4HACB

Crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
308
structure length
308
Chain Sequence
LVPRGSHMVSCSAPGKIYLFGEHAVVYGETAIACAVELRTRVRAELNDSITIQSQIGRTGLDFEKHPYVSAVIEKMRKSIPINGVFLTVDSDIPVGSGLGSSAAVTIASIGALNELFGFGLSLQEIAKLGHEIEIKVQGAASPTDTYVSTFGGVVTIPERRKLKTPDCGIVIGDTGVFSSTKELVANVRQLRESYPDLIEPLMTSIGKISRIGEQLVLSGDYASIGRLMNVNQGLLDALGVNILELSQLIYSARAAGAFGAKITGAGGGGCMVALTAPEKCNQVAEAVAGAGGKVTITKPTEQGLKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and preliminary X-ray diffraction analysis of mevalonate kinase from Methanosarcina mazei.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Transferase
molecule keywords Mevalonate kinase
total genus 89
structure length 308
sequence length 308
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00288 GHMP_kinases_N GHMP kinases N terminal domain
B PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4hacB02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4hacB01
4LF5I 4B3TI 4R1FA 4WUCA 4B3ME 4HYMA 4JI1I 4KHPE 4NXNE 4DR2I 2Q2EB 5GMDA 4JG4A 4AQYE 2V8PA 4Z7YA 4JI8E 3OTOI 3LTOA 4DV0I 4I3HA 4EMDA 5LMNE 4RPFA 1N36I 2HKJA 2UUCI 1N0VC 4FWGA 1H74A 3WU6A 5GMEA 3QT5A 1D6TA 4JI6E 2ZITA 1J5EE 2V2VA 5IT9C 1N34I 4DR3I 1B62A 1NZ0A 1HR0E 1FWKA 2VF3A 2WW4A 1BKNA 1S16A 4Z7CA 4UTGA 1XMOI 2HHHE 4FWDA 1B63A 4DV2I 2E5LE 1XHKA 2OI2A 4DR2E 1HNXE 3QT6A 1Z5AA 2UXDI 4GKKI 1XMQE 2X7IA 4LFCE 2DEJA 3JAMQ 3T1YE 1XMOE 1N36E 5A2QC 4LF4I 3PYEA 3J80Q 4X65I 1FJGE 1XNQI 1Z0EA 4P52A 4UT4A 3Q1QA 2UXBE 1Z0WA 4PRVA 1Z0TA 4LF8I 1NHJA 4B3RI 2V2QA 3J81C 4DU7A 3PYFA 2X36A 3B8HA 4DPWA 4X62I 3J7AG 4LF9E 4X66E 4DPTA 4JI3E 2UXCE 4DV4I 1Z0GA 3T1YI 2HK2A 2V34A 1IBLI 3LPSA 1N32E 4LFAE 4LF6I 3WU3A 4DPUA 2BM1A 2R3VA 3LNUA 4MYUA 2UUAI 4WUBA 4DUYI 4JI5E 1HNWI 2A2CA 1QZRA 4FWHA 2HFSA 2BV3A 4HXZA 3GONA 3CWVA 1KTVA 3QT7A 2UUBE 1RREA 1FWLA 1ZM3A 1IBKE 4PRXA 1ELOA 3ZZUA 2ZM6E 4DR7I 1MU5A 4DV3E 5BR8E 1Z5CA 3K1JA 1IBLE 2VQFE 4FN5A 1WUUA 4YY3I 4NXMI 4GKJI 5L3JA 1J5EI 1FKAE 2UU9E 4DU8A 4X64I 4JI2E 4DUZE 4DR5I 2F4VI 4DR1E 2ZM6I 3WU5A 4DPYA 4HACA 1NHHA 3M6AA 1MX0A 2UXDE 2HHHI 4GKJE 3V2UC 3PYGA 3T1HI 1EA6A 3HULA 4JV5I 4HACB 4B3TE 4ED4A 1VISA 5IWAI 4DR1I 3ZKDA 1ZXMA 4B3MI 4DV6E 2EFGA 3H4LA 4JYAE 2HKEA 4JI4I 4OX9I 4LF7I 4YHHE 2AJ4A 4LF5E 2LJPA 4PU9A 4JV5E 1PVGA 3K17A 1H7UA 2F4VE 3J80C 4KQVA 4DV7E 1HNZE 1KVKA 4MYTA 4JI8I 4JI3I 4HY1A 4LF8E 4LF7E 3T1HE 4DR3E 2E1RA 3B82A 1Z5BA 4DV6I 1EI1A 5A2QQ 4DR4E 4LFBI 1K47A 1S4EA 1U2RA 4DV1E 2UUAE 1HR0I 4DV2E 4USMA 2E5LI 1Z0CA 4B3SI 5LMUI 2A2DA 4LFAI 4ZVIA 1N33I 1XMQI 4YHHI 4XTJA 4LFCI 2HK3A 1HNWE 4DR7E 3ZZTA 4GKKE 1HNXI 4KHPI 3J81Q 1IBMI 1Z0VA 3ZM7A 1Z59A 1N33E 2VQEI 1RR9A 3B78A 4AQYI 3OTOE 1PKPA 3J7AM 1I94E 1XNRE 5LMNI 4X64E 4X65E 4JI7I 4NXNI 1XNQE 1ZM4A 4DXLA 2NPFA 2ZBKB 5LMUE 1ZXNA 3D4JA 2UXCI 4B3RE 4DV1I 4USKA 1Z0BA 1I94I 1UEKA 4JI7E 2XEXA 4M1KA 2DEIA 1A6FA 3ZKBA 1ZM2A 5FLXC 4X62E 1KKHA 4WUDA 1N32I 4DV5I 4LF9I 4JYAI 1N0UA 1FI4A 2BM0A 1N34E 2VQEE 2GS8A 3ZZ0A 1FNMA 4JI5I 1NHIA 2J7KA 3JAMC 5IWAE 1IBME 4K0KI 1PIEA 4LF6E 4JI4E 3F0NA 1HNZI 4DUYE 1OJ4A 1XNRI 4JI0E 2V2ZA 1ZM9A 4DV7I 1FJGI 2UUBI 4FW9A 4DR6E 4DV3I 4DV5E 1IBKI 1H72C 2UXBI 4JI0I 4LF4E 4URLA 5BR8I 5IT9Q 3QT8A 2VQFI 1KIJA 2CZ9A 1H73A 4YY3E 4JI2I 4DPXA 4K0KE 2UU9I 4NXME 3PYDA 4DR6I 1H7SA 4LFBE 4DUZI 4DR5E 4DR4I 3WU4A 4DV4E 4B3SE 3V5RA 2UUCE 4JI1E 2R42A 4P7AA 5LL6R 4JI6I 1DARA 4X66I 2HFUA 1MG7A 5FLXQ 4OX9E 4DV0E
chains in the Genus database with same CATH superfamily
4OFZA 4M95A 3D9BA 2CG9A 2M2BA 1NDCA 3GCWP 4EO8A 2B7BB 4C7QA 2XM3A 4C8MA 3NOCA 4UOFA 2E5IA 2GAGC 3G2XA 4F36A 5J2MB 3ZTSA 4CT8A 4TKTA 1QLNA 2ILYA 3QPIA 3OL6A 1M5PC 4MU4A 1WF0A 2FC9A 1T02A 3D67A 3R97A 5A8KB 3FEXB 5HN0A 3KLGA 4JG4A 2MY7A 2Y1JA 4AQYE 5L46A 2DNNA 4RU2A 1F6TA 3HHLB 1P27B 3I5CA 3MECA 4QIWD 5E3RA 1B0TA 1VHIA 2F5GA 2RSQA 3MTKA 5F0WA 2R2UA 3OTOI 3GIRA 3OQ2A 4IG0A 1OYPA 2GO8A 3HMJG 3I5BA 2OD6A 2CJKA 4DV0I 5AXNA 1O8BA 2RDJA 1U0HA 5C0XE 1JKHB 2KVIA 4KAIA 2ZWOA 3N0VA 4CWBA 2VD3A 5HMWA 5KG2A 1NK6A 1RAEB 2QMUB 4A48A 1VBYA 4ECYA 1UTAA 3FFIA 4ZP7A 2HFZA 1LQ9A 2MHEA 2GMJA 4WBFA 2VJVA 4ECZA 1D6TA 4C8OA 1NSAA 4U3DA 1FO1A 1RABB 2IRYA 3CJTA 4ZN1A 1VJWA 2HBYB 5E0OA 5A8RB 1RJJA 4DV6J 2B56A 3QLHA 3KK3A 3AOBA 5HATA 3THTA 2PMZD 3GV8B 3C3LA 1TL1B 2VG5A 5DRRA 2C2KB 3RRKA 3JSBA 2LEBA 5J2QA 2HVHA 3ENQA 3AD8C 4NLWA 4DR3I 1CULB 4TVAB 1CPZA 1FWKA 3LP2A 2GQCA 2VOPA 4GKJF 4K4SA 3U1LA 4CTAB 4F4KA 1I5OB 4TXSA 2APOA 2WW4A 4YHHF 1M5OC 2I1RA 1Q7LB 3CSKA 3IG1B 3W5YA 2HRUA 2PO4A 1DQ9A 2UUBJ 4UZCA 1IWGA 4WP8A 1HNIA 4U9RA 2QG9B 5DG7A 3NS5A 4N8OA 5E2QA 2C2ZB 2QV6A 4OZ5A 1XMOI 1IKVB 1QAXA 2HSEB 3NAIA 5J1NA 3D6MB 4JBCA 5LM7E 2ZH3A 3DLHA 4AIMA 2J7UA 2YPYA 1FDDA 5EUHA 4RUAA 5L1IA 3DRPA 2J65A 2X3GA 2WONA 4KYZA 2F1FA 4DR3J 2EFOA 4B3OB 3MUMP 4EEYA 5J1EA 4B3TJ 2B4OA 1Z5AA 1IVZA 1MU2A 5ETLA 3RBZA 4FYYB 3KHHA 4DS4A 3VAFA 1VQ4S 4LF8J 4UY85 4NLYA 3AXMA 3SCKE 3EDQB 4H4KA 3OVAA 3F73A 3ILOA 3JAMQ 5IOLA 2G1HA 3LP1A 4ZLLA 3T1YE 4NLQA 1FK9B 1XMOE 1S1WB 2V63A 2V69A 2CQ1A 2ZJPQ 5A2QC 4U67Q 4G6VB 1RAFB 2C39A 4OX6A 1P42A 3H59A 1N88A 1M5HA 4DL4A 4KGKA 4BLGA 1R31A 2B0GA 2H4YB 2LMIA 5C25B 5LSLA 5J2QB 4KT0C 1OYRA 1FFSB 4O3RA 4X65I 2K7KA 2OSQA 4DJBA 2VFTA 1Z0EA 5KFRA 3M7ND 1RK8A 4ICLB 4IFDB 1Z0WA 3P96A 3UWTA 5KFVA 1S4FA 1SC1B 2OFGX 2KL8A 4OIXA 5ETNA 4AE5A 4NEZA 4ES2A 5EWEA 1VQNS 3DLGA 5JMNA 4JYAJ 5MAOA 4LF8I 2Z30B 3M30A 4PG4A 4CLFA 1TL7A 3PX0A 4B3RI 3QGPA 3HKMA 3AOAA 3RZAA 1HARA 4ED1A 5HJYA 3CB4A 4CYUB 1YTYA 1CQNA 1VQKS 2EEYA 4DU7A 1Q82T 1ZZNA 3MI7X 3Q8PB 4GKKF 2Q6CA 3V6HA 4LF7J 5KT3A 1BY9A 3HHKA 4HL9A 1HBOB 3CJKA 1YWXA 3HHLA 2MYFA 3O8WA 1RT6B 1T3OA 2X36A 3J7AG 1TKTB 2PT0A 2V4JB 2WZ1A 3D6HB 2BJ8A 1QD1A 3FJ2A 5T7LA 4WFZA 2PE8A 1YBUA 3MM8A 4MK7A 3DRXA 3JSRA 3ZZYA 3KK1A 1S0MA 2PMWA 1P9QC 5BYQA 2HQIA 3JXOA 5L1JA 4UOCA 4ZVGA 2ZDPA 1Y9OA 2DK2A 4RUHA 2ZZNA 4RU9A 1RHYA 2JEJA 3T1YI 4W90B 1JLBA 1Q4RA 2XZDB 3FCVA 2OEMA 3RBDA 4TU8A 3HHLD 1HQUB 2AT1B 4IRKA 3F41A 2ZBQA 5C24B 2B9EA 2QFJA 2B51A 1N32E 4IKAA 3MDFA 2LDIA 2Z4PA 5A6WA 3SQGB 5CZXA 5KT7A 2ZHBA 2MSTA 5B0DA 3VCDA 3OW2R 1SC3B 3NBPB 4YR2A 2NQPA 4ZPWR 4QIVA 2HGMA 3LGHA 3NP5A 1AYEA 1WWHA 3DLJA 3QIPB 5AE2A 5DQIA 1VQ7S 5DG8A 1KS2A 1YJNS 4PWDB 3ENVA 4M5LA 3CJRA 4MYUA 5D77A 3K89A 3M8PA 1M5KC 3G9CA 1HLWA 2C2OB 4X66I 1KVIA 1LW2B 2D9OA 2GHWA 3FNNA 4NZ7A 4H54A 4LOMA 4WYWA 2NREA 2YX1A 3A8KA 4OJGA 2F4VF 3JTNA 1FVSA 2NN6B 1FESA 1KSPA 2RDDA 2M8DB 2HEKA 3CCZA 2HWIA 4GC7A 3DYAA 3GR0A 1EP4B 4NCGA 4JI5F 4N3OA 2YQ3A 3AFGA 3N28A 4WTYA 2FZKB 1C1BB 1VDHA 2F7VA 1ZS6A 2MZJA 2JC0A 2VKRA 2PO2A 2J9DE 5D15A 2R2RA 2JX2A 1TL5A 1CBKA 3D0IE 3Q8UA 3GG0A 4N76A 1R0CB 2AJ2A 3MEDB 4NRUA 2JT2A 1NK5A 4DCJB 1U2FA 2M52A 1JJCB 3PJ9A 4X2BA 4W92B 1GT8A 3C6UA 2BOPA 2RQMA 4P2XA 3ETOA 3ZTQA 3BJYA 1D9FA 4PRFA 1UFKA 4UF4A 