1J5EE

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1j5eE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1j5eE02
3ZKBA 2LUPB 4DXLA 4HACA 2L3CA 4X66E 2UXBI 1FI4A 2A2CA 4JYAE 4KQVA 4UTGA 4PU9A 1N34E 2V2ZA 3OTOE 4FWDA 4DV3I 2DMYA 2F4VE 4B3SE 1KKHA 1ZXMA 4DR3E 1FJGI 5LMUE 4FN5A 2DIXA 2L2MA 1NHIA 1KTVA 5GMEA 2DEIA 1HNXI 2L33A 4JI4I 1ELOA 1H74A 3J7Yp 2UUCI 4LF6E 2J7KA 1MU5A 4WUCA 1WHQA 1HNWI 4P7AA 3JAMQ 3JAMC 1N33I 1ZBTA 3QT8A 5A2QQ 3K1JA 5A2QC 4DPTA 3QT7A 2E5LI 2GS8A 4NXME 1IBKI 4B3RI 1GQEA 1B62A 2V2VA 4DV7E 1U2RA 4M2ZA 1S16A 4DPWA 4YY3I 4RPFA 2R42A 2HFUA 2N3GA 4DUYI 1QZRA 1B63A 4K0KI 1FWLA 1XNRE 2UXBE 3C4BA 1ZM4A 4B3MI 1H7UA 1ZM2A 4DUZI 5LL6R 2Q2EB 2ZITA 4X65I 1H7SA 1FJGE 4NXNI 2LRSA 3B8HA 1N32I 3V5RA 1PVGA 4WUBA 3ZKDA 4DPXA 1Z0WA 5IWAI 2NUGA 1HNXE 4JI4E 2HFSA 4KHPE 4GKJE 2UUCE 3ZM7A 3WU3A 2L2KB 1H72C 4X8WA 1XHKA 2RSMA 1T4OA 2UU9I 2E5LE 3ADLA 4LF5I 1KVKA 2JY9A 2UUBE 1IBKE 3WU4A 4B3RE 1XMQI 4JI6E 1T4NA 2BV3A 4DR5E 3PYGA 4USKA 2HHHI 1J26A 4YY3E 3ADJA 4I3HA 4DUYE 2L3JA 2EZ6A 1KIJA 5BR8I 2UXDI 4EMDA 4DV2I 4B3ME 3ZZUA 1YYOA 4DUZE 1PIEA 4M30A 2UXCI 5FLXQ 4X65E 2WW4A 4NXNE 1YZ9A 3ADGA 2XEXA 1I94I 1N32E 4LF7I 2HKJA 1FKAE 1PKPA 1Z5AA 1ZXNA 4LF8E 5IWAE 2BM1A 1WHNA 1UHZA 1XMOI 3D4JA 4JG4A 4DR4I 4JI2I 2RS6A 1HR0I 3LPSA 3CWVA 5LMNI 4GKKI 1X48A 3V2UC 4LFCI 4YHHI 4JI3I 4PRXA 2X36A 1Z0TA 4LF4I 2HHHE 1YYKA 4DV6I 3J81Q 1Z5CA 3ZZ0A 2UUAI 2LTRA 3J81C 2CZ9A 5BR8E 1Z0BA 4LF9I 4DR7I 2LJHA 2UXDE 4ED4A 1EKZA 4DV2E 1IBLI 4JI1I 1NZ0A 1D6TA 3LTOA 2UXCE 4DV3E 4HYMA 4MYTA 4LF7E 2NUEA 4OX9I 2B7TA 4DV5I 2V34A 1HNZI 1UILA 4FWHA 1XMOE 1X47A 4USMA 1NHJA 3M6AA 4X66I 4DR4E 4JI2E 1HNWE 1HR0E 1QU6A 1N34I 1N33E 5LMNE 4DR6I 2LUQA 3PYEA 4GKKE 2RS7A 4DR3I 4Z7YA 4DV4I 4JI3E 4YHHE 3PYDA 1EA6A 2LTSA 5LMUI 2A2DA 3HULA 1UEKA 2VQFI 4DV0I 4DV6E 4DR1I 5IT9Q 4Z7CA 5IT9C 2UUAE 4JV5I 4LF9E 4DR7E 4DU8A 1FNMA 1DI2A 2KHXA 4JI0I 2B3TB 4OOGC 4K0KE 1IBLE 4JI1E 4LFAI 1VISA 2HKEA 2V2QA 4JI8I 1K47A 1WUUA 2LJPA 4MYUA 4B3TI 4FW9A 5L3JA 1J5EI 2CPNA 4OX9E 5FLXC 1RREA 2X7IA 2OI2A 4DV5E 1Z0CA 1Z5BA 1HNZE 3B78A 4HXZA 4WFTA 1OJ4A 3H4LA 1XNRI 1RQ0A 2YT4A 3ADIA 4JI7I 3GONA 3QT5A 1BKNA 4DR6E 4HY1A 1ZM9A 3PYFA 2HK3A 3J7AG 4P52A 4DV4E 4LFBI 2ZM6I 2UU9E 3HTXA 4LF5E 4AQYI 4JI5I 3QT6A 1XMQE 1XNQI 2RTXA 2VQFE 4DV0E 2VQEI 4DR1E 4KHPI 2L2NA 1N36I 4GKJI 4PRVA 1N0UA 2BM0A 4JV5E 2NUFA 4JI0E 1Z0VA 3LLHA 1EI1A 4X64I 4LFAE 1A6FA 4JI8E 4DKKA 4DV1I 3F0NA 2NPFA 4XTJA 4B3TE 3T1HI 2VF3A 4DPYA 2UUBI 3J80Q 3T1YI 2IHR1 4FWGA 4JI6I 3J80C 3VYXA 3J7AM 1J5EE 1RR9A 3LNUA 4DR5I 1I94E 2B7VA 1RC7A 1ZM3A 1O0WA 3WU6A 4X62I 4DR2I 1IBMI 2AJ4A 3P1XA 2NA2A 3VYYA 3K17A 1Z59A 4WUDA 2N3HA 4JI7E 1Z0GA 4DPUA 4UT4A 1X49A 4JYAI 4HACB 3OTOI 4LFBE 2EFGA 2ZM6E 2F4VI 4B3SI 2E1RA 1Z0EA 2V8PA 4JI5E 4AQYE 4URLA 4LFCE 4LF8I 1XNQE 3Q1QA 2VQEE 4LF4E 1N36E 2DEJA 2JVAA 1H73A 4R1FA 2R3VA 4ZVIA 1STUA 4LF6I 2MDRA 1FWKA 1N0VC 3ZZTA 4X64E 4DV1E 2DB2A 5CFFE 4WYQB 1YYWA 3T1HE 3B82A 3C4TA 3T1YE 1T4LB 5GMDA 2ZBKB 4DU7A 3WU5A 4NXMI 2LBSB 1NHHA 1DARA 1MG7A 1MX0A 4DV7I 4X62E 4DR2E 4M1KA 1IBME 1S4EA 2HK2A
chains in the Genus database with same CATH superfamily
2WP8B 2HJJA 4F9CB 2O1UA 3GCMA 2KOUA 2LUPB 3ZKBA 4DXLA 2C37A 5K36D 1USUA 3ECRA 2BBGA 4HACA 5K36A 2L3CA 4X66E 3KWRA 2PO0B 4R2EA 2UXBI 1RHYA 2YTEA 4BCAA 1FI4A 1OYRA 2MDGA 2A2CA 3HKMA 4JYAE 3EPHA 4KQVA 4UTGA 1YSAC 4IZJD 2N8XA 1N34E 4PU9A 3M7ND 5ELWA 4O43A 2V2ZA 3OTOE 4FWDA 4DV3I 2YRMA 2DMYA 2F4VE 4OZEA 4B3SE 1KKHA 4R2RA 1ZXMA 4FW6A 2YZTA 4DR3E 2EQ3A 3VK6A 1MEYC 2PO2A 1FJGI 1E3PA 5LMUE 4FN5A 5C0XD 2DIXA 3MHHC 1ZBQA 2EPUA 5A6JA 2L2MA 2EN7A 1NHIA 2AE8A 4AIDA 1KTVA 5GMEA 2DEIA 3Q6NA 4R03A 1HNXI 2GPIA 1PJTA 2L33A 2WNRB 4ISAA 4MQYA 1ELOA 4JI4I 4IFDA 4IFDD 1H74A 3J7Yp 3EPKA 2BA0D 4IJDA 3KZZA 2UUCI 3HPSA 4LF6E 2J7KA 2EMIA 2V88A 2Z5CB 1MU5A 5K36E 4WUCA 3K6QA 1WHQA 2IOQA 4FW4A 1X5WA 4MU3A 4P7AA 4L5NC 3JAMQ 1HNWI 4BHCA 2PNZA 2MKNA 2NABA 3JAMC 3H1CA 1N33I 2EM6A 1ZBTA 2WZOA 3QT8A 5A2QQ 3BBGA 1ZAAC 3K1JA 2V8QB 1X3CA 5A2QC 1R6LA 4DPTA 1NEIA 5AC4A 3QT7A 2E5LI 1AH5A 5KL2A 2GS8A 4NXME 2EOFA 4ZYHA 4LCGA 1IBKI 4B3RI 1GQEA 1ZU1A 3IWDA 4GQUA 5TSEA 1B62A 2V2VA 1EH8A 2CT1A 2EMHA 2LCEA 4DV7E 1U2RA 4M2ZA 1S16A 4DPWA 4IFDE 3UHMA 2EP3A 4YY3I 2YTIA 2EN6A 2EPZA 4RPFA 4RH8A 2R42A 3HQ1A 3C6MA 2HFUA 2N3GA 