1N34E

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n34E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n34E02
1FNMA 4DV2I 1Z0CA 1Z5CA 4DR7E 2VQFE 4JI3E 3HULA 4X66I 3P1XA 1PKPA 3B8HA 4OOGC 4B3TI 5IT9C 4DV4E 4X62I 4B3RE 1MU5A 2X36A 4DU7A 3ADLA 4FWGA 2UUCI 1QU6A 4JI2I 4X8WA 1FI4A 1Z0TA 3V2UC 5LL6R 3H4LA 4KHPI 4DV6I 4DUZI 3OTOE 4LF5E 3Q1QA 4LFCI 4DR3E 4DV7E 1N0UA 1NHJA 2RSMA 4JI7E 4DPTA 1H7SA 1ZM2A 2RTXA 4X65I 4LF9I 4JYAE 4DXLA 1HNZE 4LF6E 3WU4A 2XEXA 1HR0I 2HKEA 1NHIA 4DR1I 4HY1A 4LFBE 4JI5I 4DPWA 5GMDA 2HHHE 2WW4A 3J7AM 3GONA 4R1FA 2IHR1 1XNQE 4DPYA 1STUA 3T1YE 1A6FA 2OI2A 1S16A 2DEJA 1N32E 4NXME 2UUBE 5LMNI 1X48A 3VYYA 3J80Q 4PRVA 4HYMA 4USMA 4DR6E 4X64E 3WU6A 3J7Yp 1QZRA 4Z7YA 5FLXQ 3B82A 2VF3A 1N36I 4P52A 2UU9E 4AQYI 2UXCI 2CZ9A 4ZVIA 2CPNA 4FWHA 1IBKI 4LF7I 2NUFA 2R42A 5LMUE 1EKZA 4B3TE 3C4BA 1Z0EA 3VYXA 4K0KE 2N3GA 1YYOA 2RS6A 1J5EI 4M30A 2B3TB 1EI1A 4OX9I 1ELOA 4XTJA 4DV6E 1N33I 4DUZE 4GKJI 4HACB 1I94E 4LFCE 1ZM4A 4LFAI 3PYDA 2BM1A 1HNXI 2A2DA 1T4NA 4X65E 3QT6A 2L2NA 4LF9E 3B78A 1J26A 1HR0E 1XMOE 2LTSA 2R3VA 3J81C 4JI0I 4JI4E 2VQEI 4JI8E 4JI5E 5IWAI 1OJ4A 3LLHA 2B7VA 2BV3A 4DV0I 1B63A 5LMNE 1T4OA 1DARA 1D6TA 2NUGA 4WUCA 1H74A 3ADGA 2V34A 3ZZTA 1XNRE 5IT9Q 2J7KA 4B3MI 3HTXA 4LF7E 1Z0WA 2L33A 3K1JA 4JV5I 1U2RA 4DV5I 3JAMC 2UXBI 1J5EE 2HK3A 4P7AA 2LJHA 4OX9E 1EA6A 4MYUA 1X49A 2F4VI 5BR8I 1UHZA 1N33E 4YY3I 4UTGA 4FWDA 4GKJE 1WHNA 4NXNI 4LFAE 4B3SE 1XMQI 4JI6I 3PYGA 4WUDA 1HNXE 1K47A 1MX0A 1T4LB 1IBMI 4JG4A 2Q2EB 4GKKI 4DR4I 1ZXMA 2ZM6E 2DEIA 1FJGE 2AJ4A 2N3HA 2X7IA 3ADJA 1KKHA 4DV1I 2VQEE 3ZKDA 4DPXA 4HXZA 5IWAE 1KTVA 4DUYI 2E1RA 2A2CA 4DV2E 4LF4I 3PYFA 1FWLA 2NA2A 3ZZUA 2UUAI 3C4TA 4HACA 2V8PA 4M2ZA 1FWKA 4X66E 2V2QA 1ZBTA 4DR7I 4WUBA 2VQFI 4JI3I 2EFGA 4X62E 2JY9A 1IBLI 2UUCE 1UILA 4JI2E 1NHHA 4WFTA 1YYWA 5A2QC 4DV4I 1DI2A 2UXDI 1FKAE 4KHPE 4JV5E 1ZM9A 2MDRA 4DV5E 4M1KA 1ZXNA 3OTOI 2F4VE 2HFUA 4DPUA 4DR3I 5BR8E 4DV7I 4YY3E 4JI7I 2LTRA 2GS8A 4WYQB 4NXNE 3K17A 3LPSA 3CWVA 1HNZI 1XMQE 4DR1E 2HK2A 3J81Q 2HFSA 4FW9A 4DR4E 2RS7A 4LFBI 1Z5AA 3V5RA 3T1HI 4DV1E 1H72C 1KVKA 1RREA 2UUBI 4DUYE 1O0WA 2DIXA 1S4EA 1N36E 4DV3I 2UUAE 4DR6I 4AQYE 5GMEA 2UXCE 1PVGA 2DB2A 3J7AG 1IBKE 2UU9I 4JI1I 2E5LI 4Z7CA 1ZM3A 2V2VA 5LMUI 1Z0BA 1IBLE 2LJPA 5L3JA 4K0KI 3JAMQ 1GQEA 1VISA 4FN5A 1WUUA 2HKJA 3ADIA 1Z0GA 2UXDE 4LF8I 4URLA 2LUQA 1MG7A 4DU8A 4YHHI 1N0VC 1N34I 1RC7A 4DR2I 1X47A 2V2ZA 2YT4A 2BM0A 3LNUA 1I94I 3WU5A 4PU9A 1BKNA 4JI0E 1HNWI 1XMOI 2DMYA 4DR5I 3ZZ0A 2KHXA 4JI4I 1XHKA 4DV0E 1Z5BA 4JI8I 1H73A 3T1HE 2L2MA 3PYEA 4KQVA 3J80C 1YZ9A 4DV3E 1B62A 2NPFA 2L3JA 3LTOA 5FLXC 2NUEA 4B3ME 2L3CA 1XNRI 4B3RI 1NZ0A 2LBSB 4JI1E 5A2QQ 2E5LE 4PRXA 3M6AA 2UXBE 1Z0VA 2ZBKB 4LF5I 1RQ0A 1KIJA 2LRSA 2B7TA 4LF8E 1RR9A 1WHQA 4YHHE 4USKA 3WU3A 1N34E 1YYKA 2L2KB 4JYAI 4DR2E 4DKKA 3D4JA 3ZKBA 4JI6E 2JVAA 3QT7A 3QT5A 1PIEA 4LF6I 4I3HA 5CFFE 1IBME 4GKKE 4B3SI 4UT4A 2HHHI 1UEKA 4EMDA 2EZ6A 1XNQI 4ED4A 3T1YI 1HNWE 3F0NA 2ZM6I 1Z59A 2LUPB 1FJGI 1N32I 4RPFA 4DR5E 3ZM7A 4NXMI 4MYTA 1H7UA 4LF4E 3QT8A 2ZITA 4X64I
chains in the Genus database with same CATH superfamily
3M99B 1FNMA 4DV2I 4U3DA 1NEIA 2EM6A 4BBYA 1Z0CA 1Z5CA 2VESA 4FK5C 4DR7E 3IWBA 2VQFE 1JK1A 4JI3E 3HULA 4OO1F 4X66I 3L7ZA 4WSPA 2J65A 2PNZA 3P1XA 3HKMA 2JR1A 1PKPA 2EOXA 3EQ1A 4BA1A 3B8HA 2EPZA 4OOGC 4B3TI 2V88A 4FW5A 2YU5A 3Q6NA 2LE2A 4WX9A 4WXDA 3ECRA 2EMZA 4F9BB 3MHSC 4DV4E 5IT9C 3K85A 4X62I 2ENHA 4B3RE 1MU5A 2O3ZA 1F2IG 3ADLA 2G7HA 1QU6A 2X36A 5AC5A 4FWGA 2UUCI 4JI2I 4X8WA 2PNMA 2BA1D 1FI4A 1Z0TA 5EKWA 2EMCA 3V2UC 4IFDA 5LL6R 4R2SA 3H4LA 4KHPI 1IQSA 4DV6I 1TF3A 1RMDA 2EMBA 2FV4B 4J8ZA 4DUZI 3OTOE 2C38B 3THOB 2EM3A 2EMAA 2MC5A 4LF5E 1BBOA 2WP8B 2PO0B 2EOZA 3Q1QA 5F3WA 2EPOA 4LFCI 3RMPA 4DR3E 4DV7E 3HPZA 1NHJA 1N0UA 2RSMA 4JI7E 4DPTA 2VRDA 1H7SA 1ZM2A 2RTXA 3P06A 4X65I 4LF9I 1X5WA 3AUZA 4JYAE 4IZKA 4BHCA 4DXLA 1HNZE 5KL2A 4LF6E 3WU4A 2XEXA 1HR0I 5K36C 1RHYA 4GQUA 2HKEA 2O1VA 2YRMA 5AE3A 1NHIA 5C0XB 4DR1I 4ZYEA 2JE6B 5A6AA 4LFBE 4HY1A 4JI5I 1X6HA 5GMDA 2HHHE 4DPWA 2WW4A 4N3OA 3GONA 2JOXA 4R1FA 3J7AM 4IFDE 1UBDC 2IHR1 2YRHA 1XNQE 1STUA 3T1YE 1A6FA 2JEBB 2OI2A 1S16A 2EM0A 4DPYA 2DEJA 4LCFA 4P78A 1N32E 4BC7A 2EM9A 4NXME 2JWOA 2UUBE 2GLIA 5ELWA 5LMNI 2L8TA 4GZNC 1X48A 2EPXA 