1N34E

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n34E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n34E02
1XNQI 1EI1A 1Z0EA 2NUEA 4PRVA 5L3JA 4DV0I 4DUZI 4DV1E 2E5LI 1FJGE 3PYFA 4DV1I 4B3SI 1N0UA 4DV0E 4DXLA 2MDRA 1PKPA 3J7Yp 1EA6A 3B8HA 1QU6A 1IBMI 4B3SE 5LMNI 2RSMA 4DUYE 4JI7E 1RREA 1UHZA 1VISA 1N36E 1PIEA 4FW9A 2L3CA 4WUDA 3ZZUA 2UXDI 1ZM3A 4JI8I 4DPWA 4YHHE 2UXBE 4M2ZA 2CZ9A 3QT7A 4DV7I 4NXNI 1J26A 1UILA 2JVAA 4LF9I 4NXNE 2LJHA 1XMOE 4JI6I 4Z7CA 2E1RA 3CWVA 3J80C 4AQYE 4DR6I 4JI1I 4PU9A 1QZRA 4X64E 1J5EE 1EKZA 4DPXA 2RS7A 3PYDA 2VQFI 3Q1QA 1X49A 3J81C 5CFFE 2B7VA 4M30A 2DEJA 4WFTA 3K1JA 1RR9A 3B78A 3HTXA 2UUCE 2NUGA 1H74A 1I94I 4DU8A 1Z5AA 1MX0A 4UT4A 2N3GA 3VYXA 3F0NA 1YZ9A 4B3TE 1Z59A 1HNZI 2ZBKB 2UUAI 4ZVIA 4X66E 1MU5A 4JI0I 2F4VE 1DARA 5LMNE 2F4VI 4JI7I 4DV4E 5GMEA 4DR2E 2DB2A 4DV2I 5FLXC 2HHHI 1NHHA 4KHPE 4RPFA 4DPUA 4KHPI 2UXCI 2UUBE 4FN5A 2A2CA 4KQVA 3WU3A 1XNQE 4DR4E 4JI4I 1FWLA 4ED4A 4LF4E 4LF5E 3V5RA 1XNRE 3T1HE 1N33I 2A2DA 1N32E 4DV2E 1NZ0A 1FKAE 3C4BA 1N34I 1OJ4A 1PVGA 4DV4I 1T4LB 1WHNA 3V2UC 4LF7E 2KHXA 4JYAE 4URLA 5IWAI 2BM0A 4DV7E 2V8PA 2JY9A 4DR5I 3QT8A 1S16A 4UTGA 4HXZA 4JV5E 2DIXA 2UXDE 4JG4A 4X65I 4P7AA 1XHKA 1WHQA 4X65E 1H7UA 1J5EI 2N3HA 1Z0WA 2V2QA 4LFCI 2LJPA 3HULA 2EZ6A 4DR6E 1H7SA 1IBKI 1FNMA 1D6TA 4XTJA 3LTOA 1Z0TA 1XMQI 2EFGA 1B62A 2UU9I 3OTOE 2BM1A 4LF9E 1KKHA 2RS6A 1X48A 1A6FA 5LMUI 4DKKA 4JI3I 4DR7I 1N0VC 3JAMC 4DR7E 2L3JA 3C4TA 3J81Q 1DI2A 4DV3I 4GKJE 2HFUA 4FWHA 4YY3E 3OTOI 2AJ4A 1ZXNA 4JI0E 4HY1A 4DUYI 5A2QQ 4B3RI 4DR1I 1B63A 5A2QC 4USKA 4DR1E 1I94E 2E5LE 3WU4A 4GKJI 2LRSA 3ZZTA 1FJGI 4LF7I 5BR8E 4HYMA 2ZM6I 3T1HI 4PRXA 5GMDA 4DV3E 4LFBI 3QT5A 2ZM6E 4JI4E 4LF5I 3LNUA 2Q2EB 3ZKBA 1HNWI 4JI6E 4LFBE 1HNXE 2YT4A 1Z5BA 3LPSA 3LLHA 1FWKA 2L33A 3PYGA 2HFSA 4OX9E 3T1YI 2V2ZA 2LUPB 1YYWA 3K17A 4MYUA 4LFCE 1IBKE 4JYAI 1U2RA 2NA2A 4P52A 5IT9C 1YYOA 4X62I 2LUQA 1RQ0A 4HACA 3ZKDA 4X64I 4LF8I 2V2VA 1N33E 2B3TB 4K0KI 4DV6E 2BV3A 4DR3I 4GKKE 1N36I 4LF6E 1MG7A 2WW4A 1ZM4A 4JI2E 2L2MA 1KVKA 2IHR1 3ZZ0A 2L2KB 2UU9E 2XEXA 1XMQE 2VQFE 1ZBTA 1ZM2A 4R1FA 4WUBA 4JI5I 2HHHE 1K47A 1STUA 4NXME 4FWDA 4DV6I 4JV5I 2B7TA 1HNZE 4B3TI 4NXMI 1YYKA 2HKJA 4X66I 3PYEA 3H4LA 4Z7YA 2UUBI 2V34A 2J7KA 4DR4I 4DV5E 2RTXA 1HR0E 2VQEE 4USMA 4YY3I 2HK3A 2GS8A 4I3HA 4DR2I 3ADIA 4MYTA 4B3ME 3ADLA 4DPTA 2HKEA 1IBLI 4WYQB 4LF4I 1RC7A 1IBLE 1WUUA 2LBSB 2UUAE 1H72C 1KTVA 3WU5A 3J7AM 1Z5CA 1T4OA 1GQEA 3VYYA 3ADJA 4DV5I 1XNRI 2VQEI 2L2NA 2DMYA 1T4NA 4LF6I 1HNXI 2UXCE 3J7AG 5IWAE 2LTSA 3M6AA 2LTRA 4LFAE 4X8WA 3ADGA 3ZM7A 1ZM9A 4DR3E 4LFAI 4AQYI 2CPNA 4LF8E 4YHHI 1H73A 2UXBI 4JI1E 5IT9Q 4JI8E 4FWGA 1NHIA 4X62E 1KIJA 1FI4A 4JI5E 1Z0BA 4DR5E 3D4JA 3J80Q 1IBME 4HACB 1XMOI 2X36A 3T1YE 4OX9I 2UUCI 4GKKI 1Z0VA 3B82A 5BR8I 4K0KE 3P1XA 1ZXMA 3JAMQ 2VF3A 5FLXQ 5LMUE 1UEKA 3GONA 1HR0I 2OI2A 2X7IA 1X47A 4B3RE 2ZITA 1NHJA 2R3VA 4WUCA 2NPFA 4JI2I 1BKNA 1Z0GA 4DU7A 4M1KA 4DUZE 1N34E 1O0WA 3WU6A 1Z0CA 2R42A 1ELOA 2HK2A 4JI3E 3QT6A 4DPYA 4OOGC 5LL6R 1N32I 2NUFA 2DEIA 1HNWE 4B3MI 1S4EA 4EMDA
chains in the Genus database with same CATH superfamily
1XNQI 2GO3A 5C0XF 3M7ND 1ZAAC 2YWQA 1EI1A 2EMHA 2LT7A 5KL6A 2NUEA 1Z0EA 1IMUA 4PRVA 2JE6B 5DNXA 5L3JA 1PJSA 2EMGA 2O3ZA 4DV0I 2PO1B 4DUZI 4DV1E 2E5LI 1FJGE 1HK7A 1DGCA 2PRTA 3PYFA 4DV1I 4B3SI 1N0UA 3BIDA 4DV0E 4DXLA 1X6FA 2EN2A 2RSIA 2MDRA 1BB8A 4OO1C 1PKPA 1YHCA 4IFDF 3J7Yp 1EA6A 3B8HA 1QU6A 2NN6B 2FV4B 5KL2A 5KL4A 2L6MA 1E3HA 2CSHA 1IBMI 4B3SE 5LMNI 2RQLA 2C37A 2RSMA 2LO3A 4DUYE 1A1FA 4JI7E 1RREA 1UHZA 3RMPA 1DQ3A 1VISA 2FTXB 1N36E 1PIEA 4BC7A 4FW9A 2L3CA 5A6KA 2EOSA 2JOXA 3JU0A 4WUDA 2EPNA 3ZZUA 4HTGA 2UXDI 1LLMC 4IZJA 2WP8B 5A6AA 1ZM3A 1A1LA 4JI8I 4DPWA 2DMIA 4YHHE 3VHTB 4M2ZA 2ENHA 2UXBE 2WBSA 2CZ9A 1TN9A 5KL3A 3QT7A 1TF6A 2BR2B 4DV7I 1Y5YA 4Q35B 4NXNI 2KONA 1J26A 2EOMA 4BBYA 1Y4UA 2Z5CB 2CGEA 1UILA 2JVAA 4R2EA 4LF9I 4NXNE 2EMKA 2LJHA 3HXLA 1XMOE 3L00A 4JI6I 1USUA 4Z7CA 2EMIA 2E1RA 4MLVA 3J80C 3CWVA 5KL7A 4LOMA 5DRRA 1UDQA 2YU5A 2PNZA 4U3BA 4AQYE 3PRYA 2E1MA 4DR6I 4JI1I 4PU9A 3P3GA 1QZRA 4LCFA 5ADZA 4X64E 2VF1A 1J5EE 1EKZA 2RS7A 3L7ZB 3PYDA 2H36X 4DPXA 2VQFI 1SFEA 3P3EA 5K36E 4Q28A 1X49A 3J81C 5CFFE 1BBOA 2EMLA 1G2FC 2YTPA 1YUJA 2B7VA 2PNMA 4M30A 2DRPA 1UDOA 1AH5A 