4HACB

Crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
308
structure length
308
Chain Sequence
LVPRGSHMVSCSAPGKIYLFGEHAVVYGETAIACAVELRTRVRAELNDSITIQSQIGRTGLDFEKHPYVSAVIEKMRKSIPINGVFLTVDSDIPVGSGLGSSAAVTIASIGALNELFGFGLSLQEIAKLGHEIEIKVQGAASPTDTYVSTFGGVVTIPERRKLKTPDCGIVIGDTGVFSSTKELVANVRQLRESYPDLIEPLMTSIGKISRIGEQLVLSGDYASIGRLMNVNQGLLDALGVNILELSQLIYSARAAGAFGAKITGAGGGGCMVALTAPEKCNQVAEAVAGAGGKVTITKPTEQGLKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mevalonate kinase
publication title Crystallization and preliminary X-ray diffraction analysis of mevalonate kinase from Methanosarcina mazei.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Transferase
total genus 89
structure length 308
sequence length 308
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00288 GHMP_kinases_N GHMP kinases N terminal domain
B PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4hacB02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4hacB01
3PYEA 2F4VI 3JAMQ 1UEKA 4DR1I 4DR4I 4YY3E 1B63A 5LL6R 4ED4A 1FWLA 1Z0VA 1XMQI 1BKNA 1QZRA 3WU3A 1ZM9A 5IT9C 2VQEI 3Q1QA 4JI0I 4USMA 2NPFA 1XNRI 1H74A 4LF4I 1PKPA 4WUBA 1MX0A 1H7UA 3WU5A 1ZM3A 4PRVA 2VQFE 1Z0WA 1IBLI 1ZXNA 5BR8E 4JI8E 5IT9Q 3D4JA 1FKAE 4JI2E 1ELOA 2HFSA 1KTVA 2HFUA 3ZM7A 2V8PA 1H7SA 3B78A 3OTOI 3T1HI 4UTGA 2BV3A 4K0KI 2DEJA 5A2QC 4LFAI 4B3MI 4DV1E 4LF9E 4MYTA 2UUAE 5GMEA 3V2UC 4P52A 4Z7YA 1HNWI 4DR5E 1FJGE 1HNZI 4DR4E 1N34E 3PYDA 1NZ0A 1S16A 5A2QQ 2VQEE 1PIEA 2UXCE 2ZBKB 1XNRE 3J7AM 1XHKA 1FNMA 4LFBE 4WUDA 1IBLE 4X66E 2VQFI 4DV2E 3HULA 3LPSA 1FI4A 4P7AA 3J7AG 4JV5I 2X36A 3B8HA 4HY1A 3OTOE 4DR7I 3CWVA 4K0KE 3T1YI 1HR0I 4B3ME 4URLA 1Z5BA 2UUAI 1K47A 1MU5A 1N36E 1HNWE 1HNZE 4DPXA 4DR5I 4DXLA 4USKA 1N34I 1Z0TA 2CZ9A 2V2QA 4JI1I 4JI6I 4JYAI 2J7KA 4PRXA 2ZITA 3PYFA 4HACB 3LNUA 1H73A 2UXCI 3QT5A 2X7IA 2UXBE 2A2CA 4FW9A 1KKHA 4DU8A 4LFBI 4LF6I 1A6FA 1N0UA 4DV4E 4X66I 4DV2I 4DV6I 2HKJA 2WW4A 4B3RI 5L3JA 4JV5E 4B3TE 3WU6A 2BM0A 3LTOA 4DR7E 1Z0CA 2E5LI 4X64E 3T1YE 2VF3A 3M6AA 1HR0E 4FWGA 2HHHI 4FWHA 1VISA 4YHHI 4AQYI 4DR3I 1N36I 4GKJI 3K1JA 5LMUI 2R3VA 3J81Q 2HK3A 4JI1E 4JI6E 1I94I 4JYAE 4WUCA 2UXDI 5GMDA 1N33E 4DPTA 1S4EA 4KHPI 1H72C 4Z7CA 5FLXC 2UXBI 4JI4E 1Z0GA 4LF6E 2UU9I 1Z0EA 4DV4I 4X65E 1ZM2A 4DUYI 4DPYA 4DV6E 