3VYYA 4PRVA 3J80Q 5K36D 2NN6F 4HYMA 1EH6A 4X64E 4DR6E 3WU6A 4USMA 2EMGA 4DU7A 2KONA 3L00A 3VK6A 3J7Yp 4LPFA 1QZRA 4Z7YA 5FLXQ 3B82A 1HK7A 2VF3A 4P52A 1N36I 2O1WA 2UU9E 1L4SA 3KWRA 1P47A 2V83A 4AQYI 2UXCI 2CZ9A 4R2QA 4TUIA 5FWKA 4ZVIA 2CPNA 5A6KA 1YHCA 4FWHA 1IBKI 4LF7I 1KYQA 5AC4A 2EL4A 5A69A 2NUFA 2R42A 4R8OA 5LMUE 1EH8A 1EKZA 2Z5BA 4B3TE 3C4BA 1Z0EA 4OO1B 3P3GA 3VYXA 4K0KE 2JYAA 2N3GA 2GO4A 2O1TA 3F6HA 4R2AA 4NBQA 1YUJA 2BA1G 2N8XA 2Z5CB 1YYOA 4AIDA 2WZOA 2RS6A 1UDNA 4QNJA 1J5EI 2JEAB 4R2DA 4M30A 2B3TB 2EQ3A 2V86A 1EI1A 3IWCA 4OX9I 2EL6A 1ELOA 5JEAE 4XTJA 2YTQA 4IS1C 2LV2A 4DV6E 1N33I 4DUZE 1MGTA 4F9CB 4LCHA 1IMUA 2CGEA 4GKJI 2C37B 4HACB 4WSGA 2HJJA 1I94E 4LFCE 1ZM4A 4IZJB 5DROA 2EOMA 4LFAI 1PJQA 2R1FA 2IOQA 3PYDA 3H1CA 2BM1A 3BBGA 1HNXI 2A2DA 2EPCA 1T4NA 4X65E 3QT6A 2L2NA 4LF9E 2V8QB 3B78A 5A6JA 2Q8UA 2EOOA 1J26A 5EL9A 1HR0E 1XMOE 2LTSA 2R3VA 2EM5A 3J81C 3P3CA 4JI0I 1EH7A 4BCAA 5C0XC 4JI4E 2VQEI 3OMLA 2EOIA 4IFDF 4JI8E 4JI5E 1XXEA 3VHTB 4X9JA 4OZEA 5IWAI 2FGGA 2GQ0A 1OJ4A 3LLHA 1UDOA 2NN6E 3CDJA 4MU1A 2R76A 1AH5A 2EMWA 1A1JA 2B7VA 2BV3A 3K6QA 4DV0I 1B63A 5LMNE 1T4OA 1DARA 1D6TA 2NUGA 4WUCA 2YU8A 3LMLA 4F6MA 1BBGA 5K36B 4WXCA 1H74A 5C0XD 2EMKA 3ADGA 2V34A 3ZZTA 1LLMC 4F54A 1XNRE 2RQLA 4ZYGA 1TN9A 5C0XA 5IT9Q 2J7KA 2AE8A 2F1DA 4B3MI 2JE6A 3HTXA 4LF7E 3HQ1A 1USVA 2EOYA 2GHFA 3FIGA 2Z5EA 3THNA 2L33A 3BF2A 5KL6A 1Y4UA 2YTDA 1Z0WA 3K1JA 4OO1C 2EOSA 2EPPA 4O5GA 2LVHA 2JEBA 4JV5I 4AIMA 2PO1B 1U2RA 4DV5I 3JAMC 2EM2A 4I8OA 2UXBI 1J5EE 2J7JA 2HK3A 2YSOA 1SR9A 4P7AA 2LJHA 5JEAB 4MDTA 4OX9E 4NHRA 1EA6A 4MYUA 1X49A 4R2CA 2F4VI 3HPSA 1Y5YA 3DD6A 4QNKA 2JEAA 4BHBA 5BR8I 1UHZA 2V87A 1N33E 3C6KA 3MHHC 4UTGA 4FWDA 4YY3I 4GKJE 2RSIA 1QNTA 1WHNA 3H09A 4NXNI 1TF6A 2O1UA 2M1SA 4LFAE 4R03A 4B3SE 4OO1D 1XMQI 4JI6I 3PYGA 1X6FA 2LMZA 5C0XE 2V85A 2YTPA 4WUDA 1HNXE 2LJUA 4LCGA 1K47A 1MX0A 1T4LB 4ISAA 1IBMI 4MLQA 4JG4A 2Q2EB 4GKKI 2D9HA 4TUGA 4DR4I 1ZXMA 2ZM6E 2DEIA 3L7ZB 4BS9A 3M7ND 1FJGE 1PJTA 2AJ4A 2N3HA 2Z5CA 5KL7A 2X7IA 2JP9A 3ADJA 1OYPA 1Z1BA 1KKHA 4DV1I 3TQMA 2VQEE 3ZKDA 4DPXA 3QG5C 4HXZA 5IWAE 1KTVA 4DUYI 2E1RA 3UK3C 2A2CA 1DQ3A 4HTGA 4HEIA 4DV2E 1AAYA 4IZJD 3PYFA 2KOUA 4LF4I 5K36A 2NA2A 2EMLA 1FWLA 2C37A 3ZZUA 2UUAI 3C4TA 4HACA 2V8PA 2CG9A 4M2ZA 4IZJA 1FWKA 4X66E 2PNLA 4M9VC 2V2QA 4BMJA 1ZAAC 2F8BA 2ELZA 1ZBTA 4DR7I 1MEYC 4WUBA 2VQFI 4JI3I 2JT2A 3GMEA 2DLQA 3HJCA 1G2DC 2EN4A 1N3GA 2EFGA 4X62E 2WNRB 2JY9A 2L6MA 2YRKA 1UILA 2UUCE 4JI2E 1NHHA 3P76A 5DNXA 1IBLI 3CDIA 4WFTA 2VF1A 1A1IA 4L5NC 4Q35B 3JU0A 3UHMA 1ZBQA 2RPCA 1YYWA 5A2QC 4DV4I 2YPNA 4RHBB 1DI2A 5ADZA 4U3BA 4O43A 2UXDI 1FKAE 4KHPE 5LLQA 4JV5E 1WXRA 2EMHA 2DLKA 2DRPA 1ZM9A 2MDRA 4DV5E 2YTIA 5IXMB 4J3DA 1Y60A 5K36E 4M1KA 2HC5A 2WBTA 5A6BD 1A1FA 4GEQB 2M9AA 1UDSA 1ZXNA 2CVEA 2MKDA 1OYSA 2GPIA 3JTZA 3OTOI 4O24A 1A1LA 5A6BA 1DGCA 5JEAC 4N4RB 3GCMA 2F4VE 1YPNA 2HFUA 4RH8A 2EOEA 2ADRA 1OYRA 4DPUA 4DR3I 5BR8E 2YTOA 4DV7I 4YY3E 4MU4A 4JI7I 2LTRA 2GS8A 4ZYHA 1ZR9A 4WYQB 4NXNE 3AV0A 2EQ0A 3K17A 2EPLX 3LPSA 2I13A 3CWVA 5C0XF 1HNZI 2EE8A 1XMQE 2EOHA 2HGHA 2IERA 4DR1E 2HK2A 3J81Q 2HFSA 2EPNA 4FW9A 3M7NG 2DGCA 2FTXB 2GO3A 3PS2A 4DR4E 2C38A 2PO1A 2RS7A 2C39B 4LFBI 2PO0A 3DF6A 4KWYA 1Z5AA 2WP8A 3V5RA 2PO2B 5JEAD 3T1HI 2Z5BB 1IQOA 1YH8A 2YWQA 2EPRA 4R2PA 4DV1E 1G2FC 4NZVA 2LT7A 1H72C 4F6NA 1KVKA 2CT1A 2IESA 5JEAA 2BBGA 1RREA 4OKGA 3M85D 2UUBI 4DUYE 2BR2B 4R2RA 1O0WA 2EN7A 4BA2B 2DIXA 2BB8A 2E1MA 1N36E 1S4EA 4DV3I 3PS1A 2EORA 5KL5A 2UUAE 4IFDC 2NN6B 4DR6I 4AQYE 5GMEA 2UXCE 2YTGA 5DRPA 2EOQA 2EMXA 2DB2A 1PVGA 2V89A 2I9IA 1A1HA 3J7AG 1IBKE 3F6GA 2UU9I 1T39A 3PRYA 2EP3A 1BB8A 1USUA 2WCC3 2EMYA 2ENAA 4JI1I 2YTFA 2YTNA 2M4IA 2WBSA 2PRTA 1R6MA 4Z7CA 2E5LI 1ZM3A 2MDGA 2V2VA 5LMUI 1A1GA 1Z0BA 3PS3A 3MSWA 4LU9A 1IBLE 2LJPA 5L3JA 3U1KA 4K0KI 3JAMQ 5DRRA 4AM3A 1GQEA 1VISA 4Q28A 3DJWA 1WUUA 4FN5A 2EL5A 2JOBA 4BC9A 3ADIA 2HKJA 4LTYA 1Z0GA 2EPKX 2LO3A 2UXDE 4F9AB 4LF8I 4URLA 2LUQA 1MG7A 1WJPA 5K36F 4DU8A 4YHHI 5AE2A 2EQ1A 1N0VC 5IV8B 4L8NA 2YZTA 1N34I 1RC7A 4DR2I 4FW7A 1X47A 1Y4SA 2V2ZA 2YT4A 2WBUA 1NCSA 4FW4A 2BM0A 3LNUA 4OO1A 1I94I 1KJKA 1ZU1A 1VI7A 2EOJA 1GZ6A 4DMIA 4WPYA 2LCEA 3WU5A 3BGHA 2EN3A 2L92A 3B4TA 2PNZB 2ODRC 4PU9A 2WNRA 2YTJA 4BA1B 1PDAA 3EPJA 1BKNA 4LOMA 4JI0E 1HNWI 4F2JC 2B9DA 3NZKA 3HXLA 2IOPA 1XMOI 2DMYA 2VE7C 4DR5I 1R6LA 2K7IA 3ZZ0A 1X6EA 2ELYA 2KHXA 4IS9A 1SFEA 2YSPA 1XHKA 4JI4I 4R2EA 2DSYA 4DV0E 1Z5BA 4IFDB 4JI8I 2EWLA 2EM4A 1H73A 3T1HE 2L2MA 2EN1A 4P7DA 3EPHA 4FW3A 2BA0D 3M85G 4MU3A 3PYEA 4KQVA 3ZOQB 4FW6A 4IFDD 2ODRD 1GTKA 3J80C 2MC6A 4OO1E 3IWDA 1YZ9A 4DV3E 1B62A 1JK2A 2NPFA 4MU0A 2L3JA 4O4KA 4ZYDA 5FLXC 3LTOA 5DNLA 2NN6C 5AE1A 2JPAA 2MKNA 4IZKB 4IJDA 2NUEA 4B3ME 2CTDA 2L3CA 3KZZA 1XNRI 4B3RI 2EPAA 3Q6MA 1NZ0A 2K4VA 2LBSB 4JI1E 5A2QQ 1YUIA 2C39A 2E5LE 1T38A 2EN8A 1A1KA 2PO2A 5DNYA 2EM8A 4PRXA 5DRQA 4KZSA 3M6AA 2UXBE 1Z0VA 2M7QA 3EPKA 3BIDA 5JEAF 2DMIA 2ZBKB 4LF5I 1RQ0A 2E72A 1KIJA 2LRSA 2B7TA 2BR2A 3P3EA 1E3HA 2NN6D 4LF8E 1RR9A 5KL4A 2EN6A 4BA2A 1WHQA 2A25A 2EOFA 4YHHE 4USKA 2EMFA 2NN6A 3WU3A 1UDQA 1N34E 1E3PA 1YYKA 3GLLA 2L2KB 4JYAI 2H36X 4DR2E 4DKKA 3D4JA 3ZKBA 2EM7A 3KZYA 2JVAA 4JI6E 3QT5A 1PIEA 3QT7A 1YSAC 1PJSA 4I3HA 1Y6ZA 4LF6I 4M0VA 5CFFE 1IBME 4GKKE 4B3SI 4UT4A 3EPLA 2EJ4A 1P42A 1UN6B 3KRNA 5TSEA 2HHHI 2EPMX 1UEKA 4MQYA 4EMDA 2JXPA 2EZ6A 1XNQI 2EMIA 4ED4A 3T1YI 1B69A 1HNWE 2YTEA 3F0NA 2ZM6I 1X3CA 2NABA 1Z59A 2LUPB 1FJGI 1N32I 4RPFA 2EN2A 2EPUA 2CSHA 5T6JA 4DR5E 3ZM7A 4NXMI 4MYTA 1WRJA 1YFHA 3C6MA 1H7UA 4LF4E 2BA0G 4MLVA 2ENCA 3U1YA 3QT8A 5AASA 2ZITA 4X64I 5KL3A
chains in the Genus database with same CATH topology
1FNMA 4DV2I 4BBYA 1Z0CA 1Z5CA 4DR7E 3IWBA 2VQFE 4JI3E 3HULA 4X66I 4WSPA 3P1XA 2JR1A 1PKPA 3B8HA 4OOGC 4B3TI 2V88A 3Q6NA 2LE2A 5IT9C 4F9BB 4DV4E 3K85A 4X62I 4B3RE 1MU5A 2X36A 4DU7A 3ADLA 4FWGA 2G7HA 1QU6A 2UUCI 4JI2I 4X8WA 2PNMA 1FI4A 1Z0TA 3V2UC 5LL6R 3H4LA 4KHPI 4DV6I 4DUZI 2FV4B 4J8ZA 3OTOE 2MC5A 4LF5E 3Q1QA 5F3WA 4LFCI 3RMPA 4DR3E 4DV7E 3HPZA 1NHJA 1N0UA 2RSMA 4JI7E 4DPTA 1H7SA 1ZM2A 2RTXA 3P06A 4X65I 4LF9I 4JYAE 3AUZA 4IZKA 4DXLA 1HNZE 4LF6E 3WU4A 2XEXA 1HR0I 2HKEA 2O1VA 5AE3A 1NHIA 4DR1I 4HY1A 4LFBE 4JI5I 4DPWA 5GMDA 2HHHE 2WW4A 4N3OA 3GONA 2JOXA 4R1FA 3J7AM 2IHR1 1XNQE 4DPYA 1STUA 3T1YE 1A6FA 2OI2A 1S16A 2DEJA 4P78A 1N32E 4BC7A 4NXME 2JWOA 2UUBE 5LMNI 2L8TA 1X48A 3VYYA 3J80Q 4PRVA 4HYMA 4USMA 4DR6E 4X64E 3WU6A 2KONA 3VK6A 3J7Yp 1QZRA 4Z7YA 5FLXQ 3B82A 1HK7A 2VF3A 4P52A 1N36I 2O1WA 2UU9E 3KWRA 2V83A 4AQYI 2UXCI 2CZ9A 4TUIA 5FWKA 4ZVIA 2CPNA 4FWHA 1IBKI 4LF7I 2NUFA 2R42A 4R8OA 5LMUE 1EKZA 2Z5BA 4B3TE 3C4BA 1Z0EA 3VYXA 4K0KE 2N3GA 2O1TA 3F6HA 2Z5CB 1YYOA 2WZOA 2RS6A 1J5EI 4M30A 2B3TB 2V86A 1EI1A 3IWCA 4OX9I 1ELOA 4XTJA 4DV6E 1N33I 4DUZE 4F9CB 2CGEA 4GKJI 4HACB 1I94E 4LFCE 1ZM4A 4IZJB 4LFAI 2IOQA 3PYDA 2BM1A 1HNXI 2A2DA 1T4NA 4X65E 3QT6A 2L2NA 4LF9E 2V8QB 3B78A 1J26A 1HR0E 1XMOE 2LTSA 2R3VA 3J81C 4JI0I 4BCAA 4JI4E 2VQEI 3OMLA 4JI8E 4JI5E 5IWAI 2FGGA 2GQ0A 1OJ4A 3LLHA 2B7VA 2BV3A 3K6QA 4DV0I 1B63A 5LMNE 1T4OA 1DARA 1D6TA 2NUGA 4WUCA 3LMLA 1H74A 3ADGA 2V34A 3ZZTA 4F54A 1XNRE 5IT9Q 2J7KA 4B3MI 3HTXA 4LF7E 3HQ1A 1USVA 2Z5EA 3FIGA 1Z0WA 2L33A 1Y4UA 3K1JA 4JV5I 1U2RA 4DV5I 3JAMC 4I8OA 2UXBI 1J5EE 2HK3A 1SR9A 4P7AA 2LJHA 4OX9E 1EA6A 4MYUA 1X49A 2F4VI 3HPSA 5BR8I 1UHZA 2V87A 1N33E 4UTGA 4YY3I 4FWDA 4GKJE 1WHNA 3H09A 4NXNI 2O1UA 2M1SA 4LFAE 4R03A 4B3SE 1XMQI 4JI6I 3PYGA 2LMZA 2V85A 4WUDA 1HNXE 1K47A 1MX0A 1T4LB 1IBMI 4JG4A 2Q2EB 4GKKI 4TUGA 4DR4I 1ZXMA 2ZM6E 2DEIA 4BS9A 1FJGE 2AJ4A 2N3HA 2Z5CA 2X7IA 3ADJA 1KKHA 4DV1I 2VQEE 3ZKDA 4DPXA 4HXZA 5IWAE 1KTVA 4DUYI 2E1RA 2A2CA 1DQ3A 4DV2E 4IZJD 4LF4I 3PYFA 2KOUA 1FWLA 2NA2A 3ZZUA 2UUAI 3C4TA 4HACA 2V8PA 2CG9A 4M2ZA 4IZJA 1FWKA 4X66E 2PNLA 2V2QA 4BMJA 2F8BA 1ZBTA 4DR7I 4WUBA 2VQFI 4JI3I 3HJCA 2EFGA 4X62E 2JY9A 2L6MA 2UUCE 1UILA 4JI2E 1NHHA 1IBLI 4WFTA 2VF1A 4L5NC 3JU0A 1ZBQA 1YYWA 5A2QC 4DV4I 1DI2A 5ADZA 2UXDI 1FKAE 4KHPE 4JV5E 1WXRA 1ZM9A 2MDRA 4DV5E 4M1KA 4GEQB 1ZXNA 3OTOI 3JTZA 2F4VE 2HFUA 4DPUA 4DR3I 5BR8E 4DV7I 4YY3E 4JI7I 2LTRA 2GS8A 4WYQB 4NXNE 3AV0A 3K17A 3LPSA 3CWVA 1HNZI 1XMQE 4DR1E 2HK2A 3J81Q 2HFSA 4FW9A 2FTXB 4DR4E 2RS7A 4LFBI 3DF6A 1Z5AA 3V5RA 3T1HI 2Z5BB 4DV1E 1H72C 1KVKA 1RREA 2UUBI 4DUYE 1O0WA 2DIXA 1S4EA 2E1MA 1N36E 4DV3I 2UUAE 4DR6I 4AQYE 5GMEA 2UXCE 1PVGA 2DB2A 2V89A 3J7AG 1IBKE 3F6GA 2UU9I 3PRYA 1USUA 4JI1I 2M4IA 2E5LI 4Z7CA 1ZM3A 2V2VA 5LMUI 1Z0BA 3MSWA 4LU9A 1IBLE 2LJPA 5L3JA 4K0KI 3JAMQ 1GQEA 1VISA 4Q28A 3DJWA 1WUUA 4FN5A 2JOBA 4BC9A 3ADIA 2HKJA 4LTYA 1Z0GA 2UXDE 4F9AB 4LF8I 