4HACB

Crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
308
structure length
308
Chain Sequence
LVPRGSHMVSCSAPGKIYLFGEHAVVYGETAIACAVELRTRVRAELNDSITIQSQIGRTGLDFEKHPYVSAVIEKMRKSIPINGVFLTVDSDIPVGSGLGSSAAVTIASIGALNELFGFGLSLQEIAKLGHEIEIKVQGAASPTDTYVSTFGGVVTIPERRKLKTPDCGIVIGDTGVFSSTKELVANVRQLRESYPDLIEPLMTSIGKISRIGEQLVLSGDYASIGRLMNVNQGLLDALGVNILELSQLIYSARAAGAFGAKITGAGGGGCMVALTAPEKCNQVAEAVAGAGGKVTITKPTEQGLKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mevalonate kinase
publication title Crystallization and preliminary X-ray diffraction analysis of mevalonate kinase from Methanosarcina mazei.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Transferase
total genus 89
structure length 308
sequence length 308
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00288 GHMP_kinases_N GHMP kinases N terminal domain
B PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4hacB02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4hacB01
3F0NA 3PYGA 1J5EI 4JI0E 1N0UA 4DV0I 3V5RA 1HNZI 1Z0EA 3D4JA 4YHHE 4GKKI 4FWHA 1OJ4A 4KHPI 4DPUA 2E5LE 4JI2E 2UU9I 3PYDA 3JAMC 3K17A 1DARA 3J7AG 4DR2I 3OTOE 4JI1I 1Z0VA 4JI8I 4DV4E 4LFBE 4ED4A 4XTJA 4DV1E 4B3RE 1XMOE 4UT4A 2F4VI 1J5EE 4DV0E 2HKJA 1U2RA 1H72C 1HNZE 4FWGA 1Z5CA 3QT7A 4GKKE 3B8HA 4DV5I 4KHPE 2R3VA 1S16A 5FLXQ 2BM0A 1S4EA 2UU9E 4LF6I 1MG7A 1HR0I 2HFUA 4DR2E 4USKA 1ZM9A 4JI1E 4JI8E 4DR1I 2V2VA 2OI2A 3QT8A 4ZVIA 2UXDI 4LF4I 4LF9I 2F4VE 3J80Q 4JV5I 5IT9Q 4DV5E 4NXNI 4M1KA 2NPFA 5LMUI 2V2ZA 4LF6E 1HR0E 1FNMA 4DV7I 4K0KI 2V8PA 1H73A 1FI4A 1ZXMA 2ZM6I 1H7UA 4JI5I 1RREA 2UXDE 1EI1A 4LF4E 4LFAI 4NXME 4LF9E 3ZZ0A 1Z0TA 3QT6A 4JV5E 1NZ0A 2EFGA 1QZRA 3ZM7A 4B3SI 4LFCI 4NXNE 5A2QC 5LMUE 1Z0GA 3CWVA 4DV7E 2X7IA 4PU9A 4K0KE 3GONA 1I94I 1KVKA 5L3JA 2UUBI 5LMNI 2A2CA 4FWDA 4DR5I 2ZM6E 4URLA 3B78A 4JI5E 5IWAI 4LFAE 1ZM3A 4JG4A 4X64I 4USMA 1XMQI 4DR4I 4B3SE 1UEKA 4LFCE 2VF3A 1Z0WA 2BM1A 1N33I 4GKJI 1I94E 3J81C 4DUZI 4Z7CA 2UUBE 4PRXA 4R1FA 5LMNE 1FWLA 4DR5E 4RPFA 1N32I 1N0VC 5IWAE 4Z7YA 4DUYI 1PIEA 4JI3I 4X64E 4LF8I 5GMDA 1XMQE 4DR4E 1HNXI 1N34I 2BV3A 1ELOA 4I3HA 4HY1A 4KQVA 1N33E 4HACB 1XNQI 4WUBA 1ZM4A 1Z5BA 3ZKBA 4GKJE 2J7KA 5A2QQ 4DUZE 4OX9I 3LTOA 3T1YI 3K1JA 4MYTA 4P52A 1N32E 4JYAI 4DUYE 3M6AA 2ZBKB 4JI3E 1D6TA 4PRVA 4LF8E 3JAMQ 4DR1E 1MX0A 1KTVA 2HKEA 1K47A 1N36I 1HNXE 2LJPA 5LL6R 5BR8I 1N34E 1Z0BA 1NHIA 1PVGA 1XNQE 4DV6I 5FLXC 2HK3A 3V2UC 4UTGA 4DPTA 1Z0CA 2AJ4A 1IBKI 4OX9E 2R42A 1H7SA 1Z59A 3T1YE 4X65I 4JI7I 4LF5I 3J7AM 3PYFA 4WUCA 4DR6I 4JYAE 3B82A 1KIJA 2Q2EB 3HULA 3ZZUA 4P7AA 1B62A 1RR9A 4YY3I 3WU3A 3J80C 2VQFI 1N36E 3ZKDA 1IBLI 1NHJA 5BR8E 5IT9C 2VQEI 1ZM2A 4DV6E 4AQYI 3LPSA 4B3MI 2ZITA 3T1HI 1IBKE 4B3TI 4JI6I 1H74A 1Z5AA 2UXCI 5GMEA 4X65E 1IBMI 4JI7E 4FN5A 3WU5A 4LF5E 1MU5A 4DR6E 1VISA 2CZ9A 4DPYA 4DPWA 4DR3I 3LNUA 4DXLA 4YY3E 3ZZTA 2UUAI 2VQFE 1FJGI 1IBLE 2V2QA 1XHKA 2UUCI 2VQEE 4DV2I 2X36A 4AQYE 4B3ME 3T1HE 2A2DA 2WW4A 3PYEA 4B3TE 1FWKA 4JI6E 2UXCE 2DEJA 1IBME 4LF7I 3WU4A 4X66I 1HNWI 4HACA 4EMDA 3H4LA 4DR3E 4JI4I 2HHHI 2E1RA 4DR7I 2UUAE 4HXZA 4DV3I 4DU8A 1FJGE 4FW9A 3WU6A 2UUCE 4NXMI 4DV2E 2XEXA 4X62I 1FKAE 2UXBI 1XNRI 4LF7E 2DEIA 4JI0I 1NHHA 4X66E 1KKHA 3QT5A 1HNWE 4YHHI 3Q1QA 4JI4E 2HHHE 2GS8A 4DR7E 4DV3E 2E5LI 1BKNA 1PKPA 4JI2I 1ZXNA 1B63A 4DU7A 3J81Q 4WUDA 2HFSA 1EA6A 1WUUA 3OTOI 4DV4I 4LFBI 4MYUA 2V34A 4DPXA 1A6FA 4X62E 2HK2A 4DV1I 4HYMA 2UXBE 1XNRE 4B3RI 1XMOI
chains in the Genus database with same CATH superfamily
1J5EI 3EDRB 2DRBA 3K58A 2UXCJ 1K44A 3K7RA 3W5ZA 1HW9A 3VAGA 4RWWA 4K4XA 5L39A 4DPUA 3QGGA 2U2FA 2DNYA 4KH0B 4PABA 2LKZA 1SJ3P 2AWZA 4LFCF 2D69A 5E3RA 1RCXB 3J81Y 4MKYA 3J7AN 2CQCA 1Q53A 3NCRA 3SIPB 3EE3A 4B3RE 4DLGA 4OYMA 1FDDA 2VQFF 1PKUA 2HKJA 2MHNA 1H72C 1HNZE 1IVZA 4ZPCA 2FVQA 4X66J 2UU9E 3MAAB 4NA2A 6AT1B 2BYCA 3EYZA 3HVTB 2FY8A 1N33F 2MKYA 4NRUA 2FY1A 2FJXA 4R8UB 4FZVA 1IQZA 2BKPA 5D4PA 1AZSB 2NUUG 4G6VB 2P6SA 3K8VA 1A6LA 2VJVA 4ELUA 1TAQA 1HBUB 2C2OB 5FJ4A 3IG1A 3O1LA 4JI0J 1RAFB 1S1VB 4ANEA 3IA0A 2NPFA 3N6NA 3NWGA 3VAHA 4K0KI 4B17A 4NPOA 2XYHB 1SC6A 2C3YA 2ALZA 1HWJA 4CT9A 3ILOA 3WBZA 2QL7B 3BKFA 2Z5EA 1FDAA 5J2PB 2XHCA 3SFGA 2AJ0A 2ZUGA 1W26A 4WCEQ 3M85D 1OMSA 4NCGA 3TANA 3TZZA 2VQEJ 3C15B 2KT5A 5K20B 2AYEA 4TU9A 4EZ6A 4IH5A 2F1FA 5CA5A 4L73A 2HZVA 2GIQA 1IM6A 2ATLA 2IFXA 1HNVA 3QSYB 1PAEX 3CJKB 1ZM3A 1VQMS 4TU7A 4PWDA 1GXTA 2GO8A 3WX4A 5DROA 4WU3A 4ECUA 2RDJA 2VG5A 4B3SE 1UWAA 3JSMB 1SUQB 3TAQA 1DTTB 2GHWA 4GKJI 5KG7A 2PDAA 1RTJB 1XQIA 2FJEB 5LOQA 3T41A 4CTAA 1F6TA 3HT0A 1C1CB 3D67A 4UF4A 1NCLA 3PACA 4ERDA 2Z2YB 5GMDA 1WTBA 1HHTP 2E1MC 3B54A 3HZEA 4A8MP 1USVA 1TQLA 4IO1A 4HACB 2NYHA 4NLVA 4RUBA 5B0FA 2UVVA 2NQPA 1Z2LA 4NXNJ 1D3WA 3CW2C 4DUZE 1NEEA 2J76E 2HMIB 3T1YI 3BGOP 2HRUA 1WC3A 3I87A 3MM9A 4ED2A 4YN3B 4JYAI 2O1UA 3EWGA 1IKWA 4IG0A 5B08A 3PNIA 4C0OC 4XIUA 2DYAA 3DD6A 4B3RJ 2GVDA 5J2QA 3C46A 3JAMU 3MFIA 5L1LA 3MCNA 4JI7I 2ACMA 3PYFA 4WUCA 2CYYA 4F3MA 1UKUA 2NN6F 2XO6A 1WI8A 4YY3I 2XMAA 4IOCQ 2CJYB 3V6DB 3ILIA 3D1QA 2F5GA 5DDOC 2PNLA 4PRFA 4TLQA 2OEMA 2RUGA 5MAOA 3ZTRA 3MM6B 3OTBA 5E3PA 1C0UB 3ZTOA 3POTA 4F3OA 2VBZA 2VG6B 4Z37A 2B56A 1FEEA 2N4CA 4QR1A 3EX7B 3JQMA 4HT7A 2ADCA 5KAKA 4DR3I 1N32J 2ZWOA 3H5UA 4RUAA 2EXUA 3CJ3A 4I2QB 2BACA 5HBMA 3HSGA 5IWAF 3P49B 3OJSA 3M05A 3FBEA 4HH0A 4LF7I 3RB6A 1CEZA 4CNZA 5D77A 3BZQA 1RT7B 1QY7A 3ETMA 2CDQA 3GJSB 4YDXA 3H40A 3SV4A 3M7VA 4RU2A 3FK4A 1DHMA 1JNZB 3KRNA 4MT1A 3BYPA 4P2SA 1S1TB 2M88A 4F0HA 3J81j 5HI7A 3Q8PB 4IFDE 4NLGA 1R0CB 3QT5A 1TK0A 4N76A 1P42A 2HHHE 3V4IB 5D8HB 5E2QA 2HBRB 5I42A 2ZZTA 2E5LI 4BA2B 1U6FA 4ZVHA 3IAM9 4OHYA 2PSZA 3OR2A 2KJVA 3H2VE 3H59A 1OYDA 5D78A 3F73A 1IM4A 4DV1I 3J80Y 3PYGA 2O5DA 2VG7A 4CLYA 5F3TA 1U0HB 4ID8A 2HURA 4FWHA 4DV6F 5JEAF 1LW0A 2H5JB 2ZZNA 3GPAA 1VIOA 1IBKF 3PYDA 5KFYA 5HATA 4WZMA 3LGMA 1WC6A 4JI8I 4N3OA 1WDTA 2QL5B 2F4VI 4DV0E 4AUKA 4AM3A 1Z5CA 4GKKE 4DSJA 3N6MA 2R3VA 3AA9A 4RW9B 2IJNA 2DNLA 2OH2A 3GYNA 3H90A 4PPZA 1IBMF 1N88A 3V6HA 3L9ZA 2HFZA 4K5RA 1REVB 2WVDA 1RWVB 2OI2A 4EBEA 2XMUA 3KHLA 4DOZA 3R2DJ 2HWHA 1RWMB 4EWTA 4OO1E 3AQOA 4IZJD 5JUMA 1S5ZA 1OQ6A 5B0AA 4MU3A 4ZPTR 4H4KC 1XC9A 3C6UB 4JI2J 1YGYA 3MXHP 1T95A 1T02A 1KLNA 4J9SA 4EGLA 1EAYC 2W4PA 5DM7Q 3Q8SB 3LP1B 4C8YA 4FNIA 3NL0A 2O1VA 5CYQA 1UDNA 2G2ZA 2JZ5A 2OGUA 1M1KT 2EC2A 2HRTA 4X62F 5IT9Y 2MJNA 1P9YA 4MK8A 4KHPJ 4DV7E 4KO0B 3G82B 4ZHRA 1YJVA 5AJ3J 4IS9A 1S6PB 4K2XA 3DM2B 4WYWA 3ENQA 4MTPA 2PC6A 3PJWA 2CPDA 1SJRA 1XWLA 2VF3A 2KXHA 3HHLA 2X3GA 4RW7B 3PM9A 4FP9A 2BKNA 2LU2A 4C0HA 5C0XA 3W2WA 1RABB 1D8ZA 2MXYA 1VQYA 3CB4A 2MSSA 3CCWA 3PY8A 4NXMJ 3DRPA 4DR2F 2ZE2B 1OYPA 2JE6A 1HNXI 2ZBRA 3T5HA 3OSPA 2Y0SD 1PJ5A 3V6KA 1M5VC 2XY6A 3KK1B 5DS7A 2IA0A 2LLZA 2XWYA 1FT8A 4PQUB 3JTOA 5A8KB 2ZM6J 4LF8E 