1J5EE

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1j5eE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1j5eE02
2DIXA 4LF5I 2E5LE 4DPWA 4M30A 2RS7A 4LF4E 2L3CA 1FJGE 5IWAI 4M2ZA 3ADGA 2HK3A 4RPFA 1HR0E 3PYEA 3T1YI 2CZ9A 4DPTA 1I94E 1S4EA 2LTSA 5BR8I 4DR6I 4YY3I 4DR1I 4JI0E 3ADLA 4JYAI 1T4LB 1STUA 3ZZ0A 3HTXA 1HNZE 4DU7A 2JY9A 3QT7A 4JI1E 1KVKA 4OOGC 1XHKA 4WYQB 1IBME 1J5EI 4GKKE 4UT4A 2RTXA 1O0WA 3V5RA 4X64E 3J80C 3VYYA 4FWHA 2UUAE 4Z7YA 1ZXNA 2OI2A 2N3GA 4WFTA 3WU4A 4X65I 4DPXA 1UEKA 1XMOE 5LMUE 3J7AG 2XEXA 4X66E 1ZM9A 3LPSA 1Z5CA 4DV0I 2AJ4A 3LNUA 4DPYA 1RR9A 2L2KB 1U2RA 4JI6E 2UUBE 1OJ4A 1FI4A 4KHPE 4DR3E 2V2QA 4B3SE 4B3RI 4KQVA 1T4OA 4JI5E 1BKNA 3B78A 1H74A 1XNQI 1N34E 4JI7I 2MDRA 2HKJA 4UTGA 5LMNI 4LFCI 1X49A 4JI4E 1Z0CA 2L2NA 2VF3A 4DV2I 4DKKA 1H7UA 5FLXQ 1Z59A 4LF9I 4AQYE 1EA6A 2Q2EB 2R42A 1ZM2A 2NUGA 2GS8A 1N36E 1B63A 2NA2A 1HNWI 1FNMA 2LBSB 4YHHI 4DV6E 2UXCI 4DV4E 1NZ0A 1IBLI 4P7AA 4DUYI 3QT6A 1A6FA 1QU6A 3OTOE 2UXBE 2ZBKB 2R3VA 1N32E 4USMA 3K17A 4X8WA 4B3ME 4JV5E 4B3TE 4GKJI 4FWDA 1H72C 2F4VE 2BV3A 4WUDA 4X62I 1IBKE 3ZM7A 2B3TB 1ZM4A 1YYKA 4USKA 4LF6I 3VYXA 2ZITA 1ELOA 2B7TA 1ZBTA 2VQFI 2ZM6I 1XMQE 2J7KA 4JI3I 2V2ZA 4LFBE 2A2DA 3JAMC 2DEJA 2UXDE 1NHIA 3CWVA 4LF5E 4DR4I 5A2QQ 2BM0A 5IT9Q 2E5LI 3B82A 2X36A 4LF4I 1FJGI 1HR0I 2B7VA 3HULA 1WUUA 4XTJA 2L3JA 4MYUA 3PYFA 3J7Yp 4JI0I 1Z0GA 2N3HA 1S16A 1NHJA 2WW4A 2UUCI 1HNZI 3J81C 1YZ9A 3QT8A 2LJPA 4DV1E 4LFAI 2IHR1 3D4JA 2X7IA 5GMEA 1VISA 1H73A 4P52A 1IBMI 4GKKI 3B8HA 3K1JA 2HHHE 4K0KE 2RSMA 2UUAI 4HXZA 4DV7E 3M6AA 2LUPB 4MYTA 4NXME 5LMUI 4X66I 1Z0BA 2VQEE 2KHXA 4DR2I 2L33A 5L3JA 4JI6I 4DV3E 2UUBI 3C4TA 4KHPI 4DR3I 4PRVA 4WUCA 1UHZA 4B3SI 1D6TA 1Z0TA 4LF7E 4JI5I 3WU6A 1DARA 2E1RA 4DV2E 4DR5E 1UILA 4JI4I 2V8PA 4JI2E 4AQYI 1QZRA 4ED4A 2LTRA 1HNXE 2UXCE 3LTOA 1XNRE 4DUYE 1N36I 4ZVIA 1DI2A 1KIJA 4DV6I 4DV4I 1N0VC 4WUBA 4NXNE 1H7SA 4HY1A 5LL6R 4DUZE 2DB2A 3OTOI 2UXBI 2HKEA 3J80Q 4OX9I 3ZKBA 1N32I 1Z0EA 1N33E 2UU9E 4DR7E 4B3MI 4B3TI 3T1HE 2F4VI 1RC7A 1N0UA 1Z5AA 1IBKI 1KKHA 1Z5BA 4PU9A 1Z0VA 1RQ0A 1EI1A 2VQFE 2ZM6E 1X47A 4DV5E 3ZZTA 3QT5A 4Z7CA 2YT4A 4JI8E 4LF8E 2L2MA 1XMQI 4LFBI 5IWAE 3T1YE 4DR4E 2UXDI 3ZZUA 5BR8E 4DR6E 5FLXC 3H4LA 4YY3E 4DR1E 1FKAE 4DXLA 1I94I 4JYAE 4FN5A 5GMDA 4DU8A 3F0NA 3Q1QA 2A2CA 2HFSA 1PKPA 2V34A 2JVAA 1J5EE 4JI1I 2EZ6A 1RREA 4DPUA 2UUCE 1GQEA 4HACA 3GONA 4LFAE 2HK2A 4X64I 4X65E 4DV1I 1KTVA 3P1XA 2DEIA 3WU3A 4HACB 1MU5A 4DV0E 1XMOI 3PYDA 2HHHI 4K0KI 3V2UC 3PYGA 2RS6A 1FWLA 1J26A 4B3RE 2BM1A 4FWGA 1FWKA 1EKZA 1XNQE 4DV7I 4JI7E 4NXMI 4DR2E 2LJHA 5LMNE 4EMDA 4LFCE 3ADIA 4I3HA 4JG4A 3JAMQ 1N34I 1MX0A 1PVGA 2VQEI 1Z0WA 3C4BA 4DV3I 2DMYA 4LF9E 1YYWA 1NHHA 4R1FA 4LF7I 5A2QC 5IT9C 4DR5I 1HNWE 4YHHE 2LUQA 4URLA 1IBLE 4JI2I 1ZXMA 3ADJA 1HNXI 2NUEA 1ZM3A 3ZKDA 4HYMA 1PIEA 1XNRI 4PRXA 1X48A 4GKJE 3J81Q 4X62E 1YYOA 4JV5I 3LLHA 4NXNI 5CFFE 4OX9E 1T4NA 4DUZI 1B62A 4LF6E 4FW9A 4M1KA 2V2VA 1N33I 2UU9I 4DR7I 1MG7A 4JI3E 3WU5A 3T1HI 3J7AM 1WHNA 2NUFA 1WHQA 2NPFA 2LRSA 2EFGA 4DV5I 2CPNA 1K47A 2HFUA 4JI8I 4LF8I
chains in the Genus database with same CATH superfamily
2DIXA 4LF5I 2E5LE 1ZU1A 4MU0A 4DPWA 4M30A 2RS7A 2MDGA 4LF4E 2L3CA 1FJGE 5IWAI 4M2ZA 2EN8A 3ADGA 2HK3A 4RPFA 2EMIA 2EQ0A 1HR0E 1UDOA 1GTKA 3PYEA 3T1YI 2EOFA 1AAYA 2CZ9A 4DPTA 1I94E 1S4EA 4OKGA 2Z5EA 1R6MA 2LTSA 5BR8I 4WSGA 4DR6I 4YY3I 4DR1I 1A1GA 4JI0E 2RQLA 3ADLA 2WNRA 4JYAI 1T4LB 5C0XF 2YTGA 1NEIA 1AH5A 5IV8B 4IFDA 4IFDD 1STUA 5A6AA 3ZZ0A 3HTXA 1HNZE 2CTDA 2EL6A 1X5WA 4DU7A 2JY9A 1USVA 3QT7A 4JI1E 1KVKA 4OOGC 1XHKA 2E72A 4WYQB 4IFDB 1IBME 2CSHA 4U3BA 4GKKE 1J5EI 3HPSA 4BC9A 4UT4A 3P3CA 2YSOA 2RTXA 1O0WA 3V5RA 4X64E 3J80C 2WZOA 3VYYA 4X9JA 2UUAE 4FWHA 2EM3A 2ODRD 2N8XA 1QNTA 2YTFA 2N3GA 1GZ6A 3H09A 4IJDA 4ZYDA 1ZXNA 2BA0D 2NN6F 2OI2A 3IWCA 2EMYA 4WFTA 2M9AA 3WU4A 2EQ1A 4MQYA 4X65I 2EN1A 4DPXA 4J3DA 1UEKA 1XMOE 5LMUE 3IWDA 3J7AG 2XEXA 5JEAF 4X66E 5KL2A 1ZM9A 3LPSA 5DNLA 1Z5CA 2BR2A 1X6FA 4RHBB 1OYSA 4DV0I 2AJ4A 3LNUA 4DPYA 2HJJA 1RR9A 2L2KB 2HGHA 1U2RA 4JI6E 3P3GA 3KZYA 2UUBE 1OJ4A 1FI4A 3B4TA 4KHPE 4DR3E 1EH6A 3KZZA 2V2QA 3RMPA 4B3SE 4B3RI 4KQVA 1T4OA 4JI5E 2EMKA 2L8TA 1BKNA 4P78A 2BR2B 3B78A 5EL9A 1H74A 1RHYA 3P76A 1XNQI 2LCEA 1N34E 5EKWA 2MDRA 4JI7I 5C0XE 2HKJA 5AC5A 