1NHHA 4B3RE 4OX9I 1RREA 4B3TI 1KIJA 5FLXQ 2E5LE 1J5EE 4LF5E 4X64I 1MG7A 2ZM6E 1XNQI 2HHHE 1N32I 4YHHE 4AQYE 4JI7I 4DR3E 1Z5AA 4GKJE 5LMUE 1IBME 3QT8A 3J80C 1DARA 3ZKDA 2HK2A 1I94E 3K17A 4NXNI 2AJ4A 5LMNE 2UXDE 3ZZUA 4MYUA 4ZVIA 1N33I 4KHPE 1IBKI 2UUCI 1Z59A 3QT6A 4DV3I 4LF7I 4JI4I 3J80Q 3ZKBA 1PVGA 4UT4A 2UU9E 4X65I 4DUYE 4DV7I 4NXMI 2HKEA 1EA6A 4OX9E 1NHJA 2DEIA 3J81C 4HACA 2UUBE 1J5EI 1RR9A 4LF5I 4DUZI 3B82A 4DR2I 4KQVA 2ZM6I 4DU7A 4DV5I 1XNQE 4B3SI 1WUUA 1N32E 4JI7E 4XTJA 2V2ZA 4LF8I 4DR6E 4DV0I 1IBMI 4LFCE 2V2VA 3ZZTA 1XMOI 4JI5I 4RPFA 1NHIA 4GKKE 5IWAI 1D6TA 4NXNE 1HNXI 4JI3I 5LMNI 3QT7A 4R1FA 4EMDA 4HXZA 4X62E 4M1KA 2OI2A 2LJPA 1IBKE 2F4VE 2UUCE 4DR1E 1OJ4A 4DV3E 4LF7E 4YY3I 2XEXA 1XMQE 3V5RA 2EFGA 2A2DA 1N0VC 1EI1A 4DV7E 4NXME 1ZM4A 2E1RA 1U2RA 4JI0E 2GS8A 3WU4A 4LF4E 1Z5CA 2BM1A 1FWKA 4DPUA 2UUBI 4DUZE 4DR2E 1Z0BA 1KVKA 4HYMA 4DV5E 4B3SE 3PYGA 4JG4A 3F0NA 4DPWA 2V34A 5BR8I 4JI8I 2Q2EB 4JI2I 4LF8E 4DV0E 4PU9A 4DR6I 3JAMC 1XMOE 2R42A 3ZZ0A 4LFCI 4JI5E 3T1HE 5IWAE 1ZXMA 4I3HA 4GKKI 4FN5A 1B62A 1HNXE 4JI3E 4LFAE 3GONA 3H4LA 4DV1I 4LF9I 4FWDA 4X62I 1FJGI
chains in the Genus database with same CATH superfamily
3OHBA 3OUYA 4DLEA 3KG0A 1KC8T 2XO6A 3UD3P 4IFDF 2DR9A 2IBKA 3I32A 4NLDA 1E6VB 2N7YA 3VZHA 2GMJA 1ZA1B 5HK4A 3SMZA 2OELA 1WEXA 4DFJA 4PRVA 3HSJA 1HWJA 1X4HA 1ZXNA 4RNHA 5EN1A 4ZPTR 3WIUA 4RW7A 2NR0A 1X4GA 3IR5B 1NB7A 1C1CA 1KTVA 4J9OA 1IM4A 4NZ0A 1DQ9A 2WP8B 1S76D 2BV3A 2R7OA 4RBVA 2UUAE 5GMEA 3BF4A 4PUOB 4L3NA 3BGLA 1N32F 4BBYA 1L3UA 4MJKA 5A6PA 2MKKA 3BSAA 5KFJA 3KUHA 2R7TA 3T19A 4H4KA 1C4AA 2QLFB 4NLPA 2PA8D 1WKLA 3TX0A 1RK8A 4D3GA 3PRBA 3VVTA 2MKIA 2HZVA 1PILA 3OFEA 3VQTA 3MFIA 3OTDA 4LF2A 1FE4A 4A8OA 1R31A 3GP9A 4DL2A 4DUYJ 1G2EA 3GLJA 4EO8A 3FK4A 2YX1A 3FSIA 3Q8UA 1CJVB 2B56A 4K4ZA 4X64J 4M5MA 4DR7I 3AJDA 2Y1IA 2W2NP 2OLWA 1PYSB 1RHMB 2G4BA 2WAQD 1EX8A 2HS4A 3C6UA 2I5JB 4ED7A 4QWCA 4MKYA 4DXLA 1YIJS 4FW5A 3JSBA 4NXNJ 4I0WA 4JI1I 4RBUA 3M6WA 3ZZYA 1NH8A 1AZSB 4YQWA 1SUQB 2B5JA 2A10A 4X65J 2CPEA 2CKWA 2AZ1A 5H9FJ 4QW9A 4KE5A 5DM7Q 4KPYA 3FQLA 3GG1A 4HKQA 3H59A 5D77A 1TAUA 1VQLS 4DR2J 3V4IA 1CJKA 3LPEA 5CD4H 3W3SA 3T1YE 1RZMA 4ER8A 4OYAA 1APSA 5EGYA 5DQHA 2RAQA 2RQCA 3NY0A 4WIIA 4LF8J 4Y3CA 2DNYA 3K1JA 1IBMJ 2IIHA 3PX4A 4NCAA 2R3VA 2CJYB 4LVOP 4LJMA 