4URLA 2LUQA 1MG7A 4DU8A 4YHHI 5AE2A 1N0VC 4L8NA 2YZTA 1N34I 1RC7A 4DR2I 1X47A 1Y4SA 2V2ZA 2YT4A 2BM0A 3LNUA 1I94I 1GZ6A 4DMIA 4WPYA 3WU5A 2L92A 2ODRC 4PU9A 1BKNA 4JI0E 1HNWI 2B9DA 3HXLA 2IOPA 1XMOI 2DMYA 2VE7C 4DR5I 3ZZ0A 2KHXA 4JI4I 1XHKA 2DSYA 4DV0E 1Z5BA 4JI8I 2EWLA 1H73A 3T1HE 2L2MA 4P7DA 3PYEA 4KQVA 3ZOQB 2ODRD 3J80C 2MC6A 3IWDA 1YZ9A 4DV3E 1B62A 2NPFA 2L3JA 5FLXC 3LTOA 5AE1A 4IZKB 2NUEA 4B3ME 2L3CA 1XNRI 4B3RI 3Q6MA 1NZ0A 2K4VA 2LBSB 4JI1E 5A2QQ 2E5LE 5DNYA 4PRXA 4KZSA 3M6AA 2UXBE 1Z0VA 2M7QA 2ZBKB 4LF5I 1RQ0A 1KIJA 2LRSA 2B7TA 4LF8E 1RR9A 1WHQA 4YHHE 4USKA 3WU3A 1N34E 1YYKA 2L2KB 4JYAI 2H36X 4DR2E 4DKKA 3D4JA 3ZKBA 4JI6E 2JVAA 3QT7A 3QT5A 1PIEA 4LF6I 4I3HA 1Y6ZA 4M0VA 5CFFE 1IBME 4GKKE 4B3SI 4UT4A 2HHHI 1UEKA 4EMDA 2EZ6A 1XNQI 4ED4A 3T1YI 1HNWE 3F0NA 2ZM6I 1Z59A 2LUPB 1FJGI 1N32I 4RPFA 4DR5E 3ZM7A 5T6JA 4NXMI 4MYTA 1H7UA 4LF4E 3QT8A 5AASA 2ZITA 4X64I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNM A;  4DV2 I;  1Z0C A;  1Z5C A;  4DR7 E;  2VQF E;  4JI3 E;  3HUL A;  4X66 I;  3P1X A;  1PKP A;  3B8H A;  4OOG C;  4B3T I;  5IT9 C;  4DV4 E;  4X62 I;  4B3R E;  1MU5 A;  2X36 A;  4DU7 A;  3ADL A;  4FWG A;  2UUC I;  1QU6 A;  4JI2 I;  4X8W A;  1FI4 A;  1Z0T A;  3V2U C;  5LL6 R;  3H4L A;  4KHP I;  4DV6 I;  4DUZ I;  3OTO E;  4LF5 E;  3Q1Q A;  4LFC I;  4DR3 E;  4DV7 E;  1N0U A;  1NHJ A;  2RSM A;  4JI7 E;  4DPT A;  1H7S A;  1ZM2 A;  2RTX A;  4X65 I;  4LF9 I;  4JYA E;  4DXL A;  1HNZ E;  4LF6 E;  3WU4 A;  2XEX A;  1HR0 I;  2HKE A;  1NHI A;  4DR1 I;  4HY1 A;  4LFB E;  4JI5 I;  4DPW A;  5GMD A;  2HHH E;  2WW4 A;  3J7A M;  3GON A;  4R1F A;  2IHR 1;  1XNQ E;  4DPY A;  1STU A;  3T1Y E;  1A6F A;  2OI2 A;  1S16 A;  2DEJ A;  1N32 E;  4NXM E;  2UUB E;  5LMN I;  1X48 A;  3VYY A;  3J80 Q;  4PRV A;  4HYM A;  4USM A;  4DR6 E;  4X64 E;  3WU6 A;  3J7Y p;  1QZR A;  4Z7Y A;  5FLX Q;  3B82 A;  2VF3 A;  1N36 I;  4P52 A;  2UU9 E;  4AQY I;  2UXC I;  2CZ9 A;  4ZVI A;  2CPN A;  4FWH A;  1IBK I;  4LF7 I;  2NUF A;  2R42 A;  5LMU E;  1EKZ A;  4B3T E;  3C4B A;  1Z0E A;  3VYX A;  4K0K E;  2N3G A;  1YYO A;  2RS6 A;  1J5E I;  4M30 A;  2B3T B;  1EI1 A;  4OX9 I;  1ELO A;  4XTJ A;  4DV6 E;  1N33 I;  4DUZ E;  4GKJ I;  4HAC B;  1I94 E;  4LFC E;  1ZM4 A;  4LFA I;  3PYD A;  2BM1 A;  1HNX I;  2A2D A;  1T4N A;  4X65 E;  3QT6 A;  2L2N A;  4LF9 E;  3B78 A;  1J26 A;  1HR0 E;  1XMO E;  2LTS A;  2R3V A;  3J81 C;  4JI0 I;  4JI4 E;  2VQE I;  4JI8 E;  4JI5 E;  5IWA I;  1OJ4 A;  3LLH A;  2B7V A;  2BV3 A;  4DV0 I;  1B63 A;  5LMN E;  1T4O A;  1DAR A;  1D6T A;  2NUG A;  4WUC A;  1H74 A;  3ADG A;  2V34 A;  3ZZT A;  1XNR E;  5IT9 Q;  2J7K A;  4B3M I;  3HTX A;  4LF7 E;  1Z0W A;  2L33 A;  3K1J A;  4JV5 I;  1U2R A;  4DV5 I;  3JAM C;  2UXB I;  1J5E E;  2HK3 A;  4P7A A;  2LJH A;  4OX9 E;  1EA6 A;  4MYU A;  1X49 A;  2F4V I;  5BR8 I;  1UHZ A;  1N33 E;  4YY3 I;  4UTG A;  4FWD A;  4GKJ E;  1WHN A;  4NXN I;  4LFA E;  4B3S E;  1XMQ I;  4JI6 I;  3PYG A;  4WUD A;  1HNX E;  1K47 A;  1MX0 A;  1T4L B;  1IBM I;  4JG4 A;  2Q2E B;  4GKK I;  4DR4 I;  1ZXM A;  2ZM6 E;  2DEI A;  1FJG E;  2AJ4 A;  2N3H A;  2X7I A;  3ADJ A;  1KKH A;  4DV1 I;  2VQE E;  3ZKD A;  4DPX A;  4HXZ A;  5IWA E;  1KTV A;  4DUY I;  2E1R A;  2A2C A;  4DV2 E;  4LF4 I;  3PYF A;  1FWL A;  2NA2 A;  3ZZU A;  2UUA I;  3C4T A;  4HAC A;  2V8P A;  4M2Z A;  1FWK A;  4X66 E;  2V2Q A;  1ZBT A;  4DR7 I;  4WUB A;  2VQF I;  4JI3 I;  2EFG A;  4X62 E;  2JY9 A;  1IBL I;  2UUC E;  1UIL A;  4JI2 E;  1NHH A;  4WFT A;  1YYW A;  5A2Q C;  4DV4 I;  1DI2 A;  2UXD I;  1FKA E;  4KHP E;  4JV5 E;  1ZM9 A;  2MDR A;  4DV5 E;  4M1K A;  1ZXN A;  3OTO I;  2F4V E;  2HFU A;  4DPU A;  4DR3 I;  5BR8 E;  4DV7 I;  4YY3 E;  4JI7 I;  2LTR A;  2GS8 A;  4WYQ B;  4NXN E;  3K17 A;  3LPS A;  3CWV A;  1HNZ I;  1XMQ E;  4DR1 E;  2HK2 A;  3J81 Q;  2HFS A;  4FW9 A;  4DR4 E;  2RS7 A;  4LFB I;  1Z5A A;  3V5R A;  3T1H I;  4DV1 E;  1H72 C;  1KVK A;  1RRE A;  2UUB I;  4DUY E;  1O0W A;  2DIX A;  1S4E A;  1N36 E;  4DV3 I;  2UUA E;  4DR6 I;  4AQY E;  5GME A;  2UXC E;  1PVG A;  2DB2 A;  3J7A G;  1IBK E;  2UU9 I;  4JI1 I;  2E5L I;  4Z7C A;  1ZM3 A;  2V2V A;  5LMU I;  1Z0B A;  1IBL E;  2LJP A;  5L3J A;  4K0K I;  3JAM Q;  1GQE A;  1VIS A;  4FN5 A;  1WUU A;  2HKJ A;  