1J5EE

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1j5eE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1j5eE02
1IBKI 2VQEI 4RPFA 4JI3I 2J7KA 2VQEE 1H7SA 1FKAE 1X48A 2R3VA 1UEKA 3C4BA 1H74A 3J7AM 1B63A 1UHZA 3HTXA 4GKKE 4DV0E 1T4LB 1ZXMA 1EI1A 2UUCI 4USKA 3J80Q 2ZITA 4HY1A 1HNXI 2LJPA 2LRSA 4JI7I 3ADIA 2N3GA 5BR8E 3J81C 2IHR1 4DPUA 3PYEA 4DV3E 4NXMI 3J7AG 4DPTA 4JI6I 1N36E 1S4EA 4DXLA 1FNMA 4DV6E 4DR6I 4DR5E 1X47A 2HKEA 1N0VC 4X62E 4DR1E 1WHQA 1IBMI 2HHHE 2LUPB 1HNZI 3PYGA 2ZM6E 4LF8E 2L33A 1DARA 4LF9I 4X65E 1Z5AA 1J5EI 1YYWA 2OI2A 1KTVA 1HNWE 1HNWI 4WYQB 2GS8A 5GMEA 3F0NA 1D6TA 4DUYI 2DB2A 1OJ4A 3VYYA 1ZM9A 4DUZE 1J5EE 4LF9E 2F4VE 4R1FA 4X65I 4LF8I 4OOGC 4UTGA 1XNQE 4FN5A 1HNZE 3ADLA 4I3HA 2HHHI 1ELOA 1IBME 2HFUA 5A2QQ 2V2QA 4X8WA 4X62I 4DU8A 4DV6I 1ZXNA 4JI6E 1RC7A 4P7AA 4NXME 2UU9I 1X49A 1Z0WA 3QT6A 4JI1I 4YY3E 5BR8I 2LJHA 1S16A 4WFTA 3C4TA 5GMDA 4DV7E 3ZZ0A 1Z0EA 3QT7A 1Z59A 3P1XA 4PRVA 4DV0I 4DV4E 4LF7I 1ZBTA 2LUQA 4LFBE 1XMQE 1ZM2A 4B3TI 3WU4A 2L2MA 3ADGA 4XTJA 2MDRA 1QU6A 4JI3E 1KKHA 2Q2EB 1Z5BA 1IBKE 4JI2E 3ZZTA 2RS7A 2E1RA 4YHHE 2CZ9A 2E5LI 2UXCI 2UUAI 2DMYA 3JAMC 3B78A 2JVAA 1HR0E 4EMDA 1T4OA 4LF4E 3VYXA 4K0KE 4B3MI 4M2ZA 2R42A 4X66E 1H73A 1T4NA 3J81Q 1FJGI 1N34E 2AJ4A 4PRXA 3LLHA 1STUA 4X64E 2KHXA 5LMNI 4JI5E 2B7TA 5IWAI 1H72C 4DPWA 4Z7YA 2RSMA 1K47A 2V2ZA 4DR7I 4B3RI 1N32E 3WU3A 4JI4I 4DR4I 1KVKA 4LFCI 4DV1E 3CWVA 3T1YE 4WUBA 3ZZUA 1Z0GA 2YT4A 4ZVIA 4HACA 3OTOE 1N33E 1EKZA 4JV5E 4KHPE 3K17A 4AQYE 3J7Yp 4JI0E 4B3SI 1H7UA 2VQFE 2NPFA 3B8HA 4URLA 1MX0A 1NHIA 4FWGA 2NA2A 2LBSB 5A2QC 2UUBE 3QT5A 2UUBI 4FW9A 1B62A 1WHNA 1ZM4A 2BM0A 1UILA 2NUGA 2BV3A 3ZKBA 2UXDI 3ADJA 1RR9A 2VQFI 3T1HI 2XEXA 4JI8I 4KQVA 1I94I 2DIXA 1WUUA 1A6FA 4DV5E 4LF6I 4FWDA 4AQYI 4PU9A 4KHPI 3OTOI 4WUCA 1Z0BA 3WU5A 4JYAI 3Q1QA 4DPXA 4UT4A 5LMUI 2HK2A 4DR3E 4DV1I 2V8PA 4JI4E 4OX9I 4LF5I 4DV2E 4DPYA 4GKJE 4LFAI 4JI5I 1QZRA 2UXBI 1IBLE 1PKPA 1PVGA 4DR2E 4NXNI 3LPSA 4HACB 2VF3A 4X66I 4HYMA 3M6AA 1XNRE 2WW4A 4B3ME 2B7VA 3LNUA 4K0KI 1XMOI 3V5RA 5IT9C 4LF4I 3JAMQ 1HR0I 1N0UA 4YHHI 1XMOE 1RREA 2X7IA 1XNRI 3D4JA 1GQEA 4NXNE 4P52A 2NUFA 4DR2I 2ZBKB 2EFGA 1IBLI 2UXBE 1KIJA 1RQ0A 1FWLA 4LFAE 1DI2A 4GKJI 4MYTA 4DV2I 4B3TE 5LL6R 4LF5E 3QT8A 1XMQI 4OX9E 2JY9A 4M1KA 4LFBI 4DR3I 4LF7E 4Z7CA 2RTXA 4DV4I 5LMUE 2L3JA 4HXZA 3GONA 4DV7I 3J80C 2B3TB 2L2NA 4JYAE 1Z5CA 3K1JA 4MYUA 1Z0CA 1BKNA 2DEJA 1PIEA 4M30A 1Z0TA 4JI1E 4YY3I 1MU5A 4ED4A 4DV5I 1I94E 4LF6E 4JG4A 1Z0VA 4JI8E 3T1HE 1EA6A 3H4LA 2UU9E 2UXDE 3PYFA 3LTOA 2HFSA 4USMA 3ZM7A 1YYKA 2LTRA 3ZKDA 5FLXQ 1XNQI 1YYOA 2X36A 2F4VI 2LTSA 4DUZI 4WUDA 4B3SE 4DUYE 1FI4A 4JI0I 1J26A 3V2UC 2N3HA 1NHJA 4JV5I 1XHKA 1N33I 3HULA 4FWHA 2ZM6I 2A2CA 1NZ0A 3T1YI 2HKJA 4LFCE 2BM1A 4DU7A 2DEIA 4DR4E 1N32I 2L3CA 4B3RE 4DR7E 4DR1I 1U2RA 4DR5I 2V34A 4DR6E 1N36I 3WU6A 5FLXC 2HK3A 4DKKA 1YZ9A 5IWAE 5CFFE 4DV3I 5LMNE 2A2DA 4X64I 2EZ6A 1N34I 2V2VA 1FJGE 5L3JA 4JI7E 1HNXE 2NUEA 1FWKA 5IT9Q 3PYDA 2UUCE 1MG7A 2CPNA 4GKKI 1O0WA 3B82A 2UUAE 1ZM3A 2UXCE 1VISA 2E5LE 2RS6A 2L2KB 1NHHA 4JI2I
chains in the Genus database with same CATH superfamily
1IBKI 2VQEI 5AC4A 4RPFA 1JK1A 3BIDA 1T39A 2EPUA 4JI3I 2J7KA 2VQEE 1H7SA 4MU1A 1FKAE 2EOIA 2V86A 1X48A 2AE8A 1ZU1A 1OYPA 5K36D 5K36A 2PO2A 4ZYHA 2V88A 2R3VA 1UEKA 2VESA 2JR1A 3C6MA 3C4BA 1H74A 5C0XE 4DMIA 2O1UA 2EPOA 3J7AM 5IV8B 1B63A 2BA1D 1UHZA 5A6KA 2EN7A 2EMXA 3HTXA 4WXDA 2EMZA 4GKKE 4DV0E 1T4LB 1ZXMA 4LU9A 4WPYA 1EI1A 2UUCI 4USKA 3J80Q 3FIGA 2ZITA 2EL4A 4HY1A 2EM9A 4FW5A 1HNXI 2LJPA 2LRSA 2V87A 4MQYA 2GLIA 2EMCA 3ADIA 2FTXB 2N3GA 4JI7I 4ZYEA 2EMKA 5BR8E 1T38A 3J81C 2IHR1 3AUZA 1A1HA 4LCHA 4DPUA 4I8OA 2M1SA 3PYEA 4DV3E 1IMUA 1A1LA 2EN4A 2EOYA 2WP8A 2KONA 4NXMI 3J7AG 2EM4A 2RSIA 2JPAA 2EM3A 3HXLA 4DPTA 1N36E 3BGHA 4L5NC 1S4EA 4DXLA 1TN9A 4DV6E 1FNMA 4DR5E 2JEBA 1N3GA 3K6QA 1X47A 2VRDA 2HKEA 4LOMA 2CSHA 4X62E 1N0VC 4P78A 4DR1E 1ZBQA 1A1KA 3EPHA 2LV2A 5KL7A 1XXEA 1WHQA 4AIDA 2JE6A 1IBMI 2EM0A 2EOXA 2HHHE 2LUPB 2DMIA 5K36F 1HNZI 2JWOA 5C0XF 2FV4B 2ZM6E 3PYGA 2O1WA 4LF8E 2L33A 1DARA 4LF9I 4X65E 1Z5AA 1J5EI 4LTYA 2BA0G 1YYWA 3U1YA 2ENCA 1G2FC 1A1FA 2NN6F 2OI2A 2Z5EA 4M9VC 1KTVA 1Y4SA 1USUA 1HNWE 1HNWI 4WYQB 1YUIA 2GS8A 5GMEA 3F0NA 1D6TA 4DUYI 2EPKX 2YPNA 2YTIA 3AV0A 2DB2A 