4UTGA 5A6KA 5LMNI 1YUIA 4LFCI 5ELWA 1X49A 4JI4E 1Z0CA 5AC4A 2YTEA 2YU5A 3THNA 3TQMA 2JEAB 3L7ZB 2LJUA 1MGTA 2L2NA 2PNMA 2VF3A 4DV2I 2EQ3A 2EN2A 4DKKA 2WP8A 1H7UA 5FLXQ 1Z59A 4LF9I 4AQYE 3EPHA 4F6NA 1EA6A 2EN6A 4WX9A 2C37A 2Q2EB 2EMCA 1ZAAC 2R42A 1ZM2A 2JXPA 5C0XD 2NUGA 2NN6E 4L5NC 2KOUA 2GS8A 4IFDF 2EPPA 3BGHA 1N36E 1B63A 4ZYHA 2NA2A 1HNWI 1FNMA 2LBSB 4YHHI 4DV6E 2UXCI 4DV4E 2V86A 1NZ0A 1IBLI 2MC6A 4P7AA 2C38A 4DUYI 5A69A 3QT6A 1YHCA 4FW6A 5JEAE 2GO4A 1A6FA 2PRTA 1QU6A 1ZBQA 3OTOE 2UXBE 3MHSC 3MSWA 1XXEA 2ZBKB 3C6MA 3F6GA 1PJQA 2R3VA 1N32E 1YSAC 4USMA 3AUZA 2KONA 3K17A 2YU8A 1RMDA 4X8WA 4B3ME 4JV5E 4B3TE 4GKJI 4FWDA 1H72C 2F4VE 2BV3A 4WUDA 4OO1A 4X62I 2EM6A 4WXDA 4FW5A 4OO1D 3EQ1A 1X6EA 1IMUA 1IBKE 1A1FA 5JEAD 2EPOA 2EM0A 2IOPA 2PNZB 3ZM7A 2ELYA 2B3TB 4R8OA 1ZM4A 1YYKA 2NN6C 4TUIA 4USKA 2JOXA 1A1LA 1OYRA 4LF6I 3VYXA 1Y6ZA 1ZR9A 2H36X 2ZITA 3F6HA 1ELOA 2B7TA 4OO1B 4N4RB 4IZKB 4BMJA 1ZBTA 2YRHA 1PDAA 1IQOA 2RPCA 2VQFI 2ZM6I 5JEAC 1XMQE 2J7KA 4JI3I 2EMXA 2V2ZA 4F9BB 4LFBE 2A2DA 2LE2A 4WPYA 1T39A 3JAMC 4IFDE 2HC5A 2ENCA 2DEJA 1UN6B 2UXDE 1NHIA 2VF1A 4R2RA 2EL5A 3CWVA 2NABA 4LF5E 3M7NG 4ZYEA 2V85A 4DR4I 1P42A 4TUGA 2K4VA 2BM0A 3PRYA 5A2QQ 5IT9Q 2E5LI 3B82A 2DSYA 5A6JA 2X36A 1G2DC 4BA1B 4LF4I 5DROA 1FJGI 4WSPA 2DGCA 1HR0I 2J65A 2EOZA 2B7VA 3HULA 1WUUA 4XTJA 1T38A 3VHTB 2L3JA 4MYUA 4AM3A 3IWBA 4L8NA 5K36A 3PYFA 3J7Yp 2WCC3 4JI0I 4HTGA 4FW7A 1X6HA 2N3HA 1Z0GA 4IFDC 2JWOA 1S16A 5DRRA 1EH8A 1NHJA 5KL4A 1A1HA 2WW4A 2FGGA 1UBDC 2UUCI 3DJWA 3J81C 2L92A 1YFHA 1HNZI 2EM9A 1YZ9A 3QT8A 2LJPA 5K36B 4DV1E 4LFAI 2IHR1 3D4JA 1WXRA 2X7IA 5GMEA 2EOJA 1VISA 1H73A 4P52A 4OO1F 1IBMI 4GKKI 1PJTA 3B8HA 4P7DA 2MKNA 3K1JA 2HHHE 2ODRC 4NZVA 4K0KE 2RSMA 2UUAI 2F8BA 2PO2B 2EN4A 5FWKA 4IZJB 2CGEA 1R6LA 1BBGA 4HXZA 4DV7E 3M6AA 2LUPB 1NCSA 2EOYA 2O1VA 1Z1BA 4MYTA 2PO1A 4NXME 3P06A 4N3OA 2YSPA 5LMUI 2G7HA 2JEAA 3L7ZA 4X66I 1G2FC 1Z0BA 2ELZA 5LLQA 2CG9A 2VQEE 2KHXA 2JT2A 4DR2I 3M7ND 2EOMA 2L33A 2IERA 5L3JA 1LLMC 2V8QB 4JI6I 4DV3E 2UUBI 3C4TA 4KHPI 1X3CA 4PRVA 4DR3I 2M7QA 4WUCA 1UHZA 4B3SI 1D6TA 1BB8A 4LF7E 1Z0TA 2EPNA 2PO0A 2R1FA 4JI5I 3WU6A 1DARA 3JU0A 4J8ZA 1E3PA 2E1RA 4R2PA 1P47A 2YRMA 2EMAA 1TF3A 2EPUA 4DV2E 4DR5E 3UHMA 1UILA 2B9DA 4JI4I 3OMLA 2V8PA 2PO0B 2R76A 4JI2E 2EM4A 4R2DA 3NZKA 2ADRA 4QNKA 4OO1E 4AQYI 2YTJA 3BBGA 1QZRA 4ED4A 5K36F 2LTRA 5AE2A 1HNXE 2EPCA 1B69A 2UXCE 4Z7YA 5C0XC 4M0VA 2YZTA 3LTOA 1XNRE 3K85A 4AIDA 4O43A 3THOB 2JP9A 3CDJA 4LCGA 4DUYE 1N36I 2YTQA 4ZVIA 1DI2A 2V83A 1KIJA 2PNZA 4DV6I 4F6MA 4DV4I 1N0VC 4WUBA 4R2QA 2BBGA 4NXNE 1F2IG 2VRDA 1H7SA 2EMLA 4HY1A 4MU3A 1SFEA 5LL6R 2EM2A 4BC7A 4DUZE 2DB2A 2JYAA 2DRPA 2EPRA 4IZKA 1UDNA 5DNXA 2HKEA 3J80Q 3OTOI 2UXBI 2EP3A 3AV0A 3UK3C 4KWYA 2O1UA 4OX9I 3GMEA 5F3WA 4MLQA 4BHBA 3ZKBA 1N32I 1Z0EA 1N33E 2UU9E 4DR7E 4ISAA 4B3MI 4B3TI 4FK5C 1JK1A 1OYPA 3T1HE 4GQUA 2JEBB 2Z5BB 2CT1A 2F4VI 4OO1C 2EM7A 2EMWA 1RC7A 1N0UA 2RSIA 3GCMA 2DMIA 1DGCA 1Z5AA 2IESA 5KL5A 1IBKI 4IS9A 4Q28A 1KKHA 1Z5BA 2GQ0A 2GLIA 1Z0VA 4PU9A 1RQ0A 2D9HA 1EI1A 4HEIA 2VQFE 2ZM6E 2EM5A 2LVHA 1X47A 4O5GA 2IOQA 4R2AA 4DV5E 3ZZTA 3QT5A 2FTXB 5DNYA 4Z7CA 3M85G 2LV2A 2YT4A 4JI8E 4LF8E 2EN7A 1E3HA 4BA1A 2L2MA 1XMQI 5AE1A 4MU4A 2YTPA 4NHRA 2C39B 5K36E 2ENAA 4LFBI 5IWAE 2DLKA 5KL7A 3ECRA 2GHFA 3U1YA 3P3EA 1Y4SA 3T1YE 4DR4E 3GLLA 5KL6A 1YH8A 2UXDI 3ZZUA 5BR8E 4DR6E 1EH7A 5TSEA 5ADZA 3C6KA 5A6BA 5FLXC 5A6BD 3H4LA 4YY3E 4DR1E 1Y4UA 2F1DA 3DD6A 1FKAE 4DXLA 1I94I 4JYAE 4F54A 4FN5A 3EPJA 5IXMB 2JE6B 5T6JA 3PS3A 4LCHA 2EJ4A 2EOQA 3H1CA 5GMDA 2I13A 2PO1B 5K36D 2ENHA 2FV4B 4GZNC 4DU8A 2O1WA 2O3ZA 4KZSA 4F9CB 3F0NA 2EMBA 2A2CA 2I9IA 1PKPA 2HFSA 2V34A 2JVAA 2YTOA 1KJKA 3Q1QA 4M9VC 1SR9A 4O4KA 4IS1C 1J5EE 2YPNA 3EPLA 4JI1I 5K36C 2EZ6A 4R03A 1RREA 2PO2A 4DPUA 1DQ3A 4IZJA 4IZJD 2UUCE 4GEQB 1GQEA 2EMZA 3GONA 4HACA 2EORA 4LFAE 2V88A 3HPZA 2WNRB 2HK2A 4X64I 4X65E 2M1SA 2J7JA 2Z5CA 2MKDA 4DV1I 2L6MA 4AIMA 1KTVA 3P1XA 2DEIA 3WU3A 2EOHA 4LOMA 1BBOA 2EL4A 2EOEA 5KL3A 4HACB 1MU5A 2Q8UA 4DV0E 1XMOI 5DRQA 1TF6A 2A25A 3L00A 2M4IA 2YWQA 2Z5CB 3PYDA 3M85D 4BA2A 2HHHI 3QG5C 4K0KI 2YTDA 2EOXA 3V2UC 3PYGA 2RS6A 3Q6NA 2WBUA 1FWLA 2WBTA 1JK2A 2EN3A 1N3GA 2BB8A 1MEYC 4B3RE 1J26A 2BA1G 2BM1A 4FWGA 2JR1A 1FWKA 4I8OA 3FIGA 1HK7A 1EKZA 4F2JC 2V87A 1XNQE 