4WXDA 4TUIA 1KJKA 4DUYI 2LO3A 1QZRA 3F6GA 1B63A 4K0KI 1FWLA 1XNRE 2UXBE 2LMZA 2EN3A 3C4BA 2JPAA 5DRQA 1TF3A 2EMGA 2JXPA 5AE3A 2EPMX 1ZM4A 1Y60A 4B3MI 3NZKA 1YHCA 2C37B 1H7UA 1ZM2A 4DUZI 4BC7A 5K36B 5LL6R 2Q2EB 3GLLA 2ZITA 4X65I 5K36C 1H7SA 2EMBA 1FJGE 3AV0A 4IZJB 4NXNI 2LRSA 3B8HA 1N32I 3V5RA 1PVGA 1XXEA 4WUBA 5DNYA 2WNRA 3ZKDA 4BA1A 1Z0WA 4P78A 4DPXA 5IWAI 2NUGA 2Z5CA 1HNXE 4JI4E 2HFSA 2EPCA 2EWLA 4KHPE 4GKJE 2UUCE 5C0XB 2EM8A 2PNMA 3ZOQB 1EH7A 3HJCA 2VRDA 3ZM7A 4R8OA 3U1KA 4J8ZA 4MU0A 2EE8A 4RHBB 3WU3A 2YU5A 2L2KB 4IFDB 1H72C 2CG9A 4X8WA 3LMLA 1XHKA 2RSMA 2PO1A 2EOZA 4IFDC 4R2AA 4F9BB 2YRKA 1T4OA 5KL7A 2EMKA 2L92A 2YWQA 2UU9I 2E5LE 2EMLA 3ADLA 4LF5I 1KVKA 2JY9A 2UUBE 2M1SA 4OO1D 1IBKE 3WU4A 4B3RE 4LU9A 1UN6B 2EM3A 4JI6E 1XMQI 1T4NA 4AIMA 2BV3A 5A6BA 4R2DA 2ENCA 4DR5E 3PYGA 4USKA 2O1WA 2DLQA 2HHHI 4N4RB 1J26A 3P3GA 4HTGA 4YY3E 2DGCA 2R76A 5A6AA 3ADJA 4I3HA 1P47A 2EOXA 2JE6B 4DUYE 2L3JA 3THNA 2YTJA 2EZ6A 1KIJA 5BR8I 2JOBA 2J65A 2EMXA 2UXDI 4EMDA 4BA2A 5DROA 4DV2I 1E3HA 4TUGA 2EN1A 2C38B 2EMYA 4B3ME 3ZZUA 2EPNA 1YYOA 4DUZE 3P3CA 1DGCA 2H36X 1PIEA 2M4IA 2EMAA 4M30A 4BC9A 4IZJA 2UXCI 2YSPA 5FLXQ 4X65E 2JEBB 2NN6D 2WW4A 2JWOA 1SFEA 5AE1A 4NXNE 3ADGA 1YZ9A 2GO4A 2XEXA 5JEAD 5JEAA 1I94I 1N32E 4LF7I 1Y5YA 2HKJA 2EMZA 1FKAE 2C39B 1PKPA 1Z5AA 1ZXNA 4O24A 4LF8E 5IWAE 3DD6A 2BM1A 2EPPA 4M0VA 5C0XA 3CDJA 1WHNA 1UHZA 2DMIA 4R2PA 3TQMA 5DNLA 4O4KA 1XMOI 3EPJA 2CVEA 2JYAA 3D4JA 4BA1B 2I9IA 2EPKX 2V87A 4JG4A 1BBGA 3DF6A 4DR4I 1X6EA 4JI2I 2R1FA 2RS6A 1HR0I 2EL4A 2FGGA 2EOEA 2F1DA 3QG5C 3LPSA 1T38A 3CWVA 5LMNI 5KL4A 1Z1BA 1N3GA 2BA1G 2O3ZA 4KZSA 2EOOA 4GKKI 4MLQA 1X48A 5JEAE 3V2UC 2ELZA 4LFCI 4YHHI 4JI3I 4J3DA 4PRXA 2X36A 2PO1B 1Z0TA 3PS3A 4LF4I 2HGHA 3BIDA 5C0XE 2Z5EA 2FTXB 2HHHE 1L4SA 2Z5BA 5A69A 1YYKA 4FW7A 4O5GA 1UBDC 4DV6I 2JE6A 1ZR9A 1JK1A 4ZYDA 4OO1B 2EOIA 2GO3A 3J81Q 1Z5CA 3ZZ0A 4MLVA 2LTRA 2UUAI 3J81C 4KWYA 2CZ9A 1Y4UA 5BR8E 4OO1C 1Z0BA 4LF9I 2EM7A 4WSGA 2LJHA 4DR7I 2UXDE 1R6MA 1YUJA 5AC5A 2C38A 4F54A 4ED4A 1G2DC 4AM3A 3UK3C 1EKZA 4DV2E 3PRYA 1WJPA 1GZ6A 1UDSA 4JI1I 1NZ0A 1IBLI 1D6TA 3LTOA 1X6FA 3KZYA 1RMDA 2ENHA 4IS9A 5DNXA 2JEBA 2EN4A 2V89A 2UXCE 4BA2B 4DV3E 4BHBA 2C39A 2LVHA 2MKDA 2BR2B 4HYMA 4LCFA 4MYTA 4LF7E 4BMJA 2NUEA 1Y4SA 4OX9I 2B7TA 2EM9A 1UDOA 1A1IA 4X9JA 1OYPA 2EOJA 4DV5I 2K7IA 2V34A 2NN6B 1HNZI 4NZVA 1UILA 5JEAB 2ENAA 2YTGA 4FWHA 1B69A 1QNTA 1XMOE 1X47A 2GQ0A 4USMA 1IMUA 5JEAC 1NHJA 3M6AA 4LCHA 1A1FA 2EORA 3PS2A 4X66I 3IWBA 4DR4E 4JI2E 2D9HA 2HC5A 1F2IG 1HR0E 1HNWE 4LPFA 5C0XC 1QU6A 1N34I 5K36F 4HEIA 1N33E 2LJUA 2LT7A 3H09A 4QNKA 5LMNE 4DR6I 1UDNA 2LUQA 3PYEA 2EOHA 3JU0A 4F9AB 4GKKE 2RS7A 4DR3I 4Z7YA 2EM0A 3L00A 2I13A 4JI3E 2V83A 4YHHE 2J7JA 4DV4I 3PYDA 3C6KA 2LTSA 1EA6A 5LMUI 3BF2A 2EPLX 5KL6A 1USVA 1BBOA 4QNJA 2VE7C 4L8NA 4MU4A 5EKWA 4FW5A 2A2DA 4OO1A 2EL6A 4R2QA 3HULA 4GZNC 1LLMC 1UEKA 5AASA 2VQFI 4DV0I 4DV6E 5C0XF 4DR1I 2M9AA 5IT9Q 4Z7CA 5IT9C 1A1HA 2EOSA 2UUAE 2IERA 4BS9A 1A1LA 1X6HA 1HK7A 1BB8A 4FK5C 4JV5I 4LF9E 2Z5BB 4DR7E 4DU8A 4IFDF 1FNMA 1DI2A 2KHXA 4JI0I 2B3TB 2IOPA 4OOGC 2KONA 4K0KE 1IBLE 4JI1E 2E1MA 4LFAI 1VISA 2HKEA 2V2QA 4JI8I 1K47A 1WUUA 2LJPA 2YTQA 2BB8A 1PDAA 4IS1C 2BR2A 4MYUA 4U3DA 4B3TI 3M85G 4FW9A 2EPRA 5IV8B 1WRJA 2DLKA 5L3JA 4OO1E 1J5EI 2CPNA 2JP9A 2EPAA 5DRPA 2JEAA 1PJQA 4OX9E 2WBTA 4DMIA 5FLXC 2PRTA 1RREA 2NN6A 2X7IA 3HXLA 4F6MA 4DV5E 2OI2A 4I8OA 1Z0CA 1Z5BA 2B9DA 1HNZE 3P76A 1YUIA 3M7NG 3OMLA 2EQ1A 3B78A 4WX9A 4LOMA 4HXZA 2JOXA 4WFTA 1OJ4A 4OKGA 2Q8UA 4LTYA 4Q35B 3H4LA 3IWCA 1XNRI 1DQ3A 1RQ0A 2YT4A 4WXCA 2PNLA 3CDIA 3ADIA 4JI7I 3GONA 1TN9A 3QT5A 1BKNA 2EN2A 4DR6E 3P3EA 4HY1A 1ZM9A 2YTFA 1OYSA 3PYFA 2G7HA 2HK3A 3J7AG 5F3WA 2YU8A 2K4VA 2YRHA 4DV4E 4P52A 2EMCA 4ZYGA 2ZM6I 4LFBI 2EOMA 4U3BA 2BA0G 3B4TA 2UU9E 3HTXA 2NN6E 4LF5E 4AQYI 2EMWA 4JI5I 3QT6A 3AUZA 1XMQE 1XNQI 3P06A 2RTXA 2VQFE 4DV0E 2VQEI 4DR1E 3KRNA 3Q6MA 2BA1D 4KHPI 2EN8A 2L2NA 4IZKA 3HPZA 3U1YA 1N36I 4PRVA 4GKJI 1N0UA 2ODRD 3DJWA 3F6HA 4Q28A 5AE2A 4JV5E 2BM0A 3MHSC 4NBQA 1P42A 2EM2A 1PJSA 2NUFA 4JI0E 2EOYA 1Z0VA 3LLHA 1EI1A 3EQ1A 2EM4A 2YTDA 2WCC3 4F2JC 2L8TA 4X64I 4LFAE 3BGHA 2EPOA 1A6FA 4JI8E 4DKKA 4DV1I 3F0NA 3L7ZB 4FW3A 2NPFA 2EOQA 2IESA 2FV4B 4XTJA 1WXRA 5KL3A 4B3TE 2VF3A 4DPYA 3T1HI 2EJ4A 2GHFA 3M99B 