1OJ4A 3VYYA 1ZM9A 4DUZE 3HPZA 1J5EE 4LF9E 2F4VE 4R1FA 4X65I 1A1GA 4LF8I 4OOGC 4IJDA 2EPMX 4UTGA 4IZKB 1XNQE 4FN5A 1HNZE 3ADLA 4I3HA 2HHHI 1ELOA 4HEIA 1IBME 2YU8A 4WX9A 2HFUA 4J8ZA 5A2QQ 5JEAE 5JEAA 2JEAA 2C38A 4N3OA 2LVHA 4RH8A 2V2QA 2YRMA 4X8WA 1OYSA 4U3BA 4DU8A 4X62I 1NCSA 2DSYA 1SR9A 2PNZA 3MHHC 1P47A 4DV6I 1ZXNA 2Z5BB 2MC5A 4L8NA 1RC7A 4JI6E 1UDSA 4P7AA 3IWDA 4NXME 2ODRD 2UU9I 1X49A 1Z0WA 5K36B 4F6NA 3P76A 2YSOA 2NN6A 3QT6A 5A6BD 4JI1I 4YY3E 1OYRA 1YUJA 2PNMA 4IZJA 5BR8I 2NABA 2LJHA 1S16A 2IOQA 4WFTA 1BB8A 5C0XC 4J3DA 5JEAC 3C4TA 1QNTA 5GMDA 4DV7E 2JOXA 4BCAA 3ZZ0A 2HGHA 1WJPA 1Z0EA 3QT7A 4IFDD 4ZYDA 1UDNA 3P1XA 1Y4UA 1Z59A 2PO0A 3P3CA 4DV4E 4PRVA 4DV0I 1RHYA 4LF7I 3THOB 1UDOA 4O24A 5AE1A 1ZBTA 1UN6B 4QNKA 2Z5CB 2LUQA 3JTZA 4LFBE 2WBTA 4F54A 1XMQE 4LPFA 5KL4A 2EN8A 2NN6C 2EOHA 2J7JA 2EOQA 1ZM2A 2EE8A 3PS3A 2V83A 4M0VA 4B3TI 4U3DA 1VI7A 2L2MA 2R1FA 3ADGA 3WU4A 5DNXA 1TF3A 2C39A 3MHSC 2E72A 4ISAA 5A6JA 2JT2A 4KZSA 4XTJA 2MDRA 1QU6A 4JI3E 3F6GA 2EQ1A 1X6FA 3M99B 2EMWA 2LO3A 4RHBB 1KKHA 1Z5BA 2Q2EB 1IBKE 5KL5A 4IS9A 4JI2E 4MU4A 3ZZTA 1PDAA 2VE7C 2DGCA 3UHMA 3THNA 1X6HA 4X9JA 1EH6A 5DRQA 5AC5A 2RS7A 2E1RA 4MLVA 4YHHE 3UK3C 2D9HA 2CZ9A 2E5LI 2UXCI 4R2QA 2UUAI 4IFDA 4OO1C 2Q8UA 2YTQA 4O43A 2DMYA 3JAMC 3B78A 1X3CA 1A1JA 1IQOA 2EM8A 2JVAA 2I9IA 1HR0E 2EP3A 4LCFA 4EMDA 1T4OA 4LF4E 4BA1A 4MLQA 2EQ3A 4FW6A 1DQ3A 3VYXA 4K0KE 4B3MI 4OKGA 4M2ZA 2EPPA 2R42A 3ECRA 4X66E 4NBQA 4R2SA 1T4NA 1H73A 3JU0A 2WNRB 3J81Q 1FJGI 5A6AA 1N34E 2AJ4A 3PRYA 4PRXA 3LLHA 1STUA 4X64E 2KHXA 4R8OA 5LMNI 4JI5E 4OO1A 2B7TA 1WRJA 4IFDC 3KRNA 4QNJA 5IWAI 4P7DA 3PS2A 2BA0D 4R2RA 5K36E 4BHBA 1H72C 4DPWA 2WNRA 4Z7YA 2B9DA 4DV7I 2RSMA 1K47A 2V2ZA 3KZYA 3DD6A 2GO4A 4BA2B 4DR7I 4B3RI 2WBUA 2MC6A 1N32E 3WU3A 2DLQA 4JI4I 2ADRA 2H36X 2WBSA 4DR4I 2EN6A 1KVKA 4LFCI 3B4TA 4DV1E 2WP8B 3T1YE 3CWVA 4WUBA 4IFDE 3ZZUA 2GQ0A 3Q6NA 1Z0GA 3EPLA 2YT4A 2WCC3 2F1DA 4BBYA 4ZVIA 4HACA 4FK5C 2YTPA 3OTOE 1N33E 2IERA 4MU0A 1EKZA 4JV5E 4KHPE 3K17A 4AQYE 3J7Yp 5K36C 4JI0E 4B3SI 2YU5A 1H7UA 2EM2A 2EOMA 2EL6A 2VQFE 2EMFA 1R6MA 2NPFA 3B8HA 4URLA 1MX0A 3BF2A 1NHIA 2N8XA 5DRPA 4FWGA 2EM5A 2NA2A 2LBSB 2RQLA 1MEYC 4BS9A 2EL5A 2BBGA 5A2QC 3EPKA 1HK7A 4LCGA 2UUBE 3QT5A 2UUBI 3IWBA 1IQSA 4FW9A 3GMEA 1B62A 1WHNA 3H1CA 4O5GA 2JEBB 3GCMA 2EOSA 3F6HA 4DR6I 1ZM4A 2Z5CA 2O1VA 4IZKA 2BM0A 3TQMA 1UILA 2NUGA 2BV3A 3ZKBA 2YTEA 2YTJA 3ADJA 1RR9A 2UXDI 2VQFI 1NEIA 3T1HI 2YRHA 4R03A 2XEXA 4FW4A 4JI8I 1ZR9A 2EMGA 2CTDA 4KQVA 2WZOA 2DIXA 1WUUA 4NZVA 4DV5E 1A6FA 1I94I 4FWDA 1X6EA 4LF6I 1A1IA 4AQYI 2GPIA 4F2JC 4PU9A 1EH7A 4KHPI 5DROA 4R2EA 5AE2A 2ELZA 4IZJB 5AE3A 3OTOI 4IS1C 4WUCA 3OMLA 2EMLA 5A69A 1Z0BA 3QG5C 4NHRA 2YTOA 3P06A 2EOJA 3WU5A 4JYAI 2NN6B 4WSPA 4DPXA 3Q1QA 1USVA 1E3PA 4UT4A 5LMUI 2YZTA 1PJSA 2HK2A 4DR3E 2JE6B 4DV1I 2V8PA 5EKWA 1Y5YA 4JI4E 4TUGA 2R76A 3LMLA 4MDTA 3P3EA 2G7HA 2PNZB 4OX9I 2CG9A 4LF5I 1F2IG 2CGEA 4DV2E 4DPYA 4GKJE 2JP9A 4LFAI 3RMPA 3PS1A 4GEQB 4JI5I 1QZRA 2UXBI 1IBLE 1PKPA 2PRTA 3BBGA 1PVGA 2ELYA 4DR2E 4JI6I 4NXNI 2JOBA 1AAYA 3LPSA 4HACB 2O1TA 2VF3A 4HYMA 5IXMB 1XNRE 2WW4A 3M6AA 3L00A 2PNLA 4B3ME 2B7VA 3LNUA 4K0KI 1XMOI 1YPNA 3V5RA 2LCEA 2RPCA 5IT9C 1R6LA 1Y60A 4LF4I 1PJTA 3JAMQ 1HR0I 5FWKA 1N0UA 2L6MA 2EM6A 2V85A 5DRRA 2ODRC 2GHFA 3ZOQB 4YHHI 3M85D 1XMOE 1RREA 2X7IA 1SFEA 1XNRI 2I13A 2EQ0A 3D4JA 4AIMA 2E1MA 5ELWA 1GQEA 4NXNE 4P52A 2DRPA 2NUFA 1EH8A 3CDJA 4DR2I 2ZBKB 2EFGA 2V8QB 4F6MA 1IBLI 2UXBE 4R2DA 2BR2A 1KIJA 4OO1D 3M7ND 1RQ0A 1FWLA 2LJUA 4LFAE 1DI2A 4R2CA 2MDGA 4GKJI 2BB8A 2PO1A 4MYTA 5T6JA 4BA1B 4DV2I 3U1KA 4B3TE 3M85G 5C0XB 5LL6R 2C37B 4LF5E 2FGGA 1B69A 3QT8A 1XMQI 4OX9E 3IWCA 2EPCA 1GZ6A 2YWQA 2JY9A 4R2AA 4M1KA 4LFBI 2MKNA 2MKDA 2CT1A 4DR3I 4LF7E 4Z7CA 2RTXA 4DV4I 2EOEA 1PJQA 5LMUE 2L3JA 1BBOA 2J65A 4HXZA 3GONA 4BC9A 2JYAA 3VK6A 3J80C 2B3TB 2ENAA 2L2NA 1YSAC 4JYAE 1Z5CA 2NN6E 1G2DC 1JK2A 3K1JA 4OO1B 2EPZA 3L7ZA 4IZJD 2YTDA 4MYUA 1LLMC 1Z0CA 1BKNA 5DNLA 2K7IA 2YTNA 2YTFA 3VHTB 4BHCA 2KOUA 2LE2A 2DEJA 1PIEA 2PO2B 4M30A 1MGTA 2HJJA 4JI1E 1Z0TA 1MU5A 4YY3I 4ED4A 1UDQA 4DV5I 1I94E 4LF6E 4JG4A 2EMIA 1Z0VA 2F8BA 4GQUA 4JI8E 1Z1BA 3T1HE 1EA6A 4FW3A 3H4LA 2UU9E 2UXDE 3PYFA 2V89A 5C0XD 3Q6MA 4F9CB 3LTOA 2EPRA 2HFSA 4USMA 3DJWA 2BA1G 1YH8A 5C0XA 1KJKA 3MSWA 1AH5A 