1J5EE

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1j5eE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1j5eE02
4K0KE 4X8WA 1X48A 1YZ9A 2GS8A 3ZKBA 1HNWI 2F4VE 2Q2EB 1HR0E 4LF7E 2MDRA 4B3RI 4URLA 4DKKA 4DUYE 1IBKI 1FKAE 4I3HA 1N34E 5BR8I 2NUGA 1J5EE 1NHJA 3PYGA 1UHZA 4Z7YA 1N32I 2RS6A 1DI2A 2RS7A 3B78A 4MYUA 4X65E 1VISA 1J5EI 4KQVA 4YY3E 5IWAI 3OTOI 3K17A 4JI4E 4JI0E 4DPUA 2NPFA 3LLHA 4LF4I 2R42A 2X7IA 1H7UA 1ZXMA 4LF9E 2AJ4A 2HKEA 4LF6I 1XNRE 2LJPA 2V2QA 4FWDA 1PVGA 1HNXI 1B62A 1J26A 2LUPB 4DXLA 4DR1E 1HNXE 4OX9I 1ELOA 4JI2E 1XMQE 4B3TI 4DR2E 4M2ZA 3WU5A 3VYXA 4X64I 4B3TE 1KKHA 2ZITA 4JYAI 4X62E 2CPNA 2L33A 1Z5AA 4DV5E 4JI7I 4DV7I 4HY1A 4JV5E 1N0VC 3T1YI 4LF8I 3B8HA 1N34I 5BR8E 3C4BA 1RC7A 2DIXA 4DV2I 4P52A 2X36A 2HFSA 3HTXA 1HR0I 2UUAE 1PIEA 2DEIA 4WUDA 2VF3A 1EI1A 4HACB 3WU6A 5CFFE 1BKNA 4DV1E 1YYKA 1UILA 2JY9A 4YHHE 3J7AG 4X65I 4DR5I 3WU4A 4WYQB 1MG7A 4LFBI 4DV0I 4JI6E 4LF5I 4DV6I 4JI0I 4X66E 5LL6R 2YT4A 2EFGA 4KHPE 4X66I 2RTXA 2R3VA 5A2QC 3PYFA 1T4LB 4M1KA 3F0NA 2HFUA 3J81Q 1FJGI 1D6TA 4DR2I 4LFCI 1Z0GA 4UT4A 1FNMA 1EA6A 4USKA 4NXMI 2E5LI 1O0WA 4DUZI 2LTSA 2L2NA 2UXDE 1FWLA 4B3RE 1XMOI 1HNZE 4LF9I 1Z0VA 2ZM6E 4JV5I 4GKJI 1FI4A 4YY3I 2L2MA 3ADIA 1H7SA 1WHQA 4P7AA 2ZM6I 4JI1I 4UTGA 1Z5CA 5IWAE 3OTOE 4DR4I 1GQEA 2N3GA 4DV0E 2BM1A 4DR6I 4DPWA 3QT6A 3ADGA 2J7KA 3ADLA 1UEKA 1Z0WA 2E1RA 5LMUI 3PYDA 2A2DA 3V2UC 4YHHI 1U2RA 4LFAI 1HNZI 5L3JA 1Z0TA 2A2CA 4JG4A 4JI6I 1OJ4A 2HKJA 4HXZA 1XNQI 4GKJE 1YYWA 1ZM3A 1XMQI 3VYYA 3J81C 3LNUA 5A2QQ 2UUAI 2WW4A 2B7VA 3ZZ0A 4DR3E 3JAMC 4JYAE 1B63A 2LTRA 2XEXA 1Z0CA 2V34A 4DV3I 4HACA 2HK3A 4DV4E 1IBKE 3ZM7A 2KHXA 2LRSA 4LFBE 2UUCE 2V2ZA 3V5RA 1S16A 4DV4I 4HYMA 4OOGC 4DV1I 4JI8E 5GMDA 1A6FA 3ADJA 2ZBKB 4FWGA 1Z5BA 4NXNE 3J80C 2RSMA 4JI3E 2BV3A 3T1HE 1IBMI 4B3MI 2NA2A 4DR7E 3J7Yp 1KIJA 4AQYI 5LMUE 1DARA 4NXME 4WUBA 4JI3I 2B3TB 4PU9A 4LF6E 1XNRI 1PKPA 3D4JA 2IHR1 2L3JA 2HK2A 2BM0A 3P1XA 1ZM4A 3H4LA 4JI7E 4DV5I 2UXCI 2UUCI 2HHHE 4FN5A 3T1YE 2LJHA 2EZ6A 1QZRA 4DU7A 1MX0A 1N0UA 4LFCE 2UXCE 1NHIA 1STUA 2DEJA 4DUYI 1RQ0A 1N32E 1QU6A 4M30A 4FW9A 4JI1E 2N3HA 3QT5A 1IBME 3J80Q 4DR7I 2VQEE 4B3SI 1H73A 5GMEA 1N36E 1KTVA 4LF4E 1XMOE 4MYTA 5FLXQ 3QT8A 5LMNI 1H72C 4XTJA 1S4EA 4WUCA 4JI8I 1NZ0A 2LBSB 4LFAE 3LTOA 2L2KB 1IBLI 2UXBI 4NXNI 5FLXC 2L3CA 1Z0EA 4PRXA 3T1HI 2OI2A 4JI4I 4OX9E 4ED4A 1I94I 1FJGE 4FWHA 2VQFI 3WU3A 3JAMQ 4DR6E 1T4OA 4LF7I 4GKKE 3ZZTA 1N33I 4DV3E 2NUEA 4X64E 2HHHI 1X47A 2LUQA 4GKKI 4X62I 3C4TA 4EMDA 5LMNE 2UXDI 1EKZA 3LPSA 1Z0BA 1ZBTA 2V2VA 4DR1I 4ZVIA 4DPYA 3J7AM 3CWVA 4DPTA 2CZ9A 4DR3I 2UU9I 4PRVA 2E5LE 4WFTA 2VQEI 5IT9Q 3GONA 2VQFE 3PYEA 1XHKA 1WUUA 4DUZE 1N36I 4Z7CA 4DV7E 4RPFA 1X49A 1NHHA 3B82A 2NUFA 2UUBE 4JI5E 4LF8E 2DMYA 3ZKDA 1ZM9A 1HNWE 1ZXNA 1ZM2A 4R1FA 1N33E 1RR9A 4LF5E 2DB2A 2UUBI 4B3SE 4DU8A 4JI5I 4DV2E 4DR5E 5IT9C 1H74A 3M6AA 4JI2I 1WHNA 4DV6E 4DPXA 4USMA 4KHPI 1RREA 1KVKA 4DR4E 1Z59A 1MU5A 1I94E 1FWKA 2B7TA 1T4NA 4AQYE 1YYOA 3Q1QA 3K1JA 3QT7A 1XNQE 4B3ME 2JVAA 1IBLE 2UXBE 2UU9E 2V8PA 4K0KI 3ZZUA 3HULA 2F4VI 1K47A
chains in the Genus database with same CATH superfamily
1JK1A 4AM3A 1ZU1A 2V88A 2NN6B 1PJTA 1ZBQA 2O1UA 4K0KE 1YSAC 4O4KA 1X48A 2D9HA 4X8WA 1YZ9A 2GS8A 3ZKBA 1OYPA 1HNWI 2V86A 2F4VE 2IERA 2Q2EB 1HR0E 4LF7E 2MDRA 2BA1D 4B3RI 2EPZA 3AV0A 4URLA 2EL6A 2YTIA 4WSGA 4DKKA 4DUYE 2Z5CB 1USUA 1IBKI 1FKAE 2MC5A 2L92A 4I3HA 4IFDD 1N34E 1USVA 5BR8I 2NUGA 1J5EE 2EQ0A 5C0XF 1T39A 4MQYA 1NHJA 3PYGA 1UHZA 4Z7YA 2FTXB 2RS6A 1DI2A 5JEAB 2PO1B 1N32I 2RS7A 5JEAA 2A25A 3B78A 4MYUA 2YU8A 2EMAA 3IWCA 4X65E 2DGCA 1VISA 1J5EI 1KYQA 4KQVA 2N8XA 4YY3E 4ZYDA 5KL4A 4TUIA 2JT2A 5IWAI 3OTOI 3K17A 2B9DA 4JI4E 3EPLA 4JI0E 4GQUA 2JYAA 4DPUA 2NPFA 4OO1B 3LLHA 1YFHA 1ZAAC 4AIMA 2BB8A 4RH8A 2I13A 3L7ZB 2F4VI 4LF4I 3L7ZA 3ECRA 2R42A 5C0XE 2LCEA 1RHYA 4NBQA 2X7IA 1E3HA 4ISAA 4NHRA 1H7UA 4IZJB 1ZXMA 4LF9E 2AJ4A 3UHMA 5K36E 3P76A 2DSYA 2GPIA 2HKEA 4LF6I 5JEAF 1XNRE 3CDJA 2JEBA 2LJPA 4BC9A 1B69A 2V2QA 2EQ3A 4FWDA 1PVGA 2WBSA 1HNXI 2EWLA 1Y6ZA 4R2RA 1B62A 1X3CA 2M9AA 4MDTA 1IQOA 1J26A 2EORA 2LUPB 5K36A 2DMIA 4DXLA 4DR1E 3B4TA 5AE2A 1HNXE 3PS3A 2K4VA 4OX9I 4MU4A 5A6BA 1ELOA 4JI2E 1XMQE 2PNZA 4B3TI 4KZSA 4DR2E 3HJCA 1EH8A 4HTGA 1UBDC 4M2ZA 3M99B 2NN6A 2ENCA 1WRJA 2EP3A 