1N34E

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n34E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n34E02
2V8PA 2F4VI 5LMUI 4X64E 3QT6A 3QT8A 2E5LE 3CWVA 1WUUA 4LF7E 1IBLI 3V2UC 1J5EE 4JV5E 1K47A 3J7AG 2EFGA 2E1RA 4URLA 3HULA 4JI3I 1IBKE 1HNWE 1HNXI 2VF3A 4DV0E 3LLHA 1EKZA 4LF8I 3VYXA 1UHZA 4B3RE 1RQ0A 1N32I 2JY9A 5BR8E 2NUEA 1MU5A 1WHQA 2BM1A 4JI4E 1X47A 4LF5I 4DV4E 1Z5BA 2DMYA 4X8WA 2UXCI 4DR7E 5LMUE 2BM0A 4KQVA 1FJGI 4JI0E 2A2DA 4OX9I 4FW9A 4B3TE 3HTXA 2UXBI 3T1HI 2X7IA 3PYGA 4M30A 2DIXA 3F0NA 5LMNI 3JAMC 1H72C 1UEKA 1MX0A 1S16A 2CZ9A 5IWAI 5A2QC 4DKKA 2HK2A 1FI4A 4DV7I 1RC7A 3H4LA 1U2RA 1H73A 4KHPI 3C4TA 1YYKA 1HNZI 4HYMA 1EA6A 2ZBKB 3T1YE 2V2VA 4FN5A 4LFBE 4NXNI 4DXLA 2CPNA 3LNUA 1IBMI 2UUBI 4DPXA 3J80Q 1QZRA 2UU9I 4XTJA 4JI7I 4LFAE 1RREA 3J7Yp 2LTRA 3OTOI 4DR3E 4DR5I 2NA2A 3Q1QA 2HHHE 2V34A 3PYFA 2GS8A 2OI2A 4WUCA 3GONA 5IT9Q 2EZ6A 1H7SA 1J26A 1RR9A 3WU3A 4JI1I 4YY3I 1QU6A 1N0VC 4B3MI 4Z7CA 2X36A 4DV3E 3ZZUA 2LRSA 3M6AA 2VQFI 4NXMI 4WYQB 1KTVA 1N36E 5GMDA 4OOGC 1NHHA 5LL6R 2B7TA 3ZKBA 3J81Q 4JYAI 4DR6I 2UUCE 1DARA 4FWHA 4LF4I 1KKHA 2LUQA 3C4BA 4DUZI 2ZM6I 1XMQI 1B62A 4B3SI 4JI6I 2B3TB 1HR0I 3OTOE 4DR5E 2JVAA 2R42A 4DUYE 2XEXA 3V5RA 4JI8I 2LJPA 2L3CA 1Z5CA 3ZKDA 3LTOA 4DV5I 4DV2E 4JI1E 1H74A 2LTSA 2VQEE 1PVGA 1T4OA 4B3ME 1I94E 4AQYI 3D4JA 1BKNA 2L2KB 2DEIA 2F4VE 1S4EA 4HY1A 2RTXA 3LPSA 4USMA 1XNQI 4X65I 4WUBA 3B82A 4LF9I 2L2MA 2HKEA 1IBLE 4JYAE 3ZZTA 4P7AA 4JI3E 1FNMA 2DB2A 1HNXE 2ZM6E 4WFTA 1XMQE 4LF8E 4DR4I 2LBSB 1ZBTA 2LUPB 1N32E 2NPFA 4DPWA 4I3HA 4YHHI 3ZZ0A 1FWLA 2AJ4A 4ED4A 4GKKI 1DI2A 4HXZA 4PU9A 4DR2I 3P1XA 4LF5E 1NHJA 3J80C 1B63A 3J7AM 2UXCE 1ZM2A 2RSMA 1PIEA 1NHIA 1STUA 1FJGE 5IT9C 4OX9E 1XHKA 4LF9E 4X64I 2L3JA 2UXBE 3T1HE 4UTGA 3PYEA 5LMNE 4X62I 1Z0VA 4FWGA 5IWAE 4PRVA 4LFCI 4LF7I 1J5EI 4DV7E 1XMOI 2L33A 1ELOA 4USKA 2V2ZA 4KHPE 4P52A 1HNZE 4JI5I 4RPFA 4B3RI 3J81C 4K0KI 2NUFA 4DR1I 4NXNE 4X66I 3B78A 1Z5AA 2B7VA 2YT4A 1ZXMA 2ZITA 4JI4I 1IBME 1Z0BA 2J7KA 3ADLA 3ADIA 1XNRI 2UUBE 1ZM9A 2UU9E 4DR7I 4JI7E 5FLXQ 1MG7A 1KIJA 4DU7A 2BV3A 4JI0I 4X62E 1KVKA 4B3TI 2UUAI 1EI1A 4LFCE 1Z59A 2WW4A 4DV1I 2HFSA 4YY3E 4DV6I 1XMOE 1Z0WA 4GKJI 1N0UA 4FWDA 4JI5E 4Z7YA 4K0KE 4JG4A 4DR1E 1A6FA 1Z0EA 3ZM7A 2VQFE 1Z0TA 4NXME 1Z0CA 1X49A 4X66E 2NUGA 2HKJA 1T4LB 2IHR1 1N33I 2LJHA 3T1YI 5L3JA 1ZXNA 1XNRE 4LFBI 4DR6E 5CFFE 4LF4E 4DUZE 4JI2I 1YYOA 4B3SE 4JI6E 1HR0E 1WHNA 1OJ4A 2MDRA 4DPUA 1NZ0A 3QT5A 4R1FA 3QT7A 3K17A 4JI8E 2RS6A 4LF6I 2UUAE 4LFAI 2UXDI 1Z0GA 4DV1E 4DR3I 4DV5E 1GQEA 4DV6E 2HHHI 4GKJE 2N3HA 2R3VA 4AQYE 1D6TA 2HFUA 4HACB 1YYWA 1ZM4A 2DEJA 1N34I 4ZVIA 3JAMQ 1XNQE 4DV3I 4X65E 1N33E 5A2QQ 3WU4A 1PKPA 3ADGA 2L2NA 1N36I 2E5LI 4MYTA 2N3GA 2HK3A 3ADJA 4HACA 3WU6A 2A2CA 4JI2E 2RS7A 4MYUA 4DR4E 4JV5I 3VYYA 4EMDA 1FKAE 2UUCI 1O0WA 1VISA 3K1JA 1IBKI 1HNWI 4YHHE 1FWKA 4DPYA 4DV0I 4LF6E 4GKKE 5GMEA 2KHXA 1UILA 2UXDE 4DR2E 4DUYI 1YZ9A 4PRXA 5BR8I 4DU8A 4M2ZA 1ZM3A 1T4NA 3B8HA 2V2QA 4UT4A 5FLXC 3PYDA 4DV2I 1X48A 4DPTA 2VQEI 1H7UA 1N34E 2Q2EB 3WU5A 4WUDA 4DV4I 4M1KA 1I94I
chains in the Genus database with same CATH superfamily
5JEAF 2V8PA 2F4VI 4GEQB 2LVHA 5LMUI 4NHRA 1SR9A 5A6BD 1EH7A 5KL7A 2I9IA 4X64E 2MKDA 3QT6A 1UN6B 4LOMA 1UDNA 2EM9A 3QT8A 2E5LE 4BA2A 2VESA 4RHBB 2EMIA 2M7QA 2EPPA 3CWVA 1F2IG 4F2JC 1WUUA 2EN8A 2Z5BB 4LF7E 3UHMA 4LU9A 3V2UC 2DMIA 1IBLI 1J5EE 4JV5E 1K47A 2H36X 3J7AG 1PJTA 2EFGA 2E1RA 4URLA 2GLIA 4IFDC 3HULA 4JI3I 2HGHA 1IBKE 1HNWE 5K36B 1HNXI 2VF3A 4DV0E 2GHFA 3LLHA 1A1IA 2EPRA 1EKZA 3VYXA 4LF8I 1UHZA 1X3CA 4B3RE 2EWLA 1RQ0A 3EPLA 2EMLA 4HTGA 2EMBA 2LMZA 2B9DA 2EM5A 1N32I 1T38A 2EN1A 3IWCA 2EM4A 2JY9A 4OZEA 5BR8E 4TUGA 2EMGA 1PJQA 2NUEA 4O43A 1MU5A 3AUZA 1WHQA 2BM1A 1RHYA 4BMJA 4JI4E 1WRJA 4WSPA 2EN4A 1YUIA 3K85A 1X47A 2EPOA 4LF5I 5JEAC 4DV4E 2MKNA 2DRPA 5K36A 1NCSA 1Z5BA 2DMYA 4X8WA 2UXCI 1NEIA 1G2FC 1Y4SA 2EOOA 2EOHA 5KL4A 2EP3A 4DR7E 5LMUE 2EJ4A 1ZBQA 2BM0A 4KQVA 3MSWA 1FJGI 3RMPA 5DRQA 2O1TA 4JI0E 4AIDA 2YTQA 1X6FA 2A2DA 1T39A 4FW9A 4OX9I 5K36D 2NN6E 2EN2A 4B3TE 3M99B 3KWRA 2C38B 3HTXA 2IOPA 4OO1F 3T1HI 2V83A 4IFDE 2UXBI 2X7IA 3PYGA 4M30A 2DIXA 3F0NA 4P78A 5LMNI 3JAMC 1H72C 1UEKA 3HPSA 1MX0A 1S16A 2CZ9A 5IWAI 3EQ1A 5A2QC 1KYQA 2RQLA 4DKKA 4R2PA 1KJKA 1FI4A 4TUIA 2HK2A 