4M9VC 2UUBI 3J80Q 3T1YI 2O1VA 2IHR1 4FWGA 1G2FC 4WSPA 1NCSA 2JR1A 3J80C 1TF6A 1J5EE 3VYXA 4JI6I 3J7AM 1GTKA 1RR9A 3LNUA 2CSHA 3EPLA 4DR5I 1I94E 4OO1F 4ZYEA 2EM5A 5ADZA 2B7VA 1RC7A 2WP8A 1ZM3A 4R2CA 1A1GA 1JK2A 2RSIA 1O0WA 2LV2A 3WU6A 4X62I 2M7QA 4DR2I 5EL9A 2PO0A 1IBMI 2JEAB 3JTZA 2AJ4A 2EMFA 2NA2A 3P1XA 4BBYA 3VYYA 3K17A 2WBSA 3FIGA 1Z59A 2NN6C 4WUDA 2YTNA 2DSYA 3RMPA 4GEQB 2N3HA 4NHRA 4JI7E 2WBUA 1IQOA 1A1KA 1Z0GA 1YPNA 4DPUA 4N3OA 4UT4A 1X49A 1IQSA 2DRPA 4P7DA 4HACB 2YPNA 4JYAI 5A6KA 2RQLA 1YH8A 3OTOI 2RPCA 4LFBE 2EFGA 2EPXA 2ZM6E 2F4VI 4B3SI 2E1RA 2F8BA 1Z0EA 2V8PA 4JI5E 4AQYE 4URLA 4LFCE 4LF8I 1XNQE 2NN6F 3Q1QA 5JEAF 4R2SA 3PS1A 2VQEE 4LF4E 2PO2B 1MGTA 1AAYA 1N36E 5KL5A 2DEJA 5T6JA 2CGEA 2JVAA 1H73A 4R1FA 2R3VA 4ZVIA 1STUA 1Y6ZA 4LF6I 2MDRA 2V86A 1FWKA 1N0VC 3ZZTA 3L7ZA 2JT2A 4IZKB 4X64E 4WPYA 4DV1E 1A1JA 2MC5A 2GLIA 2DB2A 5CFFE 5LLQA 4WYQB 2PNZB 1YYWA 2ODRC 2E72A 2MC6A 2VF1A 3VHTB 3T1HE 3C4TA 2O1TA 3B82A 5DRRA 2LE2A 1EH6A 2EQ0A 2L6MA 3T1YE 5IXMB 1T4LB 5GMDA 4MDTA 2EL5A 3MSWA 1SR9A 2ZBKB 5A6BD 4DU7A 2A25A 1VI7A 1KYQA 3WU5A 5FWKA 4NXMI 2CTDA 2LBSB 1NHHA 1DARA 1UDQA 3THOB 2YTPA 2ELYA 2YTOA 4F6NA 2YSOA 1MG7A 1YFHA 1MX0A 2VESA 4DV7I 4X62E 4DR2E 2V85A 2ADRA 3GMEA 1IBME 3K85A 1T39A 4M1KA 4MU1A 3M85D 1S4EA 2HK2A
chains in the Genus database with same CATH topology
4F9CB 2O1UA 3ZKBA 2KOUA 2LUPB 4DXLA 1USUA 4HACA 2L3CA 4X66E 3KWRA 2UXBI 4BCAA 1FI4A 2A2CA 4JYAE 4KQVA 4UTGA 4IZJD 4PU9A 1N34E 2V2ZA 3OTOE 4FWDA 4DV3I 2DMYA 2F4VE 4B3SE 1KKHA 1ZXMA 2YZTA 4DR3E 3VK6A 1FJGI 5LMUE 4FN5A 2DIXA 1ZBQA 2L2MA 1NHIA 1KTVA 5GMEA 2DEIA 3Q6NA 4R03A 1HNXI 2L33A 4JI4I 1ELOA 1H74A 3J7Yp 2UUCI 3HPSA 4LF6E 2J7KA 2V88A 2Z5CB 1MU5A 4WUCA 3K6QA 1WHQA 2IOQA 1HNWI 4P7AA 3JAMQ 4L5NC 3JAMC 1N33I 1ZBTA 2WZOA 3QT8A 5A2QQ 3K1JA 2V8QB 5A2QC 4DPTA 3QT7A 2E5LI 2GS8A 4NXME 1IBKI 4B3RI 1GQEA 3IWDA 1B62A 2V2VA 4DV7E 1U2RA 4M2ZA 1S16A 4DPWA 4YY3I 4RPFA 2R42A 3HQ1A 2HFUA 2N3GA 4DUYI 4TUIA 1QZRA 3F6GA 1B63A 4K0KI 1FWLA 1XNRE 2UXBE 2LMZA 3C4BA 5AE3A 1ZM4A 4B3MI 1H7UA 1ZM2A 4DUZI 4BC7A 5LL6R 2Q2EB 2ZITA 4X65I 1H7SA 1FJGE 3AV0A 4IZJB 4NXNI 2LRSA 3B8HA 1N32I 3V5RA 1PVGA 4WUBA 5DNYA 3ZKDA 4DPXA 1Z0WA 4P78A 5IWAI 2NUGA 2Z5CA 1HNXE 4JI4E 2HFSA 2EWLA 4KHPE 4GKJE 2UUCE 2PNMA 3ZOQB 3HJCA 3ZM7A 4R8OA 4J8ZA 3WU3A 2L2KB 1H72C 2CG9A 4X8WA 3LMLA 1XHKA 2RSMA 4F9BB 1T4OA 2L92A 2UU9I 2E5LE 3ADLA 4LF5I 1KVKA 2JY9A 2UUBE 2M1SA 1IBKE 3WU4A 4B3RE 4LU9A 1XMQI 4JI6E 1T4NA 2BV3A 4DR5E 3PYGA 4USKA 2O1WA 2HHHI 1J26A 4YY3E 3ADJA 4I3HA 4DUYE 2L3JA 2EZ6A 1KIJA 5BR8I 2JOBA 2UXDI 4EMDA 4DV2I 4TUGA 4B3ME 3ZZUA 1YYOA 4DUZE 2H36X 1PIEA 2M4IA 4BC9A 4M30A 4IZJA 2UXCI 5FLXQ 4X65E 2WW4A 2JWOA 5AE1A 4NXNE 1YZ9A 3ADGA 2XEXA 1I94I 1N32E 4LF7I 2HKJA 1FKAE 1PKPA 1Z5AA 1ZXNA 4LF8E 5IWAE 2BM1A 4M0VA 1WHNA 1UHZA 1XMOI 3D4JA 2V87A 4JG4A 3DF6A 4DR4I 4JI2I 2RS6A 1HR0I 2FGGA 3LPSA 3CWVA 5LMNI 4KZSA 4GKKI 1X48A 3V2UC 4LFCI 4YHHI 4JI3I 4PRXA 2X36A 1Z0TA 4LF4I 2Z5EA 2FTXB 2HHHE 2Z5BA 1YYKA 4DV6I 3J81Q 1Z5CA 3ZZ0A 2UUAI 2LTRA 3J81C 2CZ9A 1Y4UA 5BR8E 1Z0BA 4LF9I 4DR7I 2LJHA 2UXDE 4ED4A 4F54A 1EKZA 4DV2E 3PRYA 1GZ6A 4JI1I 1IBLI 1NZ0A 1D6TA 3LTOA 2V89A 2UXCE 4DV3E 4HYMA 4MYTA 4LF7E 4BMJA 2NUEA 1Y4SA 4OX9I 2B7TA 4DV5I 2V34A 1HNZI 1UILA 4FWHA 1XMOE 1X47A 2GQ0A 4USMA 1NHJA 3M6AA 4X66I 3IWBA 4DR4E 4JI2E 1HNWE 1HR0E 1QU6A 1N34I 1N33E 3H09A 5LMNE 4DR6I 2LUQA 3PYEA 3JU0A 4GKKE 4F9AB 2RS7A 4DR3I 4Z7YA 4DV4I 4JI3E 2V83A 4YHHE 3PYDA 1EA6A 2LTSA 5LMUI 1USVA 2VE7C 4L8NA 2A2DA 3HULA 1UEKA 5AASA 2VQFI 4DV0I 4DV6E 4DR1I 5IT9Q 4Z7CA 5IT9C 2UUAE 4BS9A 1HK7A 4JV5I 4LF9E 2Z5BB 4DR7E 4DU8A 1FNMA 1DI2A 2KHXA 4JI0I 2B3TB 2IOPA 4OOGC 2KONA 4K0KE 1IBLE 4JI1E 2E1MA 4LFAI 1VISA 2HKEA 2V2QA 4JI8I 1K47A 1WUUA 2LJPA 4MYUA 4B3TI 4FW9A 5L3JA 1J5EI 2CPNA 4OX9E 4DMIA 5FLXC 1RREA 2X7IA 3HXLA 2OI2A 4DV5E 4I8OA 1Z0CA 1Z5BA 2B9DA 1HNZE 3OMLA 3B78A 4HXZA 2JOXA 4WFTA 1OJ4A 4LTYA 3H4LA 3IWCA 1XNRI 1DQ3A 1RQ0A 2YT4A 2PNLA 3ADIA 4JI7I 3GONA 3QT5A 1BKNA 4DR6E 4HY1A 1ZM9A 3PYFA 2G7HA 2HK3A 3J7AG 5F3WA 4P52A 2K4VA 4DV4E 4LFBI 2ZM6I 2UU9E 3HTXA 4LF5E 4AQYI 4JI5I 3QT6A 1XMQE 3AUZA 1XNQI 3P06A 2RTXA 2VQFE 4DV0E 2VQEI 4DR1E 3Q6MA 4KHPI 2L2NA 4IZKA 3HPZA 1N36I 4GKJI 4PRVA 1N0UA 2ODRD 3DJWA 3F6HA 4Q28A 5AE2A 4JV5E 2BM0A 2NUFA 4JI0E 1Z0VA 3LLHA 