4HACB

Crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
308
structure length
308
Chain Sequence
LVPRGSHMVSCSAPGKIYLFGEHAVVYGETAIACAVELRTRVRAELNDSITIQSQIGRTGLDFEKHPYVSAVIEKMRKSIPINGVFLTVDSDIPVGSGLGSSAAVTIASIGALNELFGFGLSLQEIAKLGHEIEIKVQGAASPTDTYVSTFGGVVTIPERRKLKTPDCGIVIGDTGVFSSTKELVANVRQLRESYPDLIEPLMTSIGKISRIGEQLVLSGDYASIGRLMNVNQGLLDALGVNILELSQLIYSARAAGAFGAKITGAGGGGCMVALTAPEKCNQVAEAVAGAGGKVTITKPTEQGLKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mevalonate kinase
publication title Crystallization and preliminary X-ray diffraction analysis of mevalonate kinase from Methanosarcina mazei.
pubmed doi rcsb
source organism Methanosarcina mazei
total genus 89
structure length 308
sequence length 308
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00288 GHMP_kinases_N GHMP kinases N terminal domain
B PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4hacB02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4hacB01
4DV6E 1IBKE 4FWHA 4DR5E 4KHPI 1MG7A 1Z0WA 1H7UA 2Q2EB 3T1HE 5BR8E 4LF7E 2V34A 4HY1A 1S4EA 1XMQI 1IBLI 4JV5I 4K0KI 2ZITA 4YY3E 1HNWI 1IBMI 2F4VE 4URLA 4JI4I 2V2QA 4UTGA 4ED4A 1ZXMA 1NZ0A 1VISA 1XMOE 4NXNI 4NXMI 1Z5AA 3J81Q 3GONA 4DV5E 4DV6I 5IWAE 1IBKI 1N32E 4DR5I 1DARA 1D6TA 1ZXNA 1Z5BA 3T1HI 1I94E 5BR8I 4LF7I 3J7AG 1Z0TA 4YY3I 2F4VI 1EA6A 4DPUA 4DR6E 3ZZTA 4DV1E 1B62A 2V8PA 2WW4A 3K17A 1XMOI 1S16A 2A2DA 1H73A 1ZM9A 4LF9E 2UUCE 4DV5I 5IWAI 1N32I 4JI1E 1I94I 1KVKA 5LMUE 1HNZE 2ZM6E 2X36A 2V2VA 1N0VC 2UU9E 4DR6I 4DV1I 1FWKA 3B78A 4LF9I 1XNQE 2UUCI 4B3ME 4R1FA 4JI1I 1N34E 5LMUI 1HNZI 2ZM6I 2HKJA 1OJ4A 2UUBE 4HACA 1Z0BA 2UU9I 1N33E 4FWDA 3LNUA 3J80Q 3JAMC 1PVGA 4LF5E 4RPFA 1XNQI 1B63A 5FLXC 4B3MI 2UXDE 2VQFE 1N34I 4JI0E 4YHHE 2OI2A 3PYDA 2UUBI 4GKJE 2HK2A 1N33I 2VF3A 4DV2E 1HNXE 3ZM7A 4LF5I 4I3HA 4EMDA 4UT4A 4HACB 1MU5A 2UXDI 4JI6E 3J81C 2VQFI 2LJPA 4JG4A 4JI0I 4YHHI 3QT5A 5A2QQ 3F0NA 1KKHA 2R3VA 1N0UA 4DU8A 2BM1A 4GKJI 1J5EE 3PYGA 2BV3A 4DPTA 4DV2I 1HNXI 1K47A 2X7IA 1Z0CA 2VQEE 4USKA 3WU3A 1UEKA 4MYUA 2R42A 4PRVA 3V2UC 5IT9Q 4JI6I 1WUUA 1KTVA 2DEJA 4JI7E 3ZKBA 1J5EI 4DUYE 3QT8A 3H4LA 1FNMA 4JYAE 1RR9A 3ZZUA 4DV3E 2VQEI 4FN5A 2DEIA 4LFCE 4ZVIA 4DR4E 2E5LE 1MX0A 4X64E 3OTOE 4JI7I 1NHJA 4B3RE 1H7SA 4DUYI 4JI2E 1Z0VA 4JYAI 1NHHA 4DV3I 2AJ4A 3M6AA 4LF6E 3Q1QA 5LL6R 4Z7CA 1Z5CA 1PKPA 2HK3A 3J80C 3T1YE 4LFCI 4X66E 3ZZ0A 4DR4I 4OX9E 2E5LI 2HFSA 4LF8E 4B3TE 1HR0E 4X64I 3OTOI 4JI3E 3LTOA 3CWVA 4HXZA 4B3RI 4DU7A 4USMA 4JI2I 4GKKE 4LF6I 2UXBE 3PYEA 4DV7E 4FW9A 1ZM4A 2E1RA 1U2RA 3T1YI 2UXCE 4DR3E 4X66I 1RREA 4OX9I 4LF8I 4M1KA 1Z0EA 5FLXQ 4B3TI 3QT7A 1HR0I 4LFBE 4JI3I 3WU6A 2V2ZA 5A2QC 4WUBA 4FWGA 3LPSA 1ZM3A 4GKKI 3B82A 1BKNA 2UXBI 4DV7I 1EI1A 1H72C 2BM0A 2UXCI 4DR3I 1QZRA 5IT9C 3ZKDA 4LFBI 3PYFA 3V5RA 1XNRE 1H74A 4P52A 5GMEA 1FKAE 4DPYA 2ZBKB 4JI5E 3K1JA 4X62E 3QT6A 4LF4E 3D4JA 4DR2E 4DV0E 2XEXA 3WU4A 4DUZE 1PIEA 2HKEA 4DR1E 1XHKA 1XNRI 3B8HA 1KIJA 2NPFA 1FI4A 2A2CA 4XTJA 2UUAE 1NHIA 2HHHE 1ELOA 4B3SE 4LFAE 1N36E 4JI5I 5LMNE 2HFUA 4X62I 4WUDA 4LF4I 4DR2I 1Z59A 1ZM2A 4KQVA 4DV0I 5L3JA 1FJGE 2EFGA 1FWLA 4DV4E 4DUZI 4PRXA 1Z0GA 4DR1I 4P7AA 3HULA 4X65E 4AQYE 4HYMA 2GS8A 4DPWA 2CZ9A 4DR7E 4JI8E 2J7KA 2UUAI 3J7AM 2HHHI 5GMDA 4WUCA 4Z7YA 4KHPE 4B3SI 4LFAI 1N36I 4MYTA 5LMNI 1IBLE 1XMQE 4JV5E 4K0KE 1FJGI 4DXLA 4DV4I 1HNWE 1IBME 4JI4E 4X65I 4AQYI 3WU5A 3JAMQ 4DPXA 4PU9A 1A6FA 4DR7I 4NXNE 4NXME 4JI8I
chains in the Genus database with same CATH superfamily
2Z5CA 1WTFA 1VQ9S 3G82A 3QMQA 2IYGA 3JB9k 3BN4A 2V34A 3UPFA 3KLFB 2JLEA 3SCIE 5K9FA 4R5PA 3LGHA 2Y1IA 5KG1A 2OFGX 2V2QA 5DGBA 1G1XA 3HKZD 2HEKA 3CULA 4O3PA 4NA2A 4CYUA 3CMES 5K20B 1Y4ZB 4QIWD 4U3BA 4MK9A 1RWNB 3J81j 3GG0A 4JI0J 4KGXB 4FVCA 1D6TA 2CYYA 5C0XA 3LQVA 1VC6A 2VFSA 5EX3A 5T41A 3DRYA 4DPUA 2C2DA 4DR6E 1HWUA 3BGOP 1LV5A 3FSXA 2V8PA 3NMRA 1F2GA 1YJNS 2UUCE 2CJXB 1ZZNA 1YJWS 5GMKa 1JQGA 5LMUE 2ZM6E 4A8XA 3CC4S 3L7PA 4K2XA 3U1KA 3CSKA 1RWXB 2CRLA 4DR6I 4IFYA 2UP1A 3MM8B 5KT7A 5F8JA 2EK6A 2UUCI 3HLUA 4ED0A 1RT6B 2CQ1A 4IFDB 1S0VA 1KN6A 5LMUI 5IC4B 2ZM6I 3BF4A 5J2PA 3QGGA 3ENVA 1FRXA 3FCVA 2IAJB 2BA0G 2QGFB 3NY0A 3W5XA 3PV8A 2XYHB 1VQ7S 4URQU 1MROA 4PQUB 2DYAA 3I0SA 2HHQA 2HLTA 1EARA 1SVDA 3O1LA 2C3MA 3DGVA 4KHRA 3FVYA 1D9AA 3QSIA 2ZUGA 1ROFA 1P8GA 3J81U 2XMMA 1FKPB 4P6QA 3ZM7A 4R0EA 5EL9A 2ZNZA 4O23A 2ZC3A 3BYRA 1MU5A 2CNKB 3CUNA 1HR0J 5IV3A 3M6UA 2R7OA 1WC0A 1X5OA 4DU8A 2GW8A 4ERDA 4NOHA 1IBMF 1LWCA 3C8YA 3M9NB 3RB4A 4JI4F 4L76A 2CG4A 3W66A 3W65A 4KQZA 2A0FB 3I5AA 2ROPA 4ECYA 1RT7A 3Q2SC 2C2ZB 3TAPA 2YKOA 2P9CA 4JYAE 3HJFA 2XZTB 1LQ9A 5SUHA 4AYBD 4PPZA 3LP2B 4KGMA 3P4UB 4K59A 3MUVP 1HIYA 1MWZA 2XS2A 5HI7A 3J80U 2Q6CA 5LT5A 5HSPA 3PX6A 3RR7A 3MEDB 1GTHA 5A8WA 3HVRA 1WDTA 2VOPA 2GCFA 1YITS 4JYAI 3BH6B 1NHHA 2VQEF 4LF1A 4GC7A 1DLOB 5LM7E 1Z5CA 3BO2A 1HQUB 4ZPAA 3GB0A 5H9FJ 4RO0A 1RWPB 5AXNA 2HS3A 1DQAA 3R7SB 2NCKL 1WDDA 5HBMB 4RKUC 4C11B 2BKPA 4EO6A 4ZVFA 2DHAA 1UJ5A 2B51A 5KFJA 4FDFA 4ZCIA 2J8SA 3R5CA 4M5DB 4X84A 3Q6NA 4A8WA 4GVLA 4JI8J 3E01A 4W98A 1ZM3A 5HQLA 3Q6MA 4LF6F 2DR9A 1GXUA 2Z56B 4B02A 2YKAA 1NJWA 3A12A 1M5VC 2QL7B 3OLAA 3SSQA 1S6QA 1KHVA 3BN7A 4ZVQB 4ED6A 2W01A 4WBFA 2I5JA 1Q78A 1LWEA 4USTA 2H5EA 2VQFF 2VG6B 2ZH1A 2DR8A 3SV3A 5J2NA 3TWZA 3IFEA 2KU7A 2JH3A 2NS1B 5GMEA 2EEYA 1FKAE 4DPYA 3HVWA 3HFVA 1X7VA 5IQQA 3Q8YA 4TKTA 3LH2S 3V6DA 3DOMA 1UTAA 3QT6A 3AJ2A 2CDRB 4Q0BB 4QZVB 5IT9Y 3MM6B 4EI2A 4A8FA 4H4KA 5IWAJ 3H20A 3BQ1A 2XMKA 2LCWA 2LDIA 3NAHA 4ZVTB 3L9ZA 2E9ZA 1KQSR 3DOLA 3LW5C 2DO0A 4WFAQ 3W60A 3MMAB 4YP3A 3DDKA 3MCNA 5HVFA 4IFDC 1MU2B 2AJ2A 4P7AA 1UEUA 2NN6F 1WD6A 4DR7E 4QYRA 2NZCA 4AXIA 1FEHA 2C38B 1XMQE 2QYCA 2R7VA 2JEFA 2AWZA 2I2YA 3HKMA 1M1GA 2B8QA 4DQIA 2HGLA 2YBVA 4DR7I 3QIPB 4E0DA 4ECSA 2UVWA 1AB8A 3CNQP 3THTA 4O44B 4X4NA 2FGCA 2BJDA 2QLBB 2HGNA 1XMQI 1T05A 3WX4A 1EAYC 3D6TB 4IRKA 4DX7A 2OP5A 1RWKB 3NNCA 3GFHA 4EBCA 1VRUB 1JLFA 2EKNA 1SKWA 3MEEB 4P72A 2GJFA 3HJVA 5JEAA 4DSKA 1M5OC 4NXNF 4FP9A 1XC9A 5KFLA 1S16A 1H73A 5E0OA 1YK9A 2OPQA 3BKTA 2QA4S 4NMXA 2PNZB 3KUEA 2YNGA 2W2NP 5KFXA 4C3MA 2PMHA 5IZHA 1DJ0A 3IO1A 4DX6A 4P2MA 2DHGA 3BGRA 1VJWA 4WIQA 1I1GA 1RTHA 2RB7A 1I94F 5EKWA 5CZXA 4R1FA 4U8YA 1W2IA 3KMSA 5AE2A 2CGEA 4NI2B 4MU4A 3MFHA 3W62A 3L4BC 3LNUA 4EZ9A 1TKTA 4OHXA 2E5LJ 3IP0A 3M30B 4XTTA 1PBAA 4CLSA 2UUAJ 4JI0E 1H2VZ 4I4BA 2XMAA 2E9RX 3CEDA 5LMNF 3I9ZA 2V8DA 5CH7B 3M9MB 4CWBA 2MGZB 5CYMA 1NK0A 3D66A 3S1TA 4J7CA 2F9JA 4B3MF 4OYIA 2LXIA 4LRCA 1RT1A 3W5YA 2BACA 3MMCB 1P9YA 1Q81T 5ETQA 4JI0I 3PHEA 2UUBF 2CG8A 1NH8A 3HHLB 4J9UE 1UVLA 1HNWF 1WOOA 3CCSS 1VQ4S 3H8YA 3R2DJ 3MOZA 3M7NG 3B6BA 1IKYA 2NLWA 1U0SA 2AT1B 3ZKBA 1KRPA 4GQUA 2ZE2B 3H4LA 4IG0B 3UR0A 2B3TB 3L7ZA 3OFFA 2IC3A 3SCKE 5CYQA 1Q16B 1WSRA 4XDDA 4URSA 4M5JA 3EYZA 