5AE1A 4DV7I 1RC7A 3H4LA 1U2RA 4FW7A 2NABA 1H73A 2EOSA 4KHPI 3C4TA 1YYKA 1HNZI 2YPNA 4ZYHA 2NN6B 2GO4A 4FW6A 4HYMA 4BBYA 2C37A 4R2EA 4KZSA 1EA6A 2CSHA 2ZBKB 3T1YE 2V2VA 4IFDB 3CDIA 4FN5A 2Z5EA 4LFBE 4NXNI 2EN6A 3QG5C 2PNMA 1AAYA 2CPNA 4GQUA 2YTEA 4MU0A 4DXLA 2ELYA 2R76A 2ODRC 2WBSA 3EPJA 4MLVA 3LNUA 2BBGA 1IBMI 1YFHA 2EMAA 4FK5C 3PS3A 2V89A 2UUBI 3C6MA 4O24A 1Y5YA 2EORA 4P7DA 4DPXA 2NN6F 3J80Q 1QZRA 2EMHA 1E3PA 2UU9I 4RH8A 1A1HA 4IZJA 4XTJA 4JI7I 4LFAE 2FGGA 1RREA 2IESA 4IFDA 2YTPA 2C39B 3J7Yp 2LTRA 3OTOI 4DR3E 4DR5I 3P3EA 3IWBA 2NA2A 1DGCA 3Q1QA 3H09A 2HHHE 2V34A 2YRMA 3PYFA 2GS8A 2OI2A 4WUCA 4HEIA 3GONA 2JE6B 2WNRB 2YTIA 5DNYA 2NN6D 5IT9Q 2EZ6A 2EN7A 1H7SA 3P06A 4R2CA 2VRDA 5A6BA 2ENHA 1J26A 1RR9A 1XXEA 3L7ZA 4JI1I 3WU3A 4YY3I 4IFDD 1QU6A 3JU0A 2LV2A 1MEYC 4BHBA 1R6MA 2LCEA 1N0VC 2WBUA 3F6HA 4B3MI 4Z7CA 5T6JA 5ADZA 2X36A 4DV3E 2YRHA 4L8NA 3ZZUA 3ZOQB 5JEAA 2ELZA 2JR1A 2EPKX 3KRNA 2O3ZA 2LRSA 3M6AA 4FW3A 2VQFI 4QNKA 4NXMI 4WYQB 4O5GA 1KTVA 1N36E 1USUA 3P3GA 1USVA 2JE6A 2CT1A 4OOGC 1NHHA 5GMDA 2RSIA 3DD6A 2YU8A 3KZZA 2PO1A 5LL6R 5JEAD 2B7TA 3ZKBA 3J81Q 2NN6C 1MGTA 1A1JA 4JYAI 4BHCA 2L8TA 2CVEA 4DR6I 4U3DA 1HR0I 2WP8B 2UUCE 4OKGA 1DARA 4FWHA 4LF4I 1KKHA 3FIGA 2LUQA 4L5NC 3C4BA 2CGEA 4DUZI 2ZM6I 1A1KA 1XMQI 2PNLA 1G2DC 1B62A 4M0VA 4B3SI 2F8BA 4JI6I 2B3TB 2YSOA 3F6GA 5F3WA 3OTOE 4F54A 4DR5E 2KONA 4MU4A 1YUJA 2MDGA 2JVAA 2R42A 4DUYE 2XEXA 3V5RA 4LCHA 2AE8A 2EL5A 3EPKA 4JI8I 2EOZA 2LJPA 5A6KA 2EE8A 2L3CA 4WPYA 1Z5CA 2Z5BA 3ZKDA 5EKWA 2PO0B 3LTOA 4DV5I 4DV2E 4JI1E 4AM3A 3C6KA 5AE3A 1H74A 2LTSA 2VQEE 1PVGA 5EL9A 1T4OA 4B3ME 1I94E 4AQYI 3D4JA 1ZAAC 5KL3A 1BKNA 4AIMA 2L2KB 2DEIA 2F4VE 1S4EA 1OYPA 4HY1A 2RTXA 2O1UA 3LPSA 1Y60A 3PS2A 2FV4B 2J7JA 3GCMA 4MU3A 4BC9A 2PNZB 4USMA 5C0XE 1XNQI 2YTJA 4M9VC 4X65I 4WUBA 2JWOA 3HQ1A 2J65A 3B82A 4LF9I 4Q35B 2LJUA 2L2MA 2HKEA 2V88A 1A1FA 5DNXA 1LLMC 4J8ZA 1IBLE 2V86A 4JYAE 3EPHA 1YHCA 3ZZTA 2YU5A 3CDJA 2JT2A 4P7AA 1PJSA 2EQ1A 2ODRD 4JI3E 1FNMA 4BC7A 1WXRA 2DB2A 4WXCA 2EOYA 1HNXE 2JEAB 4MU1A 3M85D 2DLQA 4WFTA 2ZM6E 1XMQE 3MHSC 4LF8E 4DR4I 2LBSB 2MC5A 4R03A 4R2AA 2BR2B 1ZBTA 4U3BA 4BCAA 1TF3A 2LUPB 1N32E 1UDQA 2NPFA 4DPWA 4F9AB 5C0XB 4I3HA 4YHHI 3ZZ0A 1FWLA 2EMZA 2AJ4A 2JXPA 3H1CA 4ED4A 2Q8UA 4GKKI 1DI2A 1TF6A 2C38A 2EPNA 2HC5A 4HXZA 4PU9A 4QNJA 4DR2I 5AC5A 5A6JA 2K4VA 3P1XA 2EPLX 2G7HA 2I13A 2EMYA 2KOUA 4LTYA 2YWQA 4LF5E 3J80C 2EM7A 2EM8A 1NHJA 4FW4A 3M85G 4IZKB 3M7ND 1B63A 5A6AA 3Q6NA 1P47A 3J7AM 2EM6A 2BB8A 4MLQA 5IV8B 3DJWA 2EOQA 2UXCE 1B69A 3PRYA 2JYAA 2O1VA 2L92A 1ZM2A 2RSMA 1Y4UA 2JOBA 1JK1A 5C0XF 1PIEA 3GLLA 1NHIA 4OO1E 3THOB 1STUA 4IJDA 1FJGE 3AV0A 4WSGA 1YPNA 4WXDA 2EL6A 5IT9C 4OX9E 1Y6ZA 2VF1A 2JEBB 1XHKA 2NN6A 4LF9E 2M9AA 1VI7A 3M7NG 4X64I 2L3JA 2UXBE 3T1HE 4UTGA 4ZYEA 3PYEA 2R1FA 2EL4A 4IZKA 5LMNE 3DF6A 5C0XD 4X62I 1Z0VA 2IERA 3VK6A 1PDAA 4F6MA 2EMWA 4FWGA 5IWAE 4ZYGA 4PRVA 4LFCI 4LF7I 2PRTA 1UDSA 1BB8A 2EPUA 1J5EI 2EPMX 3ECRA 4DV7E 1XMOI 2BA0D 2L33A 4I8OA 1ELOA 2CG9A 2EPZA 1R6LA 3PS1A 2V2ZA 4USKA 4KHPE 4OO1B 1OYSA 4P52A 2F1DA 2YSPA 1HNZE 4BA1B 4JI5I 2JOXA 2YTGA 4RPFA 4B3RI 1IQSA 3J81C 2C39A 4K0KI 3IWDA 2EMXA 2NUFA 4DR1I 4GZNC 4J3DA 3NZKA 2ADRA 4BA2B 4NXNE 4X66I 3B78A 1A1LA 2WNRA 1Z5AA 1SFEA 5C0XC 2B7VA 2BA0G 3B4TA 1Z1BA 2YT4A 2GQ0A 1ZXMA 2ZITA 2EMCA 4R2DA 5DNLA 1IBME 1RMDA 1Z0BA 2EQ0A 4JI4I 2J7KA 3HXLA 2DSYA 3ADLA 3ADIA 3UK3C 2LO3A 2UUBE 1XNRI 2YTOA 4BA1A 2WBTA 1ZM9A 2UU9E 1BBOA 4DR7I 4JI7E 5FLXQ 2EOFA 3BIDA 2DLKA 4MDTA 2M1SA 3LMLA 1MG7A 1KIJA 5ELWA 2YRKA 2EOXA 4DU7A 2BV3A 3JTZA 4IS1C 4OO1D 2DGCA 4JI0I 1X6HA 5TSEA 4WX9A 4X62E 2ENCA 2EMKA 1KVKA 4B3TI 2UUAI 1EI1A 2LT7A 4LFCE 1Z59A 2BA1D 2WW4A 4DV1I 2HFSA 3BF2A 2RPCA 4YY3E 4DV6I 1XMOE 1Z0WA 4GKJI 2EM3A 3TQMA 4LPFA 1N0UA 2WP8A 2V87A 5LLQA 2D9HA 4FWDA 4JI5E 5DROA 2JP9A 4Z7YA 2EPAA 1QNTA 1ZR9A 3U1KA 4K0KE 2CTDA 5AC4A 4DR1E 4JG4A 1A6FA 1X5WA 3VHTB 1GZ6A 1L4SA 2O1WA 1Z0EA 3ZM7A 2VQFE 1Z0TA 4IS9A 4NXME 1Z0CA 4R2RA 1X49A 4F9CB 4X66E 2WCC3 2NUGA 2BA1G 1T4LB 2IHR1 2HKJA 1N33I 4OO1C 3L00A 2LJHA 2PO0A 2Z5CB 3T1YI 1DQ3A 5L3JA 2EM0A 5K36F 1BBGA 2V85A 1ZXNA 2E72A 1XNRE 3OMLA 4DR6E 4LFBI 1ZU1A 5CFFE 1IQOA 4LF4E 2GPIA 4DUZE 5IXMB 4JI2I 1YYOA 2K7IA 4B3SE 4JI6E 1HR0E 1WHNA 1OJ4A 5A69A 2GO3A 2MDRA 2PO2B 4DPUA 2A25A 1NZ0A 2PNZA 