 2UU9E 2RS7A 5BR8E 3ZKBA 4USKA 2LBSB 2HK3A 3VYXA 1FWKA 1HNZI 2HKJA 2E5LI 1ZXNA 1Z5BA 2DEJA 4FW9A 2R42A 2A2CA 2VQFI 1YYKA 1H7SA 4DV4I 1ZM2A 5LMUE 2HKEA 3B78A 2JY9A 3J80C 4RPFA 4LF8E 1NZ0A 4B3RE 2V2ZA 4LF4E 1XMOE 1FWLA 4K0KE 4X64I 1FJGI 1B62A 1RC7A 4DV7I 4XTJA 5IWAE 2LJHA 2UXCE 4MYUA 4DV0E 3J81C 5IT9C 1FKAE 4X66E 1QU6A 1NHIA 2N3HA 4PU9A 2JVAA 3M6AA 3WU5A 4DR6E 4URLA 4DPYA 4X62E 3T1YE 4NXME 2LUPB 1MG7A 3JAMQ 1N32E 2NPFA 4YHHI 2B3TB 4M2ZA 1YYOA 2UXBE 4DUYI 5A2QQ 2BV3A 1ZM4A 1WHNA 4KHPI 1U2RA 3D4JA 1T4OA 4LF5E 2X7IA 2L3CA 4JYAE 1N33I 1UEKA 1HNWI 4DR3E 4B3ME 1IBLE 1Z0CA 3J81Q 4DUZI 2Q2EB 4DPTA 4WFTA 3GONA 4DR2I 2VF3A 4JI7I 1Z0BA 4JG4A 3ZM7A 3B8HA 4DV5I 4DV3I 4NXNI 1IBKE 2EZ6A 1T4NA 2NA2A 4LF7E 4PRVA 4LF6I 4DPXA 4GKKE 1FNMA 4HYMA 1O0WA 4WUCA 4LFAI 4DV1I 4OX9I 4JI8E 1QZRA 4USMA 2UUAI 4YY3E 4DV6I 4JI1I 3OTOE 3WU3A 4HY1A 1KVKA 2HHHE 4JI4E 1HNXI 4JI5E 1X47A 2VQEE 4B3SE 1NHHA 5LMNE 5FLXQ 1S16A 2GS8A 1ZM3A 1XNRE 1XMQI 2LTSA 2HK2A 1EA6A 4DXLA 2V2VA 4B3TE 5LMUI 5L3JA 4LF8I 1PVGA 4B3RI 2MDRA 1YZ9A 4GKJE 1PIEA 1XHKA 1XMOI 2L33A 1ELOA 3QT6A 4HACB 1A6FA 5CFFE 4K0KI 3ADGA 2DEIA 4DPWA 3ZZ0A 2LUQA 3T1HE 2YT4A 5IWAI 2UXCI 4Z7CA 1YYWA 4LFCE 3C4TA 3J7Yp 2UUBE 2E1RA 4DV2E 4FN5A 4DR7I 2L2MA 2UXDI 4X62I 3LTOA 3T1YI 4NXMI 3HULA 1N32I 3ADJA 4OOGC 1BKNA 4Z7YA 2ZM6E 1XNQI 1Z0TA 4X65I 4I3HA 3PYEA 4LFBE 2V8PA 3PYDA 4JI2I 4DR1E 3WU6A
chains in the Genus database with same CATH superfamily
2EOZA 2EM3A 1GTKA 4LF5I 2WP8A 2L2NA 2B7VA 2YTJA 4WX9A 1P42A 1Z1BA 4FW4A 2EMHA 2GHFA 2JWOA 2BM1A 2C38A 3J80Q 2V85A 4NZVA 4LOMA 4BS9A 1NHJA 2V89A 4QNKA 2MKNA 2F4VE 4P78A 2NUGA 1TF6A 2I9IA 3P06A 4FWGA 2CPNA 4R2RA 2EWLA 1J26A 1IBME 1H7UA 1FJGE 2ZITA 4IZJD 4DU7A 3P76A 4ISAA 1UDNA 1Z0WA 3M7ND 1H73A 1Y5YA 3K17A 3K1JA 1R6LA 1I94I 1Z0VA 1D6TA 4DKKA 1A1IA 1KTVA 4OO1A 1E3PA 3ADLA 3H4LA 2V87A 3EQ1A 1X6FA 3UK3C 4IZKB 4P7AA 1IBKI 5LLQA 3OMLA 4DR5E 2EM2A 2CZ9A 4LF7I 4JV5E 5A6KA 4HEIA 3HPZA 2CGEA 2EPKX 1X49A 2EOYA 5IT9Q 5KL4A 2YTGA 2EMIA 1STUA 2L3JA 2O1VA 2ODRD 2AJ4A 2NUEA 5DROA 2LE2A 4JI6E 1USUA 2EPPA 4R2EA 4YY3I 4JI0E 2UUCI 2VE7C 4ZYEA 2YRMA 2B7TA 3OTOI 2NN6B 2NN6C 2D9HA 4O5GA 3DD6A 2EMYA 3JTZA 5JEAA 2HHHI 2BBGA 4JI4I 4HXZA 2VQEI 4BC9A 4ZYGA 2WNRB 5AASA 4DUYE 2LVHA 4DMIA 2Z5EA 3V5RA 3LPSA 2FV4B 2EMWA 3C4BA 4P52A 4JI3E 5LMNI 1J5EI 1MG7A 1UDQA 3B82A 4L5NC 3K85A 1YH8A 2PO0A 4HTGA 1RR9A 2BA0D 2C39A 5KL5A 1XNRI 1A1KA 2LJUA 1UBDC 1WHQA 2UU9I 2L6MA 1OYSA 4ED4A 5BR8I 5GMEA 4B3TI 3MSWA 1SR9A 1HNWE 3ECRA 4F2JC 4AQYE 5IXMB 2LRSA 1GQEA 2EOQA 2JOXA 1N0UA 1UN6B 3H1CA 1A1LA 1N36E 2HFUA 4GKJI 2CG9A 2NN6D 4FWHA 4DR2E 2Z5CA 4WXCA 1WUUA 2V34A 4DR4E 2JYAA 4IZJA 2O3ZA 1OJ4A 3QT8A 2JOBA 4DV5E 1KKHA 2EQ3A 1T4LB 2NUFA 3HJCA 2LTRA 3Q1QA 3T1HI 1DARA 2ENAA 5LL6R 1K47A 2HFSA 1RQ0A 4MDTA 4LF4I 2E1MA 4FWDA 4LF9E 4DV1E 1UDOA 2RTXA 3CDIA 2WCC3 2EN4A 3ZKDA 5KL7A 3QT7A 1JK2A 1MU5A 2YRKA 3CWVA 3QT5A 2IHR1 4TUIA 3F0NA 2DMYA 4LPFA 4DV6E 4GQUA 4ZVIA 2UUBI 2DLQA 1N34E 4JI1E 3PS3A 2GQ0A 4DV2I 2A2DA 1YHCA 4LU9A 1UHZA 3RMPA 2FGGA 1HNXE 3PRYA 2KHXA 3M7NG 1ZM9A 4LCGA 1NEIA 2BR2B 4DV0I 4X66I 2F1DA 1YFHA 3ADIA 5DRPA 2ZM6I 4BBYA 4R1FA 2HGHA 2V83A 1PDAA 3JAMC 1HR0E 1XMQE 3BGHA 4WSGA 2EOXA 2M1SA 5IV8B 5KL2A 1NCSA 1N0VC 2OI2A 1Y4SA 1KYQA 2BA1G 4F9AB 2O1UA 2Z5BB 4DR6I 4IFDE 1EI1A 1HNZE 4LFBI 1ZR9A 5DNYA 3VYYA 2E5LE 4WUDA 4DR1I 4KQVA 4GEQB 2LT7A 2EM9A 5A2QC 2R3VA 2EPXA 2N3GA 2YTQA 2KOUA 4U3BA 2UXBI 2VQFE 2EMLA 2LMZA 2E72A 2NN6A 1ZBQA 4DV4E 2V2QA 5GMDA 2F4VI 3L7ZA 1ZBTA 1UILA 2I13A 1IBMI 1OYPA 4NHRA 3HTXA 4PRXA 1YUJA 1L4SA 4OKGA 3JU0A 4BC7A 4UT4A 2EPUA 1EKZA 2ELYA 1S4EA 1BB8A 2LO3A 4MU1A 4BMJA 2L2KB 3BBGA 1YPNA 4DR3I 4MU4A 1IBLI 4X64E 4DR5I 4B3MI 3PYFA 4JV5I 1BBGA 4M30A 1Z59A 5C0XB 5C0XC 2PO2B 4ZYHA 2YU8A 4DV7E 4RH8A 2NN6E 2L8TA 4DU8A 4DR7E 2YZTA 1WXRA 2UXDE 4EMDA 4JI6I 2EFGA 4JI0I 1BBOA 2EMFA 5K36B 2EMBA 1RREA 3K6QA 5C0XF 5K36C 4P7DA 4F9BB 2WBSA 4NBQA 1B63A 2FTXB 2EQ0A 2RS6A 1VISA 4GKKI 2BA1D 1XNQE 1IQOA 1SFEA 2JPAA 4X65E 4JI8I 3LLHA 1HK7A 4UTGA 4JI3I 3ZZUA 4OZEA 2YTDA 4JI2E 3EPKA 5K36F 2EN2A 3THOB 4HACA 5ELWA 