2EE8A 4JI7E 4DV7I 2V89A 4FW4A 4BA2B 4BHCA 4NXMI 4DR2E 3M99B 2LO3A 2LJHA 4R2CA 5LMNE 4EMDA 4BS9A 4LFCE 3ADIA 3HXLA 4JG4A 2YTNA 4I3HA 1VI7A 3JAMQ 3BIDA 1N34I 2VE7C 4O24A 4ZYGA 1MX0A 1PVGA 2VQEI 3LMLA 3PS1A 1Z0WA 3C4BA 4DV3I 2DMYA 4LF9E 4U3DA 1TN9A 1YYWA 3DF6A 1Y5YA 1NHHA 2EPLX 3VK6A 4R1FA 1A1JA 4LF7I 5A2QC 5IT9C 3HKMA 4OZEA 1Y60A 5AE3A 4BBYA 4BCAA 4DR5I 1HNWE 4YHHE 2LUQA 2PNLA 4LPFA 4URLA 1IBLE 2EOOA 4JI2I 4Q35B 1A1KA 2YRKA 2EPAA 2JOBA 3BF2A 3JTZA 3CDIA 5C0XA 4R2SA 1ZXMA 2WP8B 2K7IA 1WJPA 2EOSA 3ADJA 1UDSA 4FW3A 3Q6MA 1HNXI 2GO3A 3KWRA 2NUEA 3U1KA 2JEBA 1ZM3A 2Z5BA 2C37B 3KRNA 4HYMA 3HQ1A 1PIEA 3ZKDA 4PRXA 1X48A 1XNRI 4GKJE 3J81Q 5C0XB 2EPMX 4R2EA 2JPAA 2WBSA 1WRJA 4X62E 2LT7A 2EM8A 2EOIA 1YYOA 3LLHA 2O1TA 4JV5I 1YPNA 4NXNI 5CFFE 4LTYA 4OX9E 1T4NA 2YTIA 1YUJA 3MHHC 4LU9A 3EPKA 4DUZI 1B62A 4LF6E 2NN6A 2C38B 2NN6D 2BA1D 4FW9A 2VESA 1A1IA 2GPIA 5DRPA 4M1KA 4RH8A 4F9AB 2AE8A 2EPXA 4MLVA 1L4SA 2V2VA 1N33I 4DMIA 2C39A 4MDTA 2UU9I 4NBQA 4DR7I 2EMFA 2EMHA 2EPKX 1MG7A 2EWLA 2LMZA 4JI3E 2BA0G 3HJCA 3WU5A 2NN6B 5JEAA 3T1HI 2EMGA 3J7AM 1KYQA 2CVEA 1WHNA 2NUFA 1UDQA 2MC5A 1WHQA 4QNJA 1IQSA 4LCFA 4MU1A 5AASA 2NPFA 2DLQA 1PJSA 3K6QA 5JEAB 2LRSA 4WXCA 3PS2A 1USUA 2EFGA 4DV5I 2CPNA 1K47A 2EPZA 2JE6A 2HFUA 3ZOQB 2E1MA 4JI8I 4LF8I
chains in the Genus database with same CATH topology
2DIXA 4LF5I 2E5LE 4DPWA 4M30A 2RS7A 4LF4E 2L3CA 1FJGE 5IWAI 4M2ZA 3ADGA 2HK3A 4RPFA 1HR0E 3PYEA 3T1YI 2CZ9A 4DPTA 1I94E 1S4EA 2Z5EA 2LTSA 5BR8I 4DR6I 4YY3I 4DR1I 4JI0E 3ADLA 4JYAI 1T4LB 1STUA 3ZZ0A 3HTXA 1HNZE 4DU7A 2JY9A 1USVA 3QT7A 4JI1E 1KVKA 4OOGC 1XHKA 4WYQB 1IBME 1J5EI 4GKKE 3HPSA 4BC9A 4UT4A 2RTXA 1O0WA 3V5RA 4X64E 3J80C 2WZOA 3VYYA 4FWHA 2UUAE 2ODRD 4Z7YA 1ZXNA 3H09A 2N3GA 1GZ6A 2OI2A 3IWCA 4WFTA 3WU4A 4X65I 4DPXA 1UEKA 1XMOE 5LMUE 3IWDA 3J7AG 2XEXA 4X66E 1ZM9A 3LPSA 1Z5CA 4DV0I 2AJ4A 3LNUA 4DPYA 1RR9A 2L2KB 1U2RA 4JI6E 2UUBE 1OJ4A 1FI4A 4KHPE 4DR3E 2V2QA 3RMPA 4B3SE 4B3RI 4KQVA 1T4OA 4JI5E 2L8TA 1BKNA 4P78A 3B78A 1H74A 1XNQI 1N34E 4JI7I 2MDRA 2HKJA 4UTGA 5LMNI 4LFCI 1X49A 4JI4E 1Z0CA 2L2NA 2VF3A 2PNMA 4DV2I 4DKKA 1H7UA 5FLXQ 1Z59A 4LF9I 4AQYE 1EA6A 2Q2EB 2R42A 1ZM2A 2NUGA 2KOUA 4L5NC 2GS8A 1N36E 1B63A 2NA2A 1HNWI 1FNMA 2LBSB 4YHHI 4DV6E 2UXCI 4DV4E 2V86A 1NZ0A 1IBLI 2MC6A 4P7AA 4DUYI 3QT6A 1A6FA 1QU6A 1ZBQA 3OTOE 2UXBE 2ZBKB 3MSWA 3F6GA 2R3VA 1N32E 4USMA 3AUZA 2KONA 3K17A 4X8WA 4B3ME 4JV5E 4B3TE 4GKJI 4FWDA 1H72C 2F4VE 2BV3A 4WUDA 4X62I 1IBKE 2IOPA 3ZM7A 2B3TB 4R8OA 1ZM4A 1YYKA 4USKA 4TUIA 2JOXA 4LF6I 3VYXA 1Y6ZA 2H36X 2ZITA 3F6HA 1ELOA 2B7TA 4IZKB 4BMJA 1ZBTA 2VQFI 2ZM6I 1XMQE 2J7KA 4JI3I 2V2ZA 4F9BB 4LFBE 2A2DA 2LE2A 4WPYA 3JAMC 2DEJA 2UXDE 1NHIA 2VF1A 3CWVA 4LF5E 2V85A 4DR4I 4TUGA 2K4VA 2BM0A 3PRYA 5A2QQ 5IT9Q 2E5LI 3B82A 2DSYA 2X36A 4LF4I 1FJGI 4WSPA 1HR0I 2B7VA 3HULA 1WUUA 4XTJA 2L3JA 4MYUA 3IWBA 4L8NA 3PYFA 3J7Yp 4JI0I 1Z0GA 2N3HA 2JWOA 1S16A 1NHJA 2WW4A 2FGGA 2UUCI 3DJWA 3J81C 2L92A 1HNZI 1YZ9A 3QT8A 2LJPA 4DV1E 4LFAI 2IHR1 3D4JA 1WXRA 2X7IA 5GMEA 1VISA 1H73A 4P52A 1IBMI 4GKKI 3B8HA 4P7DA 3K1JA 2HHHE 2ODRC 4K0KE 2RSMA 2UUAI 2F8BA 5FWKA 4IZJB 2CGEA 4HXZA 4DV7E 3M6AA 2LUPB 2O1VA 4MYTA 4NXME 3P06A 4N3OA 5LMUI 2G7HA 4X66I 1Z0BA 2CG9A 2VQEE 2KHXA 4DR2I 2L33A 5L3JA 2V8QB 4JI6I 4DV3E 2UUBI 3C4TA 4KHPI 4DR3I 4PRVA 2M7QA 4WUCA 1UHZA 4B3SI 1D6TA 1Z0TA 4LF7E 4JI5I 3WU6A 1DARA 3JU0A 4J8ZA 2E1RA 4DV2E 4DR5E 1UILA 2B9DA 4JI4I 3OMLA 2V8PA 4JI2E 4AQYI 1QZRA 4ED4A 2LTRA 5AE2A 1HNXE 2UXCE 4M0VA 2YZTA 3LTOA 1XNRE 3K85A 4DUYE 1N36I 4ZVIA 1DI2A 2V83A 1KIJA 4DV6I 4DV4I 1N0VC 4WUBA 4NXNE 1H7SA 4HY1A 5LL6R 4BC7A 4DUZE 2DB2A 4IZKA 3OTOI 2UXBI 2HKEA 3J80Q 3AV0A 2O1UA 4OX9I 5F3WA 3ZKBA 1N32I 1Z0EA 1N33E 2UU9E 4DR7E 4B3MI 4B3TI 3T1HE 2Z5BB 2F4VI 1RC7A 1N0UA 1Z5AA 1IBKI 4Q28A 1KKHA 1Z5BA 2GQ0A 1Z0VA 4PU9A 1RQ0A 1EI1A 2VQFE 2ZM6E 1X47A 2IOQA 4DV5E 3ZZTA 3QT5A 2FTXB 5DNYA 4Z7CA 2YT4A 4JI8E 4LF8E 2L2MA 1XMQI 5AE1A 4LFBI 5IWAE 1Y4SA 3T1YE 4DR4E 2UXDI 3ZZUA 5BR8E 4DR6E 5ADZA 5FLXC 3H4LA 4YY3E 4DR1E 1Y4UA 1FKAE 4DXLA 1I94I 4JYAE 4F54A 4FN5A 5T6JA 5GMDA 2FV4B 4DU8A 2O1WA 4KZSA 4F9CB 3F0NA 3Q1QA 2A2CA 2HFSA 1PKPA 2V34A 2JVAA 1SR9A 1J5EE 4JI1I 2EZ6A 4R03A 1RREA 4DPUA 1DQ3A 4IZJA 4IZJD 2UUCE 4GEQB 1GQEA 3GONA 4HACA 4LFAE 3HPZA 2V88A 2HK2A 4X64I 4X65E 2M1SA 