3QT5A 4R1FA 4ISAA 3QT7A 4NZVA 1X6EA 5KL2A 5KL6A 3K17A 4JI8E 3Q6MA 4LCFA 2RS6A 2EOJA 3U1YA 2UUAE 2Z5CA 4LF6I 5FWKA 4LFAI 2V8QB 2C37B 1EH6A 2HJJA 1Z0GA 2UXDI 1YSAC 4DV1E 4DR3I 4DV5E 1GQEA 1E3HA 4DMIA 4DV6E 3HPZA 4GKJE 2HHHI 1GTKA 2EOMA 4X9JA 2VE7C 2N3HA 2R3VA 5DRRA 2JEAA 4AQYE 3GMEA 1D6TA 5KL5A 2HFUA 3P3CA 4F9BB 4HACB 1YYWA 2BR2A 3K6QA 2PO2A 4KWYA 2YTFA 1ZM4A 2DEJA 4FW5A 1EH8A 1N34I 4ZVIA 4ZYDA 5C0XA 2EPCA 1IMUA 4R2SA 3KZYA 1XNQE 1OYRA 2IOQA 3JAMQ 4DV3I 4R8OA 4X65E 1N33E 4NBQA 4IZJB 3MHHC 5A2QQ 2E1MA 2YZTA 5JEAE 1YH8A 3WU4A 5K36C 1PKPA 3ADGA 2L2NA 4O4KA 1N36I 2E5LI 2N8XA 2N3GA 2HK3A 4MYTA 3ADJA 2EOIA 3BBGA 4HACA 5AASA 3WU6A 2EOEA 2A2CA 1WJPA 4R2QA 2EMFA 2RS7A 4JI2E 4MYUA 4DR4E 4N3OA 3THNA 3L7ZB 4JV5I 2EPXA 2EM2A 3VYYA 4EMDA 1P42A 5DRPA 3HKMA 1FKAE 2UUCI 1O0WA 1VISA 3K1JA 1IBKI 1HNWI 4N4RB 4YHHE 2JPAA 1FWKA 4DPYA 4DV0I 2JEBA 1HK7A 4LF6E 2ENAA 4GKKE 4IFDF 5GMEA 1N3GA 2KHXA 1UILA 5JEAB 2UXDE 4DR2E 1UBDC 4DUYI 1A1GA 1TN9A 3P76A 1YZ9A 4Q28A 4PRXA 5BR8I 4DU8A 4M2ZA 1ZM3A 1T4NA 2EN3A 3B8HA 2V2QA 2FTXB 4F6NA 5FLXC 4UT4A 3HJCA 4IZJD 2YTNA 3PYDA 2MC6A 4DV2I 5AE2A 1X48A 2PO1B 2EQ3A 2WZOA 1UDOA 1AH5A 1JK2A 4DPTA 4MQYA 2VQEI 1H7UA 1N34E 2Q2EB 4OO1A 4WUDA 3BGHA 3WU5A 4DV4I 4LCGA 2L6MA 4M1KA 1I94I 2M4IA 2LE2A 4BS9A 2YTDA 5K36E
chains in the Genus database with same CATH topology
2V8PA 2F4VI 4GEQB 5LMUI 1SR9A 4X64E 3QT6A 3QT8A 2E5LE 2M7QA 3CWVA 1WUUA 2Z5BB 4LF7E 1IBLI 4LU9A 3V2UC 1J5EE 4JV5E 1K47A 2H36X 3J7AG 2EFGA 2E1RA 4URLA 3HULA 4JI3I 1IBKE 1HNWE 1HNXI 2VF3A 4DV0E 3LLHA 1EKZA 4LF8I 3VYXA 1UHZA 4B3RE 2EWLA 1RQ0A 2LMZA 2B9DA 1N32I 3IWCA 2JY9A 5BR8E 4TUGA 2NUEA 1MU5A 3AUZA 1WHQA 2BM1A 4BMJA 4JI4E 4WSPA 3K85A 1X47A 4LF5I 4DV4E 1Z5BA 2DMYA 4X8WA 2UXCI 1Y4SA 4DR7E 5LMUE 2BM0A 1ZBQA 4KQVA 3MSWA 1FJGI 3RMPA 2O1TA 4JI0E 2A2DA 4OX9I 4FW9A 4B3TE 3KWRA 3HTXA 2IOPA 2UXBI 3T1HI 2V83A 2X7IA 3PYGA 4M30A 2DIXA 3F0NA 4P78A 5LMNI 3JAMC 1H72C 1UEKA 3HPSA 1MX0A 1S16A 2CZ9A 5IWAI 5A2QC 4DKKA 2HK2A 1FI4A 4TUIA 5AE1A 4DV7I 1RC7A 3H4LA 1U2RA 1H73A 4KHPI 3C4TA 1YYKA 1HNZI 4HYMA 4BBYA 1EA6A 4KZSA 2ZBKB 3T1YE 2V2VA 4FN5A 2Z5EA 4LFBE 4NXNI 2PNMA 4DXLA 2CPNA 2ODRC 3LNUA 1IBMI 2V89A 2UUBI 4P7DA 4DPXA 3J80Q 1QZRA 2UU9I 4XTJA 4IZJA 4JI7I 4LFAE 2FGGA 1RREA 3J7Yp 2LTRA 3OTOI 4DR3E 4DR5I 3IWBA 2NA2A 3Q1QA 3H09A 2HHHE 2V34A 3PYFA 2GS8A 2OI2A 4WUCA 3GONA 5DNYA 5IT9Q 2EZ6A 1H7SA 3P06A 1J26A 1RR9A 3WU3A 4JI1I 4YY3I 1QU6A 3JU0A 1N0VC 4B3MI 3F6HA 4Z7CA 5T6JA 5ADZA 2X36A 4DV3E 4L8NA 3ZZUA 3ZOQB 2JR1A 2LRSA 3M6AA 2VQFI 4NXMI 4WYQB 1KTVA 1N36E 1USUA 1USVA 5GMDA 4OOGC 1NHHA 5LL6R 2B7TA 3ZKBA 3J81Q 4JYAI 2L8TA 4DR6I 2UUCE 1DARA 4FWHA 4LF4I 1KKHA 3FIGA 2LUQA 4L5NC 3C4BA 2CGEA 4DUZI 2ZM6I 1XMQI 2PNLA 1B62A 4M0VA 4B3SI 2F8BA 4JI6I 2B3TB 5F3WA 3F6GA 1HR0I 3OTOE 4F54A 4DR5E 2KONA 2JVAA 2R42A 4DUYE 2XEXA 3V5RA 4JI8I 2LJPA 2L3CA 4WPYA 1Z5CA 2Z5BA 3ZKDA 3LTOA 4DV5I 4DV2E 4JI1E 5AE3A 1H74A 2LTSA 2VQEE 1PVGA 1T4OA 4B3ME 1I94E 4AQYI 3D4JA 1BKNA 2L2KB 2DEIA 2F4VE 1S4EA 4HY1A 2RTXA 2O1UA 3LPSA 2FV4B 4USMA 4BC9A 1XNQI 4X65I 4WUBA 2JWOA 3HQ1A 3B82A 4LF9I 2L2MA 2HKEA 2V88A 4J8ZA 1IBLE 2V86A 4JYAE 3ZZTA 4P7AA 2ODRD 4JI3E 1FNMA 4BC7A 1WXRA 2DB2A 1HNXE 2ZM6E 4WFTA 1XMQE 4LF8E 4DR4I 2LBSB 2MC5A 4R03A 1ZBTA 4BCAA 2LUPB 1N32E 2NPFA 4DPWA 4F9AB 4I3HA 4YHHI 3ZZ0A 1FWLA 2AJ4A 4ED4A 4GKKI 1DI2A 4HXZA 4PU9A 4DR2I 2K4VA 3P1XA 2G7HA 2KOUA 4LTYA 4LF5E 3J80C 1NHJA 4IZKB 1B63A 3Q6NA 3J7AM 3DJWA 2UXCE 3PRYA 2O1VA 2L92A 1ZM2A 2RSMA 1Y4UA 2JOBA 1PIEA 1NHIA 1STUA 1FJGE 3AV0A 1Y6ZA 5IT9C 4OX9E 2VF1A 1XHKA 4LF9E 4X64I 2L3JA 2UXBE 3T1HE 4UTGA 3PYEA 4IZKA 5LMNE 3DF6A 4X62I 1Z0VA 3VK6A 4FWGA 5IWAE 4PRVA 4LFCI 4LF7I 1J5EI 4DV7E 1XMOI 2L33A 4I8OA 1ELOA 2CG9A 4USKA 2V2ZA 4KHPE 4P52A 1HNZE 4JI5I 2JOXA 4RPFA 4B3RI 3J81C 4K0KI 3IWDA 2NUFA 4DR1I 4NXNE 4X66I 3B78A 1Z5AA 2B7VA 2YT4A 2GQ0A 1ZXMA 2ZITA 4JI4I 1IBME 1Z0BA 2J7KA 3HXLA 2DSYA 3ADLA 3ADIA 1XNRI 2UUBE 1ZM9A 2UU9E 4DR7I 4JI7E 5FLXQ 2M1SA 3LMLA 1MG7A 1KIJA 4DU7A 2BV3A 3JTZA 4JI0I 4X62E 1KVKA 4B3TI 2UUAI 1EI1A 4LFCE 1Z59A 2WW4A 4DV1I 2HFSA 4YY3E 4DV6I 1XMOE 1Z0WA 4GKJI 1N0UA 2V87A 4FWDA 4JI5E 4Z7YA 4K0KE 4JG4A 4DR1E 1A6FA 2O1WA 1GZ6A 1Z0EA 3ZM7A 2VQFE 1Z0TA 4NXME 1Z0CA 1X49A 4F9CB 4X66E 2NUGA 2HKJA 1T4LB 2IHR1 1N33I 2LJHA 2Z5CB 3T1YI 1DQ3A 5L3JA 