1J5EE

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1j5eE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1j5eE02
3H4LA 1ZM9A 5LL6R 3V5RA 2UUAE 2A2CA 2LJPA 1Z0EA 4DKKA 2AJ4A 1Z0CA 1N0UA 4KQVA 3B82A 2LUPB 1HR0I 4I3HA 4JI8E 2L2KB 3B8HA 4LF6I 2RS7A 1T4LB 3T1YE 2F4VI 4LF9I 2VF3A 4R1FA 4JI3E 1KTVA 4DR5E 3JAMC 1FJGI 1H73A 2UUAI 5IT9Q 4USKA 4DV7E 1RR9A 4DUYI 3LNUA 1GQEA 3T1YI 1H7UA 1ZM4A 2OI2A 4DR5I 4DR3E 4NXME 1PKPA 4PRVA 4DV7I 4JI2E 1Z0BA 4JI5E 3K17A 2IHR1 4KHPE 4P52A 4P7AA 1XHKA 4B3ME 2L3CA 4LFCE 1YZ9A 1Z0VA 4HXZA 4UTGA 1XNQI 5L3JA 4FN5A 1N32E 3QT7A 4WUDA 3PYFA 1BKNA 4DPUA 4JI2I 4LF4I 3J80Q 4JI0E 1K47A 4JI5I 4KHPI 1X49A 3J7AM 4DV4E 1N34E 2JVAA 1Z5AA 4JI1I 1MX0A 2UUBE 2L2NA 2HK2A 3OTOE 2DMYA 1N0VC 1N32I 2WW4A 4DR4E 1UEKA 4JI0I 4ED4A 1KKHA 1NHIA 2N3HA 4OX9E 4LFAE 1DARA 4DV0I 4NXNE 4DV4I 2X7IA 1XMQI 1WUUA 1MU5A 1B63A 4URLA 2V2VA 3J7Yp 1FWKA 4DXLA 1WHQA 2LBSB 1IBMI 1J26A 1HR0E 4X65E 1J5EE 1EKZA 5IWAE 4DV1I 2F4VE 2NA2A 4DUZI 4DR4I 1T4OA 2GS8A 2R3VA 2LTSA 4FW9A 1FJGE 4OX9I 4LFAI 1YYKA 4DR7I 4NXNI 4X62E 1ZM2A 4WUBA 3J81Q 2CZ9A 2JY9A 1WHNA 4DUYE 3M6AA 2ZBKB 1O0WA 4X65I 1J5EI 4B3RE 1HNXI 4OOGC 5LMNE 5IWAI 2LUQA 2NUGA 5LMUI 3LLHA 1EI1A 4DR6I 3WU5A 3ZKDA 2UXCE 3F0NA 4JV5E 4X62I 1STUA 3ZZTA 1HNZI 3ZZ0A 2DEIA 4FWGA 4B3RI 4ZVIA 5LMNI 3WU3A 3QT5A 2B7VA 4DV5E 4LFBE 3PYDA 1D6TA 1FWLA 2UXCI 4WUCA 1NHJA 5A2QQ 1XNQE 4JV5I 1FKAE 4LF4E 1H7SA 1Z0GA 4RPFA 2XEXA 5GMDA 2Q2EB 2RTXA 4X64E 4DPYA 3HTXA 4DV3I 2R42A 4YY3E 4GKJE 2BM0A 4JI1E 4FWDA 4DV5I 1IBLI 3C4TA 4LFBI 2UU9E 2HK3A 1RQ0A 3T1HE 2ZITA 2EZ6A 1N36I 4JG4A 1MG7A 2A2DA 2L3JA 2B7TA 4JI7E 1ELOA 4X64I 1VISA 4DV0E 5IT9C 1NHHA 4YY3I 4GKJI 4M2ZA 1XMQE 1UILA 5FLXQ 3WU4A 3WU6A 4JYAE 2BV3A 2UU9I 3LPSA 1IBME 3T1HI 3ADIA 2LRSA 2UXDE 4DV1E 2J7KA 4DUZE 4M30A 1YYWA 4JI7I 3CWVA 3VYXA 2ZM6E 1OJ4A 1ZM3A 4LF7E 4DR7E 2EFGA 2UUCI 4LF8E 4X66E 4DR1E 3LTOA 2E5LE 1PVGA 1Z5CA 1ZXNA 4JYAI 4GKKE 3JAMQ 4YHHE 1PIEA 1H74A 3ADGA 3ADLA 4DV2E 1QZRA 2HKJA 4DPXA 1RREA 1HNXE 1Z59A 2HFUA 4UT4A 2UXDI 3P1XA 5LMUE 4DR6E 2DEJA 2ZM6I 5CFFE 4EMDA 4LF7I 2KHXA 4LF8I 3J80C 4HY1A 4X66I 4JI4E 4DR1I 2E5LI 4HYMA 5GMEA 4AQYI 1B62A 4GKKI 1HNZE 4YHHI 2N3GA 4PU9A 2YT4A 4XTJA 3V2UC 4DV2I 4DV6I 1NZ0A 3ADJA 4B3SE 1EA6A 2BM1A 4HACA 3QT6A 2X36A 2RSMA 5BR8I 2UXBE 4JI4I 1N33E 1FNMA 2LJHA 3ZZUA 4DV3E 4MYUA 1RC7A 1IBLE 4PRXA 4B3SI 1S16A 3PYEA 2HHHE 2RS6A 2L2MA 1FI4A 1N36E 3C4BA 4B3TE 1XNRE 2UXBI 2LTRA 2VQEE 2V2ZA 1KVKA 1N33I 4DU8A 3ZKBA 1ZBTA 2B3TB 4LF5E 4JI8I 3J81C 2CPNA 2DB2A 4JI3I 1DI2A 3K1JA 2E1RA 4K0KE 3D4JA 2HHHI 3VYYA 1UHZA 2NUEA 1S4EA 4B3TI 1XNRI 3Q1QA 1X48A 1I94E 1Z0WA 3QT8A 2VQEI 1Z0TA 3GONA 1QU6A 4DU7A 2HKEA 2DIXA 3ZM7A 1YYOA 1ZXMA 4LF5I 2UUCE 2VQFE 4Z7YA 1KIJA 1U2RA 4K0KI 4DR3I 4NXMI 4JI6E 2NUFA 1I94I 4FWHA 1XMOE 4MYTA 4HACB 3HULA 5A2QC 3B78A 2V34A 2NPFA 4Z7CA 4B3MI 2VQFI 4LFCI 4DPWA 2V8PA 1X47A 4AQYE 1HNWE 3J7AG 2HFSA 3PYGA 4M1KA 4X8WA 2L33A 4JI6I 4DV6E 4DR2E 1IBKE 2MDRA 1T4NA 2V2QA 1XMOI 1H72C 1N34I 5BR8E 1A6FA 2UUBI 1HNWI 3OTOI 4WFTA 4LF6E 4WYQB 1Z5BA 5FLXC 4LF9E 4DR2I 1IBKI 4DPTA 4USMA
chains in the Genus database with same CATH superfamily
3BF2A 3H4LA 1G2DC 2M9AA 5KL5A 1ZM9A 5DRPA 5LL6R 3V5RA 4LU9A 2UUAE 2A2CA 2LJPA 3M7ND 2EM7A 1Z0EA 4Q35B 1HK7A 2WZOA 4DKKA 2PO2B 2YSPA 1KYQA 4BHBA 2PO1A 1EH7A 4IZJB 2AJ4A 4LPFA 2YTIA 2EM0A 1N0UA 1Z0CA 3B82A 2LUPB 4KQVA 1HR0I 4I3HA 4JI8E 2L2KB 4U3DA 3B8HA 4LF6I 2RS7A 1T4LB 2JEBA 2NN6A 2F1DA 2PNLA 3T1YE 5C0XA 5AE2A 4LF9I 2F4VI 2EN2A 2WCC3 1PJTA 3H09A 2VF3A 4J8ZA 4NHRA 4MU4A 3M85D 4HEIA 3Q6MA 4R1FA 4JI3E 1T38A 3GCMA 3JAMC 4DR5E 1KTVA 1FJGI 1H73A 1WRJA 4MU0A 4KWYA 1JK1A 2EOSA 2M1SA 3P3EA 2UUAI 4USKA 5IT9Q 4DV7E 2JYAA 4N4RB 2JXPA 4WXCA 2EM3A 1RR9A 2EPMX 1SR9A 4DUYI 2EJ4A 1KJKA 2L6MA 3HPSA 3EPLA 3LNUA 4R2PA 2EOFA 2JOBA 4LCHA 5AC5A 4ZYDA 1GQEA 2GPIA 4BBYA 1UDNA 1SFEA 3T1YI 4TUIA 1H7UA 5DRQA 1ZM4A 2HC5A 4BS9A 2KONA 2OI2A 2EL4A 2CT1A 2GHFA 4DR5I 4BHCA 3AV0A 4DR3E 4NXME 5LLQA 1UN6B 1PKPA 3H1CA 4PRVA 4DV7I 3M99B 4JI2E 2NN6E 1Z0BA 2YTEA 2YTQA 2PO2A 4JI5E 2V88A 3K17A 4MDTA 5JEAF 2JEBB 2EM2A 2IHR1 4KHPE 1ZR9A 2YRHA 4IFDC 2I9IA 4P52A 4P7AA 1XHKA 4OZEA 4B3ME 2YTFA 2L3CA 4LFCE 2NN6D 4BA2B 2V89A 1YZ9A 2EOXA 3NZKA 1Z0VA 1YHCA 4F54A 2WNRB 4HXZA 2RQLA 4UTGA 5L3JA 1XNQI 2EPPA 4FN5A 1N32E 2EPXA 