4FP9A 4O3PA 1XMOJ 2VG7A 4IFVB 2UUBE 3OSNA 1RZMA 3HXMA 4IR1A 1IBLE 1A7GE 1VC0A 4LRDA 1WUUA 3DGPB 3FRYA 5KFBA 1C1CA 4YY3I 5I3UB 1W26A 2U1AA 2GQ0A 5HBMA 3I9ZA 5KFWA 1Q16B 3I0RB 2ZZTA 2UU9J 1WNEA 4QU7A 3W7BA 4N5SA 1GFWB 5HI7A 3KWMA 5LL6d 2KJWA 2KU7A 1TK5A 1VQ8S 1VQYA 3SDEA 2LQ9A 5MLCV 4CNYA 1UCNA 2Z2LA 2AX0A 4PWWA 4DL5A 4PZVA 2ZM6I 3AH6A 4C8ZA 2VDIA 1HMVB 1FNOA 2PD1A 1RTHA 1K73T 2ZVSA 1T94A 2LXUA 5GVQA 1UWBB 3K57A 2JWNA 2WVEA 5D0RA 2D3OR 4ZVQB 3GLLA 4I64A 4XK8C 1KONA 1YH8A 1VS3A 1IR1A 4F3QA 2XMJA 3MCMA 4NWBA 1XMBA 4KFBA 4NASA 3V2UC 3MUVP 2D41A 1FX2A 2AD9A 1KVJA 2CJXB 1VR6A 2RH3A 2CJAA 5H9EK 2BR2A 3HULA 1UZDA 2NN6F 1RQ0A 2RB7A 3B4DA 2V5HG 2PEHA 4MDTA 2M5YA 4KGZB 4E98A 4ZCLA 3QNWB 1U7LA 1SH3A 3HHEA 2DRAA 3QFHA 3NS6A 4DR1I 1VRUA 1WC4A 3AQOA 5CYMB 1GX5A 4O0IA 3FKBA 3KHGA 4K4YA 4JOUA 1SKWA 2IJRA 3NRBA 4YY3F 1HNXF 1ZXMA 2J76E 4DV6E 2MQPA 3IBCB 1S7IA 4DQPA 4URQU 4KE5A 2F1DA 5L8RC 4JYAE 3M8WA 1RT4A 3IBFB 3BGUA 3GIMA 2MKYA 4FNIA 2FZCB 4ELVA 1ULRA 2JFKA 1RTDA 4LF7I 3R1HA 4YN3B 2MXYA 1H2UX 5K36A 1FRXA 3GFHA 4PXEA 4FYXB 3DM2B 4A8WA 3GMGA 2W2MP 4ILRA 4PU9A 1QAIA 1HR0F 5EWGA 1GX6A 3K17A 4DL2A 4LMZA 4CLTA 2CQGA 1WHWA 3LPYA 2F40A 2CQHA 4GVBB 5BJRA 4QYRA 4ZITA 5GADI 2MGZB 2CQ4A 4ANEA 3CCSS 2X1GA 4KGXB 2DJWA 2FVCA 2PNZA 2DTJA 3MR6A 4DV3J 4DV7E 1HNZE 1LWXA 3J81j 1KVKA 1LK7A 1FTCA 1RBAA 4KFBB 4YB1P 2KZMA 3PRYA 2NSCA 3D1OA 2AQ4A 5JEAF 3M6UA 2GQQA 4AT1B 1PYSB 4HH0A 2CAJA 1NRKA 2A6MA 2CWXA 1CJKB 4LF8E 2P2CB 3T1HE 2DIVA 4C3MA 2QSFA 1B0VA 3KG4A 1XWLA 4RR5A 5ETSA 2OH2A 4ATNA 3K5OA 2M8HA 4DR3E 2QRRA 3HVAA 3LAKA 1RISA 2YKOA 3IRXA 2A18A 2M3DA 4RLEA 2XC9A 2Y8YA 3G6YA 2OPPB 1AW0A 2V8DA 1NK0A 4DR6F 1IKWB 3MCSA 2N4CA 3R5CA 2PO1B 1M90T 3E51A 1NSQA 2KZZA 3P3CA 1ZH5A 4J9OA 4LSNB 4DR4E 5HBMB 2UXBJ 3MD1A 1K47A 3OR2B 1C1CB 3FUYA 2J8AA 2AEMA 3NCRA 2MKIA 3TX0A 5JEAA 4E0DA 4DV1E 4NLXA 3GYXB 3BQ2A 1RGVA 4DV4F 2IA6A 4ZVOB 1OPZA 4J90A 4DF4A 5DNXA 2E5LI 1YHQS 1N32F 1OQ3A 2A2DA 5DGAA 3AAWB 3CCUS 1BMQB 4HTJA 4X4SA 1ZZFA 1HBUB 3FDSA 4A8KA 1AFIA 2YKMB 1BD6A 4OZ1A 4UY8T 1XMQI 4OO1E 3MFHA 4FVCA 3U1YA 1C4AA 2RHSB 4NZ0A 2WP8B 1DAXA 2BVZA 4BHQA 1Q78A 1YIJS 2JJ4D 5DRQA 4YY3J 1N52B 1SUQA 2YBVA 3W1YC 2HK3A 3IP0A 4YS2A 5DRPA 2C39B 2KG0A 5D3GA 1HNWE 1QVFR 3L3CA 2H5EA 1IM4A 1X4FA 3BGRA 2W4DA 3SFGA 3ZZTA 1F5CA 3OJUA 1QSYA 2KDOA 1LW2A 2DNHA 3TOQA 2IA0A 2RAQA 1S1VA 1TZ0A 2BDPA 2D3UA 3PIOQ 3RR8A 5E3AA 1OO0B 1T9YA 4I2QA 4FF2A 1Z0VA 5JEAE 1AZSB 1Z59A 2DYAA 3C15A 5EL9A 1F5AA 1PJ6A 1TMMA 3EGWB 3ILIA 5D0HA 1SPBP 2YKAA 4ZS6A 2Y3YA 3PM9A 4OJ3A 3UCZP 3QIPA 4OX7A 3PTWA 3S7RA 2QZ8A 3FCWA 4ECUA 2FIUA 4DCPB 4IS9A 2VQEI 1G1XA 4X62J 1BLUA 4G1QA 4K5SA 1I94E 2DHAA 5IV4A 2OJ3A 1E3HA 4X84A 4PXBA 5KG4A 3CD6S 1IXKA 4DLEA 5LMNI 1K1QA 2DGXA 3IBWA 3QAEA 2RD5C 4OYWA 4B9MA 1R6LA 3DXBA 4X64E 2HQ3A 4RW4A 2G2YA 1U1QA 1Q1KA 5DM6Q 5C42B 4I2PA 1FHTA 4CLPA 1U8SA 5DG9A 2ADBA 3E3XA 4DR4F 1JLQB 3KMSA 4A47A 4DV4J 1R6YA 2XMMA 2FJBB 1VQPS 2DHGA 1SV5B 1R43A 2WP8A 5LMUE 3R2CJ 4C4WA 1ZXNA 1RLCL 1HBUA 1RWVB 2KRBA 2VASA 2W25A 3POTB 3MMAB 4ID5B 4URSA 1T7PA 5FJ4A 2CZ4A 2BW7A 2DGQA 2PEBA 4USWA 3CJKB 3UNGC 5CAAA 2VOOA 4B3RE 2UXCI 1BWVA 2YY3A 3RG6A 3NNAA 2JEIA 5JVHQ 2RVJA 3JYTB 3MEEB 3QO9A 4ALZA 4JI7E 1JXLA 2XNQA 5JEAB 2HBQB 1I94J 2CPIA 3ZKBA 1ZM2A 5LMNJ 4OI2A 1GMWA 3CDIA 4X62E 4MFBB 3P76A 5L9NA 4PWDA 2UUBF 4RWWA 4OHYA 4DR1F 2MB0B 5HQLA 3KLFA 4OHXA 3RYLA 5M2UA 3J7A1 5IS2A 1HHTP 4J9RA 4I1TA 5L39A 1LK5A 2BE9B 1KLMA 3CXCR 2G1DA 4U7CA 5J2NB 2GS8A 3ZZ0A 4K0KJ 4JI5I 2DHSA 3DMJA 3PO5A 1Q0NA 3H2VE 1NPPA 1Y5NB 1JIHA 3QGIA 1TELA 2GMLA 4UQGA 1XEZA 2DB1A 4KGMA 4LRAA 3M9MB 3MM7B 2IVMA 2CJBA 1X9SA 1HNWJ 4CLKA 3L7ZA 4HLBA 4NXNF 3QJLA 2X51A 1FRMA 1FE0A 2K06A 2FLPA 5JEAC 1NCLA 5A8WB 2YNIA 3M9OB 4WE1B 4JI4E 2L9NA 3F0NA 3DOLB 4O3NA 2LVWA 2WNRA 1P1TA 1WF2A 4DUYE 1R6MA 4NLTA 2JE6B 2XSFA 2IIHA 3AXKA 5KFTA 5K36B 1NO8A 2V2ZA 5J1EB 3T9NA 4RWXA 3VGTA 1R8PA 4DEZA 3UO0A 5GAHU 4IZJB 1HYSB 5KG1A 4XO0A 4G65A 4MT1A 3DM2A 4C2MA 5F9NA 3M7NG 1HHQA 1WJ9A 4TLQA 1Y3KA 5FDLB 3BGLA 1LWFA 1EX8A 3N9UC 5ETOA 3FVYA 4K2XA 3W5XA 3H4DA 1WTBA 4DR4J 1U1KA 1UPMB 3SEOA 4FW9A 1PG5B 1TP7A 3VV2B 4DR6E 2ZH2A 4XPEA 4JI0J 2BUNA 4DV5E 2DNPA 1JX4A 1KC8T 1BUXA 4FPIA 5K8MA 5KT5A 3I31A 2KT2A 3NY0A 3MURP 4TN2A 1X4EA 4DR7J 2W7PA 2HNZA 2NXNA 4YDDB 3GV7B 4X62F 2EG2A 1E6YA 4YR3A 4URLA 4CTAA 3BR8A 3PW5A 1WKJA 2QLFB 1KIJA 1LWCB 4DS5A 2CZ9A 2RKIB 1WDDA 3EZOA 5B0GA 5FLXU 1O6XA 2C28A 3JQMA 4X4OA 2P8IA 3NL0A 4Q0BB 4JI2I 1RA6A 2N7YA 3LWMA 3DI6B 5LMNF 1RKJA 1XR6A 4HHHA 5E3PA 1QE1B 2LQ5A 3A3NB 3LA0A 1RACB 4LRFA 4AXJA 3K8VA 1C0UB 2AKWB 5IWAF 1Q81T 2XWYA 4DV7J 3TR5A 5A8RA 1V5VA 3GIKA 3QATA 4OZ3A 1LOUA 4DUZI 4DR4I 3PY8A 2EC2A 4DV4E 1LFPA 1FRLA 1N5YA 3FEYB 1RT3B 1NU4A 2QO3A 3FFIB 3KXDA 2MY8A 4O4GB 3KK2B 2J6TA 7AT1B 4C11A 5D4LA 3D7SB 1NB2A 3PR4A 1WC1A 4JI1E 4QQBA 3S6EA 4KQZA 1WEZA 2M4MA 5AXKA 3RBEA 1XK8A 5LXRA 2I5JA 5HROA 3BSAA 4DR5F 4JI6I 4QWAA 2JEAB 2IVYA 2HLTA 2ILZA 2VPZB 1L3UA 2CIMA 1FF2A 3IAM9 3MECB 2W4CA 3UNYA 4CLYA 1IKXB 4DG1A 3G4SS 4DLGA 1TK0A 2NSBA 1OYSA 4DF8A 3R5DA 4OYZA 1EZZB 3M7VA 5A8KA 2D7SA 1RT5B 2XCPA 2E5HA 4UUWA 1UFLA 5E5NA 4LF5I 4RBTA 3G6ES 1N36F 2Z8QA 4IRCA 3PZPA 4M5HA 5KG6A 3K5NA 1RWNB 1HQ2A 4OHVA 4QIEA 1S9FA 4M5DB 1FA0A 4WUCA 2GO9A 1PSDA 2KYXA 4BA2B 2ACMA 4W98A 3MCNA 2ZEJA 3MGJA 3ZZPA 4DR2I 2HNZB 1JXVA 3K8WA 4OI6A 3HFVA 3G8QA 4L74A 2UZAA 2ZH9A 2J5AA 1X7VA 4WFXA 1TUVA 1RSCA 2BJ9A 2BE2B 2CQDA 2V8PA 5KFQA 3L09A 3LW5C 4YQWA 2CFXA 5KFMA 2OEKA 4N41A 1RHJB 1Y11A 2JZ5A 1ZETA 4CH7A 3CDWA 1WG4A 3PW0A 1NSPA 3V6DA 4KHMA 1N34I 5IT0A 3FSIA 2G2OA 3GJSB 3VGVA 3T6BA 3FQLA 2HFVA 2CRLA 1J2VA 4WFNQ 3NMAA 5CD4A 1YSJA 1B70B 2DNRA 2CPHA 2FLOA 3ELHA 5A2QU 1N36I 3VHQA 1NJIT 2YNGA 5LT5A 4LF5J 1HYSA 2EBGA 4ZA1A 1UL3A 1U8WA 4ZVPB 3TX8A 2XS5A 2L9WA 3NGKA 3WU6A 4I7FB 4F3OA 1JNRB 1XBWA 4JP8A 1TR0A 4FZVA 2B8QA 3BBCA 2HHQA 1RTZA 2J0WA 2DD8S 2R7XA 1IBLJ 2BACA 3C66A 4OL8A 2LXFA 3BV8A 2IDLA 3I0SA 1VRTA 4X4PA 1RBOB 4YR0A 4Q8EA 1H98A 2JFDA 5KFOA 1P9YA 4MK9A 4DL0C 3L7ZB 2WRMA 2WB1D 2OEJA 2C3OA 4DQRA 3W61A 4ZCIA 1Q5YA 3KNGA 5F8GA 1S6QA 1G6BA 3EM1A 3GSIA 3M2UB 2ADCA 4ELTA 5K36D 1PJ5A 4UOGA 4Q44A 2LCWA 3EX7B 1BKNA 1W2BR 2OO4A 3BZQA 2BQUA 1MN7A 4CO4A 1RT6A 4IZJD 3H4BA 4AIDA 1Z4UA 1HBOA 3PRDA 5B7WA 3KNAA 1S16A 5KFEA 1N33J 4C98A 3C14B 2O01C 4PR6A 2CQ0A 3R6LB 1Q53A 3C2PA 1QDUB 4PYAA 4F0KA 4M5IA 5DQHA 3QRRA 3MMCB 4FW3A 1RTIA 2PDAA 4IZKB 1O51A 5KAKA 2MQ8A 1S9GB 3V6KA 1SL0A 2YNFB 4DUZJ 1FE4A 2UUTA 3MOZA 4K4WA 4B3TF 5DROA 2VFVA 4NA3A 2V9WA 2XB2D 4DR2E 5H9EJ 3QO9B 2WVFA 4QIFA 1HNXE 2DR5A 2M70A 3T1AA 1GNKA 4JV1A 1RA7A 3CWJA 1UVLA 2UXDI 1RU1A 3CCJS 3MR5A 2CVIA 3BH7B 4IFDA 1FKOB 1WOSA 1DQAA 2NN6D 2DEJA 4MIAA 3OL7A 4OO1B 1YX2A 1FRJA 4YB7A 1BC6A 2JEFA 2DPJA 4MQYA 2KXFA 1HBNB 2UV8A 4B3RF 2JNJA 2WSEC 4NLOA 4Y3CA 5C25A 5KFFA 1BQXA 