4WFTA 2DEJA 1A1JA 1RR9A 3K1JA 2DLQA 3HTXA 2F1DA 2UUCE 2NUGA 3B78A 1H74A 4BA1A 1I94I 2YTJA 4DU8A 1Z5AA 2EPMX 1MX0A 4UT4A 2YRHA 2EOQA 2N3GA 3BF2A 4R2DA 3VYXA 2GQ0A 1G2DC 2EP3A 1EH8A 2V86A 2WCC3 2EOEA 4IJDA 4P7DA 4B3TE 4L8NA 1YZ9A 1Z59A 2ZBKB 3F0NA 4IZJB 1HNZI 2UUAI 3EPKA 4F54A 5DRPA 2EMAA 4X66E 1T38A 4ZVIA 5F3WA 5T6JA 1MU5A 4JI0I 5JEAF 2F4VE 1DARA 3HPSA 5C0XA 3KWRA 4ZYDA 5LMNE 2F4VI 2M4IA 4IFDA 1PJQA 4NBQA 1A1KA 4JI7I 4DV4E 5GMEA 2CTDA 2EN6A 4BA2A 4DR2E 4ZYHA 2DB2A 2NN6D 4DV2I 5FLXC 2HHHI 2ELZA 4LU9A 1NHHA 3THNA 4KHPE 3F6GA 4RPFA 1L4SA 2EN1A 1KYQA 4R2PA 3K6QA 4DPUA 4O4KA 2BA0D 4F9CB 4KHPI 2UXCI 2UUBE 3DD6A 2A2CA 4FN5A 4RH8A 1XNQE 3H09A 4DR4E 4KQVA 3WU3A 4BA2B 4P78A 4JI4I 1FWLA 4ED4A 4LF4E 4LF5E 3V5RA 1XNRE 2MDGA 2C38B 5K36B 1GTKA 2EM0A 3T1HE 2PNLA 4R2RA 2FGGA 1N33I 1QNTA 2EPXA 4TUIA 1N32E 2A2DA 4DV2E 1NZ0A 2AE8A 4NZVA 3C4BA 2A25A 3F6HA 1FKAE 2HJJA 1OJ4A 3PS3A 1E3PA 4ISAA 1N34I 2NN6E 1PVGA 2EPOA 4DV4I 1T4LB 1WHNA 3V2UC 1BBGA 2ENCA 4AM3A 2WBUA 4LF7E 3P3CA 4I8OA 2GO4A 4ZYGA 3K85A 2KHXA 4JYAE 4URLA 2CT1A 4IFDC 3MSWA 2MC5A 1PJTA 4OO1B 5IWAI 1UDNA 5ELWA 2BM0A 4DV7E 2V8PA 5JEAB 4MDTA 4MLQA 5JEAD 2JY9A 1T39A 2EM7A 5JEAC 4DR5I 5AE3A 3QT8A 1S16A 2GLIA 3AUZA 2PO0A 4UTGA 2LE2A 1JK1A 1A1IA 4HXZA 4JV5E 5DROA 2EN3A 2EMYA 1AAYA 2DIXA 2UXDE 2MKDA 4JG4A 4P7AA 4X65I 4RHBB 1XHKA 2JR1A 1TF3A 4R8OA 1WHQA 4X65E 3EPLA 1H7UA 5C0XD 3NZKA 2JEBB 1J5EI 2N3HA 1Z0WA 2J7JA 2WP8A 3M7NG 2V2QA 4LFCI 2LJPA 3HULA 2EZ6A 4DR6E 1H7SA 2PO2B 1IBKI 3Q1QA 2DLKA 2M9AA 1FNMA 1Y6ZA 1D6TA 2EL6A 5K36A 4XTJA 2C38A 2BR2A 2YTQA 3LTOA 3PS2A 1Z0TA 5DRQA 4BCAA 4BHCA 1XMQI 2L8TA 2EFGA 1B62A 2UU9I 3LMLA 4AIMA 3OTOE 1EH7A 2B9DA 2NN6C 1P47A 2BM1A 2YTFA 4LF9E 1KKHA 2RS6A 1X48A 2EPKX 1A6FA 5LMUI 1RMDA 5C0XB 4DKKA 3MHHC 4GEQB 4JI3I 4DR7I 1YPNA 4WSPA 2EPRA 4AIDA 1MEYC 4ZYEA 2EOYA 3JTZA 1Y60A 3UHMA 1N0VC 3JAMC 4DR7E 4FW4A 2L3JA 2C37B 3C4TA 2JEBA 2Z5BA 3J81Q 1DI2A 2BA1D 4DV3I 4GKJE 2HFUA 4GZNC 4FWHA 1IQSA 3HPZA 4YY3E 2EOFA 3OTOI 4M0VA 2AJ4A 1ZXNA 4JI0E 1KJKA 4HY1A 4F6MA 2F8BA 4DUYI 3CDJA 2DGCA 1ZBQA 5A2QQ 4B3RI 4DR1I 1NCSA 1B63A 2PO1A 3ZOQB 5A2QC 2EM2A 4USKA 2EL5A 4NHRA 4DR1E 3GLLA 3UK3C 4BMJA 4L5NC 4IZKA 3P06A 5C0XC 2V89A 1IQOA 1I94E 2CG9A 5DNLA 5JEAA 2E5LE 3WU4A 4HEIA 4GKJI 1ZU1A 2LRSA 3ZZTA 2EWLA 1FJGI 4N4RB 4FW5A 5BR8E 4HYMA 2N8XA 2ZM6I 4LF7I 3T1HI 4PRXA 2EPUA 5GMDA 4DV3E 4LFBI 3QT5A 3QG5C 2ZM6E 2V83A 2JPAA 4OKGA 4JI4E 4LF5I 2Q8UA 2O1UA 3LNUA 2EMBA 2Q2EB 3ZKBA 2DSYA 4JI6E 3M85D 1HNWI 2ENAA 4LFBE 1HNXE 2RPCA 5TSEA 2YT4A 1Z5BA 3LPSA 3LLHA 3EPHA 2L33A 1FWKA 2HFSA 3PYGA 4MU4A 4OX9E 4OO1A 2ODRD 2V2ZA 3T1YI 2YTNA 2PNZB 2LUPB 2K7IA 1YYWA 2EOOA 2YRMA 3K17A 4MYUA 2V8QB 2R1FA 3DF6A 5IV8B 4LFCE 1IBKE 3KZYA 4JYAI 1U2RA 2NA2A 5IT9C 4P52A 1YYOA 4X62I 2LUQA 2EPZA 1RQ0A 5AC5A 4HACA 3ZKDA 4X64I 4LF8I 5LLQA 2V2VA 1N33E 2B3TB 2K4VA 2EM5A 4K0KI 4FW3A 2EPAA 2YPNA 4IFDB 4DV6E 2NN6F 5AC4A 2BV3A 2EE8A 3M99B 2HGHA 1X3CA 4DR3I 2GHFA 2J65A 5C0XE 4GKKE 1N36I 4LF6E 2D9HA 3IWDA 4LTYA 1MG7A 2WW4A 5K36D 1ZM4A 4JI2E 2L2MA 2YTOA 2EPLX 4R2SA 1KVKA 4DMIA 5EKWA 2IHR1 2BA0G 1ZR9A 4IFDE 3C6MA 3ZZ0A 2V88A 3EPJA 1USVA 2NN6A 2L2KB 5A6JA 2UU9E 4R2QA 1UDSA 2O1TA 2XEXA 1XMQE 4OZEA 2VQFE 4BA1B 4FK5C 4BS9A 1YUIA 4O24A 1ZBTA 1ZM2A 4R1FA 2JWOA 4WUBA 4JI5I 2HHHE 2I13A 1K47A 1STUA 4NXME 1B69A 4FWDA 4DV6I 4JV5I 5IXMB 4M9VC 3Q6NA 2BA1G 2B7TA 4BHBA 2EMCA 1HNZE 4B3TI 4NXMI 3ECRA 1YYKA 3PS1A 4QNJA 4LCHA 2HKJA 1F2IG 2EJ4A 2EM8A 4X66I 5KL5A 3PYEA 3Q6MA 3H4LA 4Z7YA 1P42A 3TQMA 3KRNA 2YSPA 5AE1A 2WNRA 2UUBI 2V34A 3GMEA 4OO1D 2EMZA 2EOHA 4F9AB 1GZ6A 2YRKA 2YU8A 4WXCA 4DV5E 2J7KA 4DR4I 2R76A 3M6AA 2JP9A 4TUGA 2RTXA 1HR0E 4FW7A 2VQEE 3L7ZA 4MQYA 4MU3A 4USMA 4QNKA 3P76A 4YY3I 3C6KA 4F6NA 3EQ1A 4R2CA 1NEIA 3MHSC 5EL9A 3HQ1A 4BC9A 2HK3A 2MKNA 2ADRA 1RHYA 2EN4A 2GS8A 3HKMA 1WJPA 4I3HA 4OO1F 4DR2I 1OYSA 2E72A 3ADIA 2I9IA 4LPFA 4WPYA 4MYTA 4B3ME 4N3OA 3FIGA 2EORA 2G7HA 1WXRA 3ADLA 4DPTA 2HKEA 1IBLI 2EM9A 4WYQB 4LF4I 2EPCA 1RC7A 1IBLE 1JK2A 1WUUA 1A1GA 2KOUA 2LBSB 2IOQA 2UUAE 2C39A 1H72C 1KTVA 5A69A 3WU5A 3J7AM 2JXPA 3AV0A 4LCGA 4F2JC 1Z5CA 4WX9A 2VE7C 2YTIA 3B4TA 2WBTA 1T4OA 2EQ0A 1GQEA 4KZSA 2VRDA 3VYYA 3ADJA 1XXEA 4J3DA 4DV5I 1XNRI 2Z5EA 2VQEI 2EMFA 4IS1C 3BBGA 2L2NA 1YFHA 3H1CA 4GQUA 2DMYA 1T4NA 4LF6I 1HNXI 2UXCE 3J7AG 