2PO0B 4R2PA 4IFDB 1KYQA 2PO1B 2K4VA 3ZM7A 1YYKA 2M9AA 3HQ1A 2DLKA 2LTRA 3ZKDA 4FW7A 4TUIA 5FLXQ 2O3ZA 2BR2B 1DGCA 1XNQI 4BA2A 1YYOA 2IOPA 1Y6ZA 4OZEA 2X36A 2F4VI 2LTSA 4DUZI 5KL3A 2GO3A 5JEAF 4WUDA 5F3WA 2L92A 3P3GA 4B3SE 4O4KA 4DUYE 1FI4A 1P42A 4JI0I 3M7NG 1J26A 2EOZA 2L8TA 3K85A 3V2UC 2C39B 4OO1F 2EPLX 2YSPA 2N3HA 1NHJA 4JV5I 5KL6A 2EMHA 2M7QA 5LLQA 3NZKA 1XHKA 1N33I 3EPJA 3L7ZB 5DNYA 2EJ4A 2Z5BA 3HKMA 5KL2A 3HULA 4FWHA 2ZM6I 2A2CA 4ZYGA 3GLLA 1NZ0A 3KZZA 4OO1E 2EORA 2C38B 3KWRA 3CDIA 3T1YI 2HKJA 4LFCE 2BM1A 4DU7A 2DEIA 4DR4E 1YHCA 2EMBA 3HJCA 2VF1A 4KWYA 1N32I 2L3CA 4B3RE 4DR7E 1UBDC 2EOOA 3EQ1A 5ADZA 1E3HA 4DR1I 1BBGA 1U2RA 4DR5I 2V34A 4DR6E 2EPAA 1N36I 3WU6A 5FLXC 4IFDF 2HK3A 4DKKA 4HTGA 1X5WA 2ENHA 5IWAE 1YZ9A 1L4SA 2EN2A 4MU3A 5TSEA 2M4IA 5CFFE 4DV3I 5LMNE 2A2DA 2YTGA 2EZ6A 4X64I 2EN1A 4N4RB 1N34I 1WXRA 2V2VA 1FJGE 5L3JA 5EL9A 1ZAAC 2EPXA 4BC7A 2CVEA 1RMDA 2LMZA 4JI7E 3H09A 2EOFA 4AM3A 4BMJA 1HNXE 2NUEA 1FWKA 5IT9Q 3PYDA 5JEAD 2UUCE 2A25A 1MG7A 3HPSA 4WXCA 5AASA 1TF6A 2CPNA 4GKKI 2HC5A 2EN3A 4F9BB 1O0WA 1YFHA 3B82A 2EMAA 4X66I 2YRKA 2EWLA 4WSGA 5JEAB 4F9AB 2UUAE 1ZM3A 2UXCE 2IESA 2JEAB 4Q28A 2JXPA 2E5LE 4Q35B 2EM7A 2EMYA 1VISA 2C37A 4GZNC 2RS6A 3DF6A 2EPNA 5A6BA 2L2KB 2NN6D 1NHHA 2LT7A 3C6KA 4JI2I 1GTKA
chains in the Genus database with same CATH topology
1IBKI 2VQEI 4RPFA 4JI3I 2J7KA 2VQEE 1H7SA 1FKAE 2V86A 1X48A 2V88A 2R3VA 1UEKA 2JR1A 3C4BA 1H74A 4DMIA 2O1UA 3J7AM 1B63A 1UHZA 3HTXA 4GKKE 4DV0E 1T4LB 1ZXMA 4LU9A 4WPYA 1EI1A 2UUCI 4USKA 3J80Q 3FIGA 2ZITA 4HY1A 1HNXI 2LJPA 2LRSA 2V87A 4JI7I 3ADIA 2FTXB 2N3GA 5BR8E 3J81C 2IHR1 3AUZA 4DPUA 4I8OA 2M1SA 3PYEA 4DV3E 2KONA 4NXMI 3J7AG 4DPTA 3HXLA 4JI6I 1N36E 4L5NC 1S4EA 4DXLA 1FNMA 4DV6E 4DR6I 4DR5E 3K6QA 1X47A 2HKEA 1N0VC 4X62E 4P78A 4DR1E 1ZBQA 1WHQA 1IBMI 2HHHE 2LUPB 1HNZI 2JWOA 2FV4B 2ZM6E 3PYGA 2O1WA 4LF8E 2L33A 1DARA 4LF9I 4X65E 1Z5AA 1J5EI 4LTYA 1YYWA 2OI2A 2Z5EA 1Y4SA 1KTVA 1USUA 1HNWE 1HNWI 4WYQB 2GS8A 5GMEA 3F0NA 1D6TA 4DUYI 3AV0A 2DB2A 1OJ4A 3VYYA 1ZM9A 4DUZE 3HPZA 1J5EE 4LF9E 2F4VE 4R1FA 4X65I 4LF8I 4OOGC 4UTGA 4IZKB 1XNQE 4FN5A 1HNZE 3ADLA 4I3HA 2HHHI 1ELOA 1IBME 2HFUA 4J8ZA 5A2QQ 4N3OA 2V2QA 4X8WA 4X62I 4DU8A 2DSYA 1SR9A 4DV6I 1ZXNA 2Z5BB 2MC5A 4L8NA 1RC7A 4JI6E 4P7AA 3IWDA 4NXME 2ODRD 2UU9I 1X49A 1Z0WA 3QT6A 4JI1I 4YY3E 4IZJA 2PNMA 5BR8I 2LJHA 1S16A 2IOQA 4WFTA 3C4TA 5GMDA 4DV7E 2JOXA 4BCAA 3ZZ0A 1Z0EA 3QT7A 1Z59A 3P1XA 1Y4UA 4PRVA 4DV0I 4DV4E 4LF7I 5AE1A 1ZBTA 2Z5CB 2LUQA 3JTZA 4LFBE 4F54A 1XMQE 1ZM2A 4B3TI 2V83A 4M0VA 3WU4A 2L2MA 3ADGA 4XTJA 4KZSA 2MDRA 1QU6A 4JI3E 3F6GA 1KKHA 2Q2EB 1Z5BA 1IBKE 4JI2E 3ZZTA 2VE7C 2RS7A 2E1RA 4YHHE 2CZ9A 2E5LI 2UXCI 2UUAI 2DMYA 3JAMC 3B78A 2JVAA 1HR0E 4EMDA 1T4OA 4LF4E 1DQ3A 3VYXA 4K0KE 4B3MI 4M2ZA 2R42A 4X66E 1H73A 1T4NA 3JU0A 3J81Q 1FJGI 1N34E 2AJ4A 3PRYA 4PRXA 3LLHA 1STUA 4X64E 2KHXA 4R8OA 5LMNI 4JI5E 2B7TA 5IWAI 4P7DA 1H72C 4DPWA 4Z7YA 2B9DA 2RSMA 1K47A 2V2ZA 4DR7I 4B3RI 2MC6A 1N32E 3WU3A 4JI4I 2H36X 4DR4I 1KVKA 4LFCI 4DV1E 3CWVA 3T1YE 4WUBA 3ZZUA 2GQ0A 3Q6NA 1Z0GA 2YT4A 4BBYA 4ZVIA 4HACA 3OTOE 1N33E 1EKZA 4JV5E 4KHPE 3K17A 4AQYE 3J7Yp 4JI0E 4B3SI 1H7UA 2VQFE 2NPFA 3B8HA 4URLA 1MX0A 1NHIA 4FWGA 2NA2A 2LBSB 4BS9A 5A2QC 1HK7A 2UUBE 3QT5A 2UUBI 3IWBA 4FW9A 1B62A 1WHNA 3F6HA 1ZM4A 2Z5CA 2O1VA 4IZKA 2BM0A 1UILA 2NUGA 2BV3A 3ZKBA 2UXDI 3ADJA 1RR9A 2VQFI 3T1HI 4R03A 2XEXA 4JI8I 4KQVA 2WZOA 2DIXA 1WUUA 1A6FA 4DV5E 1I94I 4LF6I 4FWDA 4AQYI 4PU9A 4KHPI 5AE2A 4IZJB 5AE3A 3OTOI 4WUCA 3OMLA 1Z0BA 3P06A 3WU5A 4JYAI 4WSPA 4DPXA 3Q1QA 1USVA 4UT4A 5LMUI 2YZTA 2HK2A 4DR3E 4DV1I 2V8PA 4JI4E 4TUGA 3LMLA 4OX9I 2G7HA 2CG9A 4LF5I 2CGEA 4DV2E 4DPYA 4GKJE 4LFAI 3RMPA 4GEQB 4JI5I 1QZRA 2UXBI 1IBLE 1PKPA 1PVGA 4DR2E 4NXNI 2JOBA 3LPSA 4HACB 2O1TA 2VF3A 4HYMA 4X66I 1XNRE 2WW4A 3M6AA 2PNLA 4B3ME 2B7VA 3LNUA 4K0KI 1XMOI 3V5RA 5IT9C 4LF4I 3JAMQ 1HR0I 5FWKA 1N0UA 2L6MA 2V85A 2ODRC 3ZOQB 4YHHI 1XMOE 1RREA 2X7IA 1XNRI 3D4JA 2E1MA 1GQEA 4NXNE 4P52A 2NUFA 4DR2I 2ZBKB 2EFGA 2V8QB 1IBLI 2UXBE 1KIJA 1RQ0A 1FWLA 4LFAE 1DI2A 4GKJI 4MYTA 5T6JA 4DV2I 4B3TE 5LL6R 4LF5E 2FGGA 3QT8A 1XMQI 4OX9E 3IWCA 1GZ6A 2JY9A 4M1KA 4LFBI 4DR3I 4LF7E 4Z7CA 2RTXA 4DV4I 5LMUE 2L3JA 4HXZA 3GONA 4BC9A 4DV7I 3VK6A 3J80C 2B3TB 2L2NA 4JYAE 1Z5CA 3K1JA 4IZJD 