4YHHE 2M4IA 1Z0GA 5FLXC 3Q6NA 3Q6MA 4IFDF 2IERA 4X9JA 2J65A 1PJSA 2EOEA 3J7AM 3WU4A 2JEAB 1N3GA 2NABA 1IMUA 4OO1E 4JI5I 4B3SI 4MYTA 2EN8A 2CSHA 2MKDA 4WYQB 4AQYI 2B9DA 1E3HA 1ZXMA 3V2UC 2JP9A 4GZNC 1N36I 2GPIA 4F9CB 1FI4A 2RSMA 2EQ1A 4KHPE 4O24A 2X36A 2JT2A 1ZU1A 2PNMA 3IWCA 2V8QB 1I94E 4DR4I 3IWBA 1Y60A 2WW4A 5TSEA 1Z5CA 3M85D 1N33E 1TF3A 1H72C 3L00A 2XEXA 2DMIA 1KIJA 4QNJA 4X8WA 1PKPA 2EPLX 5JEAE 4M1KA 2Z5BA 4DUZE 1DI2A 1H74A 3J7AG 3VHTB 4LF9I 2BM0A 1MX0A 1Y4UA 3HKMA 2J7JA 4JI7E 2ZBKB 4AM3A 2ENCA 2YTEA 4RHBB 2CT1A 2UUCE 1X48A 1PJTA 4DV3E 5T6JA 4NXNE 5DNXA 2DB2A 1N34I 4O4KA 2EM8A 3PYGA 3ZZTA 3EPLA 2DIXA 4BA2B 2YSOA 4LF6E 4WUBA 3KWRA 2IOQA 2IESA 2EPRA 1X6HA 3PS1A 4FW7A 3P1XA 4IJDA 4LFAE 4OX9E 5A6BD 1J5EE 5AE1A 2DGCA 4LFCI 1QNTA 2LJPA 2EORA 2HC5A 2UUAE 1Z0EA 2J7KA 1Z5AA 1HR0I 2F8BA 3LNUA 2UU9E 2RS7A 5BR8E 3ZKBA 4MU0A 2V88A 2LBSB 1JK1A 3VYXA 1FWKA 2HK3A 2HKJA 4USKA 1HNZI 2YPNA 2E5LI 1VI7A 2EMZA 2PO2A 2R76A 4BHBA 1F2IG 4OO1F 4I8OA 1PJQA 1G2DC 1ZXNA 3GCMA 4MU3A 3B4TA 2EM5A 3NZKA 1Z5BA 3GMEA 2PRTA 2YTOA 4Q28A 2DEJA 4FW9A 2R42A 1GZ6A 2A2CA 2AE8A 4IZKA 2VQFI 1A1GA 1YYKA 1UDSA 5K36A 2EPCA 4IS1C 1H7SA 2EL4A 4DV4I 2GO4A 2EJ4A 5A6AA 5LMUE 1ZM2A 1AAYA 2HKEA 3B78A 2JY9A 3J80C 4RPFA 4LF8E 1NZ0A 4B3RE 2V2ZA 4LF4E 4MQYA 1XMOE 1A1JA 2YTNA 4N4RB 5DRRA 2JR1A 1FWLA 4J3DA 2DRPA 4K0KE 1TN9A 4MLVA 2JE6B 1KJKA 4X64I 2JEAA 2EL6A 2PNLA 3DF6A 1A1HA 4BA1B 1FJGI 2WNRA 2LCEA 1B62A 1T39A 1RC7A 4DV7I 2EOSA 2EOFA 1B69A 3HQ1A 4XTJA 5IWAE 2LJHA 4R2DA 2UXCE 4MYUA 4LTYA 3BIDA 3J81C 4DV0E 2DLKA 2EM6A 5IT9C 1A1FA 2R1FA 4R2QA 1FKAE 4X66E 1QU6A 3M85G 2MDGA 1NHIA 2YTIA 4IZJB 2N3HA 4R03A 5A6JA 4PU9A 2JVAA 5A6BA 4WSPA 1YUIA 5DRQA 4L8NA 2PO1B 1MGTA 3M6AA 2YU5A 3WU5A 2H36X 4DR6E 4URLA 4DPYA 2WBTA 4X62E 3T1YE 4NXME 4WXDA 2YTFA 4R2CA 2LUPB 2EOIA 4M9VC 2WBUA 1N32E 3JAMQ 5F3WA 2NPFA 4AIDA 4YHHI 3H09A 1OYRA 2B3TB 1R6MA 2JEBB 5AE3A 4IFDB 4IFDC 2EN3A 2ODRC 1USVA 2ELZA 1YYOA 4R2PA 4M2ZA 2UXBE 2O1WA 1X5WA 1X6EA 3U1YA 4DUYI 5A2QQ 4BCAA 3KZZA 3C6MA 3MHSC 2BV3A 3P3EA 4BA2A 2O1TA 4WPYA 4F6NA 1ZM4A 3CDJA 1WHNA 4O43A 3GLLA 4KHPI 1U2RA 2EM0A 2EN7A 3D4JA 2PNZB 2EOMA 1T4OA 4LF5E 5C0XD 2VF1A 2CVEA 2MC5A 2WZOA 2X7IA 2L3CA 4JYAE 2C37B 1WRJA 1P47A 1N33I 4FK5C 1UEKA 1HNWI 1G2FC 2RSIA 4DR3E 1DGCA 1IBLE 4B3ME 1Z0CA 2M7QA 5EKWA 5A69A 2EMXA 2G7HA 2CTDA 3J81Q 4DUZI 4JYAI 1Y6ZA 2Q2EB 5K36D 3EPHA 2BR2A 4DPTA 3HXLA 4WFTA 2GLIA 3GONA 2VF3A 4DR2I 4IFDD 3THNA 2GO3A 4JI7I 2K4VA 1Z0BA 4JG4A 3ZM7A 3M99B 3B8HA 2EN6A 4DV5I 2L92A 4DV3I 4NXNI 1IBKE 2EM4A 2JXPA 3AV0A 2EZ6A 1T4NA 1IQSA 3ZOQB 2NA2A 2YRHA 1RHYA 4LF7E 3L7ZB 4PRVA 4LF6I 3AUZA 4DPXA 5KL3A 5DNLA 4GKKE 1FNMA 4HYMA 1O0WA 4WUCA 2HJJA 4LFAI 4DV1I 3PS2A 4OX9I 4JI8E 2K7IA 3QG5C 4F54A 2WP8B 1QZRA 2EM7A 2EN1A 2NN6F 4USMA 2UUAI 4YY3E 4DV6I 1AH5A 2C38B 1MEYC 2RPCA 4JI1I 3OTOE 3WU3A 4HY1A 1YSAC 2JE6A 1KVKA 2HHHE 4MLQA 4KZSA 2EPOA 4JI4E 2EMCA 4JI5E 1X47A 4R2AA 2VQEE 4B3SE 1NHHA 3U1KA 1EH6A 2EPMX 2N8XA 4BA1A 4KWYA 5LMNE 4R2SA 1LLMC 5FLXQ 3UHMA 2YWQA 2EL5A 1S16A 2GS8A 4F6MA 1ZM3A 1X3CA 2KONA 4OO1B 4OO1C 1XNRE 1XMQI 2LTSA 3VK6A 1DQ3A 5AC5A 2HK2A 1EA6A 2EOOA 4DXLA 2V2VA 2Q8UA 1EH8A 3BF2A 3F6GA 4B3TE 4IS9A 1HNXI 4FW5A 4U3DA 5LMUI 5AC4A 3C6KA 5L3JA 2PO1A 1WJPA 2EMKA 5FWKA 5AE2A 5C0XA 4LF8I 1PVGA 4B3RI 2MDRA 1YZ9A 4GKJE 1PIEA 1XHKA 1XMOI 4J8ZA 2L33A 1ELOA 3QT6A 5ADZA 4FW3A 4HACB 5EL9A 2EPNA 4AIMA 1A6FA 3HPSA 3KZYA 5CFFE 2JEBA 4K0KI 2EOJA 3ADGA 5JEAB 2DEIA 5JEAC 4DPWA 4IFDA 4ZYDA 1ZAAC 1EH7A 3ZZ0A 2VESA 2LUQA 2EMAA 2YTPA 3IWDA 3TQMA 3T1HE 4OO1D 2EOHA 2BB8A 2YT4A 3LMLA 2EMGA 5IWAI 2UXCI 4Z7CA 2IOPA 2PO0B 2VRDA 2C39B 1YYWA 5C0XE 5KL6A 5JEAF 2PNZA 4LFCE 2EP3A 3DJWA 3C4TA 3J7Yp 2ENHA 2UUBE 2C37A 3FIGA 2E1RA 2LV2A 4DV2E 4DPUA 4FN5A 5K36E 4DR7I 2DSYA 2L2MA 4TUGA 2UXDI 4X62I 3LTOA 3T1YI 4NXMI 2Z5CB 3P3GA 3HULA 4FW6A 5JEAD 1N32I 2MC6A 2EPZA 3ADJA 4OOGC 4BHCA 1BKNA 4Z7YA 4R8OA 1T38A 2EPAA 3P3CA 2YSPA 2ZM6E 3EPJA 1RMDA 2A25A 2RQLA 2EE8A 2V86A 3F6HA 3MHHC 4N3OA 1Z0TA 4LCHA 1XNQI 4Q35B 4X65I 2M9AA 3KRNA 1XXEA 4I3HA 4M0VA 4LFBE 2V8PA 3PYEA 3PYDA 4JI2I 4DR1E 3WU6A 4LCFA 2ADRA 2BA0G
