1J5EE

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1j5eE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1j5eE02
2LTSA 1ZM2A 4B3ME 1Z0CA 3ADGA 4GKJI 4X64E 1ZXMA 4YY3E 2L3JA 4JI0E 4DPTA 2E5LE 1ZM3A 5GMEA 2RSMA 2VF3A 1J5EE 2GS8A 2LUPB 1IBLE 4YHHI 3T1YI 4JI6I 2NUFA 1H73A 4DV4I 2DMYA 1WHNA 4DXLA 3VYYA 4X8WA 4DUYE 2BV3A 1HR0E 4DPWA 2E1RA 3P1XA 1H7UA 2L2MA 4PRXA 2V2QA 1DARA 4HACA 4LFAI 1ELOA 4P52A 4FN5A 2B7TA 4HXZA 4DPUA 2XEXA 3Q1QA 1N33I 3WU6A 1Z0BA 4K0KI 4DR5E 2OI2A 4ZVIA 5A2QQ 3JAMQ 2ZITA 2LJHA 1X49A 2WW4A 1K47A 4DR6I 1S4EA 4GKJE 2R42A 3QT8A 4LF7I 1HNXI 4DV5I 3V2UC 1O0WA 4EMDA 4PU9A 2HFSA 4WFTA 4JI7I 3B78A 3PYDA 4LFBI 1GQEA 3T1YE 4YHHE 4JI8I 2A2CA 4B3RI 1XMOI 4MYTA 5LMUI 2Q2EB 4DV4E 4JI1I 4HYMA 1KVKA 1Z0WA 4WYQB 1YYKA 4B3SE 1WHQA 1U2RA 4LFAE 4USMA 4P7AA 2LRSA 2MDRA 3ADLA 2HKEA 4JI4I 4LF9I 4LF4I 1FNMA 2IHR1 1ZBTA 2UUAI 1IBMI 4DV1I 2V8PA 3J81C 4X66I 2N3GA 2UUBI 1MU5A 2RS7A 4LFCI 1QU6A 2B3TB 4DR6E 2J7KA 4LF7E 3PYGA 5CFFE 2UU9I 1Z0TA 4JI2I 1EI1A 4NXNI 5IT9Q 2DEIA 4JI5E 3WU3A 4LFBE 4JI8E 2UXCI 4B3RE 1Z0GA 2VQEE 1XMOE 3K1JA 3ADJA 4DV6E 1MX0A 1RREA 4JI1E 2UUCI 1UILA 4DR1E 1DI2A 4KQVA 2LJPA 5BR8E 4ED4A 4MYUA 1J26A 1XMQE 5IWAI 1UHZA 2L2NA 1PKPA 4JI4E 4LF9E 1NHIA 3J80Q 4B3TI 4DR4E 3WU4A 4X65E 2JY9A 4GKKI 1RR9A 4PRVA 3H4LA 2LUQA 1IBME 4DV1E 3LPSA 5L3JA 3T1HI 4X66E 2UUBE 1HNZI 2UXDI 1STUA 4LFCE 4DR3I 1RC7A 2R3VA 5FLXC 3J81Q 4KHPI 2V2ZA 1I94I 2VQFI 2A2DA 4M30A 2UU9E 4JI2E 4NXNE 1X48A 1EKZA 1FKAE 2LTRA 3ADIA 4NXMI 1B62A 2EZ6A 1Z59A 1N32I 3B8HA 2HKJA 2UUCE 1XHKA 4UT4A 4OX9I 1YYWA 2HK2A 2RS6A 4JV5I 3LTOA 1FJGI 5IWAE 1PVGA 3WU5A 4GKKE 4JI6E 1A6FA 1ZXNA 4FWHA 4LF8I 4DV7I 3OTOI 4DUZI 2F4VI 3T1HE 1HNZE 1QZRA 2UXDE 4DR3E 5LL6R 4LF5I 4DKKA 4JG4A 3HULA 4KHPE 1I94E 2VQFE 3J7Yp 1N34I 2HHHI 1N33E 4DU8A 5FLXQ 3C4BA 4K0KE 4DV2I 4DV0I 4DR2I 3LLHA 3F0NA 4B3MI 2HK3A 1H7SA 2BM1A 1N32E 4JI3I 1N0VC 3CWVA 3GONA 3J7AM 1XNRI 1FWLA 1NHHA 1KTVA 2CZ9A 4JYAI 1HNXE 4DV5E 2YT4A 4Z7CA 3D4JA 4XTJA 4M2ZA 2CPNA 2NA2A 1FJGE 4DPYA 1VISA 3QT6A 2X36A 4JI7E 4DUYI 4WUBA 3B82A 1UEKA 4Z7YA 2V34A 3M6AA 3V5RA 5LMUE 1KKHA 4LF8E 4DV7E 4DUZE 3VYXA 4USKA 2LBSB 1YYOA 4FW9A 2L2KB 1YZ9A 4LF5E 4HACB 1ZM9A 1ZM4A 4WUDA 1NHJA 4DPXA 1N34E 2HHHE 4LF4E 4DV2E 4DR2E 1KIJA 4DV0E 3ZKBA 2N3HA 3ZKDA 2UUAE 2DIXA 4JI3E 1XNRE 3QT7A 4AQYI 4DR7I 4RPFA 4JYAE 5LMNI 2UXBI 1N0UA 3ZZTA 4HY1A 1XNQI 4FWGA 2NUEA 4LF6I 4DV3I 2BM0A 2UXCE 2NUGA 2ZBKB 4B3SI 1S16A 3PYFA 4X62I 1T4NA 1FWKA 1MG7A 3LNUA 1D6TA 2HFUA 1HNWI 1PIEA 2JVAA 1Z5CA 4B3TE 1IBKI 2X7IA 3PYEA 2RTXA 5IT9C 1Z0VA 3J7AG 1N36I 1OJ4A 1B63A 3QT5A 4AQYE 4DR7E 4URLA 5LMNE 2UXBE 1BKNA 2L33A 1XNQE 4JI5I 3HTXA 2ZM6I 1RQ0A 2VQEI 4LF6E 4DV6I 4DV3E 4NXME 3K17A 2L3CA 1Z5AA 3C4TA 2DB2A 4DR1I 4X64I 5BR8I 4WUCA 1T4LB 2EFGA 4YY3I 4JI0I 3J80C 2NPFA 4X62E 2E5LI 1XMQI 2KHXA 4OX9E 1NZ0A 4JV5E 4DU7A 1J5EI 1HNWE 3ZM7A 1IBLI 4DR4I 1WUUA 4X65I 4UTGA 3ZZ0A 4OOGC 1Z0EA 1EA6A 1FI4A 2B7VA 1IBKE 1HR0I 4I3HA 1T4OA 2AJ4A 1H72C 3OTOE 2F4VE 1H74A 1X47A 5A2QC 1N36E 2DEJA 2V2VA 5GMDA 3JAMC 4M1KA 4DR5I 1Z5BA 3ZZUA 2ZM6E 4FWDA 4R1FA
chains in the Genus database with same CATH superfamily
2R1FA 2LTSA 2EN7A 3MSWA 1ZM2A 1BB8A 2YZTA 4B3ME 2RSIA 1Z0CA 4X9JA 2LE2A 2NN6F 3ADGA 4GKJI 4X64E 2Z5BB 2C37B 5DNXA 1ZXMA 4IJDA 3OMLA 1BBOA 4YY3E 2L3JA 4JI0E 3F6HA 1UDQA 1HK7A 2E5LE 4IS9A 4DPTA 1ZM3A 1UDSA 4LPFA 5GMEA 2JE6B 1G2DC 2RSMA 2VF3A 1J5EE 2GS8A 4OKGA 2VE7C 2YTGA 2LUPB 1IBLE 1USVA 4YHHI 3T1YI 3AUZA 1F2IG 4JI6I 2NUFA 1H73A 2Z5CB 4DV4I 2DMYA 1WHNA 2EN6A 4DXLA 3VYYA 4X8WA 1NCSA 3DJWA 4DUYE 3ECRA 1JK1A 2EQ0A 1HR0E 2BV3A 3CDIA 4DPWA 2YU8A 3P1XA 1H7UA 1XXEA 2L2MA 2E1RA 5K36B 4PRXA 2V2QA 1DARA 2BA1D 2WBUA 4HACA 4LFAI 4L5NC 1ELOA 4FN5A 4P52A 2B7TA 2EMKA 1WXRA 4HXZA 4DPUA 2YTJA 2MKDA 2PNZB 1ZBQA 2XEXA 4IZJB 5JEAA 2NN6D 3M7NG 2JOBA 2YTEA 3Q1QA 2LJUA 3PRYA 1N33I 1B69A 5FWKA 3WU6A 2O3ZA 4P78A 1Z0BA 1OYSA 4DR5E 2OI2A 4FW6A 4MU1A 4K0KI 4ZVIA 5A2QQ 2YTIA 4MDTA 1Y6ZA 2YPNA 4BMJA 3JAMQ 2ZITA 5DRRA 2LJHA 1E3HA 3JU0A 1X49A 4O4KA 4R2EA 2NN6C 4WPYA 2BA0G 5AC5A 3P3GA 2J65A 2WW4A 5ELWA 4R2SA 1K47A 1P42A 3KRNA 2EN1A 4DR6I 1S4EA 1A1IA 1HNXI 4GKJE 4LOMA 4MLVA 2R42A 1SR9A 2EMCA 3QT8A 4LF7I 3DD6A 4F9AB 4FK5C 2HGHA 3P3EA 3V2UC 1KYQA 2FGGA 4TUIA 4DV5I 1O0WA 4EMDA 4PU9A 2HFSA 2EM5A 2EOZA 2ENHA 