3CDAA 4HKQA 4FYYB 2BXJA 4QOTA 1H7SA 3R5JB 1X4EA 5K36D 1A6LA 2Q66A 2AX0A 2A18A 1B70B 2EFVA 3Q1QA 3IC1A 4Z7CA 1PKPA 3EGVA 3H7HB 3EGZA 2K7KA 5KFMA 1HR0E 5GADI 2PD1A 5KFPA 1SJFA 1JIHA 1FK9A 1X4CA 5A2QU 2OPRA 1TL3A 1NK4A 1SKUB 3OVSA 1Q95G 4RW7B 2XI2A 5LL6d 3GIIA 1P9QC 3ZO7A 2WRMA 1BD6A 4X65J 4BLGA 1MN9A 3OTEA 1Q8KA 1HR0I 3WU6A 1N34F 3J7AN 3DI6A 3M9OB 2VBZA 3FQLA 1S1TA 2CZVC 4LSZB 4HHJA 2VESA 1QZRA 5AE1A 3HVTA 2IM0A 3IBCB 5U47A 4G1QB 1X0PA 5K8OA 2C3OA 2QL5B 2L41A 3SDEB 2F9DA 4C4WA 4IO9Q 2E44A 3E8OA 2V8HA 2BJ7A 2LU1A 1Q79A 3T1HJ 2ZBKB 1SCJB 5C2GA 2IERA 4WKRA 4A8SA 1D8ZA 4HEA9 2G1DA 3ILJA 2NSCA 3TUIC 4F04B 1T3OA 2GMJA 3R27A 5CZVA 4ZDNA 1QE1A 3CF5Q 4P2SA 2OEMA 1YBUA 1PJ7A 5A0YB 2DR5A 4G65A 3UD3P 3G8QA 3U1YA 5DZ7A 3A8JA 4U95A 4M5MA 3POTB 2B7BB 4KRWA 4JI8E 1EKSA 1AUDA 3Q24A 5HROB 4KHPE 2BJ8A 2KO1A 2B6AB 1NHVA 2YQ0A 3WU5A 1AZSB 2WSCC 4QNJA 4RJVA 4JI8I 2DH8A 3EICA 2BANA 1FRLA 4KHPI 4LF7E 4F0HA 3EVMA 3GSIA 1HNIA 2OHDA 1VMBA 4X66J 1JXLA 4OI2A 2V0NA 3W2VB 1SH3A 1R8PA 4ED4A 3G2XA 4QU6A 1ITPA 4JI3J 1VLYA 4MJKA 3IXQA 2OSRA 4DV5E 5IWAE 1SUQA 1Y5IB 4WWSA 3H5XA 4LF7I 1UWBA 3KKFA 3J7AG 1Z1ZA 1VHFA 3D6HB 2W24A 2VFTA 3KUGA 1U0HA 2WOMA 1F2HA 5EHHA 1CQNA 2HMIA 4DV5I 3TUJC 4J9KA 5IWAI 1S0MA 3FSYA 1PC4A 4HT7A 4C3KA 4KV8B 3NRBA 7FDRA 4EWTA 1REVA 2IIHA 5AJ3J 3OL9A 4GO5X 5A8KA 1KWMA 1FTRA 2XNQA 4N7TA 2DB1A 3QZ8A 3LP0B 4F0MA 1NK5A 2MHEA 4OL8A 3R5AA 5K14A 3RAXA 1JLCB 2F4FA 2FVPA 1FA0A 1NMEB 3UVJB 2FVCA 3HCXA 1XXEA 1PSDA 4YR2A 1TFYA 4LPFA 4CNZA 1T03A 3UN3A 3PJ9A 4DR1J 3L3CA 1OYPA 1TELA 1G2EA 2MMYA 3QLHB 3CTRA 3W2WB 3HPOA 3DMJA 2NN6C 5E41A 4K5RA 3H2LA 3BGLA 1RTIA 1R6VA 1S6UA 4QPTA 2KVIA 3V4IA 4W4MA 2WW8A 2HNYA 3JAMY 2CQ0A 1RAEB 3HDSA 1WC6A 2PE8A 1OPIA 2YQ3A 4YR3A 3FSIA 2WSFC 4B3OA 2VJUA 1TP7A 1HHTP 2EW9A 5I3UB 1SJQA 4D3GA 2RAQA 2OAUA 3CVKA 3QJPA 2QLXA 1S1UA 2UZAA 5DQHA 4ZS6A 4ECXA 3DCAA 2ZBIA 4MU0A 2EXUA 4DR5J 3QRPA 2GJ2A 5KFGA 2HWTA 3FEXB 1TR0A 5HQ8A 3NGSA 4QYZJ 1JLBB 1RAJA 5IQ6A 2B4PA 4RU2A 3MPUB 1VLOA 1JKHB 4QWDA 2V4QA 3NGKA 3D3BJ 2E5LE 1KD1T 2AJ0A 3MD1A 1T3NA 4LSLB 3NMAA 2RU9A 4ZHRB 5B0GA 2CA9A 2KI2A 1S0OA 1HBUA 5IS2A 4A48A 3OL7A 4RNNA 2EFNA 2L9WA 4AE5A 3Q8SB 2CNLB 2E5LI 3DD6A 3IM8A 5CA5A 3CB4A 1HQEA 3MM5A 5KFIA 2HZVA 1H38A 4IKAA 3PRDA 1VRTA 2I9SA 1HKAA 5KT3A 3UN5A 3AB4B 4DS4A 5C0XE 2E1CA 1J5OA 1GX6A 2ZKTA 4LQ3A 4CP5A 1WOSA 2MPUA 1TFWA 1MMLA 4ED5A 3DDNA 3PS2A 2HVDA 3WBZA 2ROEA 3SXLA 1T9VA 3UR3C 2DPJA 4LJMA 5IT9C 2LMIA 3PYFA 3FUYA 2B43A 2DR7A 1R8HA 3G96A 2J6SA 1UW4A 2R7XA 1GK8A 1BQMA 1HNXF 1V6HA 4JI5E 3EZOA 1FNOA 3D4JA 4RBTA 2VJVA 2Z2ZA 3NG8A 3DHXA 3QJLA 1H7XA 4FPIA 3N9UC 3MMBA 3TYTA 5KFOA 4ZLNA 2OELA 5CABA 5L9NA 2YKMB 1PILA 4JI5I 2QEXS 4IDKB 2BUNA 1FDDA 3DM2A 4NASA 2JEBB 1CJUB 2EFGA 1ZTTA 4QJVA 1RJJA 1XIQA 3VGUA 3FGVA 2BR2B 4X65E 1SB6A 2RDIA 1UWAA 4U3DA 2G4BA 2P6TA 3KUHA 2GNKA 1FESA 1JMTA 4DPWA 2ZH8A 2PO1B 3P3EA 1U1KA 3C6UB 3J7AM 4ZLLA 1Y5YA 1HNZJ 4LF4F 3RBXA 5HAOA 2ZNYA 1VI7A 5LSLA 4DXLA 3RUBL 2J7UA 4IOCQ 4X65I 4F50A 2DITA 4PU9A 2AIRB 3M2RA 4A8QA 3KXDA 2Y8YA 3W9IA 1JNRB 2YWGA 4PUOB 5M2RA 3T1HE 3GV7B 5F8IA 4HY1A 2DK2A 2R8HA 3M8ZA 2JX2A 2QA1A 1TMJA 5GADU 3KFWX 4LF5J 2GX8A 1VISA 1ZOTA 3R1HA 1TKZB 3K85A 3NEKA 5J1EA 4ES2A 2Q43A 3MEGA 3T1HI 3EPGA 3EZUA 3K5MA 3PKMA 2CPFA 2Z5CB 1JXVA 4WIIA 3AA9A 2W2QP 3G82B 1PCAA 2QIFA 2OLWA 4FW3A 2JC0A 1ZA2B 4ECUA 2IA6A 4R5PB 3EWGA 5HMYA 2D3OR 4ZVEA 5DS7A 3SQOP 3FEZA 4Y2MA 4CYUB 1NJXA 1IR1A 4P2FA 4TU7A 3KK3A 3A13A 5THWA 3IWNC 1R0AA 3PEJA 3MM7A 1UVMA 1FWKA 1EP4A 3TO8A 3CO9A 3SCLE 5C0XB 3OHBA 4I6WA 3P8BB 3Q22A 1N32F 2ZZTA 4Z37A 2BJ3A 3CDUA 3I9V9 4OO1A 3CCJS 5CAAA 4DG1A 4GMKA 2O1TA 4IZJA 3FZBA 1RAAB 1FVSA 1HWLA 4MAKA 2R8GA 4ZPDA 2IM1A 4NLYA 3V6KA 3BBCA 2R8KA 2ZH5A 4MIAA 3UI3A 3CIMA 4DQRA 4WPAA 2QSFA 1LK7A 2ZWOA 1UZHA 3C3LA 1BWEA 2JE6A 4IFYB 2VC1A 2YKPA 2WSEC 2IMOA 1LXNA 2OI2A 4HI1A 4MKYA 3K57A 4DCPB 3KG4A 4MMOA 2QYGA 1S1WA 1GH8A 1Y3KA 1GMVA 5J2PB 2MLYA 1KC8T 5CQGA 3OXFA 3JSRA 2VB6A 1Y3JA 2I1RA 3BB5A 3NWRA 1X4GA 3BGUA 3IWXA 1MROB 3I0SB 3U1LA 1CJVA 1GXLA 3S8SA 4DQQA 2OSQA 3PX0A 4DPTA 4RLEA 2DKOB 4RBUA 2X7IA 2DNNA 5FD1A 4DCJB 1CC7A 2O5DA 2VQEE 3H4DA 4L3NA 2UXDF 4TLRA 2VUGA 2DEJA 4ANDA 5DETA 1MLAA 4ZIVA 1HD1A 5HP1A 2C37A 4WU2A 1RR9A 3ZZUA 3BBFA 3QZ7A 2FHMA 4FKXA 2GAHC 2VQEI 4ID5A 2BKOA 3CJTA 3WIVA 2QZ8A 3L7OA 3NGRA 2VKZG 1NDPA 3KHGA 3LANA 1LWCB 3FCHA 4GRSA 1UMJA 3BGFA 2J9EA 1NU4A 3CMQA 1Z0VA 4QWEA 1C4AA 1ZPWX 5LSOA 3OVAA 2QFIA 3PRBA 4LF6E 3W9JA 1X4HA 1FVQA 1YX2A 3GTYX 1RT7B 3KG0A 1LOUA 1UVKA 1RHYA 4LF9F 4QWBA 4JI7F 2V2KA 3RBEA 1RCOB 4DU7A 4F0KA 5JXSA 3QGHA 2WZ1A 1G6BA 5DQGA 4EO8A 4LF6I 1WELA 4TVAB 5A8WB 1U2RA 2DJWA 2PC6A 4IFDD 2V2ZA 4FWGA 4HR2A 5JEAE 2MXYA 2DNQA 3AOBA 1ACMB 1FEEA 3BREA 1X5SA 2GIRA 2BX6A 1SV5A 3VVTA 3Q8QB 3ZKDA 3V5RA 4WTOB 2JEGA 2MZ1A 4RW8A 1EB0A 3CJ0A 3EXYA 2JHEA 5F0WA 1KONA 3ISZA 2ZDPA 4DV2F 5AXLA 2DNZA 3KK2A 1RI7A 3E01B 3K1JA 4UUXA 1RP5A 3RJMB 4EFAC 2X51A 1KHWA 2MKHA 3CT9A 1S6QB 4WK3A 5A8RA 3FZ2A 2I5JB 1X9SA 1J5EJ 1LWEB 3W64A 1YTYA 3TR5A 2ZH4A 2CXEA 3ICLA 5J2NB 2P6SA 3K8VA 1Y00A 1NSPA 4PWDA 1TAQA 2ZHAA 3BQ0A 3MUMP 2DNLA 2MY8A 4CLKA 3V6DB 2XYGB 2P2CB 3DOMB 2K1RA 3ZXWA 2YWHA 4A8OA 4DUYJ 3NS7B 3P5TL 3A8EA 2G0CA 3LPEA 4DUZF 2QMUB 2FVQA 1AYEA 3DOLB 2LDYA 5IT0A 1JNZB 4I64A 2CUYA 1SJ3P 4ZVSB 2I38A 2C42A 3V4MA 4NXNE 1USVA 3EDRB 3W3SA 2N7YA 3H5UA 4BC9A 5ETOA 4Q8EA 1IKWA 4CLUA 2DGQA 5K8NA 5IM0A 3WX8A 2G0IA 1PJ6A 3G6VA 2C2MB 4NXNI 3J81Q 5B0EA 4GKKJ 4I69A 1VBYA 5CXTA 2BRLA 1R27B 3MOJB 2OD6A 1I94E 1WC3A 2NXUA 1IR2A 2ACYA 1S10A 2MLZA 1N4LA 1RTZA 1CULA 1AFJA 3KLEA 3JTPA 2W1BA 3MR7A 3OUYA 3UFCX 5BR8F 4LF2A 3GR1A 4OZLA 3D28A 1I94I 3NL0A 5HN0A 1HNZE 3DKDA 4CNYA 1YRUA 3GSDA 3DLJA 4LRBA 2K7JA 4Y3CA 2VG7A 1JLFB 4B3ME 5JEAB 3HHNB 2HBZB 1HNZI 4NLOA 1IN0A 3GU0A 2UUBE 3LALA 2OPQB 1QAIA 3CCQS 1Q7LB 3PW2A 3KJQB 5D6GA 2YNGB 3J80Q 4LFCJ 1JJ4A 3JAMC 4BA2A 4LF5E 3E51A 1FRKA 3CJQA 1PJ5A 3ZZOA 4B3MI 3MDFA 4AM3A 4MDTA 3BGRB 2AYGA 4B3RJ 4C8MA 5K36A 2LVWA 4X2BA 4B3SF 1RTHB 4LFAF 2UUBI 2FC9A 3HHKA 5DG8A 4DV4F 2Z4PA 1ZS6A 4RW6A 3MAAA 1NBEB 4AQYJ 1AXQA 2KJVA 4LF5I 4OX9J 2XM3A 4ELVA 2DY9A 2ROGA 2LJPA 2G13A 1AW0A 1U6ZA 4HI2A 1B99A 1DURA 4LSNA 2BM1A 1TKTB 1S99A 4JV5F 4K0KF 2ZBPA 1UDOA 2HAFA 1HI8A 3T9ZA 4FNHA 2W4CA 3HSZA 1QM9A 4NXMF 4LFBJ 1IUJA 1N5QA 2KRBA 5CYMB 3QAUA 3G8SA 4ZCKA 5D3GA 4UQGA 3UCUP 1BE4A 3TQ1A 1D8YA 1RT1B 1H3DA 4YY3F 5DM6Q 3FBFA 1ZH5A 5BYQA 2H1YA 3KJNB 2XWXA 2PA8D 3I96A 2XB2D 3N6NA 6FD1A 4NZ7A 1S9FA 4PXEA 2OUGA 4UW2A 2RDDA 1DTQA 1IKYB 1JLQA 3LP1A 2CQIA 5E3CA 2YNHA 3U27A 1U4BA 3L7ZB 2IC3B 4IOAQ 5CYQB 4IQMA 1Q86T 5KFSA 4USVA 1F9FA 2ZJQQ 2ZUAA 5F3TA 1S77D 4AIMA 2R7RA 5A6PA 2P5VA 4DR4F 1KLMA 2HGMA 2AEFA 4DS5A 2Q3PA 5LXYA 3KDOA 4QIFA 2ZOFA 1XK8A 3D1QA 5J1NA 1EI1A 1NDCA 4HVZA 4E98A 1EZZB 2NYIA 5G0RA 1FNXH 1M5HA 2OPRB 