chains in the Genus database with same CATH topology
4LF5I 2L2NA 2B7VA 2BM1A 2JWOA 4JYAI 3J80Q 2V85A 4BS9A 1NHJA 2V89A 2F4VE 4P78A 2NUGA 3P06A 4FWGA 2CPNA 4DPUA 2EWLA 1J26A 1IBME 1H7UA 1FJGE 2ZITA 4IZJD 4DU7A 1Z0WA 1H73A 3K17A 3K1JA 1I94I 1Z0VA 1D6TA 4DKKA 1KTVA 3ADLA 3H4LA 2V87A 4IZKB 4P7AA 1IBKI 3OMLA 4DR5E 2CZ9A 4LF7I 4JV5E 3HPZA 2CGEA 1X49A 5IT9Q 1STUA 2L3JA 2O1VA 2ODRD 2AJ4A 2NUEA 2LE2A 4JI6E 1USUA 4YY3I 4JI0E 2UUCI 2VE7C 2B7TA 3OTOI 2HHHI 3JTZA 4JI4I 4HXZA 2VQEI 4BC9A 5AASA 4DUYE 4DMIA 2Z5EA 3V5RA 3LPSA 2FV4B 3C4BA 4P52A 4JI3E 5LMNI 1J5EI 3K85A 3B82A 4L5NC 1RR9A 1XNRI 1WHQA 2UU9I 2L6MA 4ED4A 5BR8I 5GMEA 4B3TI 3MSWA 1SR9A 1HNWE 4AQYE 2LRSA 1GQEA 2JOXA 1N0UA 1N36E 2HFUA 4GKJI 2CG9A 4FWHA 4DR2E 2Z5CA 1WUUA 2V34A 4DR4E 4IZJA 1OJ4A 3QT8A 2JOBA 4DV5E 1KKHA 1T4LB 2NUFA 3HJCA 2LTRA 3Q1QA 3T1HI 1DARA 2HFSA 5LL6R 1K47A 4LF4I 1RQ0A 2E1MA 4FWDA 4LF9E 4DV1E 2RTXA 3ZKDA 3QT7A 1MU5A 3CWVA 3QT5A 2IHR1 4TUIA 3F0NA 2DMYA 4DV6E 4ZVIA 2UUBI 1N34E 4JI1E 2GQ0A 4DV2I 2A2DA 4LU9A 1UHZA 3RMPA 2FGGA 1HNXE 3PRYA 2KHXA 1ZM9A 4DV0I 4X66I 3ADIA 2ZM6I 4BBYA 4R1FA 2V83A 3JAMC 1HR0E 1XMQE 1N0VC 2M1SA 2OI2A 1Y4SA 4F9AB 2O1UA 2Z5BB 4DR6I 1EI1A 1HNZE 4LFBI 5DNYA 3VYYA 2E5LE 4WUDA 4DR1I 4KQVA 4GEQB 5A2QC 2R3VA 2N3GA 2KOUA 2UXBI 2VQFE 2LMZA 2F4VI 1ZBQA 4DV4E 2V2QA 5GMDA 1ZBTA 1UILA 1IBMI 3HTXA 4PRXA 4UT4A 3JU0A 4BC7A 1EKZA 1S4EA 4BMJA 2L2KB 4DR3I 4B3MI 1IBLI 4X64E 4DR5I 3PYFA 4JV5I 4M30A 1Z59A 4DV7E 4DU8A 2L8TA 4DR7E 2YZTA 1WXRA 2UXDE 4EMDA 4JI6I 2EFGA 4JI0I 1RREA 3K6QA 4P7DA 4F9BB 1B63A 2FTXB 2RS6A 1VISA 4GKKI 1XNQE 4X65E 4JI8I 3LLHA 1HK7A 4UTGA 4JI3I 3ZZUA 4JI2E 4HACA 4YHHE 2M4IA 1Z0GA 5FLXC 3Q6NA 3Q6MA 3J7AM 3WU4A 4JI5I 4B3SI 4MYTA 4WYQB 4AQYI 2B9DA 1ZXMA 3V2UC 1N36I 4F9CB 1FI4A 2RSMA 4KHPE 2X36A 2PNMA 3IWCA 2V8QB 1I94E 4DR4I 3IWBA 2WW4A 1Z5CA 1N33E 1H72C 2XEXA 1KIJA 4X8WA 1PKPA 4M1KA 2Z5BA 4DUZE 1DI2A 1H74A 3J7AG 4LF9I 2BM0A 1MX0A 1Y4UA 4JI7E 2ZBKB 2UUCE 1X48A 4DV3E 5T6JA 4NXNE 1N34I 2DB2A 3PYGA 3ZZTA 2DIXA 4WUBA 4LF6E 3KWRA 2IOQA 3P1XA 4LFAE 4OX9E 1J5EE 5AE1A 4LFCI 2LJPA 2UUAE 1Z0EA 2J7KA 1Z5AA 1HR0I 2F8BA 3LNUA 2UU9E 2RS7A 5BR8E 3ZKBA 2V88A 2LBSB 2HK3A 3VYXA 1FWKA 4USKA 2HKJA 1HNZI 2E5LI 4I8OA 1ZXNA 1Z5BA 4Q28A 2DEJA 4FW9A 2R42A 1GZ6A 2A2CA 4IZKA 2VQFI 1YYKA 1H7SA 4DV4I 1ZM2A 5LMUE 2HKEA 3B78A 2JY9A 3J80C 4RPFA 4LF8E 1NZ0A 4B3RE 2V2ZA 4LF4E 1XMOE 2JR1A 1FWLA 4K0KE 4X64I 2PNLA 3DF6A 1FJGI 1B62A 1RC7A 4DV7I 3HQ1A 4XTJA 5IWAE 2LJHA 2UXCE 4MYUA 4LTYA 3J81C 4DV0E 5IT9C 1FKAE 4X66E 1QU6A 1NHIA 4IZJB 2N3HA 4R03A 4PU9A 2JVAA 4WSPA 4L8NA 3M6AA 3WU5A 2H36X 4DR6E 4URLA 4DPYA 4X62E 3T1YE 4NXME 2LUPB 1MG7A 3JAMQ 1N32E 5F3WA 2NPFA 4YHHI 3H09A 2B3TB 5AE3A 1USVA 2ODRC 4M2ZA 1YYOA 2UXBE 2O1WA 4DUYI 5A2QQ 4BCAA 2BV3A 2O1TA 4WPYA 1ZM4A 1WHNA 4KHPI 1U2RA 3D4JA 1T4OA 4LF5E 2VF1A 2MC5A 2WZOA 2X7IA 2L3CA 4JYAE 1N33I 1UEKA 1HNWI 4DR3E 4B3ME 1IBLE 1Z0CA 2M7QA 2G7HA 3J81Q 4DUZI 1Y6ZA 2Q2EB 4DPTA 3HXLA 4WFTA 3GONA 4DR2I 2VF3A 4JI7I 2K4VA 1Z0BA 4JG4A 3ZM7A 3B8HA 4DV5I 2L92A 4DV3I 4NXNI 1IBKE 3AV0A 2EZ6A 1T4NA 3ZOQB 2NA2A 4LF7E 4PRVA 4LF6I 3AUZA 4DPXA 4GKKE 1FNMA 4HYMA 1O0WA 4WUCA 4LFAI 4DV1I 4OX9I 4JI8E 4F54A 1QZRA 4USMA 2UUAI 4YY3E 4DV6I 4JI1I 3OTOE 3WU3A 4HY1A 1KVKA 2HHHE 4KZSA 4JI4E 1HNXI 4JI5E 1X47A 2VQEE 4B3SE 1NHHA 5LMNE 5FLXQ 1S16A 2GS8A 1ZM3A 2KONA 1XNRE 1XMQI 2LTSA 3VK6A 1DQ3A 2HK2A 1EA6A 4DXLA 2V2VA 3F6GA 4B3TE 5LMUI 5L3JA 5FWKA 5AE2A 4LF8I 1PVGA 4B3RI 2MDRA 1YZ9A 4GKJE 1PIEA 1XHKA 1XMOI 4J8ZA 2L33A 1ELOA 3QT6A 5ADZA 4HACB 1A6FA 3HPSA 5CFFE 4K0KI 3ADGA 2DEIA 4DPWA 3ZZ0A 2LUQA 3IWDA 3T1HE 2YT4A 5IWAI 3LMLA 2UXCI 4Z7CA 2IOPA 1YYWA 4LFCE 3DJWA 3C4TA 3J7Yp 2UUBE 3FIGA 2E1RA 4DV2E 4FN5A 4DR7I 2DSYA 2L2MA 4TUGA 2UXDI 4X62I 3LTOA 3T1YI 4NXMI 2Z5CB 3HULA 1N32I 2MC6A 3ADJA 4OOGC 1BKNA 4Z7YA 4R8OA 2ZM6E 2V86A 3F6HA 4N3OA 1XNQI 1Z0TA 4X65I 4I3HA 4M0VA 4LFBE 2V8PA 3PYEA 3PYDA 4JI2I 4DR1E 3WU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 I;  2L2N A;  2B7V A;  2BM1 A;  4JYA I;  3J80 Q;  1NHJ A;  2F4V E;  2NUG A;  4FWG