3P3GA 3KRNA 1BKNA 3PYFA 1IMUA 3QT7A 2WBTA 3L00A 2C38A 4JI0E 4NZVA 3J80Q 4JI2I 1K47A 4OKGA 4LF4I 4JI5I 2EORA 2DLQA 4L5NC 2EN6A 5AC4A 2C37B 4KHPI 2BA0G 1X49A 2ADRA 3C6KA 4WPYA 3J7AM 1Y5YA 4DV4E 1N34E 2JVAA 1Z5AA 5JEAE 2EM6A 1AH5A 4JI1I 2ELZA 3VK6A 3UK3C 4P7DA 2UUBE 1MX0A 2Z5CA 4GQUA 2L2NA 3RMPA 2HK2A 4BMJA 3OTOE 4FW7A 2DMYA 2H36X 1N0VC 1IQOA 1NEIA 5K36E 5JEAD 2EMAA 2NN6B 3U1YA 1N32I 3IWDA 1B69A 4DR4E 1UEKA 2WW4A 4JI0I 4ED4A 1KKHA 2GO4A 2EOHA 3P3CA 2EPRA 4R2RA 2FV4B 2N3HA 2EMLA 4LFAE 4OX9E 2HJJA 3EPJA 1DARA 1NHIA 2ENAA 4DV0I 2D9HA 4NXNE 5K36D 3DD6A 4DV4I 2X7IA 1A1LA 1WUUA 1XMQI 1MU5A 1B63A 2BA1D 2PNZB 4AIMA 2YTDA 4URLA 2V2VA 3J7Yp 3PS3A 4J3DA 1FWKA 4DXLA 1WHQA 2LBSB 1IBMI 1J26A 4IJDA 1HR0E 4X65E 4GEQB 1J5EE 4IFDA 3GLLA 5JEAC 1EKZA 3MHSC 5IWAE 3BIDA 2AE8A 4DV1I 2JEAB 2F4VE 2NA2A 4M0VA 4DUZI 4DR4I 4OO1F 1T4OA 2LT7A 4WX9A 2GS8A 2LTSA 2R3VA 4FW9A 2WBSA 4RHBB 1FJGE 4OX9I 2DMIA 4LFAI 1GTKA 1YYKA 2C37A 4DR7I 5K36C 5JEAB 2EMGA 4O43A 4NXNI 3U1KA 3KWRA 1Y4UA 4X62E 4R03A 1ZM2A 4WUBA 1X6FA 5A6BD 2MC6A 3J81Q 2CZ9A 4F9BB 2JY9A 1WHNA 2EOIA 2EN1A 4DUYE 4LCGA 2JPAA 2Z5EA 2L8TA 3M6AA 3P76A 2HGHA 2ZBKB 1O0WA 1RMDA 4X65I 1J5EI 1ZBQA 5K36B 2YTOA 4B3RE 1TN9A 1HNXI 4OOGC 5LMNE 3KZZA 2LUQA 4IZKB 5IWAI 2NUGA 4KZSA 4ZYHA 5LMUI 2EOEA 1X5WA 3LLHA 2LO3A 3PRYA 1EI1A 4DR6I 2EPCA 3WU5A 3ZKDA 2UXCE 1EH8A 3F0NA 3F6GA 4IFDE 4JV5E 4X62I 2EQ1A 2C38B 4FW5A 1STUA 4MLQA 2JE6B 2PNZA 2EL6A 1DGCA 4R2EA 3ZZTA 3EPHA 4DPUA 1HNZI 2CG9A 4FW4A 3ZZ0A 1MEYC 2DEIA 4FWGA 2YPNA 4IFDD 4ZVIA 4B3RI 2MDGA 5DROA 5LMNI 3K6QA 3QT5A 2B7VA 4DV5E 4R2CA 3WU3A 2K7IA 2JEAA 2Z5CB 4LFBE 5AE1A 1WXRA 3PYDA 5DRRA 2EN4A 5KL4A 1YPNA 1D6TA 1USUA 2BBGA 1FWLA 4O5GA 2UXCI 4WUCA 4NBQA 1NHJA 4M9VC 2YU8A 5A2QQ 2KOUA 1XNQE 5JEAA 3F6HA 1OYPA 1EH6A 3LMLA 2ENCA 2JOXA 4O24A 2IESA 4QNKA 4JV5I 3HJCA 1FKAE 2YTJA 4LF4E 1H7SA 1A1FA 1Z0GA 4RPFA 2J65A 3CDJA 2YTGA 2XEXA 3K85A 5GMDA 2Q2EB 2R76A 2RTXA 1R6MA 4X64E 4DPYA 2IOQA 3HTXA 4DV3I 3FIGA 5K36A 2K4VA 2R42A 2Q8UA 4YY3E 4Q28A 4GKJE 2BM0A 2RPCA 2EN3A 2V85A 4IZKA 4JI1E 4FWDA 4DV5I 5KL6A 1IBLI 3C4TA 4LFBI 2EOOA 2UU9E 2CSHA 1E3HA 2HK3A 1RQ0A 2VF1A 3T1HE 1XXEA 2ZITA 3M7NG 4IFDB 2EMCA 4F6MA 2ODRD 2EZ6A 1N36I 4JG4A 1MG7A 1BBGA 2A2DA 2EM5A 2EPAA 2L3JA 2JE6A 2B7TA 1Y4SA 4JI7E 1USVA 2EPLX 2VE7C 2EMBA 2EPKX 2WBUA 1ELOA 4X64I 2C39A 2EOZA 2EMWA 4DV0E 5IT9C 2V83A 1VISA 5T6JA 1NHHA 2YRKA 4DMIA 1A1JA 4YY3I 3M85G 4GKJI 2EPNA 1QNTA 2NABA 1UILA 5A6BA 1XMQE 2M4IA 4BCAA 2JP9A 4M2ZA 1P42A 1UDQA 3WU4A 3WU6A 5FLXQ 4JYAE 2YZTA 2BV3A 2UU9I 4BC7A 3LPSA 1IBME 5DNLA 3T1HI 3ADIA 2BR2B 2ODRC 1YUJA 2LRSA 2UXDE 1YFHA 4DV1E 1Y60A 2J7KA 2WP8B 4DUZE 4M30A 3THOB 1VI7A 2LCEA 2V86A 1YYWA 4JI7I 4L8NA 3AUZA 2O1TA 3CWVA 1Z1BA 3VYXA 2EMZA 4LTYA 2ZM6E 1X6EA 3TQMA 4LF7E 4DR7E 1JK2A 1OJ4A 1ZM3A 2EFGA 3Q6NA 2UUCI 2LE2A 2GLIA 4GZNC 4LF8E 2N8XA 1DQ3A 4MQYA 2ELYA 3L7ZB 4X66E 4DR1E 3LTOA 2E5LE 1PVGA 1Z5CA 1ZXNA 2LJUA 4JYAI 2J7JA 4GKKE 2V8QB 2RSIA 2PRTA 1ZAAC 1E3PA 4YHHE 1PIEA 2EL5A 3JAMQ 1H74A 3ADGA 2VESA 3BGHA 3DJWA 1AAYA 3ADLA 4DV2E 5AASA 1QZRA 2HKJA 4DPXA 1RREA 1HNXE 1Z59A 2HFUA 5ELWA 4UT4A 2UXDI 3P1XA 1UDSA 5LMUE 2DSYA 1A1IA 5A6JA 4DR6E 2DEJA 2ZM6I 5CFFE 4EMDA 4LF7I 2MC5A 2EMKA 1PDAA 4HTGA 2KHXA 2EMYA 4LF8I 4AM3A 3J80C 2EMFA 4HY1A 1BB8A 4X66I 4JI4E 4DR1I 2E5LI 2EMHA 2EWLA 2GO3A 4HYMA 5GMEA 4AQYI 1L4SA 2EM8A 1B62A 4GKKI 3JU0A 1HNZE 1A1KA 3PS2A 4YHHI 2L92A 2N3GA 2EM9A 2BR2A 2YT4A 4PU9A 4XTJA 5EKWA 4F6NA 3V2UC 4DV2I 4DV6I 1YH8A 2WP8A 1MGTA 1NZ0A 3HQ1A 4R2QA 3ADJA 4I8OA 3VHTB 4B3SE 4WUDA 3IWBA 1EA6A 4BC9A 2BM1A 4AIDA 3QG5C 3HPZA 4HACA 4U3BA 5KL3A 1YSAC 2PO0B 3QT6A 4OO1E 2X36A 2O3ZA 2RSMA 5BR8I 2UXBE 3L7ZA 4LCFA 4JI4I 5F3WA 1N33E 1FNMA 4WXDA 2LJHA 2YRMA 2ENHA 3ZZUA 2CGEA 2Z5BB 2C39B 3OMLA 4FK5C 4DV3E 2M7QA 4OO1D 1WJPA 3MHHC 1LLMC 4MYUA 2BA0D 2YTNA 3C6MA 2B9DA 5ADZA 1RC7A 1IBLE 2EM4A 2EOYA 2YSOA 4PRXA 4B3SI 2NN6F 1X3CA 1S16A 3PYEA 2HHHE 1BBOA 2RS6A 4QNJA 5DNXA 2IOPA 1UDOA 5C0XF 2L2MA 1FI4A 2BA1G 1N36E 2EPZA 3C4BA 4B3TE 1XNRE 5DNYA 4FW3A 5EL9A 2EN7A 2UXBI 2LTRA 2VQEE 2V2ZA 2A25A 1KVKA 1N33I 5AE3A 2GQ0A 3ZKBA 4DU8A 1ZBTA 1ZU1A 4MU1A 2B3TB 4LF5E 2EOQA 4IS9A 4MU3A 4JI8I 4OO1C 5IXMB 2O1VA 1PJQA 1Y6ZA 5IV8B 2LVHA 2EPUA 3HXLA 3J81C 2CPNA 4MLVA 2DB2A 5KL7A 2VRDA 2R1FA 1P47A 1IQSA 4JI3I 4BA1B 1DI2A 