1FJEB 1ZH5A 1UDQA 2CG8A 1YIJS 1N34E 2WK4A 4XDDA 3FZ2A 4R0EA 1HBMB 4RNMA 3H2LA 1P8GA 3KLHB 2HIYA 2WHOA 1SIWB 2Z0GA 2YWFA 4KT0C 4BWMA 3ITHA 3LW5C 3DN9A 2Q2EB 2HBZB 1R8CA 1RHMB 4F0MA 4YOEA 3J80C 3R97A 4X64J 3FZBA 2VQEI 2QYGA 3IM9A 3CDUA 1X9SA 1FVQA 2NREA 1RTHA 5HROA 3OLAA 1Q78A 1NPKA 4B3TI 3ZTQA 2MEWA 2BJ9A 3ZZRA 4LF5E 1MU5A 1F2HA 2VKRA 1YBUA 4DPYA 2OPPB 1NB2A 1NUEA 1QM9A 2PT0A 4FYXB 4QYZK 4AXIA 2ZDPA 1VRUB 5IQQA 1NK6A 1VQNS 4JI3J 4Q7AA 2I38A 3ZNUA 3AODA 2IPOB 4F4WA 4FPIA 4QW9A 3KLIB 3D3CJ 4X4TA 3DRSB 4LSNA 3FDSA 1VK8A 3NY0A 1HNIA 2EPIA 2HFVA 2C3UA 5K14A 2W7PA 1S1XA 4MIWA 1SKWA 2EKYA 1LW2B 4DV2E 2HQDA 1HWIA 4Y0FA 5HJYA 3EJMA 1T3NA 4JB8B 4NE9C 3LOUA 2GO3A 1OYSA 5C5JA 1B99A 2CJAA 3UCZP 2DO4A 2GMLA 5C25B 4HL9A 2GS8A 2Z57B 1BD6A 2AGQA 2FHKA 3HZGA 1LFWA 4ECQA 1B63A 1D8YA 1ZPVA 5JEAB 2RRBA 5G0RB 1LFPA 1CJKB 2VC0A 2COLA 3QWUA 3TARA 3KK3A 2M52A 1NXIA 1VQ4S 4AQYJ 4B3RI 2RVJA 3R2CJ 1HI1A 1T9TA 3TJ8A 1UW4A 1HNZI 4JI6J 4DL0C 3MMCB 2O66A 4J9OA 2UU9I 2F63A 5K9FA 1RWXB 1ZZNA 2HFNA 3BGUA 2BE2A 2RRAA 2I1RA 2ZBIA 1NKCA 4FXVA 4WBFA 5K36F 2OD4A 2NXUA 2V8VA 4AL6A 3RTVA 3QSIA 1IBLF 3FGVA 2RH3A 3M2RB 1N34J 4NASA 3DLBA 4UQTA 4B3MF 2HVDA 4J7CA 3FSIA 1MG7A 1B64A 2UXCF 4F4YA 5F8IA 4OO1B 3LWLA 4USKA 1ZM9A 4ZVTB 5LJ5Y 3LANA 1AXQA 3EDQB 4J3DA 1RLDA 2C2MB 2XZDB 1YJ7A 2J5AA 5J2MB 3GR0A 4P72A 3IM8A 1SXLA 3TAMA 3GIMA 4IR9A 3WC0A 4TNOA 2UXBJ 2QX0A 1WSRA 2ERRA 5IM0B 3A8KA 3D6FB 2PNZA 3LAMA 3K5OA 3MGJA 1FRHA 1H7WA 4HHUA 2W9BA 1H73A 3UD3P 2Z2ZA 2NS1B 2P8IA 2MZ1A 1JJHA 4LF5J 4N7TA 4X66F 4C8OA 1WEXA 3W8GA 1IKVA 5EKWA 3S7RA 4QIEA 3G96A 1RI7A 1P1TA 3NS7B 5E41A 1Z0TA 4J37A 2IRYA 4C8LA 2Y1LB 4URQU 1XMOJ 3ZM7A 1VRTA 1LOUA 1NZ8A 5B0BA 4B3SI 3PFOA 3K5PA 5EWGA 4OHXA 5KG3A 1TMMA 4OJ1A 4JI0F 3QJPA 3E51A 1O0PA 3CC7S 4Y28C 2Y1JA 1VR6A 1TKXB 3RRKA 4XPEA 2CUYA 1HBOA 1S0VA 1NMEB 4KPCA 5D0EA 1CJTB 5ETLA 3U1NA 4M63A 2GVZB 5DETA 1P27B 5KFWA 4DUZI 1HYSB 4RJVA 3HPOA 1FWLA 1TMJA 5ELWA 1QSSA 2N3LA 1E6VA 2V9KA 1WKJA 3WIVA 1SJFA 2AP6A 2C2ZB 3KTQA 1N5YB 4C3LA 4WP9A 3KLEA 4EO8A 2XMKA 3G6XA 1H2UX 1Y5IB 4ZLNA 5L9XA 4QYZJ 2MLXA 1JXVA 4O0IA 2LP4A 3BREA 4B9SA 1S49A 4P6QA 4DL7A 1LWFB 3CMQA 1ACMB 3VVTA 1RGVA 3CDWA 3MPWA 4PG7A 1REGX 2MDAA 1T9VA 3MMBB 1Q8BA 5B0EA 2IHR1 1JXEA 4JI5J 2VFSA 2OKQA 3JAMQ 4NYPA 1MX0A 4F26A 3G71S 1K47A 4HVZA 3H25A 2BR0A 1E6YB 2B7BB 3HD1A 1T9YA 1TL4A 1VGYA 3TQEA 1Z59A 4LRDA 4GVBA 2CKWA 3J7AM 2BA1G 1W2IA 4NXNF 3AD8C 3GCWP 5C0XC 1FEHA 2G2OA 2LQBA 1RBLA 5J2NB 4MU1A 3LP0B 2JX2A 1FKPB 2GMHA 3R5CA 3H4DA 3US5A 2ZOMA 2HIQA 3WU5A 4G65A 5KT6A 3H20A 1FERA 3PG9A 4CM0A 1YQHA 2LDYA 2LDIA 1EZZB 4KGXB 4YFUA 1SPBP 2MYFA 3BH7B 3QRPA 4H4OB 3EZ5A 4ILRA 3MAAA 3VF0B 3G4SS 5DZ6A 2OPQB 1FK9A 4L74A 1XNQJ 1XR6A 2CQHA 1U1NA 2FJAB 2V4RA 2JEAB 3PKMA 3SI8A 1AZSA 1TAUA 4QYRA 1MU2A 1F9EB 4EMDA 2CWXA 2HHHI 3KHHA 4Q45A 3MEGB 1YJ9S 2UUAE 1S1VA 4ZP9A 1U09A 4NXMI 2CQDA 4UZCA 3P3DA 1N32F 2IJRA 4O3PA 5BR8J 1L3SA 3U7JA 2VASA 1OYEA 1SI9A 2ZC3A 1KLMA 4DX8H 2RQKA 1JKHA 3AJDA 5D4LA 1R0AB 5H9FJ 1HWUA 1RYRA 3A3OB 4DQIA 1TUGB 2IAJB 2CDRB 4G1QB 3SZ2A 2U1AA 3CULA 5CQGA 2CQ2A 2GIFA 4TU8A 1D09B 1BQNB 1RHYA 1XNRE 3TOQA 4AYBD 4DV0I 1R43A 5K36B 4Y2MA 4EI2A 1FD2A 4GKKI 2ZH6A 2EFQA 3I0RA 2VODA 2R8JA 4CM2A 1RT1A 1GAOA 3JSMA 2CRLA 3AD9C 1VLOA 1T03A 3W3SA 2X1BA 1LKZA 2LXFA 2CQIA 1RTJA 4FXDA 2I9SA 1WHWA 4K4YA 2JJ4D 4LF1A 2GGPA 3BO2A 3D3BJ 2LYVA 1S0OA 1R8AA 5DQHA 3QAEA 2FLNA 3EUNA 2CPJA 4ECRA 1KTQA 3CD6S 1FFSB 2ZH9A 5U47A 3M8ZA 4FF1A 1TL3A 3BR8A 4Q8EA 2DGQA 3TVYA 4IOAQ 4B3OB 1FJGF 3H5YA 2K7JA 4ISAA 4ES1A 5CD4H 1VQ5S 4B02A 4X4PA 3W9JA 2CNOB 1FTRA 4EYHB 4Q2MA 4LF6E 5I3PA 1HR0E 2BJEA 3QRRA 4FVMA 4DV7I 1GXUA 2GCFA 3K89A 4KY3A 3VVUA 1FI4A 1Q5VA 4NMXA 5IT9U 1RCOB 1XR5A 3DMJA 2AX0A 1T9WA 2V8HA 3E01A 1Q5YA 2UXDE 3D0IE 4X4SA 1I3OB 3ZZ0A 4QU6A 2GQ0A 5LSRA 4KGZB 1O8BA 3DGPB 3FC9A 3MEEB 4ECVA 2C38B 2V67A 1O51A 2DH9A 1X5OA 2VESA 3V6JA 2C39B 3MM6A 2Z5BB 3PFEA 4J91A 4ZCLA 2K2PA 2VG6A 3BN4A 2CADA 1Q86T 1BMQB 4A8WA 4JI2F 3CCMS 1KHWA 4EYIB 2QLFB 2VFTA 3GU0A 4YR0A 2FJDB 4ZVUB 3C16A 2MKIA 2OTJS 3M8RA 3HSDA 2YKMB 1YH8A 1X4FA 4DL5A 1L5UA 1HHQA 1U1RA 3DOKA 4DR5E 2KZZA 4ZLLA 3C6TB 4QWCA 3PO4A 3I32A 3FVYA 2PNMA 4KHPF 8RUCA 3UWTA 2R7TA 2FQQB 2R9LA 4L3NA 5C2CA 3R5JB 1MWQA 3T19A 4LF8I 1RT7A 5GAGU 1PJ7A 5AJ3F 1N34I 2VD3A 1GFWB 3D0HE 1FE0A 2FHMA 4B9MA 3DRXA 2DPJA 4U9RA 3ZKBA 1SH3A 4GRSA 4FBTA 5LMUJ 2LECA 1R8HA 5IZHA 4FW4A 1M5HA 4I6AA 1ZTWA 2V5HG 1NNDA 4IFDF 4ES2A 4PRVA 2YNIA 1RUSA 2M70A 3CD7A 3AB4B 4BA2A 2RHSB 2AJ1A 4ED3A 4ZVSB 1R6YA 1PYSB 4ANCA 9ATCB 3RB0A 4NXMF 2A10A 3HKWA 5KFUA 4RUCA 4OX9E 4RBTA 2XS7A 4PUOB 1RAGB 1X8DA 1H7SA 1NJIT 2PI4A 2ZNYA 8ATCB 2A1BA 4LF5I 1FD8A 2C2EA 3NWRA 3RR7A 2JH3A 4GQUA 1QTNB 3CDIA 3NS6A 2YNFB 3KDOA 2RDDA 3IR7B 4F50A 2ZM6F 3Q83A 5B7WA 5GMKa 1R8PA 2BANA 2DHAA 5EX3A 3GV5B 4NX9A 1H74A 1R8BA 2DNNA 2R7UA 1OPZA 1RXOB 2ZKTA 4DR6E 3BBBA 3E3XA 1PBAA 2B0GA 1JLEB 2XI3A 1NBEB 2UUTA 2ZD1A 4LBHA 2V9WA 1VS3A 4RW9A 2JEBB 4DV2I 2W9CB 4DS4A 4O44A 3UDCA 3HJFA 1EJ7L 2UXDJ 3MUTP 1TP7A 3T5JA 1FE4A 2AJQA 4X64F 1REVA 1TFWA 3TA1A 2DEJA 4KKOB 3JQJA 3ZZYA 1OS5A 3WC2A 1S97A 3KHGA 1G6BA 3P8BB 1SQEA 5E7OB 1FRJA 2D3UA 4DHVA 5A0YB 3PS1A 2V94A 2DXFA 4KSEB 2UUCE 3B4MA 1KN6A 3THPA 5HJXA 4DI6A 4IQXA 3HCXA 4DX6A 4JI3F 5F8GA 3MPDA 2QT7A 3CE8A 2R2UA 5JMNA 4BDPA 3M8PB 2VPZB 1G2EA 4IYQA 2YTCA 4X65J 4LCHA 4JI4E 1F60B 3I55S 4WK1A 1S6OA 1NKBA 2X51A 3BGFA 5MLCV 3J81Q 3A3PB 1YK9A 2KRRA 2QE5A 4KO0A 1HA1A 4MYUA 4IZKB 5F8MA 3T6BA 1FRKA 1SL2A 4LSZB 1S76D 3DM2A 4M5LA 3TZXA 3NCPA 4P7TA 3A12A 3M6VA 2MTLA 1RDRA 4TXSA 3IN5A 1NKEA 2L48A 5KG6A 3VTIA 4KGVB 1TKDA 2KJWA 4LVOP 4IDKB 3MWBA 3TAPA 1IWAA 3PX0A 1HIYA 4WU2A 2GHVC 4LFBE 4ED4A 4XTJA 3OXGA 1CVJA 2GV1A 3BSCA 4FS2A 3R8YA 2CJQA 4A8FA 1C1BB 4USVA 3L09A 2K1RB 3THTA 2KXFA 4QNJA 4AQYF 2ZE2A 1A7GE 1Q8KA 1HPZB 1TKTA 4JI6F 3T3FA 1BC6A 3MTKA 1NDKA 3QIPA 3KK1A 1GMWA 5HVGA 3DOMA 1CSJA 2OMLA 2G13A 3OTCA 4O4RA 1TV6A 2MGZB 4M1KA 2E5IA 1YI2S 1UJ6A 2V2ZA 3OVAA 2BE7D 3PZPA 1N34F 3Q8RB 4RL1A 2FUG9 4DR6J 1R6VA 2QEXS 3OSNA 4IRDA 1AUSL 2XLIA 1RAIB 1NZ0A 3MZIA 4J9MA 1RAEB 3NZKA 3I0SB 2K7KA 2XSJA 5F8NA 1Z0GA 4DFPA 4NLSA 2UXBF 3GILA 2YKAA 1KVKA 3CCVS 4X84A 3AB2B 3RAXA 1UZHA 3MUMP 2CPFA 1NH7A 4JI1J 1Y5NB 1FXLA 3HO1A 2QMWA 1YTYA 2MLZA 2N7CA 1VRUA 3UFCX 2IC3B 5ETMA 2HFOA 1XMOF 5L1IA 3CGIA 1VRQC 3SMZA 2IMOA 1FRIA 4ZS6A 3TZYA 2Y8WA 5FD1A 1YZ6A 3KLIA 1R3NA 3GIRA 1PIEA 2HNYA 2NN6D 1BGXT 2K3KA 4DR4E 1Q7LB 5HLFB 2LA4A 3H4BA 1PGZA 2B6AB 3DC2A 4IRCA 4LREA 4NA1A 4ED5A 1JLGB 2CG9A 2G0JA 2PO2B 2VC1A 2KTQA 3UD5A 3G6ES 5GAEI 2BABA 5C0XE 3CDEA 2QMXA 4MFBB 1S1UB 2ZEJA 4FF2A 4OHZA 1YX2A 3NNHA 2OPRA 1CJUB 3NBPA 1Q16B 1X60A 5A6PA 3T5KA 3H0PA 5DGBA 4ZP8A 5JEAA 5KT3A 3MEDA 2W2MP 3V2UC 1ZTTA 1Z0CA 1CJKA 3GIIA 3IR5B 3HSJA 1TVRB 3M85G 3FSYA 2YKPA 1TFYA 2UUBJ 3EXYA 