A;  4DPU A;  2CPN A;  1H7U A;  1J26 A;  1IBM E;  2ZIT A;  1FJG E;  4DU7 A;  1Z0W A;  1H73 A;  3K17 A;  3K1J A;  1I94 I;  1Z0V A;  1D6T A;  4DKK A;  1KTV A;  3ADL A;  3H4L A;  4P7A A;  1IBK I;  4DR5 E;  2CZ9 A;  4LF7 I;  4JV5 E;  1X49 A;  5IT9 Q;  1STU A;  2L3J A;  2AJ4 A;  2NUE A;  4JI6 E;  4YY3 I;  4JI0 E;  2UUC I;  2B7T A;  3OTO I;  2HHH I;  4JI4 I;  4HXZ A;  2VQE I;  4DUY E;  3V5R A;  3LPS A;  3C4B A;  4P52 A;  4JI3 E;  5LMN I;  1J5E I;  3B82 A;  1RR9 A;  1XNR I;  1WHQ A;  2UU9 I;  4ED4 A;  5BR8 I;  5GME A;  4B3T I;  1HNW E;  4AQY E;  2LRS A;  1GQE A;  1N0U A;  1N36 E;  2HFU A;  4GKJ I;  4FWH A;  4DR2 E;  1WUU A;  2V34 A;  4DR4 E;  1OJ4 A;  3QT8 A;  4DV5 E;  1KKH A;  1T4L B;  2NUF A;  2LTR A;  3Q1Q A;  3T1H I;  1DAR A;  2HFS A;  5LL6 R;  1K47 A;  4LF4 I;  1RQ0 A;  4FWD A;  4LF9 E;  4DV1 E;  2RTX A;  3ZKD A;  3QT7 A;  1MU5 A;  3CWV A;  3QT5 A;  2IHR 1;  3F0N A;  2DMY A;  4DV6 E;  4ZVI A;  2UUB I;  1N34 E;  4JI1 E;  4DV2 I;  2A2D A;  1UHZ A;  1HNX E;  2KHX A;  1ZM9 A;  4DV0 I;  4X66 I;  3ADI A;  2ZM6 I;  4R1F A;  3JAM C;  1HR0 E;  1XMQ E;  1N0V C;  2OI2 A;  4DR6 I;  1EI1 A;  1HNZ E;  4LFB I;  3VYY A;  2E5L E;  4WUD A;  4DR1 I;  4KQV A;  5A2Q C;  2R3V A;  2N3G A;  2UXB I;  2VQF E;  2F4V I;  4DV4 E;  2V2Q A;  5GMD A;  1ZBT A;  1UIL A;  1IBM I;  3HTX A;  4PRX A;  4UT4 A;  1EKZ A;  1S4E A;  2L2K B;  4DR3 I;  4B3M I;  1IBL I;  4X64 E;  4DR5 I;  3PYF A;  4JV5 I;  4M30 A;  1Z59 A;  4DV7 E;  4DU8 A;  4DR7 E;  2UXD E;  4EMD A;  4JI6 I;  2EFG A;  4JI0 I;  1RRE A;  1B63 A;  4GKK I;  2RS6 A;  1VIS A;  1XNQ E;  4X65 E;  4JI8 I;  3LLH A;  4UTG A;  4JI3 I;  3ZZU A;  4JI2 E;  4HAC A;  4YHH E;  1Z0G A;  5FLX C;  3J7A M;  3WU4 A;  4JI5 I;  4B3S I;  4MYT A;  4WYQ B;  4AQY I;  1ZXM A;  3V2U C;  1N36 I;  1FI4 A;  2RSM A;  4KHP E;  2X36 A;  4DR4 I;  1I94 E;  2WW4 A;  1Z5C A;  1N33 E;  1H72 C;  2XEX A;  1KIJ A;  4X8W A;  1PKP A;  4M1K A;  4DUZ E;  1DI2 A;  1H74 A;  3J7A G;  4LF9 I;  2BM0 A;  1MX0 A;  4JI7 E;  2ZBK B;  2UUC E;  1X48 A;  4DV3 E;  4NXN E;  1N34 I;  2DB2 A;  3PYG A;  3ZZT A;  2DIX A;  4WUB A;  4LF6 E;  3P1X A;  4LFA E;  4OX9 E;  1J5E E;  4LFC I;  2LJP A;  2UUA E;  1Z0E A;  2J7K A;  1Z5A A;  1HR0 I;  3LNU A;  2UU9 E;  2RS7 A;  5BR8 E;  3ZKB A;  4USK A;  2LBS B;  2HK3 A;  3VYX A;  1FWK A;  1HNZ I;  2HKJ A;  2E5L I;  1ZXN A;  1Z5B A;  2DEJ A;  4FW9 A;  2R42 A;  2A2C A;  2VQF I;  1YYK A;  1H7S A;  4DV4 I;  1ZM2 A;  5LMU E;  2HKE A;  3B78 A;  2JY9 A;  3J80 C;  4RPF A;  4LF8 E;  1NZ0 A;  4B3R E;  2V2Z A;  4LF4 E;  1XMO E;  1FWL A;  4K0K E;  4X64 I;  1FJG I;  1B62 A;  1RC7 A;  4DV7 I;  4XTJ A;  5IWA E;  2LJH A;  2UXC E;  4MYU A;  4DV0 E;  3J81 C;  5IT9 C;  1FKA E;  4X66 E;  1QU6 A;  1NHI A;  2N3H A;  4PU9 A;  2JVA A;  3M6A A;  3WU5 A;  4DR6 E;  4URL A;  4DPY A;  4X62 E;  3T1Y E;  4NXM E;  2LUP B;  1MG7 A;  3JAM Q;  1N32 E;  2NPF A;  4YHH I;  2B3T B;  4M2Z A;  1YYO A;  2UXB E;  4DUY I;  5A2Q Q;  2BV3 A;  1ZM4 A;  1WHN A;  4KHP I;  1U2R A;  3D4J A;  1T4O A;  4LF5 E;  2X7I A;  2L3C A;  4JYA E;  1N33 I;  1UEK A;  1HNW I;  4DR3 E;  4B3M E;  1IBL E;  1Z0C A;  3J81 Q;  4DUZ I;  2Q2E B;  4DPT A;  4WFT A;  3GON A;  4DR2 I;  2VF3 A;  4JI7 I;  1Z0B A;  4JG4 A;  3ZM7 A;  3B8H A;  4DV5 I;  4DV3 I;  4NXN I;  1IBK E;  2EZ6 A;  1T4N A;  2NA2 A;  4LF7 E;  4PRV A;  4LF6 I;  4DPX A;  4GKK E;  1FNM A;  4HYM A;  1O0W A;  4WUC A;  4LFA I;  4DV1 I;  4OX9 I;  4JI8 E;  1QZR A;  4USM A;  2UUA I;  4YY3 E;  4DV6 I;  4JI1 I;  3OTO E;  3WU3 A;  4HY1 A;  1KVK A;  2HHH E;  4JI4 E;  1HNX I;  4JI5 E;  1X47 A;  2VQE E;  4B3S E;  1NHH A;  5LMN E;  5FLX Q;  1S16 A;  2GS8 A;  1ZM3 A;  1XNR E;  1XMQ I;  2LTS A;  2HK2 A;  1EA6 A;  4DXL A;  2V2V A;  4B3T E;  5LMU I;  5L3J A;  4LF8 I;  1PVG A;  4B3R I;  2MDR A;  1YZ9 A;  4GKJ E;  1PIE A;  1XHK A;  1XMO I;  2L33 A;  1ELO A;  3QT6 A;  4HAC B;  1A6F A;  5CFF E;  4K0K I;  3ADG A;  2DEI A;  4DPW A;  3ZZ0 A;  2LUQ A;  3T1H E;  2YT4 A;  5IWA I;  2UXC I;  4Z7C A;  1YYW A;  4LFC E;  3C4T A;  3J7Y p;  2UUB E;  2E1R A;  4DV2 E;  4FN5 A;  4DR7 I;  2L2M A;  2UXD I;  4X62 I;  3LTO A;  3T1Y I;  4NXM I;  3HUL A;  1N32 I;  3ADJ A;  4OOG C;  1BKN A;  4Z7Y A;  2ZM6 E;  1XNQ I;  1Z0T A;  4X65 I;  4I3H A;  3PYE A;  4LFB E;  2V8P A;  3PYD A;  4JI2 I;  4DR1 E;  3WU6 A; 