2V85A 1ZXNA 1XNRE 3OMLA 4DR6E 4LFBI 5CFFE 4LF4E 4DUZE 4JI2I 1YYOA 4B3SE 4JI6E 1HR0E 1WHNA 1OJ4A 2MDRA 4DPUA 1NZ0A 3QT5A 4R1FA 3QT7A 3K17A 4JI8E 3Q6MA 2RS6A 4LF6I 2UUAE 2Z5CA 5FWKA 4LFAI 2V8QB 2UXDI 1Z0GA 4DV1E 4DR3I 4DV5E 1GQEA 4DMIA 4DV6E 3HPZA 4GKJE 2HHHI 2VE7C 2N3HA 2R3VA 4AQYE 1D6TA 2HFUA 4F9BB 4HACB 1YYWA 3K6QA 1ZM4A 2DEJA 1N34I 4ZVIA 3JAMQ 2IOQA 1XNQE 4DV3I 4R8OA 4X65E 1N33E 4IZJB 5A2QQ 2E1MA 2YZTA 3WU4A 1PKPA 3ADGA 2L2NA 1N36I 2E5LI 4MYTA 2N3GA 2HK3A 3ADJA 4HACA 5AASA 3WU6A 2A2CA 4JI2E 2RS7A 4MYUA 4DR4E 4N3OA 4JV5I 3VYYA 4EMDA 1FKAE 2UUCI 1O0WA 1VISA 3K1JA 1IBKI 1HNWI 4YHHE 1FWKA 4DPYA 4DV0I 1HK7A 4LF6E 4GKKE 5GMEA 2KHXA 1UILA 2UXDE 4DR2E 4DUYI 1YZ9A 4Q28A 4PRXA 5BR8I 4DU8A 4M2ZA 1ZM3A 1T4NA 3B8HA 2V2QA 2FTXB 4UT4A 5FLXC 3HJCA 4IZJD 3PYDA 2MC6A 4DV2I 5AE2A 1X48A 2WZOA 4DPTA 2VQEI 1H7UA 1N34E 2Q2EB 3WU5A 4WUDA 4DV4I 2L6MA 4M1KA 1I94I 2M4IA 2LE2A 4BS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8P A;  2F4V I;  5LMU I;  4X64 E;  3QT6 A;  3QT8 A;  2E5L E;  3CWV A;  1WUU A;  4LF7 E;  1IBL I;  3V2U C;  1J5E E;  4JV5 E;  1K47 A;  3J7A G;  2EFG A;  2E1R A;  4URL A;  3HUL A;  4JI3 I;  1IBK E;  1HNW E;  1HNX I;  2VF3 A;  4DV0 E;  3LLH A;  1EKZ A;  4LF8 I;  3VYX A;  1UHZ A;  4B3R E;  1RQ0 A;  1N32 I;  2JY9 A;  5BR8 E;  2NUE A;  1MU5 A;  1WHQ A;  2BM1 A;  4JI4 E;  1X47 A;  4LF5 I;  4DV4 E;  1Z5B A;  2DMY A;  4X8W A;  2UXC I;  4DR7 E;  5LMU E;  2BM0 A;  4KQV A;  1FJG I;  4JI0 E;  2A2D A;  4OX9 I;  4FW9 A;  4B3T E;  3HTX A;  2UXB I;  3T1H I;  2X7I A;  3PYG A;  4M30 A;  2DIX A;  3F0N A;  5LMN I;  3JAM C;  1H72 C;  1UEK A;  1MX0 A;  1S16 A;  2CZ9 A;  5IWA I;  5A2Q C;  4DKK A;  2HK2 A;  1FI4 A;  4DV7 I;  1RC7 A;  3H4L A;  1U2R A;  1H73 A;  4KHP I;  3C4T A;  1YYK A;  1HNZ I;  4HYM A;  1EA6 A;  2ZBK B;  3T1Y E;  2V2V A;  4FN5 A;  4LFB E;  4NXN I;  4DXL A;  2CPN A;  3LNU A;  1IBM I;  2UUB I;  4DPX A;  3J80 Q;  1QZR A;  2UU9 I;  4XTJ A;  4JI7 I;  4LFA E;  1RRE A;  3J7Y p;  2LTR A;  3OTO I;  4DR3 E;  4DR5 I;  2NA2 A;  3Q1Q A;  2HHH E;  2V34 A;  3PYF A;  2GS8 A;  2OI2 A;  4WUC A;  3GON A;  5IT9 Q;  2EZ6 A;  1H7S A;  1J26 A;  1RR9 A;  3WU3 A;  4JI1 I;  4YY3 I;  1QU6 A;  1N0V C;  4B3M I;  4Z7C A;  2X36 A;  4DV3 E;  3ZZU A;  2LRS A;  3M6A A;  2VQF I;  4NXM I;  4WYQ B;  1KTV A;  1N36 E;  5GMD A;  4OOG C;  1NHH A;  5LL6 R;  2B7T A;  3ZKB A;  3J81 Q;  4JYA I;  4DR6 I;  2UUC E;  1DAR A;  4FWH A;  4LF4 I;  1KKH A;  2LUQ A;  3C4B A;  4DUZ I;  2ZM6 I;  1XMQ I;  1B62 A;  4B3S I;  4JI6 I;  2B3T B;  1HR0 I;  3OTO E;  4DR5 E;  2JVA A;  2R42 A;  4DUY E;  2XEX A;  3V5R A;  4JI8 I;  2LJP A;  2L3C A;  1Z5C A;  3ZKD A;  3LTO A;  4DV5 I;  4DV2 E;  4JI1 E;  1H74 A;  2LTS A;  2VQE E;  1PVG A;  1T4O A;  4B3M E;  1I94 E;  4AQY I;  3D4J A;  1BKN A;  2L2K B;  2DEI A;  2F4V E;  1S4E A;  4HY1 A;  2RTX A;  3LPS A;  4USM A;  1XNQ I;  4X65 I;  4WUB A;  3B82 A;  4LF9 I;  2L2M A;  2HKE A;  1IBL E;  4JYA E;  3ZZT A;  4P7A A;  4JI3 E;  1FNM A;  2DB2 A;  1HNX E;  2ZM6 E;  4WFT A;  1XMQ E;  4LF8 E;  4DR4 I;  2LBS B;  1ZBT A;  2LUP B;  1N32 E;  2NPF A;  4DPW A;  4I3H A;  4YHH I;  3ZZ0 A;  1FWL A;  2AJ4 A;  4ED4 A;  4GKK I;  1DI2 A;  4HXZ A;  4PU9 A;  4DR2 I;  3P1X A;  4LF5 E;  1NHJ A;  3J80 C;  1B63 A;  3J7A M;  2UXC E;  1ZM2 A;  2RSM A;  1PIE A;  1NHI A;  1STU A;  1FJG E;  5IT9 C;  4OX9 E;  1XHK A;  4LF9 E;  4X64 I;  2L3J A;  2UXB E;  3T1H E;  4UTG A;  3PYE A;  5LMN E;  4X62 I;  1Z0V A;  4FWG A;  5IWA E;  4PRV A;  4LFC I;  4LF7 I;  1J5E I;  4DV7 E;  1XMO I;  2L33 A;  1ELO A;  4USK A;  2V2Z A;  4KHP E;  4P52 A;  1HNZ E;  4JI5 I;  4RPF A;  4B3R I;  3J81 C;  4K0K I;  2NUF A;  4DR1 I;  4NXN E;  4X66 I;  3B78 A;  1Z5A A;  2B7V A;  2YT4 A;  1ZXM A;  2ZIT A;  4JI4 I;  1IBM E;  1Z0B A;  2J7K A;  3ADL A;  3ADI A;  1XNR I;  2UUB E;  1ZM9 A;  2UU9 E;  4DR7 I;  4JI7 E;  5FLX Q;  1MG7 A;  1KIJ A;  4DU7 A;  2BV3 A;  4JI0 I;  4X62 E;  1KVK A;  4B3T I;  2UUA I;  1EI1 A;  4LFC E;  1Z59 A;  2WW4 A;  4DV1 I;  2HFS A;  4YY3 E;  4DV6 I;  1XMO E;  1Z0W A;  4GKJ I;  1N0U A;  4FWD A;  4JI5 E;  4Z7Y A;  4K0K E;  4JG4 A;  4DR1 E;  1A6F A;  1Z0E A;  3ZM7 A;  2VQF E;  1Z0T A;  4NXM E;  1Z0C A;  1X49 A;  4X66 E;  2NUG A;  2HKJ A;  1T4L B;  2IHR 1;  1N33 I;  2LJH A;  