4MYUA 1Z0CA 1BKNA 2KOUA 2LE2A 2DEJA 1PIEA 4M30A 1Z0TA 4JI1E 4YY3I 1MU5A 4ED4A 4DV5I 1I94E 4LF6E 4JG4A 1Z0VA 2F8BA 4JI8E 3T1HE 1EA6A 3H4LA 2UU9E 2UXDE 3PYFA 2V89A 3Q6MA 4F9CB 3LTOA 2HFSA 4USMA 3DJWA 3MSWA 2K4VA 3ZM7A 1YYKA 3HQ1A 2LTRA 3ZKDA 4TUIA 5FLXQ 1XNQI 1YYOA 2IOPA 1Y6ZA 2X36A 2F4VI 2LTSA 4DUZI 4WUDA 5F3WA 2L92A 4B3SE 4DUYE 1FI4A 4JI0I 1J26A 2L8TA 3K85A 3V2UC 2N3HA 1NHJA 4JV5I 2M7QA 1XHKA 1N33I 5DNYA 2Z5BA 3HULA 4FWHA 2ZM6I 2A2CA 1NZ0A 3KWRA 3T1YI 2HKJA 4LFCE 2BM1A 4DU7A 2DEIA 4DR4E 3HJCA 2VF1A 1N32I 2L3CA 4B3RE 4DR7E 4DR1I 5ADZA 1U2RA 4DR5I 2V34A 4DR6E 1N36I 3WU6A 5FLXC 2HK3A 4DKKA 1YZ9A 5IWAE 2M4IA 5CFFE 4DV3I 5LMNE 2A2DA 4X64I 2EZ6A 1N34I 1WXRA 2V2VA 1FJGE 5L3JA 4BC7A 2LMZA 4JI7E 3H09A 4BMJA 1HNXE 2NUEA 1FWKA 5IT9Q 3PYDA 2UUCE 1MG7A 3HPSA 5AASA 2CPNA 4GKKI 4F9BB 1O0WA 3B82A 2EWLA 4F9AB 2UUAE 1ZM3A 2UXCE 4Q28A 2E5LE 1VISA 2RS6A 3DF6A 2L2KB 1NHHA 4JI2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK I;  2VQE I;  4RPF A;  4JI3 I;  2J7K A;  2VQE E;  1H7S A;  1FKA E;  1X48 A;  2R3V A;  1UEK A;  3C4B A;  1H74 A;  3J7A M;  1B63 A;  1UHZ A;  3HTX A;  4GKK E;  4DV0 E;  1T4L B;  1ZXM A;  1EI1 A;  2UUC I;  4USK A;  3J80 Q;  2ZIT A;  4HY1 A;  1HNX I;  2LJP A;  2LRS A;  4JI7 I;  3ADI A;  2N3G A;  5BR8 E;  3J81 C;  2IHR 1;  4DPU A;  3PYE A;  4DV3 E;  4NXM I;  3J7A G;  4DPT A;  4JI6 I;  1N36 E;  1S4E A;  4DXL A;  1FNM A;  4DV6 E;  4DR6 I;  4DR5 E;  1X47 A;  2HKE A;  1N0V C;  4X62 E;  4DR1 E;  1WHQ A;  1IBM I;  2HHH E;  2LUP B;  1HNZ I;  3PYG A;  2ZM6 E;  4LF8 E;  2L33 A;  1DAR A;  4LF9 I;  4X65 E;  1Z5A A;  1J5E I;  1YYW A;  2OI2 A;  1KTV A;  1HNW E;  1HNW I;  4WYQ B;  2GS8 A;  5GME A;  3F0N A;  1D6T A;  4DUY I;  2DB2 A;  1OJ4 A;  3VYY A;  1ZM9 A;  4DUZ E;  1J5E E;  4LF9 E;  2F4V E;  4R1F A;  4X65 I;  4LF8 I;  4OOG C;  4UTG A;  1XNQ E;  4FN5 A;  1HNZ E;  3ADL A;  4I3H A;  2HHH I;  1ELO A;  1IBM E;  2HFU A;  5A2Q Q;  2V2Q A;  4X8W A;  4X62 I;  4DU8 A;  4DV6 I;  1ZXN A;  4JI6 E;  1RC7 A;  4P7A A;  4NXM E;  2UU9 I;  1X49 A;  1Z0W A;  3QT6 A;  4JI1 I;  4YY3 E;  5BR8 I;  2LJH A;  1S16 A;  4WFT A;  3C4T A;  5GMD A;  4DV7 E;  3ZZ0 A;  1Z0E A;  3QT7 A;  1Z59 A;  3P1X A;  4PRV A;  4DV0 I;  4DV4 E;  4LF7 I;  1ZBT A;  2LUQ A;  4LFB E;  1XMQ E;  1ZM2 A;  4B3T I;  3WU4 A;  2L2M A;  3ADG A;  4XTJ A;  2MDR A;  1QU6 A;  4JI3 E;  1KKH A;  2Q2E B;  1Z5B A;  1IBK E;  4JI2 E;  3ZZT A;  2RS7 A;  2E1R A;  4YHH E;  2CZ9 A;  2E5L I;  2UXC I;  2UUA I;  2DMY A;  3JAM C;  3B78 A;  2JVA A;  1HR0 E;  4EMD A;  1T4O A;  4LF4 E;  3VYX A;  4K0K E;  4B3M I;  4M2Z A;  2R42 A;  4X66 E;  1H73 A;  1T4N A;  3J81 Q;  1FJG I;  1N34 E;  2AJ4 A;  4PRX A;  3LLH A;  1STU A;  4X64 E;  2KHX A;  5LMN I;  4JI5 E;  2B7T A;  5IWA I;  1H72 C;  4DPW A;  4Z7Y A;  2RSM A;  1K47 A;  2V2Z A;  4DR7 I;  4B3R I;  1N32 E;  3WU3 A;  4JI4 I;  4DR4 I;  1KVK A;  4LFC I;  4DV1 E;  3CWV A;  3T1Y E;  4WUB A;  3ZZU A;  1Z0G A;  2YT4 A;  4ZVI A;  4HAC A;  3OTO E;  1N33 E;  1EKZ A;  4JV5 E;  4KHP E;  3K17 A;  4AQY E;  3J7Y p;  4JI0 E;  4B3S I;  1H7U A;  2VQF E;  2NPF A;  3B8H A;  4URL A;  1MX0 A;  1NHI A;  4FWG A;  2NA2 A;  2LBS B;  5A2Q C;  2UUB E;  3QT5 A;  2UUB I;  4FW9 A;  1B62 A;  1WHN A;  1ZM4 A;  2BM0 A;  1UIL A;  2NUG A;  2BV3 A;  3ZKB A;  2UXD I;  3ADJ A;  1RR9 A;  2VQF I;  3T1H I;  2XEX A;  4JI8 I;  4KQV A;  1I94 I;  2DIX A;  1WUU A;  1A6F A;  4DV5 E;  4LF6 I;  4FWD A;  4AQY I;  4PU9 A;  4KHP I;  3OTO I;  4WUC A;  1Z0B A;  3WU5 A;  4JYA I;  3Q1Q A;  4DPX A;  4UT4 A;  5LMU I;  2HK2 A;  4DR3 E;  4DV1 I;  2V8P A;  4JI4 E;  4OX9 I;  4LF5 I;  4DV2 E;  4DPY A;  4GKJ E;  4LFA I;  4JI5 I;  1QZR A;  2UXB I;  1IBL E;  1PKP A;  1PVG A;  4DR2 E;  4NXN I;  3LPS A;  4HAC B;  2VF3 A;  4X66 I;  4HYM A;  3M6A A;  1XNR E;  2WW4 A;  4B3M E;  2B7V A;  3LNU A;  4K0K I;  1XMO I;  3V5R A;  5IT9 C;  4LF4 I;  3JAM Q;  1HR0 I;  1N0U A;  4YHH I;  1XMO E;  1RRE A;  2X7I A;  1XNR I;  3D4J A;  1GQE A;  4NXN E;  4P52 A;  2NUF A;  4DR2 I;  2ZBK B;  2EFG A;  1IBL I;  2UXB E;  1KIJ A;  1RQ0 A;  1FWL A;  4LFA E;  1DI2 A;  4GKJ I;  4MYT A;  4DV2 I;  4B3T E;  5LL6 R;  4LF5 E;  3QT8 A;  1XMQ I;  4OX9 E;  2JY9 A;  4M1K A;  4LFB I;  4DR3 I;  4LF7 E;  4Z7C A;  2RTX A;  4DV4 I;  5LMU E;  2L3J A;  