1KIJA 4XTTA 3HULA 2L9DA 1CPZA 5GADU 3MMCA 2D7SA 1N36E 5D6GA 4R5PB 2K8GA 3NNAA 1XMQJ 3K2YA 4JI5F 4LF2A 4LUBA 1RT3A 4BA1B 1ZOTA 2W1BA 1YJRA 3MMAA 3K59A 2LQ9A 2IRXA 3CCSS 2Y0BB 2AYGA 2D3OR 3BDPA 2DBBA 3ISND 1PSDA 1U1MA 2LFVA 4OYBA 3W8PA 1Y5YA 2UUAI 4O3OA 3WDOA 3DXSX 2FIUA 2RKIA 5DG8A 5HAOA 2DGVA 3BQ0A 3KUEA 2X36A 1Q8LA 4OO1A 4NEZA 2WW4A 2RHQB 3DLGB 1VK3A 3RR8A 2MQOA 3MURP 3FJ2A 5J2MA 2ASLA 1CBKA 4UUWA 4KJIA 4GC6A 4ER8A 4PEOA 2P6TA 2QO3A 2BW2A 3WU6A 3V81A 1H3DA 3PX4A 1ICEB 5A2QU 2F40A 1OPIA 4WIQA 2DXDA 3PX6A 1XNRI 2OPSA 2HHVA 2QLBB 1NU4A 2XYPB 3PW7A 4TN2A 4I7FB 1B0TA 1Q82T 1RWNB 5KG5A 1XNQF 2FZCB 1D9DA 1FESA 4DV3E 2KI2A 2DR9A 4TYAA 2FPHX 2BJ1A 2FDNA 4RW6B 1XERA 2JLEA 4IZJB 2RMLA 3E8OA 5F9LA 4FKXA 3OHBA 4DR4J 2I5JB 5BR8F 2HS0A 4YHHE 3R6GB 4I6YA 1NPRA 3BF4A 4MQYA 3TA2A 5IS2A 3H1CA 3CJ8A 1QUPA 1XIQA 4L6V3 2PA8D 4TQRA 2PO0B 2GVZA 3SXLA 3LP2B 2HG4A 4DV4E 3H98A 5KT2A 4Y3CA 2ZBQA 3VZHA 4AIMA 1N5YA 4FW3A 2K3IA 2GC8A 1RT6A 1C0TB 3T5LA 4OZJA 3LWMA 5HL7Q 4YEAA 1C4AA 4HEA9 2NYIA 4LF6I 1HR0I 1UVIA 2JC1A 2E44A 4OX6A 2C37B 2ZH8A 1LNQA 1LWFA 4BWJA 2B9EA 3M1VB 4RW4A 2UXDI 4NBQA 3KLFB 4L72B 2DNQA 2KZMA 2F8MA 2H4WB 5IT9Q 1U02A 3TQ1A 3MM5A 1LK5A 4LQ3A 4GO7X 3MOJB 1UPPA 4RNOA 1GX5A 2A6OA 5D0RA 2UVWA 1NLKL 5CYMA 3EGVA 5K8OA 1YLXA 3PW2A 1FKOB 3BR9A 4K59A 1OWXA 4F4KA 2GA7A 3D68A 3I31A 4B9NA 3RBEA 2HNZB 3J7YU 1J5EJ 4XAKA 2IYGA 2ZH7A 2CXEA 5J2NA 1CG2A 1TKZB 2EG2A 2K06A 4ICLA 3GONA 1GK8A 5L3JA 4C11A 2XMTA 2EKNA 1V5VA 1T9UA 4DR5I 3G9CA 2OMOA 4YR2A 3MR6A 3O2IA 4UY85 1RTIB 4ETXA 1WORA 2KFNA 1QAIA 4WTOB 1MSWD 4CCHA 4M5DA 2J6SA 4L3KA 2P2CB 1YHQS 1VQ7S 4NI2B 2V8DA 3EMTA 3M30B 3J7A1 3EGWB 1T3OA 5I4MA 5LM7E 3TNVA 2HW3A 2JEAA 4F4ZA 3TRGA 3DHWC 1ZAVA 2BZ2A 4F67A 4MH8A 3DHXA 4DV3J 2RU3A 3SSQA 3KUHA 1RT4B 2E1PA 1KFDA 4IG3B 2BV3A 4QOTA 3ENVA 1I6JA 2CNNB 2XMMA 5KFDA 5T7LB 4OX9I 5BYQA 4ZP7A 3BB5A 2W7AA 4K0KJ 2KL8A 4DF4A 4P52A 4DUYE 2QL9B 3S6EA 4CI0B 4ZN3A 1VQLS 1R27B 2LQJA 3CCLS 2IAJA 2VFUA 4ELVA 1K0VA 3AXKA 2NCKL 4IFVB 1RU2A 4JP8A 3W1YC 4OX7A 1RHJB 2MQLA 4DPTA 3GJQB 4WFAQ 2DNOA 3GCXP 1CS4A 3M32A 1K0TA 5LSOA 1F2GA 4DR6I 4M5GA 5LMUF 1X9WA 3W66A 2RDIA 1ZAWA 3L7ZA 3KYLA 4FYVB 2B8PA 3L3CA 1WG5A 4W4MA 2QA4G 2X1AA 2HWIA 3LPYA 2H9ZA 4GKJJ 4MIAA 5KT4A 4YP3A 1Y3JA 2XGPA 5IQ6A 3N6LA 1RHQB 1HARA 1Y7PA 1V3RA 4N8OA 2CZ9A 4DPWA 3U27A 4A8YA 4ZIVA 1N52B 1I94F 4I68A 5T41A 3GV8B 4DPOA 2PMWA 4RR5A 2UUCI 1NDCA 4DQSA 4K50A 3TX8A 5L1JA 4TKTA 3T1HE 1MMNA 5JEAC 2XM3A 4M5HA 1KS2A 5ETPA 2CQ3A 5GAHU 3WU4A 2MZQA 1APSA 2AD9A 4PPDA 4C9DA 1RQ0A 2YH0A 2BA0G 2E9RX 4V19J 4JI4I 3UO0A 5HANA 4BHQA 2OFGX 4JYAJ 1DTQA 2W25A 3IBWA 4HKQA 2Q79A 2ZHBA 2XULA 3U1MA 2XEXA 2HWTA 3MF5A 4JUZA 4KTQA 2JL9A 4FYYB 2WZ1A 4RBUA 2R7OA 2YNHB 1LWCB 1RT2B 2Z58B 4KHRA 2UXDF 1HNWE 4IR1A 4JI7J 4ED6A 2VJUA 1Y4ZB 4FF4A 2W4CA 2M0GB 3MEEA 5A8WB 4YY3J 5C2GA 2EG1A 2RU9A 4M95A 3EM1A 2MZJA 3FMWA 2C39A 2Z5BA 4LFBI 1QSLA 4OO1C 5H1SV 2HK2A 3DKDA 2CZVC 1H7XA 3PEJA 1S9GA 5L9NA 3BPDA 4O4GB 1WDDA 2WONA 1S0NA 1MROB 5HVHA 5J1EA 1Z1ZA 1FWPA 3AFGA 4DR3J 3JAMC 4X65F 1NPPA 2L3MA 1TU0B 5IV4A 2YKMA 4Y2AA 1HQEB 4I1TA 5F41A 3C6TA 1UEUA 1U2RA 1G4CA 1XR7A 4TYBA 2DPIA 5DDPC 2WNRB 4KAIA 4LF7J 4O3SA 3GQCA 2EFVA 3Q8UA 4Y34A 3TYTA 4HT5A 2Q6BA 4ID5B 2YNGA 3W60A 5IFMA 4K4UA 2I8EA 4YS2A 4DMZA 3UCUP 3QT8A 3VGTA 2GMJA 2GX8A 2FHJA 3QGHA 1DBDA 3OXFA 4DFKA 3MR3A 2ZVSA 2QRRA 3M8QA 4JV1A 2AKWB 3R7SB 3R1HA 4X4RA 3SQGB 3H8YA 2E5LJ 5FLXY 3RJMB 3QZ7A 4FKYA 1S6QA 3I82A 3KLVA 4LF4E 2VBXA 3TUJC 4LF9E 4LBIA 3C2PA 4OI3A 4DV1J 2EFGA 1QZRA 1E3PA 1HD0A 3HT3A 2B9YA 2WOMB 2W2OP 1AFJA 4PYAA 4LCGA 4F0KA 2X7IA 4LRFA 2LQ5A 3GR1A 3ISZA 1WHVA 4A48A 3VAJA 2DO0A 3HVAA 4A8OA 4K5SA 3L7OA 4LFAE 3QNWB 4JI8J 2KVQE 1N56A 2BJ3A 4UZBA 2MY7A 3ZC4A 3DNCA 2JEFA 2F4VJ 4DR4I 3OTOF 2DNRA 4AL7A 2Z5CB 1DLOB 4OLPA 2C28A 4Y2CA 2BR2B 1NK4A 4CH0S 5LMNE 2CQPA 5F8HA 1KR4A 1HNWJ 1Y10A 4CO1A 4Z7YA 2D3O1 4I56A 4V19X 3ELHA 3HVWA 3SV3A 3PRVA 2CQ1A 1RWUA 4JI1F 1M5KC 3FRYA 2HVEA 2XS2A 4LSLB 2DIVA 3HVRA 4F2SA 3K1JA 2JFKA 4V1Ak 5AXLA 1RTDB 3P5TL 4DV5F 3TWZA 1UTAA 3M6AA 2ZBKB 3PEHA 3UVJB 1UETA 2I6WA 2QLWA 1JLBA 4DR1E 3GFYA 5AE3A 2JEJA 1N36I 3C14B 3PIOQ 3KFWX 1NHIA 2L08A 1FFGB 2DY1A 2HK3A 1P6TA 3HMJG 5ADZA 4OZ2A 4IZKA 3IRXB 1N5SA 2IDLA 5KFFA 4DL4A 4ZCMA 3W2VB 2L9NA 1WC5A 4USWA 5KOXA 3DDKA 1RADB 4M5KA 1VQPS 2VPWB 4RZRA 4I0WA 1QDUB 3GMGA 1OIAA 1JMTA 3BSOA 1UPMB 2DH7A 2DNMA 5GMEA 2Z2LA 4H4KA 4AL5A 4N41A 2BMBA 3LQVA 2VQFE 3M7NG 3GYXB 2UUBF 2H3EB 1HPZA 3I6PA 1HWKA 3KG1A 3ZZOA 4M94A 3O5TB 2MQMA 1HNXJ 2DHHA 2WSCC 2Z2MA 3U1KA 2NR0A 2W2QP 2YH1A 2Y8YA 2HGLA 1XMQF 2AZ1A 3CXCR 3AH6A 2V69A 1RLCL 4X4VA 5K36C 4DV3I 1SQFA 4TY8A 2EI5A 1FRMA 2WVBA 1GXLA 1DZ5A 5JXSA 3IG1B 1RBOB 3M6XA 4KHMA 4NLOA 2F8HA 4YB7A 3IR6B 1JLCA 3OXLA 3K5MA 1S59A 4U95A 3I5CA 2G1DA 3DFEA 3KJNB 2YKQA 4YHHI 1MWZA 3S1TA 1RK8A 3HJCA 5DDQC 4KC5A 2AJ2A 5KFRA 3OLBA 3I0SA 2EW9A 3PJXA 3OL7A 4ZPWR 4ZDNA 1PC5A 2OEKA 1WHYA 2AE8A 3GLLA 4DV4I 3QIDA 3KHRA 1RHKB 2V34A 2WSEC 5I3UA 1TTHB 1GNKA 4PXEA 1FRXA 4UOCA 4W90B 4BBYA 3RB4A 3RZAA 1RJJA 2BKOA 4J9NA 2NXJA 4B3TJ 3V5RA 2FZGB 1HNVB 4DSFA 4KH1B 1RWWB 4USHA 1V5IB 1JLQA 3CJ0A 4PWDB 1QAXA 1XBWA 2IC3A 4LCFA 2VG5B 2ZDOA 4YDDB 1F9HA 1IQTA 4PAAA 4ZVQB 4OYXA 1Y9OA 1BQXA 4FWGA 5KG4A 2PD1A 1C4CA 2BA9A 3B8HA 3UN2A 3VHQA 4CTAB 3OJUA 5DO2A 1W2BR 1S16A 2IRUA 3NMAA 2O1TA 4YUDA 4DR4F 3B4DA 3PRDA 3CJRA 3T9ZA 3PW5A 1UCNA 4MK9A 5C24A 1NSAA 2B5JA 2CVEA 4WE1B 3KJQB 3Q6NA 3PR4A 2IIHA 1GMUA 2DGUA 4NZ0A 1LXJA 1FCAA 4KYZA 4OMFG 3P96A 5C0XF 3W64A 2BE9B 4W92B 2DR7A 3A8JA 4M8LA 3MM9B 2KO1A 4PWWA 2KN4A 2J0SD 1IJFB 3RW7A 1S1WA 4ZVPB 3UW1A 1VOMA 3TUZC 3G6VA 3IGVA 2CG4A 1UFWA 2J9CA 2GJ2A 2XHWA 3G6YA 2IESA 3PRYA 3W5YA 2GVDB 5HMYA 1HQ2A 4NLUA 1R31A 3KLGB 4QJVA 2NN6E 5HK4A 5EGYA 1HNZJ 4C2MA 3IMQJ 3EZUA 3BS9A 2PMZD 4R5PA 4ALZA 3CWVA 2F9DA 2ZC4A 2RF2A 3MM8B 4RU9A 2CAJA 4LRAA 4NLDA 2UU9J 2Q1LA 4PG4A 4BA1A 4E8UA 2DHGA 4IFYB 1EP4A 5HVFA 2JDJA 4IFDD 3CSKA 4USMA 1GH8A 1S4FA 3D54A 1R6MA 1Z0WA 4U6PA 2DVIA 4DSIA 2XMWA 1NJXA 4U96A 1KC8T 1J5EF 3AQPA 1BHNA 3J81C 1FNXH 3KWMA 3BM7A 5CABA 3FFIA 1RACB 2FD2A 5IWAE 5HBMB 4DUYI 1U1OA 1SIZA 3BO3A 2CPYA 2V4JA 1X4GA 4I3HA 4B9TA 2C1EB 4RNNA 2KM8B 1KVJA 1Q81T 5LL6d 4AXJA 3MOZA 1QSYA 5L8RC 1U48A 4PWUA 4UQGA 5JJBA 2LEBA 1Q79A 3NOCA 3AOCA 3SDEB 1JJCB 3NNCA 2R7SA 3BN7A 3M8WA 4I7FA 3KMQA 1KTVA 2IDEA 4ECWA 3VQTA 1PVGA 2E1AA 5F0UA 3K5NA 4B3SJ 5D0GA 3M2UA 2KB2A 1OQ3A 3GFZA 5I42B 4RUHA 2DH8A 2DHSA 4IZJA 1OO0B 4URSA 2JSXA 3MR7A 3OR2B 3DI6B 3KJVA 1VC5A 1IUJA 2MSTA 5A8RB 5KFQA 3D6TB 2B4OA 4K0KF 2Q66A 1RP5A 2VG7B 1YVFA 2ZHOA 4FW5A 3H5XA 2VV5A 4CT8A 1ZM2A 5F0WA 4DV6E 2YX7A 5JEAE 3T1HI 3WZ0A 4RX6A 1LW0B 3LP2A 1IBKE 2GAGC 4Y65A 3RUBL 3GTYX 4OHWA 4K4WA 1GTEA 4DUZJ 2R8IA 5KFOA 3KG0A 4QBUA 1FJ7A 3EPGA 3QATA 1IBCB 4F3QA 5SUHA 1DQ9A 3UHMA 3IS9A 