2LCEA 4WFTA 5JEAF 4JI7I 3B78A 3PYDA 4LFBI 3THOB 1EH7A 1A1LA 1GQEA 1PJQA 5LLQA 3T1YE 4YHHE 2EN8A 4BS9A 4JI8I 2A2CA 4B3RI 1XMOI 4MYTA 5LMUI 2Q2EB 4DV4E 5DROA 4JI1I 2C38A 2Q8UA 2EMAA 1KVKA 4HYMA 2YTPA 1DQ3A 4WYQB 1Z0WA 2NN6E 4OO1B 2L8TA 1YYKA 1P47A 4B3SE 1WHQA 1U2RA 4R2RA 2PO1A 4ZYGA 4BCAA 4LFAE 1X5WA 4M0VA 5A6BA 4USMA 4P7AA 1UN6B 2LRSA 2MDRA 2WP8A 3GCMA 3BIDA 3ADLA 1IQSA 2HKEA 1ZAAC 3QG5C 3M85G 3U1KA 4JI4I 4LF9I 4F54A 4LF4I 2PO0A 1FNMA 2LO3A 2IHR1 3IWDA 4TUGA 3HKMA 2V87A 2L6MA 3BGHA 1ZBTA 2EMYA 3TQMA 3HPZA 3H1CA 4HEIA 2UUAI 3L7ZB 1IBMI 4DV1I 2V8PA 4MU0A 1PJSA 3J81C 5JEAD 2N3GA 4X66I 2E72A 5KL3A 3EPHA 1MU5A 2RS7A 4MLQA 2GO4A 4LFCI 1QU6A 2PO2B 2JOXA 3IWCA 1ZR9A 5A6JA 2CT1A 2B3TB 4DR6E 2B9DA 2J7KA 2VESA 2JT2A 4LF7E 3PYGA 5CFFE 2EM0A 1E3PA 1YH8A 2UU9I 1Z0TA 4JI2I 1EI1A 4NXNI 5C0XA 5IT9Q 2EPZA 1YFHA 2DEIA 1TF3A 2A25A 2IESA 2EJ4A 4NZVA 4WXDA 2LVHA 4JI5E 2EOYA 2C39B 4LFBE 1AH5A 3L00A 1IQOA 3WU3A 2I9IA 4JI8E 4WX9A 1Y60A 1X6FA 1N32I 3KZYA 4B3RE 2YSPA 2VQEE 1XMOE 1Z0GA 2CVEA 3K1JA 3P76A 4FW7A 3ADJA 4DV6E 1MX0A 4GQUA 1RREA 4GZNC 4JI1E 2UUCI 4BA2A 4J8ZA 1UILA 4DR1E 1DI2A 2ENAA 2WZOA 2EMXA 1A1HA 4KQVA 2LJPA 5BR8E 4ED4A 2RQLA 5KL5A 4MYUA 5AC4A 2EL5A 1J26A 4BA1A 3PS2A 3EPLA 1XMQE 1YUIA 5IWAI 4L8NA 1YSAC 1UHZA 5C0XF 2GPIA 2L2NA 5A6AA 2KOUA 1PKPA 2EPMX 4JI4E 4LF9E 1NHIA 3J80Q 4B3TI 2JPAA 4DR4E 2YTQA 3WU4A 4X65E 2JY9A 2J7JA 4GKKI 2EQ1A 1RR9A 2F8BA 2EOIA 5A6BD 4PRVA 3H4LA 2EOSA 2CSHA 2ELZA 2LUQA 1IBME 4DV1E 2YU5A 4R2AA 4R2PA 2DRPA 2EE8A 3LPSA 4X66E 2UUBE 5L3JA 2I13A 3T1HI 1HNZI 2UXDI 1JK2A 1STUA 4LFCE 4DR3I 2WNRB 2V88A 1RC7A 2EQ3A 4IZKA 2ODRD 1USUA 1G2FC 2O1VA 5EKWA 2R3VA 5FLXC 3J81Q 4KHPI 2V2ZA 4IFDA 1I94I 4QNJA 2A2DA 2VQFI 2EPUA 1PDAA 4M30A 2UU9E 4JI2E 3PS3A 2EM3A 4NXNE 3PS1A 1X48A 1EKZA 1FKAE 3EQ1A 2LTRA 2ODRC 3ADIA 2YRHA 4NXMI 2ELYA 2F1DA 2GQ0A 2IERA 2EL6A 1B62A 2EZ6A 1R6MA 1Z59A 2JWOA 2Z5BA 2GLIA 2C37A 3B8HA 5C0XD 2EMWA 2UXCI 2HKJA 2UUCE 1XHKA 1OYRA 4R2DA 4UT4A 4WXCA 2MC6A 3M7ND 4OX9I 2YRMA 1YYWA 4AM3A 2HK2A 3HXLA 5KL7A 4R2CA 3K85A 2JE6A 2RS6A 4JV5I 4U3BA 2R76A 3LTOA 5C0XC 2EL4A 2K4VA 1FJGI 5K36F 4IFDF 5IWAE 1PVGA 2FV4B 2EN4A 4Q35B 4R2QA 2V85A 3LMLA 4NHRA 2YSOA 2Z5CA 4OZEA 3WU5A 3K6QA 2BR2B 4GKKE 3GLLA 4JI6E 1A6FA 3DF6A 1TN9A 1ZXNA 3GMEA 4FWHA 4LCGA 5K36A 4LF8I 2D9HA 3OTOI 2NN6B 4DUZI 4P7DA 4DV7I 1RHYA 2F4VI 4F9BB 4N3OA 1EH8A 3T1HE 4R03A 3HPSA 1HNZE 2UXDE 1QZRA 2EN2A 2M7QA 2JEBB 2PNZA 4DR3E 5LL6R 3HJCA 4LF5I 2NABA 4IZJA 2JEAB 4DKKA 4JG4A 1UDOA 3HULA 2EMIA 4KHPE 3C6KA 1I94E 2VQFE 1OYPA 2IOQA 3J7Yp 1N34I 2BB8A 5T6JA 1X6EA 2CTDA 2HHHI 1N33E 4DU8A 5C0XE 5FLXQ 3C4BA 4K0KE 4DV2I 2EOQA 4DV0I 4DR2I 2EOFA 4F6NA 3LLHA 3F0NA 2WBTA 5DNLA 4B3MI 2EM8A 2HK3A 2KONA 4IFDD 2V86A 2EOJA 1UBDC 1H7SA 2BM1A 1BBGA 1N32E 4JI3I 1N0VC 2RPCA 5AE3A 1KJKA 3CWVA 1YHCA 3GONA 1DGCA 2EPKX 2JYAA 1XNRI 3J7AM 2EMZA 1FWLA 1NHHA 3F6GA 1KTVA 2CZ9A 4JYAI 1HNXE 3M85D 4DV5E 2BBGA 1L4SA 2YT4A 4ISAA 1WRJA 2EPNA 4GEQB 3D4JA 5JEAC 4Z7CA 4XTJA 2EPLX 4M9VC 4M2ZA 2CPNA 2EOHA 2NA2A 1FJGE 5F3WA 4BHCA 2EM2A 2G7HA 2BR2A 2CGEA 1VISA 4DPYA 2DGCA 2X36A 3QT6A 2EM4A 3AV0A 5KL2A 2PRTA 4JI7E 2O1UA 2PNLA 4U3DA 2NN6A 4DUYI 3MHSC 4WUBA 2EN3A 3B82A 1UEKA 5AE1A 2V34A 4Z7YA 4OO1A 2LMZA 4MU4A 3M6AA 1LLMC 2DSYA 5LMUE 1KKHA 3V5RA 4LF8E 4DV7E 1SFEA 4DUZE 3VYXA 4WSGA 3THNA 2CG9A 3P3CA 4AIDA 4USKA 2LBSB 1YYOA 4FW9A 2L2KB 1YZ9A 2JP9A 4NBQA 4LF5E 4HACB 1ZM9A 1ZM4A 4QNKA 4WUDA 3M99B 4F2JC 1MEYC 1A1KA 1NHJA 5A6KA 2UUBI 4DPXA 5K36D 1EH6A 3BF2A 4HTGA 3Q6NA 2YRKA 5JEAB 1N34E 4BBYA 2M1SA 2GO3A 2HHHE 5JEAE 2K7IA 2V89A 4F9CB 4DV2E 4DR2E 4DV0E 4LF4E 1KIJA 3L7ZA 1VI7A 4IZJD 3NZKA 1QNTA 3ZOQB 3ZKBA 1IMUA 5K36C 2EMLA 2N3HA 2PO2A 2O1WA 4MU3A 3ZKDA 3HQ1A 4ZYEA 2UUAE 3P06A 2DIXA 3U1YA 4OO1F 4JI3E 3H09A 1XNRE 2LV2A 1X3CA 3QT7A 1YPNA 2EPXA 4AQYI 4DR7I 2WCC3 2YWQA 4RPFA 2EMBA 4JYAE 2YTFA 5LMNI 2UXBI 1N0UA 2BA1G 3ZZTA 2M9AA 5AASA 4HY1A 1XNQI 2MC5A 1T39A 3JTZA 2C39A 2DMIA 4FWGA 4BC9A 1N3GA 2NUEA 3BBGA 4O24A 4LF6I 2EPCA 4DV3I 1NEIA 2EWLA 3KWRA 2O1TA 4LTYA 2BM0A 4N4RB 5EL9A 2UXCE 3CDJA 2NUGA 2ZBKB 4B3SI 2E1MA 2FTXB 1S16A 2C38B 3PYFA 5K36E 2EPPA 4X62I 2EOOA 1T4NA 2EORA 1FWKA 1MG7A 3LNUA 2PO1B 1D6TA 2JXPA 4KZSA 4OO1D 2HFUA 4RHBB 5KL4A 1HNWI 3UK3C 1PIEA 2WP8B 2EOEA 4JI5I 2EPAA 2JVAA 1GZ6A 4DMIA 2BA0D 1Z5CA 