1TL3B 2IRUA 3AQPA 5HMXA 4J9NA 3AH6A 1TUVA 2XQCA 4DV7F 3PW4A 1FWPA 1DBDA 4R25A 2LQJA 4OZ0A 3HP6A 1NSAA 3DI6B 2AHOB 3MHYA 5JVGQ 3T3FA 2LXUA 1FD8A 5FDLA 2GO4A 1S1TB 3M05A 2KVQE 3MEKA 3M2VA 3GCMA 1RB0A 3HVTB 3CDBA 4ECTA 3AFGA 1VQ6S 1XQIA 1TKDA 4OQJA 2V5HG 1EKRA 2HFNA 4WUDA 3EGNA 2R2TA 1PG5B 3KLGA 1S1VA 2RU3A 3DLHA 2CPZA 1WJ9A 1UPPA 2E29A 3OXLA 4BS2A 2CQDA 3RGIA 2PI4A 1QE1B 4V19J 4ZPBA 4TLQA 4DSIA 3GLLA 2ILZA 2F3JA 2OTLS 1YBAA 3CO0P 4GO7X 3ULHA 5BJRA 1A6FA 5EX0A 4N3OA 5B09A 2WCXA 1FRIA 4ZVOB 5KFVA 3OW2R 2MQMA 2LKZA 2YWEA 3B4DA 4ZPVR 4WCEQ 2RILA 2HG4A 4OI3A 3EVWA 2XTJP 1ZXMA 1O8BA 5L39A 1URRA 4NA1A 4RUAA 3TA1A 2DH7A 1Z5AA 1TL4A 2RE1A 4K5SA 2VIHA 4USUA 2AJ1A 1IBLF 1CPZA 4BWJA 3IRXA 2UXCF 2NN6D 1RKIA 4BWMA 2HBYB 1Y11A 2BANB 3NZKA 4NYOA 4M95A 2HIYA 1M5PC 2G1HA 2EI5A 2JEAA 1HNIB 4ZCLA 4OZ5A 1OSDA 4DL3A 1OPZA 5KFYA 1SC4B 4ENOA 2AEJA 1P1LA 2AU0A 2J76E 4ILRA 2CVIA 3FBEA 4FKYA 4CLLA 2K3IA 4JV0A 3O3LA 3AXMA 2V63A 2I0XA 1K1QA 1SUQB 4CLYA 2DT9A 4ZKAA 1UWBB 2ASYA 3W61A 3HXMA 3OT9A 2XULA 1WOPA 4QWAA 1U0HB 2O67A 2WOMB 3HT3A 1OJ4A 2QT7A 2HMIB 1EJ7L 3DNCA 1SPBP 4FYWB 4DV0J 3R9LA 1UFWA 1REVB 3RG6A 5A8KB 1I5OB 1CS4A 3PEHA 3TEGA 1N5VA 2VU5A 2XG8A 1N8RT 3CD7A 4PG6A 1N88A 1R89A 1ZPVA 3VQTA 5DLFA 4QNKA 5K14B 4AUKA 2F7VA 2YQ1A 4QU7A 4H54A 3Q8VA 2BYCA 2D69A 2DNYA 4RW4A 3T1YJ 1IBCB 1HLWA 4KR0B 1JWWA 2J6UA 4M5KA 4B3TJ 1T03B 3D7SB 2DHHA 5A2QQ 1SJRA 2QSWA 1KKHA 3DYAA 3P6YC 1M0SA 1F6TA 2M52A 3T41A 1Y60A 2UXBJ 3MCOA 4IO1A 1IWGA 1K8AT 5HO4A 1RHRB 4O4GA 1U2FA 1WC1A 4USKA 2KZZA 4YEAA 1CJKA 3DMJB 1WHYA 2KRRA 4U67Q 4DV6F 1RTIB 2FY1A 3V4IB 2HNYB 3OBIA 3NOCA 1LEOA 4KFBA 3M6WA 2CNOB 4WP8A 3KHHA 3CC7S 4J9MA 3TQEA 4O3RA 3M4XA 4B3OB 1R31A 4JUZA 4ISAA 1G3OA 2DGWA 4LFCE 1LKZA 2IBOA 2HHPA 2MQQA 1C1BA 4NL5A 4ZLPA 4ZPCA 1RBOB 4AL5A 1XERA 4R8UA 1NHJA 4B3RE 2BZ2A 1S1UB 4N8OA 5CCLA 4DR6J 1C0UA 4DR2J 4LFCI 4DUZJ 4Q44A 3Q23A 1VBKA 2UUCJ 4OX9E 4FZVA 4HXZA 3HK2A 4B3RI 1CG2A 2AGOA 4USMA 3HSDA 3E3XA 4NYZA 2ZFHA 5AXMA 3LWMA 2HVZA 2DGUA 1GT8A 1Y0HA 1YG0A 1FJGJ 2B9XA 1RREA 4OX9I 1KQKA 1SKRA 5KG6A 1HBUB 4LFBE 2CJKA 1R8BA 4J9OA 4OLPA 5DG9A 4UQTA 5IT9U 1QAYA 2C2OB 1B7FA 3S01A 1KOOA 1RWMB 1HQEB 2E5JA 3MM5B 3H59A 3M2UA 3UDEA 2H51B 1N6QA 4LFBI 1NB2A 1IM4A 1VRTB 3IMQJ 2V50A 4ZVGA 1HQ2A 2IVYA 2WP8B 2PSZA 2YVSA 1TZ0A 4DZDA 2YTCA 1G4CA 5BR8J 1J5OB 2CPYA 5F8MA 4OO1E 2F4VJ 2QE5A 3KLHA 4LF4E 2J65A 3RB6A 1L3UA 4WZQA 1FJ7A 3B8HA 2EFOA 2D1CA 1QUVA 5GAGI 1HBMA 3NGTA 4J91A 2CIMA 4KH0B 2CQ3A 2WB1D 1VS3A 1RT4A 2DNMA 4FXVA 5EWGA 2B9EA 3AXKA 2C2KB 4LF4I 5FWKA 2M8DB 3LO3A 3PIPQ 5GVQA 3SCJE 2EFPA 1BQMB 4OYWA 2J7KA 4JI1J 4I2QA 4K4XA 2E1PA 4Y28C 2XLKA 4LT6A 1I6JA 3M1VA 3WQPA 3WHIA 3MMBB 5HK4A 4DL7A 3T5KA 3N6LA 4IFVA 3DM2B 2RMLA 3OTOF 5ETPA 5DO2A 2HHHF 5DGAA 1SH2A 4DFKA 6FDRA 3DHWC 3CD0A 1H7WA 1Y10A 2HHXA 4K7QA 4ZJLA 2KG1A 5KFUA 2EBGA 4I68A 2VA3A 1C1CA 1RE1B 2F65A 4FYDA 2XY6A 3TX0A 2FHJD 4KAIA 2ZH3A 1DQ8A 3GYGA 4YHHJ 4ZITA 2BR0A 4U7CA 1N32E 2H4WB 2ADBA 5I4MA 3CWJA 1BMQB 3TJ9A 3M2RB 3OSPA 4WYWA 2B5JA 2ABYA 3DU5A 2EPIA 2A6MA 4PWUA 4G3IA 2R7QA 4PXDA 1GMWD 1S5ZA 1TTHB 2GVDA 2ZH9A 1F60B 2XO6A 1N32I 2GGPA 4IFDF 3A3NB 2CPEA 3M85D 3AB2B 1KLNA 5J1EB 2B4OA 3CJSA 3H2UB 3MEGB 4WFZA 1UJ4A 1QSYA 3VZIA 3B78A 1XNRF 1R7IA 3R5BA 3CPWR 1USUA 4C0BA 2G0JA 2HKJA 4RU9A 1FTCA 4DV1F 3R6LB 4FBTA 4NZ0A 4QQBA 3DRPA 1VK8A 3RB3A 3AD7C 4OJHA 3KK3B 2Y1RI 2CVEA 1SI9A 1L3SA 1DRZA 1R0AB 4QPXA 3PY8A 2N3OA 2UXDE 3MM7B 2HRYA 1EP4B 5KT4A 4X4VA 4RW9A 4OO1B 1RK8A 2D3O1 2V67A 4DG1B 4IZJB 2AGPA 3GE9A 2OPSA 1BLUA 2BOPA 4C98A 4LCFA 2HIQA 1XNQF 2XY7A 2DNRA 4DF4A 3D6MB 4I0WA 4LF8J 4F4YA 5JMNA 2UXDI 2KXNB 3GYNA 4Q7AA 4JG4A 4K8RA 3D0GE 3UNGC 4RUBA 5KFCA 2PNMA 2R9LA 2FJBB 5LSRA 3IBFB 4LR9A 2PFFB 2JE6B 3CMAS 3MMJA 2GAGC 3HX9A 2Z0GA 4N5SA 3K89A 3HFZB 3IRWP 3WU3A 4X4UA 2MY7A 2ZOGA 2RQMA 3JQKA 4M5IA 4GKJF 2LYVA 4JI7E 3QT8A 3IGNA 5J2MA 1D3WA 4YFUA 1X31C 2QG9B 3TARA 1N5TA 5DLGA 3DN9A 1OY6A 3MAHA 1CJVB 1RSCA 1C0TA 3TX8A 1VQMS 4YB5A 2MQ8A 3O8WA 4JI7I 2OMOA 3MUTP 2KFYA 3TANA 1OO0B 1U1NA 3MD3A 5D4OA 1YJTA 5KG7A 1YLXA 2XSFA 4X62J 2GMHA 2W9BA 5I3QA 1HI0P 3K7RA 3T1YE 5HP1B 2C37B 4PABA 2Z30B 4F4ZA 4ID5B 4B3TE 4F4AA 2EG2A 3CWVA 1U09A 3TA0A 5F9LA 2AMCB 5LMUF 4QR2A 2ZM6F 3F73A 2ZHOA 1VYAA 1FX4A 1FRJA 2ZC4A 3S6EA 2UXBE 3PYEA 2G9OA 4FW7A 3T1YI 5L9XA 2M8HA 1IJFB 2Z5BA 1LWXA 3MURP 1Z0EA 5FLXQ 4JI2F 4B3TI 4GVBA 2GQ0A 2KJWA 3TVKA 1IKVA 2ZH2A 3UW1A 3J7A1 2MKSA 2YWWA 4PPDA 4EYIB 4ILLA 4L6V3 3VR1A 3R7BB 5D0GA 3PCOB 2RH3A 4YQWA 2UXBI 2KB2A 4XPCA 3I31A 4USJC 4F26A 2ZHBA 3D6FB 4DBQA 1YH8A 4MKVA 3KYLA 3I82A 5L46A 4NLWA 4QR1A 3GMGA 4WU3A 2EFQA 4DR3F 3BDEA 2G2OA 3GJQB 3TI0A 4CRJA 1MNEA 1UL3A 2R4FA 3J7YU 4DR2E 1QLNA 1RTDA 4DUZE 4DQSA 1U2CA 1FJEB 2E5IA 1XMOJ 1D9DA 3P3GA 3VZHA 2MQPA 1ZZFA 1KIJA 3C14A 5ETSA 1SV5B 2G2ZA 5F9NA 3MTKA 4ANEA 4KTQA 2HFUA 2VD3A 2Z8QA 4RW8B 2RS2A 4DR2I 1UVNA 1FJGE 1JXEA 4DUZI 5K36E 2E7XA 2KXHA 3KK2B 2HZAA 4OZ1A 3T5LA 2FB0A 2IM2A 1PYOB 3VF0B 4HHHA 2XMWA 4JYAF 3X1LB 1FE0A 4MYTA 5A8RB 3HHDA 1R3NA 1OY9A 1IM6A 1QSSA 2UU9J 3BSCA 4D3HA 1KR4A 1FJGI 2DNKA 1FFGB 2H54B 4WF9Q 5D0EA 3WC0A 3HFKA 1TVRA 4PWDB 4K4UA 2DBBA 2Y1LB 4QR0A 2KYZA 2AX1A 5BR8E 2K1RB 2VDIA 4HH1A 2F4VE 2W2OP 2RJZA 3FKBA 1HYSA 2RF2A 2JL9A 4BBYA 1T8EA 1FKOA 1O0PA 5ETKA 5C25A 4BC7A 4CIOA 3FDSA 5BR8I 2CWKA 2AKWB 2F4VI 3D1HA 3K5PA 4YDDB 4NZ6A 1HHSA 1CC8A 1BWVA 3I5BA 4OFZA 4OI1A 2WW4A 2Q6BA 1IKWB 5DDOC 4JI6J 4PCQA 5IM0B 2J0QD 4NPOA 2Y0SD 3BKFA 4PXBA 1TL1A 1S59A 4OYBA 4JI1E 3L7UA 3PTWA 3DGPA 1N5SA 2JDJA 1HW9A 2IOQA 1NXIA 3VALA 2K3KA 2HLUA 3IBWA 4DSJA 2ASJA 1X5PA 1HNVA 1RABB 3VAMA 1VQKS 3JAMU 1CULB 1BGXT 3MM9A 4JI1I 2ALZA 3KLEB 2MLXA 1I51B 4RNOA 2Z57B 3OUYB 4DV3J 4Y2CA 5KFAA 4LBPA 3PR5B 5GAGU 3QBCA 1PVGA 4RPFA 3ET6A 2JOQA 1E6YA 3ISND 2J8AA 4XPEA 3GZ7A 4YHHE 4OYAA 2JVRA 5DRPA 2VG7B 4IZKA 2HK2A 1RHJB 1FT8A 3LOUA 3DLGA 2KT5A 1N54B 2PDAA 1I3OB 4DR7F 3QFWA 1RA7A 2MKYA 4YHHI 5F8HA 1R8AA 8RUCA 2Y1JA 4KHPJ 4BA2B 1N0UA 4ECZA 4ELUA 1XMQF 2KHDA 5FJ4A 1RYSA 2GO9A 5K36B 5KTQA 3RU0A 3F44A 4NLXA 3ILLA 1Q7YT 4NE9C 2BKNA 2C2NA 2QV6A 1WUUA 3MAAB 3J7Z5 5C24A 1YRTA 4EK2A 4WFNQ 9RUBA 4LF7J 1WSVA 1VBXA 4KB7A 4KGVB 2HVIA 3AOCA 4LSNB 1HBNA 4PYDA 3GIJA 4BDPA 4U6PA 3KRNA 4DR4E 1RDRA 4DV5J 1U8SA 3G4SS 5D15A 5B0BA 3T19A 1D1UA 5T7LA 3V6HA 5D3GB 1SC3B 4PEOA 1RHUB 4FS2A 2JJ4D 4DR4I 2DY1A 3SV4A 4DL5A 3LA0A 3TVYA 4LF8E 4ZPTR 4A4JA 1RLDA 3AJDA 5K8MA 2CWXA 2BA0D 4UY8T 4DEZA 2A3JA 4DV7E 1JB0C 2N4CA 1VK3A 4YMEA 1Z4UA 3JTOA 1VQ8S 2FHKA 4ER8A 5JEAD 1JLQB 4LF8I 4M1KA 2D3ZA 3LP1B 2YNHB 2LECA 1CJTA 1N56A 5C42A 4ZVPB 1DAXA 4FW4A 4A8MP 5IOLA 2JRSA 4U9RA 5D4LA 2ILYA 2H5IB 3H40A 3CCRS 4DV7I 1VHIA 1QAJA 4C8OA 4DCOB 7FD1A 2QMWA 3S7RA 5C5JA 2HHUA 4LIWA 3IGVA 4JI0F 1SC6A 3VWSA 1KLMB 1Q0NA 2K2PA 2EVZA 1Y9OA 1NM2A 2NXNA 5B0DA 4CCHA 4MQYA 4X62E 