2JEAA 3BGHA 1X6EA 4MU1A 5IWAE 2EOXA 2EN8A 2LTSA 2BB8A 4KWYA 2LTRA 5A6BA 2Z5BB 4LFAE 3GCMA 3U1YA 4X8WA 3ADGA 4IS9A 5JEAE 3ZM7A 1ZM9A 4DR3E 2JE6A 2YTGA 4X9JA 2M1SA 2CVEA 1EH6A 4LFAI 1R6LA 4AQYI 3DJWA 3HJCA 2CPNA 2EOIA 4LF8E 5AE2A 1H73A 2L92A 4JI1E 1VI7A 4YHHI 4JI8E 5FWKA 2UXBI 5IT9Q 2VESA 1Y4SA 4FWGA 1NHIA 4X62E 4IZJD 1KIJA 1FI4A 4R2AA 4JI5E 1Z0BA 5K36F 1MGTA 4DR5E 3D4JA 3J80Q 1YSAC 2EPPA 2LJUA 2EM4A 3CDIA 1IBME 2V87A 4HACB 2WZOA 2O1WA 1XMOI 1UBDC 2ODRC 2PO2A 2LMZA 2X36A 3T1YE 4OX9I 2JEAB 1X6HA 2EOJA 1OYPA 2UUCI 4MU0A 4J8ZA 4GKKI 3IWBA 1Z0VA 4U3DA 2V85A 1Z1BA 5K36C 1OYRA 5DNYA 2LCEA 3B82A 2BBGA 4F9BB 2JT2A 5BR8I 2IESA 3U1KA 4K0KE 3P1XA 2YZTA 1ZXMA 4R03A 3JAMQ 2VF3A 2C39B 5FLXQ 2EM6A 2LVHA 3IWCA 3VK6A 2PO0B 5LMUE 2EMWA 2GPIA 1UEKA 1X5WA 2YTEA 3M85G 3GONA 2EM3A 3OMLA 1R6MA 1PDAA 1UN6B 2IERA 3THOB 2OI2A 1HR0I 1YH8A 4OO1E 4WXDA 4WSGA 2X7IA 1X47A 3KZZA 4B3RE 2ZITA 1NHJA 2YSOA 2R3VA 2LV2A 2ELYA 4O43A 2EMXA 4WUCA 4IFDD 2O1VA 2NPFA 2EN7A 2M7QA 2EL4A 4JI2I 1BKNA 2NABA 1Z0GA 4DU7A 2YTDA 2Z5CA 4IZKB 4M1KA 4O5GA 4DUZE 2EOZA 1N34E 1O0WA 1A1HA 2WNRB 1Z0CA 2IOPA 5A6BD 2R42A 2JOBA 1ELOA 3WU6A 2EQ1A 2HK2A 5AASA 2HC5A 4JI3E 2EQ3A 4FW6A 1WRJA 3QT6A 4DPYA 4OOGC 5LL6R 1N32I 2NUFA 2DEIA 1HNWE 2JYAA 4B3MI 2MC6A 1SR9A 1N3GA 1S4EA 4EMDA
chains in the Genus database with same CATH topology
1XNQI 1EI1A 1Z0EA 2NUEA 4PRVA 5L3JA 4DV0I 4DUZI 4DV1E 2E5LI 1FJGE 1HK7A 3PYFA 4DV1I 4B3SI 1N0UA 4DV0E 4DXLA 2MDRA 1PKPA 3J7Yp 1EA6A 3B8HA 1QU6A 2FV4B 2L6MA 1IBMI 4B3SE 5LMNI 2RSMA 4DUYE 4JI7E 1RREA 1UHZA 3RMPA 1DQ3A 1VISA 2FTXB 1N36E 1PIEA 4BC7A 4FW9A 2L3CA 2JOXA 3JU0A 4WUDA 3ZZUA 2UXDI 4IZJA 1ZM3A 4JI8I 4DPWA 4YHHE 2UXBE 4M2ZA 2CZ9A 3QT7A 4DV7I 4NXNI 2KONA 1J26A 4BBYA 1Y4UA 2Z5CB 2CGEA 1UILA 2JVAA 4LF9I 4NXNE 2LJHA 3HXLA 1XMOE 4JI6I 1USUA 4Z7CA 2E1RA 3CWVA 3J80C 4AQYE 3PRYA 2E1MA 4DR6I 4JI1I 4PU9A 1QZRA 5ADZA 4X64E 2VF1A 1J5EE 1EKZA 2RS7A 3PYDA 4DPXA 2H36X 2VQFI 3Q1QA 4Q28A 1X49A 3J81C 5CFFE 2B7VA 2PNMA 4M30A 2DEJA 4WFTA 1RR9A 3K1JA 3HTXA 3B78A 2UUCE 2NUGA 1H74A 1I94I 4DU8A 1Z5AA 1MX0A 4UT4A 2N3GA 2GQ0A 3VYXA 2V86A 3F0NA 1YZ9A 4B3TE 4P7DA 1Z59A 4L8NA 4IZJB 2ZBKB 1HNZI 2UUAI 4ZVIA 4F54A 4X66E 5F3WA 5T6JA 1MU5A 4JI0I 2F4VE 1DARA 3HPSA 3KWRA 5LMNE 2F4VI 2M4IA 4JI7I 4DV4E 5GMEA 4DR2E 2DB2A 4DV2I 5FLXC 2HHHI 4LU9A 1NHHA 4KHPE 3F6GA 4RPFA 3K6QA 4DPUA 4F9CB 4KHPI 2UXCI 2UUBE 4FN5A 2A2CA 4KQVA 3WU3A 1XNQE 3H09A 4DR4E 4P78A 4JI4I 1FWLA 4ED4A 4LF4E 4LF5E 3V5RA 1XNRE 3T1HE 2PNLA 2FGGA 1N33I 4TUIA 2A2DA 1N32E 4DV2E 1NZ0A 1FKAE 3C4BA 3F6HA 1N34I 1OJ4A 1PVGA 4DV4I 1T4LB 1WHNA 3V2UC 4LF7E 4I8OA 3K85A 2KHXA 4JYAE 4URLA 3MSWA 2MC5A 5IWAI 2BM0A 4DV7E 2V8PA 2JY9A 4DR5I 5AE3A 3QT8A 1S16A 3AUZA 4UTGA 2LE2A 4HXZA 4JV5E 2DIXA 2UXDE 4JG4A 4X65I 4P7AA 1XHKA 2JR1A 4R8OA 1WHQA 4X65E 1H7UA 1J5EI 2N3HA 1Z0WA 2V2QA 4LFCI 2LJPA 3HULA 2EZ6A 4DR6E 1H7SA 1IBKI 1FNMA 1Y6ZA 1D6TA 4XTJA 3LTOA 1Z0TA 4BCAA 1XMQI 2L8TA 2EFGA 1B62A 2UU9I 3LMLA 3OTOE 2B9DA 2BM1A 4LF9E 1KKHA 2RS6A 1X48A 1A6FA 5LMUI 4DKKA 4GEQB 4JI3I 4DR7I 4WSPA 3JTZA 1N0VC 3JAMC 4DR7E 2L3JA 3C4TA 2Z5BA 3J81Q 1DI2A 4DV3I 4GKJE 2HFUA 4FWHA 3HPZA 4YY3E 3OTOI 4M0VA 2AJ4A 1ZXNA 4JI0E 4HY1A 2F8BA 4DUYI 1ZBQA 5A2QQ 4B3RI 4DR1I 1B63A 3ZOQB 5A2QC 4USKA 4DR1E 4BMJA 4L5NC 4IZKA 3P06A 2V89A 1I94E 2CG9A 2E5LE 3WU4A 4GKJI 2LRSA 3ZZTA 2EWLA 1FJGI 4LF7I 5BR8E 4HYMA 2ZM6I 3T1HI 4PRXA 5GMDA 4DV3E 4LFBI 3QT5A 2ZM6E 2V83A 4JI4E 4LF5I 2O1UA 3LNUA 2Q2EB 3ZKBA 2DSYA 4JI6E 1HNWI 4LFBE 1HNXE 2YT4A 1Z5BA 3LPSA 3LLHA 1FWKA 2L33A 2HFSA 3PYGA 4OX9E 3T1YI 2ODRD 2V2ZA 2LUPB 1YYWA 3K17A 4MYUA 2V8QB 3DF6A 4LFCE 1IBKE 4JYAI 1U2RA 2NA2A 5IT9C 4P52A 1YYOA 4X62I 2LUQA 1RQ0A 4HACA 3ZKDA 4X64I 4LF8I 2V2VA 1N33E 2B3TB 2K4VA 4K0KI 4DV6E 2BV3A 4DR3I 4GKKE 1N36I 4LF6E 3IWDA 4LTYA 1MG7A 2WW4A 1ZM4A 4JI2E 2L2MA 1KVKA 4DMIA 2IHR1 3ZZ0A 2V88A 1USVA 2L2KB 2UU9E 2XEXA 2O1TA 1XMQE 2VQFE 4BS9A 1ZBTA 1ZM2A 4R1FA 2JWOA 4WUBA 4JI5I 2HHHE 1K47A 1STUA 4NXME 4FWDA 4DV6I 4JV5I 3Q6NA 2B7TA 1HNZE 4B3TI 4NXMI 1YYKA 2HKJA 4X66I 3PYEA 3Q6MA 3H4LA 4Z7YA 5AE1A 2UUBI 2V34A 4F9AB 2J7KA 1GZ6A 4DR4I 4DV5E 4TUGA 2RTXA 1HR0E 2VQEE 4USMA 4YY3I 3HQ1A 4BC9A 2HK3A 2GS8A 4I3HA 4DR2I 3ADIA 4MYTA 4WPYA 4B3ME 4N3OA 3FIGA 2G7HA 1WXRA 3ADLA 4DPTA 2HKEA 1IBLI 4WYQB 4LF4I 1RC7A 1IBLE 1WUUA 