4R0JA 2FJXA 4OZ0A 4CM0A 4JI3J 2UXDI 3NS6A 2CPZA 2JJ4D 5CZVA 4CH0S 4F3OA 2HHUA 1RT5B 1O51A 1QDUB 4FNHA 2HFVA 3LP0B 1SL2A 2GHVC 4B9MA 2L41A 2UU9I 1ZM2A 4R0EA 3DOMA 4B3TI 4IRDA 5F8JA 1KHWA 4X4PA 1XR7A 3NGDA 1WC1A 2WVFA 2MMYA 1R8BA 3WHIA 1Y3JA 4DV2F 2DNOA 5C5JA 1HBMA 4BA1A 3LWLA 3ZKDA 2HK2A 3VALA 2QL7B 2M9KA 4K0KF 3QAUA 2UUTA 3DOLA 2DPIA 3RBEA 3OPKA 2F4VJ 3KUGA 2DRAA 4KHPE 1SC6A 4WZQA 3TW0A 2JRSA 2QLBB 1FXRA 3FFIA 4ILMA 4UT4A 2CADA 1QD1A 3NGTA 3UD4P 3ITHB 1C1BA 5B0GA 4L74A 4LF4J 2MKHA 3BO3A 5IT9U 3OFGA 2QA2A 1ULRA 4RW9A 4LF5I 4DUZI 2HBZB 4LQ9A 5IC6B 2DITA 1WUUA 2F65A 2BR2B 3OXLA 2R9LA 1KWMA 1RT6A 3H5UA 4NLSA 3VCDA 4J7CA 4ITSA 2HQDA 3HJCA 4JV5F 3D2WA 4RW4B 2I6WA 4UOCA 2E1CA 2AEJA 4ID5A 1VBXA 2FHJA 4FKXA 5D0EA 1DHMA 2Z58B 4NLQA 4DR5F 2AF6A 5GAEU 2W2PP 2CJAA 3W65A 3BN4A 4YR2A 2GFFA 7FDRA 3MHYA 3EMTA 1S10A 2EFOA 4FYYB 1NRKA 3VAFA 1WKJA 3RB6A 2ZH2A 2UVVA 1Z0BA 5HP1B 1OY8A 1AUDA 4JI4F 3AODA 1S1XA 2P9CA 1M1GA 3TJAA 3TA2A 1C0TB 2O1TA 4G3IA 4QZVB 2QL9B 2MZJA 1XMOE 3NBPA 2Q3PA 4GKKI 3KOAA 2HMIA 4CNYA 1J5EF 3IR6B 4DX8H 3VHQA 3K2YA 1K9MT 1MWZA 4OI4A 4HTJA 2Z57B 3TYTA 2WSEC 4DSEA 2EKNA 5LMUF 1CS4A 2B7BB 2V4JB 2B4PA 1XMQI 2PN6A 3QGIA 3B4MA 3CMES 2BX6A 1U0SA 3S8SA 4JI0I 2CQ4A 5EWGA 3MGJA 4CYUB 3W2VA 2FVQA 3OTCA 1HI8A 3SZ2A 4OJHA 1D0EA 2YPYA 1IBLJ 5IFMA 2R2SA 1VR6A 1X5SA 1YI2S 1IVZA 1FRXA 2VBXA 3GIMA 1LWFA 5HVFA 3T1HI 2DNLA 3K89A 4B9NA 2JVOA 5A2QC 3KHGA 3I5AA 2Y8YA 4LF9E 1RQ0A 1YJ9S 4M5LA 2CNNB 3QZ8A 4JB8B 3I4PA 4IQMA 4W92B 4G1QA 2HFOA 1RWXB 4HHUA 3PYDA 2ZH7A 2O3ZA 2BYCA 2GO3A 1F60B 1TKZB 2LEAA 2U1AA 4NWBA 2E9TA 1S7HA 2XLJA 2GO8A 3CCWA 2L9NA 1FJEB 4DV4J 4DV3F 4CH1A 1L3KA 3TI0A 4KR0B 4DI6A 2MEWA 2L08A 5DRPA 3R5BA 2KM8C 3F73A 4BWJA 3BBFA 4KKOB 4OYOA 1OMSA 3T1YI 1IN0A 2MGZA 1YX2A 4ED5A 2J8SA 2DJWA 3GIRA 3CCLS 2R8IA 5DDPC 1Y4SA 2ROGA 5D0RA 2V0NA 3MAAB 4DPXA 1RU2A 2QA1A 2IC3A 2JX2A 1GFWB 3G4SS 3GCMA 2YVSA 2C3PA 2P9EA 4F0HA 3WZ0A 4KY3A 2X7IA 2LQ5A 2OPSB 3G8SA 2KDOA 2KI2A 1KKHA 1JXLA 2IFXA 3PTWA 2IVMA 4WXOA 4ZJQA 2AYBA 1RKIA 4HL9A 2EBGA 2FVCA 4OO1E 2DH7A 3A8EA 2CNKB 3M6AA 4J91A 3CMAS 2KZZA 2XYPB 3A13A 2BA0D 3ET6A 1SH2A 5BR8F 2EKYA 4JI2F 1CQMA 2ILYA 3LPYA 3TEHB 4JYAE 1KLMA 3Q22A 4KHPI 1G6BA 5AE3A 2BDPA 4OO1C 3D1HA 3FEZA 5IQ6A 4DG1A 1ZAWA 3HZGA 5J2QB 1N34F 3Q23A 1NHHA 3PNIA 4ZN1A 1JLFA 