1BHNA 1T95A 1JJHA 4RR5A 1B64A 4K4SA 3MAQA 4DSLA 1DZ5A 2BA1D 1W2BR 5G0RB 2WVDA 1DY3A 3NXZA 1T02A 2ZZMA 1ELOA 4EU0A 4X62I 2NN6A 4I6AA 2FJEB 1Z59A 2M5YA 3NS6A 4DV1J 1FWLA 1S12A 3KG1A 2BVZA 4USIA 3Q0AA 2B4VA 1RT5A 2HQIA 3JS9A 1NDLA 5FDLB 3UCGA 4JV2A 3GIRA 3BM7A 4ZVUB 3M2VB 4CDIA 2XCPA 1IBLE 2XZWA 2B9WA 4C3LA 2VONA 3UDLA 1P1TA 4K50A 2PO2A 3ZTOA 4X4OA 1P6TA 3D54A 3AHPA 1LK5A 3KLIA 1BXNA 1N36F 3CCWA 2CZ4A 4O0IA 3KLGB 1Z0WA 1S1VB 1UCNA 1H7UA 5KFZA 3ETOA 1RLCL 1IBLI 3H4BA 2RDJA 3BPSP 4DL4A 2KZMA 3BSOA 2RHQB 2QN6B 1HR0F 2CQ4A 1XMOE 4QYZK 3NWGA 1SL1A 2I8EA 2MJUA 3QO9A 3MECA 5B0FA 4YB1P 2O3ZA 3OR2A 1ZETA 3M85G 2GVZA 3W1YC 2NXEA 5KG5A 3POTA 4F2RA 3U1NA 1FJCA 3E2EA 1FX2A 1XMOI 2RSQA 3ZZRA 3C15A 5IFMA 2APOA 4NRTA 1QTNB 3P3DA 2J0WA 2B4UA 3ZFVA 2HPUA 1YGYA 2UU9E 3PIOQ 2XHCA 3RZAA 3IRXB 2AJQA 2EKYA 4TU9A 4AFFA 2R7UA 4NLDA 2JEAB 1BY9A 1NK6A 4LR8A 4JI5J 4OYOA 5B0CA 2E66A 3DU6A 4K4TA 1D0EA 1Z0BA 2Z58B 5ADZA 4OI4A 2UU9I 2E5GA 4FWDA 4IRDA 2RUGA 2KT2A 3BO3A 3MF5A 4N77A 4O3NA 5KT2A 1S48A 3CDWA 4X64J 5J1PA 4HHUA 2EWHA 5L1JA 2FVSA 2A10A 4OIXA 3EZ5A 2VF3A 5E5NA 3GP9A 2FD2A 1CVJA 4EMDA 4JI8F 4JI6E 1RWOB 3D0HE 2BJ1A 1VIOA 2BA9A 4WKYA 3FJ2A 2P8IA 1CS4B 3OFHA 1U1OA 3PYGA 2YKNA 3LP0A 2BV3A 4QW8A 2HHSA 3U1MA 2KM8B 2XGPA 4F3QA 4NX9A 1U1LA 1RA6A 1NEEA 1UEKA 4PRVA 3UQSA 4JI6I 2NUHA 2KKHA 4RW4B 4L74A 5GAHI 3PO5A 3TAMA 1AUSL 1H2UX 3EX7B 2GQ2A 4DV3E 2BE2A 4OHZA 3DYAB 1KDNA 1IWAA 3NKYA 3FK4A 3WZ0A 4DSFA 5CCMA 2QMXA 5IWAF 4O4GB 2BJEA 2V8GA 4J5OA 1CJKB 2IDEA 5G4DA 1YWXA 4DV3I 2KH9A 1EETA 2JWNA 4ALZA 1WC5A 4KFBB 4IR9A 2Z2MA 4ICLA 4DUTA 1QY7A 3ZZ0A 3NLCA 5KT6A 1SL0A 2OPPA 1LW0A 3FBBA 1QVFR 3VGSA 1Q4RA 3V81A 4FNIA 4NWBA 3G6YA 3NCQA 4C2MA 4ED2A 4E2FB 4R8UB 2CJYB 1ZM4A 2M4MA 5DJBA 1WEXA 4RNHA 4X4PA 4WE1A 1V3ZA 1X9WA 1C0UB 4QIEA 2WK4A 5F0UA 5KFTA 4WUBA 4USHA 3M8YA 3B82A 3IG1A 1S0NA 1BKNA 1EQ0A 3HD1A 3Q8RB 1IBMJ 7AT1B 1HWKA 1S9GA 3TOQA 4BCAA 4JI4J 3QATA 3HHLC 3SSSA 4C6AA 2EBEA 3NNHA 1YBTA 1XTZA 3TZYA 1Y4SA 5KG3A 4RBVA 2DH9A 2GZOA 4NCGA 4ZVHA 1HBOA 4TYBA 3SQGA 3CJ4A 3M7ND 2FZGB 2FHJA 2GQQA 3G87A 1KTQA 5KG2A 3M2UB 1N6QB 2X1AA 2HHHE 5KT5A 1F0XA 2VQEJ 3DRSA 1V9OA 1RAOA 1OSCA 2CFXA 1N52B 4ELTA 1X4AA 1GMWA 2GS8A 3KLHB 4DJBA 4RNFA 2MQNA 3PDNA 2HHHI 3U02A 5GAEU 3GWCA 4PQAA 4OYZA 2J5AA 1HBMB 1R8CA 3MGJA 5HLFA 3M6VA 9ATCB 2HW3A 1Q5VA 3NS5A 1RT4B 2E5LF 2CJ9A 2ZH7A 3ITHA 2DCLA 2GHPA 4DPXA 4DFPA 2UUAF 1X60A 2DIVA 1RCXB 2RHSB 1SXLA 2D74B 4CM2A 3SBMA 4LF6J 3QFHA 1WF0A 4XK8C 4LMZA 1TKXA 4IFDE 3EUNA 2W7AA 3PRYA 4OHYA 1IXKA 3H98A 2C2RA 4I2QB 5KOXA 4MU3A 3QAEA 4PKDB 3OVBA 3M1VB 2XSJA 1BQNB 3T5JA 2DISA 2VQFJ 2CJAA 5KFBA 1GXTA 3NGDA 1OYDA 3CJRA 4HLBA 1NHKL 2FDNA 4IFVB 1UFKA 1WG4A 2CJQA 4OV1A 3TZXA 2HZCA 2LA6A 1H6KX 1FXRA 5C0XF 4DV1E 2BRKA 1U7LA 1L3VA 4JP8A 2VOOA 1NK8A 3PACA 1C1CB 3CCUS 3FBCA 4Q45A 1JLEA 3OSNA 4MIBA 2LEAA 1RHKB 3VAGA 4LREA 4ES3A 1KVIA 2RKIA 2C39A 1C2PA 2V2VA 2CQ2A 4DV1I 2RVJA 4B9MA 4B9TA 5CHCB 3KTQA 4ZMMA 2XBPA 2UV8G 5E3PA 4CH1A 1XNQE 2B5JB 3A8KA 4DSEA 2CADA 4P10A 3H42A 2D9PA 5H9EJ 2VBXA 2DRBA 3IN5A 2MZRA 3RAQA 2GVDB 4HH0A 4RL1A 2GGPB 3KLVA 3GV8B 1RYRA 3CJKA 4RUHA 4M5NA 1H98A 4AD6A 1FFSB 1XNQI 5FLXC 3D3CJ 3BPDA 2VBYA 2M7SA 3JTNA 1F5BA 3GPAA 2PFDA 2DGVA 4GKJE 5J2QA 4H4MA 3BR8A 3G71S 2L48A 5E3QA 5E33A 2FJVA 4ZP9A 2RNEA 4X65F 1WI6A 3JYTA 4ZP7A 4C7QA 5T14A 4EBEA 3DRPB 3WC2A 3GFXA 2R3VA 5ETMA 1NJIT 4GKJI 1T9XA 4FF3A 5IV4A 2CAJA 5SZTA 2RRBA 1RAHB 3IM9A 2AW0A 4RW9B 1T9UA 3CC2S 2VA2A 4NXNJ 5IT9Q 1XWLA 2OPSB 1OS5A 2YNIA 5KFRA 2QLFB 3JQMA 2LP4A 3T1HF 1UDNA 1K0TA 2LEBA 3OR1A 3N01A 4ZIWA 5LXRA 2DRAA 3H0PA 2Q1LA 4B9UA 5KOWA 1A9NB 1RWWB 4L73A 2AGQA 1WTBA 1YJ9S 1U24A 3SMZA 4QWCA 2VBWA 5KAKA 4X64E 2BE9B 1I94J 4JI2E 1S1XA 5DNLA 4M63A 2D3UA 4MK7A 2DO4A 1YJUA 3AY0A 3M32A 2JT2A 1XJWB 1HL6A 1QJHA 5EUHA 1NKBA 2LA4A 5J2MB 4OHVA 2OO4A 1CEZA 1FDAA 3RBDA 5BXIA 2FIUA 4NRUA 4C48A 4X64I 1WKLA 4JI2I 2BJ9A 4NLQA 2OIHA 1M90T 1PYTA 2AF6A 2EK1A 1C0TB 2D7SA 1DHMA 1N36J 5HL7Q 5KFKA 5LMNJ 2A6OA 1XN9A 5BYSA 4FW9A 2HHWA 2E1RA 1NRKA 4PG8A 3DLEA 1NK9A 4DR3E 2F1DA 4IR1A 2VG5A 4Q43A 2HBRB 4B3MJ 2W9BB 1R6LA 3FFIA 4TN2A 3DC2A 2UUBJ 4B9VA 1RWVB 3PFEA 2YKQA 1JLGA 3WIUA 1H72C 2BM0A 2JZ5A 4OZEA 4X66F 1Q53A 4CZCA 4ED1A 1HNWJ 4DR3I 3G6ES 4R0JA 2WONA 4JI3F 4XIUA 1S9EA 2O01C 4KPCA 2QFJA 4IRCA 4RWXA 4MFBA 2COLA 2X1BA 1P27B 3AAWB 4OO1D 3HVAA 4I6YA 4IZJD 2BA1G 4K4ZA 2Z5BB 2GQCA 1SJ4P 1FF2A 4GVBB 5D0HA 5KG0A 1IKVB 2NSBA 2CKWA 3C16A 1S4FA 4LRFA 5ELWA 3PG9A 1PIEA 3BR9A 1XHKA 4OV6A 3G9CA 2K8GA 2QJ3A 4P75A 3TEHB 3PFOA 8AT1B 4S0MA 2RRNA 3A8IA 3CDJA 5AJ3F 1Y4UA 2VPWB 4B9NA 2N3LA 1FDNA 3P06A 2J6TA 2J9CA 3ZNUA 4PRXA 1YKWA 5GAHU 4Y00A 3OL8A 5HQMA 1RU1A 1NHUA 2M2BA 1S49A 3DXSX 3F56A 3OPKA 3BSAA 4ZVRB 4FS1A 1RTDB 3M7VA 2LEPA 2MSSA 3D67A 2DPIA 2NPIA 3C14B 3LGNA 3A4TA 4DR1F 4TY8A 2HFOA 1IBME 4X4TA 1RHMB 4JI4E 3MPVA 2W8KA 2O66A 2MB0B 2LU2A 4C8KA 1VQSA 2MKIA 1O5JA 2IVMA 2YWKA 1MN7A 1KOHA 4ETZA 1N34J 3VHQA 3TW0A 2XMJA 2H65B 2RRAA 4C97A 4LQ9A 4USWA 2MDAA 2VV5A 3PRVA 3D5MA 2ZITA 3OQ2A 4F4WA 1IBMI 2AZ1A 3GR0A 4URLA 2UV8A 4JI4I 4G1IA 3QNWB 2HQGA 2DNHA 3MCMA 3UNYA 1HA1A 4N76A 4DQPA 1K0VA 2NZ4A 1TVRB 1HARA 3T5HA 1VDHA 4HTIA 3D68A 5E2QA 2ZBQA 4TU8A 4TQSA 3ZZTA 2EC2A 1R0BG 1B62A 1FRHA 2HURA 1WNEA 1VJQA 4DR5F 3KOAA 5JEAF 2QLJB 4E8UA 1HYSB 2RF2B 1X4BA 4CTAA 3HZEA 1XBWA 3GJRB 1KVKA 3QPIA 1FKOB 2X36A 3CXCR 1F5AA 3MPYA 2FJWA 1N0VC 2I6WA 1GX5A 5C25B 2VZ9A 4QW9A 1OQ3A 4A8KA 3I6PA 4MKBA 2ACMA 1SJ1A 2JFKA 3CCTA 3R97A 3FMBA 3TNVA 1RBAA 4OKGA 3EE3A 4ED3A 1U1RA 1RBLA 2R2UA 4HACA 2DIUA 1S72S 3AQOA 3MXHP 2PA3A 4PRFA 4QCLA 1RKJA 1TL1B 3TA2A 3CJ2A 3DGPB 3GCXP 4WYLA 5ETTA 2W9CA 4RUCA 2VQFE 4IG3A 2KXFA 2L9NA 4CLZA 1M1HA 1HNVB 2DNGA 3BKUA 5RUBA 3GJSB 5A76A 2RD5C 3DOKA 4U7UD 3DFEA 2PN6A 1TU0B 3MM9B 1T9TA 2XCAA 1Q8IA 4JV1A 2PNLA 5DRKA 2WHOA 3RW7A 1V5IB 2VQFI 1VRQC 4CM0A 3F0NA 2PO0A 1MMDA 1U47A 2HFVA 3ET6B 1E6YB 4NLGA 4C8NA 1RT2A 2ZEJA 1NUEA 5K5MA 3QRQA 3LGMA 1FRMA 4PG5A 4L3KA 2E7WA 4IZKB 1Q82T 1Q1KA 2BEFA 4DZ6A 3C6TA 3DLGB 2NN6E 1PC5A 1UVJA 4TXSA 2DGTA 3D0IE 4DF8A 1FFWB 2M3DA 4B17A 2XS5A 1PYSB 1F9EB 2EC0A 3PZPA 3H90A 3QSYB 3W63A 2HWHA 1UPMB 1RQ0A 1YHCA 2ADCA 2MQOA 2V4JA 5C0XC 2VPXB 2X1GA 4NYPA 4M94A 4X4RA 5F8NA 5C24B 1Q8BA 2HK3A 4B9LA 3JXOA 4I56A 1AFIA 3PW0A 4KGKA 1B0VA 3TP2A 1IQTA 4KYZA 1HBNB 4FPRA 4KE5A 3ENAA 3N28A 4A8YA 4PR6A 4KC5A 1HNZF 3GFZA 1F5CA 2C3YA 4M5HA 3CD6S 2R8IA 4ETXA 1FCAA 3NNAA 2FUG9 2OD4A 3M8WA 4DI6A 4DX5A 1Y5LB 1CLFA 1H0HB 4G1PA 3FCWA 5T7LB 4AT1B 5JUMA 1FDBA 3ZZZA 2HNZA 1YDLA 3HHEA 1X9MA 2NXJA 3UWTA 2V9KA 4U7UK 5DRQA 3HMJG 3R7NB 5I42A 4F3MA 4LF5F 2B9YA 1MWYA 2DXDA 3P5BP 1WACA 3O44A 3D1OA 1A0OB 2IOPA 4I7FA 3KWMA 4F7VA 2DR6A 3KDNA 4P2XA 1CJTB 4UOGA 5C42B 2C1EB 1VBZA 2R7SA 3R3TA 2YX4A 1OYSA 4HT5A 4CH0S 1T05B 1TV6A 1FI4A 2R2RA 3BH7B 1IQZA 