3T1Y I;  5L3J A;  1ZXN A;  1XNR E;  4LFB I;  4DR6 E;  5CFF E;  4LF4 E;  4DUZ E;  4JI2 I;  1YYO A;  4B3S E;  4JI6 E;  1HR0 E;  1WHN A;  1OJ4 A;  2MDR A;  4DPU A;  1NZ0 A;  3QT5 A;  4R1F A;  3QT7 A;  3K17 A;  4JI8 E;  2RS6 A;  4LF6 I;  2UUA E;  4LFA I;  2UXD I;  1Z0G A;  4DV1 E;  4DR3 I;  4DV5 E;  1GQE A;  4DV6 E;  2HHH I;  4GKJ E;  2N3H A;  2R3V A;  4AQY E;  1D6T A;  2HFU A;  4HAC B;  1YYW A;  1ZM4 A;  2DEJ A;  1N34 I;  4ZVI A;  3JAM Q;  1XNQ E;  4DV3 I;  4X65 E;  1N33 E;  5A2Q Q;  3WU4 A;  1PKP A;  3ADG A;  2L2N A;  1N36 I;  2E5L I;  4MYT A;  2N3G A;  2HK3 A;  3ADJ A;  4HAC A;  3WU6 A;  2A2C A;  4JI2 E;  2RS7 A;  4MYU A;  4DR4 E;  4JV5 I;  3VYY A;  4EMD A;  1FKA E;  2UUC I;  1O0W A;  1VIS A;  3K1J A;  1IBK I;  1HNW I;  4YHH E;  1FWK A;  4DPY A;  4DV0 I;  4LF6 E;  4GKK E;  5GME A;  2KHX A;  1UIL A;  2UXD E;  4DR2 E;  4DUY I;  1YZ9 A;  4PRX A;  5BR8 I;  4DU8 A;  4M2Z A;  1ZM3 A;  1T4N A;  3B8H A;  2V2Q A;  4UT4 A;  5FLX C;  3PYD A;  4DV2 I;  1X48 A;  4DPT A;  2VQE I;  1H7U A;  1N34 E;  2Q2E B;  3WU5 A;  4WUD A;  4DV4 I;  4M1K A;  1I94 I; 
#chains in the Genus database with same CATH topology
 5JEA F;  2V8P A;  2F4V I;  4GEQ B;  2LVH A;  5LMU I;  4NHR A;  1SR9 A;  5A6B D;  1EH7 A;  5KL7 A;  2I9I A;  4X64 E;  2MKD A;  3QT6 A;  1UN6 B;  4LOM A;  1UDN A;  2EM9 A;  3QT8 A;  2E5L E;  4BA2 A;  2VES A;  4RHB B;  2EMI A;  2M7Q A;  2EPP A;  3CWV A;  1F2I G;  4F2J C;  1WUU A;  2EN8 A;  2Z5B B;  4LF7 E;  3UHM A;  4LU9 A;  3V2U C;  2DMI A;  1IBL I;  1J5E E;  4JV5 E;  1K47 A;  2H36 X;  3J7A G;  1PJT A;  2EFG A;  2E1R A;  4URL A;  2GLI A;  4IFD C;  3HUL A;  4JI3 I;  2HGH A;  1IBK E;  1HNW E;  5K36 B;  1HNX I;  2VF3 A;  4DV0 E;  2GHF A;  3LLH A;  1A1I A;  2EPR A;  1EKZ A;  3VYX A;  4LF8 I;  1UHZ A;  1X3C A;  4B3R E;  2EWL A;  1RQ0 A;  3EPL A;  2EML A;  4HTG A;  2EMB A;  2LMZ A;  2B9D A;  2EM5 A;  1N32 I;  1T38 A;  2EN1 A;  3IWC A;  2EM4 A;  2JY9 A;  4OZE A;  5BR8 E;  4TUG A;  2EMG A;  1PJQ A;  2NUE A;  4O43 A;  1MU5 A;  3AUZ A;  1WHQ A;  2BM1 A;  1RHY A;  4BMJ A;  4JI4 E;  1WRJ A;  4WSP A;  2EN4 A;  1YUI A;  3K85 A;  1X47 A;  2EPO A;  4LF5 I;  5JEA C;  4DV4 E;  2MKN A;  2DRP A;  5K36 A;  1NCS A;  1Z5B A;  2DMY A;  4X8W A;  2UXC I;  1NEI A;  1G2F C;  1Y4S A;  2EOO A;  2EOH A;  5KL4 A;  2EP3 A;  4DR7 E;  5LMU E;  2EJ4 A;  1ZBQ A;  2BM0 A;  4KQV A;  3MSW A;  1FJG I;  3RMP A;  5DRQ A;  2O1T A;  4JI0 E;  4AID A;  2YTQ A;  1X6F A;  2A2D A;  1T39 A;  4FW9 A;  4OX9 I;  5K36 D;  2NN6 E;  2EN2 A;  4B3T E;  3M99 B;  3KWR A;  2C38 B;  3HTX A;  2IOP A;  4OO1 F;  3T1H I;  2V83 A;  4IFD E;  2UXB I;  2X7I A;  3PYG A;  4M30 A;  2DIX A;  3F0N A;  4P78 A;  5LMN I;  3JAM C;  1H72 C;  1UEK A;  3HPS A;  1MX0 A;  1S16 A;  2CZ9 A;  5IWA I;  3EQ1 A;  5A2Q C;  1KYQ A;  2RQL A;  4DKK A;  4R2P A;  1KJK A;  1FI4 A;  4TUI A;  2HK2 A;  5AE1 A;  4DV7 I;  1RC7 A;  3H4L A;  1U2R A;  4FW7 A;  2NAB A;  1H73 A;  2EOS A;  4KHP I;  3C4T A;  1YYK A;  1HNZ I;  2YPN A;  4ZYH A;  2NN6 B;  2GO4 A;  4FW6 A;  4HYM A;  4BBY A;  2C37 A;  4R2E A;  4KZS A;  1EA6 A;  2CSH A;  2ZBK B;  3T1Y E;  2V2V A;  4IFD B;  3CDI A;  4FN5 A;  2Z5E A;  4LFB E;  4NXN I;  2EN6 A;  3QG5 C;  2PNM A;  1AAY A;  2CPN A;  4GQU A;  2YTE A;  4MU0 A;  4DXL A;  2ELY A;  2R76 A;  2ODR C;  2WBS A;  3EPJ A;  4MLV A;  3LNU A;  2BBG A;  1IBM I;  1YFH A;  2EMA A;  4FK5 C;  3PS3 A;  2V89 A;  2UUB I;  3C6M A;  4O24 A;  1Y5Y A;  2EOR A;  4P7D A;  4DPX A;  2NN6 F;  3J80 Q;  1QZR A;  2EMH A;  1E3P A;  2UU9 I;  4RH8 A;  1A1H A;  4IZJ A;  4XTJ A;  4JI7 I;  4LFA E;  2FGG A;  1RRE A;  2IES A;  4IFD A;  2YTP A;  2C39 B;  3J7Y p;  2LTR A;  3OTO I;  4DR3 E;  4DR5 I;  3P3E A;  3IWB A;  2NA2 A;  1DGC A;  3Q1Q A;  3H09 A;  2HHH E;  2V34 A;  2YRM A;  3PYF A;  2GS8 A;  2OI2 A;  4WUC A;  4HEI A;  3GON A;  2JE6 B;  2WNR B;  2YTI A;  5DNY A;  2NN6 D;  5IT9 Q;  2EZ6 A;  2EN7 A;  1H7S A;  3P06 A;  4R2C A;  2VRD A;  5A6B A;  2ENH A;  1J26 A;  1RR9 A;  1XXE A;  3L7Z A;  4JI1 I;  3WU3 A;  4YY3 I;  4IFD D;  1QU6 A;  3JU0 A;  2LV2 A;  1MEY C;  4BHB A;  1R6M A;  2LCE A;  1N0V C;  2WBU A;  3F6H A;  4B3M I;  4Z7C A;  5T6J A;  5ADZ A;  2X36 A;  4DV3 E;  2YRH A;  4L8N A;  3ZZU A;  3ZOQ B;  5JEA A;  2ELZ A;  2JR1 A;  2EPK X;  