4LF4I 2HAIA 2WW8A 5DDPC 2R7RA 2QLXA 1YI2S 2EWHA 2O5DA 4QWEA 1FWPA 4OYAA 3J80Q 1OY9A 4GRSA 4DV2J 2QL9B 3H90A 1FJGE 2V8VA 3RAXA 4WZMA 4YHHJ 3CJ5A 4Q2LA 4UT4A 2ERRA 4IOAQ 1MU2B 2NZCA 2ZFHA 3T1YF 1UVIA 3H1CA 4V19X 3ICLA 3SI8A 4ZJLA 2X1AA 1HI1A 4RW7A 1KWMA 4N56A 1RT2A 2R7OA 3UD3P 3HPOA 2KHCA 4DV5F 2RF2B 4EZ6A 2DNMA 3H5UA 3EVOA 2CGEA 1S5ZA 3Q8QB 3J81C 2YKNB 3T5LA 4USVA 1K8AT 1RAGB 2H5JB 1Y7PA 1U09A 4RNFA 3PJWA 1KQKA 1OSCA 2DITA 8AT1B 2ZE2A 3CCLS 4NXMF 3EDRB 4QWBA 2XY6A 3K7RA 3IR7B 3IO1A 4QR1A 4ZVRB 2HFNA 3B8HA 2ASYA 3N6MA 3UVJB 5CXTA 5KFXA 4DPTA 4JI3E 2UXCE 4TYBA 3PACA 4LUBA 4ED8A 5F8MA 2HPUA 1NHUA 4OYIA 4BC9A 1USUA 3R8YA 1Z0GA 4BA2A 4YB5A 5L1LA 2HK2A 1TKZB 2G13A 3IN5A 4M5DA 1S7HA 3W9JA 4G3IA 4TLRA 2X1BA 4CLZA 1S57A 1B3TA 4EU0A 1IBLI 3LPSA 3T1YJ 4KGVB 4J9QA 2Z58B 3DGVA 2CPDA 1WG1A 1QY7A 3HSGA 4NLVA 3KK3B 2UVUA 4LF9J 4LF6I 2GA7A 3H5XA 4OZEA 1PC4A 1SJQA 3DLKB 3ZO7A 5IQ6A 3WU3A 4HYKA 2EXUA 3CO0P 6FD1A 3CEDA 1B7FA 3GCMA 3DRSA 3SBMA 3V4IB 4HR2A 2G9OA 4RUCA 5G0RB 1RDRA 4FF3A 1HNWF 3NG8A 2OPPA 3SV3A 3W62A 4DUYI 1JLFB 1D09B 1X5SA 2VPXB 1MMLA 3IC1A 2AX1A 3IRXB 4OHWA 4WTOB 2GCFA 4DV0F 2HZVA 1HPZB 2EK1A 3NMRA 2W2PP 4BS2A 4NMXA 3KK2A 3MOJB 1ROFA 2JEBA 5K8NA 1VK8A 1N5YB 1RAJA 5ETTA 3BPDA 3NWRA 2I2YA 1MROB 2PGCA 2O1WA 5K8PA 2FJXA 2BV3A 5AXLA 4CT9A 3CWVA 4AUKA 1E3PA 2B3TB 3QT7A 1RHMB 1NHKL 3BKUA 2OLWA 1Y10A 4KHRA 1MNEA 3T19A 4CH0S 1QE1A 4EI2A 2O3DA 3EE3A 5LXYA 5KFHA 2RRBA 3EPGA 1IBKE 2DXEA 3DRRB 2UXDJ 5KT4A 2FYXA 1TKXA 3KJFB 4OZLA 2PNZB 1XMOF 4HT7A 4TY8B 2KFZA 1VGYA 2E1AA 1HA1A 2Y0SD 3EJMA 1LWCA 3R3TA 4N8NA 1MWZA 2ZKUA 3ZZUA 4C6AA 2HHWA 4RNMA 4DR7F 4YB6A 2GFFA 3G96A 1VBZA 1M1HA 4S0MA 4Y65A 1MU5A 5BR8E 4BCAA 2BE7D 2A10A 2VQFE 1SKSA 3AJ1A 3F44A 2GJ2A 3AD7C 4KV8B 4R0EA 1T0TV 4A46A 2WAQD 3KLEB 4LFCJ 2EKYA 3D6FB 3J81Y 1UVJA 2Y9HA 2HAFA 2E9ZA 1EETB 3W2WA 5F8NA 1L3KA 4DV7I 1K44A 4XAKA 1VQ6S 1UW4A 3H5SA 2E1PA 1NNDA 1CJUB 2SXLA 2F63A 5AJ3J 2LECA 4KH0B 4LCHA 2G2ZA 3Q23A 1BHNA 2HBRB 2LQJA 2ROGA 3GB0A 1U2CA 1YRUA 2DNZA 4LSLB 4M5MA 2B5JB 4ZPCA 2ASLA 3HCXA 2BR0A 3C16A 1OYDA 5EGYA 3MEGA 1UPPA 4ZK7M 1KLNA 3K0JA 2VZ9A 3RB4A 3WU5A 4OX9E 3EYZA 3UPFA 1A0OB 3THPA 1Z1ZA 4XTTA 1L5UA 1H7XA 2FGOA 2ZH5A 2HHTA 5DDQC 2BJEA 4HACA 3PR5B 3HJFA 3VQTA 3UI3A 3KLIB 4AYBD 1UVKA 2V8GA 1FT8A 2W9AA 1MX0A 2QT7A 3TUIC 4AQYJ 2D3O1 3DOLA 2AE8A 4DSJA 2HVEA 3P06A 1TUWA 5DM7Q 3GU0A 5A8WA 1JJ2R 1BXNA 1DQ8A 3OBIA 1S0OA 3ENWA 1EA6A 2CQ2A 4LR7A 1R0AB 4H4MA 4OYXA 2NCKL 4B3TE 1S1XB 3AJDA 4ED4A 1ZA2B 5IXUA 3BB5A 5ITHA 1N6QB 3DD6A 3Q22A 4DR6J 5IWAI 1SJ1A 2Q3PA 3SQOP 4NBQA 3O1LA 4LRBA 3VAGA 4CP5A 4K4VA 4ECQA 4P73A 3OFEA 2C2RA 4FDFA 1IKYA 4ZHRA 1KLMB 4ZVEA 5A0YA 2RQKA 4DSKA 3PO4A 3SDEB 3GLJA 1HQEA 2UVWA 3KLVA 4E2FB 3SZ2A 2EFGA 2AMCB 4L75A 4YEAA 3WHIA 2VESA 4KIAA 2XO6A 3VVUA 1J5EF 1FJCA 4JI4I 4J9PA 1JLAB 3OFGA 4ZLJA 4TQRA 1NUEA 4F4YA 1I94F 4R5PA 2AJ4A 3MWBA 2DHXA 1WDTA 2RUGA 3QAUA 1R27B 1NH7A 5AXMA 1U6ZA 2KM8B 3IRWP 4OI4A 3QFWA 3I32A 4I68A 2R8GA 3OLAA 3M8QB 1S9EA 3T9ZA 2QX0A 3M32B 4L6V3 4JV5E 4R0JA 2PO0B 4A8FA 1MW7A 1YBAA 4C9DA 3JYTA 1G2EA 1Y4UA 2F4VE 3K85A 1FJGF 2NXUA 2RE1A 3C6UB 1HL6A 3R5JB 3KJNB 5CD4H 1FDAA 1WC5A 3GWCA 4LF2A 1NPKA 4P74A 5D0GA 4X66J 4DR3F 3UCUP 4HHUA 4V19J 1UDSA 3POTA 3U1NA 1UW9A 4ZIWA 4ID5A 2W01A 4X4RA 4QR2A 1SL2A 5F3ZA 4OZ0A 3IWLA 1IM6A 5KFDA 2F8EX 1KOOA 3A8EA 2XYPB 4U6PA 5HO4A 4F7VA 4FS1A 4ECSA 2OIHA 4HY1A 5K36E 2BOAA 2WSCC 1FCAA 2BA1G 4JI6F 2K2PA 3TQ1A 4IQXA 1RTJB 4J9NA 2CNOB 3NZKA 2F9DA 5HQMA 2NS1B 3CDUA 3TEHB 2BQ3A 5D4PA 1WI8A 1JLGB 4G1QB 4Z2XA 2E1RA 1YJ9S 4PQAA 2C2MB 4WXOA 2FD2A 2OPQB 2AW0A 2VFSA 2IVFB 1B7YB 3I6PA 4N47A 2UP1A 1EETA 2O67A 3W2WB 2FUG9 5A2QQ 2IJFA 4KPCA 4RBUA 2XZWA 3FQKA 5HVHA 4LCFA 4IG3B 2V4QA 3GZ7A 4CO3A 2J9EA 4ILMA 2CPJA 2UUAE 2RJZA 3X1LB 5FLXY 1HR0I 4FKYA 2AJ1A 2NUUG 3BGRB 4DFKA 2UUCJ 4USMA 1CEZA 1WD6A 2YWKA 4NLSA 4FYVB 3FBEA 1JLEA 3N5FA 1Z0CA 2NXJA 1JLBB 3J80Y 3PRVA 4QCLA 2IMOA 1SH0A 2QE5A 2QL5B 2IAJB 2YX4A 5D0EA 3MR7A 5JJBA 3DRRA 4DDFA 2VIHA 3M8ZA 3TVKA 4M63A 3MM8B 4PXCA 4C97A 3RRHA 3EGZA 3TJAA 1V9OA 3GTYX 4NXMJ 3CJ4A 3HVTB 2AWZA 3H0PA 4LT6A 4P6QA 2M0GB 3MHYA 2V4RA 5JVGQ 4DSEA 1N56A 1J5EJ 1Y60A 3OT9A 4KSEB 4U7UD 4XTJA 2ZNZA 2P6TA 4L76A 4F4XA 3RTVA 1VQMS 4LFCI 1XNRF 4ES1A 1S1TA 2Z2MA 5B0BA 4UW2A 2MQOA 1JB0C 1GH8A 4M5KA 2GMHA 2Y1LB 2O3ZA 3VQSA 1EB0A 4AL7A 4ECRA 2QN6B 4MTPA 3U1MA 4GKKE 3J81Q 2XULA 1JLFA 2QGFB 1Q8BA 3OUYB 1VK3A 2GC8A 2YQ0A 1VBKA 4RKUC 1X4AA 1H6KX 2PN6A 5KFUA 1Q79A 4ISAA 5J2PA 4KHPE 2E9TA 1FEEA 4AQYF 2PO1A 3WZ0A 3OTEA 3DOKA 1YITS 1HWLA 2UUWA 3DLKA 1JXEA 4ZPAA 2HHHF 3OTOE 1XNQF 1FD2A 4KPYA 3QWPA 3MR3A 2Z2YB 1XNRE 1H7SA 2F3JA 3HLUA 1T03B 2FHOB 3FSYA 4FYWB 4P9SA 4F26A 4RNNA 3W64A 3BGOP 3A4TA 1X4BA 4IH7A 3TNVA 4ECVA 4JI7I 5A2QY 2VL1A 2V8HA 1T3NA 1SJFA 3D54A 4PUOA 2IYGA 4ZVUB 3J7YI 1IJEB 4U3BA 1XNQE 3R5AA 5CZVA 2ZBKB 2JC1A 1XC9A 2D3ZA 1FK9A 2MKJA 1XMQF 2DH8A 2Z0GA 2MZ1A 2G0JA 3UCGA 2CADA 4PYDA 2Z5BB 1R8BA 5AT1B 3W66A 3Q6NA 1ITPA 5KOWA 2W9BB 1QM9A 2FJWA 2DXFA 2Z5EA 3QJPA 1DZ5A 1UEKA 2W24A 1DTQB 1NH8A 2K1RB 3RB6A 5K9FA 4NLRA 2NXCA 2PSZA 2DEIA 2HMIA 2HQFA 1K1SA 5FLXC 4WUDA 2C37A 2BANB 4EUVA 2DH7A 2BRKA 3UQSA 1YBTA 2CG4A 2R2SA 1VCTA 4IDKB 3PV8A 5ETPA 2OPQA 4KR0B 4F0HA 4NCBA 4P7TA 1S72S 2F4FA 2BM0A 1IUJA 1N34E 2VQEE 1VQSA 5K20B 2FVQA 3CVKA 4ENOA 6FDRA 4U8VA 3KKFA 5AJ3F 3QZ7A 1SL1A 1UKUA 2QC3A 3I4HX 3CCVS 4O3QA 3UR3C 2LYVA 3C19A 5IWAE 2HLUA 3DHXA 2HGNA 2WOMA 3SSQA 3M8RA 2EG1A 1ZTTA 2CZVC 3CCMS 1PGZA 3WX4A 3UHMA 4K0KI 4NA2A 1I3OB 4C48A 4Y6IA 3T1HF 5ETQA 4LF6E 1TL1A 2VG5B 3OSPA 1FKAF 3CJ2A 3BBFA 3W65A 2VBYA 1D9DA 3HKWA 1Z2LA 1DJ0A 3FK4A 4M94A 1SJ4P 4IR9A 1HNZI 5T41A 5GAHI 1FRHA 4QOTA 2Y1RI 1XNRI 4KO0B 2CQPA 1B0PA 4Y34A 4F0MA 5KFGA 1RYSA 3FMBA 1F2HA 1YG0A 2UXDF 3OV7A 2HNYA 3M8SA 1S9EB 2IRUA 1CC8A 1S12A 2ROPA 4KKOB 5ETRA 4BBYA 2FGCA 1RTIB 3R6GB 3J7Z5 1U0HB 1XHKA 3MM6A 3MEKA 1X9MA 1NK9A 2UUBI 4MKBA 3LGMA 1Y4SA 3ZXWA 2XHCA 3N79A 2Z56B 3BPSP 4IG0B 4DV3I 1H38A 2FY1A 4FF4A 3VALA 1QSLA 1DFDA 5CCLA 3VAKA 2AGQA 3RRGA 1N33F 3FMWA 3DGPA 1H72C 5A0YB 4J9MA 3IR5B 4CZCA 1R8CA 3K58A 2MQQA 2UXBI 4Y28C 4JI0I 2GW8A 2OPRA 3GILA 1L3VA 4LF4E 1DHMA 1UZHA 1X0FA 3NWGA 5BR8I 2FY8A 5BYSA 3GIJA 2MZQA 3TA1A 2E7WA 3D2WA 1RLDA 4A8YA 1C2PA 1WEYA 2FTRA 2CJQA 3IWXA 4H4MB 4DHVA 2KT3A 5J2MA 1U4BA 4C8NA 3CGIA 1MWQA 4DPXA 1EJ7L 1SQGA 1R7IA 3VR1A 3HO1A 1WOOA 1U1NA 4DN9A 3LANA 2B8PA 1PAEX 4DR6I 1WHVA 3BH6B 2DNYA 2IOQA 2VDHA 4DSIA 2CDQA 2BA9A 3KLIA 5KFAA 4IOCQ 2XY7A 1RYRA 4DR5E 4R8UA 5IT4A 1SBRA 4I7FA 4L72B 1DRZA 4KJIA 4IRDA 2YWWA 3GE9A 1HK7A 1FD8A 1RHQB 3ZNUA 4WU2A 1UFWA 3B54A 4A8SA 3KDOA 3EVMA 2XI3A 3K2YA 1RWUA 4J91A 1YJWS 4QU6A 3IA0A 4OZJA 3M8PB 1N54B 4EBCA 3LOUA 4PG8A 2UUAF 3WBZA 3ZFVA 4CLLA 1OSDA 2OFHX 2AJ0A 5T14A 4K2JA 4JUZA 1GXTA 4LBIA 1OY8A 2CJ9A 2CQCA 2XMUA 2ZOGA 