1EI1A 2L8TA 4X64I 4LFAE 1A6FA 4JI8E 4DKKA 4DV1I 3F0NA 2NPFA 2FV4B 4XTJA 1WXRA 4B3TE 3T1HI 2VF3A 4DPYA 2UUBI 3J80Q 3T1YI 2O1VA 2IHR1 4FWGA 4WSPA 4JI6I 2JR1A 3J80C 3VYXA 1J5EE 3J7AM 1RR9A 3LNUA 4DR5I 1I94E 5ADZA 2B7VA 1RC7A 1ZM3A 1O0WA 3WU6A 4X62I 2M7QA 4DR2I 1IBMI 3JTZA 2AJ4A 3P1XA 2NA2A 3VYYA 4BBYA 3K17A 3FIGA 1Z59A 4WUDA 2DSYA 3RMPA 4GEQB 2N3HA 4JI7E 1Z0GA 4DPUA 4N3OA 4UT4A 1X49A 4JYAI 4HACB 4P7DA 3OTOI 4LFBE 2EFGA 2ZM6E 2F4VI 4B3SI 2E1RA 2F8BA 1Z0EA 2V8PA 4JI5E 4AQYE 4URLA 4LFCE 4LF8I 1XNQE 3Q1QA 2VQEE 4LF4E 1N36E 2DEJA 5T6JA 2CGEA 2JVAA 1H73A 4R1FA 2R3VA 4ZVIA 1STUA 1Y6ZA 4LF6I 2MDRA 2V86A 1FWKA 1N0VC 3ZZTA 4IZKB 4X64E 4WPYA 4DV1E 2MC5A 2DB2A 5CFFE 4WYQB 1YYWA 2ODRC 2MC6A 2VF1A 3T1HE 2O1TA 3C4TA 3B82A 2LE2A 2L6MA 3T1YE 1T4LB 5GMDA 2ZBKB 3MSWA 1SR9A 4DU7A 3WU5A 4NXMI 5FWKA 2LBSB 1NHHA 1DARA 1MG7A 1MX0A 4DV7I 4X62E 4DR2E 2V85A 4M1KA 1IBME 3K85A 1S4EA 2HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZKB A;  2LUP B;  4DXL A;  4HAC A;  2L3C A;  4X66 E;  2UXB I;  1FI4 A;  2A2C A;  4JYA E;  4KQV A;  4UTG A;  4PU9 A;  1N34 E;  2V2Z A;  3OTO E;  4FWD A;  4DV3 I;  2DMY A;  2F4V E;  4B3S E;  1KKH A;  1ZXM A;  4DR3 E;  1FJG I;  5LMU E;  4FN5 A;  2DIX A;  2L2M A;  1NHI A;  1KTV A;  5GME A;  2DEI A;  1HNX I;  2L33 A;  4JI4 I;  1ELO A;  1H74 A;  3J7Y p;  2UUC I;  4LF6 E;  2J7K A;  1MU5 A;  4WUC A;  1WHQ A;  1HNW I;  4P7A A;  3JAM Q;  3JAM C;  1N33 I;  1ZBT A;  3QT8 A;  5A2Q Q;  3K1J A;  5A2Q C;  4DPT A;  3QT7 A;  2E5L I;  2GS8 A;  4NXM E;  1IBK I;  4B3R I;  1GQE A;  1B62 A;  2V2V A;  4DV7 E;  1U2R A;  4M2Z A;  1S16 A;  4DPW A;  4YY3 I;  4RPF A;  2R42 A;  2HFU A;  2N3G A;  4DUY I;  1QZR A;  1B63 A;  4K0K I;  1FWL A;  1XNR E;  2UXB E;  3C4B A;  1ZM4 A;  4B3M I;  1H7U A;  1ZM2 A;  4DUZ I;  5LL6 R;  2Q2E B;  2ZIT A;  4X65 I;  1H7S A;  1FJG E;  4NXN I;  2LRS A;  3B8H A;  1N32 I;  3V5R A;  1PVG A;  4WUB A;  3ZKD A;  4DPX A;  1Z0W A;  5IWA I;  2NUG A;  1HNX E;  4JI4 E;  2HFS A;  4KHP E;  4GKJ E;  2UUC E;  3ZM7 A;  3WU3 A;  2L2K B;  1H72 C;  4X8W A;  1XHK A;  2RSM A;  1T4O A;  2UU9 I;  2E5L E;  3ADL A;  4LF5 I;  1KVK A;  2JY9 A;  2UUB E;  1IBK E;  3WU4 A;  4B3R E;  1XMQ I;  4JI6 E;  1T4N A;  2BV3 A;  4DR5 E;  3PYG A;  4USK A;  2HHH I;  1J26 A;  4YY3 E;  3ADJ A;  4I3H A;  4DUY E;  2L3J A;  2EZ6 A;  1KIJ A;  5BR8 I;  2UXD I;  4EMD A;  4DV2 I;  4B3M E;  3ZZU A;  1YYO A;  4DUZ E;  1PIE A;  4M30 A;  2UXC I;  5FLX Q;  4X65 E;  2WW4 A;  4NXN E;  1YZ9 A;  3ADG A;  2XEX A;  1I94 I;  1N32 E;  4LF7 I;  2HKJ A;  1FKA E;  1PKP A;  1Z5A A;  1ZXN A;  4LF8 E;  5IWA E;  2BM1 A;  1WHN A;  1UHZ A;  1XMO I;  3D4J A;  4JG4 A;  4DR4 I;  4JI2 I;  2RS6 A;  1HR0 I;  3LPS A;  3CWV A;  5LMN I;  4GKK I;  1X48 A;  3V2U C;  4LFC I;  4YHH I;  4JI3 I;  4PRX A;  2X36 A;  1Z0T A;  4LF4 I;  2HHH E;  1YYK A;  4DV6 I;  3J81 Q;  1Z5C A;  3ZZ0 A;  2UUA I;  2LTR A;  3J81 C;  2CZ9 A;  5BR8 E;  1Z0B A;  4LF9 I;  4DR7 I;  2LJH A;  2UXD E;  4ED4 A;  1EKZ A;  4DV2 E;  1IBL I;  4JI1 I;  1NZ0 A;  1D6T A;  3LTO A;  2UXC E;  4DV3 E;  4HYM A;  4MYT A;  4LF7 E;  2NUE A;  4OX9 I;  2B7T A;  4DV5 I;  2V34 A;  1HNZ I;  1UIL A;  4FWH A;  1XMO E;  1X47 A;  4USM A;  1NHJ A;  3M6A A;  4X66 I;  4DR4 E;  4JI2 E;  1HNW E;  1HR0 E;  1QU6 A;  1N34 I;  1N33 E;  5LMN E;  4DR6 I;  2LUQ A;  3PYE A;  4GKK E;  2RS7 A;  4DR3 I;  4Z7Y A;  4DV4 I;  4JI3 E;  4YHH E;  3PYD A;  1EA6 A;  2LTS A;  5LMU I;  2A2D A;  3HUL A;  1UEK A;  2VQF I;  4DV0 I;  4DV6 E;  4DR1 I;  5IT9 Q;  4Z7C A;  5IT9 C;  2UUA E;  4JV5 I;  4LF9 E;  4DR7 E;  4DU8 A;  1FNM A;  1DI2 A;  2KHX A;  4JI0 I;  2B3T B;  4OOG C;  4K0K E;  1IBL E;  4JI1 E;  4LFA I;  1VIS A;  2HKE A;  2V2Q A;  4JI8 I;  1K47 A;  1WUU A;  2LJP A;  4MYU A;  4B3T I;  4FW9 A;  5L3J A;  1J5E I;  2CPN A;  4OX9 E;  5FLX C;  1RRE A;  2X7I A;  2OI2 A;  4DV5 E;  1Z0C A;  1Z5B A;  1HNZ E;  3B78 A;  4HXZ A;  4WFT A;  1OJ4 A;  3H4L A;  1XNR I;  1RQ0 A;  2YT4 A;  3ADI A;  4JI7 I;  3GON A;  3QT5 A;  1BKN A;  4DR6 E;  4HY1 A;  1ZM9 A;  3PYF A;  2HK3 A;  3J7A G;  4P52 A;  4DV4 E;  4LFB I;  2ZM6 I;  2UU9 E;  3HTX A;  4LF5 E;  4AQY I;  4JI5 I;  3QT6 A;  1XMQ E;  1XNQ I;  2RTX A;  2VQF E;  4DV0 E;  2VQE I;  4DR1 E;  4KHP I;  2L2N A;  1N36 I;  4GKJ I;  4PRV A;  