3K5LA 2N82B 2HFZA 2ALYB 1N36E 5LMNE 4NLVA 3ZTQA 1SQEA 2XY5A 5MAOA 3EPIA 1U25A 1VOMA 1UA1A 4AL7A 1NJZA 2YX7A 1Z0GA 4YR0A 2GFFA 1UETA 3R2CJ 4IH5A 3GQCA 1VIXA 2RUSA 1ZTWA 5LJ5Y 4FYXB 4J9RA 3I5CA 5D77A 2O1UA 2BW7A 1B7YB 3ZTPA 5GMDA 2HHTA 1E3PA 1N36I 5LMNI 2FLPA 1RADB 3CJ5A 3BSNA 1HNWE 5M2UA 2Q79A 3SYZA 3JAMQ 4I2PA 3THPA 5L1IA 3KJVA 2NN6B 1SQGA 1TQLA 1RT3A 4KBIA 3LF0A 2X3DA 4HDGA 1S4EA 1RT5B 1HNWI 4HYKA 2J9DA 2YH0A 2H9ZA 3K5NA 4CLPA 4CI0B 2HBQB 2IY5B 2WTFA 2F40A 3BV8A 1PBUA 3JSBA 1HW8A 4K4WA 4NLRA 1U02A 1DARA 2PO2B 1GNKA 2F8MA 1Z5BA 3T1AA 4V19X 3LAMA 2E1MC 2IBKA 1UZDA 2DRDA 2HS4A 2FJDB 2CQHA 3KLIB 5HATA 1HNXJ 1RGVA 4ZPWR 3TUPA 4FYVB 3DDIA 3Q8UA 1ZM9A 1JK9B 3BO4A 5D78A 2AE8A 1IKXA 1WG1A 3PO4A 3QO9B 2IPOB 3MECB 4P73A 2SXLA 2VFVA 3OR2B 4CO2A 3CW2C 1U1QA 3ISNC 2H4YB 4FXWA 1M1KT 2GVZB 2IDLA 4LR7A 4V1Ak 1X4DA 4NLSA 2ZBCA 1N34E 1OWXA 3C66A 4ECQA 3QRRA 3FRYA 3TAQA 2ZOMA 4UOHA 3C15B 3DRRA 2XMUA 4LF4J 1LWFA 1WG5A 1D9FA 3MWBA 2NYHA 3K58A 5DROA 4MH8A 5F41A 2H5JB 1CQMA 4H4KC 5JJBA 1B63A 4P74A 3I55S 1N34I 3O6QA 3PYDA 1OYEA 1HMVA 4TY9A 2E5HA 3P76A 2L9DA 3ZNJ1 3K5OA 3UHMA 4TQRA 1YQHA 3I0RA 5C7PA 1RXOB 1DTTA 1X8DA 4OI0A 1TMMA 4PAAA 1S97A 1B4SA 1RWUA 1N33F 1RAFB 3HJCA 3TRGA 1NZ8A 2FPHX 1FK9B 1Z0CA 1PGZA 1JLAA 1K9MT 2MTLA 2JLGA 4C8ZA 3IS9A 1EIYB 3JSYA 3MR3A 3J81Y 2ATLA 4YB7A 2HQDA 3HF5A 4EEYA 1P42A 4MKAA 4FN5A 1L5UA 5C2CA 2DEIA 2YKNB 4AXJA 3MR6A 2CPJA 4ZVIA 3HHLD 1MX0A 1N32J 3P96A 1J5EF 1S76D 3VAFA 1TUWA 1RTJA 1F3FA 2VHGA 1AT1B 1U45A 3M6AA 4ID8A 3N5BA 2UVUA 5JEAC 1RAGB 3TAMB 2QL9B 1B0TA 2BE2B 1R43A 4DUYF 4XDCA 5DM7Q 4RNMA 2MKJA 1JX4A 2UVRA 1PKUA 2IESA 2AZ3A 1WORA 3R8YA 4MTPA 4LIRA 3MR5A 2LQ8A 1HPZA 3J80Y 2WAQD 4LCHA 4Y2KA 1EETB 3FNNA 4FF2A 1WKKA 4MK8A 3GIMA 4RZRA 4ICLB 2MZTA 1O6XA 4EUVA 3A3OB 4J3DA 1F3VA 2OPPB 1LW0B 2OEKA 4YDXA 1M5KC 4WFBQ 5EDWA 3OFEA 4OX8A 3C2PA 3V81B 2KFNA 2N7CA 2UXDJ 4L72B 3M8PA 3GMEA 4GKKF 5ETLA 2MHNA 3DLBA 2FZCB 2HHVA 2M88A 2VFUA 3ENWA 5E7OB 2YPYA 4WE1B 1HWJA 1UDSA 4ZCMA 3V6JA 2IRYA 4DMZA 5DZ6A 1ZA1B 3IG1B 1YIJS 2FLNA 5LJ3Y 5D4PA 4PYAA 2CPIA 3MPDA 5M2PA 2W2PP 1S9GB 1ZAXA 4C0OC 1UFLA 4K4YA 1Y6ZA 2CPXA 2UUAE 3MCSA 3W8GA 5B0AA 4ZLJA 2AD9A 2XYPB 3GIKA 5D0RA 5L3JA 4DDFA 3HO1A 3CDIA 1FHTA 3D9BA 1N5YA 2Y3YA 3NGUA 1R6YA 4LF9J 3CCZA 4NCGB 1GMUA 4F3OA 4JI7J 1HBOB 3SQGB 4YS2A 3O2IA 5AT1B 3SSRA 2UUAI 2C3UA 1VC5A 5HVHA 1NPPA 2B0GA 3KHRA 4X4QA 1SKSA 2HNDA 1VFJA 4LFCF 1ZYQA 1SIWB 2W25A 4NLUA 3ZC4A 3TVZA 2Z2YB 3NBPA 3TJ8A 5LOQA 2WP8A 4QIVA 3DRSB 4K2JA 1E3HA 3LWLA 4BA1A 4B3RF 3M8RA 4EZ6A 2XS7A 4FWHA 1SH0A 5L8RC 2W2MP 3Q83A 2IYIA 4AQYF 2V9WA 2ATCB 4OX9F 1NZ0A 2WBRA 3J7YI 4NCBA 4WP9A 2UUTA 5HLFB 1S6PA 4CO1A 2BBEA 3ITHB 4KIAA 1ZXNA 3FRZA 3FQKA 2M9KA 3N6MA 2VFRA 2VL1A 4TNOA 4DV2J 2HRTA 3GCWP 4NEYA 3AODA 4LFBF 1TKXB 1VQNS 2IRXA 1IBKF 2CQBA 1IJEB 3GYXB 3I32A 5IXUA 3VAHA 3HSGA 4HTJA 1NO8A 3FMWA 1QDUB 2XSJB 1E6VA 2YNFA 5CYJA 1K44A 2QA4G 2B8PA 3W8PA 3M8SA 4RWWA 4P7TA 4J9VA 3EXCX 1RZMA 1CSJA 1YZ6A 2BOAA 2QO3A 4O3SA 1YI2S 4IOBA 2WVBA 4N56A 2V69A 5FLXU 5EN1A 4OO1F 4UOFA 1JLEB 2ZH6A 3IA0A 1U8WA 2HVHA 1J2VA 1T9WA 4ZN1A 1UW9A 2RKIB 2C39B 3RW6A 4YB6A 4BHQA 3P45B 3SI8A 3QYYA 1FD2A 2ZD1A 4XAKA 5JVHQ 3UE2A 2IJFA 1HNXE 2KFZA 4B9SA 2V68A 4ZP6A 3GV5B 1L3TA 4OJ1A 2LLZA 2BW2A 2MZSA 1MW7A 2FTRA 1W7WA 2WVEA 3CJKB 3PNIA 3R1LA 1F1BB 2WVCA 2VODA 3M8QA 3ZZPA 3DLKA 2WNRA 3QGIA 2Z2LA 2FVRA 4URGA 1HNXI 1HK7A 2MQLA 2O1PA 3KJFB 5J2QB 4H4MB 3T9NA 2AP6A 3LAKA 3OJUA 1Y5NB 4CQ1A 3Q86A 3JYTB 2O3DA 1EX8A 4KKOA 3Q89A 4DOZA 4KO0A 3PJWA 1J27A 3M6XA 3PKYA 3HZGA 1UP1A 4IYQA 5HMWA 1LW2A 1CBKA 1MMNA 2QTWA 2J0SD 4H4OA 3MFIA 1ZAVA 2LQ5A 2LXFA 1R0CB 1NCLA 3ADAC 5IT4A 1KP6A 4OYMA 2OMLA 3NCRA 2E9TA 2AYMA 2F5GA 2YNIB 3JSMA 3BEGB 1KFDA 3QWUA 4X66E 3OR1B 3IAS9 1NPRA 3L95X 2HFSA 1WEYA 4F36A 4JI3E 3UD4P 2XO7A 2V94A 4PXCA 1VQ5S 2BABA 3MTJA 3IR7B 2YX1A 4B3SJ 4LFAJ 1TL7A 4J9SA 2NQPA 1APSA 1S1XB 2O1WA 4DV4J 4HL9A 5ETNA 4X66I 2GV1A 1SBRA 2B56A 1JJCB 2MSTA 3A3PB 5DDQC 4JI3I 3M32B 5E3RA 3RBZA 3LPSA 3VV2B 3DLLQ 1WHXA 1JJ2R 2XI3A 4JV5J 4DFMA 4K0KJ 4I1TA 2RQKA 1QUPA 4DL6A 2Y8WA 1GQEA 1O51A 2RQCA 4ZP8A 2CPDA 3NCPA 1FERA 4NXMJ 4RX6A 5A2QY 3DLEB 2HQCA 3PHTA 2VG5B 4P52A 3PS1A 4W92B 4OYPA 2YH1A 1NNDA 3FFIB 2UVVA 1TK0A 2DCUB 4JOUA 2CQCA 4YY3J 1K1SA 2Y9HA 3N0VA 4KY3A 2XZDB 3HD2A 1JLGB 3G86A 4DR1E 1NB7A 2PIIA 3RRKA 3ILOA 5HMZA 2A2CA 2WONB 4IH7A 4XTJA 1S9EB 1F9HA 3KK1A 4MFBB 5H9FK 2HYIB 2BQRA 1Q8LA 2DGSA 3IR6B 3G6XA 1NSQA 4DR1I 2OJ3A 4OJGA 3C16B 3KLFA 2CZ9A 3HT0A 1X0FA 2PI5A 1M5SA 4OI6A 3VAIA 4Z7YA 4LVNP 2LFVA 5EGYA 4DV0F 2W7PA 1NK7A 1XR6A 2W7OA 4DPOA 2GMLA 4DR4J 4ED8A 4IS9A 2MZQA 1URNA 4WP3A 3ETMA 1OY8A 2LQBA 4DR5E 2ZBRA 4A46A 1N33J 4Y65A 1WF2A 3T1YF 2HVEA 3OL6A 1RAIB 4CT8A 2KHCA 4B3TF 2CQGA 4TY8B 2UUWA 4ZJQA 4DR5I 2YWFA 3MM8A 2UXBF 4DV7J 1NZAA 1Z0TA 2AJFE 1Z2ZA 1VQLS 1EA6A 4LOMA 2CG9A 5E3AA 5L38A 1RT6A 4IFDA 1S1WB 1BQXA 3Q2TC 2QX0A 4LF9E 5DG7A 2IAJA 2E7VA 3UN2A 3NOGA 4PQUA 2A1BA 1S57A 2H3EB 4K4VA 2GO8A 2DHSA 3BYPA 3ZTSA 4LF9I 5F8LA 2AV5A 4CO4A 1FKPA 3D2WA 1ULRA 1V5VA 4I67A 4CH7A 1W25A 3CE8A 4FF4A 3BS9A 1KVJA 4DR6F 2YPZA 4CO0A 4DR2F 2D9OA 2XNRA 4CTAB 1XR7A 2KN4A 2J0XA 1Y7PA 2UUCF 4WZMA 5DDPC 3P49B 4DL0C 4ECWA 3KHLA 3QIDA 3GJTB 2GO3A 1WWHA 3VAKA 4CO3A 5C0XD 3TJAA 4CT9A 2MKCA 1FJGF 4OZ2A 4DV2E 5A6WA 5K36F 2YY3A 3K59A 4XO0A 1D09B 2RT3A 4TYAA 4HACB 1HD0A 3ILIA 4X4SA 3J81C 5D8HB 2NXCA 3AT1B 4NA3A 2FY8A 3LP2A 1IBLJ 3THVA 2W9CB 2F8EX 4DV2I 4MU1A 4IG3B 2VDHA 1PAEX 1VGYA 3AOAA 2UXCJ 3OD2A 3SZ2A 3MEDA 4MYUA 3DOKB 1T0TV 1UAWA 1KTVA 4Y0FA 4PZVA 2G2YA 1LNQA 1DLOA 3H25A 2ZJRQ 4J37A 1WHVA 2FHOB 1B0PA 1HQUA 2P9GA 1Q5YA 2HAIA 2F4VF 2MEWA 2PO0B 4KHMA 3DXBA 4IQXA 2L08A 3R6GB 2JLFA 1RT2B 5HBMA 2QLWA 2JEJA 4C11A 2IA0A 1FXDA 4NEZA 3EMTA 3C6TB 4M5DA 3OXGA 1NPKA 3J80C 2DD8S 3CD5A 4F2SA 1IVZA 3G8TA 2EG1A 4W90B 4JI1F 5IC6B 2J9DE 2ZKUA 3KNGA 1HWIA 2XLJA 2GC8A 1S79A 5F8GA 2V8VA 2VG6A 2V4JB 3K2YA 2JVOA 4OO1C 3HI9A 6AT1B 2HQ3A 3EVOA 2BMBA 2LQ9A 2ZJPQ 3RAMA 4DL2A 5CD4H 5KFQA 1C4CA 1WC4A 5KFEA 2U2FA 4Q0BA 4LCGA 3MM6A 2OKQA 4C0HA 1PO6A 4LRAA 2OEJA 3T6JA 4YHHF 1FO1A 1H74A 1QAXA 4O0NA 5BYRA 4DV6J 2N4DA 1IBKJ 3MMAA 1K73T 1OQ6A 2PEHA 1MU2A 2HNZB 4QBUA 3BJYA 1VC0A 1AA1B 4ECVA 3AJ1A 1WEZA 5ITHA 1KSPA 3GLJA 2HKEA 2BQUA 1NKEA 3AA8A 1N48A 5I42B 2C38A 3SEOA 3VTIA 1NAQA 2NPFA 2AEMA 2PT0A 2NREA 4B3SE 4LFAE 4EYHB 3QGPA 3RYLA 4KQVA 3QIPA 4I7FB 3TZZA 4ZN3A 4DV4E 3ELHA 2ZZNA 1R6MA 1KBRA 2FJXA 4O44A 1EHWA 1RUSA 3CCES 2OH2A 3JQJA 5L1KA 3HM9A 2IJNA 1FKAF 2VH7A 5HANA 2VPYB 3BBBA 1NDKA 3H5YA 2QC3A 2DVIA 4B3SI 4LFAI 1TV6B 3X3UA 1RHQB 4UUWA 4JV5E 1OMSA 1VQOS 1HFEL 4K0KE 3CGIA 3IR5B 4DV4I 2VPZB 3US5A 1YJVA 1UA0A 4WTYA 2XMTA 3I56S 1UVIA 4NXME 3UCZP 1VRUA 3MEEA 2GIQA 3KNAA 1VQPS 5DQIA 3R5DA 4JV5I 3N5FA 4P9SA 4K0KI 4YY3E 2J7WA 1NSKL 3W5ZA 3B4TA 