2Z5CA 4DV1I 2L6MA 1KTVA 3P1XA 2DEIA 3WU3A 4HACB 1MU5A 4DV0E 1XMOI 2M4IA 2Z5CB 3PYDA 2HHHI 4K0KI 3V2UC 3PYGA 2RS6A 3Q6NA 1FWLA 1J26A 4B3RE 2BM1A 4FWGA 2JR1A 1FWKA 4I8OA 3FIGA 1HK7A 1EKZA 2V87A 1XNQE 4DV7I 4JI7E 2V89A 4NXMI 4DR2E 2LJHA 5LMNE 4EMDA 4BS9A 4LFCE 3ADIA 3HXLA 4JG4A 4I3HA 3JAMQ 1N34I 2VE7C 1MX0A 1PVGA 2VQEI 3LMLA 1Z0WA 3C4BA 4DV3I 2DMYA 4LF9E 1YYWA 3DF6A 1NHHA 3VK6A 4R1FA 4LF7I 5A2QC 5IT9C 5AE3A 4BBYA 4BCAA 4DR5I 1HNWE 4YHHE 2LUQA 2PNLA 4URLA 1IBLE 4JI2I 2JOBA 3JTZA 1ZXMA 3ADJA 3Q6MA 1HNXI 3KWRA 2NUEA 2Z5BA 1ZM3A 3ZKDA 4HYMA 3HQ1A 1PIEA 1XNRI 4PRXA 1X48A 4GKJE 3J81Q 4X62E 1YYOA 2O1TA 3LLHA 4JV5I 4NXNI 5CFFE 4LTYA 4OX9E 1T4NA 4LU9A 4DUZI 1B62A 4LF6E 4FW9A 4M1KA 4F9AB 2V2VA 1N33I 4DMIA 2UU9I 4DR7I 1MG7A 2EWLA 2LMZA 4JI3E 3HJCA 3WU5A 3T1HI 3J7AM 1WHNA 2NUFA 2MC5A 1WHQA 5AASA 2NPFA 3K6QA 2LRSA 1USUA 2EFGA 4DV5I 2CPNA 1K47A 2HFUA 3ZOQB 2E1MA 4JI8I 4LF8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIX A;  4LF5 I;  2E5L E;  4DPW A;  4M30 A;  2RS7 A;  4LF4 E;  2L3C A;  1FJG E;  5IWA I;  4M2Z A;  3ADG A;  2HK3 A;  4RPF A;  1HR0 E;  3PYE A;  3T1Y I;  2CZ9 A;  4DPT A;  1I94 E;  1S4E A;  2LTS A;  5BR8 I;  4DR6 I;  4YY3 I;  4DR1 I;  4JI0 E;  3ADL A;  4JYA I;  1T4L B;  1STU A;  3ZZ0 A;  3HTX A;  1HNZ E;  4DU7 A;  2JY9 A;  3QT7 A;  4JI1 E;  1KVK A;  4OOG C;  1XHK A;  4WYQ B;  1IBM E;  1J5E I;  4GKK E;  4UT4 A;  2RTX A;  1O0W A;  3V5R A;  4X64 E;  3J80 C;  3VYY A;  4FWH A;  2UUA E;  4Z7Y A;  1ZXN A;  2OI2 A;  2N3G A;  4WFT A;  3WU4 A;  4X65 I;  4DPX A;  1UEK A;  1XMO E;  5LMU E;  3J7A G;  2XEX A;  4X66 E;  1ZM9 A;  3LPS A;  1Z5C A;  4DV0 I;  2AJ4 A;  3LNU A;  4DPY A;  1RR9 A;  2L2K B;  1U2R A;  4JI6 E;  2UUB E;  1OJ4 A;  1FI4 A;  4KHP E;  4DR3 E;  2V2Q A;  4B3S E;  4B3R I;  4KQV A;  1T4O A;  4JI5 E;  1BKN A;  3B78 A;  1H74 A;  1XNQ I;  1N34 E;  4JI7 I;  2MDR A;  2HKJ A;  4UTG A;  5LMN I;  4LFC I;  1X49 A;  4JI4 E;  1Z0C A;  2L2N A;  2VF3 A;  4DV2 I;  4DKK A;  1H7U A;  5FLX Q;  1Z59 A;  4LF9 I;  4AQY E;  1EA6 A;  2Q2E B;  2R42 A;  1ZM2 A;  2NUG A;  2GS8 A;  1N36 E;  1B63 A;  2NA2 A;  1HNW I;  1FNM A;  2LBS B;  4YHH I;  4DV6 E;  2UXC I;  4DV4 E;  1NZ0 A;  1IBL I;  4P7A A;  4DUY I;  3QT6 A;  1A6F A;  1QU6 A;  3OTO E;  2UXB E;  2ZBK B;  2R3V A;  1N32 E;  4USM A;  3K17 A;  4X8W A;  4B3M E;  4JV5 E;  4B3T E;  4GKJ I;  4FWD A;  1H72 C;  2F4V E;  2BV3 A;  4WUD A;  4X62 I;  1IBK E;  3ZM7 A;  2B3T B;  1ZM4 A;  1YYK A;  4USK A;  4LF6 I;  3VYX A;  2ZIT A;  1ELO A;  2B7T A;  1ZBT A;  2VQF I;  2ZM6 I;  1XMQ E;  2J7K A;  4JI3 I;  2V2Z A;  4LFB E;  2A2D A;  3JAM C;  2DEJ A;  2UXD E;  1NHI A;  3CWV A;  4LF5 E;  4DR4 I;  5A2Q Q;  2BM0 A;  5IT9 Q;  2E5L I;  3B82 A;  2X36 A;  4LF4 I;  1FJG I;  1HR0 I;  2B7V A;  3HUL A;  1WUU A;  4XTJ A;  2L3J A;  4MYU A;  3PYF A;  3J7Y p;  4JI0 I;  1Z0G A;  2N3H A;  1S16 A;  1NHJ A;  2WW4 A;  2UUC I;  1HNZ I;  3J81 C;  1YZ9 A;  3QT8 A;  2LJP A;  4DV1 E;  4LFA I;  2IHR 1;  3D4J A;  2X7I A;  5GME A;  1VIS A;  1H73 A;  4P52 A;  1IBM I;  4GKK I;  3B8H A;  3K1J A;  2HHH E;  4K0K E;  2RSM A;  2UUA I;  4HXZ A;  4DV7 E;  3M6A A;  2LUP B;  4MYT A;  4NXM E;  5LMU I;  4X66 I;  1Z0B A;  2VQE E;  2KHX A;  4DR2 I;  2L33 A;  5L3J A;  4JI6 I;  4DV3 E;  2UUB I;  3C4T A;  4KHP I;  4DR3 I;  4PRV A;  4WUC A;  1UHZ A;  4B3S I;  1D6T A;  1Z0T A;  4LF7 E;  4JI5 I;  3WU6 A;  1DAR A;  2E1R A;  4DV2 E;  4DR5 E;  1UIL A;  4JI4 I;  2V8P A;  4JI2 E;  4AQY I;  1QZR A;  4ED4 A;  2LTR A;  1HNX E;  2UXC E;  3LTO A;  1XNR E;  4DUY E;  1N36 I;  4ZVI A;  1DI2 A;  1KIJ A;  4DV6 I;  4DV4 I;  1N0V C;  4WUB A;  4NXN E;  1H7S A;  4HY1 A;  5LL6 R;  4DUZ E;  2DB2 A;  3OTO I;  2UXB I;  2HKE A;  3J80 Q;  4OX9 I;  3ZKB A;  1N32 I;  1Z0E A;  1N33 E;  2UU9 E;  4DR7 E;  4B3M I;  4B3T I;  3T1H E;  2F4V I;  1RC7 A;  1N0U A;  1Z5A A;  1IBK I;  1KKH A;  1Z5B A;  4PU9 A;  1Z0V A;  1RQ0 A;  1EI1 A;  2VQF E;  2ZM6 E;  1X47 A;  4DV5 E;  3ZZT A;  3QT5 A;  4Z7C A;  2YT4 A;  4JI8 E;  4LF8 E;  2L2M A;  1XMQ I;  4LFB I;  5IWA E;  3T1Y E;  4DR4 E;  2UXD I;  3ZZU A;  5BR8 E;  4DR6 E;  5FLX C;  3H4L A;  4YY3 E;  4DR1 E;  1FKA E;  4DXL A;  1I94 I;  4JYA E;  4FN5 A;  5GMD A;  4DU8 A;  3F0N A;  3Q1Q A;  2A2C A;  2HFS A;  1PKP A;  2V34 A;  2JVA A;  