1N0U A;  2BM0 A;  4JV5 E;  2NUF A;  4JI0 E;  1Z0V A;  3LLH A;  1EI1 A;  4X64 I;  4LFA E;  1A6F A;  4JI8 E;  4DKK A;  4DV1 I;  3F0N A;  2NPF A;  4XTJ A;  4B3T E;  3T1H I;  2VF3 A;  4DPY A;  2UUB I;  3J80 Q;  3T1Y I;  2IHR 1;  4FWG A;  4JI6 I;  3J80 C;  3VYX A;  3J7A M;  1J5E E;  1RR9 A;  3LNU A;  4DR5 I;  1I94 E;  2B7V A;  1RC7 A;  1ZM3 A;  1O0W A;  3WU6 A;  4X62 I;  4DR2 I;  1IBM I;  2AJ4 A;  3P1X A;  2NA2 A;  3VYY A;  3K17 A;  1Z59 A;  4WUD A;  2N3H A;  4JI7 E;  1Z0G A;  4DPU A;  4UT4 A;  1X49 A;  4JYA I;  4HAC B;  3OTO I;  4LFB E;  2EFG A;  2ZM6 E;  2F4V I;  4B3S I;  2E1R A;  1Z0E A;  2V8P A;  4JI5 E;  4AQY E;  4URL A;  4LFC E;  4LF8 I;  1XNQ E;  3Q1Q A;  2VQE E;  4LF4 E;  1N36 E;  2DEJ A;  2JVA A;  1H73 A;  4R1F A;  2R3V A;  4ZVI A;  1STU A;  4LF6 I;  2MDR A;  1FWK A;  1N0V C;  3ZZT A;  4X64 E;  4DV1 E;  2DB2 A;  5CFF E;  4WYQ B;  1YYW A;  3T1H E;  3B82 A;  3C4T A;  3T1Y E;  1T4L B;  5GMD A;  2ZBK B;  4DU7 A;  3WU5 A;  4NXM I;  2LBS B;  1NHH A;  1DAR A;  1MG7 A;  1MX0 A;  4DV7 I;  4X62 E;  4DR2 E;  4M1K A;  1IBM E;  1S4E A;  2HK2 A; 
#chains in the Genus database with same CATH topology
 2WP8 B;  2HJJ A;  4F9C B;  2O1U A;  3GCM A;  2KOU A;  2LUP B;  3ZKB A;  4DXL A;  2C37 A;  5K36 D;  1USU A;  3ECR A;  2BBG A;  4HAC A;  5K36 A;  2L3C A;  4X66 E;  3KWR A;  2PO0 B;  4R2E A;  2UXB I;  1RHY A;  2YTE A;  4BCA A;  1FI4 A;  1OYR A;  2MDG A;  2A2C A;  3HKM A;  4JYA E;  3EPH A;  4KQV A;  4UTG A;  1YSA C;  4IZJ D;  2N8X A;  1N34 E;  4PU9 A;  3M7N D;  5ELW A;  4O43 A;  2V2Z A;  3OTO E;  4FWD A;  4DV3 I;  2YRM A;  2DMY A;  2F4V E;  4OZE A;  4B3S E;  1KKH A;  4R2R A;  1ZXM A;  4FW6 A;  2YZT A;  4DR3 E;  2EQ3 A;  3VK6 A;  1MEY C;  2PO2 A;  1FJG I;  1E3P A;  5LMU E;  4FN5 A;  5C0X D;  2DIX A;  3MHH C;  1ZBQ A;  2EPU A;  5A6J A;  2L2M A;  2EN7 A;  1NHI A;  2AE8 A;  4AID A;  1KTV A;  5GME A;  2DEI A;  3Q6N A;  4R03 A;  1HNX I;  2GPI A;  1PJT A;  2L33 A;  2WNR B;  4ISA A;  4MQY A;  1ELO A;  4JI4 I;  4IFD A;  4IFD D;  1H74 A;  3J7Y p;  3EPK A;  2BA0 D;  4IJD A;  3KZZ A;  2UUC I;  3HPS A;  4LF6 E;  2J7K A;  2EMI A;  2V88 A;  2Z5C B;  1MU5 A;  5K36 E;  4WUC A;  3K6Q A;  1WHQ A;  2IOQ A;  4FW4 A;  1X5W A;  4MU3 A;  4P7A A;  4L5N C;  3JAM Q;  1HNW I;  4BHC A;  2PNZ A;  2MKN A;  2NAB A;  3JAM C;  3H1C A;  1N33 I;  2EM6 A;  1ZBT A;  2WZO A;  3QT8 A;  5A2Q Q;  3BBG A;  1ZAA C;  3K1J A;  2V8Q B;  1X3C A;  5A2Q C;  1R6L A;  4DPT A;  1NEI A;  5AC4 A;  3QT7 A;  2E5L I;  1AH5 A;  5KL2 A;  2GS8 A;  4NXM E;  2EOF A;  4ZYH A;  4LCG A;  1IBK I;  4B3R I;  1GQE A;  1ZU1 A;  3IWD A;  4GQU A;  5TSE A;  1B62 A;  2V2V A;  1EH8 A;  2CT1 A;  2EMH A;  2LCE A;  4DV7 E;  1U2R A;  4M2Z A;  1S16 A;  4DPW A;  4IFD E;  3UHM A;  2EP3 A;  4YY3 I;  2YTI A;  2EN6 A;  2EPZ A;  4RPF A;  4RH8 A;  2R42 A;  3HQ1 A;  3C6M A;  2HFU A;  2N3G A;  4WXD A;  4TUI A;  1KJK A;  4DUY I;  2LO3 A;  1QZR A;  3F6G A;  1B63 A;  4K0K I;  1FWL A;  1XNR E;  2UXB E;  2LMZ A;  2EN3 A;  3C4B A;  2JPA A;  5DRQ A;  1TF3 A;  2EMG A;  2JXP A;  5AE3 A;  2EPM X;  1ZM4 A;  1Y60 A;  4B3M I;  3NZK A;  1YHC A;  2C37 B;  1H7U A;  1ZM2 A;  4DUZ I;  4BC7 A;  5K36 B;  5LL6 R;  2Q2E B;  3GLL A;  2ZIT A;  4X65 I;  5K36 C;  1H7S A;  2EMB A;  1FJG E;  3AV0 A;  4IZJ B;  4NXN I;  2LRS A;  3B8H A;  1N32 I;  3V5R A;  1PVG A;  1XXE A;  4WUB A;  5DNY A;  2WNR A;  3ZKD A;  4BA1 A;  1Z0W A;  4P78 A;  4DPX A;  5IWA I;  2NUG A;  2Z5C A;  1HNX E;  4JI4 E;  2HFS A;  2EPC A;  2EWL A;  4KHP E;  4GKJ E;  2UUC E;  5C0X B;  2EM8 A;  2PNM A;  3ZOQ B;  1EH7 A;  3HJC A;  2VRD A;  3ZM7 A;  4R8O A;  3U1K A;  4J8Z A;  4MU0 A;  2EE8 A;  4RHB B;  3WU3 A;  2YU5 A;  2L2K B;  4IFD B;  1H72 C;  2CG9 A;  4X8W A;  3LML A;  1XHK A;  2RSM A;  2PO1 A;  2EOZ A;  4IFD C;  4R2A A;  4F9B B;  2YRK A;  1T4O A;  5KL7 A;  2EMK A;  2L92 A;  2YWQ A;  2UU9 I;  2E5L E;  2EML A;  3ADL A;  4LF5 I;  1KVK A;  2JY9 A;  2UUB E;  2M1S A;  4OO1 D;  1IBK E;  3WU4 A;  4B3R E;  4LU9 A;  1UN6 B;  2EM3 A;  4JI6 E;  1XMQ I;  1T4N A;  4AIM A;  2BV3 A;  5A6B A;  4R2D A;  2ENC A;  4DR5 E;  3PYG A;  4USK A;  2O1W A;  2DLQ A;  2HHH I;  4N4R B;  1J26 A;  3P3G A;  4HTG A;  4YY3 E;  2DGC A;  2R76 A;  5A6A A;  3ADJ A;  4I3H A;  1P47 A;  2EOX A;  2JE6 