1Q16B 3OVBA 2B7CB 2VPZB 1KOOA 3UHMA 2YX4A 2FHMA 3MOZA 4Q44A 4WYLA 5A76A 3IBCB 4AQYE 1D9FA 3PW2A 4WP8A 3CD7A 4DR6J 2NZ4A 2HW3A 4JV2A 2ZZNA 2W7AA 1IR0A 1DARA 2LXIA 3F56A 3J80U 2RMLA 1HK7A 4Y2IA 1MW7A 1UVKA 4F4ZA 1D8ZA 2HHSA 4K4VA 1VC0A 4ES3A 1Z59A 5LXRA 4C0HA 4P2MA 3ZKBA 3TAQA 4IH7A 2VQEJ 4OX9E 5DGBA 2FJDB 1T03B 3J81C 1ZYQA 2NZCA 1YZ6A 1EJ7L 2B4VA 3G2XA 1U1MA 4LSLA 2W9CB 1Q8LA 2DXDA 5F9NA 4U9RA 1TTHB 3KK2B 2A3JA 4O3OA 1P42A 3N79A 2KU7A 4XPEA 2HVEA 3LAKA 2V2VA 3LQVA 1TKXB 1XMOI 3CJRA 2HQIA 2W9BB 1VQOS 4RPFA 5KOXA 5F0WA 1KS2A 4O3QA 4DR7F 4F04B 2LU2A 4QPXA 2B8QA 2OI2A 2R4FA 3UCUP 5K8PA 4W98A 1JLEB 3V5RA 2LQBA 3C14B 4WFXA 3DLGB 1UVNA 3PHTA 1RAIB 1S1TB 2XULA 5JEAD 4FF2A 4JI1F 1MROB 2D41A 1F0XA 2BJ8A 3O6QA 1KNZA 3BYRA 3CJ4A 2K06A 2DR7A 3CJKA 1IQTA 4B3SE 3PYGA 3KHRA 1H3DA 1H2UX 2WVCA 1NDCA 4IOBA 2HVZA 1S77D 3T3FA 2K7KA 4DN0A 4EWTA 1YJ7A 4OHWA 1VQ7S 3CO9A 3DM2B 4W4MA 4J5OA 1RWWB 4LF9I 1URRA 4B9TA 4P6QA 1T9YA 4CT8A 3NL0A 3OJUA 2NN6E 1WI6A 1RKJA 3R5GA 2BE2B 3W2WB 4DS5A 1N88A 5JMNA 5IZHA 2CUYA 1ZM9A 2FZCB 2RU9A 3R27A 2UXDF 3E51A 4OO1A 4U7UK 2HNZB 4DS4A 2FUG9 4DJBA 3MM5B 2P6SA 1Z0WA 2FQQB 2BOPA 3V6DB 5ETPA 2UU9F 2VG7B 2ADBA 2NN6C 3CCTA 1GH8A 1E6VA 4OX8A 3OVAA 4LRFA 1UTAA 5HLFB 1UPMB 3GFZA 4UTGA 2RS2A 1FRHA 1A0OB 4YHHJ 1B64A 4GKJJ 4L73A 4ZVFA 2RDDA 2OMLA 3PX6A 1USVA 1R0CB 4C3MA 3FUYA 3JSYA 3QFWA 1VQ6S 3POTB 5L46A 2POKA 2UXBJ 2YH1A 4LFBE 2GAHC 3U02A 4WUDA 3D3BJ 3THPA 4X66E 3CCSS 4FNIA 1FCAA 2PNZB 2QG9B 4P7AA 1YBUA 5L39A 3C6TB 4XIUA 1CG2A 3RR7A 1B0VA 2RD5C 4NLGA 4DUZF 2AKWB 1FRKA 1N36E 1USUA 2J7WA 2BQRA 1U47A 3UQSA 4CLUA 1JLGB 2JOQA 2WB1D 4JYAI 2R2RA 1HW9A 1S99A 1YKWA 5DM6Q 1T7PA 4LFAF 2UUCJ 3FZ2A 4LF7J 2I5JA 7FD1A 2RF2A 2WSCC 2ZJRQ 5EX0A 4F67A 4NXMJ 2CJXB 1SXLA 2ZBIA 4R8UB 1A6LA 3N28A 3LTOA 5KFUA 4F3MA 1AW0A 1TVRB 4IR9A 1S7IA 3H4DA 3BN7A 1O5JA 4GO7X 4FWHA 1SUQA 4FF3A 3QJJA 4AQYI 4LBHA 5I3UB 2CAJA 3SXLA 2AW0A 1EHWA 1KDNA 4CI0B 1ZA2B 2VICA 1X4DA 1TUVA 1JKHB 1ZPVA 2UP1A 2D1CA 2BEFA 2XY5A 2Q1LA 4LREA 1RTIB 3PDNA 1S4EA 2LEPA 2HNYB 2RVJA 1RAGB 1RBAA 3BQ0A 4ZVTB 1VQ4S 1RAOA 2MQOA 4J9MA 2IESA 4OX9I 1XR5A 1RREA 1SKSA 1VIXA 4ATNA 2QA4S 5FLXQ 4OZJA 2E5LE 4JI0F 2X1GA 3GJTB 3DHXA 3DRSB 3LP0A 5I4MA 2NN6A 1PYOB 4LFCJ 4OYBA 3CC7S 2DTJA 2OIHA 2VOOA 2KT3A 1I94E 3S7RA 3DHWC 1RWVB 5KFZA 3AT1B 