3ADI A;  1Z0G A;  2UXD E;  4LF8 I;  4URL A;  2LUQ A;  1MG7 A;  4DU8 A;  4YHH I;  1N0V C;  1N34 I;  1RC7 A;  4DR2 I;  1X47 A;  2V2Z A;  2YT4 A;  2BM0 A;  3LNU A;  1I94 I;  3WU5 A;  4PU9 A;  1BKN A;  4JI0 E;  1HNW I;  1XMO I;  2DMY A;  4DR5 I;  3ZZ0 A;  2KHX A;  4JI4 I;  1XHK A;  4DV0 E;  1Z5B A;  4JI8 I;  1H73 A;  3T1H E;  2L2M A;  3PYE A;  4KQV A;  3J80 C;  1YZ9 A;  4DV3 E;  1B62 A;  2NPF A;  2L3J A;  3LTO A;  5FLX C;  2NUE A;  4B3M E;  2L3C A;  1XNR I;  4B3R I;  1NZ0 A;  2LBS B;  4JI1 E;  5A2Q Q;  2E5L E;  4PRX A;  3M6A A;  2UXB E;  1Z0V A;  2ZBK B;  4LF5 I;  1RQ0 A;  1KIJ A;  2LRS A;  2B7T A;  4LF8 E;  1RR9 A;  1WHQ A;  4YHH E;  4USK A;  3WU3 A;  1N34 E;  1YYK A;  2L2K B;  4JYA I;  4DR2 E;  4DKK A;  3D4J A;  3ZKB A;  4JI6 E;  2JVA A;  3QT7 A;  3QT5 A;  1PIE A;  4LF6 I;  4I3H A;  5CFF E;  1IBM E;  4GKK E;  4B3S I;  4UT4 A;  2HHH I;  1UEK A;  4EMD A;  2EZ6 A;  1XNQ I;  4ED4 A;  3T1Y I;  1HNW E;  3F0N A;  2ZM6 I;  1Z59 A;  2LUP B;  1FJG I;  1N32 I;  4RPF A;  4DR5 E;  3ZM7 A;  4NXM I;  4MYT A;  1H7U A;  4LF4 E;  3QT8 A;  2ZIT A;  4X64 I; 
#chains in the Genus database with same CATH topology
 3M99 B;  1FNM A;  4DV2 I;  4U3D A;  1NEI A;  2EM6 A;  4BBY A;  1Z0C A;  1Z5C A;  2VES A;  4FK5 C;  4DR7 E;  3IWB A;  2VQF E;  1JK1 A;  4JI3 E;  3HUL A;  4OO1 F;  4X66 I;  3L7Z A;  4WSP A;  2J65 A;  2PNZ A;  3P1X A;  3HKM A;  2JR1 A;  1PKP A;  2EOX A;  3EQ1 A;  4BA1 A;  3B8H A;  2EPZ A;  4OOG C;  4B3T I;  2V88 A;  4FW5 A;  2YU5 A;  3Q6N A;  2LE2 A;  4WX9 A;  4WXD A;  3ECR A;  2EMZ A;  4F9B B;  3MHS C;  4DV4 E;  5IT9 C;  3K85 A;  4X62 I;  2ENH A;  4B3R E;  1MU5 A;  2O3Z A;  1F2I G;  3ADL A;  2G7H A;  1QU6 A;  2X36 A;  5AC5 A;  4FWG A;  2UUC I;  4JI2 I;  4X8W A;  2PNM A;  2BA1 D;  1FI4 A;  1Z0T A;  5EKW A;  2EMC A;  3V2U C;  4IFD A;  5LL6 R;  4R2S A;  3H4L A;  4KHP I;  1IQS A;  4DV6 I;  1TF3 A;  1RMD A;  2EMB A;  2FV4 B;  4J8Z A;  4DUZ I;  3OTO E;  2C38 B;  3THO B;  2EM3 A;  2EMA A;  2MC5 A;  4LF5 E;  1BBO A;  2WP8 B;  2PO0 B;  2EOZ A;  3Q1Q A;  5F3W A;  2EPO A;  4LFC I;  3RMP A;  4DR3 E;  4DV7 E;  3HPZ A;  1NHJ A;  1N0U A;  2RSM A;  4JI7 E;  4DPT A;  2VRD A;  1H7S A;  1ZM2 A;  2RTX A;  3P06 A;  4X65 I;  4LF9 I;  1X5W A;  3AUZ A;  4JYA E;  4IZK A;  4BHC A;  4DXL A;  1HNZ E;  5KL2 A;  4LF6 E;  3WU4 A;  2XEX A;  1HR0 I;  5K36 C;  1RHY A;  4GQU A;  2HKE A;  2O1V A;  2YRM A;  5AE3 A;  1NHI A;  5C0X B;  4DR1 I;  4ZYE A;  2JE6 B;  5A6A A;  4LFB E;  4HY1 A;  4JI5 I;  1X6H A;  5GMD A;  2HHH E;  4DPW A;  2WW4 A;  4N3O A;  3GON A;  2JOX A;  4R1F A;  3J7A M;  4IFD E;  1UBD C;  2IHR 1;  2YRH A;  1XNQ E;  1STU A;  3T1Y E;  1A6F A;  2JEB B;  2OI2 A;  1S16 A;  2EM0 A;  4DPY A;  2DEJ A;  4LCF A;  4P78 A;  1N32 E;  4BC7 A;  2EM9 A;  4NXM E;  2JWO A;  2UUB E;  2GLI A;  5ELW A;  5LMN I;  2L8T A;  4GZN C;  1X48 A;  2EPX A;  3VYY A;  4PRV A;  3J80 Q;  5K36 D;  2NN6 F;  4HYM A;  1EH6 A;  4X64 E;  4DR6 E;  3WU6 A;  4USM A;  2EMG A;  4DU7 A;  2KON A;  3L00 A;  3VK6 A;  3J7Y p;  4LPF A;  1QZR A;  4Z7Y A;  5FLX Q;  3B82 A;  1HK7 A;  2VF3 A;  4P52 A;  1N36 I;  2O1W A;  2UU9 E;  1L4S A;  3KWR A;  1P47 A;  2V83 A;  4AQY I;  2UXC I;  2CZ9 A;  4R2Q A;  4TUI A;  5FWK A;  4ZVI A;  2CPN A;  5A6K A;  1YHC A;  4FWH A;  1IBK I;  4LF7 I;  1KYQ A;  5AC4 A;  2EL4 A;  5A69 A;  2NUF A;  2R42 A;  4R8O A;  5LMU E;  1EH8 A;  1EKZ A;  2Z5B A;  4B3T E;  3C4B A;  1Z0E A;  4OO1 B;  3P3G A;  3VYX A;  4K0K E;  2JYA A;  2N3G A;  2GO4 A;  2O1T A;  3F6H A;  4R2A A;  4NBQ A;  1YUJ A;  2BA1 G;  2N8X A;  2Z5C B;  1YYO A;  4AID A;  2WZO A;  2RS6 A;  1UDN A;  4QNJ A;  1J5E I;  2JEA B;  4R2D A;  4M30 A;  2B3T B;  2EQ3 A;  2V86 A;  1EI1 A;  3IWC A;  4OX9 I;  2EL6 A;  1ELO A;  5JEA E;  4XTJ A;  2YTQ A;  4IS1 C;  2LV2 A;  4DV6 E;  1N33 I;  4DUZ E;  1MGT A;  4F9C B;  4LCH A;  1IMU A;  2CGE A;  4GKJ I;  2C37 B;  4HAC B;  4WSG A;  2HJJ A;  1I94 E;  4LFC E;  1ZM4 A;  4IZJ B;  5DRO A;  2EOM A;  4LFA I;  1PJQ A;  2R1F A;  2IOQ A;  3PYD A;  3H1C A;  2BM1 A;  3BBG A;  1HNX I;  2A2D A;  2EPC A;  1T4N A;  4X65 E;  3QT6 A;  2L2N A;  4LF9 E;  2V8Q B;  3B78 A;  5A6J A;  2Q8U A;  2EOO A;  1J26 A;  5EL9 A;  1HR0 E;  1XMO E;  2LTS A;  2R3V A;  2EM5 A;  3J81 C;  3P3C A;  4JI0 I;  1EH7 A;  