1J5E E;  4JI1 I;  2EZ6 A;  1RRE A;  4DPU A;  2UUC E;  1GQE A;  4HAC A;  3GON A;  4LFA E;  2HK2 A;  4X64 I;  4X65 E;  4DV1 I;  1KTV A;  3P1X A;  2DEI A;  3WU3 A;  4HAC B;  1MU5 A;  4DV0 E;  1XMO I;  3PYD A;  2HHH I;  4K0K I;  3V2U C;  3PYG A;  2RS6 A;  1FWL A;  1J26 A;  4B3R E;  2BM1 A;  4FWG A;  1FWK A;  1EKZ A;  1XNQ E;  4DV7 I;  4JI7 E;  4NXM I;  4DR2 E;  2LJH A;  5LMN E;  4EMD A;  4LFC E;  3ADI A;  4I3H A;  4JG4 A;  3JAM Q;  1N34 I;  1MX0 A;  1PVG A;  2VQE I;  1Z0W A;  3C4B A;  4DV3 I;  2DMY A;  4LF9 E;  1YYW A;  1NHH A;  4R1F A;  4LF7 I;  5A2Q C;  5IT9 C;  4DR5 I;  1HNW E;  4YHH E;  2LUQ A;  4URL A;  1IBL E;  4JI2 I;  1ZXM A;  3ADJ A;  1HNX I;  2NUE A;  1ZM3 A;  3ZKD A;  4HYM A;  1PIE A;  1XNR I;  4PRX A;  1X48 A;  4GKJ E;  3J81 Q;  4X62 E;  1YYO A;  4JV5 I;  3LLH A;  4NXN I;  5CFF E;  4OX9 E;  1T4N A;  4DUZ I;  1B62 A;  4LF6 E;  4FW9 A;  4M1K A;  2V2V A;  1N33 I;  2UU9 I;  4DR7 I;  1MG7 A;  4JI3 E;  3WU5 A;  3T1H I;  3J7A M;  1WHN A;  2NUF A;  1WHQ A;  2NPF A;  2LRS A;  2EFG A;  4DV5 I;  2CPN A;  1K47 A;  2HFU A;  4JI8 I;  4LF8 I; 
#chains in the Genus database with same CATH topology
 2DIX A;  4LF5 I;  2E5L E;  1ZU1 A;  4MU0 A;  4DPW A;  4M30 A;  2RS7 A;  2MDG A;  4LF4 E;  2L3C A;  1FJG E;  5IWA I;  4M2Z A;  2EN8 A;  3ADG A;  2HK3 A;  4RPF A;  2EMI A;  2EQ0 A;  1HR0 E;  1UDO A;  1GTK A;  3PYE A;  3T1Y I;  2EOF A;  1AAY A;  2CZ9 A;  4DPT A;  1I94 E;  1S4E A;  4OKG A;  2Z5E A;  1R6M A;  2LTS A;  5BR8 I;  4WSG A;  4DR6 I;  4YY3 I;  4DR1 I;  1A1G A;  4JI0 E;  2RQL A;  3ADL A;  2WNR A;  4JYA I;  1T4L B;  5C0X F;  2YTG A;  1NEI A;  1AH5 A;  5IV8 B;  4IFD A;  4IFD D;  1STU A;  5A6A A;  3ZZ0 A;  3HTX A;  1HNZ E;  2CTD A;  2EL6 A;  1X5W A;  4DU7 A;  2JY9 A;  1USV A;  3QT7 A;  4JI1 E;  1KVK A;  4OOG C;  1XHK A;  2E72 A;  4WYQ B;  4IFD B;  1IBM E;  2CSH A;  4U3B A;  4GKK E;  1J5E I;  3HPS A;  4BC9 A;  4UT4 A;  3P3C A;  2YSO A;  2RTX A;  1O0W A;  3V5R A;  4X64 E;  3J80 C;  2WZO A;  3VYY A;  4X9J A;  2UUA E;  4FWH A;  2EM3 A;  2ODR D;  2N8X A;  1QNT A;  2YTF A;  2N3G A;  1GZ6 A;  3H09 A;  4IJD A;  4ZYD A;  1ZXN A;  2BA0 D;  2NN6 F;  2OI2 A;  3IWC A;  2EMY A;  4WFT A;  2M9A A;  3WU4 A;  2EQ1 A;  4MQY A;  4X65 I;  2EN1 A;  4DPX A;  4J3D A;  1UEK A;  1XMO E;  5LMU E;  3IWD A;  3J7A G;  2XEX A;  5JEA F;  4X66 E;  5KL2 A;  1ZM9 A;  3LPS A;  5DNL A;  1Z5C A;  2BR2 A;  1X6F A;  4RHB B;  1OYS A;  4DV0 I;  2AJ4 A;  3LNU A;  4DPY A;  2HJJ A;  1RR9 A;  2L2K B;  2HGH A;  1U2R A;  4JI6 E;  3P3G A;  3KZY A;  2UUB E;  1OJ4 A;  1FI4 A;  3B4T A;  4KHP E;  4DR3 E;  1EH6 A;  3KZZ A;  2V2Q A;  3RMP A;  4B3S E;  4B3R I;  4KQV A;  1T4O A;  4JI5 E;  2EMK A;  2L8T A;  1BKN A;  4P78 A;  2BR2 B;  3B78 A;  5EL9 A;  1H74 A;  1RHY A;  3P76 A;  1XNQ I;  2LCE A;  1N34 E;  5EKW A;  2MDR A;  4JI7 I;  5C0X E;  2HKJ A;  5AC5 A;  4UTG A;  5A6K A;  5LMN I;  1YUI A;  4LFC I;  5ELW A;  1X49 A;  4JI4 E;  1Z0C A;  5AC4 A;  2YTE A;  2YU5 A;  3THN A;  3TQM A;  2JEA B;  3L7Z B;  2LJU A;  1MGT A;  2L2N A;  2PNM A;  2VF3 A;  4DV2 I;  2EQ3 A;  2EN2 A;  4DKK A;  2WP8 A;  1H7U A;  5FLX Q;  1Z59 A;  4LF9 I;  4AQY E;  3EPH A;  4F6N A;  1EA6 A;  2EN6 A;  4WX9 A;  2C37 A;  2Q2E B;  2EMC A;  1ZAA C;  2R42 A;  1ZM2 A;  2JXP A;  5C0X D;  2NUG A;  2NN6 E;  4L5N C;  2KOU A;  2GS8 A;  4IFD F;  2EPP A;  3BGH A;  1N36 E;  1B63 A;  4ZYH A;  2NA2 A;  1HNW I;  1FNM A;  2LBS B;  4YHH I;  4DV6 E;  2UXC I;  4DV4 E;  2V86 A;  1NZ0 A;  1IBL I;  2MC6 A;  4P7A A;  2C38 A;  4DUY I;  5A69 A;  3QT6 A;  1YHC A;  4FW6 A;  5JEA E;  2GO4 A;  1A6F A;  2PRT A;  1QU6 A;  1ZBQ A;  3OTO E;  2UXB E;  3MHS C;  3MSW A;  1XXE A;  2ZBK B;  3C6M A;  3F6G A;  1PJQ A;  2R3V A;  1N32 E;  1YSA C;  4USM A;  3AUZ A;  2KON A;  3K17 A;  2YU8 A;  1RMD A;  4X8W A;  4B3M E;  4JV5 E;  4B3T E;  4GKJ I;  4FWD A;  1H72 C;  2F4V E;  2BV3 A;  4WUD A;  4OO1 A;  4X62 I;  2EM6 A;  4WXD A;  4FW5 A;  4OO1 D;  3EQ1 A;  1X6E A;  1IMU A;  1IBK E;  1A1F A;  5JEA D;  2EPO A;  2EM0 A;  2IOP A;  2PNZ B;  3ZM7 A;  2ELY A;  2B3T B;  4R8O A;  1ZM4 A;  1YYK A;  2NN6 C;  4TUI A;  4USK A;  2JOX A;  1A1L A;  1OYR A;  4LF6 I;  3VYX A;  1Y6Z A;  1ZR9 A;  2H36 X;  2ZIT A;  3F6H A;  1ELO A;  2B7T A;  4OO1 B;  4N4R B;  4IZK