2IMWP 2DHXA 4UTGA 4LF8F 2PNZA 5FLXY 3OTCA 4FXDA 2JC1A 4NXMI 3MR2A 4HDHA 2M70A 2W4DA 2BE7D 4I2PB 2HSEB 3KJVB 5FIIA 4UOCA 4YY3I 2HRUA 1FE4A 3QWPA 1RT3B 2L3MA 2KL8A 8ATCB 4P7VA 2Z5EA 4OHWA 2A2DA 2AYBA 4Y2AA 1GFWB 4RW6B 4F8RA 4NI2A 3LPYA 4P71A 5KG4A 5KFFA 4GC6A 3GFYA 1BUXA 3ZTRA 2PO4A 4DWIA 2DGXA 4OMFG 3M30A 2JNJA 2M0GB 1RISA 5GAEI 4O3QA 3PJXA 2QRRA 4DN9A 4ZOSA 3OV7A 1WHWA 1SIZA 2MKKA 4NLPA 2PMZD 2CNNB 1X4FA 1PAUB 2MGZA 2AYEA 4FVMA 5KFDA 3OTBA 3C46A 3EJMA 4X62F 1TAUA 5EWFA 4F4KA 1N33E 3MMCA 3QQCD 4CO5A 3KMQA 3BZQA 1IKXB 4F4XA 3HHLA 3DRXA 3SIPB 3IWLA 1LFPA 4MIWA 4IH6A 3OTOJ 1KQFB 2HHHJ 5KFNA 3PX4A 2CPHA 2JFDA 3PXGa 4N41A 1N33I 2DNPA 1AROP 1T11A 5I3PA 2V4RA 4AL6A 1DTQB 1RACB 2MZJA 3TZWA 4UT4A 3DRRB 3P3CA 1VR6A 4A47A 2ZE2A 1LWFB 1XMBA 4IG0A 2OTJS 4L75A 2R2SA 3C19A 1J5EE 4F25A 4WXWA 4C8LA 1S6OA 3EDQB 3CCVS 1K47A 2D41A 1HMVB 1VCTA 1U6BA 1X5TA 2R42A 1YZ7A 2FYXA 4PWWA 4EGLA 2IFXA 3I0RB 3BQ2A 1OYRA 4OX7A 1J5EI 1DTTB 4DUYE 2CQPA 2H48B 4ES1A 2VASA 1FNMA 2IVFB 2JEIA 2AQ4A 4AIDA 4ECRA 2F8HA 3K0JA 2ERRA 1XMOF 1TK5A 2BDPA 4WFXA 1T94A 1XNRJ 3F41A 3LUYA 2NR0A 4RW7A 1JLAB 4DUYI 5HJXA 3OJSA 3IS9B 5ETVA 3UDCA 4CLWA 2AJ4A 5LL6R 4ANCA 1T9YA 2F63A 1QTMA 2WVFA 4Q2LA 4J9LA 3PR4A 3CJ8A 1U49A 3ZZYA 3UO0A 4GKKE 2MJNA 1U26A 1LFWA 1KS2A 5HJYA 3ONQA 2W4PA 2UU9F 1QVGR 4G1QA 5KFHA 3PM9A 3PVXA 2UXCE 1RTJB 3SDEA 2HQFA 4N8NA 4C9DA 4YOEA 2R8JA 3K8WA 1XNQJ 4NMLA 2FQQB 5MLCV 2C28A 3QT7A 2RIJA 2GA7A 2KG0A 5A2QC 2RQ4A 4JB8B 4GKKI 2ZVIA 2W9AA 1HHQA 2GHWA 3MZIA 2FLOA 2UXCI 3B4MA 1NJYA 2X1FA 3VQSA 3H2VE 4WK1A 2CJBA 3O5TB 2GIFA 5A0YA 2MYFA 5K36C 1HPZB 2Y0BB 2KT3A 4KSEB 4GKJJ 2DXFA 3QJJA 4DLGA 2ASLA 3W9HA 1KEKA 2GHVC 5H9EK 3CJ3A 4JI6F 2B7CB 2XHWA 5HROA 2E1AA 1V3SA 2B6AA 3I87A 4ED7A 3M8PB 1NHIA 4O4RA 1AZSA 3OTDA 4C8YA 4OZ3A 1ZM2A 2DNOA 3MI7X 3R5GA 3HULA 1WI8A 4AQYE 1FXLA 3L09A 4UZBA 3CCMS 2ASDA 1EQMA 3OLBA 3NAIA 5LMUJ 3W2VA 2ZM6J 4DV3F 2YXLA 1DQ9A 5D4NA 4Y2IA 1NLKL 3SFGA 1UEVA 2PMWA 4AQYI 4WXOA 2HWIA 1UJ6A 4NLTA 4JI2J 4FBUA 4DV6E 1IBKE 4J90A 2DGOA 1N5YB 1MG7A 2FC8A 4KH1B 2Q2EB 4DX8H 5F3ZA 1DFDA 4F67A 1B3TA 3RR8A 4KGZB 3FEYB 5CD4A 5H1SV 4KV8A 4B08A 3EM1A 4WJBA 2HNDB 1W26A 2JSXA 4KHPF 3GONA 4DV6I 1IBKI 1WKJA 4DFJA 3NBPB 3AD8C 1SL2A 3N79A 4BA1B 3VAJA 2KYXA 4DR3J 1JLCA 4Y6IA 4EBDA 1KNZA 4DHVA 1GTEA 3K17A 2FJAB 3UVJA 1GAOA 2KDOA 4LF7F 2IJRA 2BQ3A 4DLEA 1YVFA 1YRXA 1YJRA 1MSWD 1S6PB 3QLHA 4M5GA 3W2WA 3J7ZT 3H5SA 2POKA 4Y34A 3EGWB 4DV5F 3BDPA 2FLLA 5DDRC 1ICEB 2O1VA 2RS8A 4LBHA 2KTQA 4PG4A 2R7TA 4JYAJ 4FF1A 1GEHA 2XGQA 1TL5A 3H1CA 2XMVA 2U1AA 2PEBA 1BQNA 1E6VB 2YNFB 4Q5VA 5L1LA 3I4PA 2P9EA 4OYXA 4KJIA 3GILA 1QSLA 4IUFA 1NKCA 2DTJA 4FW6A 5DNXA 3PS3A 5I3UA 4Q8FA 3HKWA 3OHAA 1NH7A 2F1FA 1C1BB 2GJIA 3CIZA 3N4WA 4CLFA 4DN0A 4MT1A 1REGX 1TK8A 2R7WA 1MWQA 4I3HA 3NP5A 2V6AA 5B08A 4U96A 1JLBA 1U1PA 3QT5A 4PG7A 4J9QA 4N47A 4QIGA 3WDOA 2WB4A 1XR5A 1JKHA 5EWEA 3RRGA 1A7GE 2DXEA 3PW7A 5K8PA 2ZD1B 4LSLA 3V2UC 4OJ3A 3RB0A 4ZHRA 3UDVA 1G7CB 3W7BA 2XWYA 2IHR1 3CCLS 4M8LA 3UD5A 4WFYA 5AE3A 4UZCA 4OX6A 1SQFA 5B7WA 2K06A 1RU2A 4KPYA 3OFGA 2ZWPA 3M8QB 1YSJA 3T6BA 2ZVSA 3DLKB 2WNRB 2VICA 1S7HA 3GG1A 4OZNA 3Q8PB 5DRRA 3OTOE 1UKUA 2X3GA 2VC0A 1ZAWA 1L3KA 1U6FA 2OGUA 1U48A 3VGTA 2WBMA 1TUGB 2NUUG 1OIAA 2W8LA 5KFWA 4KKOB 1HI1A 2XC9A 1U1MA 3VGVA 4ILMA 4KO0B 4YUDA 3U7JA 4ATNA 1UDQA 2OFHX 3OTOI 1LW2B 3LTOA 4YN3B 2CDQA 3SFUA 4LBIA 4H4OB 2ZDOA 2C2EA 2VKRA 4JBCA 4FW5A 4F02A 3ENQA 3JSMB 1IR0A 2QA2A 4DR7J 4UF4A 3FC9A 4LVOP 4OLOA 4OZJA 1T7PA 4M5LA 2FZKB 1XMQJ 3B54A 1XEZA 1V3RA 3MPWA 2XLIA 1TL7B 2C22A 2IM3A 2YKMA 4G6VB 4NBQA 1XNRE 2KM8C 4IDKA 4Z2XA 2PGCA 4ZJOA 4Q2MA 2JEBA 1CJUA 3CDEA 4LUBA 3RTVA 1SC1B 1YJ7A 2BR2A 3HSJA 3VVUA 1Z2LA 1KFSA 1H2TZ 2PO1A 4DV0E 3C6UA 2XEXA 3WU4A 2C3PA 1XNRI 3AD9C 3VCDA 4LRDA 1KQGB 1S7IA 3A1YG 4NCAA 1WF1A 4CLTA 4DV0I 4KT0C 3TUZC 5ETRA 5AXKA 4UY85 3IAM9 3PW5A 1ZBTA 4PUOA 4HYMA 4U8VA 1BC6A 4ZK7M 1YHQS 4JI5F 4J9PA 4WUCA 3I4HX 1LXJA 4ITSA 1VQYA 1TKZA 1QD1A 3KK1B 5HVGA 2FGOA 2HS0A 4X64F 4O3OA 4ZA1A 3RRHA
chains in the Genus database with same CATH topology
2Z5CA 4DV6E 1IBKE 4FWHA 4DR5E 4KHPI 1MG7A 1Z0WA 1H7UA 2Q2EB 3T1HE 5BR8E 4LF7E 2V34A 4HY1A 1S4EA 1XMQI 3PRYA 1IBLI 4JV5I 4K0KI 2ZITA 4YY3E 1HNWI 1IBMI 2F4VE 4URLA 4JI4I 2V2QA 4UTGA 4ED4A 1ZXMA 1NZ0A 1VISA 1XMOE 4NXNI 3K85A 4NXMI 1Z5AA 3J81Q 3GONA 4DV5E 4DV6I 5IWAE 1IBKI 1N32E 4DR5I 1DARA 1D6TA 1ZXNA 1Z5BA 3T1HI 1I94E 5BR8I 4LF7I 3J7AG 1Z0TA 4YY3I 2F4VI 1EA6A 4DPUA 2Z5CB 2CG9A 4DR6E 3ZZTA 4DV1E 1B62A 2Z5EA 2V8PA 2WW4A 3K17A 1XMOI 1S16A 2A2DA 1H73A 1ZM9A 4LF9E 2UUCE 4DV5I 5IWAI 1N32I 4JI1E 1I94I 1KVKA 5LMUE 1HNZE 2ZM6E 2IOQA 2V2VA 2X36A 1N0VC 2UU9E 4DR6I 4DV1I 1FWKA 3B78A 4LF9I 1XNQE 2UUCI 4B3ME 2O1VA 4IZJA 2O1TA 4R1FA 1USUA 4JI1I 1N34E 5LMUI 1HNZI 2CGEA 2ZM6I 2HKJA 1OJ4A 2UUBE 4HACA 1Z0BA 2UU9I 1N33E 4FWDA 3LNUA 3J80Q 3JAMC 1PVGA 4LF5E 4RPFA 1XNQI 1B63A 5FLXC 4B3MI 2UXDE 2VQFE 1N34I 4JI0E 4YHHE 2OI2A 3PYDA 2UUBI 4GKJE 4IZKA 2HK2A 1N33I 4IZJB 2VF3A 4DV2E 1HNXE 3ZM7A 2PNLA 4LF5I 4I3HA 4EMDA 4UT4A 4HACB 1MU5A 2UXDI 4JI6E 3J81C 2VQFI 2LJPA 4JG4A 4JI0I 4YHHI 3QT5A 5A2QQ 3F0NA 1KKHA 2R3VA 1N0UA 2PNMA 4DU8A 2BM1A 4GKJI 1J5EE 3HJCA 3PYGA 2BV3A 4DPTA 4DV2I 1HNXI 1HK7A 1K47A 2X7IA 1Z0CA 2VQEE 4USKA 3WU3A 1UEKA 4MYUA 2R42A 4PRVA 4IZKB 3V2UC 5IT9Q 4JI6I 1WUUA 1KTVA 2DEJA 4JI7E 3ZKBA 1J5EI 4DUYE 3QT8A 3H4LA 1FNMA 4JYAE 1RR9A 3ZZUA 4DV3E 2VQEI 4FN5A 2DEIA 4LFCE 4ZVIA 4DR4E 2E5LE 1MX0A 4X64E 3OTOE 4JI7I 1NHJA 4B3RE 1H7SA 4DUYI 4JI2E 1Z0VA 4JYAI 1NHHA 4DV3I 2AJ4A 3M6AA 4LF6E 3Q1QA 5LL6R 4Z7CA 1Z5CA 1PKPA 2HK3A 3J80C 3T1YE 4LFCI 4X66E 3ZZ0A 4DR4I 4OX9E 2E5LI 2HFSA 4LF8E 4B3TE 1HR0E 4X64I 3OTOI 4JI3E 3LTOA 3CWVA 4HXZA 4B3RI 4DU7A 4USMA 4JI2I 4GKKE 4LF6I 2UXBE 3PYEA 4DV7E 4FW9A 1ZM4A 2E1RA 1U2RA 3T1YI 2O1WA 2UXCE 4DR3E 4X66I 1RREA 4OX9I 2Z5BA 4LF8I 4M1KA 1Z0EA 5FLXQ 3Q6NA 4B3TI 3QT7A 1HR0I 4LFBE 2GQ0A 4JI3I 3WU6A 2V2ZA 5A2QC 4WUBA 4FWGA 3LPSA 1ZM3A 4GKKI 3Q6MA 3B82A 1BKNA 2UXBI 4DV7I 1EI1A 1H72C 2BM0A 2UXCI 4DR3I 1QZRA 5IT9C 3ZKDA 4LFBI 3PYFA 3V5RA 1XNRE 1H74A 2IOPA 4P52A 4IZJD 2Z5BB 5GMEA 1Y4SA 1FKAE 4DPYA 2ZBKB 4JI5E 3K1JA 4X62E 3QT6A 4LF4E 3D4JA 4DR2E 4DV0E 2XEXA 3WU4A 4DUZE 1PIEA 2HKEA 4DR1E 1XHKA 1XNRI 3B8HA 1KIJA 2NPFA 1FI4A 2A2CA 4XTJA 1Y6ZA 2UUAE 1Y4UA 1NHIA 2HHHE 1ELOA 4B3SE 4LFAE 1N36E 4JI5I 5LMNE 2HFUA 4X62I 4WUDA 3P06A 4LF4I 4DR2I 1Z59A 1ZM2A 4KQVA 4DV0I 5FWKA 5L3JA 1FJGE 2EFGA 1FWLA 4DV4E 4DUZI 4PRXA 1Z0GA 4DR1I 4P7AA 3HULA 4X65E 4AQYE 4HYMA 2GS8A 4DPWA 2CZ9A 4DR7E 4JI8E 2J7KA 2UUAI 2O1UA 3J7AM 2HHHI 5GMDA 4WUCA 4Z7YA 4KHPE 4B3SI 4LFAI 1N36I 4MYTA 5LMNI 1IBLE 1XMQE 4JV5E 4K0KE 1FJGI 4DXLA 4DV4I 1HNWE 1IBME 4JI4E 4X65I 4AQYI 3WU5A 3JAMQ 4DPXA 4PU9A 1A6FA 4N3OA 4DR7I 4NXNE 1USVA 4NXME 4JI8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 E;  1IBK E;  4FWH A;  4DR5 E;  4KHP I;  1MG7 A;  1Z0W A;  1H7U A;  2Q2E B;  3T1H E;  5BR8 E;  4LF7 E;  2V34 A;  4HY1 A;  1S4E A;  1XMQ I;  1IBL I;  4JV5 I;  4K0K I;  2ZIT A;  4YY3 E;  1HNW I;  1IBM I;  2F4V E;  4URL A;  4JI4 I;  2V2Q A;  4UTG A;  4ED4 A;  1ZXM A;  1NZ0 A;  1VIS A;  1XMO E;  4NXN I;  4NXM I;  1Z5A A;  3J81 Q;  3GON A;  4DV5 E;  4DV6 I;  5IWA E;  1IBK I;  1N32 E;  4DR5 I;  1DAR A;  1D6T A;  1ZXN A;  1Z5B A;  3T1H I;  1I94 E;  5BR8 I;  4LF7 I;  3J7A G;  1Z0T A;  4YY3 I;  2F4V I;  1EA6 A;  4DPU A;  4DR6 E;  3ZZT A;  4DV1 E;  1B62 A;  2V8P A;  2WW4 A;  3K17 A;  1XMO I;  1S16 A;  2A2D A;  1H73 A;  1ZM9 A;  4LF9 E;  2UUC E;  4DV5 I;  5IWA I;  1N32 I;  4JI1 E;  1I94 I;  1KVK A;  5LMU E;  1HNZ E;  2ZM6 E;  2X36 A;  2V2V A;  1N0V C;  2UU9 E;  4DR6 I;  4DV1 I;  1FWK A;  3B78 A;  4LF9 I;  1XNQ E;  2UUC I;  4B3M E;  4R1F A;  4JI1 I;  1N34 E;  5LMU I;  1HNZ I;  2ZM6 I;  2HKJ A;  1OJ4 A;  2UUB E;  4HAC A;  1Z0B A;  2UU9 I;  1N33 E;  4FWD A;  3LNU A;  3J80 Q;  3JAM C;  1PVG A;  4LF5 E;  4RPF A;  1XNQ I;  1B63 A;  5FLX C;  4B3M I;  2UXD E;  2VQF E;  1N34 I;  4JI0 E;  4YHH E;  2OI2 A;  3PYD A;  2UUB I;  4GKJ E;  2HK2 A;  1N33 I;  2VF3 A;  4DV2 E;  1HNX E;  3ZM7 A;  4LF5 I;  4I3H A;  4EMD A;  4UT4 A;  4HAC B;  1MU5 A;  2UXD I;  4JI6 E;  3J81 C;  2VQF I;  2LJP A;  4JG4 A;  4JI0 I;  4YHH I;  3QT5 A;  5A2Q Q;  3F0N A;  1KKH A;  2R3V A;  1N0U A;  4DU8 A;  2BM1 A;  4GKJ I;  1J5E E;  3PYG A;  2BV3 A;  4DPT A;  4DV2 I;  1HNX I;  1K47 A;  2X7I A;  1Z0C A;  2VQE E;  4USK A;  3WU3 A;  1UEK A;  4MYU A;  2R42 A;  4PRV A;  3V2U C;  5IT9 Q;  4JI6 I;  1WUU A;  1KTV A;  2DEJ A;  4JI7 E;  3ZKB A;  1J5E I;  4DUY E;  3QT8 A;  3H4L A;  1FNM A;  4JYA E;  1RR9 A;  3ZZU A;  4DV3 E;  2VQE I;  4FN5 A;  2DEI A;  4LFC E;  4ZVI A;  4DR4 E;  2E5L E;  1MX0 A;  4X64 E;  3OTO E;  4JI7 I;  1NHJ A;  4B3R E;  1H7S A;  4DUY I;  4JI2 E;  1Z0V A;  4JYA I;  1NHH A;  4DV3 I;  2AJ4 A;  3M6A A;  4LF6 E;  3Q1Q A;  5LL6 R;  4Z7C A;  1Z5C A;  1PKP A;  2HK3 A;  3J80 C;  3T1Y E;  4LFC I;  4X66 E;  3ZZ0 A;  4DR4 I;  4OX9 E;  2E5L I;  2HFS A;  4LF8 E;  4B3T E;  1HR0 E;  4X64 I;  3OTO I;  4JI3 E;  3LTO A;  3CWV A;  4HXZ A;  4B3R I;  4DU7 A;  4USM A;  4JI2 I;  4GKK E;  4LF6 I;  2UXB E;  3PYE A;  4DV7 E;  4FW9 A;  1ZM4 A;  2E1R A;  1U2R A;  3T1Y I;  2UXC E;  4DR3 E;  4X66 I;  1RRE A;  4OX9 I;  4LF8 I;  4M1K A;  1Z0E A;  5FLX Q;  4B3T I;  3QT7 A;  1HR0 I;  4LFB E;  4JI3 I;  3WU6 A;  2V2Z A;  5A2Q C;  4WUB A;  4FWG A;  3LPS A;  1ZM3 A;  4GKK I;  3B82 A;  1BKN A;  2UXB I;  4DV7 I;  1EI1 A;  1H72 C;  2BM0 A;  2UXC I;  4DR3 I;  1QZR A;  5IT9 C;  3ZKD A;  4LFB I;  3PYF A;  3V5R A;  1XNR E;  1H74 A;  4P52 A;  5GME A;  1FKA E;  4DPY A;  2ZBK B;  4JI5 E;  3K1J A;  4X62 E;  3QT6 A;  4LF4 E;  3D4J A;  4DR2 E;  4DV0 E;  2XEX A;  3WU4 A;  4DUZ E;  1PIE A;  2HKE A;  4DR1 E;  1XHK A;  1XNR I;  3B8H A;  1KIJ A;  2NPF A;  1FI4 A;  2A2C A;  4XTJ A;  2UUA E;  1NHI A;  2HHH E;  1ELO A;  4B3S E;  4LFA E;  1N36 E;  4JI5 I;  5LMN E;  2HFU A;  4X62 I;  4WUD A;  4LF4 I;  4DR2 I;  1Z59 A;  1ZM2 A;  4KQV A;  4DV0 I;  5L3J A;  1FJG E;  2EFG A;  1FWL A;  4DV4 E;  4DUZ I;  4PRX A;  1Z0G A;  4DR1 I;  4P7A A;  3HUL A;  4X65 E;  4AQY E;  4HYM A;  2GS8 A;  4DPW A;  2CZ9 A;  4DR7 E;  4JI8 E;  2J7K A;  2UUA I;  3J7A M;  2HHH I;  5GMD A;  4WUC A;  4Z7Y A;  4KHP E;  4B3S I;  4LFA I;  1N36 I;  4MYT A;  5LMN I;  1IBL E;  1XMQ E;  4JV5 E;  4K0K E;  1FJG I;  4DXL A;  4DV4 I;  1HNW E;  1IBM E;  4JI4 E;  4X65 I;  4AQY I;  3WU5 A;  3JAM Q;  4DPX A;  4PU9 A;  1A6F A;  4DR7 I;  4NXN E;  4NXM E;  4JI8 I; 
#chains in the Genus database with same CATH topology
 2Z5C A;  1WTF A;  1VQ9 S;  3G82 A;  3QMQ A;  2IYG A;  3JB9 k;  3BN4 A;  2V34 A;  3UPF A;  3KLF B;  2JLE A;  3SCI E;  5K9F A;  4R5P A;  3LGH A;  2Y1I A;  5KG1 A;  2OFG X;  2V2Q A;  5DGB A;  1G1X A;  3HKZ D;  2HEK A;  3CUL A;  4O3P A;  4NA2 A;  4CYU A;  3CME S;  5K20 B;  1Y4Z B;  4QIW D;  4U3B A;  4MK9 A;  1RWN B;  3J81 j;  3GG0 A;  4JI0 J;  4KGX B;  4FVC A;  1D6T A;  2CYY A;  5C0X A;  3LQV A;  1VC6 A;  2VFS A;  5EX3 A;  5T41 A;  3DRY A;  4DPU A;  2C2D A;  4DR6 E;  1HWU A;  3BGO P;  1LV5 A;  3FSX A;  2V8P A;  3NMR A;  1F2G A;  1YJN S;  2UUC E;  2CJX B;  1ZZN A;  1YJW S;  5GMK a;  1JQG A;  5LMU E;  2ZM6 E;  4A8X A;  3CC4 S;  3L7P A;  4K2X A;  3U1K A;  3CSK A;  1RWX B;  2CRL A;  4DR6 I;  4IFY A;  2UP1 A;  3MM8 B;  5KT7 A;  5F8J A;  2EK6 A;  2UUC I;  3HLU A;  4ED0 A;  1RT6 B;  2CQ1 A;  4IFD B;  1S0V A;  1KN6 A;  5LMU I;  5IC4 B;  2ZM6 I;  3BF4 A;  5J2P A;  3QGG A;  3ENV A;  1FRX A;  3FCV A;  2IAJ B;  2BA0 G;  2QGF B;  3NY0 A;  3W5X A;  3PV8 A;  2XYH B;  1VQ7 S;  4URQ U;  1MRO A;  4PQU B;  2DYA A;  3I0S A;  2HHQ A;  2HLT A;  1EAR A;  1SVD A;  3O1L A;  2C3M A;  3DGV A;  4KHR A;  3FVY A;  1D9A A;  3QSI A;  2ZUG A;  1ROF A;  1P8G A;  3J81 U;  2XMM A;  1FKP B;  4P6Q A;  3ZM7 A;  4R0E A;  5EL9 A;  2ZNZ A;  4O23 A;  2ZC3 A;  3BYR A;  1MU5 A;  2CNK B;  3CUN A;  1HR0 J;  5IV3 A;  3M6U A;  2R7O A;  1WC0 A;  1X5O A;  4DU8 A;  2GW8 A;  4ERD A;  4NOH A;  1IBM F;  1LWC A;  3C8Y A;  3M9N B;  3RB4 A;  4JI4 F;  4L76 A;  2CG4 A;  3W66 A;  3W65 A;  4KQZ A;  2A0F B;  3I5A A;  2ROP A;  4ECY A;  1RT7 A;  3Q2S C;  2C2Z B;  3TAP A;  2YKO A;  2P9C A;  4JYA E;  3HJF A;  2XZT B;  1LQ9 A;  5SUH A;  4AYB D;  4PPZ A;  3LP2 B;  4KGM A;  3P4U B;  4K59 A;  3MUV P;  1HIY A;  1MWZ A;  2XS2 A;  5HI7 A;  3J80 U;  2Q6C A;  5LT5 A;  5HSP A;  3PX6 A;  3RR7 A;  3MED B;  1GTH A;  5A8W A;  3HVR A;  1WDT A;  2VOP A;  2GCF A;  1YIT S;  4JYA I;  3BH6 B;  1NHH A;  2VQE F;  4LF1 A;  4GC7 A;  1DLO B;  5LM7 E;  1Z5C A;  3BO2 A;  1HQU B;  4ZPA A;  3GB0 A;  5H9F J;  4RO0 A;  1RWP B;  5AXN A;  2HS3 A;  1DQA A;  3R7S B;  2NCK L;  1WDD A;  5HBM B;  4RKU C;  4C11 B;  2BKP A;  4EO6 A;  4ZVF A;  2DHA A;  1UJ5 A;  2B51 A;  5KFJ A;  4FDF A;  4ZCI A;  2J8S A;  3R5C A;  4M5D B;  4X84 A;  3Q6N A;  4A8W A;  4GVL A;  4JI8 J;  3E01 A;  4W98 A;  1ZM3 A;  5HQL A;  3Q6M A;  4LF6 F;  2DR9 A;  1GXU A;  2Z56 B;  4B02 A;  2YKA A;  1NJW A;  3A12 A;  1M5V C;  2QL7 B;  3OLA A;  3SSQ A;  1S6Q A;  1KHV A;  3BN7 A;  4ZVQ B;  4ED6 A;  2W01 A;  4WBF A;  2I5J A;  1Q78 A;  1LWE A;  4UST A;  2H5E A;  2VQF F;  2VG6 B;  2ZH1 A;  2DR8 A;  3SV3 A;  5J2N A;  3TWZ A;  3IFE A;  2KU7 A;  2JH3 A;  2NS1 B;  5GME A;  2EEY A;  1FKA E;  4DPY A;  3HVW A;  3HFV A;  1X7V A;  5IQQ A;  3Q8Y A;  4TKT A;  3LH2 S;  3V6D A;  3DOM A;  1UTA A;  3QT6 A;  3AJ2 A;  2CDR B;  4Q0B B;  4QZV B;  5IT9 Y;  3MM6 B;  4EI2 A;  4A8F A;  4H4K A;  5IWA J;  3H20 A;  3BQ1 A;  2XMK A;  2LCW A;  2LDI A;  3NAH A;  4ZVT B;  3L9Z A;  2E9Z A;  1KQS R;  3DOL