2KOUA 2LBSB 2IOQA 2UUAE 1H72C 1KTVA 3WU5A 3J7AM 3AV0A 1Z5CA 2VE7C 1T4OA 4KZSA 1GQEA 3VYYA 3ADJA 4DV5I 1XNRI 2Z5EA 2VQEI 2L2NA 2DMYA 1T4NA 4LF6I 1HNXI 2UXCE 3J7AG 5IWAE 2LTSA 3M6AA 2LTRA 2Z5BB 4LFAE 4X8WA 3ADGA 3ZM7A 1ZM9A 4DR3E 2M1SA 4LFAI 4AQYI 3DJWA 3HJCA 2CPNA 4LF8E 5AE2A 1H73A 2L92A 4JI1E 4YHHI 2UXBI 4JI8E 5FWKA 5IT9Q 1Y4SA 4FWGA 1NHIA 4X62E 4IZJD 1KIJA 1FI4A 4JI5E 1Z0BA 4DR5E 3D4JA 3J80Q 1IBME 2V87A 4HACB 2WZOA 2O1WA 1XMOI 2ODRC 2LMZA 2X36A 3T1YE 4OX9I 2UUCI 4J8ZA 4GKKI 3IWBA 1Z0VA 2V85A 5DNYA 3B82A 4F9BB 5BR8I 4K0KE 3P1XA 2YZTA 1ZXMA 4R03A 3JAMQ 2VF3A 5FLXQ 3IWCA 3VK6A 5LMUE 1UEKA 3GONA 3OMLA 1HR0I 2OI2A 2X7IA 1X47A 4B3RE 2ZITA 1NHJA 2R3VA 4WUCA 2O1VA 2NPFA 2M7QA 4JI2I 1BKNA 1Z0GA 4DU7A 2Z5CA 4IZKB 4M1KA 4DUZE 1N34E 1O0WA 3WU6A 1Z0CA 2IOPA 2R42A 2JOBA 1ELOA 2HK2A 5AASA 4JI3E 3QT6A 4DPYA 4OOGC 5LL6R 1N32I 2NUFA 2DEIA 1HNWE 4B3MI 2MC6A 1SR9A 1S4EA 4EMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ I;  1EI1 A;  1Z0E A;  2NUE A;  4PRV A;  5L3J A;  4DV0 I;  4DUZ I;  4DV1 E;  2E5L I;  1FJG E;  3PYF A;  4DV1 I;  4B3S I;  1N0U A;  4DV0 E;  4DXL A;  2MDR A;  1PKP A;  3J7Y p;  1EA6 A;  3B8H A;  1QU6 A;  1IBM I;  4B3S E;  5LMN I;  2RSM A;  4DUY E;  4JI7 E;  1RRE A;  1UHZ A;  1VIS A;  1N36 E;  1PIE A;  4FW9 A;  2L3C A;  4WUD A;  3ZZU A;  2UXD I;  1ZM3 A;  4JI8 I;  4DPW A;  4YHH E;  2UXB E;  4M2Z A;  2CZ9 A;  3QT7 A;  4DV7 I;  4NXN I;  1J26 A;  1UIL A;  2JVA A;  4LF9 I;  4NXN E;  2LJH A;  1XMO E;  4JI6 I;  4Z7C A;  2E1R A;  3CWV A;  3J80 C;  4AQY E;  4DR6 I;  4JI1 I;  4PU9 A;  1QZR A;  4X64 E;  1J5E E;  1EKZ A;  4DPX A;  2RS7 A;  3PYD A;  2VQF I;  3Q1Q A;  1X49 A;  3J81 C;  5CFF E;  2B7V A;  4M30 A;  2DEJ A;  4WFT A;  3K1J A;  1RR9 A;  3B78 A;  3HTX A;  2UUC E;  2NUG A;  1H74 A;  1I94 I;  4DU8 A;  1Z5A A;  1MX0 A;  4UT4 A;  2N3G A;  3VYX A;  3F0N A;  1YZ9 A;  4B3T E;  1Z59 A;  1HNZ I;  2ZBK B;  2UUA I;  4ZVI A;  4X66 E;  1MU5 A;  4JI0 I;  2F4V E;  1DAR A;  5LMN E;  2F4V I;  4JI7 I;  4DV4 E;  5GME A;  4DR2 E;  2DB2 A;  4DV2 I;  5FLX C;  2HHH I;  1NHH A;  4KHP E;  4RPF A;  4DPU A;  4KHP I;  2UXC I;  2UUB E;  4FN5 A;  2A2C A;  4KQV A;  3WU3 A;  1XNQ E;  4DR4 E;  4JI4 I;  1FWL A;  4ED4 A;  4LF4 E;  4LF5 E;  3V5R A;  1XNR E;  3T1H E;  1N33 I;  2A2D A;  1N32 E;  4DV2 E;  1NZ0 A;  1FKA E;  3C4B A;  1N34 I;  1OJ4 A;  1PVG A;  4DV4 I;  1T4L B;  1WHN A;  3V2U C;  4LF7 E;  2KHX A;  4JYA E;  4URL A;  5IWA I;  2BM0 A;  4DV7 E;  2V8P A;  2JY9 A;  4DR5 I;  3QT8 A;  1S16 A;  4UTG A;  4HXZ A;  4JV5 E;  2DIX A;  2UXD E;  4JG4 A;  4X65 I;  4P7A A;  1XHK A;  1WHQ A;  4X65 E;  1H7U A;  1J5E I;  2N3H A;  1Z0W A;  2V2Q A;  4LFC I;  2LJP A;  3HUL A;  2EZ6 A;  4DR6 E;  1H7S A;  1IBK I;  1FNM A;  1D6T A;  4XTJ A;  3LTO A;  1Z0T A;  1XMQ I;  2EFG A;  1B62 A;  2UU9 I;  3OTO E;  2BM1 A;  4LF9 E;  1KKH A;  2RS6 A;  1X48 A;  1A6F A;  5LMU I;  4DKK A;  4JI3 I;  4DR7 I;  1N0V C;  3JAM C;  4DR7 E;  2L3J A;  3C4T A;  3J81 Q;  1DI2 A;  4DV3 I;  4GKJ E;  2HFU A;  4FWH A;  4YY3 E;  3OTO I;  2AJ4 A;  1ZXN A;  4JI0 E;  4HY1 A;  4DUY I;  5A2Q Q;  4B3R I;  4DR1 I;  1B63 A;  5A2Q C;  4USK A;  4DR1 E;  1I94 E;  2E5L E;  3WU4 A;  4GKJ I;  2LRS A;  3ZZT A;  1FJG I;  4LF7 I;  5BR8 E;  4HYM A;  2ZM6 I;  3T1H I;  4PRX A;  5GMD A;  4DV3 E;  4LFB I;  3QT5 A;  2ZM6 E;  4JI4 E;  4LF5 I;  3LNU A;  2Q2E B;  3ZKB A;  1HNW I;  4JI6 E;  4LFB E;  1HNX E;  2YT4 A;  1Z5B A;  3LPS A;  3LLH A;  1FWK A;  2L33 A;  3PYG A;  2HFS A;  4OX9 E;  3T1Y I;  2V2Z A;  2LUP B;  1YYW A;  3K17 A;  4MYU A;  4LFC E;  1IBK E;  4JYA I;  1U2R A;  2NA2 A;  4P52 A;  5IT9 C;  1YYO A;  4X62 I;  2LUQ A;  1RQ0 A;  4HAC A;  3ZKD A;  4X64 I;  4LF8 I;  2V2V A;  1N33 E;  2B3T B;  4K0K I;  4DV6 E;  2BV3 A;  4DR3 I;  4GKK E;  1N36 I;  4LF6 E;  1MG7 A;  2WW4 A;  1ZM4 A;  4JI2 E;  2L2M A;  1KVK A;  2IHR 1;  3ZZ0 A;  2L2K B;  2UU9 E;  2XEX A;  1XMQ E;  2VQF E;  1ZBT A;  1ZM2 A;  4R1F A;  4WUB A;  4JI5 I;  2HHH E;  1K47 A;  1STU A;  4NXM E;  4FWD A;  4DV6 I;  4JV5 I;  2B7T A;  1HNZ E;  4B3T I;  4NXM I;  1YYK A;  2HKJ A;  4X66 I;  3PYE A;  3H4L A;  4Z7Y A;  2UUB I;  2V34 A;  2J7K A;  4DR4 I;  4DV5 E;  2RTX A;  1HR0 E;  2VQE E;  4USM A;  4YY3 I;  2HK3 A;  2GS8 A;  4I3H A;  4DR2 I;  3ADI A;  