4B3TE 2PO0B 1MGTA 1IBKI 4LCHA 2EM7A 2X7IA 4J3DA 4FW5A 2Z5EA 3PYEA 2RTXA 4OO1C 5IV8B 2EM9A 4O5GA 2WNRA 1Y4UA 5IT9C 2EOMA 3VHTB 1Z0VA 5AE2A 3J7AG 1N36I 1OJ4A 1A1FA 1B63A 3QT5A 4LCFA 2IOPA 4AQYE 3MHHC 1Z1BA 4DR7E 4URLA 5LMNE 2AE8A 2UXBE 2HJJA 5IXMB 1BKNA 4BC7A 2L33A 1XNQE 1TF6A 1T38A 2YTDA 1YUJA 1RMDA 3HTXA 3UHMA 5C0XB 2ZM6I 4IS1C 2ADRA 5DRPA 2L92A 3RMPA 1RQ0A 2VQEI 4LF6E 1A1JA 2HC5A 4DV6I 4DV3E 4NXME 1GTKA 3K17A 2VRDA 1X6HA 2L3CA 1Y5YA 1Z5AA 3C4TA 4F6MA 2DB2A 2EPRA 4X64I 4DR1I 2DLQA 1UDNA 2VF1A 4BHBA 5BR8I 4BA2B 4OO1E 4WUCA 2MDGA 1T4LB 5KL6A 2LT7A 1AAYA 2EFGA 4JI0I 3J80C 2NPFA 2H36X 4YY3I 2EM6A 4X62E 2E5LI 3IWBA 1XMQI 1R6LA 2DLKA 2KHXA 4O43A 4OX9E 4IFDC 1WJPA 4RH8A 1NZ0A 2EMHA 2MKNA 4JV5E 4BA1B 4DU7A 1J5EI 1HNWE 3ZM7A 1IBLI 4DR4I 1WUUA 4X65I 4UTGA 3ZZ0A 3KZZA 4OOGC 3VK6A 1Z0EA 2V83A 2EP3A 4I8OA 1ZU1A 1EA6A 2M4IA 2GHFA 2B7VA 1FI4A 1IBKE 1HR0I 5TSEA 2N8XA 2EPOA 4WSPA 5A69A 4I3HA 1T4OA 2AJ4A 2JEBA 2EMFA 1H72C 3Q6MA 3C6MA 2YTOA 4KWYA 5ADZA 2JR1A 4LU9A 4ZYDA 3OTOE 2WBSA 1A1GA 2F4VE 2JEAA 1H74A 1X47A 2V8QB 2ENCA 5A2QC 1N36E 2DEJA 2V2VA 4AIMA 3EPKA 4MQYA 5GMDA 4IZKB 4ZYHA 3JAMC 4M1KA 3B4TA 4DR5I 4FW3A 4IFDB 1PJTA 4Q28A 1Z5BA 2PNMA 3ZZUA 2ZM6E 1Y4SA 4IFDE 4FWDA 4R1FA 5DNYA 3EPJA 2EMGA 2EOXA 3FIGA 4R8OA 4FW4A 2YTNA 5DRQA
chains in the Genus database with same CATH topology
2LTSA 3MSWA 1ZM2A 2YZTA 4B3ME 1Z0CA 2LE2A 3ADGA 4GKJI 4X64E 2Z5BB 1ZXMA 3OMLA 4YY3E 2L3JA 4JI0E 3F6HA 1HK7A 2E5LE 4DPTA 1ZM3A 5GMEA 2RSMA 2VF3A 1J5EE 2GS8A 2VE7C 2LUPB 1IBLE 4YHHI 1USVA 3T1YI 3AUZA 4JI6I 2NUFA 1H73A 2Z5CB 4DV4I 2DMYA 1WHNA 4DXLA 3VYYA 4X8WA 4DUYE 3DJWA 2BV3A 1HR0E 4DPWA 2E1RA 3P1XA 1H7UA 2L2MA 4PRXA 2V2QA 1DARA 4HACA 4LFAI 4L5NC 1ELOA 4FN5A 4P52A 2B7TA 1WXRA 4HXZA 4DPUA 1ZBQA 2XEXA 4IZJB 3Q1QA 2JOBA 3PRYA 1N33I 5FWKA 3WU6A 4P78A 1Z0BA 4K0KI 4DR5E 2OI2A 4ZVIA 5A2QQ 1Y6ZA 4BMJA 3JAMQ 2ZITA 2LJHA 3JU0A 1X49A 4WPYA 2WW4A 1K47A 4DR6I 1S4EA 4GKJE 2R42A 1SR9A 3QT8A 4LF7I 1HNXI 4F9AB 4DV5I 3V2UC 4TUIA 2FGGA 1O0WA 4EMDA 4PU9A 2HFSA 4WFTA 4JI7I 3B78A 3PYDA 4LFBI 1GQEA 3T1YE 4YHHE 4JI8I 4BS9A 2A2CA 4B3RI 1XMOI 4MYTA 5LMUI 2Q2EB 4DV4E 4JI1I 4HYMA 1KVKA 1DQ3A 4WYQB 1Z0WA 2L8TA 1YYKA 4B3SE 1WHQA 1U2RA 4BCAA 4LFAE 4M0VA 4USMA 4P7AA 2LRSA 2MDRA 3ADLA 2HKEA 4JI4I 4LF9I 4F54A 4LF4I 1FNMA 3IWDA 2IHR1 4TUGA 2V87A 2L6MA 1ZBTA 3HPZA 2UUAI 1IBMI 4DV1I 2V8PA 3J81C 4X66I 2N3GA 2UUBI 1MU5A 2RS7A 4LFCI 1QU6A 2JOXA 3IWCA 2B3TB 4DR6E 2B9DA 2J7KA 4LF7E 3PYGA 5CFFE 2UU9I 1Z0TA 4JI2I 1EI1A 4NXNI 5IT9Q 2DEIA 4JI5E 3WU3A 4LFBE 4JI8E 2UXCI 4B3RE 1Z0GA 2VQEE 1XMOE 3K1JA 3ADJA 4DV6E 1MX0A 1RREA 4JI1E 2UUCI 4J8ZA 1UILA 4DR1E 1DI2A 2WZOA 4KQVA 2LJPA 5BR8E 4ED4A 4MYUA 1J26A 1XMQE 5IWAI 4L8NA 1UHZA 2L2NA 2KOUA 1PKPA 4JI4E 4LF9E 1NHIA 3J80Q 4B3TI 4DR4E 3WU4A 4X65E 2JY9A 4GKKI 1RR9A 2F8BA 4PRVA 3H4LA 2LUQA 1IBME 4DV1E 3LPSA 5L3JA 3T1HI 4X66E 2UUBE 1HNZI 2UXDI 1STUA 4LFCE 4DR3I 2V88A 1RC7A 4IZKA 2ODRD 1USUA 2O1VA 2R3VA 5FLXC 3J81Q 4KHPI 2V2ZA 1I94I 2VQFI 2A2DA 4M30A 2UU9E 4JI2E 4NXNE 1X48A 1EKZA 1FKAE 2LTRA 2ODRC 3ADIA 4NXMI 2GQ0A 1B62A 2EZ6A 1Z59A 1N32I 2JWOA 2Z5BA 3B8HA 2HKJA 2UUCE 1XHKA 4UT4A 2MC6A 4OX9I 1YYWA 2HK2A 3HXLA 3K85A 2RS6A 4JV5I 3LTOA 2K4VA 1FJGI 5IWAE 1PVGA 2FV4B 2V85A 3LMLA 2Z5CA 3WU5A 3K6QA 4GKKE 4JI6E 1A6FA 3DF6A 1ZXNA 4FWHA 4LF8I 4DV7I 3OTOI 4DUZI 4P7DA 2F4VI 4F9BB 4N3OA 3T1HE 4R03A 3HPSA 1HNZE 2UXDE 1QZRA 2M7QA 4DR3E 5LL6R 3HJCA 4LF5I 4IZJA 4DKKA 4JG4A 3HULA 4KHPE 1I94E 2VQFE 2IOQA 3J7Yp 1N34I 5T6JA 2HHHI 1N33E 4DU8A 5FLXQ 3C4BA 4K0KE 4DV2I 4DV0I 4DR2I 3LLHA 3F0NA 4B3MI 2HK3A 2KONA 2V86A 1H7SA 2BM1A 1N32E 4JI3I 1N0VC 5AE3A 3CWVA 3GONA 3J7AM 1XNRI 1FWLA 1NHHA 3F6GA 1KTVA 2CZ9A 4JYAI 1HNXE 4DV5E 2YT4A 4Z7CA 4GEQB 3D4JA 4XTJA 4M2ZA 2CPNA 2NA2A 1FJGE 5F3WA 2G7HA 4DPYA 2CGEA 1VISA 3QT6A 2X36A 3AV0A 4JI7E 2O1UA 2PNLA 4DUYI 4WUBA 3B82A 1UEKA 5AE1A 2V34A 4Z7YA 2LMZA 3M6AA 3V5RA 2DSYA 5LMUE 1KKHA 4LF8E 4DV7E 4DUZE 3VYXA 2CG9A 4USKA 2LBSB 1YYOA 4FW9A 2L2KB 1YZ9A 4LF5E 4HACB 1ZM9A 1ZM4A 4WUDA 1NHJA 4DPXA 3Q6NA 1N34E 4BBYA 2M1SA 2HHHE 2V89A 4LF4E 4F9CB 4DV2E 4DR2E 4DV0E 1KIJA 4IZJD 3ZKBA 3ZOQB 2N3HA 3ZKDA 2O1WA 3HQ1A 2UUAE 3P06A 2DIXA 4JI3E 3H09A 1XNRE 3QT7A 4AQYI 4DR7I 4RPFA 4JYAE 5LMNI 2UXBI 1N0UA 3ZZTA 5AASA 4HY1A 1XNQI 2MC5A 3JTZA 4FWGA 4BC9A 2NUEA 