B;  4BMJ A;  1ZBT A;  2YRH A;  1PDA A;  1IQO A;  2RPC A;  2VQF I;  2ZM6 I;  5JEA C;  1XMQ E;  2J7K A;  4JI3 I;  2EMX A;  2V2Z A;  4F9B B;  4LFB E;  2A2D A;  2LE2 A;  4WPY A;  1T39 A;  3JAM C;  4IFD E;  2HC5 A;  2ENC A;  2DEJ A;  1UN6 B;  2UXD E;  1NHI A;  2VF1 A;  4R2R A;  2EL5 A;  3CWV A;  2NAB A;  4LF5 E;  3M7N G;  4ZYE A;  2V85 A;  4DR4 I;  1P42 A;  4TUG A;  2K4V A;  2BM0 A;  3PRY A;  5A2Q Q;  5IT9 Q;  2E5L I;  3B82 A;  2DSY A;  5A6J A;  2X36 A;  1G2D C;  4BA1 B;  4LF4 I;  5DRO A;  1FJG I;  4WSP A;  2DGC A;  1HR0 I;  2J65 A;  2EOZ A;  2B7V A;  3HUL A;  1WUU A;  4XTJ A;  1T38 A;  3VHT B;  2L3J A;  4MYU A;  4AM3 A;  3IWB A;  4L8N A;  5K36 A;  3PYF A;  3J7Y p;  2WCC 3;  4JI0 I;  4HTG A;  4FW7 A;  1X6H A;  2N3H A;  1Z0G A;  4IFD C;  2JWO A;  1S16 A;  5DRR A;  1EH8 A;  1NHJ A;  5KL4 A;  1A1H A;  2WW4 A;  2FGG A;  1UBD C;  2UUC I;  3DJW A;  3J81 C;  2L92 A;  1YFH A;  1HNZ I;  2EM9 A;  1YZ9 A;  3QT8 A;  2LJP A;  5K36 B;  4DV1 E;  4LFA I;  2IHR 1;  3D4J A;  1WXR A;  2X7I A;  5GME A;  2EOJ A;  1VIS A;  1H73 A;  4P52 A;  4OO1 F;  1IBM I;  4GKK I;  1PJT A;  3B8H A;  4P7D A;  2MKN A;  3K1J A;  2HHH E;  2ODR C;  4NZV A;  4K0K E;  2RSM A;  2UUA I;  2F8B A;  2PO2 B;  2EN4 A;  5FWK A;  4IZJ B;  2CGE A;  1R6L A;  1BBG A;  4HXZ A;  4DV7 E;  3M6A A;  2LUP B;  1NCS A;  2EOY A;  2O1V A;  1Z1B A;  4MYT A;  2PO1 A;  4NXM E;  3P06 A;  4N3O A;  2YSP A;  5LMU I;  2G7H A;  2JEA A;  3L7Z A;  4X66 I;  1G2F C;  1Z0B A;  2ELZ A;  5LLQ A;  2CG9 A;  2VQE E;  2KHX A;  2JT2 A;  4DR2 I;  3M7N D;  2EOM A;  2L33 A;  2IER A;  5L3J A;  1LLM C;  2V8Q B;  4JI6 I;  4DV3 E;  2UUB I;  3C4T A;  4KHP I;  1X3C A;  4PRV A;  4DR3 I;  2M7Q A;  4WUC A;  1UHZ A;  4B3S I;  1D6T A;  1BB8 A;  4LF7 E;  1Z0T A;  2EPN A;  2PO0 A;  2R1F A;  4JI5 I;  3WU6 A;  1DAR A;  3JU0 A;  4J8Z A;  1E3P A;  2E1R A;  4R2P A;  1P47 A;  2YRM A;  2EMA A;  1TF3 A;  2EPU A;  4DV2 E;  4DR5 E;  3UHM A;  1UIL A;  2B9D A;  4JI4 I;  3OML A;  2V8P A;  2PO0 B;  2R76 A;  4JI2 E;  2EM4 A;  4R2D A;  3NZK A;  2ADR A;  4QNK A;  4OO1 E;  4AQY I;  2YTJ A;  3BBG A;  1QZR A;  4ED4 A;  5K36 F;  2LTR A;  5AE2 A;  1HNX E;  2EPC A;  1B69 A;  2UXC E;  4Z7Y A;  5C0X C;  4M0V A;  2YZT A;  3LTO A;  1XNR E;  3K85 A;  4AID A;  4O43 A;  3THO B;  2JP9 A;  3CDJ A;  4LCG A;  4DUY E;  1N36 I;  2YTQ A;  4ZVI A;  1DI2 A;  2V83 A;  1KIJ A;  2PNZ A;  4DV6 I;  4F6M A;  4DV4 I;  1N0V C;  4WUB A;  4R2Q A;  2BBG A;  4NXN E;  1F2I G;  2VRD A;  1H7S A;  2EML A;  4HY1 A;  4MU3 A;  1SFE A;  5LL6 R;  2EM2 A;  4BC7 A;  4DUZ E;  2DB2 A;  2JYA A;  2DRP A;  2EPR A;  4IZK A;  1UDN A;  5DNX A;  2HKE A;  3J80 Q;  3OTO I;  2UXB I;  2EP3 A;  3AV0 A;  3UK3 C;  4KWY A;  2O1U A;  4OX9 I;  3GME A;  5F3W A;  4MLQ A;  4BHB A;  3ZKB A;  1N32 I;  1Z0E A;  1N33 E;  2UU9 E;  4DR7 E;  4ISA A;  4B3M I;  4B3T I;  4FK5 C;  1JK1 A;  1OYP A;  3T1H E;  4GQU A;  2JEB B;  2Z5B B;  2CT1 A;  2F4V I;  4OO1 C;  2EM7 A;  2EMW A;  1RC7 A;  1N0U A;  2RSI A;  3GCM A;  2DMI A;  1DGC A;  1Z5A A;  2IES A;  5KL5 A;  1IBK I;  4IS9 A;  4Q28 A;  1KKH A;  1Z5B A;  2GQ0 A;  2GLI A;  1Z0V A;  4PU9 A;  1RQ0 A;  2D9H A;  1EI1 A;  4HEI A;  2VQF E;  2ZM6 E;  2EM5 A;  2LVH A;  1X47 A;  4O5G A;  2IOQ A;  4R2A A;  4DV5 E;  3ZZT A;  3QT5 A;  2FTX B;  5DNY A;  4Z7C A;  3M85 G;  2LV2 A;  2YT4 A;  4JI8 E;  4LF8 E;  2EN7 A;  1E3H A;  4BA1 A;  2L2M A;  1XMQ I;  5AE1 A;  4MU4 A;  2YTP A;  4NHR A;  2C39 B;  5K36 E;  2ENA A;  4LFB I;  5IWA E;  2DLK A;  5KL7 A;  3ECR A;  2GHF A;  3U1Y A;  3P3E A;  1Y4S A;  3T1Y E;  4DR4 E;  3GLL A;  5KL6 A;  1YH8 A;  2UXD I;  3ZZU A;  5BR8 E;  4DR6 E;  1EH7 A;  5TSE A;  5ADZ A;  3C6K A;  5A6B A;  5FLX C;  5A6B D;  3H4L A;  4YY3 E;  4DR1 E;  1Y4U A;  2F1D A;  3DD6 A;  1FKA E;  4DXL A;  1I94 I;  4JYA E;  4F54 A;  4FN5 A;  3EPJ A;  5IXM B;  2JE6 B;  5T6J A;  3PS3 A;  4LCH A;  2EJ4 A;  2EOQ A;  3H1C A;  5GMD A;  2I13 A;  2PO1 B;  5K36 D;  2ENH A;  2FV4 B;  4GZN C;  4DU8 A;  2O1W A;  2O3Z A;  4KZS A;  4F9C B;  3F0N A;  2EMB A;  2A2C A;  2I9I A;  1PKP A;  2HFS A;  2V34 A;  2JVA A;  2YTO A;  1KJK A;  3Q1Q A;  4M9V C;  1SR9 A;  4O4K A;  4IS1 C;  1J5E E;  2YPN A;  3EPL A;  4JI1 I;  5K36 C;  2EZ6 A;  4R03 A;  1RRE A;  2PO2 A;  4DPU A;  1DQ3 A;  4IZJ A;  4IZJ D;  2UUC E;  4GEQ B;  1GQE A;  2EMZ A;  3GON A;  4HAC A;  2EOR A;  4LFA E;  2V88 A;  3HPZ A;  2WNR B;  2HK2 A;  4X64 I;  4X65 E;  2M1S A;  2J7J A;  2Z5C A;  2MKD A;  4DV1 I;  2L6M A;  4AIM A;  1KTV A;  3P1X A;  2DEI A;  3WU3 A;  2EOH A;  4LOM A;  1BBO A;  2EL4 A;  2EOE A;  5KL3 A;  4HAC B;  1MU5 A;  2Q8U A;  4DV0 E;  1XMO I;  5DRQ A;  1TF6 A;  2A25 A;  3L00 A;  2M4I A;  2YWQ A;  2Z5C B;  3PYD A;  3M85 D;  4BA2 A;  2HHH I;  3QG5 C;  4K0K I;  2YTD A;  2EOX A;  3V2U C;  3PYG A;  2RS6 A;  3Q6N A;  2WBU A;  1FWL A;  2WBT A;  1JK2 A;  2EN3 A;  1N3G A;  2BB8 A;  1MEY C;  4B3R E;  1J26 A;  2BA1 G;  2BM1 A;  4FWG A;  2JR1 A;  1FWK A;  4I8O A;  3FIG A;  1HK7 A;  1EKZ A;  4F2J C;  2V87 A;  1XNQ E;  2EE8 A;  4JI7 E;  4DV7 I;  2V89 A;  4FW4 A;  4BA2 B;  4BHC A;  4NXM I;  4DR2 E;  3M99 B;  2LO3 A;  2LJH A;  4R2C A;  5LMN E;  4EMD A;  4BS9 A;  4LFC E;  3ADI A;  3HXL A;  4JG4 A;  2YTN A;  4I3H A;  1VI7 A;  3JAM Q;  3BID A;  1N34 I;  2VE7 C;  4O24 A;  4ZYG A;  1MX0 A;  1PVG A;  2VQE I;  3LML A;  3PS1 A;  1Z0W A;  3C4B A;  4DV3 I;  2DMY A;  4LF9 E;  4U3D A;  1TN9 A;  1YYW A;  3DF6 A;  1Y5Y A;  1NHH A;  2EPL X;  3VK6 A;  4R1F A;  1A1J A;  4LF7 I;  5A2Q C;  5IT9 C;  3HKM A;  4OZE A;  1Y60 A;  5AE3 A;  4BBY A;  4BCA A;  4DR5 I;  1HNW E;  4YHH E;  2LUQ A;  2PNL A;  4LPF A;  4URL A;  1IBL E;  2EOO A;  4JI2 I;  4Q35 B;  1A1K A;  2YRK A;  2EPA A;  2JOB A;  3BF2 A;  3JTZ A;  3CDI A;  5C0X A;  4R2S A;  1ZXM A;  2WP8 B;  2K7I A;  1WJP A;  2EOS A;  3ADJ A;  1UDS A;  4FW3 A;  3Q6M A;  1HNX I;  2GO3 A;  3KWR A;  2NUE A;  3U1K A;  2JEB A;  1ZM3 A;  2Z5B A;  2C37 B;  3KRN A;  4HYM A;  3HQ1 A;  1PIE A;  3ZKD A;  4PRX A;  1X48 A;  1XNR I;  4GKJ E;  3J81 Q;  5C0X B;  2EPM X;  4R2E A;  2JPA A;  2WBS A;  1WRJ A;  4X62 E;  2LT7 A;  2EM8 A;  2EOI A;  1YYO A;  3LLH A;  2O1T A;  4JV5 I;  1YPN A;  4NXN I;  5CFF E;  4LTY A;  4OX9 E;  1T4N A;  2YTI A;  1YUJ A;  3MHH C;  4LU9 A;  3EPK A;  4DUZ I;  1B62 A;  4LF6 E;  2NN6 A;  2C38 B;  2NN6 D;  2BA1 D;  4FW9 A;  2VES A;  1A1I A;  2GPI A;  5DRP A;  4M1K A;  4RH8 A;  4F9A B;  2AE8 A;  2EPX A;  4MLV A;  1L4S A;  2V2V A;  1N33 I;  4DMI A;  2C39 A;  4MDT A;  2UU9 I;  4NBQ A;  4DR7 I;  2EMF A;  2EMH A;  2EPK X;  1MG7 A;  2EWL A;  2LMZ A;  4JI3 E;  2BA0 G;  3HJC A;  3WU5 A;  2NN6 B;  5JEA A;  3T1H I;  2EMG A;  3J7A M;  1KYQ A;  2CVE A;  1WHN A;  2NUF A;  1UDQ A;  2MC5 A;  1WHQ A;  4QNJ A;  1IQS A;  4LCF A;  4MU1 A;  5AAS A;  2NPF A;  2DLQ A;  1PJS A;  3K6Q A;  5JEA B;  2LRS A;  4WXC A;  3PS2 A;  1USU A;  2EFG A;  4DV5 I;  2CPN A;  1K47 A;  2EPZ A;  2JE6 A;  2HFU A;  3ZOQ B;  2E1M A;  4JI8 I;  4LF8 I; 
#chains in the Genus database with same CATH homology
 2DIX A;  4LF5 I;  2E5L E;  4DPW A;  4M30 A;  2RS7 A;  4LF4 E;  2L3C A;  1FJG E;  5IWA I;  4M2Z A;  3ADG A;  2HK3 A;  4RPF A;  1HR0 E;  3PYE A;  3T1Y I;  2CZ9 A;  4DPT A;  1I94 E;  1S4E A;  2Z5E A;  2LTS A;  5BR8 I;  4DR6 I;  4YY3 I;  4DR1 I;  4JI0 E;  3ADL A;  4JYA I;  1T4L B;  1STU A;  3ZZ0 A;  3HTX A;  1HNZ E;  4DU7 A;  2JY9 A;  1USV A;  3QT7 A;  4JI1 E;  1KVK A;  4OOG C;  1XHK A;  4WYQ B;  1IBM E;  1J5E I;  4GKK E;  3HPS A;  4BC9 A;  4UT4 A;  2RTX A;  1O0W A;  3V5R A;  4X64 E;  3J80 C;  2WZO A;  3VYY A;  4FWH A;  2UUA E;  2ODR D;  4Z7Y A;  1ZXN A;  3H09 A;  2N3G A;  1GZ6 A;  2OI2 A;  3IWC A;  4WFT A;  3WU4 A;  4X65 I;  4DPX A;  1UEK A;  1XMO E;  5LMU E;  3IWD A;  3J7A G;  2XEX A;  4X66 E;  1ZM9 A;  3LPS A;  1Z5C A;  4DV0 I;  2AJ4 A;  3LNU A;  4DPY A;  1RR9 A;  2L2K B;  1U2R A;  4JI6 E;  2UUB E;  1OJ4 A;  1FI4 A;  4KHP E;  4DR3 E;  2V2Q A;  3RMP A;  4B3S E;  4B3R I;  4KQV A;  1T4O A;  4JI5 E;  2L8T A;  1BKN A;  4P78 A;  3B78 A;  1H74 A;  1XNQ I;  1N34 E;  4JI7 I;  2MDR A;  2HKJ A;  4UTG A;  5LMN I;  4LFC I;  1X49 A;  4JI4 E;  1Z0C A;  2L2N A;  2VF3 A;  2PNM A;  4DV2 I;  4DKK A;  1H7U A;  5FLX Q;  1Z59 A;  4LF9 I;  4AQY E;  1EA6 A;  2Q2E B;  2R42 A;  1ZM2 A;  2NUG A;  2KOU A;  4L5N C;  2GS8 A;  1N36 E;  1B63 A;  2NA2 A;  1HNW I;  1FNM A;  2LBS B;  4YHH I;  4DV6 E;  2UXC I;  4DV4 E;  2V86 A;  1NZ0 A;  1IBL I;  2MC6 A;  4P7A A;  4DUY I;  3QT6 A;  1A6F A;  1QU6 A;  1ZBQ A;  3OTO E;  2UXB E;  2ZBK B;  3MSW A;  3F6G A;  2R3V A;  1N32 E;  4USM