3FEZA 2WVEA 3WHIA 2A2DA 3CMAS 2C37A 3PYEA 4NZ6A 1CJVB 1IBME 4WTYA 4DX5A 3M1VA 4F8RA 1HNWI 2FLOA 4LR7A 4P73A 4GKJF 2PFFB 4YR3A 4ZPAA 4ECTA 4FW9A 2F9JA 2WAQD 2HBQB 3MECA 4ZOSA 3IO1A 3L7UA 4CO0A 4A4JA 1NB7A 2W01A 1YZ7A 4ZK7M 3Q89A 3CCZA 1WKLA 2VIHA 5D4NA 3FCHA 3N9UC 2C3PA 1JJ4A 3T1YF 1TKZA 1NK0A 4RW8A 4JYAF 2RQ4A 2LU1A 3VGVA 4X62E 3RAQA 2QZ8A 2QLJB 3OFHA 4ZHRB 2CA9A 1T8EA 3SCLE 3OR1A 1UL3A 2LXUA 1Z2ZA 1DARA 4JI7F 2IVMA 1HQUA 1G3OA 3DLEB 3NEKA 3K5LA 1VJWA 4NOHA 3AXMA 3HHLB 4YY3F 2IVFB 2N3OA 2VDHA 3HFVA 2C2RA 4RLEA 5F8LA 2XWXA 4HI2A 3FKBA 2HGNA 3GWCA 4ES3A 1RT4A 3W2WB 1R89A 4DX7A 2HHHJ 5A6WA 3UDVA 5ETVA 4DR2E 2BVZA 2WP8A 3TUPA 2ATCB 5T7LA 3DRPB 4C97A 4DR3F 4BLGA 5FLXU 4LF4I 4LF9I 1S57A 3UPFA 4USIA 1LWEA 3NXZA 2ZBCA 3P45B 3MI7X 3R5DA 4X2BA 1AROP 2BJ7A 4LR8A 5KT7A 1F9FA 1FKAF 3AA8A 2FVRA 4LF7F 2DD8S 4LRBA 3FMBA 2AYBA 2NN6B 4P10A 4AIDA 3N5BA 4LFAI 2R2RA 3VGUA 1LEOA 4HHHA 4DZ6A 1K8AT 4U8VA 2Q6CA 1CC8A 4DV0J 2HVHA 2CVIA 2ZVIA 4C3KA 4GKKJ 3DRRA 3QAUA 3OUYA 2J6UA 2C2DA 4C4WA 3EVMA 5LMNI 1S72S 1KWMA 3OL8A 1A9NB 3B78A 4YB1P 1NH8A 4FW6A 4LT6A 5CCLA 2E5LF 1RTHB 2R2SA 1RISA 2J9EA 4ENOA 2MKKA 1R7IA 2CZ4A 3KJFB 1T0TV 1UEKA 1IJEB 4DV1F 1N6QA 1Y6ZA 4R1FA 3VAFA 5KFCA 3I9ZA 1JJ2R 2EVZA 4ANDA 2XB2D 4OJHA 2ALYB 3G8SA 4QQBA 3CC2S 3DDNA 3M9NB 4JI8F 4LSNB 5ETQA 3Q8QB 1HNIB 2VZ9A 2M8HA 3VZIA 4AFFA 3NGTA 3S01A 5K14B 2JOQA 2F4VF 1PG5B 4HR2A 1XMBA 4CLSA 1S1XB 4ZITA 1KRPA 4DV7J 1U6BA 4MYTA 1DQ8A 2VUGA 3OV7A 4FDFA 4EBDA 1RT2A 3M2VA 4OV1A 1HNWF 4DN9A 4NYZA 3E2EA 3K85A 3DCAA 1Z0BA 3JYTA 1KD1T 1H0HB 2HHUA 5CH7B 1EQ0A 1K1QA 2C3OA 1WACA 3GFHA 2E5GA 2YKNA 2DXEA 1TL1A 3DYAB 1T05A 1J5OA 1UWBA 3KK3B 2YQ1A 1MROA 4WFNQ 2VQFI 2DGSA 5IT9C 2W24A 4ZVOB 2FYXA 3GIJA 4KPYA 2R8GA 3LPSA 5EDWA 5DG7A 2W4DA 2RS8A 3SEOA 2EBEA 1HQEA 3L95X 1O6XA 1FRLA 1QE1B 2BE2B 3GSIA 3DLKA 5BJRA 2R8HA 5K36E 1RWOB 2WNRA 9RUBA 3M4XA 1IBLE 4LF8J 2R7VA 4USUA 2QSWA 4B3ME 2LEAA 4QWBA 1WC1A 1X4AA 4OKGA 5BXIA 1KEKA 2UXCE 1QTMA 1Q1KA 2DNPA 4LRCA 2VFVA 4QW8A 1WELA 2XTJP 3VV2B 2HAFA 3W65A 5H9FK 1VCTA 2WCXA 4DG1A 2EK6A 4WYLA 2E5HA 1L3KA 3P3GA 4Q44A 3SQGA 4JV0A 3PHEA 2PNZB 1N8RT 3CCES 2CNKB 3C8YA 4IKAA 2DHXA 2DISA 1QJHA 4JV2A 2F4FA 3TI0A 1BE4A 1HNXF 5DLFA 4X66E 4ZJLA 2QA1A 1F5AA 1IKVB 1FX2A 1XEZA 4YB6A 1X5TA 1JLFA 4O23A 1WUUA 3D7SB 3ZFVA 3OFGA 4ILMA 3BGRB 3W63A 1NSPA 3U1YA 1VRTB 2F65A 3Q24A 3L7PA 4K4SA 4P2XA 1NJZA 4JI0E 2R2TA 3IWNC 1Y11A 3D4JA 4XK8C 4Y2IA 2C2KB 4WK3A 4XDCA 2ADBA 5C42A 2FGOA 4NLPA 2RAQA 4DQRA 3PRBA 4X4UA 2C2NA 2Z5CA 5B09A 2ZZMA 1HMVB 1YG0A 2FHJD 1QD1A 1M5OC 5HQ8A 3R7BB 3HKMA 4DV2J 3A8IA 1M1GA 1UDSA 5DRQA 5KFLA 2HQGA 2GQ2A 1IKYB 2YKOA 3MHYA 5KFAA 1SB6A 2VQEF 1EETA 3CCQS 3HI9A 3DOLA 2XNQA 5D3GA 3G86A 4F2RA 4B3TF 2E7VA 4CLTA 3T9NA 2VU5A 1SKSA 1SVDA 5E3CA 1J27A 3U02A 4LSLA 4Q43A 3KLEB 4KQZA 5DLGA 1BQMA 1JLAB 3NGUA 2BBEA 4J9RA 3KDNA 2DB1A 2M3DA 2QSFA 3BPSP 2NXCA 4DN0A 3CDBA 3OTEA 1CULB 3PS3A 1AUDA 3NLCA 2HNDA 4DCOB 3HX9A 3U1LA 2XCPA 2V63A 2ZH2A 1ZA2B 3W7BA 2KFYA 2GQQA 2MQ8A 1ZXMA 5F8JA 4Y6IA 4CYUA 3A13A 3IRXA 1EI1A 1MMLA 1Q0NA 4KFBA 1UEVA 5HP1B 3BSAA 2MPUA 4LPFA 1KDNA 1X4HA 4NXNE 4JBCA 2D74B 1KP6A 2MQQA 2RSQA 2ASJA 4PU9A 1F0XA 3JSRA 4PCQA 2IMWP 1WTFA 4ECXA 2A2CA 4PG8A 3HHNB 3BGLA 2WBMA 2J7WA 4HYKA 5DQIA 3D0GE 5IWAI 2JFDA 3I56S 3QGIA 2RUSA 5H9EJ 1UAWA 4DQQA 2KDOA 3M9OB 5KG0A 2JLFA 4P71A 1VQ9S 4B3RF 4LIWA 1HNZF 1D9FA 3QJLA 1T11A 2IM1A 2UU9F 1S79A 3HVTA 3CO0P 2OUGA 1FK9B 5M2PA 1R6LA 3NRBA 1RT5B 3FEYB 2QG9B 4R8UA 4NA3A 4IO9Q 4OYPA 1T9XA 1MU2B 4BCAA 1ZM4A 2V8GA 4ED8A 2J7KA 1HBUA 5KFVA 2FVPA 2YWKA 2BXJA 3G8QA 4QPTA 2BUNA 4ETZA 1W25A 1X9MA 2JC0A 1N32E 4MU4A 3OT9A 3BH6B 3LALA 1D6TA 4O3QA 3A3NB 5L46A 1KLMB 1JWWA 1PJ6A 3PJ9A 2LJPA 1JKHB 5J2PA 1BUXA 1W7WA 4DV6I 3HDSA 2DGWA 3I9V9 1IBKI 1YBTA 1BWEA 2R42A 4ZLJA 3RBXA 3C15A 1F5BA 3TJAA 1WOPA 2ZNZA 5A2QY 2KRBA 1XXEA 2H48B 2WBRA 1WD6A 2FHOB 3IBFB 3R3TA 3OVSA 2HLUA 2R7XA 2A18A 4G1IA 4C0BA 2MY8A 3NP5A 3F44A 3CJKA 3LGNA 3SYZA 1RWKB 2CQBA 5CCMA 5HN0A 3I0RB 4K4ZA 1RT1B 1KNZA 5ETNA 3CJ2A 1IBMI 3KXDA 1T03B 4B3SF 3THVA 1SUQA 2CJ9A 1DTTA 1DURA 4C7QA 3C66A 3PR5B 2GGPB 3VGSA 5DRRA 2M9KA 1YJUA 1C1CA 2WVCA 2HEKA 4B9VA 1ROFA 5EX0A 1FXRA 5DNLA 4WE1A 1TR0A 2EC0A 4W98A 3VAIA 1SKUB 3JXOA 5K8NA 1U45A 3UN3A 4HACA 5THWA 2HQ3A 1TL3B 3NMRA 2LVWA 1FJGE 2HMIA 4DUZF 3DLHA 3TX0A 1GQEA 3GJRB 3RRHA 4X62I 3PKYA 1WHXA 4FVCA 4GO5X 4UW2A 1G7CB 1KKHA 4OFZA 4CNYA 3BKUA 3DMJB 4UUXA 1WOSA 3HHDA 1URNA 2HBYB 1F3FA 3E01B 3KLGA 1Z4UA 1BKNA 2GZOA 2IBOA 2DRAA 3CJ4A 2QJ3A 3MM8A 3W61A 2POKA 1JB0C 4ED7A 1HWLA 3W9HA 1U1QA 3V6DA 4IFYA 2Z30B 1U1LA 1U25A 1N0UA 3SQOP 4FW7A 3EVWA 4WF9Q 3GG0A 2B3TB 3IRWP 4MDTA 3IBCB 1C0UA 4DL3A 1RAAB 3Q23A 2ZKUA 3IFEA 4JI2E 1KONA 1IKXB 2CPXA 1XJWB 2UUAJ 4DR2I 2YWEA 4USTA 4O0NA 3GP9A 4P2FA 3C16B 4UT4A 2DNKA 2MKSA 3GV7B 4I2QA 1PILA 1KOHA 4ATNA 2IM3A 5KFSA 1VQSA 3DOKB 3EPIA 1GX6A 4KHPE 5FLXQ 4RBVA 1S4EA 5BYSA 2X3DA 4OX8A 2HFUA 4OL8A 1IR2A 2E9ZA 4ZIWA 2XI2A 1TL5A 2V50A 2HQIA 1NK5A 3C19A 1YWXA 3OFFA 3EICA 4I6WA 3OD2A 1OY9A 2M2BA 2V0NA 2XMVA 3SDEA 1XNRJ 2OAUA 1S1TA 4KGKA 3SCKE 3J7Z5 3D66A 2ROGA 4CLWA 3G8TA 3LF0A 3RU0A 4ZPDA 2UVUA 1HLWA 2YNIB 4PXCA 5DQGA 2WB4A 3V4IA 2ZJPQ 1H7UA 2HHHF 2E9TA 4NXME 5DG9A 3QT6A 3DI6A 4JV5E 1RKIA 2EFNA 4DEZA 4A8SA 4GMKA 5A8RA 1CQNA 4I2PB 1X5SA 2MZSA 2ROPA 1KHVA 4ZP6A 5A2QC 4DFJA 2C3MA 2XG8A 2WSFC 3QLHB 4FYWB 5LT5A 3IGNA 5B0DA 2HQCA 3KOAA 2HHPA 1U0HA 4FWDA 2ZM6E 1SC1B 2ABYA 2CFXA 3LO3A 1NJWA 5KFZA 3BV8A 2JT2A 1FJGJ 2BANB 2HSEB 1FVSA 5KG1A 5J1PA 2KT2A 2R4FA 4X4OA 2ZJQQ 2IM2A 2YWWA 3R7NB 2DIUA 5E3QA 2PIIA 3MD1A 2XGQA 2ZD1B 4X4NA 4DV0F 4LF6J 1HR0J 5D4OA 3X3UA 1CJVA 4GKKF 1SC4B 1N0VC 4R25A 4O44B 1HW8A 1MLAA 4X64E 1U6ZA 2AZ3A 4ZPVR 4Q8FA 2Y1IA 2BOPA 2YWHA 3CJ5A 3MPYA 1YJTA 3LH2S 3CJSA 4DJBA 4WUBA 1NJYA 2YWGA 3HFKA 4F4XA 4ECYA 4OO1F 4LQ9A 1VBZA 2W7OA 1BY9A 2B7CB 2GNKA 2XS5A 4JI3E 1YSJA 4URGA 2F7VA 1H2TZ 2JVRA 3TEGA 3KG4A 4DDFA 4N8NA 3C6UA 4M5IA 1FDNA 2HS4A 2Q3PA 1UP1A 2FVSA 1YRUA 3LP1A 2EWHA 3AAWB 5IC4B 3QFHA 1F3VA 1U26A 1Y5LB 1U8WA 4DF8A 1A0OB 1FO1A 4DR5J 1M5SA 4P7AA 3CO9A 2VKZG 4C48A 4DV7F 3D1OA 3G82A 2G0CA 3JTNA 1IBLI 4WIIA 1S6PA 5KFTA 3QO9B 3KKFA 1UA0A 4B3MI 3GJTB 5EHHA 2SXLA 3EGNA 3DLEA 2CPEA 2UXCI 2H5IB 2W2NP 3JSYA 3BJYA 4FN5A 2BQRA 1VISA 5DZ7A 1SH2A 1K1SA 4RW7A 5KFGA 1RAOA 2XQCA 1M1HA 2Y1RI 3CCTA 3JQKA 2ZWPA 1UVNA 3MR2A 1XHKA 1VQKS 3QBCA 4ZKAA 4AQYE 1X31C 2OIHA 3NG8A 4ZJOA 2BA0D 2DGXA 2HYIB 4JV5J 4JI6E 2H51B 2I0XA 3AOAA 1TKTB 3JSBA 4OX9J 1GTHA 2VOOA 3G87A 1B7YB 4X66I 4NCBA 1ZBTA 3QIPB 4CRJA 4OI1A 3TVKA 3DOMB 5DDRC 1O5JA 2MZTA 1KQKA 2ZJRQ 4PQUA 1TV6B 2QMUB 4I67A 5A8KA 3UR0A 1LV5A 2F1DA 1J2VA 3CJTA 4RNHA 2NN6A 4LF8F 2B4VA 4JI0I 2MMYA 2BQ3A 1HBMA 2MKCA 1NSQA 3KLHA 1X4EA 4KV8B 3KK2B 4DR7E 3FRZA 4PG5A 2BQUA 4C98A 2J7UA 1HHSA 3HM9A 3I96A 4S0MA 