4ZYGA 3K1JA 2E1RA 4K0KE 3B4TA 3D4JA 2HHHI 4OO1B 2G7HA 3VYYA 2PO0A 4X9JA 2EOMA 2EQ3A 1R6LA 2JWOA 1UHZA 4IS1C 2NUEA 1S4EA 4B3TI 1XNRI 1X48A 1I94E 3Q1QA 2FGGA 1Z0WA 1T39A 1F2IG 3QT8A 5C0XE 2VQEI 3KZYA 2DGCA 3CDIA 1NCSA 4F2JC 4IZJA 1UBDC 2EP3A 3MSWA 1Z0TA 3GONA 1QU6A 4DU7A 2HKEA 2DIXA 3ZM7A 1YYOA 1ZXMA 2Z5BA 4LF5I 4F9AB 5A6AA 2UUCE 3EQ1A 4R8OA 4R2AA 2IERA 4R2DA 2MKNA 2VQFE 2PNMA 4Z7YA 2EOJA 1KIJA 2EQ0A 3HKMA 5C0XD 3PS1A 5K36F 2I13A 1U2RA 2O1WA 4P78A 2YU5A 2FTXB 4K0KI 4DR3I 4NXMI 3UHMA 1RHYA 4JI6E 3THNA 5A6KA 1GZ6A 2NUFA 1G2FC 3IWCA 1I94I 1TF3A 1YUIA 4O4KA 4FWHA 2LMZA 1XMOE 4MYTA 4HACB 3HULA 5A2QC 3B78A 3P06A 2V34A 2NPFA 4Z7CA 4B3MI 5TSEA 5A69A 3BBGA 2NN6C 2VQFI 4LFCI 4DPWA 5C0XC 2DLKA 2EPOA 2V8PA 1X47A 2YTPA 2PO1B 4AQYE 1HNWE 1A1HA 4BA1A 3J7AG 2YWQA 2HFSA 2JT2A 3PYGA 4M1KA 4OO1A 4X8WA 2L33A 4JI6I 4F9CB 3ZOQB 4DV6E 2BB8A 5C0XB 4DR2E 1IBKE 2MDRA 2F8BA 2MKDA 1T4NA 2V2QA 2E72A 4TUGA 3GMEA 4IZJD 5KL2A 4ZYEA 1XMOI 2EN8A 2EMIA 4WSGA 1H72C 2CVEA 1A1GA 3DF6A 1OYRA 1N34I 3ECRA 5BR8E 3JTZA 2EE8A 4BA2A 4ISAA 1A6FA 2UUBI 2EMXA 1PJSA 2E1MA 1TF6A 2LV2A 1HNWI 4WSPA 2WNRA 3OTOI 2JR1A 4R2SA 4LOMA 4WFTA 4RH8A 4LF6E 1OYSA 4WYQB 1Z5BA 2V87A 2DRPA 2O1UA 5FLXC 4FW6A 5FWKA 4LF9E 1X6HA 4DR2I 1IBKI 2CTDA 4DPTA 4N3OA 4IFDF 1N3GA 3EPKA 4USMA
chains in the Genus database with same CATH topology
3H4LA 1ZM9A 5LL6R 3V5RA 4LU9A 2UUAE 2A2CA 2LJPA 1Z0EA 1HK7A 2WZOA 4DKKA 4IZJB 2AJ4A 1Z0CA 1N0UA 4KQVA 3B82A 2LUPB 1HR0I 4I3HA 4JI8E 2L2KB 3B8HA 4LF6I 2RS7A 1T4LB 2PNLA 3T1YE 5AE2A 4LF9I 2F4VI 2VF3A 3H09A 4J8ZA 3Q6MA 4R1FA 4JI3E 3JAMC 4DR5E 1KTVA 1FJGI 1H73A 2M1SA 2UUAI 5IT9Q 4USKA 4DV7E 1RR9A 1SR9A 4DUYI 2L6MA 3HPSA 3LNUA 2JOBA 1GQEA 4BBYA 3T1YI 4TUIA 1H7UA 1ZM4A 4BS9A 2KONA 2OI2A 4DR5I 3AV0A 4DR3E 4NXME 1PKPA 4PRVA 4DV7I 4JI2E 1Z0BA 4JI5E 2V88A 3K17A 2IHR1 4KHPE 4P52A 4P7AA 1XHKA 4B3ME 2L3CA 4LFCE 2V89A 1YZ9A 1Z0VA 4F54A 4HXZA 4UTGA 1XNQI 5L3JA 4FN5A 1N32E 3QT7A 4WUDA 3PYFA 1BKNA 4DPUA 4JI2I 4LF4I 3J80Q 4JI0E 1K47A 4JI5I 4L5NC 4KHPI 1X49A 4WPYA 3J7AM 4DV4E 1N34E 2JVAA 1Z5AA 4JI1I 3VK6A 4P7DA 2UUBE 1MX0A 2Z5CA 2L2NA 3RMPA 2HK2A 4BMJA 3OTOE 2DMYA 2H36X 1N0VC 1N32I 3IWDA 2WW4A 4DR4E 1UEKA 4JI0I 4ED4A 1KKHA 2FV4B 2N3HA 4OX9E 4LFAE 1DARA 1NHIA 4DV0I 4NXNE 4DV4I 2X7IA 1XMQI 1WUUA 1MU5A 1B63A 4URLA 2V2VA 3J7Yp 1FWKA 4DXLA 1WHQA 2LBSB 1IBMI 1J26A 1HR0E 4X65E 4GEQB 1J5EE 1EKZA 5IWAE 4DV1I 2F4VE 2NA2A 4M0VA 4DUZI 4DR4I 1T4OA 2GS8A 2R3VA 2LTSA 4FW9A 1FJGE 4OX9I 4LFAI 1YYKA 4DR7I 4NXNI 3KWRA 1Y4UA 4X62E 4R03A 1ZM2A 4WUBA 2MC6A 3J81Q 2CZ9A 4F9BB 2JY9A 1WHNA 4DUYE 2Z5EA 2L8TA 3M6AA 2ZBKB 1O0WA 4X65I 1J5EI 1ZBQA 4B3RE 1HNXI 4OOGC 5LMNE 4IZKB 2LUQA 5IWAI 2NUGA 4KZSA 5LMUI 3LLHA 3PRYA 1EI1A 4DR6I 3WU5A 3ZKDA 2UXCE 3F0NA 3F6GA 4JV5E 4X62I 1STUA 3ZZTA 1HNZI 2CG9A 3ZZ0A 2DEIA 4FWGA 4B3RI 4ZVIA 5LMNI 3K6QA 3QT5A 2B7VA 4DV5E 3WU3A 2Z5CB 4LFBE 5AE1A 1WXRA 3PYDA 1D6TA 1USUA 1FWLA 2UXCI 4WUCA 1NHJA 5A2QQ 2KOUA 1XNQE 3F6HA 3LMLA 2JOXA 4JV5I 3HJCA 1FKAE 4LF4E 1H7SA 1Z0GA 4RPFA 2XEXA 3K85A 5GMDA 2Q2EB 2RTXA 4X64E 4DPYA 2IOQA 3HTXA 4DV3I 3FIGA 2K4VA 2R42A 4YY3E 4Q28A 4GKJE 2BM0A 2V85A 4IZKA 4JI1E 4FWDA 4DV5I 1IBLI 3C4TA 4LFBI 2UU9E 2HK3A 1RQ0A 2VF1A 3T1HE 2ZITA 2EZ6A 2ODRD 1N36I 4JG4A 1MG7A 2A2DA 2L3JA 2B7TA 1Y4SA 4JI7E 1USVA 2VE7C 1ELOA 4X64I 5IT9C 4DV0E 1VISA 2V83A 5T6JA 1NHHA 4DMIA 4YY3I 4GKJI 4M2ZA 1XMQE 1UILA 2M4IA 4BCAA 5FLXQ 3WU4A 3WU6A 4JYAE 2YZTA 2BV3A 2UU9I 4BC7A 3LPSA 1IBME 3T1HI 3ADIA 2ODRC 2LRSA 2UXDE 4DV1E 2J7KA 4DUZE 4M30A 2V86A 1YYWA 4JI7I 4L8NA 3AUZA 2O1TA 3CWVA 3VYXA 4LTYA 2ZM6E 1OJ4A 4LF7E 1ZM3A 3Q6NA 4DR7E 2EFGA 2UUCI 2LE2A 4LF8E 1DQ3A 4X66E 4DR1E 3LTOA 2E5LE 1PVGA 1Z5CA 1ZXNA 4JYAI 4GKKE 2V8QB 3JAMQ 4YHHE 1PIEA 1H74A 3ADGA 3ADLA 3DJWA 4DV2E 5AASA 1QZRA 2HKJA 4DPXA 1RREA 1HNXE 1Z59A 2HFUA 4UT4A 2UXDI 3P1XA 5LMUE 2DSYA 4DR6E 2DEJA 2ZM6I 5CFFE 4EMDA 4LF7I 2MC5A 2KHXA 4LF8I 3J80C 4HY1A 4X66I 4JI4E 4DR1I 2E5LI 2EWLA 4HYMA 5GMEA 4AQYI 1B62A 4GKKI 3JU0A 1HNZE 4YHHI 2L92A 2N3GA 4PU9A 2YT4A 4XTJA 3V2UC 4DV2I 4DV6I 1NZ0A 3HQ1A 3ADJA 4I8OA 4B3SE 3IWBA 1EA6A 4BC9A 2BM1A 3HPZA 4HACA 3QT6A 2X36A 2RSMA 5BR8I 2UXBE 4JI4I 5F3WA 1N33E 1FNMA 2LJHA 3ZZUA 2CGEA 2Z5BB 3OMLA 4DV3E 2M7QA 4MYUA 5ADZA 2B9DA 1RC7A 1IBLE 4PRXA 4B3SI 1S16A 3PYEA 2HHHE 2RS6A 2IOPA 2L2MA 