#chains in the Genus database with same CATH topology
 2EOZ A;  2EM3 A;  1GTK A;  4LF5 I;  2WP8 A;  2L2N A;  2B7V A;  2YTJ A;  4WX9 A;  1P42 A;  1Z1B A;  4FW4 A;  2EMH A;  2GHF A;  2JWO A;  2BM1 A;  2C38 A;  3J80 Q;  2V85 A;  4NZV A;  4LOM A;  4BS9 A;  1NHJ A;  2V89 A;  4QNK A;  2MKN A;  2F4V E;  4P78 A;  2NUG A;  1TF6 A;  2I9I A;  3P06 A;  4FWG A;  2CPN A;  4R2R A;  2EWL A;  1J26 A;  1IBM E;  1H7U A;  1FJG E;  2ZIT A;  4IZJ D;  4DU7 A;  3P76 A;  4ISA A;  1UDN A;  1Z0W A;  3M7N D;  1H73 A;  1Y5Y A;  3K17 A;  3K1J A;  1R6L A;  1I94 I;  1Z0V A;  1D6T A;  4DKK A;  1A1I A;  1KTV A;  4OO1 A;  1E3P A;  3ADL A;  3H4L A;  2V87 A;  3EQ1 A;  1X6F A;  3UK3 C;  4IZK B;  4P7A A;  1IBK I;  5LLQ A;  3OML A;  4DR5 E;  2EM2 A;  2CZ9 A;  4LF7 I;  4JV5 E;  5A6K A;  4HEI A;  3HPZ A;  2CGE A;  2EPK X;  1X49 A;  2EOY A;  5IT9 Q;  5KL4 A;  2YTG A;  2EMI A;  1STU A;  2L3J A;  2O1V A;  2ODR D;  2AJ4 A;  2NUE A;  5DRO A;  2LE2 A;  4JI6 E;  1USU A;  2EPP A;  4R2E A;  4YY3 I;  4JI0 E;  2UUC I;  2VE7 C;  4ZYE A;  2YRM A;  2B7T A;  3OTO I;  2NN6 B;  2NN6 C;  2D9H A;  4O5G A;  3DD6 A;  2EMY A;  3JTZ A;  5JEA A;  2HHH I;  2BBG A;  4JI4 I;  4HXZ A;  2VQE I;  4BC9 A;  4ZYG A;  2WNR B;  5AAS A;  4DUY E;  2LVH A;  4DMI A;  2Z5E A;  3V5R A;  3LPS A;  2FV4 B;  2EMW A;  3C4B A;  4P52 A;  4JI3 E;  5LMN I;  1J5E I;  1MG7 A;  1UDQ A;  3B82 A;  4L5N C;  3K85 A;  1YH8 A;  2PO0 A;  4HTG A;  1RR9 A;  2BA0 D;  2C39 A;  5KL5 A;  1XNR I;  1A1K A;  2LJU A;  1UBD C;  1WHQ A;  2UU9 I;  2L6M A;  1OYS A;  4ED4 A;  5BR8 I;  5GME A;  4B3T I;  3MSW A;  1SR9 A;  1HNW E;  3ECR A;  4F2J C;  4AQY E;  5IXM B;  2LRS A;  1GQE A;  2EOQ A;  2JOX A;  1N0U A;  1UN6 B;  3H1C A;  1A1L A;  1N36 E;  2HFU A;  4GKJ I;  2CG9 A;  2NN6 D;  4FWH A;  4DR2 E;  2Z5C A;  4WXC A;  1WUU A;  2V34 A;  4DR4 E;  2JYA A;  4IZJ A;  2O3Z A;  1OJ4 A;  3QT8 A;  2JOB A;  4DV5 E;  1KKH A;  2EQ3 A;  1T4L B;  2NUF A;  3HJC A;  2LTR A;  3Q1Q A;  3T1H I;  1DAR A;  2ENA A;  5LL6 R;  1K47 A;  2HFS A;  1RQ0 A;  4MDT A;  4LF4 I;  2E1M A;  4FWD A;  4LF9 E;  4DV1 E;  1UDO A;  2RTX A;  3CDI A;  2WCC 3;  2EN4 A;  3ZKD A;  5KL7 A;  3QT7 A;  1JK2 A;  1MU5 A;  2YRK A;  3CWV A;  3QT5 A;  2IHR 1;  4TUI A;  3F0N A;  2DMY A;  4LPF A;  4DV6 E;  4GQU A;  4ZVI A;  2UUB I;  2DLQ A;  1N34 E;  4JI1 E;  3PS3 A;  2GQ0 A;  4DV2 I;  2A2D A;  1YHC A;  4LU9 A;  1UHZ A;  3RMP A;  2FGG A;  1HNX E;  3PRY A;  2KHX A;  3M7N G;  1ZM9 A;  4LCG A;  1NEI A;  2BR2 B;  4DV0 I;  4X66 I;  2F1D A;  1YFH A;  3ADI A;  5DRP A;  2ZM6 I;  4BBY A;  4R1F A;  2HGH A;  2V83 A;  1PDA A;  3JAM C;  1HR0 E;  1XMQ E;  3BGH A;  4WSG A;  2EOX A;  2M1S A;  5IV8 B;  5KL2 A;  1NCS A;  1N0V C;  2OI2 A;  1Y4S A;  1KYQ A;  2BA1 G;  4F9A B;  2O1U A;  2Z5B B;  4DR6 I;  4IFD E;  1EI1 A;  1HNZ E;  4LFB I;  1ZR9 A;  5DNY A;  3VYY A;  2E5L E;  4WUD A;  4DR1 I;  4KQV A;  4GEQ B;  2LT7 A;  2EM9 A;  5A2Q C;  2R3V A;  2EPX A;  2N3G A;  2YTQ A;  2KOU A;  4U3B A;  2UXB I;  2VQF E;  2EML A;  2LMZ A;  2E72 A;  2NN6 A;  1ZBQ A;  4DV4 E;  2V2Q A;  5GMD A;  2F4V I;  3L7Z A;  1ZBT A;  1UIL A;  2I13 A;  1IBM I;  1OYP A;  4NHR A;  3HTX A;  4PRX A;  1YUJ A;  1L4S A;  4OKG A;  3JU0 A;  4BC7 A;  4UT4 A;  2EPU A;  1EKZ A;  2ELY A;  1S4E A;  1BB8 A;  2LO3 A;  4MU1 A;  4BMJ A;  2L2K B;  3BBG A;  1YPN A;  4DR3 I;  4MU4 A;  1IBL I;  4X64 E;  4DR5 I;  4B3M I;  3PYF A;  4JV5 I;  1BBG A;  4M30 A;  1Z59 A;  5C0X B;  5C0X C;  2PO2 B;  4ZYH A;  2YU8 A;  4DV7 E;  4RH8 A;  2NN6 E;  2L8T A;  4DU8 A;  4DR7 E;  2YZT A;  1WXR A;  2UXD E;  4EMD A;  4JI6 I;  2EFG A;  4JI0 I;  1BBO A;  2EMF A;  5K36 B;  2EMB A;  1RRE A;  3K6Q A;  5C0X F;  5K36 C;  4P7D A;  4F9B B;  2WBS A;  4NBQ A;  1B63 A;  2FTX B;  2EQ0 A;  2RS6 A;  1VIS A;  4GKK I;  2BA1 D;  1XNQ E;  1IQO A;  1SFE A;  2JPA A;  4X65 E;  4JI8 I;  3LLH A;  1HK7 A;  4UTG A;  4JI3 I;  3ZZU A;  4OZE A;  2YTD A;  4JI2 E;  3EPK A;  5K36 F;  2EN2 A;  3THO B;  4HAC A;  5ELW A;  4YHH E;  2M4I A;  1Z0G A;  5FLX C;  3Q6N A;  3Q6M A;  4IFD F;  2IER A;  4X9J A;  2J65 A;  1PJS A;  2EOE A;  3J7A M;  3WU4 A;  2JEA B;  1N3G A;  2NAB A;  1IMU A;  4OO1 E;  4JI5 I;  4B3S I;  4MYT A;  2EN8 A;  2CSH A;  2MKD A;  4WYQ B;  4AQY I;  2B9D A;  1E3H A;  1ZXM A;  3V2U C;  2JP9 A;  4GZN C;  1N36 I;  2GPI A;  4F9C B;  1FI4 A;  2RSM A;  2EQ1 A;  4KHP E;  4O24 A;  2X36 A;  2JT2 A;  1ZU1 A;  2PNM A;  3IWC A;  2V8Q B;  1I94 E;  4DR4 I;  3IWB A;  1Y60 A;  2WW4 A;  5TSE A;  1Z5C A;  3M85 D;  1N33 E;  1TF3 A;  1H72 C;  3L00 A;  2XEX A;  2DMI A;  1KIJ A;  4QNJ A;  4X8W A;  1PKP A;  2EPL X;  5JEA E;  4M1K A;  2Z5B A;  4DUZ E;  1DI2 A;  1H74 A;  3J7A G;  3VHT B;  4LF9 I;  2BM0 A;  1MX0 A;  1Y4U A;  3HKM A;  2J7J A;  4JI7 E;  2ZBK B;  4AM3 A;  2ENC A;  2YTE A;  4RHB B;  2CT1 A;  2UUC E;  1X48 A;  1PJT A;  4DV3 E;  5T6J A;  4NXN E;  5DNX A;  2DB2 A;  1N34 I;  4O4K A;  2EM8 A;  3PYG A;  3ZZT A;  3EPL A;  2DIX A;  4BA2 B;  2YSO A;  4LF6 E;  4WUB A;  3KWR A;  2IOQ A;  2IES A;  2EPR A;  1X6H A;  3PS1 A;  4FW7 A;  3P1X A;  4IJD A;  4LFA E;  4OX9 E;  5A6B D;  1J5E E;  5AE1 A;  2DGC A;  4LFC I;  1QNT A;  2LJP A;  2EOR A;  2HC5 A;  2UUA E;  1Z0E A;  2J7K A;  1Z5A A;  1HR0 I;  2F8B A;  3LNU A;  2UU9 E;  2RS7 A;  5BR8 E;  3ZKB A;  4MU0 A;  2V88 A;  2LBS B;  1JK1 A;  3VYX A;  1FWK A;  2HK3 A;  2HKJ A;  4USK A;  1HNZ I;  2YPN A;  2E5L I;  1VI7 A;  2EMZ A;  2PO2 A;  2R76 A;  4BHB A;  1F2I G;  4OO1 F;  4I8O A;  1PJQ A;  1G2D C;  1ZXN A;  3GCM A;  4MU3 A;  3B4T A;  2EM5 A;  3NZK A;  1Z5B A;  3GME A;  2PRT A;  2YTO A;  4Q28 A;  2DEJ A;  4FW9 A;  2R42 A;  1GZ6 A;  2A2C A;  2AE8 A;  4IZK A;  2VQF I;  1A1G A;  1YYK A;  1UDS A;  5K36 A;  2EPC A;  4IS1 C;  1H7S A;  2EL4 A;  4DV4 I;  2GO4 A;  2EJ4 A;  5A6A A;  5LMU E;  1ZM2 A;  1AAY A;  2HKE A;  3B78 A;  2JY9 A;  3J80 C;  4RPF A;  4LF8 E;  1NZ0 A;  4B3R E;  2V2Z A;  4LF4 E;  4MQY A;  1XMO E;  1A1J A;  2YTN A;  4N4R B;  5DRR A;  2JR1 A;  1FWL A;  4J3D A;  2DRP A;  4K0K E;  1TN9 A;  4MLV A;  2JE6 B;  1KJK A;  4X64 I;  2JEA A;  2EL6 A;  2PNL A;  3DF6 A;  1A1H A;  4BA1 B;  1FJG I;  2WNR A;  2LCE A;  1B62 A;  1T39 A;  1RC7 A;  4DV7 I;  2EOS A;  2EOF A;  1B69 A;  3HQ1 A;  4XTJ A;  5IWA E;  2LJH A;  4R2D A;  2UXC E;  4MYU A;  4LTY A;  3BID A;  3J81 C;  4DV0 E;  2DLK A;  2EM6 A;  5IT9 C;  1A1F A;  2R1F A;  4R2Q A;  1FKA E;  4X66 E;  1QU6 A;  3M85 G;  2MDG A;  1NHI A;  2YTI A;  4IZJ B;  2N3H A;  4R03 A;  5A6J A;  4PU9 A;  2JVA A;  5A6B A;  4WSP A;  1YUI A;  5DRQ A;  4L8N A;  2PO1 B;  1MGT A;  3M6A A;  2YU5 A;  3WU5 A;  2H36 X;  4DR6 E;  4URL A;  4DPY A;  2WBT A;  4X62 E;  3T1Y E;  4NXM E;  4WXD A;  2YTF A;  4R2C A;  2LUP B;  2EOI A;  4M9V C;  2WBU A;  1N32 E;  3JAM Q;  5F3W A;  2NPF A;  4AID A;  4YHH I;  3H09 A;  1OYR A;  2B3T B;  1R6M A;  2JEB B;  5AE3 A;  4IFD B;  4IFD C;  2EN3 A;  2ODR C;  1USV A;  2ELZ A;  1YYO A;  4R2P A;  4M2Z A;  2UXB E;  2O1W A;  1X5W A;  1X6E A;  3U1Y A;  4DUY I;  5A2Q Q;  4BCA A;  3KZZ A;  3C6M A;  3MHS C;  2BV3 A;  3P3E A;  4BA2 A;  2O1T A;  4WPY A;  4F6N A;  1ZM4 A;  3CDJ A;  1WHN A;  4O43 A;  3GLL A;  4KHP I;  1U2R A;  2EM0 A;  2EN7 A;  3D4J A;  2PNZ B;  2EOM A;  1T4O A;  4LF5 E;  5C0X D;  2VF1 A;  2CVE A;  2MC5 A;  2WZO A;  2X7I A;  2L3C A;  4JYA E;  2C37 B;  1WRJ A;  1P47 A;  1N33 I;  4FK5 C;  1UEK A;  1HNW I;  1G2F C;  2RSI A;  4DR3 E;  1DGC A;  1IBL E;  4B3M E;  1Z0C A;  2M7Q A;  5EKW A;  5A69 A;  2EMX A;  2G7H A;  2CTD A;  3J81 Q;  4DUZ I;  4JYA I;  1Y6Z A;  2Q2E B;  5K36 D;  3EPH A;  2BR2 A;  4DPT A;  3HXL A;  4WFT A;  2GLI A;  3GON A;  2VF3 A;  4DR2 I;  4IFD D;  3THN A;  2GO3 A;  4JI7 I;  2K4V A;  1Z0B A;  4JG4 A;  3ZM7 A;  3M99 B;  3B8H A;  2EN6 A;  4DV5 I;  2L92 A;  4DV3 I;  4NXN I;  1IBK E;  2EM4 A;  2JXP A;  3AV0 A;  2EZ6 A;  1T4N A;  1IQS A;  3ZOQ B;  2NA2 A;  2YRH A;  1RHY