4F6NA 1X6EA 4R2PA 3VYXA 2LE2A 3WU5A 4AIDA 4X64I 2IOQA 1Y4UA 1KJKA 4B3TE 2BA0D 1KKHA 2EOQA 2WBUA 1QNTA 2ZITA 4JYAI 4X62E 2CPNA 2CVEA 2L33A 1Z5AA 2NN6D 4BBYA 4DV5E 4JI7I 1L4SA 1ZR9A 3DJWA 4DV7I 4U3DA 4HY1A 2EOIA 3MHHC 4JV5E 1N0VC 3T1YI 4J8ZA 5FWKA 3KWRA 4BHBA 4LF8I 1A1FA 3HKMA 3B8HA 2BA0G 4IFDF 2YZTA 2PO1A 1N34I 5BR8E 3C4BA 4L5NC 1RC7A 1YPNA 2EN3A 4Q35B 2DIXA 2YU5A 2ELZA 1PJSA 4DV2I 3EPKA 4P52A 2M1SA 2X36A 1MEYC 2WCC3 2HFSA 3F6GA 3HTXA 1PDAA 1HR0I 2GHFA 2UUAE 2EOJA 1PIEA 2LV2A 2DEIA 2EPOA 4WUDA 5IXMB 2R76A 2EOFA 3KRNA 2VF3A 2EMGA 1EI1A 4HACB 3WU6A 5CFFE 1BKNA 4DV1E 2PNLA 1YYKA 1Z1BA 5C0XD 4QNJA 5AASA 1UILA 4HEIA 2JEBB 2EOSA 2JY9A 4DMIA 4YHHE 2O3ZA 2EOXA 2ENHA 3J7AG 4X65I 4DR5I 3WU4A 4WYQB 1MG7A 4LFBI 2J65A 1AAYA 4DV0I 2EM8A 4JI6E 1YHCA 5LLQA 2GLIA 4LF5I 4DV6I 4R2EA 4JI0I 4X66E 2EE8A 1OYSA 3AUZA 5LL6R 4LPFA 2NN6C 1G2FC 4OKGA 2YT4A 5DRPA 2CSHA 2EFGA 4KHPE 1DQ3A 4R2QA 2EPPA 2PO2B 4X66I 1X5WA 2RTXA 2R3VA 2NN6F 5A2QC 3H1CA 3PYFA 1T4LB 4M1KA 3F0NA 2RPCA 2HFUA 3J81Q 1FJGI 1D6TA 4DR2I 2JP9A 4LFCI 3GCMA 1Z0GA 1UDOA 3DD6A 5KL7A 4UT4A 1WXRA 1FNMA 2BR2A 2BA1G 3P3EA 1YH8A 1EA6A 4USKA 4NXMI 4IS1C 2J7JA 2EMBA 2JE6A 2JE6B 2EMKA 2EL4A 2EM4A 2EPXA 3K6QA 2EMYA 5A69A 5K36D 2EPCA 2E5LI 1GZ6A 3Q6NA 1O0WA 2JXPA 4F54A 2C37A 4DUZI 2LTSA 2L2NA 2L8TA 1BB8A 2UXDE 1FWLA 4IFDC 4B3RE 4O43A 1XMOI 4O5GA 2EQ1A 4BA2B 3HXLA 1HNZE 2CTDA 3JU0A 4LF9I 3JTZA 4U3BA 2EN1A 2YWQA 1Z0VA 1XXEA 2CGEA 5DNYA 2ZM6E 4JV5I 1SR9A 2WNRB 2JEAB 4GKJI 2ELYA 1FI4A 1UDQA 4YY3I 2EN6A 1X6FA 2L2MA 3ADIA 4ZYHA 1H7SA 1TN9A 1WHQA 3LMLA 4P7AA 2ZM6I 2Z5CA 4JI1I 4UTGA 1Z5CA 2ODRD 2LVHA 3BF2A 5IWAE 3OTOE 4BS9A 4DR4I 1GQEA 2Z5EA 2MKNA 1UN6B 5C0XB 2JOXA 2F8BA 2N3GA 4Q28A 4BA1B 4LOMA 5JEAD 3M7NG 5K36B 5DRRA 3IWBA 2WZOA 4OO1F 4DV0E 2BM1A 5F3WA 4DPWA 4DR6I 4LTYA 3QT6A 3ADGA 3L00A 2IESA 3ADLA 1UEKA 2J7KA 2PO2A 1Z0WA 1AH5A 2YPNA 2E1RA 2LMZA 3MHSC 2K7IA 5LMUI 3U1YA 2WBTA 2EN2A 1PJQA 5ADZA 3H09A 3PYDA 2A2DA 1X6HA 2GO3A 5JEAE 1SFEA 3PS1A 2DLKA 2MC6A 3V2UC 4YHHI 3BGHA 2KONA 1U2RA 2YTGA 4LFAI 2LO3A 1P47A 5L3JA 1HNZI 2EN8A 1Z0TA 2EMCA 4I8OA 2A2CA 4JG4A 4JI6I 4RHBB 3U1KA 2E72A 5DRQA 1OJ4A 3GMEA 2BR2B 2HKJA 4HXZA 3F6HA 4LCGA 1XNQI 2RSIA 2NABA 1YYWA 3IWDA 4GKJE 1ZM3A 1WJPA 4WXCA 5DNXA 1XMQI 2WP8A 1Y4SA 3OMLA 2GO4A 3VYYA 3J81C 2C39B 4X9JA 2M7QA 1A1GA 2EPKX 3LNUA 5A2QQ 1EH7A 3M85D 2UUAI 2WW4A 2B7VA 2O1TA 5AE3A 3ZZ0A 4DR3E 2YTOA 5AC4A 3JAMC 4JYAE 1B63A 2LTRA 3C6MA 2EOZA 2XEXA 4BA2A 1Z0CA 2V34A 5K36F 2ENAA 4DV3I 4OO1C 2EPLX 1A1LA 4N3OA 3PRYA 4WXDA 1HK7A 5AC5A 4HACA 2HK3A 3P3CA 3EQ1A 4IZJD 2V8QB 2JEAA 5AE1A 2EN4A 4DV4E 3RMPA 2VRDA 2HC5A 2EPRA 1IBKE 3ZM7A 3VK6A 2KHXA 2LRSA 3EPJA 2UUCE 4LFBE 2V2ZA 3V5RA 2EM0A 1S16A 2EJ4A 3THNA 1A1KA 4IS9A 1NCSA 4DV4I 2YTPA 4HYMA 4FW5A 4FK5C 2C38B 2CT1A 4OOGC 4FW6A 5IV8B 4JI8E 4DV1I 5GMDA 1BBGA 1A6FA 3ADJA 3ZOQB 4LU9A 2ZBKB 4FWGA 4O24A 2M4IA 2R1FA 4FW7A 2YTDA 1Z5BA 2LT7A 3J80C 4NXNE 4R03A 2C37B 2RSMA 4R2DA 2ADRA 4JI3E 2YTFA 2BV3A 3PS2A 1A1JA 3T1HE 1IBMI 4B3MI 2NA2A 2YTJA 2YTEA 4F6MA 4DR7E 4BCAA 2EMLA 3J7Yp 1KIJA 4AQYI 2V83A 5LMUE 1DARA 4NXME 2O1WA 2ODRC 3P3GA 4WUBA 4JI3I 2B3TB 4L8NA 4PU9A 4FW3A 4LF6E 2WNRA 1XNRI 4LCHA 1PKPA 4GZNC 2IHR1 3D4JA 2L3JA 2HK2A 5DROA 2BM0A 3P1XA 2G7HA 4IFDB 1T38A 2FV4B 1NEIA 4OO1D 1ZM4A 3H4LA 4JI7E 4DV5I 1G2DC 2YTQA 2UXCI 2YSPA 4F9AB 2O1VA 2JR1A 2YSOA 3HPSA 3EPHA 2UUCI 2FGGA 2HHHE 4FN5A 2PO0B 2JOBA 2HGHA 3T1YE 2LJHA 3KZYA 5A6AA 2EZ6A 1QZRA 1BBOA 3GLLA 2EMIA 4BA1A 4DU7A 2EOHA 2YRMA 1MX0A 1N0UA 4LFCE 1P42A 3P06A 2UXCE 4IZKA 1NHIA 1YUJA 4LCFA 1STUA 4ZYEA 2DEJA 5C0XC 4F9CB 4P78A 2JPAA 4DUYI 4R2AA 2H36X 2MDGA 2Q8UA 5EL9A 1RQ0A 1N32E 1QU6A 5K36C 3KZZA 4M30A 2V89A 4FW9A 4MU0A 4JI1E 3BBGA 2N3HA 3QT5A 1Y5YA 2EPNA 4J3DA 1IBME 4MU1A 3J80Q 3DF6A 4DR7I 2VQEE 4B3SI 5TSEA 1Y60A 3HPZA 1RMDA 4MLQA 1H73A 2CG9A 2EOOA 1N36E 1KTVA 2EOMA 4M0VA 4WSPA 1XMOE 1LLMC 2EM6A 4LF4E 5GMEA 4MYTA 5FLXQ 2VESA 2V85A 5C0XA 3TQMA 3QT8A 5LMNI 2EM9A 1R6MA 1H72C 4XTJA 5KL2A 1S4EA 1UDSA 4WUCA 4JI8I 1NZ0A 2DLQA 3FIGA 1R6LA 2YRKA 2LBSB 4M9VC 4LFAE 1TF3A 4TUGA 2L2KB 3LTOA 1IBLI 2UXBI 4NXNI 5FLXC 1UDNA 2L3CA 4BMJA 2IOPA 2EM3A 4IFDE 1Z0EA 4PRXA 3T1HI 2EM7A 2VE7C 2OI2A 4JI4I 4F9BB 2EN7A 3HQ1A 1JK2A 4OX9E 1FJGE 4FWHA 4ED4A 2VQFI 3WU3A 3JAMQ 1I94I 2JWOA 4N4RB 4DR6E 4IFDA 3C6KA 