4MYT A;  4B3M E;  3ADL A;  4DPT A;  2HKE A;  1IBL I;  4WYQ B;  4LF4 I;  1RC7 A;  1IBL E;  1WUU A;  2LBS B;  2UUA E;  1H72 C;  1KTV A;  3WU5 A;  3J7A M;  1Z5C A;  1T4O A;  1GQE A;  3VYY A;  3ADJ A;  4DV5 I;  1XNR I;  2VQE I;  2L2N A;  2DMY A;  1T4N A;  4LF6 I;  1HNX I;  2UXC E;  3J7A G;  5IWA E;  2LTS A;  3M6A A;  2LTR A;  4LFA E;  4X8W A;  3ADG A;  3ZM7 A;  1ZM9 A;  4DR3 E;  4LFA I;  4AQY I;  2CPN A;  4LF8 E;  4YHH I;  1H73 A;  2UXB I;  4JI1 E;  5IT9 Q;  4JI8 E;  4FWG A;  1NHI A;  4X62 E;  1KIJ A;  1FI4 A;  4JI5 E;  1Z0B A;  4DR5 E;  3D4J A;  3J80 Q;  1IBM E;  4HAC B;  1XMO I;  2X36 A;  3T1Y E;  4OX9 I;  2UUC I;  4GKK I;  1Z0V A;  3B82 A;  5BR8 I;  4K0K E;  3P1X A;  1ZXM A;  3JAM Q;  2VF3 A;  5FLX Q;  5LMU E;  1UEK A;  3GON A;  1HR0 I;  2OI2 A;  2X7I A;  1X47 A;  4B3R E;  2ZIT A;  1NHJ A;  2R3V A;  4WUC A;  2NPF A;  4JI2 I;  1BKN A;  1Z0G A;  4DU7 A;  4M1K A;  4DUZ E;  1N34 E;  1O0W A;  3WU6 A;  1Z0C A;  2R42 A;  1ELO A;  2HK2 A;  4JI3 E;  3QT6 A;  4DPY A;  4OOG C;  5LL6 R;  1N32 I;  2NUF A;  2DEI A;  1HNW E;  4B3M I;  1S4E A;  4EMD A; 
#chains in the Genus database with same CATH topology
 1XNQ I;  2GO3 A;  5C0X F;  3M7N D;  1ZAA C;  2YWQ A;  1EI1 A;  2EMH A;  2LT7 A;  5KL6 A;  2NUE A;  1Z0E A;  1IMU A;  4PRV A;  2JE6 B;  5DNX A;  5L3J A;  1PJS A;  2EMG A;  2O3Z A;  4DV0 I;  2PO1 B;  4DUZ I;  4DV1 E;  2E5L I;  1FJG E;  1HK7 A;  1DGC A;  2PRT A;  3PYF A;  4DV1 I;  4B3S I;  1N0U A;  3BID A;  4DV0 E;  4DXL A;  1X6F A;  2EN2 A;  2RSI A;  2MDR A;  1BB8 A;  4OO1 C;  1PKP A;  1YHC A;  4IFD F;  3J7Y p;  1EA6 A;  3B8H A;  1QU6 A;  2NN6 B;  2FV4 B;  5KL2 A;  5KL4 A;  2L6M A;  1E3H A;  2CSH A;  1IBM I;  4B3S E;  5LMN I;  2RQL A;  2C37 A;  2RSM A;  2LO3 A;  4DUY E;  1A1F A;  4JI7 E;  1RRE A;  1UHZ A;  3RMP A;  1DQ3 A;  1VIS A;  2FTX B;  1N36 E;  1PIE A;  4BC7 A;  4FW9 A;  2L3C A;  5A6K A;  2EOS A;  2JOX A;  3JU0 A;  4WUD A;  2EPN A;  3ZZU A;  4HTG A;  2UXD I;  1LLM C;  4IZJ A;  2WP8 B;  5A6A A;  1ZM3 A;  1A1L A;  4JI8 I;  4DPW A;  2DMI A;  4YHH E;  3VHT B;  4M2Z A;  2ENH A;  2UXB E;  2WBS A;  2CZ9 A;  1TN9 A;  5KL3 A;  3QT7 A;  1TF6 A;  2BR2 B;  4DV7 I;  1Y5Y A;  4Q35 B;  4NXN I;  2KON A;  1J26 A;  2EOM A;  4BBY A;  1Y4U A;  2Z5C B;  2CGE A;  1UIL A;  2JVA A;  4R2E A;  4LF9 I;  4NXN E;  2EMK A;  2LJH A;  3HXL A;  1XMO E;  3L00 A;  4JI6 I;  1USU A;  4Z7C A;  2EMI A;  2E1R A;  4MLV A;  3J80 C;  3CWV A;  5KL7 A;  4LOM A;  5DRR A;  1UDQ A;  2YU5 A;  2PNZ A;  4U3B A;  4AQY E;  3PRY A;  2E1M A;  4DR6 I;  4JI1 I;  4PU9 A;  3P3G A;  1QZR A;  4LCF A;  5ADZ A;  4X64 E;  2VF1 A;  1J5E E;  1EKZ A;  2RS7 A;  3L7Z B;  3PYD A;  2H36 X;  4DPX A;  2VQF I;  1SFE A;  3P3E A;  5K36 E;  4Q28 A;  1X49 A;  3J81 C;  5CFF E;  1BBO A;  2EML A;  1G2F C;  2YTP A;  1YUJ A;  2B7V A;  2PNM A;  4M30 A;  2DRP A;  1UDO A;  1AH5 A;  4WFT A;  2DEJ A;  1A1J A;  1RR9 A;  3K1J A;  2DLQ A;  3HTX A;  2F1D A;  2UUC E;  2NUG A;  3B78 A;  1H74 A;  4BA1 A;  1I94 I;  2YTJ A;  4DU8 A;  1Z5A A;  2EPM X;  1MX0 A;  4UT4 A;  2YRH A;  2EOQ A;  2N3G A;  3BF2 A;  4R2D A;  3VYX A;  2GQ0 A;  1G2D C;  2EP3 A;  1EH8 A;  2V86 A;  2WCC 3;  2EOE A;  4IJD A;  4P7D A;  4B3T E;  4L8N A;  1YZ9 A;  1Z59 A;  2ZBK B;  3F0N A;  4IZJ B;  1HNZ I;  2UUA I;  3EPK A;  4F54 A;  5DRP A;  2EMA A;  4X66 E;  1T38 A;  4ZVI A;  5F3W A;  5T6J A;  1MU5 A;  4JI0 I;  5JEA F;  2F4V E;  1DAR A;  3HPS A;  5C0X A;  3KWR A;  4ZYD A;  5LMN E;  2F4V I;  2M4I A;  4IFD A;  1PJQ A;  4NBQ A;  1A1K A;  4JI7 I;  4DV4 E;  5GME A;  2CTD A;  2EN6 A;  4BA2 A;  4DR2 E;  4ZYH A;  2DB2 A;  2NN6 D;  4DV2 I;  5FLX C;  2HHH I;  2ELZ A;  4LU9 A;  1NHH A;  3THN A;  4KHP E;  3F6G A;  4RPF A;  1L4S A;  2EN1 A;  1KYQ A;  4R2P A;  3K6Q A;  4DPU A;  4O4K A;  2BA0 D;  4F9C B;  4KHP I;  2UXC I;  2UUB E;  3DD6 A;  2A2C A;  4FN5 A;  4RH8 A;  1XNQ E;  3H09 A;  4DR4 E;  4KQV A;  3WU3 A;  4BA2 B;  4P78 A;  4JI4 I;  1FWL A;  4ED4 A;  4LF4 E;  4LF5 E;  3V5R A;  1XNR E;  2MDG A;  2C38 B;  5K36 B;  1GTK A;  2EM0 A;  3T1H E;  2PNL A;  4R2R A;  2FGG A;  1N33 I;  1QNT A;  2EPX A;  4TUI A;  1N32 E;  2A2D A;  4DV2 E;  1NZ0 A;  2AE8 A;  4NZV A;  3C4B A;  2A25 A;  3F6H A;  1FKA E;  2HJJ A;  1OJ4 A;  3PS3 A;  1E3P A;  4ISA A;  1N34 I;  