3OQ2A 3HHLD 4HYMA 2XSJB 2KVIA 2UXBE 4EFAC 3EVOA 2HLTA 5IOLA 2R7QA 2GHPA 2HPUA 4OHVA 3LUYA 5C0XD 1OJ4A 4HH1A 1U8SA 4GC7A 1TZ0A 1VLYA 4P75A 1EKSA 2NSBA 2OPPA 4LF5F 1M0SA 2UUCJ 4X4QA 1H2VZ 3Q8VA 3Q2TC 1XMOE 3DXBA 4J9KA 2D3ZA 3H2UB 1FJCA 2YQ3A 4FYDA 2ZUAA 3NOGA 5HMWA 2GJFA 2XCAA 1Q7YT 3TJ9A 1AT1B 4JI4J 1UJ5A 3SSRA 1HD1A 2HNYB 3ZTSA 3DRSA 3CC4S 2E7XA 2WRMA 2MJUA 4NLRA 3UDEA 1VFJA 4RNFA 2W9AA 3HF5A 4IFDB 3Q6MA 1UJ4A 2Y9HA 3FEXB 1LW2A 4I64A 2AW0A 3BSNA 4DV2F 4IH7A 2QFIA 4YMEA 2ZH3A 4NXNI 1SC3B 1X7VA 3NKYA 1H6KX 1FNMA 2OPRB 3NBPB 1S9EB 2J8SA 5C25A 4N77A 5KOWA 1U1PA 1RREA 1U2FA 2MB0B 4K4VA 4LFBJ 3MEDB 4CQ1A 1YRTA 4MMOA 5G0RA 3DYAA 1E3HA 1NSKL 1BWVA 5GAEU 3PIPQ 4RO0A 1FX4A 2XBPA 4CO4A 3J81U 3QWPA 5HQLA 4M5JA 2KM8C 1DFDA 2VL1A 4URLA 4JI5E 3OTDA 1DJ0A 2QN6B 1QE1A 1RT3B 2WTFA 3MMAB 4MKAA 3PTWA 2J9DE 4EZ9A 4O3RA 5RUBA 3MPVA 3BO4A 4OV6A 2MHEA 3M2RA 2UP1A 2J8AA 2C22A 4BS2A 2RKIB 1N32I 2FC9A 1RSCA 4WFYA 2ZHAA 4LBPA 4DR7J 4DL6A 1VQ8S 5CAAA 2AT1B 3OHAA 7FDRA 4NLWA 2Z56B 4DBQA 4P2MA 3D5MA 3RBDA 4WXWA 1KQGB 4OYWA 2LCWA 4ED0A 2B8QA 3MM7B 1SKRA 1RBAA 2AMCB 2H1YA 5IM0A 3QZ8A 5DM6Q 4OZNA 3V81B 2OD6A 1B3TA 4IH6A 4WXOA 2NZ4A 1K73T 1X0PA 2JVOA 3OW2R 3HD2A 2AGOA 5F3ZA 4OYOA 3H42A 4QWDA 2KH9A 2OPSB 3FQKA 4E98A 4H4MB 3DU6A 1XNQE 1SCJB 2FJVA 3LAKA 2DCUB 4FF3A 2CIMA 3BGRA 4CLUA 1ZA1B 3HHKA 5EUHA 1TK8A 4DSKA 1RA7A 2JHEA 3B6BA 3ETOA 3DDIA 4B08A 1VJQA 1WF1A 4B9LA 1OY6A 2F8EX 5AXKA 1HI8A 1H98A 2AF6A 1YBAA 5BR8E 4ZN1A 1LK7A 1T94A 1TKXA 3GYGA 3UQSA 2MKHA 2Z4PA 1HMVA 2ZITA 5JVGQ 2R7WA 1RZMA 3S8SA 1Z5AA 2KHDA 2WVFA 4CO5A 3M7ND 1U0SA 2H5EA 3UI3A 1KOOA 1IKYA 1I1GA 1CJTA 4ZCKA 4CH1A 3PS2A 3ZZTA 4IOBA 1HYSA 1KSPA 4U8YA 4F4AA 1FJGI 2FC8A 4XO0A 4G1PA 2QYCA 2PEBA 2VFRA 2MKJA 2D9OA 2L9WA 1RT6B 1FWKA 4DL2A 4Q0BB 1JLAA 4CH7A 2BRLA 4OI0A 2OO4A 3CPWR 2E1RA 1CULA 1GEHA 4RW4B 1U24A 4HXZA 1JIHA 2HHSA 2GO4A 4CZCA 4WJBA 1Y0HA 1SV5B 1N36J 3MMBA 3MM5B 4OI4A 1SJQA 4OJ3A 2MLYA 3LPEA 5ETSA 4QIVA 2PO1B 3HHLC 2XY5A 3OVBA 1E6YA 5HP1A 5CYMB 3DU5A 5K5MA 6FD1A 3C3LA 1U2CA 4OQJA 4JI2I 4U3BA 2M7SA 2PO4A 4WUDA 4YB5A 1SL1A 2AIRB 3RRGA 1A6FA 4A8QA 1NZAA 1ULRA 1UDOA 5AE1A 1RAHB 4ICLB 4WFBQ 1SH0A 3LP0A 4C11B 2UV8G 1YHCA 1RB0A 1FKPA 3MFHA 3JS9A 4KHPI 5LXRA 2OHDA 2LA6A 5SZTA 4WP3A 1IR1A 4EUVA 2V68A 3SCJE 2G0IA 3T1AA 2HHQA 3SCIE 4FBUA 1AFIA 5HMZA 2NN6C 4H4OA 4OZ5A 4M5DB 2P9EA 5FIIA 1S10A 1D0EA 5EWEA 1EARA 4DSLA 1WSVA 2RJZA 1RT5A 3IWLA 2OPQA 3FQLA 1OY8A 4EO6A 3R5AA 1L3TA 2KXNB 1WEZA 2EEYA 4N5SA 2O3DA 2V2VA 5ITHA 1L3VA 3MEGA 1RHRB 2UUAF 4JV5I 5ETKA 2X1FA 1UZDA 3V4MA 1NHKL 1S0MA 3NAIA 2CPIA 4YHHJ 2PA3A 1R0AA 1VBKA 2B4UA 4HI1A 4L76A 4EU0A 3J80U 3FCVA 2JNJA 4OIXA 1EB0A 3DLJA 3DRYA 4R0JA 5FWKA 2ZM6I 4G1QA 4H54A 2PI5A 4HDGA 1UA1A 4DV4J 5IT4A 3AJ1A 4K7QA 3TUIC 4NL5A 1CS4B 3ZNJ1 3M32B 3NGDA 2DGOA 5LJ3Y 1VYAA 2DNGA 4CP5A 5LMUE 1BQNA 1S48A 3NCQA 3M9MB 5HO4A 1XNRF 3ENAA 5K36A 3P4UB 3L7ZB 2HVIA 3MCMA 2GO9A 3GIKA 2RD5C 3ISNC 2EFOA 3BEGB 1WC0A 4JG4A 4NRTA 2CGEA 4X64I 1RWPB 3QFWA 3NGSA 2GIRA 4DWIA 4PXDA 2W8LA 3N4WA 1I94E 1CLFA 2KKHA 5FDLB 2Z8QA 1L3UA 4D3GA 2OLWA 3ENWA 3D6HB 3M6UA 1B7FA 4O3NA 4JI3I 4FNHA 3BBCA 3HKZD 5KT5A 3KUGA 3CDJA 4CIOA 5G4DA 2EK1A 3HXMA 2JWNA 4B3OA 3OFEA 1TL7B 1OYRA 1YITS 1OSDA 1DTQB 2NLWA 5KFBA 2G9OA 2E5JA 3MAQA 1B70B 3TA0A 2VBWA 3MTJA 1S9FA 3PCOB 3RG6A 2VA3A 2GJIA 4LF6F 1HR0F 4NLXA 4DQPA 3RGIA 3PXGa 1NHVA 2XNRA 3TR5A 2H4YB 1WG1A 4ECSA 1N5VA 4BC9A 1KVIA 1ZS6A 2BW7A 3DGPA 5KTQA 1CC7A 2C42A 2C38A 3B82A 1VMBA 1RR9A 2XLJA 2DKOB 1S9GB 4USJC 1JK9B 1IKXA 4HTIA 5GVQA 2WONB 2YPZA 4AQYI 3CJQA 3CTRA 2RE1A 3N0VA 5J1EB 2ZH4A 5GAGI 4P7VA 4JI6I 5M2RA 1HK7A 4X65E 2HZAA 1HL6A 5L38A 4MKVA 2W2PP 3R6LB 3VR1A 4ZVFA 4DUYJ 1URRA 1TELA 4K8RA 3CMES 2QA2A 4DR5F 1N54B 1S12A 4CWBA 3Q0AA 4KR0B 3BBFA 5CD4A 4C8MA 5KFXA 4DS5A 4IQMA 3ET6B 5CYJA 2BOAA 2YNGB 3D1HA 2GFFA 3J7ZT 2MQPA 5AT1B 4DR7I 5B0CA 4DU8A 1WNEA 3G2XA 1M90T 2W8KA 4WP8A 1HBNB 3ADAC 1VBXA 4ITSA 2UXBI 2ASDA 1WC4A 3M8QB 2DEIA 1HFEL 2PGCA 2NXNA 3Q1QA 4I2PA 2JEIA 1DAXA 4JV5F 1S6QB 1VQ6S 4KB7A 1YDLA 4PUOA 1I94J 4OX9F 1MNEA 3DGVA 3QLHA 2NSCA 1IN0A 1EIYB 3DLLQ 1UVMA 4HLBA 4DCPB 3AD7C 2QV6A 3MUVP 2KG1A 4QIWD 1XMOI 2YNFA 3T1HJ 4KE5A 2R8KA 4UOHA 4N56A 2DITA 3IC1A 3H5SA 4NLTA 2OFHX 5IC6B 1VQOS 1TUVA 1X4DA 3R1LA 1WF0A 2P9GA 2RS2A 1U49A 1C2PA 2OTLS 4ECZA 3RYLA 3OTOE 2QFJA 5EN1A 5KFPA 4DR6F 1JLEA 3BDEA 1K9MT 3JTPA 5IT0A 1Q8IA 1H38A 2DTJA 2N7YA 2KYZA 5EL9A 2JEBA 3ONQA 1PCAA 1IR0A 3F56A 2W9CA 1UMJA 1N48A 3QT7A 1S7IA 5E0OA 2HHTA 3UDLA 3AJ2A 2BM0A 3I4HX 2KT3A 4KKOA 3F41A 2QC3A 4OZ3A 3KMSA 4U67Q 4JI1E 3LGHA 2G2YA 4ZVIA 3H7HB 1VC0A 1EKRA 5A0YA 3O3LA 3I5AA 2UUCF 4EEYA 4DV5E 5J1NA 2D9PA 2VDIA 2YQ0A 2RIJA 1KQFB 3EGZA 2BX6A 3HJVA 2V8PA 1UVLA 1JLBB 2UZAA 3M8PA 4CDIA 1VIXA 5HQMA 2CWKA 1S99A 4JI4F 4JI5I 2ILYA 2LQ8A 3CVKA 5E5NA 1N4LA 1NHUA 2B51A 2ASYA 2VPXB 4BC7A 2BRKA 2AGPA 3NGRA 3QO9A 3UNGC 2B9WA 1SJ4P 3NS5A 2NUHA 3D2WA 1YJNS 5BYRA 4IDKA 1FNOA 2DR8A 4LFCE 4J9VA 4CLPA 4LFBF 2BM1A 3Q86A 2XMJA 1C1BA 2CPZA 5JVHQ 4YQWA 3HLUA 2K1RA 5CXTA 4WKYA 2UUBE 2PE8A 2L41A 4DSEA 2JEGA 1NO8A 4I69A 2ILZA 4EBCA 3FCWA 1EX8A 1MWYA 2IVYA 1RE1B 2YXLA 4LF4J 1XMQE 4LF9J 2KHCA 3FNNA 1V3SA 1AYEA 2CNLB 2P9CA 4C3MA 1N33E 6FDRA 3ZXWA 1XNQI 3BYRA 1Z5BA 3HSZA 1DRZA 3CNQP 5A2QQ 4MAKA 1SL0A 3AOBA 1D9AA 2MGZA 4TY8B 2G1HA 4C8ZA 2V4QA 3IXQA 2VOPA 1M5PC 3PVXA 3QMQA 5IV3A 5KG2A 4LFAJ 1NAQA 1JLCB 1D1UA 4KV8A 3KK2A 5LL6R 3OTOJ 5BR8I 1V3ZA 1Y00A 4DR7F 4GVLA 1MN7A 1VHFA 5ETOA 5FLXC 4OZEA 2AJ4A 4ILLA 4MU0A 1SQGA 5CHCB 4ZLPA 1T7PA 3FUYA 2ROEA 5LMNJ 4KRWA 3QGPA 4NCGB 4Q2LA 5I3UB 2DK2A 3ZKDA 2IOQA 1NHJA 3UD4P 2H65B 5DRPA 3JB9k 3QRQA 4QR2A 2ZBPA 5T14A 5I3QA 2O3ZA 5DRKA 2YPYA 3SFUA 3MCSA 1PAUB 1JLQB 3D9BA 4DV5J 1WI6A 3HP6A 3PDNA 1GMWD 1YRXA 1ZETA 2O67A 1NK8A 4DR1J 3QYYA 4WKRA 3CD0A 1RA6A 2HS3A 2AV5A 1VDHA 5KFIA 4UOFA 3SSSA 4IFDA 5HLFA 4NLYA 4ZMMA 2HHXA 1I51B 5C24B 2LXIA 2B5JB 3H4LA 2B6AA 3KNGA 1JLGA 2PO2A 2O1WA 2BDPA 4P74A 3FBBA 2AYMA 1LWXA 1KBRA 4PG6A 3P06A 4MFBA 1S1UA 2VH7A 1S9EA 3PO5A 3N01A 1JQGA 1CJUA 1Y3KA 3A1YG 4QWEA 2HGMA 4L75A 5GADI 2JLGA 1FHTA 5KFEA 1S1WB 3GLJA 1KQSR 1S7HA 1HI0P 4LFCJ 1IKWB 4Y00A 4IG0B 2V6AA 1TK5A 1PKPA 3Q22A 1Y60A 4FXWA 1TVRA 1WWHA 4WFZA 3O6QA 4CO2A 4DLEA 4QIGA 2VQFJ 3B4TA 3W9IA 1TUWA 3CT9A 5J2QB 2UVRA 3FSXA 2WB1D 3TZWA 3QPIA 3KNAA 4QU7A 2RF2B 1N36F 5KFKA 1Z0EA 3X1LB 1N33J 4Y2KA 1ZAXA 1EP4B 1ZPWX 2F3JA 3FBCA 2J65A 3J7AG 3O44A 1WKKA 3POTB 5CZVA 4HDHA 1DY3A 2BEFA 4QIFA 3VAMA 4K4TA 1ZYQA 1OSCA 2MQNA 3TVZA 2ZH5A 3FBFA 2UV8A 1J5EE 1AB8A 1U4BA 4A47A 4HHJA 4PR6A 4RWXA 3FFIB 3DLGA 2CQ0A 1QVFR 1F5CA 2G4BA 2DNHA 2RT3A 2V4JB 4QPXA 4TLRA 3MM7A 4F02A 3MEKA 4B9UA 5JEAD 4P9SA 4PKDB 3J80Q 2EFPA 1NDPA 2XSFA 2YBVA 3NGKA 1BLUA 4IRKA 2LMIA 5LMUI 4H4MA 3OL6A 1NRKA 3AHPA 4I4BA 3TEHB 1N5TA 2RILA 4A8KA 2DJWA 4TQSA 