4NZVA 5ELWA 1T4OA 2C39A 4WX9A 2EMZA 2YTNA 4GKKE 1OYRA 2WP8B 3ZZTA 4LF7I 2EL5A 4BC7A 1N33I 4DV3E 2NUEA 2L6MA 4X64E 4OZEA 2EMHA 3M85G 2HHHI 1X47A 3BIDA 2EMXA 2LUQA 1A1HA 4MU3A 4GKKI 4X62I 2EPMX 3C4TA 4EMDA 2YRHA 3THOB 4OO1A 5KL5A 5LMNE 5A6KA 5A6BD 1EKZA 5KL3A 3LPSA 4FW4A 2UXDI 1Z0BA 1ZBTA 2V2VA 2V87A 4IJDA 5A6JA 4DR1I 4ZVIA 4DPYA 3J7AM 2EOYA 1F2IG 2PNMA 2EOEA 2MKDA 2LJUA 3NZKA 2EPUA 2EM5A 5JEAC 3CWVA 2E1MA 3VHTB 2EMWA 1IMUA 4DPTA 1GTKA 2RQLA 2CZ9A 4DR3I 2UU9I 4BHCA 4PRVA 2BBGA 4R2CA 2E5LE 1VI7A 4WFTA 2NN6E 2VQEI 5IT9Q 3GONA 2VQFE 3PYEA 2AE8A 1XHKA 2C38A 1WUUA 4DUZE 5DNLA 4WPYA 1N36I 4Z7CA 4DV7E 3K85A 4RPFA 1X49A 1NHHA 5T6JA 1A1IA 2I9IA 3B82A 2NUFA 2UUBE 3M7ND 4JI5E 4KWYA 4LF8E 2DMYA 3ZKDA 1ZM9A 2EMFA 2EPAA 1HNWE 1ZXNA 1ZM2A 4MLVA 4GEQB 4R1FA 5KL6A 2PRTA 1N33E 2DRPA 1RR9A 4LF5E 2HJJA 2DB2A 3Q6MA 3MSWA 2UUBI 4B3SE 4DU8A 4JI5I 4DV2E 1IQSA 4DR5E 1E3PA 5IT9C 1H74A 3M6AA 5EKWA 4JI2I 1WHNA 4DV6E 4DPXA 4IZJA 4OO1E 2EM2A 4USMA 4KHPI 1MGTA 2VF1A 1RREA 1KVKA 4DR4E 1Z59A 1MU5A 1I94E 2GQ0A 2KOUA 4P7DA 1FWKA 2B7TA 1T4NA 4F2JC 4AQYE 1YYOA 3Q1QA 1N3GA 3K1JA 3QT7A 1XNQE 4B3ME 2PO0A 2JVAA 2F1DA 1IBLE 4ZYGA 2UXBE 2UU9E 2V8PA 4R8OA 4IZKB 3CDIA 1DGCA 2Z5BA 4R2SA 4K0KI 2Z5BB 1EH6A 1YUIA 3UK3C 2PNZB 4QNKA 3QG5C 3HULA 3ZZUA 1TF6A 1K47A
chains in the Genus database with same CATH topology
2V88A 1ZBQA 2O1UA 4K0KE 4X8WA 1X48A 1YZ9A 2GS8A 3ZKBA 1HNWI 2V86A 2F4VE 2Q2EB 1HR0E 4LF7E 2MDRA 4B3RI 3AV0A 4URLA 4DKKA 4DUYE 2Z5CB 1USUA 1IBKI 1FKAE 2MC5A 2L92A 4I3HA 1N34E 1USVA 5BR8I 2NUGA 1J5EE 1NHJA 3PYGA 1UHZA 4Z7YA 2FTXB 2RS6A 1DI2A 1N32I 2RS7A 3B78A 4MYUA 3IWCA 4X65E 1VISA 1J5EI 4KQVA 4YY3E 4TUIA 5IWAI 3OTOI 3K17A 2B9DA 4JI4E 4JI0E 4DPUA 2NPFA 3LLHA 4LF4I 2R42A 2X7IA 1H7UA 4IZJB 1ZXMA 4LF9E 2AJ4A 2DSYA 2HKEA 4LF6I 1XNRE 2LJPA 4BC9A 2V2QA 4FWDA 1PVGA 1HNXI 2EWLA 1Y6ZA 1B62A 1J26A 2LUPB 4DXLA 4DR1E 5AE2A 1HNXE 4OX9I 2K4VA 1ELOA 4JI2E 1XMQE 4B3TI 4KZSA 4DR2E 3HJCA 4M2ZA 3Q6NA 3WU5A 3VYXA 2LE2A 4X64I 2IOQA 1Y4UA 4B3TE 1KKHA 2ZITA 4JYAI 4X62E 2CPNA 2L33A 1Z5AA 4BBYA 4DV5E 4JI7I 3DJWA 4DV7I 4HY1A 4JV5E 1N0VC 3T1YI 4J8ZA 5FWKA 3KWRA 4LF8I 3B8HA 2YZTA 1N34I 5BR8E 3C4BA 4L5NC 1RC7A 2DIXA 4DV2I 4P52A 2M1SA 2X36A 2HFSA 3F6GA 3HTXA 1HR0I 2UUAE 1PIEA 2DEIA 4WUDA 2VF3A 1EI1A 4HACB 3WU6A 5CFFE 1BKNA 4DV1E 2PNLA 1YYKA 5AASA 1UILA 2JY9A 4DMIA 4YHHE 3J7AG 4X65I 4DR5I 3WU4A 4WYQB 1MG7A 4LFBI 4DV0I 4JI6E 4LF5I 4DV6I 4JI0I 4X66E 3AUZA 5LL6R 2YT4A 2EFGA 4KHPE 1DQ3A 4X66I 2RTXA 2R3VA 5A2QC 3PYFA 1T4LB 4M1KA 3F0NA 2HFUA 3J81Q 1FJGI 1D6TA 4DR2I 4LFCI 1Z0GA 4UT4A 1WXRA 1FNMA 1EA6A 4USKA 4NXMI 3K6QA 2E5LI 1GZ6A 1O0WA 4F54A 4DUZI 2LTSA 2L8TA 2L2NA 2UXDE 1FWLA 4B3RE 1XMOI 3HXLA 1HNZE 3JU0A 4LF9I 3JTZA 1Z0VA 2CGEA 5DNYA 2ZM6E 4JV5I 1SR9A 4GKJI 1FI4A 4YY3I 2L2MA 3ADIA 1H7SA 1WHQA 3LMLA 4P7AA 2ZM6I 2Z5CA 4JI1I 4UTGA 1Z5CA 2ODRD 5IWAE 3OTOE 4BS9A 4DR4I 1GQEA 2Z5EA 2JOXA 2F8BA 2N3GA 4Q28A 3IWBA 2WZOA 4DV0E 2BM1A 5F3WA 4DPWA 4DR6I 4LTYA 3QT6A 3ADGA 2J7KA 3ADLA 1UEKA 1Z0WA 2E1RA 2LMZA 5LMUI 5ADZA 3H09A 3PYDA 2A2DA 2MC6A 3V2UC 4YHHI 2KONA 1U2RA 4LFAI 1HNZI 5L3JA 1Z0TA 4I8OA 2A2CA 4JG4A 4JI6I 1OJ4A 2HKJA 4HXZA 3F6HA 1XNQI 4GKJE 1YYWA 3IWDA 1ZM3A 1XMQI 1Y4SA 3OMLA 3VYYA 3J81C 3LNUA 2M7QA 5A2QQ 2UUAI 2WW4A 2B7VA 2O1TA 5AE3A 3ZZ0A 4DR3E 3JAMC 4JYAE 1B63A 2LTRA 2XEXA 1Z0CA 2V34A 4DV3I 4N3OA 3PRYA 1HK7A 4HACA 2HK3A 4IZJD 2V8QB 5AE1A 4DV4E 3RMPA 1IBKE 3ZM7A 3VK6A 2KHXA 2LRSA 4LFBE 2UUCE 2V2ZA 3V5RA 1S16A 4DV4I 4HYMA 4OOGC 4DV1I 4JI8E 5GMDA 1A6FA 3ADJA 3ZOQB 4LU9A 2ZBKB 4FWGA 2M4IA 1Z5BA 4NXNE 3J80C 4R03A 2RSMA 4JI3E 2BV3A 3T1HE 1IBMI 4B3MI 2NA2A 4DR7E 4BCAA 3J7Yp 1KIJA 4AQYI 2V83A 5LMUE 1DARA 4NXME 2O1WA 2ODRC 4WUBA 4JI3I 2B3TB 4L8NA 4PU9A 4LF6E 1XNRI 1PKPA 3D4JA 2IHR1 2L3JA 2HK2A 2BM0A 3P1XA 2G7HA 2FV4B 1ZM4A 3H4LA 4JI7E 4DV5I 2UXCI 4F9AB 2O1VA 2JR1A 3HPSA 2UUCI 2FGGA 2HHHE 4FN5A 2JOBA 3T1YE 2LJHA 2EZ6A 1QZRA 4DU7A 3P06A 1MX0A 1N0UA 4LFCE 2UXCE 4IZKA 1NHIA 1STUA 2DEJA 4F9CB 4P78A 4DUYI 2H36X 1RQ0A 1N32E 1QU6A 4M30A 2V89A 4FW9A 4JI1E 2N3HA 3QT5A 1IBME 3J80Q 3DF6A 4DR7I 2VQEE 4B3SI 3HPZA 2CG9A 1H73A 1N36E 1KTVA 5GMEA 4M0VA 4WSPA 1XMOE 4LF4E 4MYTA 5FLXQ 2V85A 3QT8A 5LMNI 1H72C 4XTJA 1S4EA 4WUCA 4JI8I 1NZ0A 3FIGA 2LBSB 4LFAE 3LTOA 4TUGA 2L2KB 1IBLI 2UXBI 4NXNI 5FLXC 2L3CA 