2NN6 E;  1PVG A;  2EPO A;  4DV4 I;  1T4L B;  1WHN A;  3V2U C;  1BBG A;  2ENC A;  4AM3 A;  2WBU A;  4LF7 E;  3P3C A;  4I8O A;  2GO4 A;  4ZYG A;  3K85 A;  2KHX A;  4JYA E;  4URL A;  2CT1 A;  4IFD C;  3MSW A;  2MC5 A;  1PJT A;  4OO1 B;  5IWA I;  1UDN A;  5ELW A;  2BM0 A;  4DV7 E;  2V8P A;  5JEA B;  4MDT A;  4MLQ A;  5JEA D;  2JY9 A;  1T39 A;  2EM7 A;  5JEA C;  4DR5 I;  5AE3 A;  3QT8 A;  1S16 A;  2GLI A;  3AUZ A;  2PO0 A;  4UTG A;  2LE2 A;  1JK1 A;  1A1I A;  4HXZ A;  4JV5 E;  5DRO A;  2EN3 A;  2EMY A;  1AAY A;  2DIX A;  2UXD E;  2MKD A;  4JG4 A;  4P7A A;  4X65 I;  4RHB B;  1XHK A;  2JR1 A;  1TF3 A;  4R8O A;  1WHQ A;  4X65 E;  3EPL A;  1H7U A;  5C0X D;  3NZK A;  2JEB B;  1J5E I;  2N3H A;  1Z0W A;  2J7J A;  2WP8 A;  3M7N G;  2V2Q A;  4LFC I;  2LJP A;  3HUL A;  2EZ6 A;  4DR6 E;  1H7S A;  2PO2 B;  1IBK I;  3Q1Q A;  2DLK A;  2M9A A;  1FNM A;  1Y6Z A;  1D6T A;  2EL6 A;  5K36 A;  4XTJ A;  2C38 A;  2BR2 A;  2YTQ A;  3LTO A;  3PS2 A;  1Z0T A;  5DRQ A;  4BCA A;  4BHC A;  1XMQ I;  2L8T A;  2EFG A;  1B62 A;  2UU9 I;  3LML A;  4AIM A;  3OTO E;  1EH7 A;  2B9D A;  2NN6 C;  1P47 A;  2BM1 A;  2YTF A;  4LF9 E;  1KKH A;  2RS6 A;  1X48 A;  2EPK X;  1A6F A;  5LMU I;  1RMD A;  5C0X B;  4DKK A;  3MHH C;  4GEQ B;  4JI3 I;  4DR7 I;  1YPN A;  4WSP A;  2EPR A;  4AID A;  1MEY C;  4ZYE A;  2EOY A;  3JTZ A;  1Y60 A;  3UHM A;  1N0V C;  3JAM C;  4DR7 E;  4FW4 A;  2L3J A;  2C37 B;  3C4T A;  2JEB A;  2Z5B A;  3J81 Q;  1DI2 A;  2BA1 D;  4DV3 I;  4GKJ E;  2HFU A;  4GZN C;  4FWH A;  1IQS A;  3HPZ A;  4YY3 E;  2EOF A;  3OTO I;  4M0V A;  2AJ4 A;  1ZXN A;  4JI0 E;  1KJK A;  4HY1 A;  4F6M A;  2F8B A;  4DUY I;  3CDJ A;  2DGC A;  1ZBQ A;  5A2Q Q;  4B3R I;  4DR1 I;  1NCS A;  1B63 A;  2PO1 A;  3ZOQ B;  5A2Q C;  2EM2 A;  4USK A;  2EL5 A;  4NHR A;  4DR1 E;  3GLL A;  3UK3 C;  4BMJ A;  4L5N C;  4IZK A;  3P06 A;  5C0X C;  2V89 A;  1IQO A;  1I94 E;  2CG9 A;  5DNL A;  5JEA A;  2E5L E;  3WU4 A;  4HEI A;  4GKJ I;  1ZU1 A;  2LRS A;  3ZZT A;  2EWL A;  1FJG I;  4N4R B;  4FW5 A;  5BR8 E;  4HYM A;  2N8X A;  2ZM6 I;  4LF7 I;  3T1H I;  4PRX A;  2EPU A;  5GMD A;  4DV3 E;  4LFB I;  3QT5 A;  3QG5 C;  2ZM6 E;  2V83 A;  2JPA A;  4OKG A;  4JI4 E;  4LF5 I;  2Q8U A;  2O1U A;  3LNU A;  2EMB A;  2Q2E B;  3ZKB A;  2DSY A;  4JI6 E;  3M85 D;  1HNW I;  2ENA A;  4LFB E;  1HNX E;  2RPC A;  5TSE A;  2YT4 A;  1Z5B A;  3LPS A;  3LLH A;  3EPH A;  2L33 A;  1FWK A;  2HFS A;  3PYG A;  4MU4 A;  4OX9 E;  4OO1 A;  2ODR D;  2V2Z A;  3T1Y I;  2YTN A;  2PNZ B;  2LUP B;  2K7I A;  1YYW A;  2EOO A;  2YRM A;  3K17 A;  4MYU A;  2V8Q B;  2R1F A;  3DF6 A;  5IV8 B;  4LFC E;  1IBK E;  3KZY A;  4JYA I;  1U2R A;  2NA2 A;  5IT9 C;  4P52 A;  1YYO A;  4X62 I;  2LUQ A;  2EPZ A;  1RQ0 A;  5AC5 A;  4HAC A;  3ZKD A;  4X64 I;  4LF8 I;  5LLQ A;  2V2V A;  1N33 E;  2B3T B;  2K4V A;  2EM5 A;  4K0K I;  4FW3 A;  2EPA A;  2YPN A;  4IFD B;  4DV6 E;  2NN6 F;  5AC4 A;  2BV3 A;  2EE8 A;  3M99 B;  2HGH A;  1X3C A;  4DR3 I;  2GHF A;  2J65 A;  5C0X E;  4GKK E;  1N36 I;  4LF6 E;  2D9H A;  3IWD A;  4LTY A;  1MG7 A;  2WW4 A;  5K36 D;  1ZM4 A;  4JI2 E;  2L2M A;  2YTO A;  2EPL X;  4R2S A;  1KVK A;  4DMI A;  5EKW A;  2IHR 1;  2BA0 G;  1ZR9 A;  4IFD E;  3C6M A;  3ZZ0 A;  2V88 A;  3EPJ A;  1USV A;  2NN6 A;  2L2K B;  5A6J A;  2UU9 E;  4R2Q A;  1UDS A;  2O1T A;  2XEX A;  1XMQ E;  4OZE A;  2VQF E;  4BA1 B;  4FK5 C;  4BS9 A;  1YUI A;  4O24 A;  1ZBT A;  1ZM2 A;  4R1F A;  2JWO A;  4WUB A;  4JI5 I;  2HHH E;  2I13 A;  1K47 A;  1STU A;  4NXM E;  1B69 A;  4FWD A;  4DV6 I;  4JV5 I;  5IXM B;  4M9V C;  3Q6N A;  2BA1 G;  2B7T A;  4BHB A;  2EMC A;  1HNZ E;  4B3T I;  4NXM I;  3ECR A;  1YYK A;  3PS1 A;  4QNJ A;  4LCH A;  2HKJ A;  1F2I G;  2EJ4 A;  2EM8 A;  4X66 I;  5KL5 A;  3PYE A;  3Q6M A;  3H4L A;  4Z7Y A;  1P42 A;  3TQM A;  3KRN A;  2YSP A;  5AE1 A;  2WNR A;  2UUB I;  2V34 A;  3GME A;  4OO1 D;  2EMZ A;  2EOH A;  4F9A B;  1GZ6 A;  2YRK A;  2YU8 A;  4WXC A;  4DV5 E;  2J7K A;  4DR4 I;  2R76 A;  3M6A A;  2JP9 A;  4TUG A;  2RTX A;  1HR0 E;  4FW7 A;  2VQE E;  3L7Z A;  4MQY A;  4MU3 A;  4USM A;  4QNK A;  3P76 A;  4YY3 I;  3C6K A;  4F6N A;  3EQ1 A;  4R2C A;  1NEI A;  3MHS C;  5EL9 A;  3HQ1 A;  4BC9 A;  2HK3 A;  2MKN A;  2ADR A;  1RHY A;  2EN4 A;  