3KRN A;  2O3Z A;  2LRS A;  3M6A A;  4FW3 A;  2VQF I;  4QNK A;  4NXM I;  4WYQ B;  4O5G A;  1KTV A;  1N36 E;  1USU A;  3P3G A;  1USV A;  2JE6 A;  2CT1 A;  4OOG C;  1NHH A;  5GMD A;  2RSI A;  3DD6 A;  2YU8 A;  3KZZ A;  2PO1 A;  5LL6 R;  5JEA D;  2B7T A;  3ZKB A;  3J81 Q;  2NN6 C;  1MGT A;  1A1J A;  4JYA I;  4BHC A;  2L8T A;  2CVE A;  4DR6 I;  4U3D A;  1HR0 I;  2WP8 B;  2UUC E;  4OKG A;  1DAR A;  4FWH A;  4LF4 I;  1KKH A;  3FIG A;  2LUQ A;  4L5N C;  3C4B A;  2CGE A;  4DUZ I;  2ZM6 I;  1A1K A;  1XMQ I;  2PNL A;  1G2D C;  1B62 A;  4M0V A;  4B3S I;  2F8B A;  4JI6 I;  2B3T B;  2YSO A;  3F6G A;  5F3W A;  3OTO E;  4F54 A;  4DR5 E;  2KON A;  4MU4 A;  1YUJ A;  2MDG A;  2JVA A;  2R42 A;  4DUY E;  2XEX A;  3V5R A;  4LCH A;  2AE8 A;  2EL5 A;  3EPK A;  4JI8 I;  2EOZ A;  2LJP A;  5A6K A;  2EE8 A;  2L3C A;  4WPY A;  1Z5C A;  2Z5B A;  3ZKD A;  5EKW A;  2PO0 B;  3LTO A;  4DV5 I;  4DV2 E;  4JI1 E;  4AM3 A;  3C6K A;  5AE3 A;  1H74 A;  2LTS A;  2VQE E;  1PVG A;  5EL9 A;  1T4O A;  4B3M E;  1I94 E;  4AQY I;  3D4J A;  1ZAA C;  5KL3 A;  1BKN A;  4AIM A;  2L2K B;  2DEI A;  2F4V E;  1S4E A;  1OYP A;  4HY1 A;  2RTX A;  2O1U A;  3LPS A;  1Y60 A;  3PS2 A;  2FV4 B;  2J7J A;  3GCM A;  4MU3 A;  4BC9 A;  2PNZ B;  4USM A;  5C0X E;  1XNQ I;  2YTJ A;  4M9V C;  4X65 I;  4WUB A;  2JWO A;  3HQ1 A;  2J65 A;  3B82 A;  4LF9 I;  4Q35 B;  2LJU A;  2L2M A;  2HKE A;  2V88 A;  1A1F A;  5DNX A;  1LLM C;  4J8Z A;  1IBL E;  2V86 A;  4JYA E;  3EPH A;  1YHC A;  3ZZT A;  2YU5 A;  3CDJ A;  2JT2 A;  4P7A A;  1PJS A;  2EQ1 A;  2ODR D;  4JI3 E;  1FNM A;  4BC7 A;  1WXR A;  2DB2 A;  4WXC A;  2EOY A;  1HNX E;  2JEA B;  4MU1 A;  3M85 D;  2DLQ A;  4WFT A;  2ZM6 E;  1XMQ E;  3MHS C;  4LF8 E;  4DR4 I;  2LBS B;  2MC5 A;  4R03 A;  4R2A A;  2BR2 B;  1ZBT A;  4U3B A;  4BCA A;  1TF3 A;  2LUP B;  1N32 E;  1UDQ A;  2NPF A;  4DPW A;  4F9A B;  5C0X B;  4I3H A;  4YHH I;  3ZZ0 A;  1FWL A;  2EMZ A;  2AJ4 A;  2JXP A;  3H1C A;  4ED4 A;  2Q8U A;  4GKK I;  1DI2 A;  1TF6 A;  2C38 A;  2EPN A;  2HC5 A;  4HXZ A;  4PU9 A;  4QNJ A;  4DR2 I;  5AC5 A;  5A6J A;  2K4V A;  3P1X A;  2EPL X;  2G7H A;  2I13 A;  2EMY A;  2KOU A;  4LTY A;  2YWQ A;  4LF5 E;  3J80 C;  2EM7 A;  2EM8 A;  1NHJ A;  4FW4 A;  3M85 G;  4IZK B;  3M7N D;  1B63 A;  5A6A A;  3Q6N A;  1P47 A;  3J7A M;  2EM6 A;  2BB8 A;  4MLQ A;  5IV8 B;  3DJW A;  2EOQ A;  2UXC E;  1B69 A;  3PRY A;  2JYA A;  2O1V A;  2L92 A;  1ZM2 A;  2RSM A;  1Y4U A;  2JOB A;  1JK1 A;  5C0X F;  1PIE A;  3GLL A;  1NHI A;  4OO1 E;  3THO B;  1STU A;  4IJD A;  1FJG E;  3AV0 A;  4WSG A;  1YPN A;  4WXD A;  2EL6 A;  5IT9 C;  4OX9 E;  1Y6Z A;  2VF1 A;  2JEB B;  1XHK A;  2NN6 A;  4LF9 E;  2M9A A;  1VI7 A;  3M7N G;  4X64 I;  2L3J A;  2UXB E;  3T1H E;  4UTG A;  4ZYE A;  3PYE A;  2R1F A;  2EL4 A;  4IZK A;  5LMN E;  3DF6 A;  5C0X D;  4X62 I;  1Z0V A;  2IER A;  3VK6 A;  1PDA A;  4F6M A;  2EMW A;  4FWG A;  5IWA E;  4ZYG A;  4PRV A;  4LFC I;  4LF7 I;  2PRT A;  1UDS A;  1BB8 A;  2EPU A;  1J5E I;  2EPM X;  3ECR A;  4DV7 E;  1XMO I;  2BA0 D;  2L33 A;  4I8O A;  1ELO A;  2CG9 A;  2EPZ A;  1R6L A;  3PS1 A;  2V2Z A;  4USK A;  4KHP E;  4OO1 B;  1OYS A;  4P52 A;  2F1D A;  2YSP A;  1HNZ E;  4BA1 B;  4JI5 I;  2JOX A;  2YTG A;  4RPF A;  4B3R I;  1IQS A;  3J81 C;  2C39 A;  4K0K I;  3IWD A;  2EMX A;  2NUF A;  4DR1 I;  4GZN C;  4J3D A;  3NZK A;  2ADR A;  4BA2 B;  4NXN E;  4X66 I;  3B78 A;  1A1L A;  2WNR A;  1Z5A A;  1SFE A;  5C0X C;  2B7V A;  2BA0 G;  3B4T A;  1Z1B A;  2YT4 A;  2GQ0 A;  1ZXM A;  2ZIT A;  2EMC A;  4R2D A;  5DNL A;  1IBM E;  1RMD A;  1Z0B A;  2EQ0 A;  4JI4 I;  2J7K A;  3HXL A;  2DSY A;  3ADL A;  3ADI A;  3UK3 C;  2LO3 A;  2UUB E;  1XNR I;  2YTO A;  4BA1 A;  2WBT A;  1ZM9 A;  2UU9 E;  1BBO A;  4DR7 I;  4JI7 E;  5FLX Q;  2EOF A;  3BID A;  2DLK A;  4MDT A;  2M1S A;  3LML A;  1MG7 A;  1KIJ A;  5ELW A;  2YRK A;  2EOX A;  4DU7 A;  2BV3 A;  3JTZ A;  4IS1 C;  4OO1 D;  2DGC A;  4JI0 I;  1X6H A;  5TSE A;  4WX9 A;  4X62 E;  2ENC A;  2EMK A;  1KVK A;  4B3T I;  2UUA I;  1EI1 A;  2LT7 A;  4LFC E;  1Z59 A;  2BA1 D;  2WW4 A;  4DV1 I;  2HFS A;  3BF2 A;  2RPC A;  4YY3 E;  4DV6 I;  1XMO E;  1Z0W A;  4GKJ I;  2EM3 A;  3TQM A;  4LPF A;  1N0U A;  2WP8 A;  2V87 A;  5LLQ A;  2D9H A;  4FWD