4BMJA 2IOPA 1Z0EA 4PRXA 3T1HI 2VE7C 2OI2A 4JI4I 4F9BB 3HQ1A 4OX9E 4ED4A 1I94I 1FJGE 4FWHA 2VQFI 3WU3A 3JAMQ 2JWOA 4DR6E 1T4OA 4LF7I 4GKKE 3ZZTA 4BC7A 1N33I 4DV3E 2NUEA 2L6MA 4X64E 2HHHI 1X47A 2LUQA 4GKKI 4X62I 3C4TA 4EMDA 5LMNE 2UXDI 1EKZA 3LPSA 1Z0BA 1ZBTA 2V2VA 2V87A 4DR1I 4ZVIA 4DPYA 3J7AM 2PNMA 3CWVA 2E1MA 4DPTA 2CZ9A 4DR3I 2UU9I 4PRVA 2E5LE 4WFTA 2VQEI 5IT9Q 3GONA 2VQFE 3PYEA 1XHKA 1WUUA 4DUZE 4WPYA 1N36I 4Z7CA 4DV7E 3K85A 4RPFA 1X49A 1NHHA 5T6JA 3B82A 2NUFA 2UUBE 4JI5E 4LF8E 2DMYA 3ZKDA 1ZM9A 1HNWE 1ZXNA 1ZM2A 4GEQB 4R1FA 1N33E 1RR9A 4LF5E 3Q6MA 2DB2A 3MSWA 2UUBI 4B3SE 4DU8A 4JI5I 4DV2E 4DR5E 5IT9C 1H74A 3M6AA 4JI2I 1WHNA 4DV6E 4DPXA 4IZJA 4USMA 4KHPI 2VF1A 1RREA 1KVKA 4DR4E 1Z59A 1MU5A 1I94E 2GQ0A 2KOUA 4P7DA 1FWKA 2B7TA 1T4NA 4AQYE 1YYOA 3Q1QA 3K1JA 3QT7A 1XNQE 4B3ME 2JVAA 1IBLE 2UXBE 2UU9E 2V8PA 4R8OA 4IZKB 2Z5BA 4K0KI 2Z5BB 3ZZUA 3HULA 2F4VI 1K47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K E;  4X8W A;  1X48 A;  1YZ9 A;  2GS8 A;  3ZKB A;  1HNW I;  2F4V E;  2Q2E B;  1HR0 E;  4LF7 E;  2MDR A;  4B3R I;  4URL A;  4DKK A;  4DUY E;  1IBK I;  1FKA E;  4I3H A;  1N34 E;  5BR8 I;  2NUG A;  1J5E E;  1NHJ A;  3PYG A;  1UHZ A;  4Z7Y A;  1N32 I;  2RS6 A;  1DI2 A;  2RS7 A;  3B78 A;  4MYU A;  4X65 E;  1VIS A;  1J5E I;  4KQV A;  4YY3 E;  5IWA I;  3OTO I;  3K17 A;  4JI4 E;  4JI0 E;  4DPU A;  2NPF A;  3LLH A;  4LF4 I;  2R42 A;  2X7I A;  1H7U A;  1ZXM A;  4LF9 E;  2AJ4 A;  2HKE A;  4LF6 I;  1XNR E;  2LJP A;  2V2Q A;  4FWD A;  1PVG A;  1HNX I;  1B62 A;  1J26 A;  2LUP B;  4DXL A;  4DR1 E;  1HNX E;  4OX9 I;  1ELO A;  4JI2 E;  1XMQ E;  4B3T I;  4DR2 E;  4M2Z A;  3WU5 A;  3VYX A;  4X64 I;  4B3T E;  1KKH A;  2ZIT A;  4JYA I;  4X62 E;  2CPN A;  2L33 A;  1Z5A A;  4DV5 E;  4JI7 I;  4DV7 I;  4HY1 A;  4JV5 E;  1N0V C;  3T1Y I;  4LF8 I;  3B8H A;  1N34 I;  5BR8 E;  3C4B A;  1RC7 A;  2DIX A;  4DV2 I;  4P52 A;  2X36 A;  2HFS A;  3HTX A;  1HR0 I;  2UUA E;  1PIE A;  2DEI A;  4WUD A;  2VF3 A;  1EI1 A;  4HAC B;  3WU6 A;  5CFF E;  1BKN A;  4DV1 E;  1YYK A;  1UIL A;  2JY9 A;  4YHH E;  3J7A G;  4X65 I;  4DR5 I;  3WU4 A;  4WYQ B;  1MG7 A;  4LFB I;  4DV0 I;  4JI6 E;  4LF5 I;  4DV6 I;  4JI0 I;  4X66 E;  5LL6 R;  2YT4 A;  2EFG A;  4KHP E;  4X66 I;  2RTX A;  2R3V A;  5A2Q C;  3PYF A;  1T4L B;  4M1K A;  3F0N A;  2HFU A;  3J81 Q;  1FJG I;  1D6T A;  4DR2 I;  4LFC I;  1Z0G A;  4UT4 A;  1FNM A;  1EA6 A;  4USK A;  4NXM I;  2E5L I;  1O0W A;  4DUZ I;  2LTS A;  2L2N A;  2UXD E;  1FWL A;  4B3R E;  1XMO I;  1HNZ E;  4LF9 I;  1Z0V A;  2ZM6 E;  4JV5 I;  4GKJ I;  1FI4 A;  4YY3 I;  2L2M A;  3ADI A;  1H7S A;  1WHQ A;  4P7A A;  2ZM6 I;  4JI1 I;  4UTG A;  1Z5C A;  5IWA E;  3OTO E;  4DR4 I;  1GQE A;  2N3G A;  4DV0 E;  2BM1 A;  4DR6 I;  4DPW A;  3QT6 A;  3ADG A;  2J7K A;  3ADL A;  1UEK A;  1Z0W A;  2E1R A;  5LMU I;  3PYD A;  2A2D A;  3V2U C;  4YHH I;  1U2R A;  4LFA I;  1HNZ I;  5L3J A;  1Z0T A;  2A2C A;  4JG4 A;  4JI6 I;  1OJ4 A;  2HKJ A;  4HXZ A;  1XNQ I;  4GKJ E;  1YYW A;  1ZM3 A;  1XMQ I;  3VYY A;  3J81 C;  3LNU A;  5A2Q Q;  2UUA I;  2WW4 A;  2B7V A;  3ZZ0 A;  4DR3 E;  3JAM C;  4JYA E;  1B63 A;  2LTR A;  2XEX A;  1Z0C A;  2V34 A;  4DV3 I;  4HAC A;  2HK3 A;  4DV4 E;  1IBK E;  3ZM7 A;  2KHX A;  2LRS A;  4LFB E;  2UUC E;  2V2Z A;  3V5R A;  1S16 A;  4DV4 I;  4HYM A;  4OOG C;  4DV1 I;  4JI8 E;  5GMD A;  1A6F A;  3ADJ A;  2ZBK B;  4FWG A;  1Z5B A;  4NXN E;  3J80 C;  2RSM A;  4JI3 E;  2BV3 A;  3T1H E;  1IBM I;  4B3M I;  2NA2 A;  4DR7 E;  3J7Y p;  1KIJ A;  4AQY I;  5LMU E;  1DAR A;  4NXM E;  4WUB A;  4JI3 I;  2B3T B;  4PU9 A;  4LF6 E;  1XNR I;  1PKP A;  3D4J A;  2IHR 1;  2L3J A;  2HK2 A;  2BM0 A;  3P1X A;  1ZM4 A;  3H4L A;  4JI7 E;  4DV5 I;  2UXC I;  2UUC I;  2HHH E;  4FN5 A;  3T1Y E;  2LJH A;  2EZ6 A;  1QZR A;  4DU7 A;  1MX0 A;  1N0U A;  4LFC E;  2UXC E;  1NHI A;  1STU A;  2DEJ A;  4DUY I;  1RQ0 A;  1N32 E;  1QU6 A;  4M30 A;  4FW9 A;  4JI1 E;  2N3H A;  3QT5 A;  1IBM E;  3J80 Q;  4DR7 I;  2VQE E;  4B3S I;  1H73 A;  5GME A;  1N36 E;  1KTV A;  4LF4 E;  1XMO E;  4MYT A;  5FLX Q;  3QT8 A;  5LMN I;  1H72 C;  4XTJ A;  1S4E A;  4WUC A;  4JI8 I;  1NZ0 A;  2LBS B;  4LFA E;  3LTO A;  2L2K B;  1IBL I;  2UXB I;  4NXN I;  5FLX C;  2L3C A;  1Z0E A;  4PRX A;  