4HXZ A;  3GON A;  4DV7 I;  3J80 C;  2B3T B;  2L2N A;  4JYA E;  1Z5C A;  3K1J A;  4MYU A;  1Z0C A;  1BKN A;  2DEJ A;  1PIE A;  4M30 A;  1Z0T A;  4JI1 E;  4YY3 I;  1MU5 A;  4ED4 A;  4DV5 I;  1I94 E;  4LF6 E;  4JG4 A;  1Z0V A;  4JI8 E;  3T1H E;  1EA6 A;  3H4L A;  2UU9 E;  2UXD E;  3PYF A;  3LTO A;  2HFS A;  4USM A;  3ZM7 A;  1YYK A;  2LTR A;  3ZKD A;  5FLX Q;  1XNQ I;  1YYO A;  2X36 A;  2F4V I;  2LTS A;  4DUZ I;  4WUD A;  4B3S E;  4DUY E;  1FI4 A;  4JI0 I;  1J26 A;  3V2U C;  2N3H A;  1NHJ A;  4JV5 I;  1XHK A;  1N33 I;  3HUL A;  4FWH A;  2ZM6 I;  2A2C A;  1NZ0 A;  3T1Y I;  2HKJ A;  4LFC E;  2BM1 A;  4DU7 A;  2DEI A;  4DR4 E;  1N32 I;  2L3C A;  4B3R E;  4DR7 E;  4DR1 I;  1U2R A;  4DR5 I;  2V34 A;  4DR6 E;  1N36 I;  3WU6 A;  5FLX C;  2HK3 A;  4DKK A;  1YZ9 A;  5IWA E;  5CFF E;  4DV3 I;  5LMN E;  2A2D A;  4X64 I;  2EZ6 A;  1N34 I;  2V2V A;  1FJG E;  5L3J A;  4JI7 E;  1HNX E;  2NUE A;  1FWK A;  5IT9 Q;  3PYD A;  2UUC E;  1MG7 A;  2CPN A;  4GKK I;  1O0W A;  3B82 A;  2UUA E;  1ZM3 A;  2UXC E;  1VIS A;  2E5L E;  2RS6 A;  2L2K B;  1NHH A;  4JI2 I; 
#chains in the Genus database with same CATH topology
 1IBK I;  2VQE I;  5AC4 A;  4RPF A;  1JK1 A;  3BID A;  1T39 A;  2EPU A;  4JI3 I;  2J7K A;  2VQE E;  1H7S A;  4MU1 A;  1FKA E;  2EOI A;  2V86 A;  1X48 A;  2AE8 A;  1ZU1 A;  1OYP A;  5K36 D;  5K36 A;  2PO2 A;  4ZYH A;  2V88 A;  2R3V A;  1UEK A;  2VES A;  2JR1 A;  3C6M A;  3C4B A;  1H74 A;  5C0X E;  4DMI A;  2O1U A;  2EPO A;  3J7A M;  5IV8 B;  1B63 A;  2BA1 D;  1UHZ A;  5A6K A;  2EN7 A;  2EMX A;  3HTX A;  4WXD A;  2EMZ A;  4GKK E;  4DV0 E;  1T4L B;  1ZXM A;  4LU9 A;  4WPY A;  1EI1 A;  2UUC I;  4USK A;  3J80 Q;  3FIG A;  2ZIT A;  2EL4 A;  4HY1 A;  2EM9 A;  4FW5 A;  1HNX I;  2LJP A;  2LRS A;  2V87 A;  4MQY A;  2GLI A;  2EMC A;  3ADI A;  2FTX B;  2N3G A;  4JI7 I;  4ZYE A;  2EMK A;  5BR8 E;  1T38 A;  3J81 C;  2IHR 1;  3AUZ A;  1A1H A;  4LCH A;  4DPU A;  4I8O A;  2M1S A;  3PYE A;  4DV3 E;  1IMU A;  1A1L A;  2EN4 A;  2EOY A;  2WP8 A;  2KON A;  4NXM I;  3J7A G;  2EM4 A;  2RSI A;  2JPA A;  2EM3 A;  3HXL A;  4DPT A;  1N36 E;  3BGH A;  4L5N C;  1S4E A;  4DXL A;  1TN9 A;  4DV6 E;  1FNM A;  4DR5 E;  2JEB A;  1N3G A;  3K6Q A;  1X47 A;  2VRD A;  2HKE A;  4LOM A;  2CSH A;  4X62 E;  1N0V C;  4P78 A;  4DR1 E;  1ZBQ A;  1A1K A;  3EPH A;  2LV2 A;  5KL7 A;  1XXE A;  1WHQ A;  4AID A;  2JE6 A;  1IBM I;  2EM0 A;  2EOX A;  2HHH E;  2LUP B;  2DMI A;  5K36 F;  1HNZ I;  2JWO A;  5C0X F;  2FV4 B;  2ZM6 E;  3PYG A;  2O1W A;  4LF8 E;  2L33 A;  1DAR A;  4LF9 I;  4X65 E;  1Z5A A;  1J5E I;  4LTY A;  2BA0 G;  1YYW A;  3U1Y A;  2ENC A;  1G2F C;  1A1F A;  2NN6 F;  2OI2 A;  2Z5E A;  4M9V C;  1KTV A;  1Y4S A;  1USU A;  1HNW E;  1HNW I;  4WYQ B;  1YUI A;  2GS8 A;  5GME A;  3F0N A;  1D6T A;  4DUY I;  2EPK X;  2YPN A;  2YTI A;  3AV0 A;  2DB2 A;  1OJ4 A;  3VYY A;  1ZM9 A;  4DUZ E;  3HPZ A;  1J5E E;  4LF9 E;  2F4V E;  4R1F A;  4X65 I;  1A1G A;  4LF8 I;  4OOG C;  4IJD A;  2EPM X;  4UTG A;  4IZK B;  1XNQ E;  4FN5 A;  1HNZ E;  3ADL A;  4I3H A;  2HHH I;  1ELO A;  4HEI A;  1IBM E;  2YU8 A;  4WX9 A;  2HFU A;  4J8Z A;  5A2Q Q;  5JEA E;  5JEA A;  2JEA A;  2C38 A;  4N3O A;  2LVH A;  4RH8 A;  2V2Q A;  2YRM A;  4X8W A;  1OYS A;  4U3B A;  4DU8 A;  4X62 I;  1NCS A;  2DSY A;  1SR9 A;  2PNZ A;  3MHH C;  1P47 A;  4DV6 I;  1ZXN A;  2Z5B B;  2MC5 A;  4L8N A;  1RC7 A;  4JI6 E;  1UDS A;  4P7A A;  3IWD A;  4NXM E;  2ODR D;  2UU9 I;  1X49 A;  1Z0W A;  5K36 B;  4F6N A;  3P76 A;  2YSO A;  2NN6 A;  3QT6 A;  5A6B D;  4JI1 I;  4YY3 E;  1OYR A;  1YUJ A;  2PNM A;  4IZJ A;  5BR8 I;  2NAB A;  2LJH A;  1S16 A;  2IOQ A;  4WFT A;  1BB8 A;  5C0X C;  4J3D A;  5JEA C;  3C4T A;  1QNT A;  5GMD A;  4DV7 E;  2JOX A;  4BCA A;  3ZZ0 A;  2HGH A;  1WJP A;  1Z0E A;  3QT7 A;  4IFD D;  4ZYD A;  1UDN A;  3P1X A;  1Y4U A;  1Z59 A;  2PO0 A;  3P3C A;  4DV4 E;  4PRV A;  4DV0 I;  1RHY A;  4LF7 I;  3THO B;  1UDO A;  4O24 A;  5AE1 A;  1ZBT A;  1UN6 B;  4QNK A;  2Z5C B;  2LUQ A;  3JTZ A;  4LFB E;  2WBT A;  4F54 A;  1XMQ E;  4LPF A;  5KL4 A;  2EN8 A;  2NN6 C;  2EOH A;  2J7J A;  2EOQ A;  1ZM2 A;  2EE8 A;  3PS3 A;  2V83 A;  4M0V A;  4B3T I;  4U3D A;  1VI7 A;  2L2M A;  2R1F A;  3ADG A;  3WU4 A;  5DNX A;  1TF3 