3M8SA 4DV3F 2DT9A 3M2UB 3GG1A 2WW8A 5K8PA 2BA1D 2KYXA 4OJGA 2PMHA 2B43A 4RW6A 4J90A 3MMJA 2CQ4A 1MMDA 3KJVB 4J9LA 1LXNA 1U1KA 2IA6A 4K0KE 1I94I 2I5JA 4CLKA 4YHHF 4U7CA 1P1LA 5IXUA 2IJFA 4OO1D 3CCRS 2FJWA 2DRDA 5D0HA 4PYDA 2PO0A 3N28A 3P6YC 2RQCA 2N82B 3I5BA 2OSRA 4OYIA 4DV4F 3UCGA 3RB3A 1UW9A 5AXNA 3VAKA 4NWBA 2M4MA 4Z7CA 4CLZA 1C0TA 2KU7A 4LVNP 1I5OB 4E0DA 4Q0BA 3BKTA 3IS9B 4IUFA 2MZRA 2KG0A 3ICLA 1F1BB 3M8YA 5D15A 3UE2A 2J0XA 2XZWA 3K0JA 2CJBA 3BQ2A 1X4BA 3CIZA 1ELOA 2QTWA 4KQVA 2RQMA 3GZ7A 3KLFA 7AT1B 4GKJE 2FVCA 1SV5A 5HSPA 3LTOA 2VONA 1B4SA 4DCJB 2A6MA 3J7YI 2IERA 2ZOGA 2LEPA 1BXNA 4ZVGA 1ZZFA 2X1GA 3K57A 3MECB 2DR6A 2PO1A 4LIRA 5ETTA 4ED1A 3CIMA 1MW7A 3MR5A 3EXCX 1KFSA 1PYTA 3ULHA 2NZCA 1FKOA 2IBKA 2HHWA 3R9LA 5CZXA 2UUWA 4DZDA 4C8KA 4K2JA 1PO6A 3P76A 2APOA 2HNZA 2EBGA 4J9QA 3T1YE 2J6TA 4X65I 2AEFA 2GW8A 3RW6A 4JYAE 1UVKA 4NCAA 5K8MA 4RW8B 3VQSA 3ZZUA 1B62A 3UNYA 1FDBA 5IWAJ 3WU3A 5CYQB 1IXKA 4C8NA 1JNRB 3WX8A 2BJ8A 4UY8T 3JAMY 3ILJA 3N5FA 2E66A 2BJDA 2FLPA 3R27A 4ZCIA 2YY3A 1RTIA 3D6MB 2AHOB 3OR1B 1SJ1A 5EWFA 4JI7E 3CDAA 2QA4S 1HQUB 3MCOA 4WPAA 3LNUA 2ACYA 4YY3E 1FA0A 1FTCA 4NI2A 2R7RA 3M30A 2E1CA 2M5YA 1NM2A 2V2QA 1RHUB 2E7WA 4NZ7A 2A0FB 5AXMA 1VC6A 1V6HA 1Q95G 3P3CA 4OYZA 1FF2A 5C0XB 4WFXA 2Q43A 2I2YA 4IG3A 2WP8B 3GB0A 1FXDA 2GQCA 4DR3E 3MAHA 4OZ0A 2JE6B 1Q4RA 1AW0A 2XY7A 4Z2XA 1LWEB 4NYOA 5KFJA 1NK7A 4E2FB 1JX4A 2VPYB 4DUYF 4QNKA 4DV6J 2OELA 1FKAE 2CJKA 4NEYA 4LOMA 4LF7E 1IBKJ 4J5OA 4IFVA 2YX1A 1R0BG 3CUNA 1UFLA 2IM0A 4QWAA 4QR0A 3O8WA 5ETRA 1XTZA 1PYOB 3Q2SC 2HFSA 1N5QA 1EA6A 3ZZZA 3OTOI 4HTJA 4OI6A 3PW0A 3K8WA 4DPXA 3CWJA 2J9DA 4MK7A 3HFZB 3ITHB 1SBRA 2PN6A 1QVGR 5KFHA 4IFDC 1LQ9A 3F0NA 3DRRB 3OUYB 1RKJA 3WQPA 1VI7A 1IBMJ 3TW0A 2QGFB 2E5LE 2RRNA 2HRYA 3K17A 4OI2A 5HMXA 5GAHI 4ZVEA 3RAMA 5HROB 3PV8A 3HK2A 4JI1I 3M6WA 1HKAA 1Z0VA 1S6UA 3OBIA 5FDLA 3UN5A 2FTRA 4DV1E 3VALA 2YX4A 1N6QB 4FPRA 4F04B 3GFXA 4DV5I 2XO7A 1XN9A 4UOGA 4OZLA 3T1HF 1RYSA 4NLQA 3AY0A 2HVZA 2FB0A 5LXYA 4A8XA 3AT1B 2H54B 3T1YJ 2PEHA 4CLFA 3W5XA 3ILLA 1TL7A 3CEDA 4JI8E 4DR1I 4WWSA 5KFNA 3CCUS 2XYGB 4PQAA 2F4VE 2IOPA 4X62J 2XZTB 2VA2A 4N47A 1NDLA 4LR9A 2RB7A 2ZH1A 1Y4UA 2A3JA 3R5BA 5K36D 3GE9A 2B4PA 4AD6A 3D28A 3M2VB 2AU0A 3PW4A 2YNHA 1LWCA 1QLNA 1UVJA 4XPCA 2J0QD 3JYTB 4F7VA 5A8WA 4ZJQA 1EQMA 5L1KA 1DQAA 1FFWB 2HAIA 2B9XA 4DFMA 3L4BC 1U7LA 4LFCI 5H9EK 2IYIA 1YKWA 2YKNB 1YJWS 3A8EA 2FZKB 3LA0A 1TL1B 3BQ1A 4U3DA 1T05B 1J5OB 1UWBB 4O4GA 4U7UK 2UUBI 1IWGA 4NMLA 4DR2J 2AQ4A 4J9UE 2OP5A 4U7UD 1UFKA 2N4DA 2OEJA 3T6JA 4AT1B 2J0WA 1XK8A 4AE5A 3MD3A 1XMQI 5DJBA 2VBYA 3CD5A 3TP2A 4PXBA 2O1PA 2FJBB 1N33I 3DLKB 3I4PA 2ZOFA 3GMEA 4RKUC 1WOOA 2AEMA 4PRXA 3UR3C 4F36A 1GMVA 4OLOA 3VWSA 4RPFA 3CCJS 1AA1B 3ET6A 5AE2A 2FLLA 2HZCA 2VHGA 3Q8YA 4ID5A 3A4TA 1EHWA 4JOUA 1X4CA 4HY1A 3N79A 8AT1B 2D41A 4C6AA 2NPIA 5E33A 3CF5Q 4LJMA 4ZA1A 5DNXA 1HBNA 4DG1B 7FD1A 2KFZA 3ZO7A 2O01C 3ZTPA 4OZ1A 3TAMB 4MIBA 4QZVB 4DUTA 4EK2A 1QAYA 4QCLA 1X0FA 4OYAA 3ZZPA 2AJFE 1WF2A 2HKEA 2D1CA 4M5NA 1X5PA 1HNXE 2VICA 4TVAB 4CO3A 2GAHC 2YVSA 1JXLA 1RTZA 1MN9A 2V2KA 2W9BB 1WJ9A 1GT8A 3QJJA 4LF4F 2OSQA 4UTGA 4LF9F 1QUVA 1U47A 1RAJA 1WEYA 2IY5B 1JLFB 2WOMA 3EZOA 2RNEA 5F9NA 3RBZA 5E3AA 5B0GA 1G1XA 4PZVA 3QQCD 2QIFA 5C7PA 1PBUA 1B0VA 3TO8A 1Y4SA 5A76A 3MPUB 4A46A 5M2UA 4LMZA 2DCLA 3MDFA 2CQGA 3VCDA 2DR5A 4ELTA 4MKBA 2AEJA 2E29A 4LFAF 1V9OA 1S77D 3W62A 5C42B 1DLOA 1P9QC 2BR2A 1HBOB 3GSDA 4DXLA 4ZPBA 2HQFA 1QAJA 4ZVRB 2FGCA 2ZFHA 5LMNF 2VQEE 2QLXA 2VB6A 1EETB 4MJKA 4Q5VA 2DY9A 3P3EA 3DOLB 4CLLA 4D3HA 5D3GB 2CJXB 4B3TE 1E6VB 5LSLA 2XC9A 2CPHA 2DGTA 3IWXA 3IP0A 5DGAA 4G3IA 1BQMB 1NK9A 3PHTA 2P5VA 2Y3YA 2DNZA 1RTDA 1CQMA 3UVJA 2HNDB 3IAS9 2JRSA 4M5MA 1PC4A 4KBIA 2OJ3A 3WIUA 4DR1F 3C14A 2NXEA 1VBYA 1NHHA 3OPKA 1ITPA 1RU1A 1B0PA 1VHIA 3P5BP 2AX1A 3NAHA 4CYUB 4FS1A 4WZQA 4F25A 3R5GA 1USUA 3HHEA 1ZXNA 4TY9A 4KFBB 4J9PA 4DU7A 2PFDA 2XLKA 5KFMA 3W2VA 1IBLJ 1WG4A 3OL9A 4KGMA 3GCMA 4GVBB 3SBMA 4KIAA 2M8DB 4B3MJ
chains in the Genus database with same CATH topology
3F0NA 3PYGA 1J5EI 4JI0E 1N0UA 4DV0I 3V5RA 1HNZI 1Z0EA 3D4JA 4YHHE 4GKKI 4FWHA 1OJ4A 4KHPI 4DPUA 2E5LE 4JI2E 2UU9I 3PYDA 3JAMC 3K17A 2Z5CA 1DARA 3J7AG 4DR2I 3OTOE 4JI1I 1Z0VA 4JI8I 4DV4E 4LFBE 4ED4A 4XTJA 4N3OA 4DV1E 4B3RE 1XMOE 4UT4A 2F4VI 1J5EE 4DV0E 2HKJA 1U2RA 1H72C 1HNZE 4FWGA 1Z5CA 3QT7A 4GKKE 3B8HA 4DV5I 4KHPE 2R3VA 1S16A 5FLXQ 2BM0A 2O1TA 1S4EA 2UU9E 4LF6I 1MG7A 1HR0I 2HFUA 4DR2E 4USKA 1ZM9A 4JI1E 4JI8E 4DR1I 3Q6NA 2V2VA 3Q6MA 2OI2A 3QT8A 4ZVIA 2UXDI 4LF4I 4LF9I 2F4VE 3J80Q 2IOPA 4JV5I 5IT9Q 4IZJD 4DV5E 4NXNI 1Y4UA 4M1KA 2NPFA 5LMUI 2V2ZA 4LF6E 1HR0E 1FNMA 4DV7I 4K0KI 2V8PA 1H73A 1FI4A 1ZXMA 5FWKA 2ZM6I 1H7UA 4JI5I 1RREA 2Z5EA 2UXDE 1EI1A 4LF4E 4LFAI 4NXME 4LF9E 3ZZ0A 1Z0TA 3QT6A 4JV5E 3PRYA 1NZ0A 2GQ0A 2EFGA 1QZRA 3ZM7A 2O1VA 4B3SI 4LFCI 4NXNE 5A2QC 5LMUE 1Z0GA 3CWVA 4DV7E 2X7IA 4PU9A 4K0KE 3GONA 1I94I 1KVKA 2Z5BB 5L3JA 2UUBI 5LMNI 2A2CA 4FWDA 4DR5I 2ZM6E 4URLA 3B78A 4JI5E 5IWAI 4LFAE 1ZM3A 4JG4A 2CGEA 4X64I 4USMA 1XMQI 4DR4I 4B3SE 1UEKA 4LFCE 2VF3A 1Z0WA 2Z5CB 2BM1A 1N33I 4GKJI 1I94E 1Y6ZA 3J81C 4DUZI 4Z7CA 2UUBE 4PRXA 4R1FA 5LMNE 1FWLA 4DR5E 4RPFA 1N32I 1N0VC 5IWAE 2PNMA 4Z7YA 4DUYI 1PIEA 4JI3I 4X64E 4LF8I 5GMDA 1XMQE 4DR4E 1HNXI 1N34I 1USVA 2BV3A 1ELOA 4I3HA 4HY1A 4KQVA 1N33E 4HACB 1XNQI 4WUBA 1ZM4A 1Z5BA 3ZKBA 4GKJE 2J7KA 5A2QQ 2CG9A 4DUZE 4OX9I 3LTOA 3T1YI 3K1JA 4MYTA 4P52A 1N32E 4JYAI 4DUYE 3M6AA 2ZBKB 4JI3E 2O1UA 1D6TA 4PRVA 4LF8E 3JAMQ 4DR1E 1MX0A 1KTVA 2HKEA 1K47A 1N36I 1HNXE 2LJPA 5LL6R 3K85A 5BR8I 1N34E 1Z0BA 1NHIA 1PVGA 1XNQE 4DV6I 5FLXC 2HK3A 3V2UC 4UTGA 4DPTA 1Z0CA 2AJ4A 1IBKI 4OX9E 2R42A 1H7SA 1Z59A 4IZKA 3T1YE 4IZJA 4X65I 4JI7I 4LF5I 3J7AM 3PYFA 4WUCA 4DR6I 4JYAE 3B82A 1KIJA 2Q2EB 3HULA 3ZZUA 4P7AA 1B62A 1RR9A 4YY3I 3WU3A 3J80C 2VQFI 1Y4SA 1N36E 3ZKDA 2IOQA 1IBLI 1NHJA 5BR8E 5IT9C 2PNLA 2VQEI 1ZM2A 4DV6E 4AQYI 3LPSA 4B3MI 2ZITA 3T1HI 1IBKE 4B3TI 4JI6I 1H74A 1HK7A 1Z5AA 2UXCI 5GMEA 4X65E 1IBMI 4JI7E 4FN5A 3WU5A 4LF5E 1MU5A 4DR6E 1VISA 2CZ9A 4DPYA 4DPWA 4DR3I 3LNUA 4DXLA 4YY3E 3ZZTA 2UUAI 2VQFE 1FJGI 1IBLE 2V2QA 1XHKA 2UUCI 2VQEE 4DV2I 2X36A 4AQYE 4B3ME 3T1HE 2A2DA 2WW4A 3PYEA 4B3TE 1FWKA 4JI6E 2UXCE 2DEJA 1IBME 4LF7I 3WU4A 4X66I 1HNWI 4HACA 4EMDA 3H4LA 4DR3E 4JI4I 2HHHI 2E1RA 4DR7I 2UUAE 4HXZA 4DV3I 2O1WA 4DU8A 1FJGE 4FW9A 3WU6A 2UUCE 4NXMI 3P06A 4DV2E 2XEXA 4X62I 1FKAE 2UXBI 1XNRI 4LF7E 2DEIA 4JI0I 1NHHA 4X66E 1KKHA 3QT5A 1HNWE 4YHHI 3Q1QA 4JI4E 2HHHE 3HJCA 2GS8A 1USUA 4DR7E 4DV3E 2E5LI 1BKNA 1PKPA 4JI2I 1ZXNA 1B63A 4DU7A 3J81Q 4WUDA 2HFSA 1EA6A 1WUUA 3OTOI 2Z5BA 4DV4I 4LFBI 4MYUA 2V34A 4DPXA 1A6FA 4IZKB 4X62E 4IZJB 2HK2A 4DV1I 4HYMA 2UXBE 1XNRE 4B3RI 1XMOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0N