1FI4A 1N36E 3C4BA 4B3TE 1XNRE 5DNYA 2UXBI 2LTRA 2VQEE 2V2ZA 1KVKA 1N33I 5AE3A 2GQ0A 3ZKBA 4DU8A 1ZBTA 2B3TB 4LF5E 4JI8I 2O1VA 1Y6ZA 3HXLA 3J81C 2CPNA 2DB2A 4JI3I 1DI2A 3K1JA 2E1RA 4K0KE 3D4JA 2HHHI 2G7HA 3VYYA 2JWOA 1UHZA 2NUEA 1S4EA 4B3TI 1XNRI 3Q1QA 1X48A 1I94E 2FGGA 1Z0WA 3QT8A 2VQEI 4IZJA 3MSWA 1Z0TA 3GONA 1QU6A 4DU7A 2HKEA 2DIXA 3ZM7A 1YYOA 1ZXMA 2Z5BA 4LF5I 4F9AB 2UUCE 4R8OA 2PNMA 2VQFE 4Z7YA 1KIJA 1U2RA 2O1WA 4P78A 2FTXB 4K0KI 4DR3I 4NXMI 4JI6E 1GZ6A 2NUFA 3IWCA 1I94I 4FWHA 2LMZA 1XMOE 4MYTA 4HACB 3HULA 5A2QC 3B78A 3P06A 2V34A 2NPFA 4Z7CA 4B3MI 2VQFI 4LFCI 4DPWA 2V8PA 1X47A 4AQYE 1HNWE 3J7AG 2HFSA 3PYGA 4M1KA 4X8WA 2L33A 4JI6I 4F9CB 3ZOQB 4DV6E 4DR2E 1IBKE 2MDRA 2F8BA 1T4NA 2V2QA 4TUGA 4IZJD 1XMOI 1H72C 3DF6A 1N34I 5BR8E 3JTZA 1A6FA 2UUBI 2E1MA 1HNWI 4WSPA 3OTOI 2JR1A 4WFTA 4LF6E 4WYQB 1Z5BA 2V87A 2O1UA 5FLXC 5FWKA 4LF9E 4DR2I 1IBKI 4DPTA 4N3OA 4USMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4L A;  1ZM9 A;  5LL6 R;  3V5R A;  2UUA E;  2A2C A;  2LJP A;  1Z0E A;  4DKK A;  2AJ4 A;  1Z0C A;  1N0U A;  4KQV A;  3B82 A;  2LUP B;  1HR0 I;  4I3H A;  4JI8 E;  2L2K B;  3B8H A;  4LF6 I;  2RS7 A;  1T4L B;  3T1Y E;  2F4V I;  4LF9 I;  2VF3 A;  4R1F A;  4JI3 E;  1KTV A;  4DR5 E;  3JAM C;  1FJG I;  1H73 A;  2UUA I;  5IT9 Q;  4USK A;  4DV7 E;  1RR9 A;  4DUY I;  3LNU A;  1GQE A;  3T1Y I;  1H7U A;  1ZM4 A;  2OI2 A;  4DR5 I;  4DR3 E;  4NXM E;  1PKP A;  4PRV A;  4DV7 I;  4JI2 E;  1Z0B A;  4JI5 E;  3K17 A;  2IHR 1;  4KHP E;  4P52 A;  4P7A A;  1XHK A;  4B3M E;  2L3C A;  4LFC E;  1YZ9 A;  1Z0V A;  4HXZ A;  4UTG A;  1XNQ I;  5L3J A;  4FN5 A;  1N32 E;  3QT7 A;  4WUD A;  3PYF A;  1BKN A;  4DPU A;  4JI2 I;  4LF4 I;  3J80 Q;  4JI0 E;  1K47 A;  4JI5 I;  4KHP I;  1X49 A;  3J7A M;  4DV4 E;  1N34 E;  2JVA A;  1Z5A A;  4JI1 I;  1MX0 A;  2UUB E;  2L2N A;  2HK2 A;  3OTO E;  2DMY A;  1N0V C;  1N32 I;  2WW4 A;  4DR4 E;  1UEK A;  4JI0 I;  4ED4 A;  1KKH A;  1NHI A;  2N3H A;  4OX9 E;  4LFA E;  1DAR A;  4DV0 I;  4NXN E;  4DV4 I;  2X7I A;  1XMQ I;  1WUU A;  1MU5 A;  1B63 A;  4URL A;  2V2V A;  3J7Y p;  1FWK A;  4DXL A;  1WHQ A;  2LBS B;  1IBM I;  1J26 A;  1HR0 E;  4X65 E;  1J5E E;  1EKZ A;  5IWA E;  4DV1 I;  2F4V E;  2NA2 A;  4DUZ I;  4DR4 I;  1T4O A;  2GS8 A;  2R3V A;  2LTS A;  4FW9 A;  1FJG E;  4OX9 I;  4LFA I;  1YYK A;  4DR7 I;  4NXN I;  4X62 E;  1ZM2 A;  4WUB A;  3J81 Q;  2CZ9 A;  2JY9 A;  1WHN A;  4DUY E;  3M6A A;  2ZBK B;  1O0W A;  4X65 I;  1J5E I;  4B3R E;  1HNX I;  4OOG C;  5LMN E;  5IWA I;  2LUQ A;  2NUG A;  5LMU I;  3LLH A;  1EI1 A;  4DR6 I;  3WU5 A;  3ZKD A;  2UXC E;  3F0N A;  4JV5 E;  4X62 I;  1STU A;  3ZZT A;  1HNZ I;  3ZZ0 A;  2DEI A;  4FWG A;  4B3R I;  4ZVI A;  5LMN I;  3WU3 A;  3QT5 A;  2B7V A;  4DV5 E;  4LFB E;  3PYD A;  1D6T A;  1FWL A;  2UXC I;  4WUC A;  1NHJ A;  5A2Q Q;  1XNQ E;  4JV5 I;  1FKA E;  4LF4 E;  1H7S A;  1Z0G A;  4RPF A;  2XEX A;  5GMD A;  2Q2E B;  2RTX A;  4X64 E;  4DPY A;  3HTX A;  4DV3 I;  2R42 A;  4YY3 E;  4GKJ E;  2BM0 A;  4JI1 E;  4FWD A;  4DV5 I;  1IBL I;  3C4T A;  4LFB I;  2UU9 E;  2HK3 A;  1RQ0 A;  3T1H E;  2ZIT A;  2EZ6 A;  1N36 I;  4JG4 A;  1MG7 A;  2A2D A;  2L3J A;  2B7T A;  4JI7 E;  1ELO A;  4X64 I;  1VIS A;  4DV0 E;  5IT9 C;  1NHH A;  4YY3 I;  4GKJ I;  4M2Z A;  1XMQ E;  1UIL A;  5FLX Q;  3WU4 A;  3WU6 A;  4JYA E;  2BV3 A;  2UU9 I;  3LPS A;  1IBM E;  3T1H I;  3ADI A;  2LRS A;  2UXD E;  4DV1 E;  2J7K A;  4DUZ E;  4M30 A;  1YYW A;  4JI7 I;  3CWV A;  3VYX A;  2ZM6 E;  1OJ4 A;  1ZM3 A;  4LF7 E;  4DR7 E;  2EFG A;  2UUC I;  4LF8 E;  4X66 E;  4DR1 E;  3LTO A;  2E5L E;  1PVG A;  1Z5C A;  1ZXN A;  4JYA I;  4GKK E;  3JAM Q;  4YHH E;  1PIE A;  1H74 A;  3ADG A;  3ADL A;  4DV2 E;  1QZR A;  2HKJ A;  4DPX A;  1RRE A;  1HNX E;  1Z59 A;  2HFU A;  4UT4 A;  2UXD I;  3P1X A;  5LMU E;  4DR6 E;  2DEJ A;  2ZM6 I;  5CFF E;  4EMD A;  4LF7 I;  2KHX A;  4LF8 I;  3J80 C;  4HY1 A;  4X66 I;  4JI4 E;  4DR1 I;  2E5L I;  4HYM A;  5GME A;  4AQY I;  1B62 A;  4GKK I;  1HNZ E;  4YHH I;  2N3G A;  4PU9 A;  2YT4 A;  4XTJ A;  3V2U C;  4DV2 I;  4DV6 I;  1NZ0 A;  3ADJ A;  4B3S E;  1EA6 A;  2BM1 A;  4HAC A;  3QT6 A;  2X36 A;  2RSM A;  5BR8 I;  2UXB E;  4JI4 I;  1N33 E;  1FNM A;  2LJH A;  3ZZU A;  4DV3 E;  4MYU A;  1RC7 A;  