3T1H I;  2OI2 A;  4JI4 I;  4OX9 E;  4ED4 A;  1I94 I;  1FJG E;  4FWH A;  2VQF I;  3WU3 A;  3JAM Q;  4DR6 E;  1T4O A;  4LF7 I;  4GKK E;  3ZZT A;  1N33 I;  4DV3 E;  2NUE A;  4X64 E;  2HHH I;  1X47 A;  2LUQ A;  4GKK I;  4X62 I;  3C4T A;  4EMD A;  5LMN E;  2UXD I;  1EKZ A;  3LPS A;  1Z0B A;  1ZBT A;  2V2V A;  4DR1 I;  4ZVI A;  4DPY A;  3J7A M;  3CWV A;  4DPT A;  2CZ9 A;  4DR3 I;  2UU9 I;  4PRV A;  2E5L E;  4WFT A;  2VQE I;  5IT9 Q;  3GON A;  2VQF E;  3PYE A;  1XHK A;  1WUU A;  4DUZ E;  1N36 I;  4Z7C A;  4DV7 E;  4RPF A;  1X49 A;  1NHH A;  3B82 A;  2NUF A;  2UUB E;  4JI5 E;  4LF8 E;  2DMY A;  3ZKD A;  1ZM9 A;  1HNW E;  1ZXN A;  1ZM2 A;  4R1F A;  1N33 E;  1RR9 A;  4LF5 E;  2DB2 A;  2UUB I;  4B3S E;  4DU8 A;  4JI5 I;  4DV2 E;  4DR5 E;  5IT9 C;  1H74 A;  3M6A A;  4JI2 I;  1WHN A;  4DV6 E;  4DPX A;  4USM A;  4KHP I;  1RRE A;  1KVK A;  4DR4 E;  1Z59 A;  1MU5 A;  1I94 E;  1FWK A;  2B7T A;  1T4N A;  4AQY E;  1YYO A;  3Q1Q A;  3K1J A;  3QT7 A;  1XNQ E;  4B3M E;  2JVA A;  1IBL E;  2UXB E;  2UU9 E;  2V8P A;  4K0K I;  3ZZU A;  3HUL A;  2F4V I;  1K47 A; 
#chains in the Genus database with same CATH topology
 1JK1 A;  4AM3 A;  1ZU1 A;  2V88 A;  2NN6 B;  1PJT A;  1ZBQ A;  2O1U A;  4K0K E;  1YSA C;  4O4K A;  1X48 A;  2D9H A;  4X8W A;  1YZ9 A;  2GS8 A;  3ZKB A;  1OYP A;  1HNW I;  2V86 A;  2F4V E;  2IER A;  2Q2E B;  1HR0 E;  4LF7 E;  2MDR A;  2BA1 D;  4B3R I;  2EPZ A;  3AV0 A;  4URL A;  2EL6 A;  2YTI A;  4WSG A;  4DKK A;  4DUY E;  2Z5C B;  1USU A;  1IBK I;  1FKA E;  2MC5 A;  2L92 A;  4I3H A;  4IFD D;  1N34 E;  1USV A;  5BR8 I;  2NUG A;  1J5E E;  2EQ0 A;  5C0X F;  1T39 A;  4MQY A;  1NHJ A;  3PYG A;  1UHZ A;  4Z7Y A;  2FTX B;  2RS6 A;  1DI2 A;  5JEA B;  2PO1 B;  1N32 I;  2RS7 A;  5JEA A;  2A25 A;  3B78 A;  4MYU A;  2YU8 A;  2EMA A;  3IWC A;  4X65 E;  2DGC A;  1VIS A;  1J5E I;  1KYQ A;  4KQV A;  2N8X A;  4YY3 E;  4ZYD A;  5KL4 A;  4TUI A;  2JT2 A;  5IWA I;  3OTO I;  3K17 A;  2B9D A;  4JI4 E;  3EPL A;  4JI0 E;  4GQU A;  2JYA A;  4DPU A;  2NPF A;  4OO1 B;  3LLH A;  1YFH A;  1ZAA C;  4AIM A;  2BB8 A;  4RH8 A;  2I13 A;  3L7Z B;  2F4V I;  4LF4 I;  3L7Z A;  3ECR A;  2R42 A;  5C0X E;  2LCE A;  1RHY A;  4NBQ A;  2X7I A;  1E3H A;  4ISA A;  4NHR A;  1H7U A;  4IZJ B;  1ZXM A;  4LF9 E;  2AJ4 A;  3UHM A;  5K36 E;  3P76 A;  2DSY A;  2GPI A;  2HKE A;  4LF6 I;  5JEA F;  1XNR E;  3CDJ A;  2JEB A;  2LJP A;  4BC9 A;  1B69 A;  2V2Q A;  2EQ3 A;  4FWD A;  1PVG A;  2WBS A;  1HNX I;  2EWL A;  1Y6Z A;  4R2R A;  1B62 A;  1X3C A;  2M9A A;  4MDT A;  1IQO A;  1J26 A;  2EOR A;  2LUP B;  5K36 A;  2DMI A;  4DXL A;  4DR1 E;  3B4T A;  5AE2 A;  1HNX E;  3PS3 A;  2K4V A;  4OX9 I;  4MU4 A;  5A6B A;  1ELO A;  4JI2 E;  1XMQ E;  2PNZ A;  4B3T I;  4KZS A;  4DR2 E;  3HJC A;  1EH8 A;  4HTG A;  1UBD C;  4M2Z A;  3M99 B;  2NN6 A;  2ENC A;  1WRJ A;  2EP3 A;  4F6N A;  1X6E A;  4R2P A;  3VYX A;  2LE2 A;  3WU5 A;  4AID A;  4X64 I;  2IOQ A;  1Y4U A;  1KJK A;  4B3T E;  2BA0 D;  1KKH A;  2EOQ A;  2WBU A;  1QNT A;  2ZIT A;  4JYA I;  4X62 E;  2CPN A;  2CVE A;  2L33 A;  1Z5A A;  2NN6 D;  4BBY A;  4DV5 E;  4JI7 I;  1L4S A;  1ZR9 A;  3DJW A;  4DV7 I;  4U3D A;  4HY1 A;  2EOI A;  3MHH C;  4JV5 E;  1N0V C;  3T1Y I;  4J8Z A;  5FWK A;  3KWR A;  4BHB A;  4LF8 I;  1A1F A;  3HKM A;  3B8H A;  2BA0 G;  4IFD F;  2YZT A;  2PO1 A;  1N34 I;  5BR8 E;  3C4B A;  4L5N C;  1RC7 A;  1YPN A;  2EN3 A;  4Q35 B;  2DIX A;  2YU5 A;  2ELZ A;  1PJS A;  4DV2 I;  3EPK A;  4P52 A;  2M1S A;  2X36 A;  1MEY C;  2WCC 3;  2HFS A;  3F6G A;  3HTX A;  1PDA A;  1HR0 I;  2GHF A;  2UUA E;  2EOJ A;  1PIE A;  2LV2 A;  2DEI A;  2EPO A;  4WUD A;  5IXM B;  2R76 A;  2EOF A;  3KRN A;  2VF3 A;  2EMG A;  1EI1 A;  4HAC B;  3WU6 A;  5CFF E;  1BKN A;  4DV1 E;  2PNL A;  1YYK A;  1Z1B A;  5C0X D;  4QNJ A;  5AAS A;  1UIL A;  4HEI A;  2JEB B;  2EOS A;  2JY9 A;  4DMI A;  4YHH E;  2O3Z A;  2EOX A;  2ENH A;  3J7A G;  4X65 I;  4DR5 I;  3WU4 A;  4WYQ B;  1MG7 A;  4LFB I;  2J65 A;  1AAY A;  4DV0 I;  2EM8 A;  4JI6 E;  1YHC A;  5LLQ A;  2GLI A;  4LF5 I;  4DV6 I;  4R2E A;  4JI0 I;  4X66 E;  2EE8 A;  1OYS A;  3AUZ A;  5LL6 R;  4LPF A;  2NN6 C;  1G2F C;  4OKG A;  2YT4 A;  5DRP A;  2CSH A;  2EFG A;  4KHP E;  1DQ3 A;  4R2Q A;  2EPP A;  2PO2 B;  4X66 I;  1X5W A;  2RTX A;  2R3V A;  2NN6 F;  5A2Q C;  3H1C A;  3PYF A;  1T4L B;  4M1K A;  3F0N A;  2RPC A;  2HFU A;  3J81 Q;  1FJG I;  1D6T A;  4DR2 I;  2JP9 A;  4LFC I;  3GCM A;  1Z0G A;  1UDO A;  3DD6 A;  5KL7 A;  4UT4 A;  1WXR A;  1FNM A;  2BR2 A;  2BA1 G;  3P3E A;  1YH8 A;  1EA6 A;  4USK A;  4NXM I;  4IS1 C;  2J7J A;  2EMB A;  2JE6 A;  2JE6 B;  2EMK A;  2EL4 A;  2EM4 A;  2EPX A;  3K6Q A;  2EMY A;  5A69 A;  5K36 D;  2EPC A;  2E5L I;  1GZ6 A;  3Q6N A;  1O0W A;  2JXP A;  4F54 A;  2C37 A;  4DUZ I;  2LTS A;  2L2N A;  2L8T A;  1BB8 A;  2UXD E;  1FWL A;  4IFD C;  4B3R E;  4O43 A;  1XMO I;  4O5G A;  2EQ1 A;  4BA2 B;  3HXL A;  1HNZ E;  2CTD A;  3JU0 A;  4LF9 I;  3JTZ A;  4U3B A;  2EN1 A;  2YWQ A;  1Z0V A;  1XXE A;  2CGE A;  5DNY A;  2ZM6 E;  4JV5 I;  1SR9 A;  2WNR B;  2JEA B;  4GKJ I;  2ELY A;  1FI4 A;  1UDQ A;  4YY3 I;  2EN6 A;  1X6F A;  2L2M A;  3ADI A;  4ZYH A;  1H7S A;  1TN9 A;  1WHQ A;  3LML A;  4P7A A;  2ZM6 I;  2Z5C A;  4JI1 I;  4UTG A;  1Z5C A;  2ODR D;  2LVH A;  3BF2 A;  5IWA E;  3OTO E;  4BS9 A;  4DR4 I;  1GQE A;  2Z5E A;  2MKN A;  1UN6 B;  5C0X B;  2JOX A;  2F8B A;  2N3G A;  4Q28 A;  4BA1 B;  4LOM A;  5JEA D;  3M7N G;  5K36 B;  5DRR A;  3IWB A;  2WZO A;  4OO1 F;  4DV0 E;  2BM1 A;  5F3W A;  4DPW A;  4DR6 I;  4LTY A;  3QT6 A;  3ADG A;  3L00 A;  2IES A;  3ADL A;  1UEK A;  2J7K A;  2PO2 A;  1Z0W A;  1AH5 A;  2YPN A;  2E1R A;  2LMZ A;  3MHS C;  2K7I A;  5LMU I;  3U1Y A;  2WBT A;  2EN2 A;  1PJQ A;  5ADZ A;  3H09 A;  3PYD A;  2A2D A;  1X6H A;  2GO3 A;  5JEA E;  1SFE A;  3PS1 A;  2DLK A;  2MC6 A;  3V2U C;  4YHH I;  3BGH A;  2KON A;  1U2R A;  2YTG A;  4LFA I;  2LO3 A;  1P47 A;  5L3J A;  1HNZ I;  2EN8 A;  1Z0T A;  2EMC A;  4I8O A;  2A2C A;  4JG4 A;  4JI6 I;  4RHB B;  3U1K A;  2E72 A;  5DRQ A;  1OJ4 A;  3GME A;  2BR2 B;  2HKJ A;  4HXZ A;  3F6H A;  4LCG A;  1XNQ I;  2RSI A;  2NAB A;  1YYW A;  3IWD A;  4GKJ E;  1ZM3 A;  1WJP A;  4WXC A;  5DNX A;  1XMQ I;  2WP8 A;  1Y4S A;  3OML A;  2GO4 A;  3VYY A;  3J81 C;  2C39 B;  4X9J A;  2M7Q A;  1A1G A;  2EPK X;  3LNU A;  5A2Q Q;  1EH7 A;  3M85 D;  2UUA I;  2WW4 A;  2B7V A;  2O1T A;  5AE3 A;  3ZZ0 A;  4DR3 E;  2YTO A;  5AC4 A;  3JAM C;  4JYA E;  1B63 A;  2LTR A;  3C6M A;  2EOZ A;  2XEX A;  4BA2 A;  1Z0C A;  2V34 A;  5K36 F;  2ENA A;  4DV3 I;  4OO1 C;  2EPL X;  1A1L A;  4N3O A;  3PRY A;  4WXD A;  1HK7 A;  5AC5 A;  4HAC A;  2HK3 A;  3P3C A;  3EQ1 A;  4IZJ D;  2V8Q B;  2JEA A;  5AE1 A;  2EN4 A;  4DV4 E;  3RMP A;  2VRD A;  2HC5 A;  2EPR A;  1IBK E;  3ZM7 A;  3VK6 A;  2KHX A;  2LRS A;  3EPJ A;  2UUC E;  4LFB E;  2V2Z A;  3V5R A;  2EM0 A;  1S16 A;  2EJ4 A;  3THN A;  1A1K A;  4IS9 A;  1NCS A;  4DV4 I;  2YTP A;  4HYM A;  4FW5 A;  4FK5 C;  2C38 B;  2CT1 A;  4OOG C;  4FW6 A;  5IV8 B;  4JI8 E;  4DV1 I;  5GMD A;  1BBG A;  1A6F A;  3ADJ A;  3ZOQ B;  4LU9 A;  2ZBK B;  4FWG A;  4O24 A;  2M4I A;  2R1F A;  4FW7 A;  2YTD A;  1Z5B A;  2LT7 A;  3J80 C;  4NXN E;  4R03 A;  2C37 B;  2RSM A;  4R2D A;  2ADR A;  4JI3 E;  2YTF A;  2BV3 A;  3PS2 A;  1A1J A;  3T1H E;  1IBM I;  4B3M I;  2NA2 A;  2YTJ A;  2YTE A;  4F6M A;  4DR7 E;  4BCA A;  2EML A;  3J7Y p;  1KIJ A;  4AQY I;  2V83 A;  5LMU E;  1DAR A;  4NXM E;  2O1W A;  2ODR C;  3P3G A;  4WUB A;  4JI3 I;  2B3T B;  4L8N A;  4PU9 A;  4FW3 A;  4LF6 E;  2WNR A;  1XNR I;  4LCH A;  1PKP A;  4GZN C;  2IHR 1;  3D4J A;  2L3J A;  2HK2 A;  5DRO A;  2BM0 A;  3P1X A;  2G7H A;  4IFD B;  1T38 A;  2FV4 B;  1NEI A;  4OO1 D;  1ZM4 A;  3H4L A;  4JI7 E;  4DV5 I;  1G2D C;  2YTQ A;  2UXC I;  2YSP A;  4F9A B;  2O1V A;  2JR1 A;  2YSO A;  3HPS A;  3EPH A;  2UUC I;  2FGG A;  2HHH E;  4FN5 A;  2PO0 B;  2JOB A;  2HGH A;  3T1Y E;  2LJH A;  3KZY A;  5A6A A;  2EZ6 A;  1QZR A;  1BBO A;  3GLL A;  2EMI A;  4BA1 A;  4DU7 A;  2EOH A;  2YRM A;  1MX0 A;  1N0U A;  4LFC E;  1P42 A;  3P06 A;  2UXC E;  4IZK A;  1NHI A;  1YUJ A;  4LCF A;  1STU A;  4ZYE A;  2DEJ A;  5C0X C;  4F9C B;  4P78 A;  2JPA A;  4DUY I;  4R2A A;  2H36 X;  2MDG A;  2Q8U A;  5EL9 A;  1RQ0 A;  1N32 E;  1QU6 A;  5K36 C;  3KZZ A;  4M30 A;  2V89 A;  4FW9 A;  4MU0 A;  4JI1 E;  3BBG A;  2N3H A;  3QT5 A;  1Y5Y A;  2EPN A;  4J3D A;  1IBM E;  4MU1 A;  3J80 Q;  3DF6 A;  4DR7 I;  2VQE E;  4B3S I;  5TSE A;  1Y60 A;  3HPZ A;  1RMD A;  4MLQ A;  1H73 A;  2CG9 A;  2EOO A;  1N36 E;  1KTV A;  2EOM A;  4M0V A;  4WSP A;  1XMO E;  1LLM C;  2EM6 A;  4LF4 E;  5GME A;  4MYT A;  5FLX Q;  2VES A;  2V85 A;  5C0X A;  3TQM A;  3QT8 A;  5LMN I;  2EM9 A;  1R6M A;  1H72 C;  4XTJ A;  5KL2 A;  1S4E A;  1UDS A;  4WUC A;  4JI8 I;  1NZ0 A;  2DLQ A;  3FIG A;  1R6L A;  2YRK A;  2LBS B;  4M9V C;  4LFA E;  1TF3 A;  4TUG A;  2L2K B;  3LTO A;  1IBL I;  2UXB I;  4NXN I;  5FLX C;  1UDN A;  2L3C A;  4BMJ A;  2IOP A;  2EM3 A;  4IFD E;  1Z0E A;  4PRX A;  3T1H I;  2EM7 A;  2VE7 C;  2OI2 A;  4JI4 I;  4F9B B;  2EN7 A;  3HQ1 A;  1JK2 A;  4OX9 E;  1FJG E;  4FWH A;  4ED4 A;  2VQF I;  3WU3 A;  3JAM Q;  1I94 I;  2JWO A;  4N4R B;  4DR6 E;  4IFD A;  3C6K A;  4NZV A;  5ELW A;  1T4O A;  2C39 A;  4WX9 A;  2EMZ A;  2YTN A;  4GKK E;  1OYR A;  2WP8 B;  3ZZT A;  4LF7 I;  2EL5 A;  4BC7 A;  1N33 I;  4DV3 E;  2NUE A;  2L6M A;  4X64 E;  4OZE A;  2EMH A;  3M85 G;  2HHH I;  1X47 A;  3BID A;  2EMX A;  2LUQ A;  1A1H A;  4MU3 A;  4GKK I;  4X62 I;  2EPM X;  3C4T A;  4EMD A;  2YRH A;  3THO B;  4OO1 A;  5KL5 A;  5LMN E;  5A6K A;  5A6B D;  1EKZ A;  5KL3 A;  3LPS A;  4FW4 A;  2UXD I;  1Z0B A;  1ZBT A;  2V2V A;  2V87 A;  4IJD A;  5A6J A;  4DR1 I;  4ZVI A;  4DPY A;  3J7A M;  2EOY A;  1F2I G;  2PNM A;  2EOE A;  2MKD A;  2LJU A;  3NZK A;  2EPU A;  2EM5 A;  5JEA C;  3CWV A;  2E1M A;  3VHT B;  2EMW A;  1IMU A;  4DPT A;  1GTK A;  2RQL A;  2CZ9 A;  4DR3 I;  2UU9 I;  4BHC A;  4PRV A;  2BBG A;  4R2C A;  2E5L E;  1VI7 A;  4WFT A;  2NN6 E;  2VQE I;  5IT9 Q;  3GON A;  2VQF E;  3PYE A;  2AE8 A;  1XHK A;  2C38 A;  1WUU A;  4DUZ E;  5DNL A;  4WPY A;  1N36 I;  4Z7C A;  4DV7 E;  3K85 A;  4RPF A;  1X49 A;  1NHH A;  5T6J A;  1A1I A;  2I9I A;  3B82 A;  2NUF A;  2UUB E;  3M7N D;  4JI5 E;  4KWY A;  4LF8 E;  2DMY A;  3ZKD A;  1ZM9 A;  2EMF A;  2EPA A;  1HNW E;  1ZXN A;  1ZM2 A;  4MLV A;  4GEQ B;  4R1F A;  5KL6 A;  2PRT A;  1N33 E;  2DRP A;  1RR9 A;  4LF5 E;  2HJJ A;  2DB2 A;  3Q6M A;  3MSW A;  2UUB I;  4B3S E;  4DU8 A;  4JI5 I;  4DV2 E;  1IQS A;  4DR5 E;  1E3P A;  5IT9 C;  1H74 A;  3M6A A;  5EKW A;  4JI2 I;  1WHN A;  4DV6 E;  4DPX A;  4IZJ A;  4OO1 E;  2EM2 A;  4USM A;  4KHP I;  1MGT A;  2VF1 A;  1RRE A;  1KVK A;  4DR4 E;  1Z59 A;  1MU5 A;  1I94 E;  2GQ0 A;  2KOU A;  4P7D A;  1FWK A;  2B7T A;  1T4N A;  4F2J C;  4AQY E;  1YYO A;  3Q1Q A;  1N3G A;  3K1J A;  3QT7 A;  1XNQ E;  4B3M E;  2PO0 A;  2JVA A;  2F1D A;  1IBL E;  4ZYG A;  2UXB E;  2UU9 E;  2V8P A;  4R8O A;  4IZK B;  3CDI A;  1DGC A;  2Z5B A;  4R2S A;  4K0K I;  2Z5B B;  1EH6 A;  1YUI A;  3UK3 C;  2PNZ B;  4QNK A;  3QG5 C;  3HUL A;  3ZZU A;  1TF6 A;  1K47 A; 
#chains in the Genus database with same CATH homology
 2V88 A;  1ZBQ A;  2O1U A;  4K0K E;  4X8W A;  1X48 A;  1YZ9 A;  2GS8 A;  3ZKB A;  1HNW I;  2V86 A;  2F4V E;  2Q2E B;  1HR0 E;  4LF7 E;  2MDR A;  4B3R I;  3AV0 A;  4URL A;  4DKK A;  4DUY E;  2Z5C B;  1USU A;  1IBK I;  1FKA E;  2MC5 A;  2L92 A;  4I3H A;  1N34 E;  1USV A;  5BR8 I;  2NUG A;  1J5E E;  1NHJ A;  3PYG A;  1UHZ A;  4Z7Y A;  2FTX B;  2RS6 A;  1DI2 A;  1N32 I;  2RS7 A;  3B78 A;  4MYU A;  3IWC A;  4X65 E;  1VIS A;  1J5E I;  4KQV A;  4YY3 E;  4TUI A;  5IWA I;  3OTO I;  3K17 A;  2B9D A;  4JI4 E;  4JI0 E;  4DPU A;  2NPF A;  3LLH A;  4LF4 I;  2R42 A;  2X7I A;  1H7U A;  4IZJ B;  1ZXM A;  4LF9 E;  2AJ4 A;  2DSY A;  2HKE A;  4LF6 I;  1XNR E;  2LJP A;  4BC9 A;  2V2Q A;  4FWD A;  1PVG A;  1HNX I;  2EWL A;  1Y6Z A;  1B62 A;  1J26 A;  2LUP B;  4DXL A;  4DR1 E;  5AE2 A;  1HNX E;  4OX9 I;  2K4V A;  1ELO A;  4JI2 E;  1XMQ E;  4B3T I;  4KZS A;  4DR2 E;  3HJC A;  4M2Z A;  3Q6N A;  3WU5 A;  3VYX A;  2LE2 A;  4X64 I;  2IOQ A;  1Y4U A;  4B3T E;  1KKH A;  2ZIT A;  4JYA I;  4X62 E;  2CPN A;  2L33 A;  1Z5A A;  4BBY A;  4DV5 E;  4JI7 I;  3DJW A;  4DV7 I;  4HY1 A;  4JV5 E;  1N0V C;  3T1Y I;  4J8Z A;  5FWK A;  3KWR A;  4LF8 I;  3B8H A;  2YZT A;  1N34 I;  5BR8 E;  3C4B A;  4L5N C;  1RC7 A;  2DIX A;  4DV2 I;  4P52 A;  2M1S A;  2X36 A;  2HFS A;  3F6G A;  3HTX A;  1HR0 I;  2UUA E;  1PIE A;  2DEI A;  4WUD A;  2VF3 A;  1EI1 A;  4HAC B;  3WU6 A;  5CFF E;  1BKN A;  4DV1 E;  2PNL A;  1YYK A;  5AAS A;  1UIL A;  2JY9 A;  4DMI A;  4YHH E;  3J7A G;  4X65 I;  4DR5 I;  3WU4 