A;  3LW5 C;  2DO0 A;  4WFA Q;  3W60 A;  3MMA B;  4YP3 A;  3DDK A;  3MCN A;  5HVF A;  4IFD C;  1MU2 B;  2AJ2 A;  4P7A A;  1UEU A;  2NN6 F;  1WD6 A;  4DR7 E;  4QYR A;  2NZC A;  4AXI A;  1FEH A;  2C38 B;  1XMQ E;  2QYC A;  2R7V A;  2JEF A;  2AWZ A;  2I2Y A;  3HKM A;  1M1G A;  2B8Q A;  4DQI A;  2HGL A;  2YBV A;  4DR7 I;  3QIP B;  4E0D A;  4ECS A;  2UVW A;  1AB8 A;  3CNQ P;  3THT A;  4O44 B;  4X4N A;  2FGC A;  2BJD A;  2QLB B;  2HGN A;  1XMQ I;  1T05 A;  3WX4 A;  1EAY C;  3D6T B;  4IRK A;  4DX7 A;  2OP5 A;  1RWK B;  3NNC A;  3GFH A;  4EBC A;  1VRU B;  1JLF A;  2EKN A;  1SKW A;  3MEE B;  4P72 A;  2GJF A;  3HJV A;  5JEA A;  4DSK A;  1M5O C;  4NXN F;  4FP9 A;  1XC9 A;  5KFL A;  1S16 A;  1H73 A;  5E0O A;  1YK9 A;  2OPQ A;  3BKT A;  2QA4 S;  4NMX A;  2PNZ B;  3KUE A;  2YNG A;  2W2N P;  5KFX A;  4C3M A;  2PMH A;  5IZH A;  1DJ0 A;  3IO1 A;  4DX6 A;  4P2M A;  2DHG A;  3BGR A;  1VJW A;  4WIQ A;  1I1G A;  1RTH A;  2RB7 A;  1I94 F;  5EKW A;  5CZX A;  4R1F A;  4U8Y A;  1W2I A;  3KMS A;  5AE2 A;  2CGE A;  4NI2 B;  4MU4 A;  3MFH A;  3W62 A;  3L4B C;  3LNU A;  4EZ9 A;  1TKT A;  4OHX A;  2E5L J;  3IP0 A;  3M30 B;  4XTT A;  1PBA A;  4CLS A;  2UUA J;  4JI0 E;  1H2V Z;  4I4B A;  2XMA A;  2E9R X;  3CED A;  5LMN F;  3I9Z A;  2V8D A;  5CH7 B;  3M9M B;  4CWB A;  2MGZ B;  5CYM A;  1NK0 A;  3D66 A;  3S1T A;  4J7C A;  2F9J A;  4B3M F;  4OYI A;  2LXI A;  4LRC A;  1RT1 A;  3W5Y A;  2BAC A;  3MMC B;  1P9Y A;  1Q81 T;  5ETQ A;  4JI0 I;  3PHE A;  2UUB F;  2CG8 A;  1NH8 A;  3HHL B;  4J9U E;  1UVL A;  1HNW F;  1WOO A;  3CCS S;  1VQ4 S;  3H8Y A;  3R2D J;  3MOZ A;  3M7N G;  3B6B A;  1IKY A;  2NLW A;  1U0S A;  2AT1 B;  3ZKB A;  1KRP A;  4GQU A;  2ZE2 B;  3H4L A;  4IG0 B;  3UR0 A;  2B3T B;  3L7Z A;  3OFF A;  2IC3 A;  3SCK E;  5CYQ A;  1Q16 B;  1WSR A;  4XDD A;  4URS A;  4M5J A;  3EYZ A;  3CDA A;  4HKQ A;  4FYY B;  2BXJ A;  4QOT A;  1H7S A;  3R5J B;  1X4E A;  5K36 D;  1A6L A;  2Q66 A;  2AX0 A;  2A18 A;  1B70 B;  2EFV A;  3Q1Q A;  3IC1 A;  4Z7C A;  1PKP A;  3EGV A;  3H7H B;  3EGZ A;  2K7K A;  5KFM A;  1HR0 E;  5GAD I;  2PD1 A;  5KFP A;  1SJF A;  1JIH A;  1FK9 A;  1X4C A;  5A2Q U;  2OPR A;  1TL3 A;  1NK4 A;  1SKU B;  3OVS A;  1Q95 G;  4RW7 B;  2XI2 A;  5LL6 d;  3GII A;  1P9Q C;  3ZO7 A;  2WRM A;  1BD6 A;  4X65 J;  4BLG A;  1MN9 A;  3OTE A;  1Q8K A;  1HR0 I;  3WU6 A;  1N34 F;  3J7A N;  3DI6 A;  3M9O B;  2VBZ A;  3FQL A;  1S1T A;  2CZV C;  4LSZ B;  4HHJ A;  2VES A;  1QZR A;  5AE1 A;  3HVT A;  2IM0 A;  3IBC B;  5U47 A;  4G1Q B;  1X0P A;  5K8O A;  2C3O A;  2QL5 B;  2L41 A;  3SDE B;  2F9D A;  4C4W A;  4IO9 Q;  2E44 A;  3E8O A;  2V8H A;  2BJ7 A;  2LU1 A;  1Q79 A;  3T1H J;  2ZBK B;  1SCJ B;  5C2G A;  2IER A;  4WKR A;  4A8S A;  1D8Z A;  4HEA 9;  2G1D A;  3ILJ A;  2NSC A;  3TUI C;  4F04 B;  1T3O A;  2GMJ A;  3R27 A;  5CZV A;  4ZDN A;  1QE1 A;  3CF5 Q;  4P2S A;  2OEM A;  1YBU A;  1PJ7 A;  5A0Y B;  2DR5 A;  4G65 A;  3UD3 P;  3G8Q A;  3U1Y A;  5DZ7 A;  3A8J A;  4U95 A;  4M5M A;  3POT B;  2B7B B;  4KRW A;  4JI8 E;  1EKS A;  1AUD A;  3Q24 A;  5HRO B;  4KHP E;  2BJ8 A;  2KO1 A;  2B6A B;  1NHV A;  2YQ0 A;  3WU5 A;  1AZS B;  2WSC C;  4QNJ A;  4RJV A;  4JI8 I;  2DH8 A;  3EIC A;  2BAN A;  1FRL A;  4KHP I;  4LF7 E;  4F0H A;  3EVM A;  3GSI A;  1HNI A;  2OHD A;  1VMB A;  4X66 J;  1JXL A;  4OI2 A;  2V0N A;  3W2V B;  1SH3 A;  1R8P A;  4ED4 A;  3G2X A;  4QU6 A;  1ITP A;  4JI3 J;  1VLY A;  4MJK A;  3IXQ A;  2OSR A;  4DV5 E;  5IWA E;  1SUQ A;  1Y5I B;  4WWS A;  3H5X A;  4LF7 I;  1UWB A;  3KKF A;  3J7A G;  1Z1Z A;  1VHF A;  3D6H B;  2W24 A;  2VFT A;  3KUG A;  1U0H A;  2WOM A;  1F2H A;  5EHH A;  1CQN A;  2HMI A;  4DV5 I;  3TUJ C;  4J9K A;  5IWA I;  1S0M A;  3FSY A;  1PC4 A;  4HT7 A;  4C3K A;  4KV8 B;  3NRB A;  7FDR A;  4EWT A;  1REV A;  2IIH A;  5AJ3 J;  3OL9 A;  4GO5 X;  5A8K A;  1KWM A;  1FTR A;  2XNQ A;  4N7T A;  2DB1 A;  3QZ8 A;  3LP0 B;  4F0M A;  1NK5 A;  2MHE A;  4OL8 A;  3R5A A;  5K14 A;  3RAX A;  1JLC B;  2F4F A;  2FVP A;  1FA0 A;  1NME B;  3UVJ B;  2FVC A;  3HCX A;  1XXE A;  1PSD A;  4YR2 A;  1TFY A;  4LPF A;  4CNZ A;  1T03 A;  3UN3 A;  3PJ9 A;  4DR1 J;  3L3C A;  1OYP A;  1TEL A;  1G2E A;  2MMY A;  3QLH B;  3CTR A;  3W2W B;  3HPO A;  3DMJ A;  2NN6 C;  5E41 A;  4K5R A;  3H2L A;  3BGL A;  1RTI A;  1R6V A;  1S6U A;  4QPT A;  2KVI A;  3V4I A;  4W4M A;  2WW8 A;  2HNY A;  3JAM Y;  2CQ0 A;  1RAE B;  3HDS A;  1WC6 A;  2PE8 A;  1OPI A;  2YQ3 A;  4YR3 A;  3FSI A;  2WSF C;  4B3O A;  2VJU A;  1TP7 A;  1HHT P;  2EW9 A;  5I3U B;  1SJQ A;  4D3G A;  2RAQ A;  2OAU A;  3CVK A;  3QJP A;  2QLX A;  1S1U A;  2UZA A;  5DQH A;  4ZS6 A;  4ECX A;  3DCA A;  2ZBI A;  4MU0 A;  2EXU A;  4DR5 J;  3QRP A;  2GJ2 A;  5KFG A;  2HWT A;  3FEX B;  1TR0 A;  5HQ8 A;  3NGS A;  4QYZ J;  1JLB B;  1RAJ A;  5IQ6 A;  2B4P A;  4RU2 A;  3MPU B;  1VLO A;  1JKH B;  4QWD A;  2V4Q A;  3NGK A;  3D3B J;  2E5L E;  1KD1 T;  2AJ0 A;  3MD1 A;  1T3N A;  4LSL B;  3NMA A;  2RU9 A;  4ZHR B;  5B0G A;  2CA9 A;  2KI2 A;  1S0O A;  1HBU A;  5IS2 A;  4A48 A;  3OL7 A;  4RNN A;  2EFN A;  2L9W A;  4AE5 A;  3Q8S B;  2CNL B;  2E5L I;  3DD6 A;  3IM8 A;  5CA5 A;  3CB4 A;  1HQE A;  3MM5 A;  5KFI A;  2HZV A;  1H38 A;  4IKA A;  3PRD A;  1VRT A;  2I9S A;  1HKA A;  5KT3 A;  3UN5 A;  3AB4 B;  4DS4 A;  5C0X E;  2E1C A;  1J5O A;  1GX6 A;  2ZKT A;  4LQ3 A;  4CP5 A;  1WOS A;  2MPU A;  1TFW A;  1MML A;  4ED5 A;  3DDN A;  3PS2 A;  2HVD A;  3WBZ A;  2ROE A;  3SXL A;  1T9V A;  3UR3 C;  2DPJ A;  4LJM A;  5IT9 C;  2LMI A;  3PYF A;  3FUY A;  2B43 A;  2DR7 A;  1R8H A;  3G96 A;  2J6S A;  1UW4 A;  2R7X A;  1GK8 A;  1BQM A;  1HNX F;  1V6H A;  4JI5 E;  3EZO A;  1FNO A;  3D4J A;  4RBT A;  2VJV A;  2Z2Z A;  3NG8 A;  3DHX A;  3QJL A;  1H7X A;  4FPI A;  3N9U C;  3MMB A;  3TYT A;  5KFO A;  4ZLN A;  2OEL A;  5CAB A;  5L9N A;  2YKM B;  1PIL A;  4JI5 I;  2QEX S;  4IDK B;  2BUN A;  1FDD A;  3DM2 A;  4NAS A;  2JEB B;  1CJU B;  2EFG A;  1ZTT A;  4QJV A;  1RJJ A;  1XIQ A;  3VGU A;  3FGV A;  2BR2 B;  4X65 E;  1SB6 A;  2RDI A;  1UWA A;  4U3D A;  2G4B A;  2P6T A;  3KUH A;  2GNK A;  1FES A;  1JMT A;  4DPW A;  2ZH8 A;  2PO1 B;  3P3E A;  1U1K A;  3C6U B;  3J7A M;  4ZLL A;  1Y5Y A;  1HNZ J;  4LF4 F;  3RBX A;  5HAO A;  2ZNY A;  1VI7 A;  5LSL A;  4DXL A;  3RUB L;  2J7U A;  4IOC Q;  4X65 I;  4F50 A;  2DIT A;  4PU9 A;  2AIR B;  3M2R A;  4A8Q A;  3KXD A;  2Y8Y A;  3W9I A;  1JNR B;  2YWG A;  4PUO B;  5M2R A;  3T1H E;  3GV7 B;  5F8I A;  4HY1 A;  2DK2 A;  2R8H A;  3M8Z A;  2JX2 A;  2QA1 A;  1TMJ A;  5GAD U;  3KFW X;  4LF5 J;  2GX8 A;  1VIS A;  1ZOT A;  3R1H A;  1TKZ B;  3K85 A;  3NEK A;  5J1E A;  4ES2 A;  2Q43 A;  3MEG A;  3T1H I;  3EPG A;  3EZU A;  3K5M A;  3PKM A;  2CPF A;  2Z