2GS8 A;  3HKM A;  1WJP A;  4I3H A;  4OO1 F;  4DR2 I;  1OYS A;  2E72 A;  3ADI A;  2I9I A;  4LPF A;  4WPY A;  4MYT A;  4B3M E;  4N3O A;  3FIG A;  2EOR A;  2G7H A;  1WXR A;  3ADL A;  4DPT A;  2HKE A;  1IBL I;  2EM9 A;  4WYQ B;  4LF4 I;  2EPC A;  1RC7 A;  1IBL E;  1JK2 A;  1WUU A;  1A1G A;  2KOU A;  2LBS B;  2IOQ A;  2UUA E;  2C39 A;  1H72 C;  1KTV A;  5A69 A;  3WU5 A;  3J7A M;  2JXP A;  3AV0 A;  4LCG A;  4F2J C;  1Z5C A;  4WX9 A;  2VE7 C;  2YTI A;  3B4T A;  2WBT A;  1T4O A;  2EQ0 A;  1GQE A;  4KZS A;  2VRD A;  3VYY A;  3ADJ A;  1XXE A;  4J3D A;  4DV5 I;  1XNR I;  2Z5E A;  2VQE I;  2EMF A;  4IS1 C;  3BBG A;  2L2N A;  1YFH A;  3H1C A;  4GQU A;  2DMY A;  1T4N A;  4LF6 I;  1HNX I;  2UXC E;  3J7A G;  2JEA A;  3BGH A;  1X6E A;  4MU1 A;  5IWA E;  2EOX A;  2EN8 A;  2LTS A;  2BB8 A;  4KWY A;  2LTR A;  5A6B A;  2Z5B B;  4LFA E;  3GCM A;  3U1Y A;  4X8W A;  3ADG A;  4IS9 A;  5JEA E;  3ZM7 A;  1ZM9 A;  4DR3 E;  2JE6 A;  2YTG A;  4X9J A;  2M1S A;  2CVE A;  1EH6 A;  4LFA I;  1R6L A;  4AQY I;  3DJW A;  3HJC A;  2CPN A;  2EOI A;  4LF8 E;  5AE2 A;  1H73 A;  2L92 A;  4JI1 E;  1VI7 A;  4YHH I;  4JI8 E;  5FWK A;  2UXB I;  5IT9 Q;  2VES A;  1Y4S A;  4FWG A;  1NHI A;  4X62 E;  4IZJ D;  1KIJ A;  1FI4 A;  4R2A A;  4JI5 E;  1Z0B A;  5K36 F;  1MGT A;  4DR5 E;  3D4J A;  3J80 Q;  1YSA C;  2EPP A;  2LJU A;  2EM4 A;  3CDI A;  1IBM E;  2V87 A;  4HAC B;  2WZO A;  2O1W A;  1XMO I;  1UBD C;  2ODR C;  2PO2 A;  2LMZ A;  2X36 A;  3T1Y E;  4OX9 I;  2JEA B;  1X6H A;  2EOJ A;  1OYP A;  2UUC I;  4MU0 A;  4J8Z A;  4GKK I;  3IWB A;  1Z0V A;  4U3D A;  2V85 A;  1Z1B A;  5K36 C;  1OYR A;  5DNY A;  2LCE A;  3B82 A;  2BBG A;  4F9B B;  2JT2 A;  5BR8 I;  2IES A;  3U1K A;  4K0K E;  3P1X A;  2YZT A;  1ZXM A;  4R03 A;  3JAM Q;  2VF3 A;  2C39 B;  5FLX Q;  2EM6 A;  2LVH A;  3IWC A;  3VK6 A;  2PO0 B;  5LMU E;  2EMW A;  2GPI A;  1UEK A;  1X5W A;  2YTE A;  3M85 G;  3GON A;  2EM3 A;  3OML A;  1R6M A;  1PDA A;  1UN6 B;  2IER A;  3THO B;  2OI2 A;  1HR0 I;  1YH8 A;  4OO1 E;  4WXD A;  4WSG A;  2X7I A;  1X47 A;  3KZZ A;  4B3R E;  2ZIT A;  1NHJ A;  2YSO A;  2R3V A;  2LV2 A;  2ELY A;  4O43 A;  2EMX A;  4WUC A;  4IFD D;  2O1V A;  2NPF A;  2EN7 A;  2M7Q A;  2EL4 A;  4JI2 I;  1BKN A;  2NAB A;  1Z0G A;  4DU7 A;  2YTD A;  2Z5C A;  4IZK B;  4M1K A;  4O5G A;  4DUZ E;  2EOZ A;  1N34 E;  1O0W A;  1A1H A;  2WNR B;  1Z0C A;  2IOP A;  5A6B D;  2R42 A;  2JOB A;  1ELO A;  3WU6 A;  2EQ1 A;  2HK2 A;  5AAS A;  2HC5 A;  4JI3 E;  2EQ3 A;  4FW6 A;  1WRJ A;  3QT6 A;  4DPY A;  4OOG C;  5LL6 R;  1N32 I;  2NUF A;  2DEI A;  1HNW E;  2JYA A;  4B3M I;  2MC6 A;  1SR9 A;  1N3G A;  1S4E A;  4EMD A; 
#chains in the Genus database with same CATH homology
 1XNQ I;  1EI1 A;  1Z0E A;  2NUE A;  4PRV A;  5L3J A;  4DV0 I;  4DUZ I;  4DV1 E;  2E5L I;  1FJG E;  1HK7 A;  3PYF A;  4DV1 I;  4B3S I;  1N0U A;  4DV0 E;  4DXL A;  2MDR A;  1PKP A;  3J7Y p;  1EA6 A;  3B8H A;  1QU6 A;  2FV4 B;  2L6M A;  1IBM I;  4B3S E;  5LMN I;  2RSM A;  4DUY E;  4JI7 E;  1RRE A;  1UHZ A;  3RMP A;  1DQ3 A;  1VIS A;  2FTX B;  1N36 E;  1PIE A;  4BC7 A;  4FW9 A;  2L3C A;  2JOX A;  3JU0 A;  4WUD A;  3ZZU A;  2UXD I;  4IZJ A;  1ZM3 A;  4JI8 I;  4DPW A;  4YHH E;  2UXB E;  4M2Z A;  2CZ9 A;  3QT7 A;  4DV7 I;  4NXN I;  2KON A;  1J26 A;  4BBY A;  1Y4U A;  2Z5C B;  2CGE A;  1UIL A;  2JVA A;  4LF9 I;  4NXN E;  2LJH A;  3HXL A;  1XMO E;  4JI6 I;  1USU A;  4Z7C A;  2E1R A;  3CWV A;  3J80 C;  4AQY E;  3PRY A;  2E1M A;  4DR6 I;  4JI1 I;  4PU9 A;  1QZR A;  5ADZ A;  4X64 E;  2VF1 A;  1J5E E;  1EKZ A;  2RS7 A;  3PYD A;  4DPX A;  2H36 X;  2VQF I;  3Q1Q A;  4Q28 A;  1X49 A;  3J81 C;  5CFF E;  2B7V A;  2PNM A;  4M30 A;  2DEJ A;  4WFT A;  1RR9 A;  3K1J A;  3HTX A;  3B78 A;  2UUC E;  2NUG A;  1H74 A;  1I94 I;  4DU8 A;  1Z5A A;  1MX0 A;  4UT4 A;  2N3G A;  2GQ0 A;  3VYX A;  2V86 A;  3F0N A;  1YZ9 A;  4B3T E;  4P7D A;  1Z59 A;  4L8N A;  4IZJ B;  2ZBK B;  1HNZ I;  2UUA I;  4ZVI A;  4F54 A;  4X66 E;  5F3W A;  5T6J A;  1MU5 A;  4JI0 I;  2F4V E;  1DAR A;  3HPS A;  3KWR A;  5LMN E;  2F4V I;  2M4I A;  4JI7 I;  4DV4 E;  5GME A;  4DR2 E;  2DB2 A;  4DV2 I;  5FLX C;  2HHH I;  4LU9 A;  1NHH A;  4KHP E;  3F6G A;  4RPF A;  3K6Q A;  4DPU A;  4F9C B;  4KHP I;  2UXC