B;  4DUY E;  2L3J A;  3THN A;  2YTJ A;  2EZ6 A;  1KIJ A;  5BR8 I;  2JOB A;  2J65 A;  2EMX A;  2UXD I;  4EMD A;  4BA2 A;  5DRO A;  4DV2 I;  1E3H A;  4TUG A;  2EN1 A;  2C38 B;  2EMY A;  4B3M E;  3ZZU A;  2EPN A;  1YYO A;  4DUZ E;  3P3C A;  1DGC A;  2H36 X;  1PIE A;  2M4I A;  2EMA A;  4M30 A;  4BC9 A;  4IZJ A;  2UXC I;  2YSP A;  5FLX Q;  4X65 E;  2JEB B;  2NN6 D;  2WW4 A;  2JWO A;  1SFE A;  5AE1 A;  4NXN E;  3ADG A;  1YZ9 A;  2GO4 A;  2XEX A;  5JEA D;  5JEA A;  1I94 I;  1N32 E;  4LF7 I;  1Y5Y A;  2HKJ A;  2EMZ A;  1FKA E;  2C39 B;  1PKP A;  1Z5A A;  1ZXN A;  4O24 A;  4LF8 E;  5IWA E;  3DD6 A;  2BM1 A;  2EPP A;  4M0V A;  5C0X A;  3CDJ A;  1WHN A;  1UHZ A;  2DMI A;  4R2P A;  3TQM A;  5DNL A;  4O4K A;  1XMO I;  3EPJ A;  2CVE A;  2JYA A;  3D4J A;  4BA1 B;  2I9I A;  2EPK X;  2V87 A;  4JG4 A;  1BBG A;  3DF6 A;  4DR4 I;  1X6E A;  4JI2 I;  2R1F A;  2RS6 A;  1HR0 I;  2EL4 A;  2FGG A;  2EOE A;  2F1D A;  3QG5 C;  3LPS A;  1T38 A;  3CWV A;  5LMN I;  5KL4 A;  1Z1B A;  1N3G A;  2BA1 G;  2O3Z A;  4KZS A;  2EOO A;  4GKK I;  4MLQ A;  1X48 A;  5JEA E;  3V2U C;  2ELZ A;  4LFC I;  4YHH I;  4JI3 I;  4J3D A;  4PRX A;  2X36 A;  2PO1 B;  1Z0T A;  3PS3 A;  4LF4 I;  2HGH A;  3BID A;  5C0X E;  2Z5E A;  2FTX B;  2HHH E;  1L4S A;  2Z5B A;  5A69 A;  1YYK A;  4FW7 A;  4O5G A;  1UBD C;  4DV6 I;  2JE6 A;  1ZR9 A;  1JK1 A;  4ZYD A;  4OO1 B;  2EOI A;  2GO3 A;  3J81 Q;  1Z5C A;  3ZZ0 A;  4MLV A;  2LTR A;  2UUA I;  3J81 C;  4KWY A;  2CZ9 A;  1Y4U A;  5BR8 E;  4OO1 C;  1Z0B A;  4LF9 I;  2EM7 A;  4WSG A;  2LJH A;  4DR7 I;  2UXD E;  1R6M A;  1YUJ A;  5AC5 A;  2C38 A;  4F54 A;  4ED4 A;  1G2D C;  4AM3 A;  3UK3 C;  1EKZ A;  4DV2 E;  3PRY A;  1WJP A;  1GZ6 A;  1UDS A;  4JI1 I;  1NZ0 A;  1IBL I;  1D6T A;  3LTO A;  1X6F A;  3KZY A;  1RMD A;  2ENH A;  4IS9 A;  5DNX A;  2JEB A;  2EN4 A;  2V89 A;  2UXC E;  4BA2 B;  4DV3 E;  4BHB A;  2C39 A;  2LVH A;  2MKD A;  2BR2 B;  4HYM A;  4LCF A;  4MYT A;  4LF7 E;  4BMJ A;  2NUE A;  1Y4S A;  4OX9 I;  2B7T A;  2EM9 A;  1UDO A;  1A1I A;  4X9J A;  1OYP A;  2EOJ A;  4DV5 I;  2K7I A;  2V34 A;  2NN6 B;  1HNZ I;  4NZV A;  1UIL A;  5JEA B;  2ENA A;  2YTG A;  4FWH A;  1B69 A;  1QNT A;  1XMO E;  1X47 A;  2GQ0 A;  4USM A;  1IMU A;  5JEA C;  1NHJ A;  3M6A A;  4LCH A;  1A1F A;  2EOR A;  3PS2 A;  4X66 I;  3IWB A;  4DR4 E;  4JI2 E;  2D9H A;  2HC5 A;  1F2I G;  1HR0 E;  1HNW E;  4LPF A;  5C0X C;  1QU6 A;  1N34 I;  5K36 F;  4HEI A;  1N33 E;  2LJU A;  2LT7 A;  3H09 A;  4QNK A;  5LMN E;  4DR6 I;  1UDN A;  2LUQ A;  3PYE A;  2EOH A;  3JU0 A;  4F9A B;  4GKK E;  2RS7 A;  4DR3 I;  4Z7Y A;  2EM0 A;  3L00 A;  2I13 A;  4JI3 E;  2V83 A;  4YHH E;  2J7J A;  4DV4 I;  3PYD A;  3C6K A;  2LTS A;  1EA6 A;  5LMU I;  3BF2 A;  2EPL X;  5KL6 A;  1USV A;  1BBO A;  4QNJ A;  2VE7 C;  4L8N A;  4MU4 A;  5EKW A;  4FW5 A;  2A2D A;  4OO1 A;  2EL6 A;  4R2Q A;  3HUL A;  4GZN C;  1LLM C;  1UEK A;  5AAS A;  2VQF I;  4DV0 I;  4DV6 E;  5C0X F;  4DR1 I;  2M9A A;  5IT9 Q;  4Z7C A;  5IT9 C;  1A1H A;  2EOS A;  2UUA E;  2IER A;  4BS9 A;  1A1L A;  1X6H A;  1HK7 A;  1BB8 A;  4FK5 C;  4JV5 I;  4LF9 E;  2Z5B B;  4DR7 E;  4DU8 A;  4IFD F;  1FNM A;  1DI2 A;  2KHX A;  4JI0 I;  2B3T B;  2IOP A;  4OOG C;  2KON A;  4K0K E;  1IBL E;  4JI1 E;  2E1M A;  4LFA I;  1VIS A;  2HKE A;  2V2Q A;  4JI8 I;  1K47 A;  1WUU A;  2LJP A;  2YTQ A;  2BB8 A;  1PDA A;  4IS1 C;  2BR2 A;  4MYU A;  4U3D A;  4B3T I;  3M85 G;  4FW9 A;  2EPR A;  5IV8 B;  1WRJ A;  2DLK A;  5L3J A;  4OO1 E;  1J5E I;  2CPN A;  2JP9 A;  2EPA A;  5DRP A;  2JEA A;  1PJQ A;  4OX9 E;  2WBT A;  4DMI A;  5FLX C;  2PRT A;  1RRE A;  2NN6 A;  2X7I A;  3HXL A;  4F6M A;  4DV5 E;  2OI2 A;  4I8O A;  1Z0C A;  1Z5B A;  2B9D A;  1HNZ E;  3P76 A;  1YUI A;  3M7N G;  3OML A;  2EQ1 A;  3B78 A;  4WX9 A;  4LOM A;  4HXZ A;  2JOX A;  4WFT A;  1OJ4 A;  4OKG A;  2Q8U A;  4LTY A;  4Q35 B;  3H4L A;  3IWC A;  1XNR I;  1DQ3 A;  1RQ0 A;  2YT4 A;  4WXC A;  2PNL A;  3CDI A;  3ADI A;  4JI7 I;  3GON A;  1TN9 A;  3QT5 A;  1BKN A;  2EN2 A;  4DR6 E;  3P3E A;  4HY1 A;  1ZM9 A;  2YTF A;  1OYS A;  3PYF A;  2G7H A;  2HK3 A;  3J7A G;  5F3W A;  2YU8 A;  2K4V A;  2YRH A;  4DV4 E;  4P52 A;  2EMC A;  4ZYG A;  2ZM6 I;  4LFB I;  2EOM A;  4U3B A;  2BA0 G;  3B4T A;  2UU9 