A;  3AUZ A;  2KON A;  3K17 A;  4X8W A;  4B3M E;  4JV5 E;  4B3T E;  4GKJ I;  4FWD A;  1H72 C;  2F4V E;  2BV3 A;  4WUD A;  4X62 I;  1IBK E;  2IOP A;  3ZM7 A;  2B3T B;  4R8O A;  1ZM4 A;  1YYK A;  4USK A;  4TUI A;  2JOX A;  4LF6 I;  3VYX A;  1Y6Z A;  2H36 X;  2ZIT A;  3F6H A;  1ELO A;  2B7T A;  4IZK B;  4BMJ A;  1ZBT A;  2VQF I;  2ZM6 I;  1XMQ E;  2J7K A;  4JI3 I;  2V2Z A;  4F9B B;  4LFB E;  2A2D A;  2LE2 A;  4WPY A;  3JAM C;  2DEJ A;  2UXD E;  1NHI A;  2VF1 A;  3CWV A;  4LF5 E;  2V85 A;  4DR4 I;  4TUG A;  2K4V A;  2BM0 A;  3PRY A;  5A2Q Q;  5IT9 Q;  2E5L I;  3B82 A;  2DSY A;  2X36 A;  4LF4 I;  1FJG I;  4WSP A;  1HR0 I;  2B7V A;  3HUL A;  1WUU A;  4XTJ A;  2L3J A;  4MYU A;  3IWB A;  4L8N A;  3PYF A;  3J7Y p;  4JI0 I;  1Z0G A;  2N3H A;  2JWO A;  1S16 A;  1NHJ A;  2WW4 A;  2FGG A;  2UUC I;  3DJW A;  3J81 C;  2L92 A;  1HNZ I;  1YZ9 A;  3QT8 A;  2LJP A;  4DV1 E;  4LFA I;  2IHR 1;  3D4J A;  1WXR A;  2X7I A;  5GME A;  1VIS A;  1H73 A;  4P52 A;  1IBM I;  4GKK I;  3B8H A;  4P7D A;  3K1J A;  2HHH E;  2ODR C;  4K0K E;  2RSM A;  2UUA I;  2F8B A;  5FWK A;  4IZJ B;  2CGE A;  4HXZ A;  4DV7 E;  3M6A A;  2LUP B;  2O1V A;  4MYT A;  4NXM E;  3P06 A;  4N3O A;  5LMU I;  2G7H A;  4X66 I;  1Z0B A;  2CG9 A;  2VQE E;  2KHX A;  4DR2 I;  2L33 A;  5L3J A;  2V8Q B;  4JI6 I;  4DV3 E;  2UUB I;  3C4T A;  4KHP I;  4DR3 I;  4PRV A;  2M7Q A;  4WUC A;  1UHZ A;  4B3S I;  1D6T A;  1Z0T A;  4LF7 E;  4JI5 I;  3WU6 A;  1DAR A;  3JU0 A;  4J8Z A;  2E1R A;  4DV2 E;  4DR5 E;  1UIL A;  2B9D A;  4JI4 I;  3OML A;  2V8P A;  4JI2 E;  4AQY I;  1QZR A;  4ED4 A;  2LTR A;  5AE2 A;  1HNX E;  2UXC E;  4M0V A;  2YZT A;  3LTO A;  1XNR E;  3K85 A;  4DUY E;  1N36 I;  4ZVI A;  1DI2 A;  2V83 A;  1KIJ A;  4DV6 I;  4DV4 I;  1N0V C;  4WUB A;  4NXN E;  1H7S A;  4HY1 A;  5LL6 R;  4BC7 A;  4DUZ E;  2DB2 A;  4IZK A;  3OTO I;  2UXB I;  2HKE A;  3J80 Q;  3AV0 A;  2O1U A;  4OX9 I;  5F3W A;  3ZKB A;  1N32 I;  1Z0E A;  1N33 E;  2UU9 E;  4DR7 E;  4B3M I;  4B3T I;  3T1H E;  2Z5B B;  2F4V I;  1RC7 A;  1N0U A;  1Z5A A;  1IBK I;  4Q28 A;  1KKH A;  1Z5B A;  2GQ0 A;  1Z0V A;  4PU9 A;  1RQ0 A;  1EI1 A;  2VQF E;  2ZM6 E;  1X47 A;  2IOQ A;  4DV5 E;  3ZZT A;  3QT5 A;  2FTX B;  5DNY A;  4Z7C A;  2YT4 A;  4JI8 E;  4LF8 E;  2L2M A;  1XMQ I;  5AE1 A;  4LFB I;  5IWA E;  1Y4S A;  3T1Y E;  4DR4 E;  2UXD I;  3ZZU A;  5BR8 E;  4DR6 E;  5ADZ A;  5FLX C;  3H4L A;  4YY3 E;  4DR1 E;  1Y4U A;  1FKA E;  4DXL A;  1I94 I;  4JYA E;  4F54 A;  4FN5 A;  5T6J A;  5GMD A;  2FV4 B;  4DU8 A;  2O1W A;  4KZS A;  4F9C B;  3F0N A;  3Q1Q A;  2A2C A;  2HFS A;  1PKP A;  2V34 A;  2JVA A;  1SR9 A;  1J5E E;  4JI1 I;  2EZ6 A;  4R03 A;  1RRE A;  4DPU A;  1DQ3 A;  4IZJ A;  4IZJ D;  2UUC E;  4GEQ B;  1GQE A;  3GON A;  4HAC A;  4LFA E;  3HPZ A;  2V88 A;  2HK2 A;  4X64 I;  4X65 E;  2M1S A;  2Z5C A;  4DV1 I;  2L6M A;  1KTV A;  3P1X A;  2DEI A;  3WU3 A;  4HAC B;  1MU5 A;  4DV0 E;  1XMO I;  2M4I A;  2Z5C B;  3PYD A;  2HHH I;  4K0K I;  3V2U C;  3PYG A;  2RS6 A;  3Q6N A;  1FWL A;  1J26 A;  4B3R E;  2BM1 A;  4FWG A;  2JR1 A;  1FWK A;  4I8O A;  3FIG A;  1HK7 A;  1EKZ A;  2V87 A;  1XNQ E;  4DV7 I;  4JI7 E;  2V89 A;  4NXM I;  4DR2 E;  2LJH A;  5LMN E;  4EMD A;  4BS9 A;  4LFC E;  3ADI A;  3HXL A;  4JG4 A;  4I3H A;  3JAM Q;  1N34 I;  2VE7 C;  1MX0 A;  1PVG A;  2VQE I;  3LML A;  1Z0W A;  3C4B A;  4DV3 I;  2DMY A;  4LF9 E;  1YYW A;  3DF6 A;  1NHH A;  3VK6 A;  4R1F A;  4LF7 I;  5A2Q C;  5IT9 C;  5AE3 A;  4BBY A;  4BCA A;  4DR5 I;  1HNW E;  4YHH E;  2LUQ A;  2PNL A;  4URL A;  1IBL E;  4JI2 I;  2JOB A;  3JTZ A;  1ZXM A;  3ADJ A;  3Q6M A;  1HNX I;  3KWR A;  2NUE A;  2Z5B A;  1ZM3 A;  3ZKD A;  4HYM A;  3HQ1 A;  1PIE A;  1XNR I;  4PRX A;  1X48 A;  4GKJ E;  3J81 Q;  4X62 E;  1YYO A;  2O1T A;  3LLH A;  4JV5 I;  4NXN I;  5CFF E;  4LTY A;  4OX9 E;  1T4N A;  4LU9 A;  4DUZ I;  1B62 A;  4LF6 E;  4FW9 A;  4M1K A;  4F9A B;  2V2V A;  1N33 I;  4DMI A;  2UU9 I;  4DR7 I;  1MG7 A;  2EWL A;  2LMZ A;  4JI3 E;  3HJC A;  3WU5 A;  3T1H I;  3J7A M;  1WHN A;  2NUF A;  2MC5 A;  1WHQ A;  5AAS A;  2NPF A;  3K6Q A;  2LRS A;  1USU A;  2EFG A;  4DV5 I;  2CPN A;  1K47 A;  2HFU A;  3ZOQ B;  2E1M A;  4JI8 I;  4LF8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...