4LF6I 4DV3I 2EWLA 3KWRA 2O1TA 4LTYA 2BM0A 2UXCE 2NUGA 2ZBKB 4B3SI 2E1MA 2FTXB 1S16A 3PYFA 4X62I 1T4NA 1FWKA 1MG7A 3LNUA 1D6TA 4KZSA 2HFUA 1HNWI 1PIEA 2JVAA 1GZ6A 4DMIA 1Z5CA 4B3TE 1IBKI 2X7IA 2Z5EA 3PYEA 2RTXA 1Y4UA 5IT9C 1Z0VA 5AE2A 3J7AG 1N36I 1OJ4A 1B63A 3QT5A 2IOPA 4AQYE 4DR7E 4URLA 5LMNE 2UXBE 1BKNA 4BC7A 2L33A 1XNQE 4JI5I 3HTXA 2ZM6I 2L92A 3RMPA 1RQ0A 2VQEI 4LF6E 4DV6I 4DV3E 4NXME 3K17A 2L3CA 1Z5AA 3C4TA 2DB2A 4DR1I 4X64I 2VF1A 5BR8I 4WUCA 1T4LB 2EFGA 4YY3I 4JI0I 3J80C 2NPFA 2H36X 4X62E 2E5LI 3IWBA 1XMQI 2KHXA 4OX9E 1NZ0A 4JV5E 4DU7A 1J5EI 1HNWE 3ZM7A 1IBLI 4DR4I 1WUUA 4X65I 4UTGA 3ZZ0A 4OOGC 3VK6A 1Z0EA 2V83A 4I8OA 1EA6A 2M4IA 1FI4A 2B7VA 1IBKE 1HR0I 4WSPA 4I3HA 1T4OA 2AJ4A 3Q6MA 1H72C 5ADZA 3OTOE 2JR1A 4LU9A 2F4VE 1H74A 1X47A 2V8QB 5A2QC 1N36E 2DEJA 2V2VA 5GMDA 4IZKB 3JAMC 4M1KA 4DR5I 4Q28A 1Z5BA 2PNMA 3ZZUA 2ZM6E 1Y4SA 4FWDA 4R1FA 5DNYA 3FIGA 4R8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTS A;  1ZM2 A;  4B3M E;  1Z0C A;  3ADG A;  4GKJ I;  4X64 E;  1ZXM A;  4YY3 E;  2L3J A;  4JI0 E;  4DPT A;  2E5L E;  1ZM3 A;  5GME A;  2RSM A;  2VF3 A;  1J5E E;  2GS8 A;  2LUP B;  1IBL E;  4YHH I;  3T1Y I;  4JI6 I;  2NUF A;  1H73 A;  4DV4 I;  2DMY A;  1WHN A;  4DXL A;  3VYY A;  4X8W A;  4DUY E;  2BV3 A;  1HR0 E;  4DPW A;  2E1R A;  3P1X A;  1H7U A;  2L2M A;  4PRX A;  2V2Q A;  1DAR A;  4HAC A;  4LFA I;  1ELO A;  4P52 A;  4FN5 A;  2B7T A;  4HXZ A;  4DPU A;  2XEX A;  3Q1Q A;  1N33 I;  3WU6 A;  1Z0B A;  4K0K I;  4DR5 E;  2OI2 A;  4ZVI A;  5A2Q Q;  3JAM Q;  2ZIT A;  2LJH A;  1X49 A;  2WW4 A;  1K47 A;  4DR6 I;  1S4E A;  4GKJ E;  2R42 A;  3QT8 A;  4LF7 I;  1HNX I;  4DV5 I;  3V2U C;  1O0W A;  4EMD A;  4PU9 A;  2HFS A;  4WFT A;  4JI7 I;  3B78 A;  3PYD A;  4LFB I;  1GQE A;  3T1Y E;  4YHH E;  4JI8 I;  2A2C A;  4B3R I;  1XMO I;  4MYT A;  5LMU I;  2Q2E B;  4DV4 E;  4JI1 I;  4HYM A;  1KVK A;  1Z0W A;  4WYQ B;  1YYK A;  4B3S E;  1WHQ A;  1U2R A;  4LFA E;  4USM A;  4P7A A;  2LRS A;  2MDR A;  3ADL A;  2HKE A;  4JI4 I;  4LF9 I;  4LF4 I;  1FNM A;  2IHR 1;  1ZBT A;  2UUA I;  1IBM I;  4DV1 I;  2V8P A;  3J81 C;  4X66 I;  2N3G A;  2UUB I;  1MU5 A;  2RS7 A;  4LFC I;  1QU6 A;  2B3T B;  4DR6 E;  2J7K A;  4LF7 E;  3PYG A;  5CFF E;  2UU9 I;  1Z0T A;  4JI2 I;  1EI1 A;  4NXN I;  5IT9 Q;  2DEI A;  4JI5 E;  3WU3 A;  4LFB E;  4JI8 E;  2UXC I;  4B3R E;  1Z0G A;  2VQE E;  1XMO E;  3K1J A;  3ADJ A;  4DV6 E;  1MX0 A;  1RRE A;  4JI1 E;  2UUC I;  1UIL A;  4DR1 E;  1DI2 A;  4KQV A;  2LJP A;  5BR8 E;  4ED4 A;  4MYU A;  1J26 A;  1XMQ E;  5IWA I;  1UHZ A;  2L2N A;  1PKP A;  4JI4 E;  4LF9 E;  1NHI A;  3J80 Q;  4B3T I;  4DR4 E;  3WU4 A;  4X65 E;  2JY9 A;  4GKK I;  1RR9 A;  4PRV A;  3H4L A;  2LUQ A;  1IBM E;  4DV1 E;  3LPS A;  5L3J A;  3T1H I;  4X66 E;  2UUB E;  1HNZ I;  2UXD I;  1STU A;  4LFC E;  4DR3 I;  1RC7 A;  2R3V A;  5FLX C;  3J81 Q;  4KHP I;  2V2Z A;  1I94 I;  2VQF I;  2A2D A;  4M30 A;  2UU9 E;  4JI2 E;  4NXN E;  1X48 A;  1EKZ A;  1FKA E;  2LTR A;  3ADI A;  4NXM I;  1B62 A;  2EZ6 A;  1Z59 A;  1N32 I;  3B8H A;  2HKJ A;  2UUC E;  1XHK A;  4UT4 A;  4OX9 I;  1YYW A;  2HK2 A;  2RS6 A;  4JV5 I;  3LTO A;  1FJG I;  5IWA E;  1PVG A;  3WU5 A;  4GKK E;  4JI6 E;  1A6F A;  1ZXN A;  4FWH A;  4LF8 I;  4DV7 I;  3OTO I;  4DUZ I;  2F4V I;  3T1H E;  1HNZ E;  1QZR A;  2UXD E;  4DR3 E;  5LL6 R;  4LF5 I;  4DKK A;  4JG4 A;  3HUL A;  4KHP E;  1I94 E;  2VQF E;  3J7Y p;  1N34 I;  2HHH I;  1N33 E;  4DU8 A;  5FLX Q;  3C4B A;  4K0K E;  4DV2 I;  4DV0 I;  4DR2 I;  3LLH A;  3F0N A;  4B3M I;  2HK3 A;  1H7S A;  2BM1 A;  1N32 E;  4JI3 I;  1N0V C;  3CWV A;  3GON A;  3J7A M;  1XNR I;  1FWL A;  1NHH A;  1KTV A;  2CZ9 A;  4JYA I;  1HNX E;  4DV5 E;  2YT4 A;  4Z7C A;  3D4J A;  4XTJ A;  4M2Z A;  2CPN A;  2NA2 A;  1FJG E;  4DPY A;  1VIS A;  3QT6 A;  2X36 A;  4JI7 E;  4DUY I;  4WUB A;  3B82 A;  1UEK A;  4Z7Y A;  2V34 A;  3M6A A;  3V5R A;  5LMU E;  1KKH A;  4LF8 E;  4DV7 E;  4DUZ E;  3VYX A;  4USK A;  2LBS B;  1YYO A;  4FW9 A;  2L2K B;  1YZ9 A;  4LF5 E;  4HAC B;  1ZM9 A;  1ZM4 A;  4WUD A;  1NHJ A;  4DPX A;  1N34 E;  2HHH E;  4LF4 E;  4DV2 E;  4DR2 E;  1KIJ A;  4DV0 E;  3ZKB A;  2N3H A;  3ZKD A;  2UUA E;  2DIX A;  4JI3 E;  1XNR E;  3QT7 A;  4AQY I;  4DR7 I;  4RPF A;  4JYA E;  