1IBL E;  4PRX A;  4B3S I;  1S16 A;  3PYE A;  2HHH E;  2RS6 A;  2L2M A;  1FI4 A;  1N36 E;  3C4B A;  4B3T E;  1XNR E;  2UXB I;  2LTR A;  2VQE E;  2V2Z A;  1KVK A;  1N33 I;  4DU8 A;  3ZKB A;  1ZBT A;  2B3T B;  4LF5 E;  4JI8 I;  3J81 C;  2CPN A;  2DB2 A;  4JI3 I;  1DI2 A;  3K1J A;  2E1R A;  4K0K E;  3D4J A;  2HHH I;  3VYY A;  1UHZ A;  2NUE A;  1S4E A;  4B3T I;  1XNR I;  3Q1Q A;  1X48 A;  1I94 E;  1Z0W A;  3QT8 A;  2VQE I;  1Z0T A;  3GON A;  1QU6 A;  4DU7 A;  2HKE A;  2DIX A;  3ZM7 A;  1YYO A;  1ZXM A;  4LF5 I;  2UUC E;  2VQF E;  4Z7Y A;  1KIJ A;  1U2R A;  4K0K I;  4DR3 I;  4NXM I;  4JI6 E;  2NUF A;  1I94 I;  4FWH A;  1XMO E;  4MYT A;  4HAC B;  3HUL A;  5A2Q C;  3B78 A;  2V34 A;  2NPF A;  4Z7C A;  4B3M I;  2VQF I;  4LFC I;  4DPW A;  2V8P A;  1X47 A;  4AQY E;  1HNW E;  3J7A G;  2HFS A;  3PYG A;  4M1K A;  4X8W A;  2L33 A;  4JI6 I;  4DV6 E;  4DR2 E;  1IBK E;  2MDR A;  1T4N A;  2V2Q A;  1XMO I;  1H72 C;  1N34 I;  5BR8 E;  1A6F A;  2UUB I;  1HNW I;  3OTO I;  4WFT A;  4LF6 E;  4WYQ B;  1Z5B A;  5FLX C;  4LF9 E;  4DR2 I;  1IBK I;  4DPT A;  4USM A; 
#chains in the Genus database with same CATH topology
 3BF2 A;  3H4L A;  1G2D C;  2M9A A;  5KL5 A;  1ZM9 A;  5DRP A;  5LL6 R;  3V5R A;  4LU9 A;  2UUA E;  2A2C A;  2LJP A;  3M7N D;  2EM7 A;  1Z0E A;  4Q35 B;  1HK7 A;  2WZO A;  4DKK A;  2PO2 B;  2YSP A;  1KYQ A;  4BHB A;  2PO1 A;  1EH7 A;  4IZJ B;  2AJ4 A;  4LPF A;  2YTI A;  2EM0 A;  1N0U A;  1Z0C A;  3B82 A;  2LUP B;  4KQV A;  1HR0 I;  4I3H A;  4JI8 E;  2L2K B;  4U3D A;  3B8H A;  4LF6 I;  2RS7 A;  1T4L B;  2JEB A;  2NN6 A;  2F1D A;  2PNL A;  3T1Y E;  5C0X A;  5AE2 A;  4LF9 I;  2F4V I;  2EN2 A;  2WCC 3;  1PJT A;  3H09 A;  2VF3 A;  4J8Z A;  4NHR A;  4MU4 A;  3M85 D;  4HEI A;  3Q6M A;  4R1F A;  4JI3 E;  1T38 A;  3GCM A;  3JAM C;  4DR5 E;  1KTV A;  1FJG I;  1H73 A;  1WRJ A;  4MU0 A;  4KWY A;  1JK1 A;  2EOS A;  2M1S A;  3P3E A;  2UUA I;  4USK A;  5IT9 Q;  4DV7 E;  2JYA A;  4N4R B;  2JXP A;  4WXC A;  2EM3 A;  1RR9 A;  2EPM X;  1SR9 A;  4DUY I;  2EJ4 A;  1KJK A;  2L6M A;  3HPS A;  3EPL A;  3LNU A;  4R2P A;  2EOF A;  2JOB A;  4LCH A;  5AC5 A;  4ZYD A;  1GQE A;  2GPI A;  4BBY A;  1UDN A;  1SFE A;  3T1Y I;  4TUI A;  1H7U A;  5DRQ A;  1ZM4 A;  2HC5 A;  4BS9 A;  2KON A;  2OI2 A;  2EL4 A;  2CT1 A;  2GHF A;  4DR5 I;  4BHC A;  3AV0 A;  4DR3 E;  4NXM E;  5LLQ A;  1UN6 B;  1PKP A;  3H1C A;  4PRV A;  4DV7 I;  3M99 B;  4JI2 E;  2NN6 E;  1Z0B A;  2YTE A;  2YTQ A;  2PO2 A;  4JI5 E;  2V88 A;  3K17 A;  4MDT A;  5JEA F;  2JEB B;  2EM2 A;  2IHR 1;  4KHP E;  1ZR9 A;  2YRH A;  4IFD C;  2I9I A;  4P52 A;  4P7A A;  1XHK A;  4OZE A;  4B3M E;  2YTF A;  2L3C A;  4LFC E;  2NN6 D;  4BA2 B;  2V89 A;  1YZ9 A;  2EOX A;  3NZK A;  1Z0V A;  1YHC A;  4F54 A;  2WNR B;  4HXZ A;  2RQL A;  4UTG A;  5L3J A;  1XNQ I;  2EPP A;  4FN5 A;  1N32 E;  2EPX A;  3P3G A;  3KRN A;  1BKN A;  3PYF A;  1IMU A;  3QT7 A;  2WBT A;  3L00 A;  2C38 A;  4JI0 E;  4NZV A;  3J80 Q;  4JI2 I;  1K47 A;  4OKG A;  4LF4 I;  4JI5 I;  2EOR A;  2DLQ A;  4L5N C;  2EN6 A;  5AC4 A;  2C37 B;  4KHP I;  2BA0 G;  1X49 A;  2ADR A;  3C6K A;  4WPY A;  3J7A M;  1Y5Y A;  4DV4 E;  1N34 E;  2JVA A;  1Z5A A;  5JEA E;  2EM6 A;  1AH5 A;  4JI1 I;  2ELZ A;  3VK6 A;  3UK3 C;  4P7D A;  2UUB E;  1MX0 A;  2Z5C A;  4GQU A;  2L2N A;  3RMP A;  2HK2 A;  4BMJ A;  3OTO E;  4FW7 A;  2DMY A;  2H36 X;  1N0V C;  1IQO A;  1NEI A;  5K36 E;  5JEA D;  2EMA A;  2NN6 B;  3U1Y A;  1N32 I;  3IWD A;  1B69 A;  4DR4 E;  1UEK A;  2WW4 A;  4JI0 I;  4ED4 A;  1KKH A;  2GO4 A;  2EOH A;  3P3C A;  2EPR A;  4R2R A;  2FV4 B;  2N3H A;  2EML A;  4LFA E;  4OX9 E;  2HJJ A;  3EPJ A;  1DAR A;  1NHI A;  2ENA A;  4DV0 I;  2D9H A;  4NXN E;  5K36 D;  3DD6 A;  4DV4 I;  2X7I A;  1A1L A;  1WUU A;  1XMQ I;  1MU5 A;  1B63 A;  2BA1 D;  2PNZ B;  4AIM A;  2YTD A;  4URL A;  2V2V A;  3J7Y p;  3PS3 A;  4J3D A;  1FWK A;  4DXL A;  1WHQ A;  2LBS B;  1IBM I;  1J26 A;  4IJD A;  1HR0 E;  4X65 E;  4GEQ B;  1J5E E;  4IFD A;  3GLL A;  5JEA C;  1EKZ A;  3MHS C;  5IWA E;  3BID A;  2AE8 A;  4DV1 I;  2JEA B;  2F4V E;  2NA2 A;  4M0V A;  4DUZ I;  4DR4 I;  4OO1 F;  1T4O A;  2LT7 A;  4WX9 A;  2GS8 A;  2LTS A;  2R3V A;  4FW9 A;  2WBS A;  4RHB B;  1FJG E;  4OX9 I;  2DMI A;  4LFA