A;  4JI5 E;  5DRO A;  2JP9 A;  4Z7Y A;  2EPA A;  1QNT A;  1ZR9 A;  3U1K A;  4K0K E;  2CTD A;  5AC4 A;  4DR1 E;  4JG4 A;  1A6F A;  1X5W A;  3VHT B;  1GZ6 A;  1L4S A;  2O1W A;  1Z0E A;  3ZM7 A;  2VQF E;  1Z0T A;  4IS9 A;  4NXM E;  1Z0C A;  4R2R A;  1X49 A;  4F9C B;  4X66 E;  2WCC 3;  2NUG A;  2BA1 G;  1T4L B;  2IHR 1;  2HKJ A;  1N33 I;  4OO1 C;  3L00 A;  2LJH A;  2PO0 A;  2Z5C B;  3T1Y I;  1DQ3 A;  5L3J A;  2EM0 A;  5K36 F;  1BBG A;  2V85 A;  1ZXN A;  2E72 A;  1XNR E;  3OML A;  4DR6 E;  4LFB I;  1ZU1 A;  5CFF E;  1IQO A;  4LF4 E;  2GPI A;  4DUZ E;  5IXM B;  4JI2 I;  1YYO A;  2K7I A;  4B3S E;  4JI6 E;  1HR0 E;  1WHN A;  1OJ4 A;  5A69 A;  2GO3 A;  2MDR A;  2PO2 B;  4DPU A;  2A25 A;  1NZ0 A;  2PNZ A;  3QT5 A;  4R1F A;  4ISA A;  3QT7 A;  4NZV A;  1X6E A;  5KL2 A;  5KL6 A;  3K17 A;  4JI8 E;  3Q6M A;  4LCF A;  2RS6 A;  2EOJ A;  3U1Y A;  2UUA E;  2Z5C A;  4LF6 I;  5FWK A;  4LFA I;  2V8Q B;  2C37 B;  1EH6 A;  2HJJ A;  1Z0G A;  2UXD I;  1YSA C;  4DV1 E;  4DR3 I;  4DV5 E;  1GQE A;  1E3H A;  4DMI A;  4DV6 E;  3HPZ A;  4GKJ E;  2HHH I;  1GTK A;  2EOM A;  4X9J A;  2VE7 C;  2N3H A;  2R3V A;  5DRR A;  2JEA A;  4AQY E;  3GME A;  1D6T A;  5KL5 A;  2HFU A;  3P3C A;  4F9B B;  4HAC B;  1YYW A;  2BR2 A;  3K6Q A;  2PO2 A;  4KWY A;  2YTF A;  1ZM4 A;  2DEJ A;  4FW5 A;  1EH8 A;  1N34 I;  4ZVI A;  4ZYD A;  5C0X A;  2EPC A;  1IMU A;  4R2S A;  3KZY A;  1XNQ E;  1OYR A;  2IOQ A;  3JAM Q;  4DV3 I;  4R8O A;  4X65 E;  1N33 E;  4NBQ A;  4IZJ B;  3MHH C;  5A2Q Q;  2E1M A;  2YZT A;  5JEA E;  1YH8 A;  3WU4 A;  5K36 C;  1PKP A;  3ADG A;  2L2N A;  4O4K A;  1N36 I;  2E5L I;  2N8X A;  2N3G A;  2HK3 A;  4MYT A;  3ADJ A;  2EOI A;  3BBG A;  4HAC A;  5AAS A;  3WU6 A;  2EOE A;  2A2C A;  1WJP A;  4R2Q A;  2EMF A;  2RS7 A;  4JI2 E;  4MYU A;  4DR4 E;  4N3O A;  3THN A;  3L7Z B;  4JV5 I;  2EPX A;  2EM2 A;  3VYY A;  4EMD A;  1P42 A;  5DRP A;  3HKM A;  1FKA E;  2UUC I;  1O0W A;  1VIS A;  3K1J A;  1IBK I;  1HNW I;  4N4R B;  4YHH E;  2JPA A;  1FWK A;  4DPY A;  4DV0 I;  2JEB A;  1HK7 A;  4LF6 E;  2ENA A;  4GKK E;  4IFD F;  5GME A;  1N3G A;  2KHX A;  1UIL A;  5JEA B;  2UXD E;  4DR2 E;  1UBD C;  4DUY I;  1A1G A;  1TN9 A;  3P76 A;  1YZ9 A;  4Q28 A;  4PRX A;  5BR8 I;  4DU8 A;  4M2Z A;  1ZM3 A;  1T4N A;  2EN3 A;  3B8H A;  2V2Q A;  2FTX B;  4F6N A;  5FLX C;  4UT4 A;  3HJC A;  4IZJ D;  2YTN A;  3PYD A;  2MC6 A;  4DV2 I;  5AE2 A;  1X48 A;  2PO1 B;  2EQ3 A;  2WZO A;  1UDO A;  1AH5 A;  1JK2 A;  4DPT A;  4MQY A;  2VQE I;  1H7U A;  1N34 E;  2Q2E B;  4OO1 A;  4WUD A;  3BGH A;  3WU5 A;  4DV4 I;  4LCG A;  2L6M A;  4M1K A;  1I94 I;  2M4I A;  2LE2 A;  4BS9 A;  2YTD A;  5K36 E; 
#chains in the Genus database with same CATH homology
 2V8P A;  2F4V I;  4GEQ B;  5LMU I;  1SR9 A;  4X64 E;  3QT6 A;  3QT8 A;  2E5L E;  2M7Q A;  3CWV A;  1WUU A;  2Z5B B;  4LF7 E;  1IBL I;  4LU9 A;  3V2U C;  1J5E E;  4JV5 E;  1K47 A;  2H36 X;  3J7A G;  2EFG A;  2E1R A;  4URL A;  3HUL A;  4JI3 I;  1IBK E;  1HNW E;  1HNX I;  2VF3 A;  4DV0 E;  3LLH A;  1EKZ A;  4LF8 I;  3VYX A;  1UHZ A;  4B3R E;  2EWL A;  1RQ0 A;  2LMZ A;  2B9D A;  1N32 I;  3IWC A;  2JY9 A;  5BR8 E;  4TUG A;  2NUE A;  1MU5 A;  3AUZ A;  1WHQ A;  2BM1 A;  4BMJ A;  4JI4 E;  4WSP A;  3K85 A;  1X47 A;  4LF5 I;  4DV4 E;  1Z5B A;  2DMY A;  4X8W A;  2UXC I;  1Y4S A;  4DR7 E;  5LMU E;  2BM0 A;  1ZBQ A;  4KQV A;  3MSW A;  1FJG I;  3RMP A;  2O1T A;  4JI0 E;  2A2D A;  4OX9 I;  4FW9 A;  4B3T E;  3KWR A;  3HTX A;  2IOP A;  2UXB I;  3T1H I;  2V83 A;  2X7I A;  3PYG A;  4M30 A;  2DIX A;  3F0N A;  4P78 A;  5LMN I;  3JAM C;  1H72 C;  1UEK A;  3HPS A;  1MX0 A;  1S16 A;  2CZ9 A;  5IWA I;  5A2Q C;  4DKK A;  2HK2 A;  1FI4 A;  4TUI A;  5AE1 A;  4DV7 I;  1RC7 A;  3H4L A;  1U2R A;  1H73 A;  4KHP I;  3C4T A;  1YYK A;  1HNZ I;  4HYM A;  4BBY A;  1EA6 A;  4KZS A;  2ZBK B;  3T1Y E;  2V2V A;  4FN5 A;  2Z5E A;  4LFB E;  4NXN I;  2PNM A;  4DXL A;  2CPN A;  2ODR C;  3LNU A;  1IBM I;  2V89 A;  2UUB I;  4P7D A;  4DPX A;  3J80 Q;  1QZR A;  2UU9 I;  4XTJ A;  4IZJ A;  4JI7 I;  4LFA E;  2FGG A;  1RRE A;  3J7Y p;  2LTR A;  3OTO I;  4DR3 E;  4DR5 I;  3IWB A;  2NA2 A;  3Q1Q A;  3H09 A;  2HHH E;  2V34 A;  3PYF A;  2GS8 A;  2OI2 A;  4WUC A;  3GON A;  5DNY A;  5IT9 Q;  2EZ6 