4BCA A;  5C0X C;  4JI4 E;  2VQE I;  3OML A;  2EOI A;  4IFD F;  4JI8 E;  4JI5 E;  1XXE A;  3VHT B;  4X9J A;  4OZE A;  5IWA I;  2FGG A;  2GQ0 A;  1OJ4 A;  3LLH A;  1UDO A;  2NN6 E;  3CDJ A;  4MU1 A;  2R76 A;  1AH5 A;  2EMW A;  1A1J A;  2B7V A;  2BV3 A;  3K6Q A;  4DV0 I;  1B63 A;  5LMN E;  1T4O A;  1DAR A;  1D6T A;  2NUG A;  4WUC A;  2YU8 A;  3LML A;  4F6M A;  1BBG A;  5K36 B;  4WXC A;  1H74 A;  5C0X D;  2EMK A;  3ADG A;  2V34 A;  3ZZT A;  1LLM C;  4F54 A;  1XNR E;  2RQL A;  4ZYG A;  1TN9 A;  5C0X A;  5IT9 Q;  2J7K A;  2AE8 A;  2F1D A;  4B3M I;  2JE6 A;  3HTX A;  4LF7 E;  3HQ1 A;  1USV A;  2EOY A;  2GHF A;  3FIG A;  2Z5E A;  3THN A;  2L33 A;  3BF2 A;  5KL6 A;  1Y4U A;  2YTD A;  1Z0W A;  3K1J A;  4OO1 C;  2EOS A;  2EPP A;  4O5G A;  2LVH A;  2JEB A;  4JV5 I;  4AIM A;  2PO1 B;  1U2R A;  4DV5 I;  3JAM C;  2EM2 A;  4I8O A;  2UXB I;  1J5E E;  2J7J A;  2HK3 A;  2YSO A;  1SR9 A;  4P7A A;  2LJH A;  5JEA B;  4MDT A;  4OX9 E;  4NHR A;  1EA6 A;  4MYU A;  1X49 A;  4R2C A;  2F4V I;  3HPS A;  1Y5Y A;  3DD6 A;  4QNK A;  2JEA A;  4BHB A;  5BR8 I;  1UHZ A;  2V87 A;  1N33 E;  3C6K A;  3MHH C;  4UTG A;  4FWD A;  4YY3 I;  4GKJ E;  2RSI A;  1QNT A;  1WHN A;  3H09 A;  4NXN I;  1TF6 A;  2O1U A;  2M1S A;  4LFA E;  4R03 A;  4B3S E;  4OO1 D;  1XMQ I;  4JI6 I;  3PYG A;  1X6F A;  2LMZ A;  5C0X E;  2V85 A;  2YTP A;  4WUD A;  1HNX E;  2LJU A;  4LCG A;  1K47 A;  1MX0 A;  1T4L B;  4ISA A;  1IBM I;  4MLQ A;  4JG4 A;  2Q2E B;  4GKK I;  2D9H A;  4TUG A;  4DR4 I;  1ZXM A;  2ZM6 E;  2DEI A;  3L7Z B;  4BS9 A;  3M7N D;  1FJG E;  1PJT A;  2AJ4 A;  2N3H A;  2Z5C A;  5KL7 A;  2X7I A;  2JP9 A;  3ADJ A;  1OYP A;  1Z1B A;  1KKH A;  4DV1 I;  3TQM A;  2VQE E;  3ZKD A;  4DPX A;  3QG5 C;  4HXZ A;  5IWA E;  1KTV A;  4DUY I;  2E1R A;  3UK3 C;  2A2C A;  1DQ3 A;  4HTG A;  4HEI A;  4DV2 E;  1AAY A;  4IZJ D;  3PYF A;  2KOU A;  4LF4 I;  5K36 A;  2NA2 A;  2EML A;  1FWL A;  2C37 A;  3ZZU A;  2UUA I;  3C4T A;  4HAC A;  2V8P A;  2CG9 A;  4M2Z A;  4IZJ A;  1FWK A;  4X66 E;  2PNL A;  4M9V C;  2V2Q A;  4BMJ A;  1ZAA C;  2F8B A;  2ELZ A;  1ZBT A;  4DR7 I;  1MEY C;  4WUB A;  2VQF I;  4JI3 I;  2JT2 A;  3GME A;  2DLQ A;  3HJC A;  1G2D C;  2EN4 A;  1N3G A;  2EFG A;  4X62 E;  2WNR B;  2JY9 A;  2L6M A;  2YRK A;  1UIL A;  2UUC E;  4JI2 E;  1NHH A;  3P76 A;  5DNX A;  1IBL I;  3CDI A;  4WFT A;  2VF1 A;  1A1I A;  4L5N C;  4Q35 B;  3JU0 A;  3UHM A;  1ZBQ A;  2RPC A;  1YYW A;  5A2Q C;  4DV4 I;  2YPN A;  4RHB B;  1DI2 A;  5ADZ A;  4U3B A;  4O43 A;  2UXD I;  1FKA E;  4KHP E;  5LLQ A;  4JV5 E;  1WXR A;  2EMH A;  2DLK A;  2DRP A;  1ZM9 A;  2MDR A;  4DV5 E;  2YTI A;  5IXM B;  4J3D A;  1Y60 A;  5K36 E;  4M1K A;  2HC5 A;  2WBT A;  5A6B D;  1A1F A;  4GEQ B;  2M9A A;  1UDS A;  1ZXN A;  2CVE A;  2MKD A;  1OYS A;  2GPI A;  3JTZ A;  3OTO I;  4O24 A;  1A1L A;  5A6B A;  1DGC A;  5JEA C;  4N4R B;  3GCM A;  2F4V E;  1YPN A;  2HFU A;  4RH8 A;  2EOE A;  2ADR A;  1OYR A;  4DPU A;  4DR3 I;  5BR8 E;  2YTO A;  4DV7 I;  4YY3 E;  4MU4 A;  4JI7 I;  2LTR A;  2GS8 A;  4ZYH A;  1ZR9 A;  4WYQ B;  4NXN E;  3AV0 A;  2EQ0 A;  3K17 A;  2EPL X;  3LPS A;  2I13 A;  3CWV A;  5C0X F;  1HNZ I;  2EE8 A;  1XMQ E;  2EOH A;  2HGH A;  2IER A;  4DR1 E;  2HK2 A;  3J81 Q;  2HFS A;  2EPN A;  4FW9 A;  3M7N G;  2DGC A;  2FTX B;  2GO3 A;  3PS2 A;  4DR4 E;  2C38 A;  2PO1 A;  2RS7 A;  2C39 B;  4LFB I;  2PO0 A;  3DF6 A;  4KWY A;  1Z5A A;  2WP8 A;  3V5R A;  2PO2 B;  5JEA D;  3T1H I;  2Z5B B;  1IQO A;  1YH8 A;  2YWQ A;  2EPR A;  4R2P A;  4DV1 E;  1G2F C;  4NZV A;  2LT7 A;  1H72 C;  4F6N A;  1KVK A;  2CT1 A;  2IES A;  5JEA A;  2BBG A;  1RRE A;  4OKG A;  3M85 D;  2UUB I;  4DUY E;  2BR2 B;  4R2R A;  1O0W A;  2EN7 A;  4BA2 B;  2DIX A;  2BB8 A;  2E1M A;  1N36 E;  1S4E A;  4DV3 I;  3PS1 A;  2EOR A;  5KL5 A;  2UUA E;  4IFD C;  2NN6 B;  4DR6 I;  4AQY E;  5GME A;  2UXC E;  2YTG A;  5DRP A;  2EOQ A;  2EMX A;  2DB2 A;  1PVG A;  2V89 A;  2I9I A;  1A1H A;  3J7A G;  1IBK E;  3F6G A;  2UU9 I;  1T39 A;  3PRY A;  2EP3 A;  1BB8 A;  1USU A;  2WCC 3;  2EMY A;  2ENA A;  4JI1 I;  2YTF A;  2YTN A;  2M4I A;  2WBS A;  2PRT A;  1R6M A;  4Z7C A;  2E5L I;  1ZM3 A;  2MDG A;  2V2V A;  5LMU I;  1A1G A;  1Z0B A;  3PS3 A;  3MSW A;  4LU9 A;  1IBL E;  2LJP A;  