5LMN I;  2UXB I;  1N0U A;  3ZZT A;  4HY1 A;  1XNQ I;  4FWG A;  2NUE A;  4LF6 I;  4DV3 I;  2BM0 A;  2UXC E;  2NUG A;  2ZBK B;  4B3S I;  1S16 A;  3PYF A;  4X62 I;  1T4N A;  1FWK A;  1MG7 A;  3LNU A;  1D6T A;  2HFU A;  1HNW I;  1PIE A;  2JVA A;  1Z5C A;  4B3T E;  1IBK I;  2X7I A;  3PYE A;  2RTX A;  5IT9 C;  1Z0V A;  3J7A G;  1N36 I;  1OJ4 A;  1B63 A;  3QT5 A;  4AQY E;  4DR7 E;  4URL A;  5LMN E;  2UXB E;  1BKN A;  2L33 A;  1XNQ E;  4JI5 I;  3HTX A;  2ZM6 I;  1RQ0 A;  2VQE I;  4LF6 E;  4DV6 I;  4DV3 E;  4NXM E;  3K17 A;  2L3C A;  1Z5A A;  3C4T A;  2DB2 A;  4DR1 I;  4X64 I;  5BR8 I;  4WUC A;  1T4L B;  2EFG A;  4YY3 I;  4JI0 I;  3J80 C;  2NPF A;  4X62 E;  2E5L I;  1XMQ I;  2KHX A;  4OX9 E;  1NZ0 A;  4JV5 E;  4DU7 A;  1J5E I;  1HNW E;  3ZM7 A;  1IBL I;  4DR4 I;  1WUU A;  4X65 I;  4UTG A;  3ZZ0 A;  4OOG C;  1Z0E A;  1EA6 A;  1FI4 A;  2B7V A;  1IBK E;  1HR0 I;  4I3H A;  1T4O A;  2AJ4 A;  1H72 C;  3OTO E;  2F4V E;  1H74 A;  1X47 A;  5A2Q C;  1N36 E;  2DEJ A;  2V2V A;  5GMD A;  3JAM C;  4M1K A;  4DR5 I;  1Z5B A;  3ZZU A;  2ZM6 E;  4FWD A;  4R1F A; 
#chains in the Genus database with same CATH topology
 2R1F A;  2LTS A;  2EN7 A;  3MSW A;  1ZM2 A;  1BB8 A;  2YZT A;  4B3M E;  2RSI A;  1Z0C A;  4X9J A;  2LE2 A;  2NN6 F;  3ADG A;  4GKJ I;  4X64 E;  2Z5B B;  2C37 B;  5DNX A;  1ZXM A;  4IJD A;  3OML A;  1BBO A;  4YY3 E;  2L3J A;  4JI0 E;  3F6H A;  1UDQ A;  1HK7 A;  2E5L E;  4IS9 A;  4DPT A;  1ZM3 A;  1UDS A;  4LPF A;  5GME A;  2JE6 B;  1G2D C;  2RSM A;  2VF3 A;  1J5E E;  2GS8 A;  4OKG A;  2VE7 C;  2YTG A;  2LUP B;  1IBL E;  1USV A;  4YHH I;  3T1Y I;  3AUZ A;  1F2I G;  4JI6 I;  2NUF A;  1H73 A;  2Z5C B;  4DV4 I;  2DMY A;  1WHN A;  2EN6 A;  4DXL A;  3VYY A;  4X8W A;  1NCS A;  3DJW A;  4DUY E;  3ECR A;  1JK1 A;  2EQ0 A;  1HR0 E;  2BV3 A;  3CDI A;  4DPW A;  2YU8 A;  3P1X A;  1H7U A;  1XXE A;  2L2M A;  2E1R A;  5K36 B;  4PRX A;  2V2Q A;  1DAR A;  2BA1 D;  2WBU A;  4HAC A;  4LFA I;  4L5N C;  1ELO A;  4FN5 A;  4P52 A;  2B7T A;  2EMK A;  1WXR A;  4HXZ A;  4DPU A;  2YTJ A;  2MKD A;  2PNZ B;  1ZBQ A;  2XEX A;  4IZJ B;  5JEA A;  2NN6 D;  3M7N G;  2JOB A;  2YTE A;  3Q1Q A;  2LJU A;  3PRY A;  1N33 I;  1B69 A;  5FWK A;  3WU6 A;  2O3Z A;  4P78 A;  1Z0B A;  1OYS A;  4DR5 E;  2OI2 A;  4FW6 A;  4MU1 A;  4K0K I;  4ZVI A;  5A2Q Q;  2YTI A;  4MDT A;  1Y6Z A;  2YPN A;  4BMJ A;  3JAM Q;  2ZIT A;  5DRR A;  2LJH A;  1E3H A;  3JU0 A;  1X49 A;  4O4K A;  4R2E A;  2NN6 C;  4WPY A;  2BA0 G;  5AC5 A;  3P3G A;  2J65 A;  2WW4 A;  5ELW A;  4R2S A;  1K47 A;  1P42 A;  3KRN A;  2EN1 A;  4DR6 I;  1S4E A;  1A1I A;  1HNX I;  4GKJ E;  4LOM A;  4MLV A;  2R42 A;  1SR9 A;  2EMC A;  3QT8 A;  4LF7 I;  3DD6 A;  4F9A B;  4FK5 C;  2HGH A;  3P3E A;  3V2U C;  1KYQ A;  2FGG A;  4TUI A;  4DV5 I;  1O0W A;  4EMD A;  4PU9 A;  2HFS A;  2EM5 A;  2EOZ A;  2ENH A;  2LCE A;  4WFT A;  5JEA F;  4JI7 I;  3B78 A;  3PYD A;  4LFB I;  3THO B;  1EH7 A;  1A1L A;  1GQE A;  1PJQ A;  5LLQ A;  3T1Y E;  4YHH E;  2EN8 A;  4BS9 A;  4JI8 I;  2A2C A;  4B3R I;  1XMO I;  4MYT A;  5LMU I;  2Q2E B;  4DV4 E;  5DRO A;  4JI1 I;  2C38 A;  2Q8U A;  2EMA A;  1KVK A;  4HYM A;  2YTP A;  1DQ3 A;  4WYQ B;  1Z0W A;  2NN6 E;  4OO1 B;  2L8T A;  1YYK A;  1P47 A;  4B3S E;  1WHQ A;  1U2R A;  4R2R A;  2PO1 A;  4ZYG A;  4BCA A;  4LFA E;  1X5W A;  4M0V A;  5A6B A;  4USM A;  4P7A A;  1UN6 B;  2LRS A;  2MDR A;  2WP8 A;  3GCM A;  3BID A;  3ADL A;  1IQS A;  2HKE A;  1ZAA C;  3QG5 C;  3M85 G;  3U1K A;  4JI4 I;  4LF9 I;  4F54 A;  4LF4 I;  2PO0 A;  1FNM A;  2LO3 A;  2IHR 1;  3IWD A;  4TUG A;  3HKM A;  2V87 A;  2L6M A;  3BGH A;  1ZBT A;  2EMY A;  3TQM A;  3HPZ A;  3H1C A;  4HEI A;  2UUA I;  3L7Z B;  1IBM I;  4DV1 I;  2V8P A;  4MU0 A;  1PJS A;  3J81 C;  5JEA D;  2N3G A;  4X66 I;  2E72 A;  5KL3 A;  3EPH A;  1MU5 A;  2RS7 A;  4MLQ A;  2GO4 A;  4LFC I;  1QU6 A;  2PO2 B;  2JOX A;  3IWC A;  1ZR9 A;  5A6J A;  2CT1 A;  2B3T B;  4DR6 E;  2B9D A;  2J7K A;  2VES A;  2JT2 A;  4LF7 E;  3PYG A;  5CFF E;  2EM0 A;  1E3P A;  1YH8 A;  2UU9 I;  1Z0T A;  4JI2 I;  1EI1 A;  4NXN I;  5C0X A;  5IT9 Q;  2EPZ A;  1YFH A;  2DEI A;  1TF3 A;  2A25 A;  2IES A;  2EJ4 A;  4NZV A;  4WXD A;  2LVH A;  4JI5 E;  2EOY A;  2C39 B;  4LFB E;  1AH5 A;  3L00 