I;  1GTK A;  1YYK A;  2C37 A;  4DR7 I;  5K36 C;  5JEA B;  2EMG A;  4O43 A;  4NXN I;  3U1K A;  3KWR A;  1Y4U A;  4X62 E;  4R03 A;  1ZM2 A;  4WUB A;  1X6F A;  5A6B D;  2MC6 A;  3J81 Q;  2CZ9 A;  4F9B B;  2JY9 A;  1WHN A;  2EOI A;  2EN1 A;  4DUY E;  4LCG A;  2JPA A;  2Z5E A;  2L8T A;  3M6A A;  3P76 A;  2HGH A;  2ZBK B;  1O0W A;  1RMD A;  4X65 I;  1J5E I;  1ZBQ A;  5K36 B;  2YTO A;  4B3R E;  1TN9 A;  1HNX I;  4OOG C;  5LMN E;  3KZZ A;  2LUQ A;  4IZK B;  5IWA I;  2NUG A;  4KZS A;  4ZYH A;  5LMU I;  2EOE A;  1X5W A;  3LLH A;  2LO3 A;  3PRY A;  1EI1 A;  4DR6 I;  2EPC A;  3WU5 A;  3ZKD A;  2UXC E;  1EH8 A;  3F0N A;  3F6G A;  4IFD E;  4JV5 E;  4X62 I;  2EQ1 A;  2C38 B;  4FW5 A;  1STU A;  4MLQ A;  2JE6 B;  2PNZ A;  2EL6 A;  1DGC A;  4R2E A;  3ZZT A;  3EPH A;  4DPU A;  1HNZ I;  2CG9 A;  4FW4 A;  3ZZ0 A;  1MEY C;  2DEI A;  4FWG A;  2YPN A;  4IFD D;  4ZVI A;  4B3R I;  2MDG A;  5DRO A;  5LMN I;  3K6Q A;  3QT5 A;  2B7V A;  4DV5 E;  4R2C A;  3WU3 A;  2K7I A;  2JEA A;  2Z5C B;  4LFB E;  5AE1 A;  1WXR A;  3PYD A;  5DRR A;  2EN4 A;  5KL4 A;  1YPN A;  1D6T A;  1USU A;  2BBG A;  1FWL A;  4O5G A;  2UXC I;  4WUC A;  4NBQ A;  1NHJ A;  4M9V C;  2YU8 A;  5A2Q Q;  2KOU A;  1XNQ E;  5JEA A;  3F6H A;  1OYP A;  1EH6 A;  3LML A;  2ENC A;  2JOX A;  4O24 A;  2IES A;  4QNK A;  4JV5 I;  3HJC A;  1FKA E;  2YTJ A;  4LF4 E;  1H7S A;  1A1F A;  1Z0G A;  4RPF A;  2J65 A;  3CDJ A;  2YTG A;  2XEX A;  3K85 A;  5GMD A;  2Q2E B;  2R76 A;  2RTX A;  1R6M A;  4X64 E;  4DPY A;  2IOQ A;  3HTX A;  4DV3 I;  3FIG A;  5K36 A;  2K4V A;  2R42 A;  2Q8U A;  4YY3 E;  4Q28 A;  4GKJ E;  2BM0 A;  2RPC A;  2EN3 A;  2V85 A;  4IZK A;  4JI1 E;  4FWD A;  4DV5 I;  5KL6 A;  1IBL I;  3C4T A;  4LFB I;  2EOO A;  2UU9 E;  2CSH A;  1E3H A;  2HK3 A;  1RQ0 A;  2VF1 A;  3T1H E;  1XXE A;  2ZIT A;  3M7N G;  4IFD B;  2EMC A;  4F6M A;  2ODR D;  2EZ6 A;  1N36 I;  4JG4 A;  1MG7 A;  1BBG A;  2A2D A;  2EM5 A;  2EPA A;  2L3J A;  2JE6 A;  2B7T A;  1Y4S A;  4JI7 E;  1USV A;  2EPL X;  2VE7 C;  2EMB A;  2EPK X;  2WBU A;  1ELO A;  4X64 I;  2C39 A;  2EOZ A;  2EMW A;  4DV0 E;  5IT9 C;  2V83 A;  1VIS A;  5T6J A;  1NHH A;  2YRK A;  4DMI A;  1A1J A;  4YY3 I;  3M85 G;  4GKJ I;  2EPN A;  1QNT A;  2NAB A;  1UIL A;  5A6B A;  1XMQ E;  2M4I A;  4BCA A;  2JP9 A;  4M2Z A;  1P42 A;  1UDQ A;  3WU4 A;  3WU6 A;  5FLX Q;  4JYA E;  2YZT A;  2BV3 A;  2UU9 I;  4BC7 A;  3LPS A;  1IBM E;  5DNL A;  3T1H I;  3ADI A;  2BR2 B;  2ODR C;  1YUJ A;  2LRS A;  2UXD E;  1YFH A;  4DV1 E;  1Y60 A;  2J7K A;  2WP8 B;  4DUZ E;  4M30 A;  3THO B;  1VI7 A;  2LCE A;  2V86 A;  1YYW A;  4JI7 I;  4L8N A;  3AUZ A;  2O1T A;  3CWV A;  1Z1B A;  3VYX A;  2EMZ A;  4LTY A;  2ZM6 E;  1X6E A;  3TQM A;  4LF7 E;  4DR7 E;  1JK2 A;  1OJ4 A;  1ZM3 A;  2EFG A;  3Q6N A;  2UUC I;  2LE2 A;  2GLI A;  4GZN C;  4LF8 E;  2N8X A;  1DQ3 A;  4MQY A;  2ELY A;  3L7Z B;  4X66 E;  4DR1 E;  3LTO A;  2E5L E;  1PVG A;  1Z5C A;  1ZXN A;  2LJU A;  4JYA I;  2J7J A;  4GKK E;  2V8Q B;  2RSI A;  2PRT A;  1ZAA C;  1E3P A;  4YHH E;  1PIE A;  2EL5 A;  3JAM Q;  1H74 A;  3ADG A;  2VES A;  3BGH A;  3DJW A;  1AAY A;  3ADL A;  4DV2 E;  5AAS A;  1QZR A;  2HKJ A;  4DPX A;  1RRE A;  1HNX E;  1Z59 A;  2HFU A;  5ELW A;  4UT4 A;  2UXD I;  3P1X A;  1UDS A;  5LMU E;  2DSY A;  1A1I A;  5A6J A;  4DR6 E;  2DEJ A;  2ZM6 I;  5CFF E;  4EMD A;  4LF7 I;  2MC5 A;  2EMK A;  1PDA A;  4HTG A;  2KHX A;  2EMY A;  4LF8 I;  4AM3 A;  3J80 C;  2EMF A;  4HY1 A;  1BB8 A;  4X66 I;  4JI4 E;  4DR1 I;  2E5L I;  2EMH A;  2EWL A;  2GO3 A;  4HYM A;  5GME A;  4AQY I;  1L4S A;  2EM8 A;  1B62 A;  4GKK I;  3JU0 A;  1HNZ E;  1A1K A;  3PS2 A;  4YHH I;  2L92 A;  2N3G A;  2EM9 A;  2BR2 A;  2YT4 A;  4PU9 A;  4XTJ A;  5EKW A;  4F6N A;  3V2U C;  4DV2 I;  4DV6 I;  1YH8 A;  2WP8 A;  1MGT A;  1NZ0 A;  3HQ1 A;  4R2Q A;  3ADJ A;  4I8O A;  3VHT B;  4B3S E;  4WUD A;  3IWB A;  1EA6 A;  4BC9 A;  2BM1 A;  4AID A;  3QG5 C;  3HPZ A;  4HAC A;  4U3B A;  5KL3 A;  1YSA C;  2PO0 B;  3QT6 A;  4OO1 E;  2X36 A;  2O3Z A;  2RSM A;  5BR8 I;  2UXB E;  3L7Z A;  4LCF A;  4JI4 I;  5F3W A;  1N33 E;  1FNM A;  4WXD A;  2LJH A;  2YRM A;  2ENH A;  3ZZU A;  2CGE A;  2Z5B B;  2C39 B;  3OML A;  4FK5 C;  4DV3 E;  2M7Q A;  4OO1 D;  1WJP A;  3MHH C;  1LLM