A;  2C39 A;  3MHS C;  2E72 A;  4ISA A;  5A6J A;  2JT2 A;  4KZS A;  4XTJ A;  2MDR A;  1QU6 A;  4JI3 E;  3F6G A;  2EQ1 A;  1X6F A;  3M99 B;  2EMW A;  2LO3 A;  4RHB B;  1KKH A;  1Z5B A;  2Q2E B;  1IBK E;  5KL5 A;  4IS9 A;  4JI2 E;  4MU4 A;  3ZZT A;  1PDA A;  2VE7 C;  2DGC A;  3UHM A;  3THN A;  1X6H A;  4X9J A;  1EH6 A;  5DRQ A;  5AC5 A;  2RS7 A;  2E1R A;  4MLV A;  4YHH E;  3UK3 C;  2D9H A;  2CZ9 A;  2E5L I;  2UXC I;  4R2Q A;  2UUA I;  4IFD A;  4OO1 C;  2Q8U A;  2YTQ A;  4O43 A;  2DMY A;  3JAM C;  3B78 A;  1X3C A;  1A1J A;  1IQO A;  2EM8 A;  2JVA A;  2I9I A;  1HR0 E;  2EP3 A;  4LCF A;  4EMD A;  1T4O A;  4LF4 E;  4BA1 A;  4MLQ A;  2EQ3 A;  4FW6 A;  1DQ3 A;  3VYX A;  4K0K E;  4B3M I;  4OKG A;  4M2Z A;  2EPP A;  2R42 A;  3ECR A;  4X66 E;  4NBQ A;  4R2S A;  1T4N A;  1H73 A;  3JU0 A;  2WNR B;  3J81 Q;  1FJG I;  5A6A A;  1N34 E;  2AJ4 A;  3PRY A;  4PRX A;  3LLH A;  1STU A;  4X64 E;  2KHX A;  4R8O A;  5LMN I;  4JI5 E;  4OO1 A;  2B7T A;  1WRJ A;  4IFD C;  3KRN A;  4QNJ A;  5IWA I;  4P7D A;  3PS2 A;  2BA0 D;  4R2R A;  5K36 E;  4BHB A;  1H72 C;  4DPW A;  2WNR A;  4Z7Y A;  2B9D A;  4DV7 I;  2RSM A;  1K47 A;  2V2Z A;  3KZY A;  3DD6 A;  2GO4 A;  4BA2 B;  4DR7 I;  4B3R I;  2WBU A;  2MC6 A;  1N32 E;  3WU3 A;  2DLQ A;  4JI4 I;  2ADR A;  2H36 X;  2WBS A;  4DR4 I;  2EN6 A;  1KVK A;  4LFC I;  3B4T A;  4DV1 E;  2WP8 B;  3T1Y E;  3CWV A;  4WUB A;  4IFD E;  3ZZU A;  2GQ0 A;  3Q6N A;  1Z0G A;  3EPL A;  2YT4 A;  2WCC 3;  2F1D A;  4BBY A;  4ZVI A;  4HAC A;  4FK5 C;  2YTP A;  3OTO E;  1N33 E;  2IER A;  4MU0 A;  1EKZ A;  4JV5 E;  4KHP E;  3K17 A;  4AQY E;  3J7Y p;  5K36 C;  4JI0 E;  4B3S I;  2YU5 A;  1H7U A;  2EM2 A;  2EOM A;  2EL6 A;  2VQF E;  2EMF A;  1R6M A;  2NPF A;  3B8H A;  4URL A;  1MX0 A;  3BF2 A;  1NHI A;  2N8X A;  5DRP A;  4FWG A;  2EM5 A;  2NA2 A;  2LBS B;  2RQL A;  1MEY C;  4BS9 A;  2EL5 A;  2BBG A;  5A2Q C;  3EPK A;  1HK7 A;  4LCG A;  2UUB E;  3QT5 A;  2UUB I;  3IWB A;  1IQS A;  4FW9 A;  3GME A;  1B62 A;  1WHN A;  3H1C A;  4O5G A;  2JEB B;  3GCM A;  2EOS A;  3F6H A;  4DR6 I;  1ZM4 A;  2Z5C A;  2O1V A;  4IZK A;  2BM0 A;  3TQM A;  1UIL A;  2NUG A;  2BV3 A;  3ZKB A;  2YTE A;  2YTJ A;  3ADJ A;  1RR9 A;  2UXD I;  2VQF I;  1NEI A;  3T1H I;  2YRH A;  4R03 A;  2XEX A;  4FW4 A;  4JI8 I;  1ZR9 A;  2EMG A;  2CTD A;  4KQV A;  2WZO A;  2DIX A;  1WUU A;  4NZV A;  4DV5 E;  1A6F A;  1I94 I;  4FWD A;  1X6E A;  4LF6 I;  1A1I A;  4AQY I;  2GPI A;  4F2J C;  4PU9 A;  1EH7 A;  4KHP I;  5DRO A;  4R2E A;  5AE2 A;  2ELZ A;  4IZJ B;  5AE3 A;  3OTO I;  4IS1 C;  4WUC A;  3OML A;  2EML A;  5A69 A;  1Z0B A;  3QG5 C;  4NHR A;  2YTO A;  3P06 A;  2EOJ A;  3WU5 A;  4JYA I;  2NN6 B;  4WSP A;  4DPX A;  3Q1Q A;  1USV A;  1E3P A;  4UT4 A;  5LMU I;  2YZT A;  1PJS A;  2HK2 A;  4DR3 E;  2JE6 B;  4DV1 I;  2V8P A;  5EKW A;  1Y5Y A;  4JI4 E;  4TUG A;  2R76 A;  3LML A;  4MDT A;  3P3E A;  2G7H A;  2PNZ B;  4OX9 I;  2CG9 A;  4LF5 I;  1F2I G;  2CGE A;  4DV2 E;  4DPY A;  4GKJ E;  2JP9 A;  4LFA I;  3RMP A;  3PS1 A;  4GEQ B;  4JI5 I;  1QZR A;  2UXB I;  1IBL E;  1PKP A;  2PRT A;  3BBG A;  1PVG A;  2ELY A;  4DR2 E;  4JI6 I;  4NXN I;  2JOB A;  1AAY A;  3LPS A;  4HAC B;  2O1T A;  2VF3 A;  4HYM A;  5IXM B;  1XNR E;  2WW4 A;  3M6A A;  3L00 A;  2PNL A;  4B3M E;  2B7V A;  3LNU A;  4K0K I;  1XMO I;  1YPN A;  3V5R A;  2LCE A;  2RPC A;  5IT9 C;  1R6L A;  1Y60 A;  4LF4 I;  1PJT A;  3JAM Q;  1HR0 I;  5FWK A;  1N0U A;  2L6M A;  2EM6 A;  2V85 A;  5DRR A;  2ODR C;  2GHF A;  3ZOQ B;  4YHH I;  3M85 D;  1XMO E;  1RRE A;  2X7I A;  1SFE A;  1XNR I;  2I13 A;  2EQ0 A;  3D4J A;  4AIM A;  2E1M A;  5ELW A;  1GQE A;  4NXN E;  4P52 A;  2DRP A;  2NUF A;  1EH8 A;  3CDJ A;  4DR2 I;  2ZBK B;  2EFG A;  2V8Q B;  4F6M A;  1IBL I;  2UXB E;  4R2D A;  2BR2 A;  1KIJ A;  4OO1 D;  3M7N D;  1RQ0 A;  1FWL A;  2LJU A;  4LFA E;  1DI2 A;  4R2C A;  2MDG A;  4GKJ I;  2BB8 A;  2PO1 A;  4MYT A;  5T6J A;  4BA1 B;  4DV2 I;  3U1K A;  4B3T E;  3M85 G;  5C0X B;  5LL6 R;  2C37 B;  4LF5 E;  2FGG A;  1B69 A;  3QT8 A;  1XMQ I;  4OX9 E;  3IWC A;  2EPC A;  1GZ6 A;  2YWQ A;  2JY9 A;  4R2A A;  4M1K A;  4LFB I;  2MKN A;  2MKD A;  2CT1 A;  4DR3 I;  4LF7 E;  4Z7C A;  2RTX A;  4DV4 I;  2EOE A;  1PJQ A;  5LMU E;  2L3J A;  1BBO