1U2CA 2OSQA 5C0XE 2LXFA 4DR4J 4DR1J 3DNCA 2DXEA 5U47A 2PI5A 3EICA 2MTLA 1TV6A 4J9LA 1GMUA 4GVBA 2DNZA 4F4KA 2ILZA 3G8TA 2JC1A 5F8NA 3CD6S 4XAKA 3JTOA 2ZM6I 2E9ZA 2GJIA 3DD6A 4B3SI 3VGVA 5AJ3F 1FJCA 3HM9A 5IT9Y 3HHEA 3MCSA 3X3UA 2KL8A 5C0XC 1QUVA 4YB5A 3W62A 3J7YI 1WEYA 4WXWA 2G2OA 1HMVA 1RTHA 3O44A 5CZXA 2LU1A 3QGHA 2QN6B 1U1RA 2DGTA 2LDIA 2AWZA 2MQQA 3M4XA 3T1YF 3CEDA 3FBFA 4FW7A 1UFWA 4LVNP 2DHGA 3AB4B 2BR2A 4P7VA 4YY3J 1OJ4A 1RAAB 2O1VA 4KRWA 3PW5A 3FCHA 2J0QD 2F3JA 1UAWA 2JE6A 4F36A 2RQKA 4CTAA 2CWXA 4Y28C 2WW8A 4BWMA 3P3GA 2KO1A 2CQ1A 3HHLB 3M8QA 5FWKA 1Y3KA 3M32B 4WKYA 4C6AA 3D66A 1YJRA 2HIQA 1M1KT 1FA0A 2GMHA 2O66A 3D6FB 2CPDA 2RH3A 1WC3A 3MMJA 2BANA 3GILA 2XY7A 5DETA 1H0HB 1OYRA 4MIWA 3HHDA 2H4WB 5LJ5Y 1UVIA 1Z4UA 3PM9A 5DGAA 2XYHB 3EX7B 3M7NG 3R3TA 4NZ6A 2AGPA 2UXCJ 4PXCA 4B17A 2VJVA 5GADI 2HWTA 2IDLA 3U27A 1LEOA 5FJ4A 4KHPF 4RL1A 2OSRA 1F3VA 5KT6A 4PKDB 2VQFE 2QX0A 5FIIA 1FDDA 4XTTA 2V4JA 2MKCA 2W8KA 3N5BA 4P9SA 2OFHX 4UY85 3CJ2A 3LH2S 4RW6B 2IJNA 5KG3A 3HX9A 2EVZA 3M9MB 1HBNB 2V8VA 4MYTA 4LCFA 3F41A 2PFDA 4PWWA 4KO0B 4UUWA 1B7YB 3FMBA 2W4CA 4Q2MA 3SQGB 4M5NA 4IFDD 3PZPA 1NZ0A 2J9DE 4Q45A 1F6TA 2DNHA 1NK5A 2N3LA 1PIEA 4E98A 3PKYA 1XNRE 2XWYA 4QR0A 3K57A 1PC4A 1FNMA 3Q2SC 1KOHA 1K1SA 1HWKA 2NPIA 3QQCD 1OYEA 3GJQB 3O3LA 4RLEA 3MF5A 4IG0A 2KJVA 4WYWA 4WFYA 2H9ZA 1FKPB 5KG2A 3SEOA 4YEAA 5F0UA 1Y6ZA 5HQLA 1KQKA 1U2FA 1VFJA 2VBWA 4B3ME 2Y0SD 1U1KA 4CCHA 4C0OC 2IA6A 1I3OB 4OFZA 2VIHA 1XMOF 1KRPA 1FVQA 1RP5A 4QJVA 4OL8A 3DGPB 3O2IA 3HI9A 2YNFB 3CDBA 2YNIB 3BH7B 3CF5Q 4DF8A 3RB0A 1QJHA 2HIYA 4YR0A 4NCGB 3DDKA 1J5OB 5F41A 2MQPA 3CB4A 2JEGA 3F44A 2ZZTA 3P06A 1R8HA 2E5LI 1SC1B 4RBTA 1UKUA 3GQCA 2C2ZB 4Q5VA 5HBMA 1HNVB 4K4UA 2HBRB 4I68A 1RBLA 2QTWA 1UPPA 1Y00A 2DIUA 5C7PA 4HVZA 1QUPA 1I94I 2FJEB 4WUCA 1U8SA 4CDIA 4M5GA 4NL5A 4LF9F 4IZJD 4OLOA 1SL0A 5A6WA 3IS9A 5CH7B 4LPFA 2UVWA 1GXUA 3DLKB 3CUNA 2FLLA 2V68A 4PCQA 1S1VB 1BC6A 3Q2TC 3EUNA 3LP1A 4ZPBA 4KPCA 1N32J 3EGWB 4R5PB 5EDWA 1QVFR 3MWBA 2VHGA 2DGSA 5J2QA 2V9WA 2ZKUA 2VG6B 2QFIA 2ERRA 5L1IA 4J3DA 1HQUB 5E3PA 1RWMB 2CNLB 2IERA 1U1PA 3PS2A 2QMUB 3MUVP 1RT4B 3I96A 3CWJA 1T9XA 4ILLA 1UVLA 1IM6A 1HARA 4DUYE 4I6YA 2HKEA 2Z2LA 3OXGA 4UOFA 2DGVA 1KFDA 3HJVA 4PQUA 4O23A 3HKZD 5AXLA 4PG8A 1VBKA 1G1XA 4LSZB 5BYSA 4M94A 