I;  2UUB E;  4FN5 A;  2A2C A;  4KQV A;  3WU3 A;  1XNQ E;  3H09 A;  4DR4 E;  4P78 A;  4JI4 I;  1FWL A;  4ED4 A;  4LF4 E;  4LF5 E;  3V5R A;  1XNR E;  3T1H E;  2PNL A;  2FGG A;  1N33 I;  4TUI A;  2A2D A;  1N32 E;  4DV2 E;  1NZ0 A;  1FKA E;  3C4B A;  3F6H A;  1N34 I;  1OJ4 A;  1PVG A;  4DV4 I;  1T4L B;  1WHN A;  3V2U C;  4LF7 E;  4I8O A;  3K85 A;  2KHX A;  4JYA E;  4URL A;  3MSW A;  2MC5 A;  5IWA I;  2BM0 A;  4DV7 E;  2V8P A;  2JY9 A;  4DR5 I;  5AE3 A;  3QT8 A;  1S16 A;  3AUZ A;  4UTG A;  2LE2 A;  4HXZ A;  4JV5 E;  2DIX A;  2UXD E;  4JG4 A;  4X65 I;  4P7A A;  1XHK A;  2JR1 A;  4R8O A;  1WHQ A;  4X65 E;  1H7U A;  1J5E I;  2N3H A;  1Z0W A;  2V2Q A;  4LFC I;  2LJP A;  3HUL A;  2EZ6 A;  4DR6 E;  1H7S A;  1IBK I;  1FNM A;  1Y6Z A;  1D6T A;  4XTJ A;  3LTO A;  1Z0T A;  4BCA A;  1XMQ I;  2L8T A;  2EFG A;  1B62 A;  2UU9 I;  3LML A;  3OTO E;  2B9D A;  2BM1 A;  4LF9 E;  1KKH A;  2RS6 A;  1X48 A;  1A6F A;  5LMU I;  4DKK A;  4GEQ B;  4JI3 I;  4DR7 I;  4WSP A;  3JTZ A;  1N0V C;  3JAM C;  4DR7 E;  2L3J A;  3C4T A;  2Z5B A;  3J81 Q;  1DI2 A;  4DV3 I;  4GKJ E;  2HFU A;  4FWH A;  3HPZ A;  4YY3 E;  3OTO I;  4M0V A;  2AJ4 A;  1ZXN A;  4JI0 E;  4HY1 A;  2F8B A;  4DUY I;  1ZBQ A;  5A2Q Q;  4B3R I;  4DR1 I;  1B63 A;  3ZOQ B;  5A2Q C;  4USK A;  4DR1 E;  4BMJ A;  4L5N C;  4IZK A;  3P06 A;  2V89 A;  1I94 E;  2CG9 A;  2E5L E;  3WU4 A;  4GKJ I;  2LRS A;  3ZZT A;  2EWL A;  1FJG I;  4LF7 I;  5BR8 E;  4HYM A;  2ZM6 I;  3T1H I;  4PRX A;  5GMD A;  4DV3 E;  4LFB I;  3QT5 A;  2ZM6 E;  2V83 A;  4JI4 E;  4LF5 I;  2O1U A;  3LNU A;  2Q2E B;  3ZKB A;  2DSY A;  4JI6 E;  1HNW I;  4LFB E;  1HNX E;  2YT4 A;  1Z5B A;  3LPS A;  3LLH A;  1FWK A;  2L33 A;  2HFS A;  3PYG A;  4OX9 E;  3T1Y I;  2ODR D;  2V2Z A;  2LUP B;  1YYW A;  3K17 A;  4MYU A;  2V8Q B;  3DF6 A;  4LFC E;  1IBK E;  4JYA I;  1U2R A;  2NA2 A;  5IT9 C;  4P52 A;  1YYO A;  4X62 I;  2LUQ A;  1RQ0 A;  4HAC A;  3ZKD A;  4X64 I;  4LF8 I;  2V2V A;  1N33 E;  2B3T B;  2K4V A;  4K0K I;  4DV6 E;  2BV3 A;  4DR3 I;  4GKK E;  1N36 I;  4LF6 E;  3IWD A;  4LTY A;  1MG7 A;  2WW4 A;  1ZM4 A;  4JI2 E;  2L2M A;  1KVK A;  4DMI A;  2IHR 1;  3ZZ0 A;  2V88 A;  1USV A;  2L2K B;  2UU9 E;  2XEX A;  2O1T A;  1XMQ E;  2VQF E;  4BS9 A;  1ZBT A;  1ZM2 A;  4R1F A;  2JWO A;  4WUB A;  4JI5 I;  2HHH E;  1K47 A;  1STU A;  4NXM E;  4FWD A;  4DV6 I;  4JV5 I;  3Q6N A;  2B7T A;  1HNZ E;  4B3T I;  4NXM I;  1YYK A;  2HKJ A;  4X66 I;  3PYE A;  3Q6M A;  3H4L A;  4Z7Y A;  5AE1 A;  2UUB I;  2V34 A;  4F9A B;  2J7K A;  1GZ6 A;  4DR4 I;  4DV5 E;  4TUG A;  2RTX A;  1HR0 E;  2VQE E;  4USM A;  4YY3 I;  3HQ1 A;  4BC9 A;  2HK3 A;  2GS8 A;  4I3H A;  4DR2 I;  3ADI A;  4MYT A;  4WPY A;  4B3M E;  4N3O A;  3FIG A;  2G7H A;  1WXR A;  3ADL A;  4DPT A;  2HKE A;  1IBL I;  4WYQ B;  4LF4 I;  1RC7 A;  1IBL E;  1WUU A;  2KOU A;  2LBS B;  2IOQ A;  2UUA E;  1H72 C;  1KTV A;  3WU5 A;  3J7A M;  3AV0 A;  1Z5C A;  2VE7 C;  1T4O A;  4KZS A;  1GQE A;  3VYY A;  3ADJ A;  4DV5 I;  1XNR I;  2Z5E A;  2VQE I;  2L2N A;  2DMY A;  1T4N A;  4LF6 I;  1HNX I;  2UXC E;  3J7A G;  5IWA E;  2LTS A;  3M6A A;  2LTR A;  2Z5B B;  4LFA E;  4X8W A;  3ADG A;  3ZM7 A;  1ZM9 A;  4DR3 E;  2M1S A;  4LFA I;  4AQY I;  3DJW A;  3HJC A;  2CPN A;  4LF8 E;  5AE2 A;  1H73 A;  2L92 A;  4JI1 E;  4YHH I;  2UXB I;  4JI8 E;  5FWK A;  5IT9 Q;  1Y4S A;  4FWG A;  1NHI A;  4X62 E;  4IZJ D;  1KIJ A;  1FI4 A;  4JI5 E;  1Z0B A;  4DR5 E;  3D4J A;  3J80 Q;  1IBM E;  2V87 A;  4HAC B;  2WZO A;  2O1W A;  1XMO I;  2ODR C;  2LMZ A;  2X36 A;  3T1Y E;  4OX9 I;  2UUC I;  4J8Z A;  4GKK I;  3IWB A;  1Z0V A;  2V85 A;  5DNY A;  3B82 A;  4F9B B;  5BR8 I;  4K0K E;  3P1X A;  2YZT A;  1ZXM A;  4R03 A;  3JAM Q;  2VF3 A;  5FLX Q;  3IWC A;  3VK6 A;  5LMU E;  1UEK A;  3GON A;  3OML A;  1HR0 I;  2OI2 A;  2X7I A;  1X47 A;  4B3R E;  2ZIT A;  1NHJ A;  2R3V A;  4WUC A;  2O1V A;  2NPF A;  2M7Q A;  4JI2 I;  1BKN A;  1Z0G A;  4DU7 A;  2Z5C A;  4IZK B;  4M1K A;  4DUZ E;  1N34 E;  1O0W A;  3WU6 A;  1Z0C A;  2IOP A;  2R42 A;  2JOB A;  1ELO A;  2HK2 A;  5AAS A;  4JI3 E;  3QT6 A;  4DPY A;  4OOG C;  5LL6 R;  1N32 I;  2NUF A;  2DEI A;  1HNW E;  4B3M I;  2MC6 A;  1SR9 A;  1S4E A;  4EMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...