A;  2J65 A;  4HXZ A;  3GON A;  4BC9 A;  2JYA A;  3VK6 A;  3J80 C;  2B3T B;  2ENA A;  2L2N A;  1YSA C;  4JYA E;  1Z5C A;  2NN6 E;  1G2D C;  1JK2 A;  3K1J A;  4OO1 B;  2EPZ A;  3L7Z A;  4IZJ D;  2YTD A;  4MYU A;  1LLM C;  1Z0C A;  1BKN A;  5DNL A;  2K7I A;  2YTN A;  2YTF A;  3VHT B;  4BHC A;  2KOU A;  2LE2 A;  2DEJ A;  1PIE A;  2PO2 B;  4M30 A;  1MGT A;  2HJJ A;  4JI1 E;  1Z0T A;  1MU5 A;  4YY3 I;  4ED4 A;  1UDQ A;  4DV5 I;  1I94 E;  4LF6 E;  4JG4 A;  2EMI A;  1Z0V A;  2F8B A;  4GQU A;  4JI8 E;  1Z1B A;  3T1H E;  1EA6 A;  4FW3 A;  3H4L A;  2UU9 E;  2UXD E;  3PYF A;  2V89 A;  5C0X D;  3Q6M A;  4F9C B;  3LTO A;  2EPR A;  2HFS A;  4USM A;  3DJW A;  2BA1 G;  1YH8 A;  5C0X A;  1KJK A;  3MSW A;  1AH5 A;  2PO0 B;  4R2P A;  4IFD B;  1KYQ A;  2PO1 B;  2K4V A;  3ZM7 A;  1YYK A;  2M9A A;  3HQ1 A;  2DLK A;  2LTR A;  3ZKD A;  4FW7 A;  4TUI A;  5FLX Q;  2O3Z A;  2BR2 B;  1DGC A;  1XNQ I;  4BA2 A;  1YYO A;  2IOP A;  1Y6Z A;  4OZE A;  2X36 A;  2F4V I;  2LTS A;  4DUZ I;  5KL3 A;  2GO3 A;  5JEA F;  4WUD A;  5F3W A;  2L92 A;  3P3G A;  4B3S E;  4O4K A;  4DUY E;  1FI4 A;  1P42 A;  4JI0 I;  3M7N G;  1J26 A;  2EOZ A;  2L8T A;  3K85 A;  3V2U C;  2C39 B;  4OO1 F;  2EPL X;  2YSP A;  2N3H A;  1NHJ A;  4JV5 I;  5KL6 A;  2EMH A;  2M7Q A;  5LLQ A;  3NZK A;  1XHK A;  1N33 I;  3EPJ A;  3L7Z B;  5DNY A;  2EJ4 A;  2Z5B A;  3HKM A;  5KL2 A;  3HUL A;  4FWH A;  2ZM6 I;  2A2C A;  4ZYG A;  3GLL A;  1NZ0 A;  3KZZ A;  4OO1 E;  2EOR A;  2C38 B;  3KWR A;  3CDI A;  3T1Y I;  2HKJ A;  4LFC E;  2BM1 A;  4DU7 A;  2DEI A;  4DR4 E;  1YHC A;  2EMB A;  3HJC A;  2VF1 A;  4KWY A;  1N32 I;  2L3C A;  4B3R E;  4DR7 E;  1UBD C;  2EOO A;  3EQ1 A;  5ADZ A;  1E3H A;  4DR1 I;  1BBG A;  1U2R A;  4DR5 I;  2V34 A;  4DR6 E;  2EPA A;  1N36 I;  3WU6 A;  5FLX C;  4IFD F;  2HK3 A;  4DKK A;  4HTG A;  1X5W A;  2ENH A;  5IWA E;  1YZ9 A;  1L4S A;  2EN2 A;  4MU3 A;  5TSE A;  2M4I A;  5CFF E;  4DV3 I;  5LMN E;  2A2D A;  2YTG A;  2EZ6 A;  4X64 I;  2EN1 A;  4N4R B;  1N34 I;  1WXR A;  2V2V A;  1FJG E;  5L3J A;  5EL9 A;  1ZAA C;  2EPX A;  4BC7 A;  2CVE A;  1RMD A;  2LMZ A;  4JI7 E;  3H09 A;  2EOF A;  4AM3 A;  4BMJ A;  1HNX E;  2NUE A;  1FWK A;  5IT9 Q;  3PYD A;  5JEA D;  2UUC E;  2A25 A;  1MG7 A;  3HPS A;  4WXC A;  5AAS A;  1TF6 A;  2CPN A;  4GKK I;  2HC5 A;  2EN3 A;  4F9B B;  1O0W A;  1YFH A;  3B82 A;  2EMA A;  4X66 I;  2YRK A;  2EWL A;  4WSG A;  5JEA B;  4F9A B;  2UUA E;  1ZM3 A;  2UXC E;  2IES A;  2JEA B;  4Q28 A;  2JXP A;  2E5L E;  4Q35 B;  2EM7 A;  2EMY A;  1VIS A;  2C37 A;  4GZN C;  2RS6 A;  3DF6 A;  2EPN A;  5A6B A;  2L2K B;  2NN6 D;  1NHH A;  2LT7 A;  3C6K A;  4JI2 I;  1GTK A; 
#chains in the Genus database with same CATH homology
 1IBK I;  2VQE I;  4RPF A;  4JI3 I;  2J7K A;  2VQE E;  1H7S A;  1FKA E;  2V86 A;  1X48 A;  2V88 A;  2R3V A;  1UEK A;  2JR1 A;  3C4B A;  1H74 A;  4DMI A;  2O1U A;  3J7A M;  1B63 A;  1UHZ A;  3HTX A;  4GKK E;  4DV0 E;  1T4L B;  1ZXM A;  4LU9 A;  4WPY A;  1EI1 A;  2UUC I;  4USK A;  3J80 Q;  3FIG A;  2ZIT A;  4HY1 A;  1HNX I;  2LJP A;  2LRS A;  2V87 A;  4JI7 I;  3ADI A;  2FTX B;  2N3G A;  5BR8 E;  3J81 C;  2IHR 1;  3AUZ A;  4DPU A;  4I8O A;  2M1S A;  3PYE A;  4DV3 E;  2KON A;  4NXM I;  3J7A G;  4DPT A;  3HXL A;  4JI6 I;  1N36 E;  4L5N C;  1S4E A;  4DXL A;  1FNM A;  4DV6 E;  4DR6 I;  4DR5 E;  3K6Q A;  1X47 A;  2HKE A;  1N0V C;  4X62 E;  4P78 A;  4DR1 E;  1ZBQ A;  1WHQ A;  1IBM I;  2HHH E;  2LUP B;  1HNZ I;  2JWO A;  2FV4 B;  2ZM6 E;  3PYG A;  2O1W A;  4LF8 E;  2L33 A;  1DAR A;  4LF9 I;  4X65 E;  1Z5A A;  1J5E I;  4LTY A;  1YYW A;  2OI2 A;  2Z5E A;  1Y4S A;  1KTV A;  1USU A;  1HNW E;  1HNW I;  4WYQ B;  2GS8 A;  5GME A;  3F0N A;  1D6T A;  4DUY I;  3AV0 A;  2DB2 A;  1OJ4 A;  3VYY A;  1ZM9 A;  4DUZ E;  3HPZ A;  1J5E E;  4LF9 E;  2F4V E;  4R1F A;  4X65 I;  4LF8 I;  4OOG C;  4UTG A;  4IZK B;  1XNQ E;  4FN5 A;  1HNZ E;  3ADL A;  4I3H A;  2HHH I;  1ELO A;  1IBM E;  2HFU A;  4J8Z A;  5A2Q Q;  4N3O A;  2V2Q A;  4X8W A;  4X62 I;  4DU8 A;  2DSY A;  1SR9 A;  4DV6 I;  1ZXN A;  2Z5B B;  2MC5 A;  4L8N A;  1RC7 A;  4JI6 E;  4P7A A;  3IWD A;  4NXM E;  2ODR D;  2UU9 I;  1X49 A;  1Z0W A;  3QT6 A;  4JI1 I;  4YY3 E;  4IZJ A;  2PNM A;  5BR8 I;  2LJH A;  1S16 A;  2IOQ A;  4WFT A;  3C4T A;  5GMD A;  4DV7 E;  2JOX A;  4BCA A;  3ZZ0 A;  1Z0E A;  3QT7 A;  1Z59 A;  3P1X A;  1Y4U A;  4PRV A;  4DV0 I;  4DV4 E;  4LF7 I;  5AE1 A;  1ZBT A;  2Z5C B;  2LUQ A;  3JTZ A;  4LFB E;  4F54 A;  1XMQ E;  1ZM2 A;  4B3T I;  2V83 A;  4M0V A;  3WU4 A;  2L2M A;  3ADG A;  4XTJ A;  4KZS A;  2MDR A;  1QU6 A;  4JI3 E;  3F6G A;  1KKH A;  2Q2E B;  1Z5B A;  1IBK E;  4JI2 E;  3ZZT A;  2VE7 C;  2RS7 A;  2E1R A;  4YHH E;  2CZ9 A;  2E5L I;  2UXC I;  2UUA I;  2DMY A;  3JAM C;  3B78 A;  2JVA A;  1HR0 E;  4EMD A;  1T4O A;  4LF4 E;  1DQ3 A;  3VYX A;  4K0K E;  4B3M I;  4M2Z A;  2R42 A;  4X66 E;  1H73 A;  1T4N A;  3JU0 A;  3J81 Q;  1FJG I;  1N34 E;  2AJ4 A;  3PRY A;  4PRX A;  3LLH A;  1STU A;  4X64 E;  2KHX A;  4R8O A;  5LMN I;  4JI5 E;  2B7T A;  5IWA I;  4P7D A;  1H72 C;  4DPW A;  4Z7Y A;  2B9D A;  2RSM A;  1K47 A;  2V2Z A;  4DR7 I;  4B3R I;  2MC6 A;  1N32 E;  3WU3 A;  4JI4 I;  2H36 X;  4DR4 I;  1KVK A;  4LFC I;  4DV1 E;  3CWV A;  3T1Y E;  4WUB A;  3ZZU A;  2GQ0 A;  3Q6N A;  1Z0G A;  2YT4 A;  4BBY A;  4ZVI A;  4HAC A;  3OTO E;  1N33 E;  1EKZ A;  4JV5 E;  4KHP E;  3K17 A;  4AQY E;  3J7Y p;  4JI0 E;  4B3S I;  1H7U A;  2VQF E;  2NPF A;  3B8H A;  4URL A;  1MX0 A;  1NHI A;  4FWG A;  2NA2 A;  2LBS B;  4BS9 A;  5A2Q C;  1HK7 A;  2UUB E;  3QT5 A;  2UUB I;  3IWB A;  4FW9 A;  1B62 A;  1WHN A;  3F6H A;  1ZM4 A;  2Z5C A;  2O1V A;  4IZK A;  2BM0 A;  1UIL A;  2NUG A;  2BV3 A;  3ZKB A;  2UXD I;  3ADJ A;  1RR9 A;  2VQF I;  3T1H I;  4R03 A;  2XEX A;  4JI8 I;  4KQV A;  2WZO A;  2DIX A;  1WUU A;  1A6F A;  4DV5 E;  1I94 I;  4LF6 I;  4FWD A;  4AQY I;  4PU9 A;  4KHP I;  5AE2 A;  4IZJ B;  5AE3 A;  3OTO I;  4WUC A;  3OML A;  1Z0B A;  3P06 A;  3WU5 A;  4JYA I;  4WSP A;  4DPX A;  3Q1Q A;  1USV A;  4UT4 A;  5LMU I;  2YZT A;  2HK2 A;  4DR3 E;  4DV1 I;  2V8P A;  4JI4 E;  4TUG A;  3LML A;  4OX9 I;  2G7H A;  2CG9 A;  4LF5 I;  2CGE A;  4DV2 E;  4DPY A;  4GKJ E;  4LFA I;  3RMP A;  4GEQ B;  4JI5 I;  1QZR A;  2UXB I;  1IBL E;  1PKP A;  1PVG A;  4DR2 E;  4NXN I;  2JOB A;  3LPS A;  4HAC B;  2O1T A;  2VF3 A;  4HYM A;  4X66 I;  1XNR E;  2WW4 A;  3M6A A;  2PNL A;  4B3M E;  2B7V A;  3LNU A;  4K0K I;  1XMO I;  3V5R A;  5IT9 C;  4LF4 I;  3JAM Q;  1HR0 I;  5FWK A;  1N0U A;  2L6M A;  2V85 A;  2ODR C;  3ZOQ B;  4YHH I;  1XMO E;  1RRE A;  2X7I A;  1XNR I;  3D4J A;  2E1M A;  1GQE A;  4NXN E;  4P52 A;  2NUF A;  4DR2 I;  2ZBK B;  2EFG A;  2V8Q B;  1IBL I;  2UXB E;  1KIJ A;  1RQ0 A;  1FWL A;  4LFA E;  1DI2 A;  4GKJ I;  4MYT A;  5T6J A;  4DV2 I;  4B3T E;  5LL6 R;  4LF5 E;  2FGG A;  3QT8 A;  1XMQ I;  4OX9 E;  3IWC A;  1GZ6 A;  2JY9 A;  4M1K A;  4LFB I;  4DR3 I;  4LF7 E;  4Z7C A;  2RTX A;  4DV4 I;  5LMU E;  2L3J A;  4HXZ A;  3GON A;  4BC9 A;  4DV7 I;  3VK6 A;  3J80 C;  2B3T B;  2L2N A;  4JYA E;  1Z5C A;  3K1J A;  4IZJ D;  4MYU A;  1Z0C A;  1BKN A;  2KOU A;  2LE2 A;  2DEJ A;  1PIE A;  4M30 A;  1Z0T A;  4JI1 E;  4YY3 I;  1MU5 A;  4ED4 A;  4DV5 I;  1I94 E;  4LF6 E;  4JG4 A;  1Z0V A;  2F8B A;  4JI8 E;  3T1H E;  1EA6 A;  3H4L A;  2UU9 E;  2UXD E;  3PYF A;  2V89 A;  3Q6M A;  4F9C B;  3LTO A;  2HFS A;  4USM A;  3DJW A;  3MSW A;  2K4V A;  3ZM7 A;  1YYK A;  3HQ1 A;  2LTR A;  3ZKD A;  4TUI A;  5FLX Q;  1XNQ I;  1YYO A;  2IOP A;  1Y6Z A;  2X36 A;  2F4V I;  2LTS A;  4DUZ I;  4WUD A;  5F3W A;  2L92 A;  4B3S E;  4DUY E;  1FI4 A;  4JI0 I;  1J26 A;  2L8T A;  3K85 A;  3V2U C;  2N3H A;  1NHJ A;  4JV5 I;  2M7Q A;  1XHK A;  1N33 I;  5DNY A;  2Z5B A;  3HUL A;  4FWH A;  2ZM6 I;  2A2C A;  1NZ0 A;  3KWR A;  3T1Y I;  2HKJ A;  4LFC E;  2BM1 A;  4DU7 A;  2DEI A;  4DR4 E;  3HJC A;  2VF1 A;  1N32 I;  2L3C A;  4B3R E;  4DR7 E;  4DR1 I;  5ADZ A;  1U2R A;  4DR5 I;  2V34 A;  4DR6 E;  1N36 I;  3WU6 A;  5FLX C;  2HK3 A;  4DKK A;  1YZ9 A;  5IWA E;  2M4I A;  5CFF E;  4DV3 I;  5LMN E;  2A2D A;  4X64 I;  2EZ6 A;  1N34 I;  1WXR A;  2V2V A;  1FJG E;  5L3J A;  4BC7 A;  2LMZ A;  4JI7 E;  3H09 A;  4BMJ A;  1HNX E;  2NUE A;  1FWK A;  5IT9 Q;  3PYD A;  2UUC E;  1MG7 A;  3HPS A;  5AAS A;  2CPN A;  4GKK I;  4F9B B;  1O0W A;  3B82 A;  2EWL A;  4F9A B;  2UUA E;  1ZM3 A;  2UXC E;  4Q28 A;  2E5L E;  1VIS A;  2RS6 A;  3DF6 A;  2L2K B;  1NHH A;  4JI2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...