A;  1H7S A;  3P06 A;  1J26 A;  1RR9 A;  3WU3 A;  4JI1 I;  4YY3 I;  1QU6 A;  3JU0 A;  1N0V C;  4B3M I;  3F6H A;  4Z7C A;  5T6J A;  5ADZ A;  2X36 A;  4DV3 E;  4L8N A;  3ZZU A;  3ZOQ B;  2JR1 A;  2LRS A;  3M6A A;  2VQF I;  4NXM I;  4WYQ B;  1KTV A;  1N36 E;  1USU A;  1USV A;  5GMD A;  4OOG C;  1NHH A;  5LL6 R;  2B7T A;  3ZKB A;  3J81 Q;  4JYA I;  2L8T A;  4DR6 I;  2UUC E;  1DAR A;  4FWH A;  4LF4 I;  1KKH A;  3FIG A;  2LUQ A;  4L5N C;  3C4B A;  2CGE A;  4DUZ I;  2ZM6 I;  1XMQ I;  2PNL A;  1B62 A;  4M0V A;  4B3S I;  2F8B A;  4JI6 I;  2B3T B;  5F3W A;  3F6G A;  1HR0 I;  3OTO E;  4F54 A;  4DR5 E;  2KON A;  2JVA A;  2R42 A;  4DUY E;  2XEX A;  3V5R A;  4JI8 I;  2LJP A;  2L3C A;  4WPY A;  1Z5C A;  2Z5B A;  3ZKD A;  3LTO A;  4DV5 I;  4DV2 E;  4JI1 E;  5AE3 A;  1H74 A;  2LTS A;  2VQE E;  1PVG A;  1T4O A;  4B3M E;  1I94 E;  4AQY I;  3D4J A;  1BKN A;  2L2K B;  2DEI A;  2F4V E;  1S4E A;  4HY1 A;  2RTX A;  2O1U A;  3LPS A;  2FV4 B;  4USM A;  4BC9 A;  1XNQ I;  4X65 I;  4WUB A;  2JWO A;  3HQ1 A;  3B82 A;  4LF9 I;  2L2M A;  2HKE A;  2V88 A;  4J8Z A;  1IBL E;  2V86 A;  4JYA E;  3ZZT A;  4P7A A;  2ODR D;  4JI3 E;  1FNM A;  4BC7 A;  1WXR A;  2DB2 A;  1HNX E;  2ZM6 E;  4WFT A;  1XMQ E;  4LF8 E;  4DR4 I;  2LBS B;  2MC5 A;  4R03 A;  1ZBT A;  4BCA A;  2LUP B;  1N32 E;  2NPF A;  4DPW A;  4F9A B;  4I3H A;  4YHH I;  3ZZ0 A;  1FWL A;  2AJ4 A;  4ED4 A;  4GKK I;  1DI2 A;  4HXZ A;  4PU9 A;  4DR2 I;  2K4V A;  3P1X A;  2G7H A;  2KOU A;  4LTY A;  4LF5 E;  3J80 C;  1NHJ A;  4IZK B;  1B63 A;  3Q6N A;  3J7A M;  3DJW A;  2UXC E;  3PRY A;  2O1V A;  2L92 A;  1ZM2 A;  2RSM A;  1Y4U A;  2JOB A;  1PIE A;  1NHI A;  1STU A;  1FJG E;  3AV0 A;  1Y6Z A;  5IT9 C;  4OX9 E;  2VF1 A;  1XHK A;  4LF9 E;  4X64 I;  2L3J A;  2UXB E;  3T1H E;  4UTG A;  3PYE A;  4IZK A;  5LMN E;  3DF6 A;  4X62 I;  1Z0V A;  3VK6 A;  4FWG A;  5IWA E;  4PRV A;  4LFC I;  4LF7 I;  1J5E I;  4DV7 E;  1XMO I;  2L33 A;  4I8O A;  1ELO A;  2CG9 A;  4USK A;  2V2Z A;  4KHP E;  4P52 A;  1HNZ E;  4JI5 I;  2JOX A;  4RPF A;  4B3R I;  3J81 C;  4K0K I;  3IWD A;  2NUF A;  4DR1 I;  4NXN E;  4X66 I;  3B78 A;  1Z5A A;  2B7V A;  2YT4 A;  2GQ0 A;  1ZXM A;  2ZIT A;  4JI4 I;  1IBM E;  1Z0B A;  2J7K A;  3HXL A;  2DSY A;  3ADL A;  3ADI A;  1XNR I;  2UUB E;  1ZM9 A;  2UU9 E;  4DR7 I;  4JI7 E;  5FLX Q;  2M1S A;  3LML A;  1MG7 A;  1KIJ A;  4DU7 A;  2BV3 A;  3JTZ A;  4JI0 I;  4X62 E;  1KVK A;  4B3T I;  2UUA I;  1EI1 A;  4LFC E;  1Z59 A;  2WW4 A;  4DV1 I;  2HFS A;  4YY3 E;  4DV6 I;  1XMO E;  1Z0W A;  4GKJ I;  1N0U A;  2V87 A;  4FWD A;  4JI5 E;  4Z7Y A;  4K0K E;  4JG4 A;  4DR1 E;  1A6F A;  2O1W A;  1GZ6 A;  1Z0E A;  3ZM7 A;  2VQF E;  1Z0T A;  4NXM E;  1Z0C A;  1X49 A;  4F9C B;  4X66 E;  2NUG A;  2HKJ A;  1T4L B;  2IHR 1;  1N33 I;  2LJH A;  2Z5C B;  3T1Y I;  1DQ3 A;  5L3J A;  2V85 A;  1ZXN A;  1XNR E;  3OML A;  4DR6 E;  4LFB I;  5CFF E;  4LF4 E;  4DUZ E;  4JI2 I;  1YYO A;  4B3S E;  4JI6 E;  1HR0 E;  1WHN A;  1OJ4 A;  2MDR A;  4DPU A;  1NZ0 A;  3QT5 A;  4R1F A;  3QT7 A;  3K17 A;  4JI8 E;  3Q6M A;  2RS6 A;  4LF6 I;  2UUA E;  2Z5C A;  5FWK A;  4LFA I;  2V8Q B;  2UXD I;  1Z0G A;  4DV1 E;  4DR3 I;  4DV5 E;  1GQE A;  4DMI A;  4DV6 E;  3HPZ A;  4GKJ E;  2HHH I;  2VE7 C;  2N3H A;  2R3V A;  4AQY E;  1D6T A;  2HFU A;  4F9B B;  4HAC B;  1YYW A;  3K6Q A;  1ZM4 A;  2DEJ A;  1N34 I;  4ZVI A;  3JAM Q;  2IOQ A;  1XNQ E;  4DV3 I;  4R8O A;  4X65 E;  1N33 E;  4IZJ B;  5A2Q Q;  2E1M A;  2YZT A;  3WU4 A;  1PKP A;  3ADG A;  2L2N A;  1N36 I;  2E5L I;  4MYT A;  2N3G A;  2HK3 A;  3ADJ A;  4HAC A;  5AAS A;  3WU6 A;  2A2C A;  4JI2 E;  2RS7 A;  4MYU A;  4DR4 E;  4N3O A;  4JV5 I;  3VYY A;  4EMD A;  1FKA E;  2UUC I;  1O0W A;  1VIS A;  3K1J A;  1IBK I;  1HNW I;  4YHH E;  1FWK A;  4DPY A;  4DV0 I;  1HK7 A;  4LF6 E;  4GKK E;  5GME A;  2KHX A;  1UIL A;  2UXD E;  4DR2 E;  4DUY I;  1YZ9 A;  4Q28 A;  4PRX A;  5BR8 I;  4DU8 A;  4M2Z A;  1ZM3 A;  1T4N A;  3B8H A;  2V2Q A;  2FTX B;  4UT4 A;  5FLX C;  3HJC A;  4IZJ D;  3PYD A;  2MC6 A;  4DV2 I;  5AE2 A;  1X48 A;  2WZO A;  4DPT A;  2VQE I;  1H7U A;  1N34 E;  2Q2E B;  3WU5 A;  4WUD A;  4DV4 I;  2L6M A;  4M1K A;  1I94 I;  2M4I A;  2LE2 A;  4BS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...