5L3J A;  3U1K A;  4K0K I;  3JAM Q;  5DRR A;  4AM3 A;  1GQE A;  1VIS A;  4Q28 A;  3DJW A;  1WUU A;  4FN5 A;  2EL5 A;  2JOB A;  4BC9 A;  3ADI A;  2HKJ A;  4LTY A;  1Z0G A;  2EPK X;  2LO3 A;  2UXD E;  4F9A B;  4LF8 I;  4URL A;  2LUQ A;  1MG7 A;  1WJP A;  5K36 F;  4DU8 A;  4YHH I;  5AE2 A;  2EQ1 A;  1N0V C;  5IV8 B;  4L8N A;  2YZT A;  1N34 I;  1RC7 A;  4DR2 I;  4FW7 A;  1X47 A;  1Y4S A;  2V2Z A;  2YT4 A;  2WBU A;  1NCS A;  4FW4 A;  2BM0 A;  3LNU A;  4OO1 A;  1I94 I;  1KJK A;  1ZU1 A;  1VI7 A;  2EOJ A;  1GZ6 A;  4DMI A;  4WPY A;  2LCE A;  3WU5 A;  3BGH A;  2EN3 A;  2L92 A;  3B4T A;  2PNZ B;  2ODR C;  4PU9 A;  2WNR A;  2YTJ A;  4BA1 B;  1PDA A;  3EPJ A;  1BKN A;  4LOM A;  4JI0 E;  1HNW I;  4F2J C;  2B9D A;  3NZK A;  3HXL A;  2IOP A;  1XMO I;  2DMY A;  2VE7 C;  4DR5 I;  1R6L A;  2K7I A;  3ZZ0 A;  1X6E A;  2ELY A;  2KHX A;  4IS9 A;  1SFE A;  2YSP A;  1XHK A;  4JI4 I;  4R2E A;  2DSY A;  4DV0 E;  1Z5B A;  4IFD B;  4JI8 I;  2EWL A;  2EM4 A;  1H73 A;  3T1H E;  2L2M A;  2EN1 A;  4P7D A;  3EPH A;  4FW3 A;  2BA0 D;  3M85 G;  4MU3 A;  3PYE A;  4KQV A;  3ZOQ B;  4FW6 A;  4IFD D;  2ODR D;  1GTK A;  3J80 C;  2MC6 A;  4OO1 E;  3IWD A;  1YZ9 A;  4DV3 E;  1B62 A;  1JK2 A;  2NPF A;  4MU0 A;  2L3J A;  4O4K A;  4ZYD A;  5FLX C;  3LTO A;  5DNL A;  2NN6 C;  5AE1 A;  2JPA A;  2MKN A;  4IZK B;  4IJD A;  2NUE A;  4B3M E;  2CTD A;  2L3C A;  3KZZ A;  1XNR I;  4B3R I;  2EPA A;  3Q6M A;  1NZ0 A;  2K4V A;  2LBS B;  4JI1 E;  5A2Q Q;  1YUI A;  2C39 A;  2E5L E;  1T38 A;  2EN8 A;  1A1K A;  2PO2 A;  5DNY A;  2EM8 A;  4PRX A;  5DRQ A;  4KZS A;  3M6A A;  2UXB E;  1Z0V A;  2M7Q A;  3EPK A;  3BID A;  5JEA F;  2DMI A;  2ZBK B;  4LF5 I;  1RQ0 A;  2E72 A;  1KIJ A;  2LRS A;  2B7T A;  2BR2 A;  3P3E A;  1E3H A;  2NN6 D;  4LF8 E;  1RR9 A;  5KL4 A;  2EN6 A;  4BA2 A;  1WHQ A;  2A25 A;  2EOF A;  4YHH E;  4USK A;  2EMF A;  2NN6 A;  3WU3 A;  1UDQ A;  1N34 E;  1E3P A;  1YYK A;  3GLL A;  2L2K B;  4JYA I;  2H36 X;  4DR2 E;  4DKK A;  3D4J A;  3ZKB A;  2EM7 A;  3KZY A;  2JVA A;  4JI6 E;  3QT5 A;  1PIE A;  3QT7 A;  1YSA C;  1PJS A;  4I3H A;  1Y6Z A;  4LF6 I;  4M0V A;  5CFF E;  1IBM E;  4GKK E;  4B3S I;  4UT4 A;  3EPL A;  2EJ4 A;  1P42 A;  1UN6 B;  3KRN A;  5TSE A;  2HHH I;  2EPM X;  1UEK A;  4MQY A;  4EMD A;  2JXP A;  2EZ6 A;  1XNQ I;  2EMI A;  4ED4 A;  3T1Y I;  1B69 A;  1HNW E;  2YTE A;  3F0N A;  2ZM6 I;  1X3C A;  2NAB A;  1Z59 A;  2LUP B;  1FJG I;  1N32 I;  4RPF A;  2EN2 A;  2EPU A;  2CSH A;  5T6J A;  4DR5 E;  3ZM7 A;  4NXM I;  4MYT A;  1WRJ A;  1YFH A;  3C6M A;  1H7U A;  4LF4 E;  2BA0 G;  4MLV A;  2ENC A;  3U1Y A;  3QT8 A;  5AAS A;  2ZIT A;  4X64 I;  5KL3 A; 
#chains in the Genus database with same CATH homology
 1FNM A;  4DV2 I;  4BBY A;  1Z0C A;  1Z5C A;  4DR7 E;  3IWB A;  2VQF E;  4JI3 E;  3HUL A;  4X66 I;  4WSP A;  3P1X A;  2JR1 A;  1PKP A;  3B8H A;  4OOG C;  4B3T I;  2V88 A;  3Q6N A;  2LE2 A;  5IT9 C;  4F9B B;  4DV4 E;  3K85 A;  4X62 I;  4B3R E;  1MU5 A;  2X36 A;  4DU7 A;  3ADL A;  4FWG A;  2G7H A;  1QU6 A;  2UUC I;  4JI2 I;  4X8W A;  2PNM A;  1FI4 A;  1Z0T A;  3V2U C;  5LL6 R;  3H4L A;  4KHP I;  4DV6 I;  4DUZ I;  2FV4 B;  4J8Z A;  3OTO E;  2MC5 A;  4LF5 E;  3Q1Q A;  5F3W A;  4LFC I;  3RMP A;  4DR3 E;  4DV7 E;  3HPZ A;  1NHJ A;  1N0U A;  2RSM A;  4JI7 E;  4DPT A;  1H7S A;  1ZM2 A;  2RTX A;  3P06 A;  4X65 I;  4LF9 I;  4JYA E;  3AUZ A;  4IZK A;  4DXL A;  1HNZ E;  4LF6 E;  3WU4 A;  2XEX A;  1HR0 I;  2HKE A;  2O1V A;  5AE3 A;  1NHI A;  4DR1 I;  4HY1 A;  4LFB E;  4JI5 I;  4DPW A;  5GMD A;  2HHH E;  2WW4 A;  4N3O A;  3GON A;  2JOX A;  4R1F A;  3J7A M;  2IHR 1;  1XNQ E;  4DPY A;  1STU A;  3T1Y E;  1A6F A;  2OI2 A;  1S16 A;  2DEJ A;  4P78 A;  1N32 E;  4BC7 A;  4NXM E;  2JWO A;  2UUB E;  5LMN I;  2L8T A;  1X48 A;  3VYY A;  3J80 Q;  4PRV A;  4HYM A;  4USM A;  4DR6 E;  4X64 E;  3WU6 A;  2KON A;  3VK6 A;  3J7Y p;  1QZR A;  4Z7Y A;  5FLX Q;  3B82 A;  1HK7 A;  2VF3 A;  4P52 A;  1N36 I;  2O1W A;  2UU9 E;  3KWR A;  2V83 A;  4AQY I;  2UXC I;  2CZ9 A;  4TUI A;  5FWK A;  4ZVI A;  2CPN A;  4FWH A;  1IBK I;  4LF7 I;  2NUF A;  2R42 A;  4R8O A;  5LMU E;  1EKZ A;  2Z5B A;  4B3T E;  3C4B A;  1Z0E A;  3VYX A;  4K0K E;  2N3G A;  2O1T A;  3F6H A;  2Z5C B;  1YYO A;  2WZO