A;  1IQO A;  3WU3 A;  2I9I A;  4JI8 E;  4WX9 A;  1Y60 A;  1X6F A;  1N32 I;  3KZY A;  4B3R E;  2YSP A;  2VQE E;  1XMO E;  1Z0G A;  2CVE A;  3K1J A;  3P76 A;  4FW7 A;  3ADJ A;  4DV6 E;  1MX0 A;  4GQU A;  1RRE A;  4GZN C;  4JI1 E;  2UUC I;  4BA2 A;  4J8Z A;  1UIL A;  4DR1 E;  1DI2 A;  2ENA A;  2WZO A;  2EMX A;  1A1H A;  4KQV A;  2LJP A;  5BR8 E;  4ED4 A;  2RQL A;  5KL5 A;  4MYU A;  5AC4 A;  2EL5 A;  1J26 A;  4BA1 A;  3PS2 A;  3EPL A;  1XMQ E;  1YUI A;  5IWA I;  4L8N A;  1YSA C;  1UHZ A;  5C0X F;  2GPI A;  2L2N A;  5A6A A;  2KOU A;  1PKP A;  2EPM X;  4JI4 E;  4LF9 E;  1NHI A;  3J80 Q;  4B3T I;  2JPA A;  4DR4 E;  2YTQ A;  3WU4 A;  4X65 E;  2JY9 A;  2J7J A;  4GKK I;  2EQ1 A;  1RR9 A;  2F8B A;  2EOI A;  5A6B D;  4PRV A;  3H4L A;  2EOS A;  2CSH A;  2ELZ A;  2LUQ A;  1IBM E;  4DV1 E;  2YU5 A;  4R2A A;  4R2P A;  2DRP A;  2EE8 A;  3LPS A;  4X66 E;  2UUB E;  5L3J A;  2I13 A;  3T1H I;  1HNZ I;  2UXD I;  1JK2 A;  1STU A;  4LFC E;  4DR3 I;  2WNR B;  2V88 A;  1RC7 A;  2EQ3 A;  4IZK A;  2ODR D;  1USU A;  1G2F C;  2O1V A;  5EKW A;  2R3V A;  5FLX C;  3J81 Q;  4KHP I;  2V2Z A;  4IFD A;  1I94 I;  4QNJ A;  2A2D A;  2VQF I;  2EPU A;  1PDA A;  4M30 A;  2UU9 E;  4JI2 E;  3PS3 A;  2EM3 A;  4NXN E;  3PS1 A;  1X48 A;  1EKZ A;  1FKA E;  3EQ1 A;  2LTR A;  2ODR C;  3ADI A;  2YRH A;  4NXM I;  2ELY A;  2F1D A;  2GQ0 A;  2IER A;  2EL6 A;  1B62 A;  2EZ6 A;  1R6M A;  1Z59 A;  2JWO A;  2Z5B A;  2GLI A;  2C37 A;  3B8H A;  5C0X D;  2EMW A;  2UXC I;  2HKJ A;  2UUC E;  1XHK A;  1OYR A;  4R2D A;  4UT4 A;  4WXC A;  2MC6 A;  3M7N D;  4OX9 I;  2YRM A;  1YYW A;  4AM3 A;  2HK2 A;  3HXL A;  5KL7 A;  4R2C A;  3K85 A;  2JE6 A;  2RS6 A;  4JV5 I;  4U3B A;  2R76 A;  3LTO A;  5C0X C;  2EL4 A;  2K4V A;  1FJG I;  5K36 F;  4IFD F;  5IWA E;  1PVG A;  2FV4 B;  2EN4 A;  4Q35 B;  4R2Q A;  2V85 A;  3LML A;  4NHR A;  2YSO A;  2Z5C A;  4OZE A;  3WU5 A;  3K6Q A;  2BR2 B;  4GKK E;  3GLL A;  4JI6 E;  1A6F A;  3DF6 A;  1TN9 A;  1ZXN A;  3GME A;  4FWH A;  4LCG A;  5K36 A;  4LF8 I;  2D9H A;  3OTO I;  2NN6 B;  4DUZ I;  4P7D A;  4DV7 I;  1RHY A;  2F4V I;  4F9B B;  4N3O A;  1EH8 A;  3T1H E;  4R03 A;  3HPS A;  1HNZ E;  2UXD E;  1QZR A;  2EN2 A;  2M7Q A;  2JEB B;  2PNZ A;  4DR3 E;  5LL6 R;  3HJC A;  4LF5 I;  2NAB A;  4IZJ A;  2JEA B;  4DKK A;  4JG4 A;  1UDO A;  3HUL A;  2EMI A;  4KHP E;  3C6K A;  1I94 E;  2VQF E;  1OYP A;  2IOQ A;  3J7Y p;  1N34 I;  2BB8 A;  5T6J A;  1X6E A;  2CTD A;  2HHH I;  1N33 E;  4DU8 A;  5C0X E;  5FLX Q;  3C4B A;  4K0K E;  4DV2 I;  2EOQ A;  4DV0 I;  4DR2 I;  2EOF A;  4F6N A;  3LLH A;  3F0N A;  2WBT A;  5DNL A;  4B3M I;  2EM8 A;  2HK3 A;  2KON A;  4IFD D;  2V86 A;  2EOJ A;  1UBD C;  1H7S A;  2BM1 A;  1BBG A;  1N32 E;  4JI3 I;  1N0V C;  2RPC A;  5AE3 A;  1KJK A;  3CWV A;  1YHC A;  3GON A;  1DGC A;  2EPK X;  2JYA A;  1XNR I;  3J7A M;  2EMZ A;  1FWL A;  1NHH A;  3F6G A;  1KTV A;  2CZ9 A;  4JYA I;  1HNX E;  3M85 D;  4DV5 E;  2BBG A;  1L4S A;  2YT4 A;  4ISA A;  1WRJ A;  2EPN A;  4GEQ B;  3D4J A;  5JEA C;  4Z7C A;  4XTJ A;  2EPL X;  4M9V C;  4M2Z A;  2CPN A;  2EOH A;  2NA2 A;  1FJG E;  5F3W A;  4BHC A;  2EM2 A;  2G7H A;  2BR2 A;  2CGE A;  1VIS A;  4DPY A;  2DGC A;  2X36 A;  3QT6 A;  2EM4 A;  3AV0 A;  5KL2 A;  2PRT A;  4JI7 E;  2O1U A;  2PNL A;  4U3D A;  2NN6 A;  4DUY I;  3MHS C;  4WUB A;  2EN3 A;  3B82 A;  1UEK A;  5AE1 A;  2V34 A;  4Z7Y A;  4OO1 A;  2LMZ A;  4MU4 A;  3M6A A;  1LLM C;  2DSY A;  5LMU E;  1KKH A;  3V5R A;  4LF8 E;  4DV7 E;  1SFE A;  4DUZ E;  3VYX A;  4WSG A;  3THN A;  2CG9 A;  3P3C A;  4AID A;  4USK A;  2LBS B;  1YYO A;  4FW9 A;  2L2K B;  1YZ9 A;  2JP9 A;  4NBQ A;  4LF5 E;  4HAC B;  1ZM9 A;  1ZM4 A;  4QNK A;  4WUD A;  3M99 B;  4F2J C;  1MEY C;  1A1K A;  1NHJ A;  5A6K A;  2UUB I;  4DPX A;  5K36 D;  1EH6 A;  3BF2 A;  4HTG A;  3Q6N A;  2YRK A;  5JEA B;  1N34 E;  4BBY A;  2M1S A;  2GO3 A;  2HHH E;  5JEA E;  2K7I A;  2V89 A;  4F9C B;  4DV2 E;  4DR2 E;  4DV0 E;  4LF4 E;  1KIJ A;  3L7Z A;  1VI7 A;  4IZJ D;  3NZK A;  1QNT A;  3ZOQ B;  3ZKB A;  1IMU A;  5K36 C;  2EML A;  2N3H A;  2PO2 A;  2O1W A;  4MU3 A;  3ZKD A;  3HQ1 A;  4ZYE A;  2UUA E;  3P06 A;  2DIX A;  3U1Y A;  4OO1 F;  4JI3 E;  3H09 A;  1XNR E;  2LV2 A;  1X3C A;  3QT7 A;  1YPN A;  2EPX