A;  4LF7 E;  3L7Z B;  4PRV A;  4LF6 I;  3AUZ A;  4DPX A;  5KL3 A;  5DNL A;  4GKK E;  1FNM A;  4HYM A;  1O0W A;  4WUC A;  2HJJ A;  4LFA I;  4DV1 I;  3PS2 A;  4OX9 I;  4JI8 E;  2K7I A;  3QG5 C;  4F54 A;  2WP8 B;  1QZR A;  2EM7 A;  2EN1 A;  2NN6 F;  4USM A;  2UUA I;  4YY3 E;  4DV6 I;  1AH5 A;  2C38 B;  1MEY C;  2RPC A;  4JI1 I;  3OTO E;  3WU3 A;  4HY1 A;  1YSA C;  2JE6 A;  1KVK A;  2HHH E;  4MLQ A;  4KZS A;  2EPO A;  4JI4 E;  2EMC A;  4JI5 E;  1X47 A;  4R2A A;  2VQE E;  4B3S E;  1NHH A;  3U1K A;  1EH6 A;  2EPM X;  2N8X A;  4BA1 A;  4KWY A;  5LMN E;  4R2S A;  1LLM C;  5FLX Q;  3UHM A;  2YWQ A;  2EL5 A;  1S16 A;  2GS8 A;  4F6M A;  1ZM3 A;  1X3C A;  2KON A;  4OO1 B;  4OO1 C;  1XNR E;  1XMQ I;  2LTS A;  3VK6 A;  1DQ3 A;  5AC5 A;  2HK2 A;  1EA6 A;  2EOO A;  4DXL A;  2V2V A;  2Q8U A;  1EH8 A;  3BF2 A;  3F6G A;  4B3T E;  4IS9 A;  1HNX I;  4FW5 A;  4U3D A;  5LMU I;  5AC4 A;  3C6K A;  5L3J A;  2PO1 A;  1WJP A;  2EMK A;  5FWK A;  5AE2 A;  5C0X A;  4LF8 I;  1PVG A;  4B3R I;  2MDR A;  1YZ9 A;  4GKJ E;  1PIE A;  1XHK A;  1XMO I;  4J8Z A;  2L33 A;  1ELO A;  3QT6 A;  5ADZ A;  4FW3 A;  4HAC B;  5EL9 A;  2EPN A;  4AIM A;  1A6F A;  3HPS A;  3KZY A;  5CFF E;  2JEB A;  4K0K I;  2EOJ A;  3ADG A;  5JEA B;  2DEI A;  5JEA C;  4DPW A;  4IFD A;  4ZYD A;  1ZAA C;  1EH7 A;  3ZZ0 A;  2VES A;  2LUQ A;  2EMA A;  2YTP A;  3IWD A;  3TQM A;  3T1H E;  4OO1 D;  2EOH A;  2BB8 A;  2YT4 A;  3LML A;  2EMG A;  5IWA I;  2UXC I;  4Z7C A;  2IOP A;  2PO0 B;  2VRD A;  2C39 B;  1YYW A;  5C0X E;  5KL6 A;  5JEA F;  2PNZ A;  4LFC E;  2EP3 A;  3DJW A;  3C4T A;  3J7Y p;  2ENH A;  2UUB E;  2C37 A;  3FIG A;  2E1R A;  2LV2 A;  4DV2 E;  4DPU A;  4FN5 A;  5K36 E;  4DR7 I;  2DSY A;  2L2M A;  4TUG A;  2UXD I;  4X62 I;  3LTO A;  3T1Y I;  4NXM I;  2Z5C B;  3P3G A;  3HUL A;  4FW6 A;  5JEA D;  1N32 I;  2MC6 A;  2EPZ A;  3ADJ A;  4OOG C;  4BHC A;  1BKN A;  4Z7Y A;  4R8O A;  1T38 A;  2EPA A;  3P3C A;  2YSP A;  2ZM6 E;  3EPJ A;  1RMD A;  2A25 A;  2RQL A;  2EE8 A;  2V86 A;  3F6H A;  3MHH C;  4N3O A;  1Z0T A;  4LCH A;  1XNQ I;  4Q35 B;  4X65 I;  2M9A A;  3KRN A;  1XXE A;  4I3H A;  4M0V A;  4LFB E;  2V8P A;  3PYE A;  3PYD A;  4JI2 I;  4DR1 E;  3WU6 A;  4LCF A;  2ADR A;  2BA0 G; 
#chains in the Genus database with same CATH homology
 4LF5 I;  2L2N A;  2B7V A;  2BM1 A;  2JWO A;  4JYA I;  3J80 Q;  2V85 A;  4BS9 A;  1NHJ A;  2V89 A;  2F4V E;  4P78 A;  2NUG A;  3P06 A;  4FWG A;  2CPN A;  4DPU A;  2EWL A;  1J26 A;  1IBM E;  1H7U A;  1FJG E;  2ZIT A;  4IZJ D;  4DU7 A;  1Z0W A;  1H73 A;  3K17 A;  3K1J A;  1I94 I;  1Z0V A;  1D6T A;  4DKK A;  1KTV A;  3ADL A;  3H4L A;  2V87 A;  4IZK B;  4P7A A;  1IBK I;  3OML A;  4DR5 E;  2CZ9 A;  4LF7 I;  4JV5 E;  3HPZ A;  2CGE A;  1X49 A;  5IT9 Q;  1STU A;  2L3J A;  2O1V A;  2ODR D;  2AJ4 A;  2NUE A;  2LE2 A;  4JI6 E;  1USU A;  4YY3 I;  4JI0 E;  2UUC I;  2VE7 C;  2B7T A;  3OTO I;  2HHH I;  3JTZ A;  4JI4 I;  4HXZ A;  2VQE I;  4BC9 A;  5AAS A;  4DUY E;  4DMI A;  2Z5E A;  3V5R A;  3LPS A;  2FV4 B;  3C4B A;  4P52 A;  4JI3 E;  5LMN I;  1J5E I;  3K85 A;  3B82 A;  4L5N C;  1RR9 A;  1XNR I;  1WHQ A;  2UU9 I;  2L6M A;  4ED4 A;  5BR8 I;  5GME A;  4B3T I;  3MSW A;  1SR9 A;  1HNW E;  4AQY E;  2LRS A;  1GQE A;  2JOX A;  1N0U A;  1N36 E;  2HFU A;  4GKJ I;  2CG9 A;  4FWH A;  4DR2 E;  2Z5C A;  1WUU A;  2V34 A;  4DR4 E;  4IZJ A;  1OJ4 A;  3QT8 A;  2JOB A;  4DV5 E;  1KKH A;  1T4L B;  2NUF A;  3HJC A;  2LTR A;  3Q1Q A;  3T1H I;  1DAR A;  2HFS A;  5LL6 R;  1K47 A;  4LF4 I;  1RQ0 A;  2E1M A;  4FWD A;  4LF9 E;  4DV1 E;  2RTX A;  3ZKD A;  3QT7 A;  1MU5 A;  3CWV A;  3QT5 A;  2IHR 1;  4TUI A;  3F0N A;  2DMY A;  4DV6 E;  4ZVI A;  2UUB I;  1N34 E;  4JI1 E;  2GQ0 A;  4DV2 I;  2A2D A;  4LU9 A;  1UHZ A;  3RMP A;  2FGG A;  1HNX E;  3PRY A;  2KHX A;  1ZM9 A;  4DV0 I;  4X66 I;  3ADI A;  2ZM6 I;  4BBY A;  4R1F A;  2V83 A;  3JAM C;  1HR0 E;  1XMQ E;  1N0V C;  2M1S A;  2OI2 A;  1Y4S A;  4F9A B;  2O1U A;  2Z5B B;  4DR6 I;  1EI1 A;  1HNZ E;  4LFB I;  5DNY A;  3VYY A;  2E5L E;  