1HLWA 2VPXB 1LOUA 1TFYA 4LRAA 3OLBA 4OHXA 3D7SB 3MMAA 3I9V9 1WHVA 3MFHA 2EPIA 2J9DA 1CC8A 5ETLA 4NXNE 4OO1F 5LMNI 1VRTA 3CJQA 4UF4A 3MTJA 4Q8EA 4ETXA 3NLCA 3UR0A 1V6HA 3RYLA 4C0BA 5D3GA 3J81j 1FDAA 4CO5A 1MMNA 2CJ9A 1IJFB 4NLXA 3HF5A 3PACA 2XS7A 3W8PA 4JYAF 2MSTA 1RYSA 4ZVRB 1R0AB 4W90B 3PJXA 2BM1A 1ZETA 1LFWA 5HROA 4DR2E 4HYMA 2VJUA 3C14A 3SIPB 1WDDA 2NXUA 3JQKA 3HD1A 3ILOA 4LF8E 4QIVA 3ZZ0A 3I0RA 1MROA 2C2EA 4FW6A 2DNPA 2KTQA 4DLGA 4JI3E 2G9OA 4U7CA 3GIJA 1GX6A 3DC2A 3CJ8A 4A8XA 3G96A 4AQYF 3TAMB 1QVGR 1B63A 2ZHBA 3QRPA 2C3MA 4JI6J 1BXNA 3ZXWA 4GC6A 3UN3A 5L9NA 3QYYA 2C28A 1HW8A 1FO1A 2NPFA 4NPOA 1U1NA 1XNRI 1D8YA 3GIKA 3EM1A 3ENWA 1H7UA 4XPCA 3R1HA 5I42B 4DV2J 3UN2A 4OHVA 4LBIA 3TJ8A 1T8EA 4OX9F 2BXJA 3B4DA 4WE1B 1X4BA 2DHHA 4EBDA 1MWYA 4B3MI 2MKSA 3DYAB 2L9WA 3MM5A 3V6DA 3NGKA 2HZAA 1NKEA 1WDTA 2DR8A 3CCQS 1L3TA 5B0AA 3BPSP 5A2QQ 2OMOA 3CO0P 2CQBA 3R97A 3G6VA 2FGOA 4NLWA 1XHKA 2FJWA 1TU0B 3DU6A 3TZYA 3QLHB 2BR0A 3L3CA 3TP2A 4M63A 1X9WA 3MM7B 2AJFE 1HI1A 4N8OA 3HULA 5DG8A 4J9KA 3MM6B 3GR0A 1TMMA 2GGPB 5CYQA 3M1VB 3V4MA 1WG1A 5KFBA 2ATCB 3POTA 2XSJB 4Y2KA 5ETVA 3CD5A 1UMJA 1NJXA 2ZM6F 4B3SF 4GC7A 5D8HB 1UCNA 1FKOB 4ISAA 2PNZA 3QWUA 1N5SA 2EFVA 2LVWA 4CWBA 5LM7E 1NM2A 2CQHA 2W7OA 4PRXA 5C25B 4NLOA 3CCMS 2YKAA 4KV8A 1N33J 2PNMA 3MR6A 5ADZA 4GRSA 2N4CA 2XZTB 5LSOA 3IR7B 5F3ZA 3Q8VA 5HN0A 4JI4J 4ECWA 1RTJB 2E66A 2NN6F 3IO1A 2MKYA 1X4CA 1S5ZA 4PG4A 4LMZA 3TVKA 2KJWA 4TY8B 1JXEA 5I3PA 3VWSA 1J5EJ 1FXDA 2VBYA 3UDLA 2JLGA 2CDRB 4AD6A 3KRNA 3NAIA 1QSSA 1FVSA 1FT8A 4EFAC 4JI5J 1L3VA 3UNGC 2FLOA 2GQ2A 5BXIA 2Z5BB 3GFXA 3IAM9 4OHZA 3IFEA 3I56S 1KR4A 1CULA 2B43A 5GMDA 1QSLA 2QRRA 4TYBA 3VGTA 3UR3C 1FTRA 5FLXU 3CCVS 1ZOTA 2KXFA 2WONA 2X1FA 4QR1A 4FS2A 3D0GE 4LBPA 5CYMB 2R8KA 3RZAA 4DPYA 4DUYI 4U3BA 3FSXA 2BOAA 2X1BA 2VA3A 3J7AN 2HVIA 1JKHA 4ECZA 1OQ3A 1FRMA 2WHOA 1CJTA 4ECQA 2RUSA 4YUDA 1RTIA 4X64I 1S6PB 4IZKB 4YOEA 2VONA 2FPHX 4LFBF 4RJVA 1TKDA 1RT2A 3OUYB 1F3FA 4MT1A 1M5SA 1GK8A 2ZBCA 4WFBQ 2DK2A 4NXNI 4UQTA 1S9EB 2DB1A 2LCWA 3DRSA 4LRCA 2XTJP 4ECTA 3HDSA 1N36F 2Q43A 4QU7A 4RW7B 2HLTA 3OFHA 4X65I 5D4LA 2ZH8A 1UETA 2D74B 3TNVA 1W26A 1CJUA 1JIHA 4K50A 1X0PA 1HHQA 2XQCA 1CVJA 4DR2I 4G1IA 4ZCMA 1X0FA 3EGZA 4XTJA 4LF8I 3L7UA 2IJFA 3MPVA 3Q8YA 3QZ7A 1IBMI 3S1TA 3H0PA 4NLRA 