E;  3HTX A;  2NN6 E;  4LF5 E;  4AQY I;  2EMW A;  4JI5 I;  3QT6 A;  3AUZ A;  1XMQ E;  1XNQ I;  3P06 A;  2RTX A;  2VQF E;  4DV0 E;  2VQE I;  4DR1 E;  3KRN A;  3Q6M A;  2BA1 D;  4KHP I;  2EN8 A;  2L2N A;  4IZK A;  3HPZ A;  3U1Y A;  1N36 I;  4PRV A;  4GKJ I;  1N0U A;  2ODR D;  3DJW A;  3F6H A;  4Q28 A;  5AE2 A;  4JV5 E;  2BM0 A;  3MHS C;  4NBQ A;  1P42 A;  2EM2 A;  1PJS A;  2NUF A;  4JI0 E;  2EOY A;  1Z0V A;  3LLH A;  1EI1 A;  3EQ1 A;  2EM4 A;  2YTD A;  2WCC 3;  4F2J C;  2L8T A;  4X64 I;  4LFA E;  3BGH A;  2EPO A;  1A6F A;  4JI8 E;  4DKK A;  4DV1 I;  3F0N A;  3L7Z B;  4FW3 A;  2NPF A;  2EOQ A;  2IES A;  2FV4 B;  4XTJ A;  1WXR A;  5KL3 A;  4B3T E;  2VF3 A;  4DPY A;  3T1H I;  2EJ4 A;  2GHF A;  3M99 B;  4M9V C;  2UUB I;  3J80 Q;  3T1Y I;  2O1V A;  2IHR 1;  4FWG A;  1G2F C;  4WSP A;  1NCS A;  2JR1 A;  3J80 C;  1TF6 A;  1J5E E;  3VYX A;  4JI6 I;  3J7A M;  1GTK A;  1RR9 A;  3LNU A;  2CSH A;  3EPL A;  4DR5 I;  1I94 E;  4OO1 F;  4ZYE A;  2EM5 A;  5ADZ A;  2B7V A;  1RC7 A;  2WP8 A;  1ZM3 A;  4R2C A;  1A1G A;  1JK2 A;  2RSI A;  1O0W A;  2LV2 A;  3WU6 A;  4X62 I;  2M7Q A;  4DR2 I;  5EL9 A;  2PO0 A;  1IBM I;  2JEA B;  3JTZ A;  2AJ4 A;  2EMF A;  2NA2 A;  3P1X A;  4BBY A;  3VYY A;  3K17 A;  2WBS A;  3FIG A;  1Z59 A;  2NN6 C;  4WUD A;  2YTN A;  2DSY A;  3RMP A;  4GEQ B;  2N3H A;  4NHR A;  4JI7 E;  2WBU A;  1IQO A;  1A1K A;  1Z0G A;  1YPN A;  4DPU A;  4N3O A;  4UT4 A;  1X49 A;  1IQS A;  2DRP A;  4P7D A;  4HAC B;  2YPN A;  4JYA I;  5A6K A;  2RQL A;  1YH8 A;  3OTO I;  2RPC A;  4LFB E;  2EFG A;  2EPX A;  2ZM6 E;  2F4V I;  4B3S I;  2E1R A;  2F8B A;  1Z0E A;  2V8P A;  4JI5 E;  4AQY E;  4URL A;  4LFC E;  4LF8 I;  1XNQ E;  2NN6 F;  3Q1Q A;  5JEA F;  4R2S A;  3PS1 A;  2VQE E;  4LF4 E;  2PO2 B;  1MGT A;  1AAY A;  1N36 E;  5KL5 A;  2DEJ A;  5T6J A;  2CGE A;  2JVA A;  1H73 A;  4R1F A;  2R3V A;  4ZVI A;  1STU A;  1Y6Z A;  4LF6 I;  2MDR A;  2V86 A;  1FWK A;  1N0V C;  3ZZT A;  3L7Z A;  2JT2 A;  4IZK B;  4X64 E;  4WPY A;  4DV1 E;  1A1J A;  2MC5 A;  2GLI A;  2DB2 A;  5CFF E;  5LLQ A;  4WYQ B;  2PNZ B;  1YYW A;  2ODR C;  2E72 A;  2MC6 A;  2VF1 A;  3VHT B;  3T1H E;  3C4T A;  2O1T A;  3B82 A;  5DRR A;  2LE2 A;  1EH6 A;  2EQ0 A;  2L6M A;  3T1Y E;  5IXM B;  1T4L B;  5GMD A;  4MDT A;  2EL5 A;  3MSW A;  1SR9 A;  2ZBK B;  5A6B D;  4DU7 A;  2A25 A;  1VI7 A;  1KYQ A;  3WU5 A;  5FWK A;  4NXM I;  2CTD A;  2LBS B;  1NHH A;  1DAR A;  1UDQ A;  3THO B;  2YTP A;  2ELY A;  2YTO A;  4F6N A;  2YSO A;  1MG7 A;  1YFH A;  1MX0 A;  2VES A;  4DV7 I;  4X62 E;  4DR2 E;  2V85 A;  2ADR A;  3GME A;  1IBM E;  3K85 A;  1T39 A;  4M1K A;  4MU1 A;  3M85 D;  1S4E A;  2HK2 A; 
#chains in the Genus database with same CATH homology
 4F9C B;  2O1U A;  3ZKB A;  2KOU A;  2LUP B;  4DXL A;  1USU A;  4HAC A;  2L3C A;  4X66 E;  3KWR A;  2UXB I;  4BCA A;  1FI4 A;  2A2C A;  4JYA E;  4KQV A;  4UTG A;  4IZJ D;  4PU9 A;  1N34 E;  2V2Z A;  3OTO E;  4FWD A;  4DV3 I;  2DMY A;  2F4V E;  4B3S E;  1KKH A;  1ZXM A;  2YZT A;  4DR3 E;  3VK6 A;  1FJG I;  5LMU E;  4FN5 A;  2DIX A;  1ZBQ A;  2L2M A;  1NHI A;  1KTV A;  5GME A;  2DEI A;  3Q6N A;  4R03 A;  1HNX I;  2L33 A;  4JI4 I;  1ELO A;  1H74 A;  3J7Y p;  2UUC I;  3HPS A;  4LF6 E;  2J7K A;  2V88 A;  2Z5C B;  1MU5 A;  4WUC A;  3K6Q A;  1WHQ A;  2IOQ A;  1HNW I;  4P7A A;  3JAM Q;  4L5N C;  3JAM C;  1N33 I;  1ZBT A;  2WZO A;  3QT8 A;  5A2Q Q;  3K1J A;  2V8Q B;  5A2Q C;  4DPT A;  3QT7 A;  2E5L I;  2GS8 A;  4NXM E;  1IBK I;  4B3R I;  1GQE A;  3IWD A;  1B62 A;  2V2V A;  4DV7 E;  1U2R A;  4M2Z A;  1S16 A;  4DPW A;  4YY3 I;  4RPF A;  2R42 A;  3HQ1 A;  2HFU A;  2N3G A;  4DUY I;  4TUI A;  1QZR A;  3F6G A;  1B63 A;  4K0K I;  1FWL A;  1XNR E;  2UXB E;  2LMZ A;  3C4B A;  5AE3 A;  1ZM4 A;  4B3M I;  1H7U A;  1ZM2 A;  4DUZ I;  4BC7 A;  5LL6 R;  2Q2E B;  2ZIT A;  4X65 I;  1H7S A;  1FJG E;  3AV0 A;  4IZJ B;  4NXN I;  2LRS A;  3B8H A;  1N32 I;  3V5R A;  1PVG A;  4WUB A;  5DNY A;  3ZKD A;  4DPX A;  1Z0W A;  4P78 A;  5IWA I;  2NUG A;  2Z5C A;  1HNX E;  4JI4 E;  2HFS A;  2EWL A;  4KHP E;  4GKJ E;  2UUC E;  2PNM A;  3ZOQ B;  3HJC A;  3ZM7 A;  4R8O A;  4J8Z A;  3WU3 A;  2L2K B;  1H72 C;  2CG9 A;  4X8W A;  3LML A;  1XHK A;  2RSM A;  4F9B B;  1T4O A;  2L92 A;  2UU9 