A;  3PYG A;  1J5E I;  4JI0 E;  1N0U A;  4DV0 I;  3V5R A;  1HNZ I;  1Z0E A;  3D4J A;  4YHH E;  4GKK I;  4FWH A;  1OJ4 A;  4KHP I;  4DPU A;  2E5L E;  4JI2 E;  2UU9 I;  3PYD A;  3JAM C;  3K17 A;  1DAR A;  3J7A G;  4DR2 I;  3OTO E;  4JI1 I;  1Z0V A;  4JI8 I;  4DV4 E;  4LFB E;  4ED4 A;  4XTJ A;  4DV1 E;  4B3R E;  1XMO E;  4UT4 A;  2F4V I;  1J5E E;  4DV0 E;  2HKJ A;  1U2R A;  1H72 C;  1HNZ E;  4FWG A;  1Z5C A;  3QT7 A;  4GKK E;  3B8H A;  4DV5 I;  4KHP E;  2R3V A;  1S16 A;  5FLX Q;  2BM0 A;  1S4E A;  2UU9 E;  4LF6 I;  1MG7 A;  1HR0 I;  2HFU A;  4DR2 E;  4USK A;  1ZM9 A;  4JI1 E;  4JI8 E;  4DR1 I;  2V2V A;  2OI2 A;  3QT8 A;  4ZVI A;  2UXD I;  4LF4 I;  4LF9 I;  2F4V E;  3J80 Q;  4JV5 I;  5IT9 Q;  4DV5 E;  4NXN I;  4M1K A;  2NPF A;  5LMU I;  2V2Z A;  4LF6 E;  1HR0 E;  1FNM A;  4DV7 I;  4K0K I;  2V8P A;  1H73 A;  1FI4 A;  1ZXM A;  2ZM6 I;  1H7U A;  4JI5 I;  1RRE A;  2UXD E;  1EI1 A;  4LF4 E;  4LFA I;  4NXM E;  4LF9 E;  3ZZ0 A;  1Z0T A;  3QT6 A;  4JV5 E;  1NZ0 A;  2EFG A;  1QZR A;  3ZM7 A;  4B3S I;  4LFC I;  4NXN E;  5A2Q C;  5LMU E;  1Z0G A;  3CWV A;  4DV7 E;  2X7I A;  4PU9 A;  4K0K E;  3GON A;  1I94 I;  1KVK A;  5L3J A;  2UUB I;  5LMN I;  2A2C A;  4FWD A;  4DR5 I;  2ZM6 E;  4URL A;  3B78 A;  4JI5 E;  5IWA I;  4LFA E;  1ZM3 A;  4JG4 A;  4X64 I;  4USM A;  1XMQ I;  4DR4 I;  4B3S E;  1UEK A;  4LFC E;  2VF3 A;  1Z0W A;  2BM1 A;  1N33 I;  4GKJ I;  1I94 E;  3J81 C;  4DUZ I;  4Z7C A;  2UUB E;  4PRX A;  4R1F A;  5LMN E;  1FWL A;  4DR5 E;  4RPF A;  1N32 I;  1N0V C;  5IWA E;  4Z7Y A;  4DUY I;  1PIE A;  4JI3 I;  4X64 E;  4LF8 I;  5GMD A;  1XMQ E;  4DR4 E;  1HNX I;  1N34 I;  2BV3 A;  1ELO A;  4I3H A;  4HY1 A;  4KQV A;  1N33 E;  4HAC B;  1XNQ I;  4WUB A;  1ZM4 A;  1Z5B A;  3ZKB A;  4GKJ E;  2J7K A;  5A2Q Q;  4DUZ E;  4OX9 I;  3LTO A;  3T1Y I;  3K1J A;  4MYT A;  4P52 A;  1N32 E;  4JYA I;  4DUY E;  3M6A A;  2ZBK B;  4JI3 E;  1D6T A;  4PRV A;  4LF8 E;  3JAM Q;  4DR1 E;  1MX0 A;  1KTV A;  2HKE A;  1K47 A;  1N36 I;  1HNX E;  2LJP A;  5LL6 R;  5BR8 I;  1N34 E;  1Z0B A;  1NHI A;  1PVG A;  1XNQ E;  4DV6 I;  5FLX C;  2HK3 A;  3V2U C;  4UTG A;  4DPT A;  1Z0C A;  2AJ4 A;  1IBK I;  4OX9 E;  2R42 A;  1H7S A;  1Z59 A;  3T1Y E;  4X65 I;  4JI7 I;  4LF5 I;  3J7A M;  3PYF A;  4WUC A;  4DR6 I;  4JYA E;  3B82 A;  1KIJ A;  2Q2E B;  3HUL A;  3ZZU A;  4P7A A;  1B62 A;  1RR9 A;  4YY3 I;  3WU3 A;  3J80 C;  2VQF I;  1N36 E;  3ZKD A;  1IBL I;  1NHJ A;  5BR8 E;  5IT9 C;  2VQE I;  1ZM2 A;  4DV6 E;  4AQY I;  3LPS A;  4B3M I;  2ZIT A;  3T1H I;  1IBK E;  4B3T I;  4JI6 I;  1H74 A;  1Z5A A;  2UXC I;  5GME A;  4X65 E;  1IBM I;  4JI7 E;  4FN5 A;  3WU5 A;  4LF5 E;  1MU5 A;  4DR6 E;  1VIS A;  2CZ9 A;  4DPY A;  4DPW A;  4DR3 I;  3LNU A;  4DXL A;  4YY3 E;  3ZZT A;  2UUA I;  2VQF E;  1FJG I;  1IBL E;  2V2Q A;  1XHK A;  2UUC I;  2VQE E;  4DV2 I;  2X36 A;  4AQY E;  4B3M E;  3T1H E;  2A2D A;  2WW4 A;  3PYE A;  4B3T E;  1FWK A;  4JI6 E;  2UXC E;  2DEJ A;  1IBM E;  4LF7 I;  3WU4 A;  4X66 I;  1HNW I;  4HAC A;  4EMD A;  3H4L A;  4DR3 E;  4JI4 I;  2HHH I;  2E1R A;  4DR7 I;  2UUA E;  4HXZ A;  4DV3 I;  4DU8 A;  1FJG E;  4FW9 A;  3WU6 A;  2UUC E;  4NXM I;  4DV2 E;  2XEX A;  4X62 I;  1FKA E;  2UXB I;  1XNR I;  4LF7 E;  2DEI A;  4JI0 I;  1NHH A;  4X66 E;  1KKH A;  3QT5 A;  1HNW E;  4YHH I;  3Q1Q A;  4JI4 E;  2HHH E;  2GS8 A;  4DR7 E;  4DV3 E;  2E5L I;  1BKN A;  1PKP A;  4JI2 I;  1ZXN A;  1B63 A;  4DU7 A;  3J81 Q;  4WUD A;  2HFS A;  1EA6 A;  1WUU A;  3OTO I;  4DV4 I;  4LFB I;  4MYU A;  2V34 A;  4DPX A;  1A6F A;  4X62 E;  2HK2 A;  4DV1 I;  4HYM A;  2UXB E;  1XNR E;  4B3R I;  1XMO I; 
#chains in the Genus database with same CATH topology
 1J5E I;  3EDR B;  2DRB A;  3K58 A;  2UXC J;  1K44 A;  3K7R A;  3W5Z A;  1HW9 A;  3VAG A;  4RWW A;  4K4X A;  5L39 A;  4DPU A;  3QGG A;  2U2F A;  2DNY A;  4KH0 B;  4PAB A;  2LKZ A;  1SJ3 P;  2AWZ A;  4LFC F;  2D69 A;  5E3R A;  1RCX B;  3J81 Y;  4MKY A;  3J7A N;  2CQC A;  1Q53 A;  3NCR A;  3SIP B;  3EE3 A;  4B3R E;  4DLG A;  4OYM A;  1FDD A;  2VQF F;  1PKU A;  2HKJ A;  2MHN A;  1H72 C;  1HNZ E;  1IVZ A;  4ZPC A;  2FVQ A;  4X66 J;  2UU9 E;  3MAA B;  4NA2 A;  6AT1 B;  2BYC A;  3EYZ A;  3HVT B;  2FY8 A;  1N33 F;  2MKY A;  4NRU A;  2FY1 A;  2FJX A;  4R8U B;  4FZV A;  1IQZ A;  2BKP A;  5D4P A;  1AZS B;  2NUU G;  4G6V B;  2P6S A;  3K8V A;  1A6L A;  2VJV A;  4ELU A;  1TAQ A;  1HBU B;  2C2O B;  5FJ4 A;  3IG1 A;  3O1L A;  4JI0 J;  1RAF B;  1S1V B;  4ANE A;  3IA0 A;  2NPF A;  3N6N A;  3NWG A;  3VAH A;  4K0K I;  4B17 A;  4NPO A;  2XYH B;  1SC6 A;  2C3Y A;  2ALZ A;  1HWJ A;  4CT9 A;  3ILO A;  3WBZ A;  2QL7 B;  3BKF A;  2Z5E A;  1FDA A;  5J2P B;  2XHC A;  3SFG A;  2AJ0 A;  2ZUG A;  1W26 A;  4WCE Q;  3M85 D;  1OMS A;  4NCG A;  3TAN A;  3TZZ A;  2VQE J;  3C15 B;  2KT5 A;  5K20 B;  2AYE A;  4TU9 A;  4EZ6 A;  4IH5 A;  2F1F A;  5CA5 A;  4L73 A;  2HZV A;  2GIQ A;  1IM6 A;  2ATL A;  2IFX A;  1HNV A;  3QSY B;  1PAE X;  3CJK B;  1ZM3 A;  1VQM S;  4TU7 A;  4PWD A;  1GXT A;  2GO8 A;  3WX4 A;  5DRO A;  4WU3 A;  4ECU A;  2RDJ A;  2VG5 A;  4B3S E;  1UWA A;  3JSM B;  1SUQ B;  3TAQ A;  1DTT B;  2GHW A;  4GKJ I;  5KG7 A;  2PDA A;  1RTJ B;  1XQI A;  2FJE B;  5LOQ A;  3T41 A;  4CTA A;  1F6T A;  3HT0 A;  1C1C B;  3D67 A;  4UF4 A;  1NCL A;  3PAC A;  4ERD A;  2Z2Y B;  5GMD A;  1WTB A;  1HHT P;  2E1M C;  3B54 A;  3HZE A;  4A8M P;  1USV A;  1TQL A;  4IO1 A;  4HAC B;  2NYH A;  4NLV A;  4RUB A;  5B0F A;  2UVV A;  2NQP A;  1Z2L A;  4NXN J;  1D3W A;  3CW2 C;  4DUZ E;  1NEE A;  2J76 E;  2HMI B;  3T1Y I;  3BGO P;  2HRU A;  1WC3 A;  3I87 A;  3MM9 A;  4ED2 A;  4YN3 B;  4JYA I;  2O1U A;  3EWG A;  1IKW A;  4IG0 A;  5B08 A;  3PNI A;  4C0O C;  4XIU A;  2DYA A;  3DD6 A;  4B3R J;  2GVD A;  5J2Q A;  3C46 A;  3JAM U;  3MFI A;  5L1L A;  3MCN A;  4JI7 I;  2ACM A;  3PYF A;  4WUC A;  2CYY A;  4F3M A;  1UKU A;  2NN6 F;  2XO6 A;  1WI8 A;  4YY3 I;  2XMA A;  4IOC Q;  2CJY B;  3V6D B;  3ILI A;  3D1Q A;  2F5G A;  5DDO C;  2PNL A;  4PRF A;  4TLQ A;  2OEM A;  2RUG A;  5MAO A;  3ZTR A;  3MM6 B;  3OTB A;  5E3P A;  1C0U B;  3ZTO A;  3POT A;  4F3O A;  2VBZ A;  2VG6 B;  4Z37 A;  2B56 A;  1FEE A;  2N4C A;  4QR1 A;  3EX7 B;  3JQM A;  4HT7 A;  2ADC A;  5KAK A;  4DR3 I;  1N32 J;  2ZWO A;  3H5U A;  4RUA A;  2EXU A;  3CJ3 A;  4I2Q B;  2BAC A;  5HBM A;  3HSG A;  5IWA F;  3P49 B;  3OJS A;  3M05 A;  3FBE A;  4HH0 A;  4LF7 I;  3RB6 A;  1CEZ A;  4CNZ A;  5D77 A;  3BZQ A;  1RT7 B;  1QY7 A;  3ETM A;  2CDQ A;  3GJS B;  4YDX A;  3H40 A;  3SV4 A;  3M7V A;  4RU2 A;  3FK4 A;  1DHM A;  1JNZ B;  3KRN A;  4MT1 A;  3BYP A;  4P2S A;  1S1T B;  2M88 A;  4F0H A;  3J81 j;  5HI7 A;  3Q8P B;  4IFD E;  4NLG A;  1R0C B;  3QT5 A;  1TK0 A;  