A;  2RS6 A;  1J5E I;  4M30 A;  2B3T B;  2V86 A;  1EI1 A;  3IWC A;  4OX9 I;  1ELO A;  4XTJ A;  4DV6 E;  1N33 I;  4DUZ E;  4F9C B;  2CGE A;  4GKJ I;  4HAC B;  1I94 E;  4LFC E;  1ZM4 A;  4IZJ B;  4LFA I;  2IOQ A;  3PYD A;  2BM1 A;  1HNX I;  2A2D A;  1T4N A;  4X65 E;  3QT6 A;  2L2N A;  4LF9 E;  2V8Q B;  3B78 A;  1J26 A;  1HR0 E;  1XMO E;  2LTS A;  2R3V A;  3J81 C;  4JI0 I;  4BCA A;  4JI4 E;  2VQE I;  3OML A;  4JI8 E;  4JI5 E;  5IWA I;  2FGG A;  2GQ0 A;  1OJ4 A;  3LLH A;  2B7V A;  2BV3 A;  3K6Q A;  4DV0 I;  1B63 A;  5LMN E;  1T4O A;  1DAR A;  1D6T A;  2NUG A;  4WUC A;  3LML A;  1H74 A;  3ADG A;  2V34 A;  3ZZT A;  4F54 A;  1XNR E;  5IT9 Q;  2J7K A;  4B3M I;  3HTX A;  4LF7 E;  3HQ1 A;  1USV A;  2Z5E A;  3FIG A;  1Z0W A;  2L33 A;  1Y4U A;  3K1J A;  4JV5 I;  1U2R A;  4DV5 I;  3JAM C;  4I8O A;  2UXB I;  1J5E E;  2HK3 A;  1SR9 A;  4P7A A;  2LJH A;  4OX9 E;  1EA6 A;  4MYU A;  1X49 A;  2F4V I;  3HPS A;  5BR8 I;  1UHZ A;  2V87 A;  1N33 E;  4UTG A;  4YY3 I;  4FWD A;  4GKJ E;  1WHN A;  3H09 A;  4NXN I;  2O1U A;  2M1S A;  4LFA E;  4R03 A;  4B3S E;  1XMQ I;  4JI6 I;  3PYG A;  2LMZ A;  2V85 A;  4WUD A;  1HNX E;  1K47 A;  1MX0 A;  1T4L B;  1IBM I;  4JG4 A;  2Q2E B;  4GKK I;  4TUG A;  4DR4 I;  1ZXM A;  2ZM6 E;  2DEI A;  4BS9 A;  1FJG E;  2AJ4 A;  2N3H A;  2Z5C A;  2X7I A;  3ADJ A;  1KKH A;  4DV1 I;  2VQE E;  3ZKD A;  4DPX A;  4HXZ A;  5IWA E;  1KTV A;  4DUY I;  2E1R A;  2A2C A;  1DQ3 A;  4DV2 E;  4IZJ D;  4LF4 I;  3PYF A;  2KOU A;  1FWL A;  2NA2 A;  3ZZU A;  2UUA I;  3C4T A;  4HAC A;  2V8P A;  2CG9 A;  4M2Z A;  4IZJ A;  1FWK A;  4X66 E;  2PNL A;  2V2Q A;  4BMJ A;  2F8B A;  1ZBT A;  4DR7 I;  4WUB A;  2VQF I;  4JI3 I;  3HJC A;  2EFG A;  4X62 E;  2JY9 A;  2L6M A;  2UUC E;  1UIL A;  4JI2 E;  1NHH A;  1IBL I;  4WFT A;  2VF1 A;  4L5N C;  3JU0 A;  1ZBQ A;  1YYW A;  5A2Q C;  4DV4 I;  1DI2 A;  5ADZ A;  2UXD I;  1FKA E;  4KHP E;  4JV5 E;  1WXR A;  1ZM9 A;  2MDR A;  4DV5 E;  4M1K A;  4GEQ B;  1ZXN A;  3OTO I;  3JTZ A;  2F4V E;  2HFU A;  4DPU A;  4DR3 I;  5BR8 E;  4DV7 I;  4YY3 E;  4JI7 I;  2LTR A;  2GS8 A;  4WYQ B;  4NXN E;  3AV0 A;  3K17 A;  3LPS A;  3CWV A;  1HNZ I;  1XMQ E;  4DR1 E;  2HK2 A;  3J81 Q;  2HFS A;  4FW9 A;  2FTX B;  4DR4 E;  2RS7 A;  4LFB I;  3DF6 A;  1Z5A A;  3V5R A;  3T1H I;  2Z5B B;  4DV1 E;  1H72 C;  1KVK A;  1RRE A;  2UUB I;  4DUY E;  1O0W A;  2DIX A;  1S4E A;  2E1M A;  1N36 E;  4DV3 I;  2UUA E;  4DR6 I;  4AQY E;  5GME A;  2UXC E;  1PVG A;  2DB2 A;  2V89 A;  3J7A G;  1IBK E;  3F6G A;  2UU9 I;  3PRY A;  1USU A;  4JI1 I;  2M4I A;  2E5L I;  4Z7C A;  1ZM3 A;  2V2V A;  5LMU I;  1Z0B A;  3MSW A;  4LU9 A;  1IBL E;  2LJP A;  5L3J A;  4K0K I;  3JAM Q;  1GQE A;  1VIS A;  4Q28 A;  3DJW A;  1WUU A;  4FN5 A;  2JOB A;  4BC9 A;  3ADI A;  2HKJ A;  4LTY A;  1Z0G A;  2UXD E;  4F9A B;  4LF8 I;  4URL A;  2LUQ A;  1MG7 A;  4DU8 A;  4YHH I;  5AE2 A;  1N0V C;  4L8N A;  2YZT A;  1N34 I;  1RC7 A;  4DR2 I;  1X47 A;  1Y4S A;  2V2Z A;  2YT4 A;  2BM0 A;  3LNU A;  1I94 I;  1GZ6 A;  4DMI A;  4WPY A;  3WU5 A;  2L92 A;  2ODR C;  4PU9 A;  1BKN A;  4JI0 E;  1HNW I;  2B9D A;  3HXL A;  2IOP A;  1XMO I;  2DMY A;  2VE7 C;  4DR5 I;  3ZZ0 A;  2KHX A;  4JI4 I;  1XHK A;  2DSY A;  4DV0 E;  1Z5B A;  4JI8 I;  2EWL A;  1H73 A;  3T1H E;  2L2M A;  4P7D A;  3PYE A;  4KQV A;  3ZOQ B;  2ODR D;  3J80 C;  2MC6 A;  3IWD A;  1YZ9 A;  4DV3 E;  1B62 A;  2NPF A;  2L3J A;  5FLX C;  3LTO A;  5AE1 A;  4IZK B;  2NUE A;  4B3M E;  2L3C A;  1XNR I;  4B3R I;  3Q6M A;  1NZ0 A;  2K4V A;  2LBS B;  4JI1 E;  5A2Q Q;  2E5L E;  5DNY A;  4PRX A;  4KZS A;  3M6A A;  2UXB E;  1Z0V A;  2M7Q A;  2ZBK B;  4LF5 I;  1RQ0 A;  1KIJ A;  2LRS A;  2B7T A;  4LF8 E;  1RR9 A;  1WHQ A;  4YHH E;  4USK A;  3WU3 A;  1N34 E;  1YYK A;  2L2K B;  4JYA I;  2H36 X;  4DR2 E;  4DKK A;  3D4J A;  3ZKB A;  4JI6 E;  2JVA A;  3QT7 A;  3QT5 A;  1PIE A;  4LF6 I;  4I3H A;  1Y6Z A;  4M0V A;  5CFF E;  1IBM E;  4GKK E;  4B3S I;  4UT4 A;  2HHH I;  1UEK A;  4EMD A;  2EZ6 A;  1XNQ I;  4ED4 A;  3T1Y I;  1HNW E;  3F0N A;  2ZM6 I;  1Z59 A;  2LUP B;  1FJG I;  1N32 I;  4RPF A;  4DR5 E;  3ZM7 A;  5T6J A;  4NXM I;  4MYT A;  1H7U A;  4LF4 E;  3QT8 A;  5AAS A;  2ZIT A;  4X64 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...