5KG1A 1UA1A 2HGNA 5ETSA 4JI3I 4ES1A 4LF1A 1JJHA 4XDCA 4MTPA 1BUXA 3GMGA 2MSSA 2CQPA 2RUGA 4QIGA 3U1LA 3M8WA 2VC1A 2JZ5A 3I5CA 3L95X 3SV3A 4CLYA 2QSFA 2FGCA 1D3WA 3G86A 3ZC4A 4DL6A 2GVZB 1JQGA 1U6FA 3FQKA 2W1BA 2DNRA 1UA0A 3DRRA 5IC4B 4QBUA 5B0DA 4UOGA 4HHJA 5DDRC 3C6UB 5DG9A 5BR8J 1W2BR 2AYMA 4A46A 4LRDA 3EDRB 1UW4A 3HSGA 4C48A 2E5LF 1LQ9A 3HHLA 4LRBA 2CIMA 3AHPA 5HATA 4FWDA 3C15A 1RU1A 1K0VA 1Y60A 3EPGA 5C42A 3M32A 1Q95G 2F4VI 1QTNB 1N34J 3NP5A 1VRUA 4QPTA 2MJUA 1NHUA 1JLCA 5K8OA 2VD3A 5KFMA 5KT4A 5IT9C 1I94F 3Q1QA 3Q8PB 2IVYA 3V4IB 4LF4I 4DFPA 1CJKB 1PKPA 4B08A 5C0XF 4I67A 2XM3A 1YDLA 5SUHA 4F7VA 4Y65A 3P45B 1SKRA 2BW7A 1TZ0A 3SFUA 2U2FA 4HLBA 1Q78A 1N56A 4DFMA 3DOKA 2XHCA 4M8LA 4AL5A 4C11A 4DR3J 4Z7YA 1GTEA 4MKVA 4DR5E 2JEJA 4P2XA 4P73A 5M2UA 4B9SA 3C46A 4RW6A 1SKWA 3MECA 2VASA 1XXEA 3ZTSA 3GYGA 3QPIA 2VQEE 1HBNA 4ZHRB 4OHYA 1TKTB 3BYPA 3FNNA 4K7QA 3OXFA 3IRWP 3N5FA 3HFKA 3JQJA 4D3HA 2HZCA 4CLZA 5DLFA 3SQGA 5BYRA 1HBMB 4BA1B 3FRYA 2E5HA 1FRLA 1TUWA 4QW8A 1I51B 3H2UB 4DR7J 2MZRA 3K0JA 3CDJA 2HS3A 2GVDA 1XNQJ 3DOLB 5D4PA 3UNYA 4X4OA 1NPRA 2EG1A 1NDLA 1HNZE 4USJC 3C16A 2BRLA 1LWXA 2CWKA 1C1BB 3QO9A 2BA1G 5B0BA 4K5SA 2MZQA 1S0OA 4JV1A 4RW9B 1HWUA 1QE1B 3P3EA 2A2CA 4FW9A 2NQPA 3TJ9A 1RT6B 2P9GA 1N6QA 2IHR1 1ZZNA 2ZH5A 2YNIA 2OKQA 5T7LB 4DV5J 4L75A 1UEUA 3HHKA 2GCFA 4FWGA 1VISA 1OQ6A 2YWWA 3W9IA 2HSEB 4NCGA 1IQZA 3IMQJ 5J1PA 3PX0A 1YG0A 3KNGA 3VV2B 5JUMA 2J9CA 4OKGA 3GYNA 1HNVA 3GJRB 3H2LA 4DPTA 1MLAA 3EXCX 5ITHA 5KFPA 4I2QA 4IDKA 2HURA 4NA2A 3THTA 5KG0A 3KDOA 3G6XA 4DV4I 3H1CA 1TL3B 3IWLA 3OJSA 3FJ2A 3NBPB 4ECVA 1XNRF 1U6ZA 1ROFA 1T9TA 4YHHE 5KFVA 3T9ZA 3M8SA 4GKJE 1SJQA 3OL9A 4I6AA 1HFEL 1EQ0A 4YMEA 3MD3A 2Q6CA 2EXUA 3NRBA 4DV1J 1D09B 2EK1A 2V69A 3MCNA 5KOWA 3W2VB 2Y9HA 4X62J 4C3LA 2WB4A 4B3MF 4R5PA 3CJ0A 1IJEB 5EKWA 3Q24A 3JAMY 1MMDA 4TU7A 3KXDA 1RHQB 3H42A 3ILIA 1M5KC 2W4PA 1NJIT 5E0OA 2BMBA 3ZTRA 2VESA 3HKMA 3I6PA 1FF2A 1T9WA 3L9ZA 2UUBE 1YRUA 2FHJD 3NGRA 3B82A 3RRGA 4UY8T 5JEAC 1PAEX 1U09A 2ZH1A 2GIRA 3QIPB 4ZCLA 4G1QB 2COLA 4DPOA 3EZ5A 1FK9B 4HDGA 3ZZTA 3HHNB 4QWEA 3AOCA 4LFAJ 2FVSA 1BGXT 3QT7A 2YKPA 4HXZA 3IGVA 1KLNA 1O0PA 3B54A 2UUCE 1NO8A 4LF7E 1N52B 3MR5A 1U1OA 1OY9A 2EFGA 2QZ8A 3NNCA 4NXME 2RNEA 2E1RA 4A8QA 1DY3A 2KT5A 2QC3A 4DPUA 2FHKA 2MGZB 2OFGX 