3FRZA 2XLJA 1SI9A 3T5HA 1MG7A 2BE2A 3NXZA 4KHPF 4X4UA 3PS3A 2MDAA 4DMZA 2CNKB 5GMKa 4XIUA 2FB0A 1U1LA 4Z37A 2R9LA 1LKZA 2OAUA 1IQZA 1HQUA 2CUYA 2PA3A 4ZP6A 4O3OA 5C2GA 3JTPA 4ER8A 1M1KT 1CC7A 1GK8A 3C8YA 4JI2F 2N3OA 4OO1D 2H51B 1IJFB 4EBEA 4ZVSB 2POKA 3PKYA 3CD7A 3GJQB 3K59A 1S0NA 4HYMA 4JI1I 4NXNE 2M88A 3MTJA 2Q2EB 2XYHB 2IBOA 3SIPB 5T7LB 3CDEA 4K4UA 2W7AA 4NL5A 2V4JA 1AUDA 1N34J 2VODA 5HMXA 3NGDA 4ZKAA 1RKIA 3P4UB 1I1GA 4MU0A 3E01A 3FCHA 3KJQB 1N4LA 4B9LA 1MROA 1FDNA 4JI8E 3OR1B 2HURA 3LTOA 3GYGA 3M1VA 3ZTRA 5AE1A 5HROB 1VQLS 1FEHA 3MM6B 4F2SA 2V9KA 1Q8LA 4EMDA 5I3QA 1HPZA 1OY6A 3I5AA 2VHGA 1SQEA 3SSSA 4C11B 3CC7S 1MSWD 2JOQA 1USVA 2HNYB 3CD5A 2AYBA 1N0VC 3HF5A 1H74A 3C6TA 4QW8A 4DX7A 4FWGA 5G0RA 2OPSA 1KN6A 2AZ3A 1MMNA 2QLWA 3OFHA 4P2FA 4UQTA 4F2RA 2NR0A 2AZ1A 3QT5A 4WZQA 4W4MA 2JL9A 3UN2A 2CQBA 3GJRB 3KHRA 2ZITA 4F8RA 1PO6A 2HNDA 1IBME 4DCOB 1C0UA 2R7UA 2GZOA 1UDOA 2ZH8A 1U47A 2V2VA 2HW3A 4FBTA 2DIUA 3Q8VA 3UN3A 1H7WA 5K8OA 5HQ8A 2CWKA 1RXOB 1HWJA 1WACA 3QBCA 5L38A 1O5JA 5I3PA 2E7VA 3PVXA 2FJVA 4F02A 1O0PA 1NZ0A 2NN6C 1HR0E 2VF3A 3UW1A 1RT1B 1UJ4A 4DPOA 4ED0A 3SCJE 3ULHA 3R9LA 2PI4A 3GPAA 3CUNA 2AEFA 2J8SA 3D0HE 3NLCA 3MMBA 2KB2A 3BO3A 4QYZJ 3LP1B 4KB7A 1FVQA 2J7WA 5LJ5Y 4GKJJ 2VBZA 4X64F 4K5RA 1U02A 3DCAA 4Y00A 4XDCA 2E1CA 1JLCA 4RW9A 3W63A 4IDKA 4J9UE 3QIDA 4RX6A 4Z7CA 4UTGA 3PHTA 1Y6ZA 3OTOF 2VJUA 2HHHE 4YDXA 4FWDA 2ROEA 3K5MA 1B63A 5LMUF 2HIQA 1NEEA 4PG5A 4DFMA 3V81B 1LNQA 4OLOA 2HWHA 2E5LE 2EFVA 2QEXS 1P1LA 4GKKJ 1HD1A 4A8QA 5IT9U 3HT0A 2NYHA 3M6VA 1SKUB 4QNJA 3QT6A 3WC0A 5GADU 3SV4A 1EARA 2VA3A 4QR0A 9RUBA 2W9BA 4I6AA 1ZA1B 2IPOB 2L48A 2VH7A 4Q7AA 4EYHB 3SCIE 2X7IA 1SCJB 1WHYA 5CABA 1XMQE 3QYYA 2P6SA 3DLLQ 1RP5A 1RT7A 2YNIB 4OMFG 1FJ7A 3A3PB 4B9UA 1N36E 1FX4A 4F3MA 1Y5IB 2ZM6J 3FC9A 1QUVA 4BWJA 4U95A 2U2FA 4J5OA 4YFUA 2XI2A 3CC2S 1HNZF 2CPEA 4NLGA 4ZLPA 4ECWA 2H65B 1WORA 3ZZOA 2A0FB 5KG7A 4Q5VA 1VFJA 3LAMA 3AA8A 5EX3A 1X4GA 1EKRA 1YVFA 4DI6A 5J2NA 2BX6A 2KM8C 3KLHB 3TAQA 1EKSA 2AJFE 4WP3A 4IYQA 4C3LA 5KTQA 4WJBA 3U7JA 2GVZB 3H42A 2G0CA 3MM5A 4XPCA 3G71S 1TFWA 2BA1D 4PRVA 3PG9A 4EBDA 3TYTA 3TZWA 1KFSA 3OL8A 2KG1A 3FZ2A 2XMWA 3C6TB 1VI7A 4WK3A 4ETZA 4DL6A 3TVZA 2FC8A 1JJHA 4P10A 4DX8H 1U1OA 1NJWA 4I69A 2RIJA 2KVQE 2ZC4A 4JI5J 3CCES 1FRIA 1G4CA 1TVRB 1D8YA 2V94A 2RHQB 4FW6A 4B9TA 3TI0A 1XR5A 1CJVB 2CPFA 1R89A 4MIWA 3G8SA 2UXBF 1IBKF 3QZ8A 3PX6A 1QAYA 1KOHA 3DKDA 1HD0A 3GR1A 4DV1F 2HS0A 3HSZA 1OMSA 2DISA 2WVDA 4TQSA 2RRAA 2YXLA 3P49B 4X4VA 3GCXP 2ZD1B 3GJTB 1QAJA 4X66E 1V6HA 2Y0BB 5F8HA 3BDEA 5KFZA 4CLSA 4MU1A 3M2UA 1V3ZA 1GMWD 2HGLA 1YZ6A 2BJ1A 3PDNA 1U24A 4HHJA 1VLYA 4LFAF 2MKHA 2ATLA 4MKYA 3KUHA 2H5IB 3ILJA 5HK4A 1JLEB 4B3SF 2V34A 2GJFA 4J7CA 4LR9A 4PG6A 3I0SB 2RU9A 1SH2A 1NSKL 3GV5B 2Z5CB 4LFAE 5B0CA 2C1EB 1R8AA 2NZ4A 4DV2I 2NUHA 2GVDB 4GMKA 5KFNA 3K5LA 4PPDA 3BQ1A 2BKPA 3MCOA 4DPUA 3M9NB 1T05A 2A1BA 1TTHB 3O5TB 4EWTA 3UDCA 1T9TA 4HH1A 1RWWB 4X66F 4F25A 1PAUB 3NGUA 4MK8A 4Y2CA 4NCAA 4IFDE 4LBHA 1F5BA 1ZPWX 2Q66A 4I2QB 3H7HB 3B6BA 3OTCA 1U26A 3L7UA 4UOHA 4I67A 4JI5E 3W5ZA 1HIYA 4RL1A 3R7BB 1QZRA 2MLZA 2HS3A 4IFDF 1RTJA 4EFAC 1T11A 4FWHA 3W60A 3TZXA 1PKUA 2QSWA 3DN9A 1TV6A 2GGPB 4NE9C 5JXSA 4FW4A 3MAAB 3ZZZA 3PIPQ 5LOQA 4HXZA 3GONA 1EIYB 3T6JA 2WHOA 5HANA 4NRTA 2MHNA 3A8IA 3G82B 3JSMA 1D9AA 1OIAA 7FDRA 4WK1A 1RREA 3WDOA 3P5TL 1Y4ZB 4A8XA 3R5BA 2MMYA 4CO2A 1WC3A 3ZZRA 1ELOA 1X4CA 4B02A 4DWIA 5U47A 3TANA 3RJMB 3JQJA 2ZM6E 4DR7I 2BRLA 4FXVA 3ZNJ1 3OHAA 4JV2A 2UXCF 4EYIB 2PO0A 1XQIA 3M32A 1Z5CA 3N6NA 3K1JA 1OS5A 1S79A 1N48A 2FLLA 3IWNC 4MKVA 3OFFA 3HK2A 4JI2J 1YGYA 2X3DA 4CO5A 2Y1IA 1XMQJ 3PS1A 4JI6J 3W8PA 1OQ6A 5L3JA 1FKAE 1AT1B 1FKPB 2IC3A 3E8OA 4OX8A 1U45A 1WOPA 1KRPA 3Q8SB 4B3SJ 4ES3A 4BA1A 2RQCA 3BN7A 3UDVA 2R7VA 3NEKA 1KTQA 3EXCX 1S97A 1WKKA 2GAHC 4X64I 3W8GA 2YTCA 2VQFJ 4KKOA 4LFAJ 4DR5I 3PW2A 2MQLA 5H9FJ 2P9GA 2YNHB 2W2QP 2AV5A 1T9WA 4O44A 5ETMA 1HNVB 4YMEA 1H0HB 1HHSA 2B9XA 3IFEA 4NOHA 3THVA 1B62A 3JAMC 2HHHJ 3JQKA 4DPYA 1N6QA 2AEJA 3D1QA 4D3GA 1YHCA 5JEAD 1CG2A 1Y0HA 1YDLA 3PRBA 1NHHA 3M6AA 3QMQA 2C3YA 4LQ9A 5K14A 2UUCF 1DLOB 2UXDE 2G4BA 2DBBA 1X8DA 3ISNC 1Q8IA 2I38A 3CT9A 1IBKJ 1PC5A 4GKJE 4Q8FA 1R8HA 3VWSA 4CI0B 1WSRA 3LQVA 2NPIA 4OYBA 1T9UA 2BYCA 3PYGA 3DI6A 2VG6A 4IFYB 4U8YA 3UN5A 4KHPJ 1RHUB 1TL3B 3IGNA 3UR0A 2R8IA 4DV6I 4JV5I 4HACB 1UWAA 4DZDA 2OSRA 3QSIA 2MGZA 1ICEB 2LP4A 2MTLA 3BBBA 3O6QA 1VISA 3SFUA 3AB2B 4ZJQA 4B3MJ 3QRQA 2UXBE 3H5YA 2DCUB 4J3DA 2BBEA 3CCRS 3TP2A 1JWWA 2B5JA 4LJMA 4X4QA 2GQ2A 4I6YA 1D1UA 3BSOA 2IMWP 4B9SA 4OX9J 1S10A 2HHUA 1M5VC 2QYGA 4GO7X 3HSDA 4FKXA 2HG4A 1BE4A 2C2NA 2H9ZA 2IM2A 3HJVA 5RUBA 5BR8F 2KXNB 1YJRA 2HKEA 4LFCF 3NGTA 2DHHA 3JTOA 1LWFB 2XMTA 5C0XC 2ZBRA 2XNRA 1DTTA 2CA9A 4CDIA 2M7SA 3N01A 3EICA 1VRUB 2AIRB 3KUEA 1FFGB 4J9KA 2ZUAA 4TU7A 4IH5A 3CMAS 5H9FK 1XXEA 3KHLA 2QA2A 1L3TA 1T9XA 3IGVA 1XJWB 3FBBA 4ANDA 4TU9A 3VGUA 1VQOS 4JI8J 2MZRA 2JE6A 3U1KA 4IFYA 3BREA 2AGPA 5DZ7A 2XO7A 3WIVA 1HI0P 5L1KA 2WNRB 5IZHA 2P5VA 4MYTA 1GEHA 2VPYB 2ASJA 4NX9A 3NAHA 5CHCB 3HD2A 3RU0A 2H48B 4KBIA 4B9NA 1HWUA 1F9EB 4RW8B 2DNQA 3PEJA 1UVNA 4USHA 3CE8A 3AT1B 2J0QD 5C0XB 1FTRA 1RTHB 5HSPA 2I8EA 2JEBB 4QZVB 1HNVA 1R0BG 3M85G 1T03A 2ATCB 2YNHA 4H4OB 1SJ3P 4JI2E 1NMEB 1E6VA 1CS4B 1HBMB 1TMJA 2L3MA 4NEYA 4FW5A 2ZBCA 1X9WA 2R7TA 3DOMA 3B82A 3NGSA 1Z5BA 4BA1B 3B4MA 1AUSL 2V67A 2CKWA 3BYPA 5DO2A 4OHZA 3KLFB 3V4IA 2XS7A 5J2PB 3AHPA 1EI1A 4ED3A 1F60B 4LFBI 2PA8D 4QWCA 3H25A 4LF9F 3OTDA 4P2SA 2N4DA 2PI5A 4JI8F 1D0EA 5H1SV 1FJGJ 3EVWA 4M8LA 3VZIA 3J7ZT 4DV2E 3EZ5A 1PCAA 1BQNA 2C2DA 3I56S 3HFKA 3CDAA 4FYDA 1VHFA 3Q8YA 4OI1A 4MKAA 5JUMA 2NN6E 4B3SI 3D3CJ 8ATCB 5KFPA 3AA9A 4CO1A 4WF9Q 3TA2A 1HR0J 2B6AA 4DR5J 1UJ5A 2MJNA 3TUZC 4LFAI 4O3SA 3H98A 4ZN3A 4KRWA 2WBRA 3MMAA 3HVTA 3G82A 2XLIA 2QA1A 3UD4P 2HQDA 3KJVA 4C0HA 3UVJA 3LPEA 1U48A 4YHHI 2HZAA 2ZBIA 3ETMA 3IS9A 1JLQA 4G1IA 3JAMY 1TK8A 1NKBA 2BA0G 5IV3A 4OX9F 2ZE2B 3AJ2A 5HLFB 1IBMJ 3G86A 1UDQA 1T95A 3P5BP 3VZHA 4WKRA 1SVDA 2VC1A 3MPVA 4NYZA 2RQ4A 3M4XA 4D3HA 4LF4J 1ZOTA 3OVSA 4B3MF 3W2VB 3RB3A 4KHPI 4O0NA 2OMOA 1Q7YT 1S49A 1X5TA 2ABYA 2QJ3A 2RNEA 3D28A 3TA0A 3VGSA 4QWDA 1YLXA 2DO4A 3ZM7A 3DLEB 3M2RA 4QPTA 2V68A 4X65F 5KFIA 3DLEA 1N33E 4A8MP 3D66A 1LXJA 1AZSA 1B99A 2AYEA 2F65A 2KXHA 2XYGB 3NBPA 3R1LA 2Q6BA 2GVDA 1QSSA 3ITHA 2KT5A 2HHSA 1S1VB 4YOEA 3SQGA 4ILLA 1MLAA 2DRBA 4X65E 2CPYA 1F3VA 4K8RA 3CC4S 3AOCA 1Y3JA 2E7XA 5KG3A 4C0OC 1NXIA 2XGPA 2A3JA 1ZM4A 4K59A 4CCHA 2XWXA 2NPFA 2B4VA 2HVDA 4AL5A 5CYJA 5KG5A 2J9DA 3KK1B 3SYZA 4DFPA 2FVRA 1F2GA 5IQQA 1U0SA 2YKMA 3QQCD 3BSNA 4USTA 4OO1A 2RMLA 4LF6J 1NDKA 4WFBQ 3CJSA 3D4JA 1V3RA 4JB8B 2B6AB 1IBLF 2ZBPA 4C8LA 1Z0BA 5I42B 5BYRA 3CTRA 2GV1A 1BQNB 3PXGa 1TVRA 4Y0FA 3VAJA 4X65J 1F3FA 4DOZA 1N5TA 3PCOB 4DL7A 5KFCA 1G3OA 2YNFA 2QLJB 3E2EA 4CM0A 1KBRA 1A6FA 5KFKA 1TL7B 4UUXA 4NLUA 1G7CB 4WXWA 4AQYI 2JVOA 3QWUA 3AB4B 2Z57B 2E5GA 5E7OB 2F8HA 3X3UA 4LSNA 3NNCA 3PEHA 4P2MA 5C0XF 2C38A 4M5GA 5KOXA 4AD6A 4USUA 4LF9I 4JYAI 4RZRA 1CQMA 1N0UA 4ICLA 2H1YA 2HS4A 3DOMB 3O44A 1FI4A 2V50A 5F0UA 1FXDA 2O1PA 2J9CA 1E6VB 2KTQA 1SIZA 2XMAA 3QGHA 4J37A 5HP1A 3HZEA 2EKNA 1NHIA 3QRPA 2FQQB 2GIRA 2CG8A 3BO4A 3BS9A 2PC6A 1VC5A 3TO8A 4EO6A 2VA2A 3FEZA 1RWOB 2DGOA 4Q2MA 3SMZA 1S1XA 4LFBF 1B64A 1W25A 1YJTA 3PJXA 5E41A 3IR6B 3U02A 3CCWA 4DUYF 4DQSA 2HYIB 7FD1A 3R7SB 5LSOA 5D6GA 1YJUA 1S1WA 1J27A 1PIEA 4L3KA 2FHJD 5EHHA 4HI2A 2BJDA 3I4PA 1WF1A 3SCLE 2B9WA 4NA1A 4DSFA 3VTIA 4DN0A 2YVSA 4X4TA 1KQFB 5J1PA 4ZMMA 1OJ4A 3TWZA 4C0BA 1CSJA 1ZYQA 3Q2SC 1U1PA 3FSXA 1N5SA 4FXWA 4GVBA 3NGRA 1GMVA 3L9ZA 4LBPA 1XR7A 4G1PA 4B3OA 3MEGB 2CPXA 1RCXB 4KC5A 5HAOA 3TJ8A 5GAEU 1KR4A 2DY9A 2YKPA 1KNZA 4K7QA 3MM9B 1IBMF 2DGUA 3KTQA 3DRPB 1XNRJ 1NZ8A 2B4PA 2ZC3A 3WC2A 1WKLA 1RTDB 1FJGI 1M0SA 2DT9A 2J0XA 4ED2A 4ED7A 2DR7A 1FFWB 1IR0A 2DGTA 2DH9A 2AHOB 2EW9A 2Q1LA 1RT4B 3CW2C 5LJ3Y 3PHEA 4RW9B 2OP5A 3VAIA 5D8HB 3QJJA 1N5QA 1QTMA 2IBKA 2V2KA 2ZH1A 1NBEB 1W2IA 4ITSA 2LU1A 2C3MA 2H4WB 2PFDA 3DDIA 3D6TB 5D4OA 2FJEB 2GX8A 3MMBB 4N7TA 4ZCKA 3IG1A 4WYLA 5CA5A 3GYNA 1SIWB 5C0XD 2RDIA 4LVOP 5EX0A 2AYGA 1CVJA 1RT1A 1F1BB 1LWEB 4FVMA 4TNOA 2ZVIA 1H73A 2OGUA 3CIZA 2F9JA 3CJ3A 4Y2IA 3S01A 5IWAJ 1TKXB 4ZP9A 2VG6B 5C7PA 2BR2B 2QTWA 2HHXA 5B0EA 3OJSA 1D8ZA 4FS2A 2UU9I 4NXME 5IT9Y 3PYDA 3N5BA 3TAPA 2YWGA 3QLHB 1NJYA 4OO1F 3NKYA 1IKXA 4DG1B 3KFWX 1BWEA 2R7QA 3BR9A 5CH7B 2DNKA 3M6XA 3OTBA 2WVBA 4J9LA 2IFXA 1S59A 2JEAA 4RO0A 4CO0A 2MKKA 1IR2A 1LW0B 1WEXA 2HFOA 2OPSB 2I5JB 4GVLA 1AROP 2XMKA 5F3TA 3T5KA 2OD4A 4B3SE 3V5RA 3K5PA 1DURA 2UUCE 2UVRA 1WTFA 2KYZA 2GHPA 1VRQC 2VBXA 1JKHA 4PCQA 1D3WA 5HVFA 2LQBA 2R42A 3ISND 3MXHP 2HVIA 4O4GA 2ZJRQ 1LW0A 1RAOA 3M2VA 4P7AA 1NDPA 3TARA 3I9V9 2K3KA 3RW6A 3I0RA 3E01B 1VMBA 3KG1A 4USJC 3GIIA 4HTIA 2R8HA 4IH6A 2UU9F 3RAQA 3KLGB 4CLUA 1OPIA 4IO9Q 3HSJA 3BYRA 4HDGA 1GTHA 2KFNA 1Q5VA 2GO4A 4JI4J 3RAMA 1NKCA 2IRXA 4IO1A 4AM3A 1MWYA 2R7SA 4WIQA 5G4DA 4L3NA 3GMEA 4B3TI 4R1FA 1M5SA 3L7PA 4ZVFA 2N82B 4Q0BA 1TKZA 1XNQJ 2RKIA 2GJIA 1GQEA 4B3ME 4IFDC 5IFMA 4JI1F 3HT3A 3OL9A 1HWKA 4ED5A 3EUNA 2CNLB 4MMOA 5DLGA 1E6YB 1HW9A 1JQGA 3MEDA 1N5VA 2IHR1 1PBUA 2IM0A 1RB0A 3OXFA 4IOBA 2CQ3A 2F8MA 2FDNA 4NMLA 4V1Ak 2VPWB 4Y2MA 5GMDA 4URGA 2ZH7A 2PO2B 2ZKTA 1M1GA 2HVZA 1ZAVA 3BGFA 3OVBA 1C1BA 1FRKA 1S1UB 3P45B 4Z7YA 2R8JA 2D69A 2ZWPA 3LP0A 1SB6A 2BKNA 2DCLA 3DYAB 3NCPA 3TUJC 4F67A 2CJYB 2MQMA 4PEOA 4PG7A 2BJ3A 2WB4A 5B09A 2XGQA 2AF6A 5F41A 1APSA 4I3HA 5FDLA 3TJ9A 4DR1J 3G6XA 4RPFA 5LMNE 4LSZB 2HKJA 2XQCA 2YWFA 3MM9A 4LF1A 1NHVA 4LVNP 1RT2B 4Y2AA 2DR9A 2UUCI 2IM3A 4RW7B 1S48A 2XY5A 1RAIB 2JDJA 3EGVA 3KDNA 5GMEA 1S6UA 2DNGA 5DDRC 1UA0A 1R3NA 1URRA 4JI6E 2MSSA 1J5EE 3ONQA 1TUGB 3PFOA 2QLBB 4OJ1A 4I6WA 4OJHA 1RAAB 1SC4B 1U1RA 3KMQA 4PWUA 4F4AA 5A6PA 4RNOA 5IT9C 3DU6A 2QMXA 3RBXA 1I51B 3TAMB 2ZJQQ 1XN9A 1YK9A 2MZSA 2MLYA 3MD3A 3RW7A 1YQHA 1YRXA 3JB9k 4LF4F 3ADAC 2V0NA 2XHWA 3I87A 2R7WA 5D4NA 2IJNA 4WCEQ 2MPUA 3MM7A 1FDBA 3T3FA 2LFVA 1C0TB 3BKFA 2BMBA 3EMTA 3H2UB 5CYQB 2CDRB 1F9FA 3OHBA 3DMJB 1H2VZ 5BXIA 2OPRB 5ETVA 3HI9A 1F0XA 4BWMA 3VF0B 5HMYA 1N8RT 2UUAJ 1YKWA 1LEOA 3MAQA 1NPRA 3ZC4A 5DRKA 2DGWA 2D1CA 2QIFA 4LREA 3KUGA 2EPIA 3LALA 1FKOA 3H40A 3Q24A 1VC6A 2HQGA 3NS7B 2GIQA 1ZBTA 2MKCA 1RBLA 4QPXA 4CH1A 4QW9A 2C38B 2VB6A 3Q6MA 2DR8A 5F8JA 2BXJA 1HFEL 1J5OA 1BQMA 4MFBA 2OUGA 3G8TA 4WKYA 4CYUA 3Q86A 1X5PA 4NI2B 2MLXA 4PAAA 4Y2KA 2H3EB 5LSRA 1RE1B 3FGVA 4J9VA 2OI2A 2LEAA 2BW2A 3CNQP 3MMCA 4KY3A 4NI2A 4CRJA 3KRNA 3MEEA 2YH1A 1J5OB 5I42A 2FHMA 1TL4A 1GXUA 2EBEA 1P8GA 3C14A 3DNCA 2E5JA 3LO3A 2B43A 1REVB 4GKKI 4DUTA 3F56A 3LGNA 1CLFA 4TYAA 4P7VA 3A8JA 4LFCE 3N4WA 5IC4B 3P3DA 2BABA 2WCXA 2OKQA 2K3IA 3O3LA 1Q95G 1S6QB 1SV5A 3PW7A 5CYQA 1S0VA 2YQ1A 3KG0A 4J9SA 4U7UK 4DQIA 3IM9A 3PYEA 2RT3A 5FIIA 4ZVTB 1H2TZ 2JLFA 3NCQA 4WPAA 1VRTB 2DNOA 2EVZA 1KEKA 5FD1A 4ZJOA 2C22A 1RT7B 5I4MA 2PNMA 5FWKA 1XNQI 3CDJA 1RHRB 2JVRA 2KKHA 3L4BC 4P52A 4WU3A 2G0IA 4AXIA 4UZBA 2GHVC 3LH2S 1AA1B 4LQ3A 1AXQA 3MZIA 3DLBA 4JI3F 3MPUB 4EGLA 6AT1B 1Y5LB 1U25A 1Z0TA 3HVRA 3M85D 5SZTA 2BANA 1WI6A 3BKTA 1NHJA 2EFNA 1HKAA 4B08A 1TAUA 4QNKA 3ILLA 4PXDA 2JHEA 2D74B 3BM7A 3W2VA 4YUDA 2V2QA 4JYAF 3V81A 4OYOA 4LCGA 2Q43A 2ZH4A 2HHPA 2ZNYA 1DTQA 2C3UA 3PYFA 5D3GB 4ZPTR 3V6DB 3RR7A 2NLWA 2YWEA 3CJ0A 5HLFA 3DFEA 1SUQB 3T1HJ 3LP0B 2BEFA 2NYIA 1JLCB 4CNZA 4ZP8A 1KD1T 1S99A 2E5LF 2AJQA 3IS9B 1HNIB 2UV8G 4DPWA 4ED6A 4FF1A 4X62I 1URNA 3KJVB 3V6JA 1A9NB 4LF9E 2CQIA 2MKSA 2IOPA 2MJUA 4EZ9A 1HNZJ 2E29A 2W2OP 3MPYA 3TZZA 3MUTP 4NLDA 3HHNB 2FVPA 2HQCA 3HKZD 1VQ5S 3DC2A 5DGBA 3C46A 4PUOB 2VC0A 2EI5A 1CULA 3CO9A 1N36J 2WK4A 1NB7A 1C4CA 1UAWA 1HW8A 2RRNA 3TZYA 4BC7A 1KQSR 1YRTA 4OI0A 1RT5A 4JI3J 3BF4A 3W9IA 4RW6A 2QL7B 4DQQA 2BA0D 2GO3A 2HRTA 4HI1A 1IWAA 2OELA 3G87A 3OR2A 1VLOA 2BM1A 3DOKB 5E3QA 4WFYA 4F50A 3CULA 2R3VA 1V5IB 1Y5YA 3LNUA 3M2VB 4NYOA 4DBQA 3D68A 4I56A 1KHWA 4WUBA 4FXDA 2UUAI 2V6AA 1NJZA 1HNWI 1NK7A 1CS4A 1HBMA 2A2CA 4HEA9 3W9HA 4EK2A 2E5LJ 4IUFA 2AP6A 2C42A 4H4OA 2ZM6F 4M5NA 5BR8J 3PS2A 2L08A 2RS8A 3ZTOA 4C3KA 1RT3A 5GAGI 4X4NA 1HI8A 5C0XA 1YJVA 1S1TB 3FZBA 4H4KC 1KQGB 4DSLA 2OMLA 3OR1A 3DHWC 5EN1A 2HFSA 4RW8A 5KFJA 2R8KA 3Q1QA 1S6OA 1LFWA 4JV0A 4K50A 2FJDB 1KTVA 4P75A 1VIXA 3MPWA 3BSCA 2PIIA 2X1FA 1UDNA 1ZM3A 1FWLA 3IMQJ 1PYOB 2MZTA 2IYIA 4NPOA 5DS7A 2KO1A 4PRXA 2I9SA 3MF5A 2B7CB 4ELUA 1JJ4A 4LPFA 2DGSA 4XDDA 1LWEA 1NDLA 3NNHA 2EK6A 3GG1A 1PJ7A 3A13A 4NZ6A 2J6UA 4ANCA 5DQGA 2XCAA 2ZZMA 1FJEB 4LF5F 4DV3E 2HIYA 1JNZB 1F9HA 4WWSA 1DTTB 3HD1A 4NYPA 4PQUB 1EQ0A 3D3BJ 5L9XA 4FN5A 1KDNA 1GAOA 2JRSA 4NXMI 2DVIA 2JLEA 4ZIVA 4GKJI 1XTZA 2LKZA 3HDSA 3R27A 1RWXB 4HVZA 5KFYA 4JI4F 3GP9A 1J5EI 2UU9E 3ISZA 4FNHA 4OO1C 5GAGU 2FHJA 4ZOSA 1HNXJ 4DU8A 4K4XA 2AGOA 1JLGA 1JK9B 4DUZE 1RAHB 1X5OA 1IQTA 5CYMA 3ENAA 4OV1A 2LQ8A 5K5MA 3U27A 1Q86T 4IZJA 2N3LA 2WSFC 4FBUA 2UVVA 1K9MT 3OD2A 4RNHA 1N34F 3B4TA 3CCTA 1Z2ZA 4R8UB 4DUZF 1A6LA 3MPDA 2XMVA 3ET6A 4P72A 1SC6A 4LRCA 3J80U 3Q0AA 5M2RA 3VAHA 5A76A 2RU3A 1X31C 2VFRA 2HHHI 4ZPDA 3D1HA 2UXCJ 4CIOA 1XIQA 4WE1A 2VKZG 1FXLA 5K14B 3DU5A 2ASDA 1UJ6A 2XSJB 2KH9A 3CMQA 4NXNJ 2BZ2A 2IESA 3T1HI 4AL6A 3JS9A 2XLKA 2BQRA 4A8OA 2E44A 5IM0A 5HL7Q 1HMVA 2C2EA 2F4VI 2JEGA 3M8QA 5HP1B 3HFZB 3BQ0A 2OTJS 5B08A 1PBAA 3H8YA 4B3MI 4R5PB 1S6PA 1KHVA 1WHXA 2B9YA 3H4LA 3GFXA 4LIWA 2YKQA 1FKPA 2IC3B 3J7YU 4DV2F 2ALYB 1DY3A 4OYPA 4DR2F 3HJCA 4OX9I 5KT2A 1YJ7A 5I3UA 1Q8KA 1VJQA 4LIRA 4DV7F 3L7OA 4YHHE 4DV3F 4LF5E 3R7NB 3AD9C 2K8GA 4ZHRB 1R6VA 4RUBA 2ALZA 4LF7F 1N32J 2ACYA 2CVEA 2LJPA 4C8KA 1PVGA 3HZGA 4FW7A 1H7UA 