A;  4AQY I;  4DR7 I;  2WCC 3;  2YWQ A;  4RPF A;  2EMB A;  4JYA E;  2YTF A;  5LMN I;  2UXB I;  1N0U A;  2BA1 G;  3ZZT A;  2M9A A;  5AAS A;  4HY1 A;  1XNQ I;  2MC5 A;  1T39 A;  3JTZ A;  2C39 A;  2DMI A;  4FWG A;  4BC9 A;  1N3G A;  2NUE A;  3BBG A;  4O24 A;  4LF6 I;  2EPC A;  4DV3 I;  1NEI A;  2EWL A;  3KWR A;  2O1T A;  4LTY A;  2BM0 A;  4N4R B;  5EL9 A;  2UXC E;  3CDJ A;  2NUG A;  2ZBK B;  4B3S I;  2E1M A;  2FTX B;  1S16 A;  2C38 B;  3PYF A;  5K36 E;  2EPP A;  4X62 I;  2EOO A;  1T4N A;  2EOR A;  1FWK A;  1MG7 A;  3LNU A;  2PO1 B;  1D6T A;  2JXP A;  4KZS A;  4OO1 D;  2HFU A;  4RHB B;  5KL4 A;  1HNW I;  3UK3 C;  1PIE A;  2WP8 B;  2EOE A;  4JI5 I;  2EPA A;  2JVA A;  1GZ6 A;  4DMI A;  2BA0 D;  1Z5C A;  4B3T E;  2PO0 B;  1MGT A;  1IBK I;  4LCH A;  2EM7 A;  2X7I A;  4J3D A;  4FW5 A;  2Z5E A;  3PYE A;  2RTX A;  4OO1 C;  5IV8 B;  2EM9 A;  4O5G A;  2WNR A;  1Y4U A;  5IT9 C;  2EOM A;  3VHT B;  1Z0V A;  5AE2 A;  3J7A G;  1N36 I;  1OJ4 A;  1A1F A;  1B63 A;  3QT5 A;  4LCF A;  2IOP A;  4AQY E;  3MHH C;  1Z1B A;  4DR7 E;  4URL A;  5LMN E;  2AE8 A;  2UXB E;  2HJJ A;  5IXM B;  1BKN A;  4BC7 A;  2L33 A;  1XNQ E;  1TF6 A;  1T38 A;  2YTD A;  1YUJ A;  1RMD A;  3HTX A;  3UHM A;  5C0X B;  2ZM6 I;  4IS1 C;  2ADR A;  5DRP A;  2L92 A;  3RMP A;  1RQ0 A;  2VQE I;  4LF6 E;  1A1J A;  2HC5 A;  4DV6 I;  4DV3 E;  4NXM E;  1GTK A;  3K17 A;  2VRD A;  1X6H A;  2L3C A;  1Y5Y A;  1Z5A A;  3C4T A;  4F6M A;  2DB2 A;  2EPR A;  4X64 I;  4DR1 I;  2DLQ A;  1UDN A;  2VF1 A;  4BHB A;  5BR8 I;  4BA2 B;  4OO1 E;  4WUC A;  2MDG A;  1T4L B;  5KL6 A;  2LT7 A;  1AAY A;  2EFG A;  4JI0 I;  3J80 C;  2NPF A;  2H36 X;  4YY3 I;  2EM6 A;  4X62 E;  2E5L I;  3IWB A;  1XMQ I;  1R6L A;  2DLK A;  2KHX A;  4O43 A;  4OX9 E;  4IFD C;  1WJP A;  4RH8 A;  1NZ0 A;  2EMH A;  2MKN A;  4JV5 E;  4BA1 B;  4DU7 A;  1J5E I;  1HNW E;  3ZM7 A;  1IBL I;  4DR4 I;  1WUU A;  4X65 I;  4UTG A;  3ZZ0 A;  3KZZ A;  4OOG C;  3VK6 A;  1Z0E A;  2V83 A;  2EP3 A;  4I8O A;  1ZU1 A;  1EA6 A;  2M4I A;  2GHF A;  2B7V A;  1FI4 A;  1IBK E;  1HR0 I;  5TSE A;  2N8X A;  2EPO A;  4WSP A;  5A69 A;  4I3H A;  1T4O A;  2AJ4 A;  2JEB A;  2EMF A;  1H72 C;  3Q6M A;  3C6M A;  2YTO A;  4KWY A;  5ADZ A;  2JR1 A;  4LU9 A;  4ZYD A;  3OTO E;  2WBS A;  1A1G A;  2F4V E;  2JEA A;  1H74 A;  1X47 A;  2V8Q B;  2ENC A;  5A2Q C;  1N36 E;  2DEJ A;  2V2V A;  4AIM A;  3EPK A;  4MQY A;  5GMD A;  4IZK B;  4ZYH A;  3JAM C;  4M1K A;  3B4T A;  4DR5 I;  4FW3 A;  4IFD B;  1PJT A;  4Q28 A;  1Z5B A;  2PNM A;  3ZZU A;  2ZM6 E;  1Y4S A;  4IFD E;  4FWD A;  4R1F A;  5DNY A;  3EPJ A;  2EMG A;  2EOX A;  3FIG A;  4R8O A;  4FW4 A;  2YTN A;  5DRQ A; 
#chains in the Genus database with same CATH homology
 2LTS A;  3MSW A;  1ZM2 A;  2YZT A;  4B3M E;  1Z0C A;  2LE2 A;  3ADG A;  4GKJ I;  4X64 E;  2Z5B B;  1ZXM A;  3OML A;  4YY3 E;  2L3J A;  4JI0 E;  3F6H A;  1HK7 A;  2E5L E;  4DPT A;  1ZM3 A;  5GME A;  2RSM A;  2VF3 A;  1J5E E;  2GS8 A;  2VE7 C;  2LUP B;  1IBL E;  4YHH I;  1USV A;  3T1Y I;  3AUZ A;  4JI6 I;  2NUF A;  1H73 A;  2Z5C B;  4DV4 I;  2DMY A;  1WHN A;  4DXL A;  3VYY A;  4X8W A;  4DUY E;  3DJW A;  2BV3 A;  1HR0 E;  4DPW A;  2E1R A;  3P1X A;  1H7U A;  2L2M A;  4PRX A;  2V2Q A;  1DAR A;  4HAC A;  4LFA I;  4L5N C;  1ELO A;  4FN5 A;  4P52 A;  2B7T A;  1WXR A;  4HXZ A;  4DPU A;  1ZBQ A;  2XEX A;  4IZJ B;  3Q1Q A;  2JOB A;  3PRY A;  1N33 I;  5FWK A;  3WU6 A;  4P78 A;  1Z0B A;  4K0K I;  4DR5 E;  2OI2 A;  4ZVI A;  5A2Q Q;  1Y6Z A;  4BMJ A;  3JAM Q;  2ZIT A;  2LJH A;  3JU0 A;  1X49 A;  4WPY A;  2WW4 A;  1K47 A;  4DR6 I;  1S4E A;  4GKJ E;  2R42 A;  1SR9 A;  3QT8 A;  4LF7 I;  1HNX I;  4F9A B;  4DV5 I;  3V2U C;  4TUI A;  2FGG A;  1O0W A;  4EMD A;  4PU9 A;  2HFS A;  4WFT A;  4JI7 I;  3B78 A;  3PYD A;  4LFB I;  1GQE A;  3T1Y E;  4YHH E;  4JI8 I;  4BS9 A;  2A2C A;  4B3R I;  1XMO I;  4MYT A;  5LMU I;  2Q2E B;  4DV4 E;  4JI1 I;  4HYM A;  1KVK A;  1DQ3 A;  4WYQ B;  1Z0W A;  2L8T A;  1YYK A;  4B3S E;  1WHQ A;  1U2R A;  4BCA A;  4LFA E;  4M0V A;  4USM A;  4P7A A;  2LRS A;  2MDR A;  3ADL A;  2HKE A;  4JI4 I;  4LF9 I;  4F54 A;  4LF4 I;  1FNM A;  3IWD A;  2IHR 1;  4TUG A;  2V87 A;  2L6M A;  1ZBT A;  3HPZ A;  2UUA I;  1IBM I;  4DV1 I;  2V8P A;  3J81 C;  4X66 