C;  4MYU A;  2BA0 D;  2YTN A;  3C6M A;  2B9D A;  5ADZ A;  1RC7 A;  1IBL E;  2EM4 A;  2EOY A;  2YSO A;  4PRX A;  4B3S I;  2NN6 F;  1X3C A;  1S16 A;  3PYE A;  2HHH E;  1BBO A;  2RS6 A;  4QNJ A;  5DNX A;  2IOP A;  1UDO A;  5C0X F;  2L2M A;  1FI4 A;  2BA1 G;  1N36 E;  2EPZ A;  3C4B A;  4B3T E;  1XNR E;  5DNY A;  4FW3 A;  5EL9 A;  2EN7 A;  2UXB I;  2LTR A;  2VQE E;  2V2Z A;  2A25 A;  1KVK A;  1N33 I;  5AE3 A;  2GQ0 A;  3ZKB A;  4DU8 A;  1ZBT A;  1ZU1 A;  4MU1 A;  2B3T B;  4LF5 E;  2EOQ A;  4IS9 A;  4MU3 A;  4JI8 I;  4OO1 C;  5IXM B;  2O1V A;  1PJQ A;  1Y6Z A;  5IV8 B;  2LVH A;  2EPU A;  3HXL A;  3J81 C;  2CPN A;  4MLV A;  2DB2 A;  5KL7 A;  2VRD A;  2R1F A;  1P47 A;  1IQS A;  4JI3 I;  4BA1 B;  1DI2 A;  4ZYG A;  3K1J A;  2E1R A;  4K0K E;  3B4T A;  3D4J A;  2HHH I;  4OO1 B;  2G7H A;  3VYY A;  2PO0 A;  4X9J A;  2EOM A;  2EQ3 A;  1R6L A;  2JWO A;  1UHZ A;  4IS1 C;  2NUE A;  1S4E A;  4B3T I;  1XNR I;  1X48 A;  1I94 E;  3Q1Q A;  2FGG A;  1Z0W A;  1T39 A;  1F2I G;  3QT8 A;  5C0X E;  2VQE I;  3KZY A;  2DGC A;  3CDI A;  1NCS A;  4F2J C;  4IZJ A;  1UBD C;  2EP3 A;  3MSW A;  1Z0T A;  3GON A;  1QU6 A;  4DU7 A;  2HKE A;  2DIX A;  3ZM7 A;  1YYO A;  1ZXM A;  2Z5B A;  4LF5 I;  4F9A B;  5A6A A;  2UUC E;  3EQ1 A;  4R8O A;  4R2A A;  2IER A;  4R2D A;  2MKN A;  2VQF E;  2PNM A;  4Z7Y A;  2EOJ A;  1KIJ A;  2EQ0 A;  3HKM A;  5C0X D;  3PS1 A;  5K36 F;  2I13 A;  1U2R A;  2O1W A;  4P78 A;  2YU5 A;  2FTX B;  4K0K I;  4DR3 I;  4NXM I;  3UHM A;  1RHY A;  4JI6 E;  3THN A;  5A6K A;  1GZ6 A;  2NUF A;  1G2F C;  3IWC A;  1I94 I;  1TF3 A;  1YUI A;  4O4K A;  4FWH A;  2LMZ A;  1XMO E;  4MYT A;  4HAC B;  3HUL A;  5A2Q C;  3B78 A;  3P06 A;  2V34 A;  2NPF A;  4Z7C A;  4B3M I;  5TSE A;  5A69 A;  3BBG A;  2NN6 C;  2VQF I;  4LFC I;  4DPW A;  5C0X C;  2DLK A;  2EPO A;  2V8P A;  1X47 A;  2YTP A;  2PO1 B;  4AQY E;  1HNW E;  1A1H A;  4BA1 A;  3J7A G;  2YWQ A;  2HFS A;  2JT2 A;  3PYG A;  4M1K A;  4OO1 A;  4X8W A;  2L33 A;  4JI6 I;  4F9C B;  3ZOQ B;  4DV6 E;  2BB8 A;  5C0X B;  4DR2 E;  1IBK E;  2MDR A;  2F8B A;  2MKD A;  1T4N A;  2V2Q A;  2E72 A;  4TUG A;  3GME A;  4IZJ D;  5KL2 A;  4ZYE A;  1XMO I;  2EN8 A;  2EMI A;  4WSG A;  1H72 C;  2CVE A;  1A1G A;  3DF6 A;  1OYR A;  1N34 I;  3ECR A;  5BR8 E;  3JTZ A;  2EE8 A;  4BA2 A;  4ISA A;  1A6F A;  2UUB I;  2EMX A;  1PJS A;  2E1M A;  1TF6 A;  2LV2 A;  1HNW I;  4WSP A;  2WNR A;  3OTO I;  2JR1 A;  4R2S A;  4LOM A;  4WFT A;  4RH8 A;  4LF6 E;  1OYS A;  4WYQ B;  1Z5B A;  2V87 A;  2DRP A;  2O1U A;  5FLX C;  4FW6 A;  5FWK A;  4LF9 E;  1X6H A;  4DR2 I;  1IBK I;  2CTD A;  4DPT A;  4N3O A;  4IFD F;  1N3G A;  3EPK A;  4USM A; 
#chains in the Genus database with same CATH homology
 3H4L A;  1ZM9 A;  5LL6 R;  3V5R A;  4LU9 A;  2UUA E;  2A2C A;  2LJP A;  1Z0E A;  1HK7 A;  2WZO A;  4DKK A;  4IZJ B;  2AJ4 A;  1Z0C A;  1N0U A;  4KQV A;  3B82 A;  2LUP B;  1HR0 I;  4I3H A;  4JI8 E;  2L2K B;  3B8H A;  4LF6 I;  2RS7 A;  1T4L B;  2PNL A;  3T1Y E;  5AE2 A;  4LF9 I;  2F4V I;  2VF3 A;  3H09 A;  4J8Z A;  3Q6M A;  4R1F A;  4JI3 E;  3JAM C;  4DR5 E;  1KTV A;  1FJG I;  1H73 A;  2M1S A;  2UUA I;  5IT9 Q;  4USK A;  4DV7 E;  1RR9 A;  1SR9 A;  4DUY I;  2L6M A;  3HPS A;  3LNU A;  2JOB A;  1GQE A;  4BBY A;  3T1Y I;  4TUI A;  1H7U A;  1ZM4 A;  4BS9 A;  2KON A;  2OI2 A;  4DR5 I;  3AV0 A;  4DR3 E;  4NXM E;  1PKP A;  4PRV A;  4DV7 I;  4JI2 E;  1Z0B A;  4JI5 E;  2V88 A;  3K17 A;  2IHR 1;  4KHP E;  4P52 A;  4P7A A;  1XHK A;  4B3M E;  2L3C A;  4LFC E;  2V89 A;  1YZ9 A;  1Z0V A;  4F54 A;  4HXZ A;  4UTG A;  1XNQ I;  5L3J A;  4FN5 A;  1N32 E;  3QT7 A;  4WUD A;  3PYF A;  1BKN A;  4DPU A;  4JI2 I;  4LF4 I;  3J80 Q;  4JI0 E;  1K47 A;  4JI5 I;  4L5N C;  4KHP I;  1X49 A;  4WPY A;  3J7A M;  4DV4 E;  1N34 E;  2JVA A;  1Z5A A;  4JI1 I;  3VK6 A;  4P7D A;  2UUB E;  1MX0 A;  2Z5C A;  2L2N A;  3RMP A;  2HK2 A;  4BMJ A;  3OTO E;  2DMY A;  2H36 X;  1N0V C;  1N32 I;  3IWD A;  2WW4 A;  4DR4 E;  1UEK A;  4JI0 I;  4ED4 A;  1KKH A;  2FV4 B;  2N3H A;  4OX9 E;  4LFA E;  1DAR A;  1NHI A;  4DV0 I;  4NXN E;  4DV4 I;  2X7I A;  1XMQ I;  1WUU A;  1MU5 A;  1B63 A;  4URL A;  2V2V A;  3J7Y p;  1FWK A;  4DXL A;  1WHQ A;  2LBS B;  1IBM I;  1J26 A;  1HR0 E;  4X65 E;  4GEQ B;  1J5E