4WUD A;  4DR1 I;  4KQV A;  4GEQ B;  5A2Q C;  2R3V A;  2N3G A;  2KOU A;  2UXB I;  2VQF E;  2LMZ A;  2F4V I;  1ZBQ A;  4DV4 E;  2V2Q A;  5GMD A;  1ZBT A;  1UIL A;  1IBM I;  3HTX A;  4PRX A;  4UT4 A;  3JU0 A;  4BC7 A;  1EKZ A;  1S4E A;  4BMJ A;  2L2K B;  4DR3 I;  4B3M I;  1IBL I;  4X64 E;  4DR5 I;  3PYF A;  4JV5 I;  4M30 A;  1Z59 A;  4DV7 E;  4DU8 A;  2L8T A;  4DR7 E;  2YZT A;  1WXR A;  2UXD E;  4EMD A;  4JI6 I;  2EFG A;  4JI0 I;  1RRE A;  3K6Q A;  4P7D A;  4F9B B;  1B63 A;  2FTX B;  2RS6 A;  1VIS A;  4GKK I;  1XNQ E;  4X65 E;  4JI8 I;  3LLH A;  1HK7 A;  4UTG A;  4JI3 I;  3ZZU A;  4JI2 E;  4HAC A;  4YHH E;  2M4I A;  1Z0G A;  5FLX C;  3Q6N A;  3Q6M A;  3J7A M;  3WU4 A;  4JI5 I;  4B3S I;  4MYT A;  4WYQ B;  4AQY I;  2B9D A;  1ZXM A;  3V2U C;  1N36 I;  4F9C B;  1FI4 A;  2RSM A;  4KHP E;  2X36 A;  2PNM A;  3IWC A;  2V8Q B;  1I94 E;  4DR4 I;  3IWB A;  2WW4 A;  1Z5C A;  1N33 E;  1H72 C;  2XEX A;  1KIJ A;  4X8W A;  1PKP A;  4M1K A;  2Z5B A;  4DUZ E;  1DI2 A;  1H74 A;  3J7A G;  4LF9 I;  2BM0 A;  1MX0 A;  1Y4U A;  4JI7 E;  2ZBK B;  2UUC E;  1X48 A;  4DV3 E;  5T6J A;  4NXN E;  1N34 I;  2DB2 A;  3PYG A;  3ZZT A;  2DIX A;  4WUB A;  4LF6 E;  3KWR A;  2IOQ A;  3P1X A;  4LFA E;  4OX9 E;  1J5E E;  5AE1 A;  4LFC I;  2LJP A;  2UUA E;  1Z0E A;  2J7K A;  1Z5A A;  1HR0 I;  2F8B A;  3LNU A;  2UU9 E;  2RS7 A;  5BR8 E;  3ZKB A;  2V88 A;  2LBS B;  2HK3 A;  3VYX A;  1FWK A;  4USK A;  2HKJ A;  1HNZ I;  2E5L I;  4I8O A;  1ZXN A;  1Z5B A;  4Q28 A;  2DEJ A;  4FW9 A;  2R42 A;  1GZ6 A;  2A2C A;  4IZK A;  2VQF I;  1YYK A;  1H7S A;  4DV4 I;  1ZM2 A;  5LMU E;  2HKE A;  3B78 A;  2JY9 A;  3J80 C;  4RPF A;  4LF8 E;  1NZ0 A;  4B3R E;  2V2Z A;  4LF4 E;  1XMO E;  2JR1 A;  1FWL A;  4K0K E;  4X64 I;  2PNL A;  3DF6 A;  1FJG I;  1B62 A;  1RC7 A;  4DV7 I;  3HQ1 A;  4XTJ A;  5IWA E;  2LJH A;  2UXC E;  4MYU A;  4LTY A;  3J81 C;  4DV0 E;  5IT9 C;  1FKA E;  4X66 E;  1QU6 A;  1NHI A;  4IZJ B;  2N3H A;  4R03 A;  4PU9 A;  2JVA A;  4WSP A;  4L8N A;  3M6A A;  3WU5 A;  2H36 X;  4DR6 E;  4URL A;  4DPY A;  4X62 E;  3T1Y E;  4NXM E;  2LUP B;  1MG7 A;  3JAM Q;  1N32 E;  5F3W A;  2NPF A;  4YHH I;  3H09 A;  2B3T B;  5AE3 A;  1USV A;  2ODR C;  4M2Z A;  1YYO A;  2UXB E;  2O1W A;  4DUY I;  5A2Q Q;  4BCA A;  2BV3 A;  2O1T A;  4WPY A;  1ZM4 A;  1WHN A;  4KHP I;  1U2R A;  3D4J A;  1T4O A;  4LF5 E;  2VF1 A;  2MC5 A;  2WZO A;  2X7I A;  2L3C A;  4JYA E;  1N33 I;  1UEK A;  1HNW I;  4DR3 E;  4B3M E;  1IBL E;  1Z0C A;  2M7Q A;  2G7H A;  3J81 Q;  4DUZ I;  1Y6Z A;  2Q2E B;  4DPT A;  3HXL A;  4WFT A;  3GON A;  4DR2 I;  2VF3 A;  4JI7 I;  2K4V A;  1Z0B A;  4JG4 A;  3ZM7 A;  3B8H A;  4DV5 I;  2L92 A;  4DV3 I;  4NXN I;  1IBK E;  3AV0 A;  2EZ6 A;  1T4N A;  3ZOQ B;  2NA2 A;  4LF7 E;  4PRV A;  4LF6 I;  3AUZ A;  4DPX A;  4GKK E;  1FNM A;  4HYM A;  1O0W A;  4WUC A;  4LFA I;  4DV1 I;  4OX9 I;  4JI8 E;  4F54 A;  1QZR A;  4USM A;  2UUA I;  4YY3 E;  4DV6 I;  4JI1 I;  3OTO E;  3WU3 A;  4HY1 A;  1KVK A;  2HHH E;  4KZS A;  4JI4 E;  1HNX I;  4JI5 E;  1X47 A;  2VQE E;  4B3S E;  1NHH A;  5LMN E;  5FLX Q;  1S16 A;  2GS8 A;  1ZM3 A;  2KON A;  1XNR E;  1XMQ I;  2LTS A;  3VK6 A;  1DQ3 A;  2HK2 A;  1EA6 A;  4DXL A;  2V2V A;  3F6G A;  4B3T E;  5LMU I;  5L3J A;  5FWK A;  5AE2 A;  4LF8 I;  1PVG A;  4B3R I;  2MDR A;  1YZ9 A;  4GKJ E;  1PIE A;  1XHK A;  1XMO I;  4J8Z A;  2L33 A;  1ELO A;  3QT6 A;  5ADZ A;  4HAC B;  1A6F A;  3HPS A;  5CFF E;  4K0K I;  3ADG A;  2DEI A;  4DPW A;  3ZZ0 A;  2LUQ A;  3IWD A;  3T1H E;  2YT4 A;  5IWA I;  3LML A;  2UXC I;  4Z7C A;  2IOP A;  1YYW A;  4LFC E;  3DJW A;  3C4T A;  3J7Y p;  2UUB E;  3FIG A;  2E1R A;  4DV2 E;  4FN5 A;  4DR7 I;  2DSY A;  2L2M A;  4TUG A;  2UXD I;  4X62 I;  3LTO A;  3T1Y I;  4NXM I;  2Z5C B;  3HUL A;  1N32 I;  2MC6 A;  3ADJ A;  4OOG C;  1BKN A;  4Z7Y A;  4R8O A;  2ZM6 E;  2V86 A;  3F6H A;  4N3O A;  1XNQ I;  1Z0T A;  4X65 I;  4I3H A;  4M0V A;  4LFB E;  2V8P A;  3PYE A;  3PYD A;  4JI2 I;  4DR1 E;  3WU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...