I;  2N3G A;  2UUB I;  1MU5 A;  2RS7 A;  4LFC I;  1QU6 A;  2JOX A;  3IWC A;  2B3T B;  4DR6 E;  2B9D A;  2J7K A;  4LF7 E;  3PYG A;  5CFF E;  2UU9 I;  1Z0T A;  4JI2 I;  1EI1 A;  4NXN I;  5IT9 Q;  2DEI A;  4JI5 E;  3WU3 A;  4LFB E;  4JI8 E;  2UXC I;  4B3R E;  1Z0G A;  2VQE E;  1XMO E;  3K1J A;  3ADJ A;  4DV6 E;  1MX0 A;  1RRE A;  4JI1 E;  2UUC I;  4J8Z A;  1UIL A;  4DR1 E;  1DI2 A;  2WZO A;  4KQV A;  2LJP A;  5BR8 E;  4ED4 A;  4MYU A;  1J26 A;  1XMQ E;  5IWA I;  4L8N A;  1UHZ A;  2L2N A;  2KOU A;  1PKP A;  4JI4 E;  4LF9 E;  1NHI A;  3J80 Q;  4B3T I;  4DR4 E;  3WU4 A;  4X65 E;  2JY9 A;  4GKK I;  1RR9 A;  2F8B A;  4PRV A;  3H4L A;  2LUQ A;  1IBM E;  4DV1 E;  3LPS A;  5L3J A;  3T1H I;  4X66 E;  2UUB E;  1HNZ I;  2UXD I;  1STU A;  4LFC E;  4DR3 I;  2V88 A;  1RC7 A;  4IZK A;  2ODR D;  1USU A;  2O1V A;  2R3V A;  5FLX C;  3J81 Q;  4KHP I;  2V2Z A;  1I94 I;  2VQF I;  2A2D A;  4M30 A;  2UU9 E;  4JI2 E;  4NXN E;  1X48 A;  1EKZ A;  1FKA E;  2LTR A;  2ODR C;  3ADI A;  4NXM I;  2GQ0 A;  1B62 A;  2EZ6 A;  1Z59 A;  1N32 I;  2JWO A;  2Z5B A;  3B8H A;  2HKJ A;  2UUC E;  1XHK A;  4UT4 A;  2MC6 A;  4OX9 I;  1YYW A;  2HK2 A;  3HXL A;  3K85 A;  2RS6 A;  4JV5 I;  3LTO A;  2K4V A;  1FJG I;  5IWA E;  1PVG A;  2FV4 B;  2V85 A;  3LML A;  2Z5C A;  3WU5 A;  3K6Q A;  4GKK E;  4JI6 E;  1A6F A;  3DF6 A;  1ZXN A;  4FWH A;  4LF8 I;  4DV7 I;  3OTO I;  4DUZ I;  4P7D A;  2F4V I;  4F9B B;  4N3O A;  3T1H E;  4R03 A;  3HPS A;  1HNZ E;  2UXD E;  1QZR A;  2M7Q A;  4DR3 E;  5LL6 R;  3HJC A;  4LF5 I;  4IZJ A;  4DKK A;  4JG4 A;  3HUL A;  4KHP E;  1I94 E;  2VQF E;  2IOQ A;  3J7Y p;  1N34 I;  5T6J A;  2HHH I;  1N33 E;  4DU8 A;  5FLX Q;  3C4B A;  4K0K E;  4DV2 I;  4DV0 I;  4DR2 I;  3LLH A;  3F0N A;  4B3M I;  2HK3 A;  2KON A;  2V86 A;  1H7S A;  2BM1 A;  1N32 E;  4JI3 I;  1N0V C;  5AE3 A;  3CWV A;  3GON A;  3J7A M;  1XNR I;  1FWL A;  1NHH A;  3F6G A;  1KTV A;  2CZ9 A;  4JYA I;  1HNX E;  4DV5 E;  2YT4 A;  4Z7C A;  4GEQ B;  3D4J A;  4XTJ A;  4M2Z A;  2CPN A;  2NA2 A;  1FJG E;  5F3W A;  2G7H A;  4DPY A;  2CGE A;  1VIS A;  3QT6 A;  2X36 A;  3AV0 A;  4JI7 E;  2O1U A;  2PNL A;  4DUY I;  4WUB A;  3B82 A;  1UEK A;  5AE1 A;  2V34 A;  4Z7Y A;  2LMZ A;  3M6A A;  3V5R A;  2DSY A;  5LMU E;  1KKH A;  4LF8 E;  4DV7 E;  4DUZ E;  3VYX A;  2CG9 A;  4USK A;  2LBS B;  1YYO A;  4FW9 A;  2L2K B;  1YZ9 A;  4LF5 E;  4HAC B;  1ZM9 A;  1ZM4 A;  4WUD A;  1NHJ A;  4DPX A;  3Q6N A;  1N34 E;  4BBY A;  2M1S A;  2HHH E;  2V89 A;  4LF4 E;  4F9C B;  4DV2 E;  4DR2 E;  4DV0 E;  1KIJ A;  4IZJ D;  3ZKB A;  3ZOQ B;  2N3H A;  3ZKD A;  2O1W A;  3HQ1 A;  2UUA E;  3P06 A;  2DIX A;  4JI3 E;  3H09 A;  1XNR E;  3QT7 A;  4AQY I;  4DR7 I;  4RPF A;  4JYA E;  5LMN I;  2UXB I;  1N0U A;  3ZZT A;  5AAS A;  4HY1 A;  1XNQ I;  2MC5 A;  3JTZ A;  4FWG A;  4BC9 A;  2NUE A;  4LF6 I;  4DV3 I;  2EWL A;  3KWR A;  2O1T A;  4LTY A;  2BM0 A;  2UXC E;  2NUG A;  2ZBK B;  4B3S I;  2E1M A;  2FTX B;  1S16 A;  3PYF A;  4X62 I;  1T4N A;  1FWK A;  1MG7 A;  3LNU A;  1D6T A;  4KZS A;  2HFU A;  1HNW I;  1PIE A;  2JVA A;  1GZ6 A;  4DMI A;  1Z5C A;  4B3T E;  1IBK I;  2X7I A;  2Z5E A;  3PYE A;  2RTX A;  1Y4U A;  5IT9 C;  1Z0V A;  5AE2 A;  3J7A G;  1N36 I;  1OJ4 A;  1B63 A;  3QT5 A;  2IOP A;  4AQY E;  4DR7 E;  4URL A;  5LMN E;  2UXB E;  1BKN A;  4BC7 A;  2L33 A;  1XNQ E;  4JI5 I;  3HTX A;  2ZM6 I;  2L92 A;  3RMP A;  1RQ0 A;  2VQE I;  4LF6 E;  4DV6 I;  4DV3 E;  4NXM E;  3K17 A;  2L3C A;  1Z5A A;  3C4T A;  2DB2 A;  4DR1 I;  4X64 I;  2VF1 A;  5BR8 I;  4WUC A;  1T4L B;  2EFG A;  4YY3 I;  4JI0 I;  3J80 C;  2NPF A;  2H36 X;  4X62 E;  2E5L I;  3IWB A;  1XMQ I;  2KHX A;  4OX9 E;  1NZ0 A;  4JV5 E;  4DU7 A;  1J5E I;  1HNW E;  3ZM7 A;  1IBL I;  4DR4 I;  1WUU A;  4X65 I;  4UTG A;  3ZZ0 A;  4OOG C;  3VK6 A;  1Z0E A;  2V83 A;  4I8O A;  1EA6 A;  2M4I A;  1FI4 A;  2B7V A;  1IBK E;  1HR0 I;  4WSP A;  4I3H A;  1T4O A;  2AJ4 A;  3Q6M A;  1H72 C;  5ADZ A;  3OTO E;  2JR1 A;  4LU9 A;  2F4V E;  1H74 A;  1X47 A;  2V8Q B;  5A2Q C;  1N36 E;  2DEJ A;  2V2V A;  5GMD A;  4IZK B;  3JAM C;  4M1K A;  4DR5 I;  4Q28 A;  1Z5B A;  2PNM A;  3ZZU A;  2ZM6 E;  1Y4S A;  4FWD A;  4R1F A;  5DNY A;  3FIG A;  4R8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...