2GNKA 3CIMA 5IM0B 3DDNA 4OKGA 1HNXI 1GTEA 4ZPBA 1X4DA 4KO0A 3J80C 4KQVA 2O66A 1RCOB 3Q89A 4OV6A 1R0AA 2IM1A 3M6WA 2XSJA 4IQMA 5F8LA 3US5A 1U1MA 1MMDA 1EQMA 2YX7A 2KRRA 2VV5A 4FPRA 4CLWA 2QA4G 1VBXA 2W9CB 4Q45A 3HP6A 4JI8I 5HMZA 1REGX 1T9VA 2J0SD 1RADB 2LXIA 2MQNA 3MAAA 3ET6B 3QGGA 4JI3I 1TV6B 2GGPA 1QJHA 2WOMB 1EP4A 4I2PB 4PKDB 5C42A 4LF7E 5KFLA 1XERA 2LA4A 4QIGA 4RW4B 4ZCMA 1PILA 2XTJP 3RB0A 2NN6A 4F4ZA 4DR2J 3FBCA 5DETA 3G6VA 1NK8A 2EC0A 2JH3A 4LSLA 4IFDD 1WC0A 1NKEA 5CQGA 3ITHB 1UEUA 4P71A 4ZLNA 2R2TA 1TKDA 1NAQA 2R4FA 5EWFA 3QSYB 3VAMA 2VFUA 3UE2A 4PABA 3WQPA 3M2RB 4DL3A 3GQCA 2QMWA 3C15B 4M5JA 1KFDA 8RUCA 1T05B 3MMJA 1S4EA 2DPIA 1U2RA 2E66A 4QBUA 2C37B 2HMIB 2KJVA 1TFYA 4PQUA 4HT5A 4ZVHA 5IC6B 2RS2A 5C24A 2M9KA 2K1RA 3T41A 3UFCX 4KH1B 3I96A 2PMHA 5F9LA 1CJTB 2P9CA 2WTFA 3BDPA 2VU5A 5E3CA 3CF5Q 3O2IA 2W4PA 4ZPVR 5LMUI 5DLFA 4TY8A 3Q8RB 2DR6A 1ZAXA 4OLPA 2CYYA 5SUHA 5DJBA 3UDLA 5CCMA 4QYZK 5K36F 2QA4S 3NOGA 2KFYA 4DFJA 4MJKA 2Z5BA 4ZVIA 3I55S 1N33I 2D9PA 1ZAWA 1TKTA 1VYAA 2ZD1A 1WC6A 2Z2ZA 4OZNA 2JLGA 1U49A 3M8YA 4RBVA 1PYTA 3SXLA 4CQ1A 1LV5A 3P3GA 3HX9A 2ZOMA 1CJVA 2HWTA 3P8BB 4U96A 4A4JA 4B17A 1GMUA 4RJVA 5THWA 4DR7E 1YZ7A 3LF0A 2CNNB 2AYMA 2FHKA 3CDBA 3H2LA 3S1TA 5B0FA 4F4WA 2VQEJ 3CMES 4BDPA 4LF8F 3M30B 5GAEI 1AFJA 1IBMI 3KYLA 3M05A 3DLGB 5C2CA 4DV6F 3BEGB 1FNXH 1U6FA 3D5MA 1W7WA 3DRSB 4MAKA 3TEGA 3P6YC 2GVZA 1H3DA 2W1BA 3B78A 3MM5B 1IKWA 5DZ6A 1RR9A 1PKPA 5AE3A 3OUYA 3KLHA 1VQ9S 1SXLA 4RW6B 2L41A 3J7AM 2DY1A 4ECTA 1BGXT 2K7JA 4USIA 1NLKL 1RI7A 4L73A 1UA1A 3PFEA 4AFFA 3A1YG 3W3SA 3WX8A 2J6SA 1RWMB 4F04B 1S77D 4NXNI 2VQFF 2YWHA 2E9RX 1CJKA 5DNLA 4DXLA 1SJRA 2N7CA 1RWKB 1FERA 2CXEA 1Y00A 2VBWA 3FBFA 1UP1A 1V3SA 2QFIA 3R5GA 3OPKA 2LA6A 1RHKB 2C3PA 3LUYA 3A12A 5KFSA 4DX5A 5DDOC 1DBDA 4DV1I 3J7AN 2IAJA 3AODA 3HVWA 3HHDA 4USKA 2ZHAA 1RWPB 1I94I 3HM9A 2LU2A 3IM8A 2HBZB 4ERDA 2YKNA 5KT6A 5E33A 4I0WA 1CJTA 3CJ8A 3OXLA 3WIUA 3CJQA 2WONB 2I6WA 4JI1J 2RF2A 2DXDA 2XEXA 2KHDA 2FPHX 1X4HA 4ID8A 4M1KA 3T5JA 4IG3A 4PPZA 4ETXA 3CPWR 2HHVA 3N6LA 2A6OA 1KKHA 3OTOJ 5C5JA 1K0TA 1K0VA 1N32I 2Q79A 4DV5I 1IKVA 1RUSA 2IDEA 3IAS9 1ZTWA 4ECXA 3OXGA 4MIBA 1EHWA 2H54B 2P9EA 3DRYA 2MEWA 3PKMA 2O1TA 5D78A 1JMTA 3GFYA 3CCQS 1L3SA 3R2DJ 2DO0A 2RUSA 4TY9A 5EKWA 1FNMA 1SQFA 2HRYA 3VVTA 3CD0A 4MU3A 2J7KA 1NJXA 1I6JA 1NM2A 2OTLS 4N77A 3TUPA 4JV5F 1KP6A 2DKOB 1IBCB 3TRGA 4JI7F 4WP9A 2Y8WA 1UMJA 3J81U 4GQUA 3LP2B 1TL3A 2XS2A 2E1MC 3KOAA 1SKRA 4K4TA 1NK4A 1QVGR 2DNLA 1HBNA 2B4UA 2KI2A 3MAHA 3V4MA 2W9CA 4DV0J 3S8SA 9ATCB 2YH0A 5F8IA 1DLOA 2HNDB 1T8EA 1GXLA 2I0XA 3D0GE 4CM2A 1ACMB 1LXNA 5LMUJ 2AU0A 5EDWA 4MH8A 2O1UA 2VUGA 2EFPA 1REVA 1NZAA 3DXSX 1TAQA 2FJAB 2VQEF 4DV5J 1UWBA 4LF6F 1U6BA 3ZTPA 1UEVA 2QYCA 1WG5A 3UD5A 4OQJA 2NXEA 2HZCA 3ZKDA 1ZM9A 4O44B 3KLEA 2FLNA 4X64J 1WSVA 2ZUGA 2ZH6A 2BJ7A 5ADZA 1S9GA 2CPZA 2DGVA 2XZTB 1P6TA 1OYEA 4KTQA 4IZKA 3BN4A 4WFAQ 1BQMB 1JLAA 3M1VB 2YPZA 4E8UA 3JAMU 5HVGA 2O1VA 1EAYC 1ZPVA 5M2PA 2RILA 4LR8A 1QUPA 4Q43A 2W7OA 1UVMA 5B0AA 1S6PB 1HQEB 1VIOA 2WBMA 2ZOFA 4WIIA 4DUYJ 2PFFB 4HDHA 1IBKI 5ETKA 4JI0E 2EFQA 1IKYB 4JI0F 3TW0A 4LFBJ 4K4ZA 3A3OB 2IERA 3JSYA 4I4BA 4O23A 4DR1E 4O4RA 2VG7B 4IFVA 5IT9Q 2W2NP 3TVYA 3RGIA 1C0TA 3EZUA 2PNLA 1HWIA 3QT8A 1S76D 2VQFI 3P3EA 2LLZA 4YY3E 3LWLA 3AQPA 1WELA 3L95X 3OLBA 2JSXA 5KG0A 1OWXA 1VOMA 2BKOA 1FXRA 1MN9A 1X60A 2VICA 3TAMA 1TQLA 3GSDA 4C8YA 4K0KE 4DZ6A 5K36C 3JSMB 4LFBE 1QTNB 3EWGA 2FVSA 3Q2TC 1X0PA 1IN0A 3IXQA 2VONA 4QJVA 4OYMA 2LDYA 5ELWA 2FZGB 3WU4A 4DV4I 4NCGB 3EXYA 4YP3A 1RU2A 2F4VJ 2GIFA 3PNIA 2W8LA 2IY5B 1B4SA 2XBPA 3I82A 3DDKA 3AY0A 3C16B 2YNGB 4GC6A 2DRDA 3PW4A 4JV5J 1TU0B 3EGNA 3Q83A 3SSRA 4B9VA 4DV1J 4JI7J 2ZDOA 2COLA 3H20A 3PX4A 2XG8A 4ZDNA 2LEPA 1CJUA 2KN4A 3BO2A 2WVCA 5LL6R 4K0KF 4DX6A 3UDEA 3HHLC 4OI3A 2ZHOA 4R25A 3TQEA 3EPIA 1DARA 1UETA 2HFUA 1S1UA 4GO5X 4OZ2A 3RUBL 4NLPA 4KV8A 4B3RJ 4HKQA 2W8KA 2OHDA 5HJXA 3MR2A 2L9DA 3MFIA 1AB8A 3GFZA 5FLXQ 2Z5CA 4DV0E
chains in the Genus database with same CATH topology
2CG9A 4LF5I 4B3TI 4R1FA 4WUCA 4B3ME 4HYMA 4JI1I 4KHPE 4NXNE 4DR2I 2Q2EB 5GMDA 4JG4A 4AQYE 2V8PA 3PRYA 4Z7YA 4JI8E 3OTOI 3LTOA 4DV0I 4I3HA 4EMDA 5LMNE 4RPFA 1N36I 2HKJA 2UUCI 1N0VC 4FWGA 1H74A 3WU6A 5GMEA 3QT5A 1D6TA 4JI6E 2ZITA 1J5EE 2V2VA 5IT9C 1N34I 4DR3I 1B62A 1NZ0A 1HR0E 1FWKA 2VF3A 2WW4A 1BKNA 4IZJD 1S16A 3Q6MA 4Z7CA 1Y6ZA 4UTGA 1XMOI 2HHHE 4FWDA 1B63A 4IZKB 4DV2I 2E5LE 1XHKA 2OI2A 4DR2E 1HNXE 3QT6A 1Z5AA 2UXDI 4GKKI 1XMQE 2X7IA 4LFCE 2DEJA 3JAMQ 3T1YE 1XMOE 1N36E 5A2QC 4LF4I 3PYEA 3J80Q 4X65I 1FJGE 2PNMA 5FWKA 1XNQI 1Z0EA 4P52A 4UT4A 3Q1QA 2UXBE 1Z0WA 4PRVA 1Z0TA 4LF8I 1NHJA 4B3RI 2V2QA 2CGEA 3J81C 4DU7A 3PYFA 2X36A 3B8HA 4DPWA 4X62I 3J7AG 4LF9E 4X66E 4DPTA 4JI3E 2UXCE 2IOPA 1USUA 4DV4I 1Z0GA 3T1YI 2HK2A 2V34A 1IBLI 3LPSA 1N32E 2Z5CB 4LFAE 4LF6I 3WU3A 4DPUA 2BM1A 2R3VA 3LNUA 4MYUA 2UUAI 4WUBA 4DUYI 4JI5E 1HNWI 2A2CA 1QZRA 4FWHA 2HFSA 4N3OA 2O1WA 2BV3A 4HXZA 3GONA 3CWVA 1KTVA 3QT7A 2UUBE 1RREA 1FWLA 1ZM3A 1IBKE 4PRXA 1ELOA 3ZZUA 2ZM6E 4DR7I 1MU5A 4DV3E 5BR8E 1Z5CA 3K1JA 1IBLE 2VQFE 4FN5A 1WUUA 4YY3I 4NXMI 2GQ0A 4GKJI 5L3JA 1J5EI 1FKAE 2UU9E 4DU8A 4X64I 4JI2E 4DUZE 4DR5I 2F4VI 4DR1E 4IZJA 2ZM6I 3WU5A 4DPYA 4HACA 1NHHA 3M6AA 1MX0A 2UXDE 2HHHI 4GKJE 3V2UC 3P06A 3PYGA 3T1HI 1EA6A 3HULA 4JV5I 4HACB 4B3TE 4ED4A 1VISA 5IWAI 4DR1I 3ZKDA 1ZXMA 4B3MI 4DV6E 2EFGA 3H4LA 4JYAE 3HJCA 2HKEA 4JI4I 4OX9I 4LF7I 4YHHE 2AJ4A 3K85A 4LF5E 2LJPA 4PU9A 4JV5E 1PVGA 3K17A 1H7UA 1Y4UA 2F4VE 3J80C 4KQVA 4DV7E 1HNZE 1KVKA 4MYTA 4JI8I 4JI3I 4HY1A 4LF8E 4LF7E 3T1HE 4DR3E 2E1RA 3B82A 1Z5BA 4DV6I 1EI1A 5A2QQ 4DR4E 4LFBI 1K47A 1S4EA 1U2RA 4DV1E 2UUAE 1HR0I 4DV2E 4USMA 2E5LI 1Z0CA 4B3SI 5LMUI 2A2DA 4LFAI 2Z5BA 4ZVIA 1N33I 1XMQI 4YHHI 4XTJA 4LFCI 2HK3A 1HNWE 4DR7E 3ZZTA 4GKKE 1HNXI 4KHPI 3J81Q 1IBMI 1Z0VA 3ZM7A 1Z59A 1N33E 2VQEI 1RR9A 3B78A 4AQYI 3OTOE 1PKPA 3J7AM 1I94E 1XNRE 5LMNI 4X64E 4X65E 4JI7I 4NXNI 1XNQE 1ZM4A 4DXLA 2NPFA 2ZBKB 5LMUE 1ZXNA 2Z5BB 3Q6NA 3D4JA 2UXCI 4B3RE 4DV1I 4USKA 2Z5EA 1Z0BA 1I94I 1UEKA 4JI7E 2XEXA 4M1KA 2DEIA 1A6FA 3ZKBA 1ZM2A 5FLXC 4X62E 1KKHA 4WUDA 1N32I 4DV5I 4LF9I 4JYAI 1N0UA 1FI4A 2BM0A 2O1TA 1N34E 2VQEE 2GS8A 3ZZ0A 1FNMA 4JI5I 1NHIA 2J7KA 3JAMC 5IWAE 1IBME 4K0KI 1PIEA 4LF6E 4JI4E 3F0NA 1HNZI 4DUYE 1OJ4A 2O1UA 1XNRI 4JI0E 2V2ZA 1ZM9A 4IZJB 4DV7I 4IZKA 1FJGI 1USVA 2UUBI 1Y4SA 4FW9A 4DR6E 4DV3I 2O1VA 4DV5E 1IBKI 1H72C 2UXBI 4JI0I 4LF4E 4URLA 5BR8I 5IT9Q 2PNLA 3QT8A 2VQFI 1KIJA 2CZ9A 1H73A 4YY3E 4JI2I 4DPXA 4K0KE 2UU9I 4NXME 3PYDA 4DR6I 1H7SA 4LFBE 2IOQA 4DUZI 4DR5E 4DR4I 3WU4A 4DV4E 1HK7A 4B3SE 3V5RA 2UUCE 4JI1E 2R42A 4P7AA 5LL6R 4JI6I 1DARA 4X66I 2HFUA 1MG7A 5FLXQ 4OX9E 2Z5CA 4DV0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 I;  4B3T I;  4R1F