A;  4WYQ B;  1MG7 A;  4LFB I;  4DV0 I;  4JI6 E;  4LF5 I;  4DV6 I;  4JI0 I;  4X66 E;  3AUZ A;  5LL6 R;  2YT4 A;  2EFG A;  4KHP E;  1DQ3 A;  4X66 I;  2RTX A;  2R3V A;  5A2Q C;  3PYF A;  1T4L B;  4M1K A;  3F0N A;  2HFU A;  3J81 Q;  1FJG I;  1D6T A;  4DR2 I;  4LFC I;  1Z0G A;  4UT4 A;  1WXR A;  1FNM A;  1EA6 A;  4USK A;  4NXM I;  3K6Q A;  2E5L I;  1GZ6 A;  1O0W A;  4F54 A;  4DUZ I;  2LTS A;  2L8T A;  2L2N A;  2UXD E;  1FWL A;  4B3R E;  1XMO I;  3HXL A;  1HNZ E;  3JU0 A;  4LF9 I;  3JTZ A;  1Z0V A;  2CGE A;  5DNY A;  2ZM6 E;  4JV5 I;  1SR9 A;  4GKJ I;  1FI4 A;  4YY3 I;  2L2M A;  3ADI A;  1H7S A;  1WHQ A;  3LML A;  4P7A A;  2ZM6 I;  2Z5C A;  4JI1 I;  4UTG A;  1Z5C A;  2ODR D;  5IWA E;  3OTO E;  4BS9 A;  4DR4 I;  1GQE A;  2Z5E A;  2JOX A;  2F8B A;  2N3G A;  4Q28 A;  3IWB A;  2WZO A;  4DV0 E;  2BM1 A;  5F3W A;  4DPW A;  4DR6 I;  4LTY A;  3QT6 A;  3ADG A;  2J7K A;  3ADL A;  1UEK A;  1Z0W A;  2E1R A;  2LMZ A;  5LMU I;  5ADZ A;  3H09 A;  3PYD A;  2A2D A;  2MC6 A;  3V2U C;  4YHH I;  2KON A;  1U2R A;  4LFA I;  1HNZ I;  5L3J A;  1Z0T A;  4I8O A;  2A2C A;  4JG4 A;  4JI6 I;  1OJ4 A;  2HKJ A;  4HXZ A;  3F6H A;  1XNQ I;  4GKJ E;  1YYW A;  3IWD A;  1ZM3 A;  1XMQ I;  1Y4S A;  3OML A;  3VYY A;  3J81 C;  3LNU A;  2M7Q A;  5A2Q Q;  2UUA I;  2WW4 A;  2B7V A;  2O1T A;  5AE3 A;  3ZZ0 A;  4DR3 E;  3JAM C;  4JYA E;  1B63 A;  2LTR A;  2XEX A;  1Z0C A;  2V34 A;  4DV3 I;  4N3O A;  3PRY A;  1HK7 A;  4HAC A;  2HK3 A;  4IZJ D;  2V8Q B;  5AE1 A;  4DV4 E;  3RMP A;  1IBK E;  3ZM7 A;  3VK6 A;  2KHX A;  2LRS A;  4LFB E;  2UUC E;  2V2Z A;  3V5R A;  1S16 A;  4DV4 I;  4HYM A;  4OOG C;  4DV1 I;  4JI8 E;  5GMD A;  1A6F A;  3ADJ A;  3ZOQ B;  4LU9 A;  2ZBK B;  4FWG A;  2M4I A;  1Z5B A;  4NXN E;  3J80 C;  4R03 A;  2RSM A;  4JI3 E;  2BV3 A;  3T1H E;  1IBM I;  4B3M I;  2NA2 A;  4DR7 E;  4BCA A;  3J7Y p;  1KIJ A;  4AQY I;  2V83 A;  5LMU E;  1DAR A;  4NXM E;  2O1W A;  2ODR C;  4WUB A;  4JI3 I;  2B3T B;  4L8N A;  4PU9 A;  4LF6 E;  1XNR I;  1PKP A;  3D4J A;  2IHR 1;  2L3J A;  2HK2 A;  2BM0 A;  3P1X A;  2G7H A;  2FV4 B;  1ZM4 A;  3H4L A;  4JI7 E;  4DV5 I;  2UXC I;  4F9A B;  2O1V A;  2JR1 A;  3HPS A;  2UUC I;  2FGG A;  2HHH E;  4FN5 A;  2JOB A;  3T1Y E;  2LJH A;  2EZ6 A;  1QZR A;  4DU7 A;  3P06 A;  1MX0 A;  1N0U A;  4LFC E;  2UXC E;  4IZK A;  1NHI A;  1STU A;  2DEJ A;  4F9C B;  4P78 A;  4DUY I;  2H36 X;  1RQ0 A;  1N32 E;  1QU6 A;  4M30 A;  2V89 A;  4FW9 A;  4JI1 E;  2N3H A;  3QT5 A;  1IBM E;  3J80 Q;  3DF6 A;  4DR7 I;  2VQE E;  4B3S I;  3HPZ A;  2CG9 A;  1H73 A;  1N36 E;  1KTV A;  5GME A;  4M0V A;  4WSP A;  1XMO E;  4LF4 E;  4MYT A;  5FLX Q;  2V85 A;  3QT8 A;  5LMN I;  1H72 C;  4XTJ A;  1S4E A;  4WUC A;  4JI8 I;  1NZ0 A;  3FIG A;  2LBS B;  4LFA E;  3LTO A;  4TUG A;  2L2K B;  1IBL I;  2UXB I;  4NXN I;  5FLX C;  2L3C A;  4BMJ A;  2IOP A;  1Z0E A;  4PRX A;  3T1H I;  2VE7 C;  2OI2 A;  4JI4 I;  4F9B B;  3HQ1 A;  4OX9 E;  4ED4 A;  1I94 I;  1FJG E;  4FWH A;  2VQF I;  3WU3 A;  3JAM Q;  2JWO A;  4DR6 E;  1T4O A;  4LF7 I;  4GKK E;  3ZZT A;  4BC7 A;  1N33 I;  4DV3 E;  2NUE A;  2L6M A;  4X64 E;  2HHH I;  1X47 A;  2LUQ A;  4GKK I;  4X62 I;  3C4T A;  4EMD A;  5LMN E;  2UXD I;  1EKZ A;  3LPS A;  1Z0B A;  1ZBT A;  2V2V A;  2V87 A;  4DR1 I;  4ZVI A;  4DPY A;  3J7A M;  2PNM A;  3CWV A;  2E1M A;  4DPT A;  2CZ9 A;  4DR3 I;  2UU9 I;  4PRV A;  2E5L E;  4WFT A;  2VQE I;  5IT9 Q;  3GON A;  2VQF E;  3PYE A;  1XHK A;  1WUU A;  4DUZ E;  4WPY A;  1N36 I;  4Z7C A;  4DV7 E;  3K85 A;  4RPF A;  1X49 A;  1NHH A;  5T6J A;  3B82 A;  2NUF A;  2UUB E;  4JI5 E;  4LF8 E;  2DMY A;  3ZKD A;  1ZM9 A;  1HNW E;  1ZXN A;  1ZM2 A;  4GEQ B;  4R1F A;  1N33 E;  1RR9 A;  4LF5 E;  3Q6M A;  2DB2 A;  3MSW A;  2UUB I;  4B3S E;  4DU8 A;  4JI5 I;  4DV2 E;  4DR5 E;  5IT9 C;  1H74 A;  3M6A A;  4JI2 I;  1WHN A;  4DV6 E;  4DPX A;  4IZJ A;  4USM A;  4KHP I;  2VF1 A;  1RRE A;  1KVK A;  4DR4 E;  1Z59 A;  1MU5 A;  1I94 E;  2GQ0 A;  2KOU A;  4P7D A;  1FWK A;  2B7T A;  1T4N A;  4AQY E;  1YYO A;  3Q1Q A;  3K1J A;  3QT7 A;  1XNQ E;  4B3M E;  2JVA A;  1IBL E;  2UXB E;  2UU9 E;  2V8P A;  4R8O A;  4IZK B;  2Z5B A;  4K0K I;  2Z5B B;  3ZZU A;  3HUL A;  2F4V I;  1K47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...