I;  2E5L E;  3ADL A;  4LF5 I;  1KVK A;  2JY9 A;  2UUB E;  2M1S A;  1IBK E;  3WU4 A;  4B3R E;  4LU9 A;  1XMQ I;  4JI6 E;  1T4N A;  2BV3 A;  4DR5 E;  3PYG A;  4USK A;  2O1W A;  2HHH I;  1J26 A;  4YY3 E;  3ADJ A;  4I3H A;  4DUY E;  2L3J A;  2EZ6 A;  1KIJ A;  5BR8 I;  2JOB A;  2UXD I;  4EMD A;  4DV2 I;  4TUG A;  4B3M E;  3ZZU A;  1YYO A;  4DUZ E;  2H36 X;  1PIE A;  2M4I A;  4BC9 A;  4M30 A;  4IZJ A;  2UXC I;  5FLX Q;  4X65 E;  2WW4 A;  2JWO A;  5AE1 A;  4NXN E;  1YZ9 A;  3ADG A;  2XEX A;  1I94 I;  1N32 E;  4LF7 I;  2HKJ A;  1FKA E;  1PKP A;  1Z5A A;  1ZXN A;  4LF8 E;  5IWA E;  2BM1 A;  4M0V A;  1WHN A;  1UHZ A;  1XMO I;  3D4J A;  2V87 A;  4JG4 A;  3DF6 A;  4DR4 I;  4JI2 I;  2RS6 A;  1HR0 I;  2FGG A;  3LPS A;  3CWV A;  5LMN I;  4KZS A;  4GKK I;  1X48 A;  3V2U C;  4LFC I;  4YHH I;  4JI3 I;  4PRX A;  2X36 A;  1Z0T A;  4LF4 I;  2Z5E A;  2FTX B;  2HHH E;  2Z5B A;  1YYK A;  4DV6 I;  3J81 Q;  1Z5C A;  3ZZ0 A;  2UUA I;  2LTR A;  3J81 C;  2CZ9 A;  1Y4U A;  5BR8 E;  1Z0B A;  4LF9 I;  4DR7 I;  2LJH A;  2UXD E;  4ED4 A;  4F54 A;  1EKZ A;  4DV2 E;  3PRY A;  1GZ6 A;  4JI1 I;  1IBL I;  1NZ0 A;  1D6T A;  3LTO A;  2V89 A;  2UXC E;  4DV3 E;  4HYM A;  4MYT A;  4LF7 E;  4BMJ A;  2NUE A;  1Y4S A;  4OX9 I;  2B7T A;  4DV5 I;  2V34 A;  1HNZ I;  1UIL A;  4FWH A;  1XMO E;  1X47 A;  2GQ0 A;  4USM A;  1NHJ A;  3M6A A;  4X66 I;  3IWB A;  4DR4 E;  4JI2 E;  1HNW E;  1HR0 E;  1QU6 A;  1N34 I;  1N33 E;  3H09 A;  5LMN E;  4DR6 I;  2LUQ A;  3PYE A;  3JU0 A;  4GKK E;  4F9A B;  2RS7 A;  4DR3 I;  4Z7Y A;  4DV4 I;  4JI3 E;  2V83 A;  4YHH E;  3PYD A;  1EA6 A;  2LTS A;  5LMU I;  1USV A;  2VE7 C;  4L8N A;  2A2D A;  3HUL A;  1UEK A;  5AAS A;  2VQF I;  4DV0 I;  4DV6 E;  4DR1 I;  5IT9 Q;  4Z7C A;  5IT9 C;  2UUA E;  4BS9 A;  1HK7 A;  4JV5 I;  4LF9 E;  2Z5B B;  4DR7 E;  4DU8 A;  1FNM A;  1DI2 A;  2KHX A;  4JI0 I;  2B3T B;  2IOP A;  4OOG C;  2KON A;  4K0K E;  1IBL E;  4JI1 E;  2E1M A;  4LFA I;  1VIS A;  2HKE A;  2V2Q A;  4JI8 I;  1K47 A;  1WUU A;  2LJP A;  4MYU A;  4B3T I;  4FW9 A;  5L3J A;  1J5E I;  2CPN A;  4OX9 E;  4DMI A;  5FLX C;  1RRE A;  2X7I A;  3HXL A;  2OI2 A;  4DV5 E;  4I8O A;  1Z0C A;  1Z5B A;  2B9D A;  1HNZ E;  3OML A;  3B78 A;  4HXZ A;  2JOX A;  4WFT A;  1OJ4 A;  4LTY A;  3H4L A;  3IWC A;  1XNR I;  1DQ3 A;  1RQ0 A;  2YT4 A;  2PNL A;  3ADI A;  4JI7 I;  3GON A;  3QT5 A;  1BKN A;  4DR6 E;  4HY1 A;  1ZM9 A;  3PYF A;  2G7H A;  2HK3 A;  3J7A G;  5F3W A;  4P52 A;  2K4V A;  4DV4 E;  4LFB I;  2ZM6 I;  2UU9 E;  3HTX A;  4LF5 E;  4AQY I;  4JI5 I;  3QT6 A;  1XMQ E;  3AUZ A;  1XNQ I;  3P06 A;  2RTX A;  2VQF E;  4DV0 E;  2VQE I;  4DR1 E;  3Q6M A;  4KHP I;  2L2N A;  4IZK A;  3HPZ A;  1N36 I;  4GKJ I;  4PRV A;  1N0U A;  2ODR D;  3DJW A;  3F6H A;  4Q28 A;  5AE2 A;  4JV5 E;  2BM0 A;  2NUF A;  4JI0 E;  1Z0V A;  3LLH A;  1EI1 A;  2L8T A;  4X64 I;  4LFA E;  1A6F A;  4JI8 E;  4DKK A;  4DV1 I;  3F0N A;  2NPF A;  2FV4 B;  4XTJ A;  1WXR A;  4B3T E;  3T1H I;  2VF3 A;  4DPY A;  2UUB I;  3J80 Q;  3T1Y I;  2O1V A;  2IHR 1;  4FWG A;  4WSP A;  4JI6 I;  2JR1 A;  3J80 C;  3VYX A;  1J5E E;  3J7A M;  1RR9 A;  3LNU A;  4DR5 I;  1I94 E;  5ADZ A;  2B7V A;  1RC7 A;  1ZM3 A;  1O0W A;  3WU6 A;  4X62 I;  2M7Q A;  4DR2 I;  1IBM I;  3JTZ A;  2AJ4 A;  3P1X A;  2NA2 A;  3VYY A;  4BBY A;  3K17 A;  3FIG A;  1Z59 A;  4WUD A;  2DSY A;  3RMP A;  4GEQ B;  2N3H A;  4JI7 E;  1Z0G A;  4DPU A;  4N3O A;  4UT4 A;  1X49 A;  4JYA I;  4HAC B;  4P7D A;  3OTO I;  4LFB E;  2EFG A;  2ZM6 E;  2F4V I;  4B3S I;  2E1R A;  2F8B A;  1Z0E A;  2V8P A;  4JI5 E;  4AQY E;  4URL A;  4LFC E;  4LF8 I;  1XNQ E;  3Q1Q A;  2VQE E;  4LF4 E;  1N36 E;  2DEJ A;  5T6J A;  2CGE A;  2JVA A;  1H73 A;  4R1F A;  2R3V A;  4ZVI A;  1STU A;  1Y6Z A;  4LF6 I;  2MDR A;  2V86 A;  1FWK A;  1N0V C;  3ZZT A;  4IZK B;  4X64 E;  4WPY A;  4DV1 E;  2MC5 A;  2DB2 A;  5CFF E;  4WYQ B;  1YYW A;  2ODR C;  2MC6 A;  2VF1 A;  3T1H E;  2O1T A;  3C4T A;  3B82 A;  2LE2 A;  2L6M A;  3T1Y E;  1T4L B;  5GMD A;  2ZBK B;  3MSW A;  1SR9 A;  4DU7 A;  3WU5 A;  4NXM I;  5FWK A;  2LBS B;  1NHH A;  1DAR A;  1MG7 A;  1MX0 A;  4DV7 I;  4X62 E;  4DR2 E;  2V85 A;  4M1K A;  1IBM E;  3K85 A;  1S4E A;  2HK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...