A;  4WUC A;  4B3M E;  4HYM A;  4JI1 I;  4KHP E;  4NXN E;  4DR2 I;  2Q2E B;  5GMD A;  4JG4 A;  4AQY E;  2V8P A;  4Z7Y A;  4JI8 E;  3OTO I;  3LTO A;  4DV0 I;  4I3H A;  4EMD A;  5LMN E;  4RPF A;  1N36 I;  2HKJ A;  2UUC I;  1N0V C;  4FWG A;  1H74 A;  3WU6 A;  5GME A;  3QT5 A;  1D6T A;  4JI6 E;  2ZIT A;  1J5E E;  2V2V A;  5IT9 C;  1N34 I;  4DR3 I;  1B62 A;  1NZ0 A;  1HR0 E;  1FWK A;  2VF3 A;  2WW4 A;  1BKN A;  1S16 A;  4Z7C A;  4UTG A;  1XMO I;  2HHH E;  4FWD A;  1B63 A;  4DV2 I;  2E5L E;  1XHK A;  2OI2 A;  4DR2 E;  1HNX E;  3QT6 A;  1Z5A A;  2UXD I;  4GKK I;  1XMQ E;  2X7I A;  4LFC E;  2DEJ A;  3JAM Q;  3T1Y E;  1XMO E;  1N36 E;  5A2Q C;  4LF4 I;  3PYE A;  3J80 Q;  4X65 I;  1FJG E;  1XNQ I;  1Z0E A;  4P52 A;  4UT4 A;  3Q1Q A;  2UXB E;  1Z0W A;  4PRV A;  1Z0T A;  4LF8 I;  1NHJ A;  4B3R I;  2V2Q A;  3J81 C;  4DU7 A;  3PYF A;  2X36 A;  3B8H A;  4DPW A;  4X62 I;  3J7A G;  4LF9 E;  4X66 E;  4DPT A;  4JI3 E;  2UXC E;  4DV4 I;  1Z0G A;  3T1Y I;  2HK2 A;  2V34 A;  1IBL I;  3LPS A;  1N32 E;  4LFA E;  4LF6 I;  3WU3 A;  4DPU A;  2BM1 A;  2R3V A;  3LNU A;  4MYU A;  2UUA I;  4WUB A;  4DUY I;  4JI5 E;  1HNW I;  2A2C A;  1QZR A;  4FWH A;  2HFS A;  2BV3 A;  4HXZ A;  3GON A;  3CWV A;  1KTV A;  3QT7 A;  2UUB E;  1RRE A;  1FWL A;  1ZM3 A;  1IBK E;  4PRX A;  1ELO A;  3ZZU A;  2ZM6 E;  4DR7 I;  1MU5 A;  4DV3 E;  5BR8 E;  1Z5C A;  3K1J A;  1IBL E;  2VQF E;  4FN5 A;  1WUU A;  4YY3 I;  4NXM I;  4GKJ I;  5L3J A;  1J5E I;  1FKA E;  2UU9 E;  4DU8 A;  4X64 I;  4JI2 E;  4DUZ E;  4DR5 I;  2F4V I;  4DR1 E;  2ZM6 I;  3WU5 A;  4DPY A;  4HAC A;  1NHH A;  3M6A A;  1MX0 A;  2UXD E;  2HHH I;  4GKJ E;  3V2U C;  3PYG A;  3T1H I;  1EA6 A;  3HUL A;  4JV5 I;  4HAC B;  4B3T E;  4ED4 A;  1VIS A;  5IWA I;  4DR1 I;  3ZKD A;  1ZXM A;  4B3M I;  4DV6 E;  2EFG A;  3H4L A;  4JYA E;  2HKE A;  4JI4 I;  4OX9 I;  4LF7 I;  4YHH E;  2AJ4 A;  4LF5 E;  2LJP A;  4PU9 A;  4JV5 E;  1PVG A;  3K17 A;  1H7U A;  2F4V E;  3J80 C;  4KQV A;  4DV7 E;  1HNZ E;  1KVK A;  4MYT A;  4JI8 I;  4JI3 I;  4HY1 A;  4LF8 E;  4LF7 E;  3T1H E;  4DR3 E;  2E1R A;  3B82 A;  1Z5B A;  4DV6 I;  1EI1 A;  5A2Q Q;  4DR4 E;  4LFB I;  1K47 A;  1S4E A;  1U2R A;  4DV1 E;  2UUA E;  1HR0 I;  4DV2 E;  4USM A;  2E5L I;  1Z0C A;  4B3S I;  5LMU I;  2A2D A;  4LFA I;  4ZVI A;  1N33 I;  1XMQ I;  4YHH I;  4XTJ A;  4LFC I;  2HK3 A;  1HNW E;  4DR7 E;  3ZZT A;  4GKK E;  1HNX I;  4KHP I;  3J81 Q;  1IBM I;  1Z0V A;  3ZM7 A;  1Z59 A;  1N33 E;  2VQE I;  1RR9 A;  3B78 A;  4AQY I;  3OTO E;  1PKP A;  3J7A M;  1I94 E;  1XNR E;  5LMN I;  4X64 E;  4X65 E;  4JI7 I;  4NXN I;  1XNQ E;  1ZM4 A;  4DXL A;  2NPF A;  2ZBK B;  5LMU E;  1ZXN A;  3D4J A;  2UXC I;  4B3R E;  4DV1 I;  4USK A;  1Z0B A;  1I94 I;  1UEK A;  4JI7 E;  2XEX A;  4M1K A;  2DEI A;  1A6F A;  3ZKB A;  1ZM2 A;  5FLX C;  4X62 E;  1KKH A;  4WUD A;  1N32 I;  4DV5 I;  4LF9 I;  4JYA I;  1N0U A;  1FI4 A;  2BM0 A;  1N34 E;  2VQE E;  2GS8 A;  3ZZ0 A;  1FNM A;  4JI5 I;  1NHI A;  2J7K A;  3JAM C;  5IWA E;  1IBM E;  4K0K I;  1PIE A;  4LF6 E;  4JI4 E;  3F0N A;  1HNZ I;  4DUY E;  1OJ4 A;  1XNR I;  4JI0 E;  2V2Z A;  1ZM9 A;  4DV7 I;  1FJG I;  2UUB I;  4FW9 A;  4DR6 E;  4DV3 I;  4DV5 E;  1IBK I;  1H72 C;  2UXB I;  4JI0 I;  4LF4 E;  4URL A;  5BR8 I;  5IT9 Q;  3QT8 A;  2VQF I;  1KIJ A;  2CZ9 A;  1H73 A;  4YY3 E;  4JI2 I;  4DPX A;  4K0K E;  2UU9 I;  4NXM E;  3PYD A;  4DR6 I;  1H7S A;  4LFB E;  4DUZ I;  4DR5 E;  4DR4 I;  3WU4 A;  4DV4 E;  4B3S E;  3V5R A;  2UUC E;  4JI1 E;  2R42 A;  4P7A A;  5LL6 R;  4JI6 I;  1DAR A;  4X66 I;  2HFU A;  1MG7 A;  5FLX Q;  4OX9 E;  4DV0 E; 
#chains in the Genus database with same CATH topology
 4OFZ A;  4M95 A;  3D9B A;  2CG9 A;  2M2B A;  1NDC A;  3GCW P;  4EO8 A;  2B7B B;  4C7Q A;  2XM3 A;  4C8M A;  3NOC A;  4UOF A;  2E5I A;  2GAG C;  3G2X A;  4F36 A;  5J2M B;  3ZTS A;  4CT8 A;  4TKT A;  1QLN A;  2ILY A;  3QPI A;  3OL6 A;  1M5P C;  4MU4 A;  1WF0 A;  2FC9 A;  1T02 A;  3D67 A;  3R97 A;  5A8K B;  3FEX B;  5HN0 A;  3KLG A;  4JG4 A;  2MY7 A;  2Y1J A;  4AQY E;  5L46 A;  2DNN A;  4RU2 A;  1F6T A;  3HHL B;  1P27 B;  3I5C A;  3MEC A;  4QIW D;  5E3R A;  1B0T A;  1VHI A;  2F5G A;  2RSQ A;  3MTK A;  5F0W A;  2R2U A;  3OTO I;  3GIR A;  3OQ2 A;  4IG0 A;  1OYP A;  2GO8 A;  3HMJ G;  3I5B A;  2OD6 A;  2CJK A;  4DV0 I;  5AXN A;  1O8B A;  2RDJ A;  1U0H A;  5C0X E;  1JKH B;  2KVI A;  4KAI A;  2ZWO A;  3N0V A;  4CWB A;  2VD3 A;  5HMW A;  5KG2 A;  1NK6 A;  1RAE B;  2QMU B;  4A48 A;  1VBY A;  4ECY A;  1UTA A;  3FFI A;  4ZP7 A;  2HFZ A;  1LQ9 A;  2MHE A;  2GMJ A;  4WBF A;  2VJV A;  4ECZ A;  1D6T A;  4C8O A;  1NSA A;  4U3D A;  1FO1 A;  1RAB B;  2IRY A;  3CJT A;  4ZN1 A;  1VJW A;  2HBY B;  5E0O A;  5A8R B;  1RJJ A;  4DV6 J;  2B56 A;  3QLH A;  3KK3 A;  3AOB A;  5HAT A;  3THT A;  2PMZ D;  3GV8 B;  3C3L A;  1TL1 B;  2VG5 A;  5DRR A;  2C2K B;  3RRK A;  3JSB A;  2LEB A;  5J2Q A;  2HVH A;  3ENQ A;  3AD8 C;  4NLW A;  4DR3 I;  1CUL B;  4TVA B;  1CPZ A;  1FWK A;  3LP2 A;  2GQC A;  2VOP A;  4GKJ F;  4K4S A;  3U1L A;  4CTA B;  4F4K A;  1I5O B;  4TXS A;  2APO A;  2WW4 A;  4YHH F;  1M5O C;  2I1R A;  1Q7L B;  3CSK A;  3IG1 B;  3W5Y A;  2HRU A;  2PO4 A;  1DQ9 A;  2UUB J;  4UZC A;  1IWG A;  4WP8 A;  1HNI A;  4U9R A;  2QG9 B;  5DG7 A;  3NS5 A;  4N8O A;  5E2Q A;  2C2Z B;  2QV6 A;  4OZ5 A;  1XMO I;  1IKV B;  1QAX A;  2HSE B;  3NAI A;  5J1N A;  3D6M B;  4JBC A;  5LM7 E;  2ZH3 A;  3DLH A;  4AIM A;  2J7U A;  2YPY A;  1FDD A;  5EUH A;  4RUA A;  5L1I A;  3DRP A;  2J65 A;  2X3G A;  2WON A;  4KYZ A;  2F1F A;  4DR3 J;  2EFO A;  4B3O B;  3MUM P;  4EEY A;  5J1E A;  4B3T J;  2B4O A;  1Z5A A;  1IVZ A;  1MU2 A;  5ETL A;  3RBZ A;  4FYY B;  3KHH A;  4DS4 A;  3VAF A;  1VQ4 S;  4LF8 J;  4UY8 5;  4NLY A;  3AXM A;  3SCK E;  3EDQ B;  4H4K A;  3OVA A;  3F73 A;  3ILO A;  3JAM Q;  5IOL A;  2G1H A;  3LP1 A;  4ZLL A;  3T1Y E;  4NLQ A;  1FK9 B;  1XMO E;  1S1W B;  2V63 A;  2V69 A;  2CQ1 A;  2ZJP Q;  5A2Q C;  4U67 Q;  4G6V B;  1RAF B;  2C39 A;  4OX6 A;  1P42 A;  3H59 A;  1N88 A;  1M5H A;  4DL4 A;  4KGK A;  4BLG A;  1R31 A;  2B0G A;  2H4Y B;  2LMI A;  5C25 B;  5LSL A;  5J2Q B;  4KT0 C;  1OYR A;  1FFS B;  4O3R A;  4X65 I;  2K7K A;  2OSQ A;  4DJB A;  2VFT A;  1Z0E A;  5KFR A;  3M7N D;  1RK8 A;  4ICL B;  4IFD B;  1Z0W A;  3P96 A;  3UWT A;  5KFV A;  1S4F A;  1SC1 B;  2OFG X;  2KL8 A;  4OIX A;  5ETN A;  4AE5 A;  4NEZ A;  4ES2 A;  5EWE A;  1VQN S;  3DLG A;  5JMN A;  4JYA J;  5MAO A;  4LF8 I;  2Z30 B;  3M30 A;  4PG4 A;  4CLF A;  1TL7 A;  3PX0 A;  4B3R I;  3QGP A;  3HKM A;  3AOA A;  3RZA A;  1HAR A;  4ED1 A;  5HJY A;  3CB4 A;  4CYU B;  1YTY A;  1CQN A;  1VQK S;  2EEY A;  4DU7 A;  1Q82 T;  1ZZN A;  3MI7 X;  3Q8P B;  4GKK F;  2Q6C A;  