4N76 A;  1P42 A;  2HHH E;  3V4I B;  5D8H B;  5E2Q A;  2HBR B;  5I42 A;  2ZZT A;  2E5L I;  4BA2 B;  1U6F A;  4ZVH A;  3IAM 9;  4OHY A;  2PSZ A;  3OR2 A;  2KJV A;  3H2V E;  3H59 A;  1OYD A;  5D78 A;  3F73 A;  1IM4 A;  4DV1 I;  3J80 Y;  3PYG A;  2O5D A;  2VG7 A;  4CLY A;  5F3T A;  1U0H B;  4ID8 A;  2HUR A;  4FWH A;  4DV6 F;  5JEA F;  1LW0 A;  2H5J B;  2ZZN A;  3GPA A;  1VIO A;  1IBK F;  3PYD A;  5KFY A;  5HAT A;  4WZM A;  3LGM A;  1WC6 A;  4JI8 I;  4N3O A;  1WDT A;  2QL5 B;  2F4V I;  4DV0 E;  4AUK A;  4AM3 A;  1Z5C A;  4GKK E;  4DSJ A;  3N6M A;  2R3V A;  3AA9 A;  4RW9 B;  2IJN A;  2DNL A;  2OH2 A;  3GYN A;  3H90 A;  4PPZ A;  1IBM F;  1N88 A;  3V6H A;  3L9Z A;  2HFZ A;  4K5R A;  1REV B;  2WVD A;  1RWV B;  2OI2 A;  4EBE A;  2XMU A;  3KHL A;  4DOZ A;  3R2D J;  2HWH A;  1RWM B;  4EWT A;  4OO1 E;  3AQO A;  4IZJ D;  5JUM A;  1S5Z A;  1OQ6 A;  5B0A A;  4MU3 A;  4ZPT R;  4H4K C;  1XC9 A;  3C6U B;  4JI2 J;  1YGY A;  3MXH P;  1T95 A;  1T02 A;  1KLN A;  4J9S A;  4EGL A;  1EAY C;  2W4P A;  5DM7 Q;  3Q8S B;  3LP1 B;  4C8Y A;  4FNI A;  3NL0 A;  2O1V A;  5CYQ A;  1UDN A;  2G2Z A;  2JZ5 A;  2OGU A;  1M1K T;  2EC2 A;  2HRT A;  4X62 F;  5IT9 Y;  2MJN A;  1P9Y A;  4MK8 A;  4KHP J;  4DV7 E;  4KO0 B;  3G82 B;  4ZHR A;  1YJV A;  5AJ3 J;  4IS9 A;  1S6P B;  4K2X A;  3DM2 B;  4WYW A;  3ENQ A;  4MTP A;  2PC6 A;  3PJW A;  2CPD A;  1SJR A;  1XWL A;  2VF3 A;  2KXH A;  3HHL A;  2X3G A;  4RW7 B;  3PM9 A;  4FP9 A;  2BKN A;  2LU2 A;  4C0H A;  5C0X A;  3W2W A;  1RAB B;  1D8Z A;  2MXY A;  1VQY A;  3CB4 A;  2MSS A;  3CCW A;  3PY8 A;  4NXM J;  3DRP A;  4DR2 F;  2ZE2 B;  1OYP A;  2JE6 A;  1HNX I;  2ZBR A;  3T5H A;  3OSP A;  2Y0S D;  1PJ5 A;  3V6K A;  1M5V C;  2XY6 A;  3KK1 B;  5DS7 A;  2IA0 A;  2LLZ A;  2XWY A;  1FT8 A;  4PQU B;  3JTO A;  5A8K B;  2ZM6 J;  4LF8 E;  1FJE B;  1ZH5 A;  1UDQ A;  2CG8 A;  1YIJ S;  1N34 E;  2WK4 A;  4XDD A;  3FZ2 A;  4R0E A;  1HBM B;  4RNM A;  3H2L A;  1P8G A;  3KLH B;  2HIY A;  2WHO A;  1SIW B;  2Z0G A;  2YWF A;  4KT0 C;  4BWM A;  3ITH A;  3LW5 C;  3DN9 A;  2Q2E B;  2HBZ B;  1R8C A;  1RHM B;  4F0M A;  4YOE A;  3J80 C;  3R97 A;  4X64 J;  3FZB A;  2VQE I;  2QYG A;  3IM9 A;  3CDU A;  1X9S A;  1FVQ A;  2NRE A;  1RTH A;  5HRO A;  3OLA A;  1Q78 A;  1NPK A;  4B3T I;  3ZTQ A;  2MEW A;  2BJ9 A;  3ZZR A;  4LF5 E;  1MU5 A;  1F2H A;  2VKR A;  1YBU A;  4DPY A;  2OPP B;  1NB2 A;  1NUE A;  1QM9 A;  2PT0 A;  4FYX B;  4QYZ K;  4AXI A;  2ZDP A;  1VRU B;  5IQQ A;  1NK6 A;  1VQN S;  4JI3 J;  4Q7A A;  2I38 A;  3ZNU A;  3AOD A;  2IPO B;  4F4W A;  4FPI A;  4QW9 A;  3KLI B;  3D3C J;  4X4T A;  3DRS B;  4LSN A;  3FDS A;  1VK8 A;  3NY0 A;  1HNI A;  2EPI A;  2HFV A;  2C3U A;  5K14 A;  2W7P A;  1S1X A;  4MIW A;  1SKW A;  2EKY A;  1LW2 B;  4DV2 E;  2HQD A;  1HWI A;  4Y0F A;  5HJY A;  3EJM A;  1T3N A;  4JB8 B;  4NE9 C;  3LOU A;  2GO3 A;  1OYS A;  5C5J A;  1B99 A;  2CJA A;  3UCZ P;  2DO4 A;  2GML A;  5C25 B;  4HL9 A;  2GS8 A;  2Z57 B;  1BD6 A;  2AGQ A;  2FHK A;  3HZG A;  1LFW A;  4ECQ A;  1B63 A;  1D8Y A;  1ZPV A;  5JEA B;  2RRB A;  5G0R B;  1LFP A;  1CJK B;  2VC0 A;  2COL A;  3QWU A;  3TAR A;  3KK3 A;  2M52 A;  1NXI A;  1VQ4 S;  4AQY J;  4B3R I;  2RVJ A;  3R2C J;  1HI1 A;  1T9T A;  3TJ8 A;  1UW4 A;  1HNZ I;  4JI6 J;  4DL0 C;  3MMC B;  2O66 A;  4J9O A;  2UU9 I;  2F63 A;  5K9F A;  1RWX B;  1ZZN A;  2HFN A;  3BGU A;  2BE2 A;  2RRA A;  2I1R A;  2ZBI A;  1NKC A;  4FXV A;  4WBF A;  5K36 F;  2OD4 A;  2NXU A;  2V8V A;  4AL6 A;  3RTV A;  3QSI A;  1IBL F;  3FGV A;  2RH3 A;  3M2R B;  1N34 J;  4NAS A;  3DLB A;  4UQT A;  4B3M F;  2HVD A;  4J7C A;  3FSI A;  1MG7 A;  1B64 A;  2UXC F;  4F4Y A;  5F8I A;  4OO1 B;  3LWL A;  4USK A;  1ZM9 A;  4ZVT B;  5LJ5 Y;  3LAN A;  1AXQ A;  3EDQ B;  4J3D A;  1RLD A;  2C2M B;  2XZD B;  1YJ7 A;  2J5A A;  5J2M B;  3GR0 A;  4P72 A;  3IM8 A;  1SXL A;  3TAM A;  3GIM A;  4IR9 A;  3WC0 A;  4TNO A;  2UXB J;  2QX0 A;  1WSR A;  2ERR A;  5IM0 B;  3A8K A;  3D6F B;  2PNZ A;  3LAM A;  3K5O A;  3MGJ A;  1FRH A;  1H7W A;  4HHU A;  2W9B A;  1H73 A;  3UD3 P;  2Z2Z A;  2NS1 B;  2P8I A;  2MZ1 A;  1JJH A;  4LF5 J;  4N7T A;  4X66 F;  4C8O A;  1WEX A;  3W8G A;  1IKV A;  5EKW A;  3S7R A;  4QIE A;  3G96 A;  1RI7 A;  1P1T A;  3NS7 B;  5E41 A;  1Z0T A;  4J37 A;  2IRY A;  4C8L A;  2Y1L B;  4URQ U;  1XMO J;  3ZM7 A;  1VRT A;  1LOU A;  1NZ8 A;  5B0B A;  4B3S I;  3PFO A;  3K5P A;  5EWG A;  4OHX A;  5KG3 A;  1TMM A;  4OJ1 A;  4JI0 F;  3QJP A;  3E51 A;  1O0P A;  3CC7 S;  4Y28 C;  2Y1J A;  1VR6 A;  1TKX B;  3RRK A;  4XPE A;  2CUY A;  1HBO A;  1S0V A;  1NME B;  4KPC A;  5D0E A;  1CJT B;  5ETL A;  3U1N A;  4M63 A;  2GVZ B;  5DET A;  1P27 B;  5KFW A;  4DUZ I;  1HYS B;  4RJV A;  3HPO A;  1FWL A;  1TMJ A;  5ELW A;  1QSS A;  2N3L A;  1E6V A;  2V9K A;  1WKJ A;  3WIV A;  1SJF A;  2AP6 A;  2C2Z B;  3KTQ A;  1N5Y B;  4C3L A;  4WP9 A;  3KLE A;  4EO8 A;  2XMK A;  3G6X A;  1H2U X;  1Y5I B;  4ZLN A;  5L9X A;  4QYZ J;  2MLX A;  1JXV A;  4O0I A;  2LP4 A;  3BRE A;  4B9S A;  1S49 A;  4P6Q A;  4DL7 A;  1LWF B;  3CMQ A;  1ACM B;  3VVT A;  1RGV A;  3CDW A;  3MPW A;  4PG7 A;  1REG X;  2MDA A;  1T9V A;  3MMB B;  1Q8B A;  5B0E A;  2IHR 1;  1JXE A;  4JI5 J;  2VFS A;  2OKQ A;  3JAM Q;  4NYP A;  1MX0 A;  4F26 A;  3G71 S;  1K47 A;  4HVZ A;  3H25 A;  2BR0 A;  1E6Y B;  2B7B B;  3HD1 A;  1T9Y A;  1TL4 A;  1VGY A;  3TQE A;  1Z59 A;  4LRD A;  4GVB A;  2CKW A;  3J7A M;  2BA1 G;  1W2I A;  4NXN F;  3AD8 C;  3GCW P;  5C0X C;  1FEH A;  2G2O A;  2LQB A;  1RBL A;  5J2N B;  4MU1 A;  3LP0 B;  2JX2 A;  1FKP B;  2GMH A;  3R5C A;  3H4D A;  3US5 A;  2ZOM A;  2HIQ A;  3WU5 A;  4G65 A;  5KT6 A;  3H20 A;  1FER A;  3PG9 A;  4CM0 A;  1YQH A;  2LDY A;  2LDI A;  1EZZ B;  4KGX B;  4YFU A;  1SPB P;  2MYF A;  3BH7 B;  3QRP A;  4H4O B;  3EZ5 A;  4ILR A;  3MAA A;  3VF0 B;  3G4S S;  5DZ6 A;  2OPQ B;  1FK9 A;  4L74 A;  1XNQ J;  1XR6 A;  2CQH A;  1U1N A;  2FJA B;  2V4R A;  2JEA B;  3PKM A;  3SI8 A;  1AZS A;  1TAU A;  4QYR A;  1MU2 A;  1F9E B;  4EMD A;  2CWX A;  2HHH I;  3KHH A;  4Q45 A;  3MEG B;  1YJ9 S;  2UUA E;  1S1V A;  4ZP9 A;  1U09 A;  4NXM I;  2CQD A;  4UZC A;  3P3D A;  1N32 F;  2IJR A;  4O3P A;  5BR8 J;  1L3S A;  3U7J A;  2VAS A;  1OYE A;  1SI9 A;  2ZC3 A;  1KLM A;  4DX8 H;  2RQK A;  1JKH A;  3AJD A;  5D4L A;  1R0A B;  5H9F J;  1HWU A;  1RYR A;  3A3O B;  4DQI A;  1TUG B;  2IAJ B;  2CDR B;  4G1Q B;  3SZ2 A;  2U1A A;  3CUL A;  5CQG A;  2CQ2 A;  2GIF A;  4TU8 A;  1D09 B;  1BQN B;  1RHY A;  1XNR E;  3TOQ A;  4AYB D;  4DV0 I;  1R43 A;  5K36 B;  4Y2M A;  4EI2 A;  1FD2 A;  4GKK I;  2ZH6 A;  2EFQ A;  3I0R A;  2VOD A;  2R8J A;  4CM2 A;  1RT1 A;  1GAO A;  3JSM A;  2CRL A;  3AD9 C;  1VLO A;  1T03 A;  3W3S A;  2X1B A;  1L