E;  1EKZ A;  5IWA E;  4DV1 I;  2F4V E;  2NA2 A;  4M0V A;  4DUZ I;  4DR4 I;  1T4O A;  2GS8 A;  2R3V A;  2LTS A;  4FW9 A;  1FJG E;  4OX9 I;  4LFA I;  1YYK A;  4DR7 I;  4NXN I;  3KWR A;  1Y4U A;  4X62 E;  4R03 A;  1ZM2 A;  4WUB A;  2MC6 A;  3J81 Q;  2CZ9 A;  4F9B B;  2JY9 A;  1WHN A;  4DUY E;  2Z5E A;  2L8T A;  3M6A A;  2ZBK B;  1O0W A;  4X65 I;  1J5E I;  1ZBQ A;  4B3R E;  1HNX I;  4OOG C;  5LMN E;  4IZK B;  2LUQ A;  5IWA I;  2NUG A;  4KZS A;  5LMU I;  3LLH A;  3PRY A;  1EI1 A;  4DR6 I;  3WU5 A;  3ZKD A;  2UXC E;  3F0N A;  3F6G A;  4JV5 E;  4X62 I;  1STU A;  3ZZT A;  1HNZ I;  2CG9 A;  3ZZ0 A;  2DEI A;  4FWG A;  4B3R I;  4ZVI A;  5LMN I;  3K6Q A;  3QT5 A;  2B7V A;  4DV5 E;  3WU3 A;  2Z5C B;  4LFB E;  5AE1 A;  1WXR A;  3PYD A;  1D6T A;  1USU A;  1FWL A;  2UXC I;  4WUC A;  1NHJ A;  5A2Q Q;  2KOU A;  1XNQ E;  3F6H A;  3LML A;  2JOX A;  4JV5 I;  3HJC A;  1FKA E;  4LF4 E;  1H7S A;  1Z0G A;  4RPF A;  2XEX A;  3K85 A;  5GMD A;  2Q2E B;  2RTX A;  4X64 E;  4DPY A;  2IOQ A;  3HTX A;  4DV3 I;  3FIG A;  2K4V A;  2R42 A;  4YY3 E;  4Q28 A;  4GKJ E;  2BM0 A;  2V85 A;  4IZK A;  4JI1 E;  4FWD A;  4DV5 I;  1IBL I;  3C4T A;  4LFB I;  2UU9 E;  2HK3 A;  1RQ0 A;  2VF1 A;  3T1H E;  2ZIT A;  2EZ6 A;  2ODR D;  1N36 I;  4JG4 A;  1MG7 A;  2A2D A;  2L3J A;  2B7T A;  1Y4S A;  4JI7 E;  1USV A;  2VE7 C;  1ELO A;  4X64 I;  5IT9 C;  4DV0 E;  1VIS A;  2V83 A;  5T6J A;  1NHH A;  4DMI A;  4YY3 I;  4GKJ I;  4M2Z A;  1XMQ E;  1UIL A;  2M4I A;  4BCA A;  5FLX Q;  3WU4 A;  3WU6 A;  4JYA E;  2YZT A;  2BV3 A;  2UU9 I;  4BC7 A;  3LPS A;  1IBM E;  3T1H I;  3ADI A;  2ODR C;  2LRS A;  2UXD E;  4DV1 E;  2J7K A;  4DUZ E;  4M30 A;  2V86 A;  1YYW A;  4JI7 I;  4L8N A;  3AUZ A;  2O1T A;  3CWV A;  3VYX A;  4LTY A;  2ZM6 E;  1OJ4 A;  4LF7 E;  1ZM3 A;  3Q6N A;  4DR7 E;  2EFG A;  2UUC I;  2LE2 A;  4LF8 E;  1DQ3 A;  4X66 E;  4DR1 E;  3LTO A;  2E5L E;  1PVG A;  1Z5C A;  1ZXN A;  4JYA I;  4GKK E;  2V8Q B;  3JAM Q;  4YHH E;  1PIE A;  1H74 A;  3ADG A;  3ADL A;  3DJW A;  4DV2 E;  5AAS A;  1QZR A;  2HKJ A;  4DPX A;  1RRE A;  1HNX E;  1Z59 A;  2HFU A;  4UT4 A;  2UXD I;  3P1X A;  5LMU E;  2DSY A;  4DR6 E;  2DEJ A;  2ZM6 I;  5CFF E;  4EMD A;  4LF7 I;  2MC5 A;  2KHX A;  4LF8 I;  3J80 C;  4HY1 A;  4X66 I;  4JI4 E;  4DR1 I;  2E5L I;  2EWL A;  4HYM A;  5GME A;  4AQY I;  1B62 A;  4GKK I;  3JU0 A;  1HNZ E;  4YHH I;  2L92 A;  2N3G A;  4PU9 A;  2YT4 A;  4XTJ A;  3V2U C;  4DV2 I;  4DV6 I;  1NZ0 A;  3HQ1 A;  3ADJ A;  4I8O A;  4B3S E;  3IWB A;  1EA6 A;  4BC9 A;  2BM1 A;  3HPZ A;  4HAC A;  3QT6 A;  2X36 A;  2RSM A;  5BR8 I;  2UXB E;  4JI4 I;  5F3W A;  1N33 E;  1FNM A;  2LJH A;  3ZZU A;  2CGE A;  2Z5B B;  3OML A;  4DV3 E;  2M7Q A;  4MYU A;  5ADZ A;  2B9D A;  1RC7 A;  1IBL E;  4PRX A;  4B3S I;  1S16 A;  3PYE A;  2HHH E;  2RS6 A;  2IOP A;  2L2M A;  1FI4 A;  1N36 E;  3C4B A;  4B3T E;  1XNR E;  5DNY A;  2UXB I;  2LTR A;  2VQE E;  2V2Z A;  1KVK A;  1N33 I;  5AE3 A;  2GQ0 A;  3ZKB A;  4DU8 A;  1ZBT A;  2B3T B;  4LF5 E;  4JI8 I;  2O1V A;  1Y6Z A;  3HXL A;  3J81 C;  2CPN A;  2DB2 A;  4JI3 I;  1DI2 A;  3K1J A;  2E1R A;  4K0K E;  3D4J A;  2HHH I;  2G7H A;  3VYY A;  2JWO A;  1UHZ A;  2NUE A;  1S4E A;  4B3T I;  1XNR I;  3Q1Q A;  1X48 A;  1I94 E;  2FGG A;  1Z0W A;  3QT8 A;  2VQE I;  4IZJ A;  3MSW A;  1Z0T A;  3GON A;  1QU6 A;  4DU7 A;  2HKE A;  2DIX A;  3ZM7 A;  1YYO A;  1ZXM A;  2Z5B A;  4LF5 I;  4F9A B;  2UUC E;  4R8O A;  2PNM A;  2VQF E;  4Z7Y A;  1KIJ A;  1U2R A;  2O1W A;  4P78 A;  2FTX B;  4K0K I;  4DR3 I;  4NXM I;  4JI6 E;  1GZ6 A;  2NUF A;  3IWC A;  1I94 I;  4FWH A;  2LMZ A;  1XMO E;  4MYT A;  4HAC B;  3HUL A;  5A2Q C;  3B78 A;  3P06 A;  2V34 A;  2NPF A;  4Z7C A;  4B3M I;  2VQF I;  4LFC I;  4DPW A;  2V8P A;  1X47 A;  4AQY E;  1HNW E;  3J7A G;  2HFS A;  3PYG A;  4M1K A;  4X8W A;  2L33 A;  4JI6 I;  4F9C B;  3ZOQ B;  4DV6 E;  4DR2 E;  1IBK E;  2MDR A;  2F8B A;  1T4N A;  2V2Q A;  4TUG A;  4IZJ D;  1XMO I;  1H72 C;  3DF6 A;  1N34 I;  5BR8 E;  3JTZ A;  1A6F A;  2UUB I;  2E1M A;  1HNW I;  4WSP A;  3OTO I;  2JR1 A;  4WFT A;  4LF6 E;  4WYQ B;  1Z5B A;  2V87 A;  2O1U A;  5FLX C;  5FWK A;  4LF9 E;  4DR2 I;  1IBK I;  4DPT A;  4N3O A;  4USM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...