3V6H A;  4LF7 J;  5KT3 A;  1BY9 A;  3HHK A;  4HL9 A;  1HBO B;  3CJK A;  1YWX A;  3HHL A;  2MYF A;  3O8W A;  1RT6 B;  1T3O A;  2X36 A;  3J7A G;  1TKT B;  2PT0 A;  2V4J B;  2WZ1 A;  3D6H B;  2BJ8 A;  1QD1 A;  3FJ2 A;  5T7L A;  4WFZ A;  2PE8 A;  1YBU A;  3MM8 A;  4MK7 A;  3DRX A;  3JSR A;  3ZZY A;  3KK1 A;  1S0M A;  2PMW A;  1P9Q C;  5BYQ A;  2HQI A;  3JXO A;  5L1J A;  4UOC A;  4ZVG A;  2ZDP A;  1Y9O A;  2DK2 A;  4RUH A;  2ZZN A;  4RU9 A;  1RHY A;  2JEJ A;  3T1Y I;  4W90 B;  1JLB A;  1Q4R A;  2XZD B;  3FCV A;  2OEM A;  3RBD A;  4TU8 A;  3HHL D;  1HQU B;  2AT1 B;  4IRK A;  3F41 A;  2ZBQ A;  5C24 B;  2B9E A;  2QFJ A;  2B51 A;  1N32 E;  4IKA A;  3MDF A;  2LDI A;  2Z4P A;  5A6W A;  3SQG B;  5CZX A;  5KT7 A;  2ZHB A;  2MST A;  5B0D A;  3VCD A;  3OW2 R;  1SC3 B;  3NBP B;  4YR2 A;  2NQP A;  4ZPW R;  4QIV A;  2HGM A;  3LGH A;  3NP5 A;  1AYE A;  1WWH A;  3DLJ A;  3QIP B;  5AE2 A;  5DQI A;  1VQ7 S;  5DG8 A;  1KS2 A;  1YJN S;  4PWD B;  3ENV A;  4M5L A;  3CJR A;  4MYU A;  5D77 A;  3K89 A;  3M8P A;  1M5K C;  3G9C A;  1HLW A;  2C2O B;  4X66 I;  1KVI A;  1LW2 B;  2D9O A;  2GHW A;  3FNN A;  4NZ7 A;  4H54 A;  4LOM A;  4WYW A;  2NRE A;  2YX1 A;  3A8K A;  4OJG A;  2F4V F;  3JTN A;  1FVS A;  2NN6 B;  1FES A;  1KSP A;  2RDD A;  2M8D B;  2HEK A;  3CCZ A;  2HWI A;  4GC7 A;  3DYA A;  3GR0 A;  1EP4 B;  4NCG A;  4JI5 F;  4N3O A;  2YQ3 A;  3AFG A;  3N28 A;  4WTY A;  2FZK B;  1C1B B;  1VDH A;  2F7V A;  1ZS6 A;  2MZJ A;  2JC0 A;  2VKR A;  2PO2 A;  2J9D E;  5D15 A;  2R2R A;  2JX2 A;  1TL5 A;  1CBK A;  3D0I E;  3Q8U A;  3GG0 A;  4N76 A;  1R0C B;  2AJ2 A;  3MED B;  4NRU A;  2JT2 A;  1NK5 A;  4DCJ B;  1U2F A;  2M52 A;  1JJC B;  3PJ9 A;  4X2B A;  4W92 B;  1GT8 A;  3C6U A;  2BOP A;  2RQM A;  4P2X A;  3ETO A;  3ZTQ A;  3BJY A;  1D9F A;  4PRF A;  1UFK A;  4UF4 A;  4FP9 A;  4O3P A;  1XMO J;  2VG7 A;  4IFV B;  2UUB E;  3OSN A;  1RZM A;  3HXM A;  4IR1 A;  1IBL E;  1A7G E;  1VC0 A;  4LRD A;  1WUU A;  3DGP B;  3FRY A;  5KFB A;  1C1C A;  4YY3 I;  5I3U B;  1W26 A;  2U1A A;  2GQ0 A;  5HBM A;  3I9Z A;  5KFW A;  1Q16 B;  3I0R B;  2ZZT A;  2UU9 J;  1WNE A;  4QU7 A;  3W7B A;  4N5S A;  1GFW B;  5HI7 A;  3KWM A;  5LL6 d;  2KJW A;  2KU7 A;  1TK5 A;  1VQ8 S;  1VQY A;  3SDE A;  2LQ9 A;  5MLC V;  4CNY A;  1UCN A;  2Z2L A;  2AX0 A;  4PWW A;  4DL5 A;  4PZV A;  2ZM6 I;  3AH6 A;  4C8Z A;  2VDI A;  1HMV B;  1FNO A;  2PD1 A;  1RTH A;  1K73 T;  2ZVS A;  1T94 A;  2LXU A;  5GVQ A;  1UWB B;  3K57 A;  2JWN A;  2WVE A;  5D0R A;  2D3O R;  4ZVQ B;  3GLL A;  4I64 A;  4XK8 C;  1KON A;  1YH8 A;  1VS3 A;  1IR1 A;  4F3Q A;  2XMJ A;  3MCM A;  4NWB A;  1XMB A;  4KFB A;  4NAS A;  3V2U C;  3MUV P;  2D41 A;  1FX2 A;  2AD9 A;  1KVJ A;  2CJX B;  1VR6 A;  2RH3 A;  2CJA A;  5H9E K;  2BR2 A;  3HUL A;  1UZD A;  2NN6 F;  1RQ0 A;  2RB7 A;  3B4D A;  2V5H G;  2PEH A;  4MDT A;  2M5Y A;  4KGZ B;  4E98 A;  4ZCL A;  3QNW B;  1U7L A;  1SH3 A;  3HHE A;  2DRA A;  3QFH A;  3NS6 A;  4DR1 I;  1VRU A;  1WC4 A;  3AQO A;  5CYM B;  1GX5 A;  4O0I A;  3FKB A;  3KHG A;  4K4Y A;  4JOU A;  1SKW A;  2IJR A;  3NRB A;  4YY3 F;  1HNX F;  1ZXM A;  2J76 E;  4DV6 E;  2MQP A;  3IBC B;  1S7I A;  4DQP A;  4URQ U;  4KE5 A;  2F1D A;  5L8R C;  4JYA E;  3M8W A;  1RT4 A;  3IBF B;  3BGU A;  3GIM A;  2MKY A;  4FNI A;  2FZC B;  4ELV A;  1ULR A;  2JFK A;  1RTD A;  4LF7 I;  3R1H A;  4YN3 B;  2MXY A;  1H2U X;  5K36 A;  1FRX A;  3GFH A;  4PXE A;  4FYX B;  3DM2 B;  4A8W A;  3GMG A;  2W2M P;  4ILR A;  4PU9 A;  1QAI A;  1HR0 F;  5EWG A;  1GX6 A;  3K17 A;  4DL2 A;  4LMZ A;  4CLT A;  2CQG A;  1WHW A;  3LPY A;  2F40 A;  2CQH A;  4GVB B;  5BJR A;  4QYR A;  4ZIT A;  5GAD I;  2MGZ B;  2CQ4 A;  4ANE A;  3CCS S;  2X1G A;  4KGX B;  2DJW A;  2FVC A;  2PNZ A;  2DTJ A;  3MR6 A;  4DV3 J;  4DV7 E;  1HNZ E;  1LWX A;  3J81 j;  1KVK A;  1LK7 A;  1FTC A;  1RBA A;  4KFB B;  4YB1 P;  2KZM A;  3PRY A;  2NSC A;  3D1O A;  2AQ4 A;  5JEA F;  3M6U A;  2GQQ A;  4AT1 B;  1PYS B;  4HH0 A;  2CAJ A;  1NRK A;  2A6M A;  2CWX A;  1CJK B;  4LF8 E;  2P2C B;  3T1H E;  2DIV A;  4C3M A;  2QSF A;  1B0V A;  3KG4 A;  1XWL A;  4RR5 A;  5ETS A;  2OH2 A;  4ATN A;  3K5O A;  2M8H A;  4DR3 E;  2QRR A;  3HVA A;  3LAK A;  1RIS A;  2YKO A;  3IRX A;  2A18 A;  2M3D A;  4RLE A;  2XC9 A;  2Y8Y A;  3G6Y A;  2OPP B;  1AW0 A;  2V8D A;  1NK0 A;  4DR6 F;  1IKW B;  3MCS A;  2N4C A;  3R5C A;  2PO1 B;  1M90 T;  3E51 A;  1NSQ A;  2KZZ A;  3P3C A;  1ZH5 A;  4J9O A;  4LSN B;  4DR4 E;  5HBM B;  2UXB J;  3MD1 A;  1K47 A;  3OR2 B;  1C1C B;  3FUY A;  2J8A A;  2AEM A;  3NCR A;  2MKI A;  3TX0 A;  5JEA A;  4E0D A;  4DV1 E;  4NLX A;  3GYX B;  3BQ2 A;  1RGV A;  4DV4 F;  2IA6 A;  4ZVO B;  1OPZ A;  4J90 A;  4DF4 A;  5DNX A;  2E5L I;  1YHQ S;  1N32 F;  1OQ3 A;  2A2D A;  5DGA A;  3AAW B;  3CCU S;  1BMQ B;  4HTJ A;  4X4S A;  1ZZF A;  1HBU B;  3FDS A;  4A8K A;  1AFI A;  2YKM B;  1BD6 A;  4OZ1 A;  4UY8 T;  1XMQ I;  4OO1 E;  3MFH A;  4FVC A;  3U1Y A;  1C4A A;  2RHS B;  4NZ0 A;  2WP8 B;  1DAX A;  2BVZ A;  4BHQ A;  1Q78 A;  1YIJ S;  2JJ4 D;  5DRQ A;  4YY3 J;  1N52 B;  1SUQ A;  2YBV A;  3W1Y C;  2HK3 A;  3IP0 A;  4YS2 A;  5DRP A;  2C39 B;  2KG0 A;  5D3G A;  1HNW E;  1QVF R;  3L3C A;  2H5E A;  1IM4 A;  1X4F A;  3BGR A;  2W4D A;  3SFG A;  3ZZT A;  1F5C A;  3OJU A;  1QSY A;  2KDO A;  1LW2 A;  2DNH A;  3TOQ A;  2IA0 A;  2RAQ A;  1S1V A;  1TZ0 A;  2BDP A;  2D3U A;  3PIO Q;  3RR8 A;  5E3A A;  1OO0 B;  1T9Y A;  4I2Q A;  4FF2 A;  1Z0V A;  5JEA E;  1AZS B;  1Z59 A;  2DYA A;  3C15 A;  5EL9 A;  1F5A A;  1PJ6 A;  1TMM A;  3EGW B;  3ILI A;  5D0H A;  1SPB P;  2YKA A;  4ZS6 A;  2Y3Y A;  3PM9 A;  4OJ3 A;  3UCZ P;  3QIP A;  4OX7 A;  3PTW A;  3S7R A;  2QZ8 A;  3FCW A;  4ECU A;  2FIU A;  4DCP B;  4IS9 A;  2VQE I;  1G1X A;  4X62 J;  1BLU A;  4G1Q A;  4K5S A;  1I94 E;  2DHA A;  5IV4 A;  2OJ3 A;  1E3H A;  4X84 A;  4PXB A;  5KG4 A;  3CD6 S;  1IXK A;  4DLE A;  5LMN I;  1K1Q A;  2DGX A;  3IBW A;  3QAE A;  2RD5 C;  4OYW A;  4B9M A;  1R6L A;  3DXB A;  4X64 E;  2HQ3 A;  4RW4 A;  2G2Y A;  1U1Q A;  1Q1K A;  5DM6 Q;  5C42 B;  4I2P A;  1FHT A;  4CLP A;  1U8S A;  5DG9 A;  2ADB A;  3E3X A;  4DR4 F;  1JLQ B;  3KMS A;  4A47 A;  4DV4 J;  1R6Y A;  2XMM A;  2FJB B;  1VQP S;  2DHG A;  1SV5 B;  1R43 A;  2WP8 A;  5LMU E;  3R2C J;  4C4W A;  1ZXN A;  1RLC L;  1HBU A;  1RWV B;  2KRB A;  2VAS A;  2W25 A;  3POT B;  3MMA B;  4ID5 B;  4URS A;  1T7P A;  5FJ4 A;  2CZ4 A;  2BW7 A;  2DGQ A;  2PEB A;  4USW A;  3CJK B;  3UNG C;  5CAA A;  2VOO A;  4B3R E;  2UXC I;  1BWV A;  2YY3 A;  3RG6 A;  3NNA A;  2JEI A;  5JVH Q;  2RVJ A;  3JYT B;  3MEE B;  3QO9 A;  4ALZ A;  4JI7 E;  1JXL A;  2XNQ A;  5JEA B;  2HBQ B;  1I94 J;  2CPI A;  3ZKB A;  1ZM2 A;  5LMN J;  4OI2 A;  1GMW A;  3CDI