2ZVIA 3KHHA 2AJ2A 4ZVUB 4PZVA 3UDCA 4PPDA 4JG4A 4NBQA 2HNDA 1PJ7A 2D3UA 2NREA 1U49A 2WVDA 3M30A 1SQEA 5F8MA 1A9NB 3JS9A 4DR6I 2IM2A 4YP3A 2V63A 1X60A 3TR5A 2W8LA 1LXJA 2JLFA 2PD1A 2UUAJ 2DISA 2E1AA 2H54B 1U25A 5GAHU 1NK9A 5KG7A 3H5YA 1QTMA 2C2DA 4IUFA 4DWIA 5B08A 4DCOB 3CDEA 2PFFB 2VQEI 3SCJE 5JJBA 2YPZA 4USMA 1GMVA 2E1MC 5E41A 3WU5A 3ET6B 2KKHA 1DQAA 3TAMA 3BDPA 2PO1A 1T05B 1W25A 3IG1A 3U1YA 5DRRA 5K5MA 2QGFB 4DUYF 3ZM7A 1V9OA 5MLCV 5KFNA 5D0GA 1S49A 1SPBP 4CP5A 3MPDA 4X64F 3BSNA 5A2QU 2N3OA 5ELWA 4P52A 5DRKA 2I9SA 5I42A 1HNZI 3HVAA 3J81Y 2XS5A 2ZE2A 4DR4E 3KTQA 1IKXA 4WZMA 4DG1B 3UW1A 4QIFA 4WE1A 2PO4A 4Y2MA 3GSIA 4NXNF 2F5GA 5B09A 1GMWA 4FF1A 2IM3A 1YSJA 2GZOA 3RB4A 4YB6A 1Q86T 3BJYA 4DOZA 1IKVB 4I4BA 4X65F 4C97A 3HFVA 1NPPA 2M4MA 1ZS6A 1S0NA 4HY1A 4P75A 2AP6A 3MCOA 1CEZA 2OTLS 2XMMA 4OI2A 4OI1A 4C4WA 4JI7J 4DR2F 2HQGA 2DVIA 2BZ2A 4C8ZA 4NRTA 4QNKA 2B6AA 2C38B 3MM6A 1REGX 1WF0A 2WTFA 4LF8F 4S0MA 3HVTB 1VS3A 4DQRA 4KGXB 3RW6A 1X9MA 3NMRA 4JI3F 5DNLA 1RT1B 3AD9C 1FHTA 1EAYC 1YLXA 2FZGB 4LSLB 4OX7A 1U6BA 1HI0P 1FKOA 1NMEB 1A6FA 3Q6NA 2XC9A 4ZP6A 5DQIA 4DV7J 5RUBA 2YBVA 2KM8B 2JEAB 3MMBA 4WK1A 4B3TE 3M7ND 2JH3A 1JLAB 2ROEA 2VF3A 3U1KA 3M6UA 1E3PA 1P9YA 4YHHI 4OYXA 1T0TV 2YNHA 4GKJI 4DL5A 3QATA 3E2EA 2H1YA 2YWFA 1CPZA 3AA8A 3WDOA 1HNXJ 4TY8A 4ZA1A 3O8WA 3EVWA 4Y00A 2UXBI 3OLAA 1Z0GA 3LAMA 1XQIA 1MWQA 2EFQA 2F4VF 4PR6A 3ZTOA 2BBEA 2XMTA 1IBCB 4MU1A 3GFHA 1Z0EA 2B4OA 2H48B 2B9YA 2D3ZA 3CDAA 2JEIA 3LW5C 2IDEA 2VUGA 4EO6A 4JOUA 4LF5E 4LF4F 4X84A 2EFPA 4IRCA 5ETKA 4MAKA 2LEBA 1PJ6A 4WFAQ 1R8CA 5DDQC 1HYSA 1H7XA 1UJ5A 3M2RB 4TU8A 2D3O1 2GIQA 1V5IB 3ADAC 4OO1B 4IZKA 1FJGJ 4NLUA 5KFLA 2XMJA 2UUCI 4CO3A 4LF7I 1NHKL 3PFEA 2V9KA 3RBDA 4HT5A 3PRVA 4WU2A 3EWGA 3E01B 2PMHA 4NXMI 1VQKS 2KT2A 2JEFA 4BC7A 1S9EA 3K5NA 4O3NA 3AA9A 5I3QA 2DNMA 5CXTA 1NDPA 4AM3A 4EU0A 1XR6A 3CC4S 3PS3A 5HI7A 3DFEA 2VFRA 2MZTA 2KH9A 1KVJA 3HJFA 4LT6A 1I1GA 4GKKE 2Y8WA 2DGQA 4CLPA 2DNNA 5ETTA 5MAOA 1V3RA 3OT9A 2M2BA 4M1KA 4X4SA 4OYZA 3AD8C 1XMQE 2HHWA 2E44A 4IFYA 1JLBB 4JI0E 1XJWB 2RB7A 3BGUA 3OSNA 4RUAA 4K4YA 5SZTA 1Y5IB 1H2VZ 4C8KA 2APOA 5E5NA 3DMJA 2F4FA 1T3OA 3FVYA 4DV0E 4LFCI 2GVZA 4BA2B 2DXFA 2BQ3A 3T1HE 3DI6A 1VBYA 4I3HA 2BJ7A 4OO1D 4FN5A 1B62A 3V6KA 2RRBA 4OLPA 2VDIA 3A8KA 5K20B 2Z4PA 3T6JA 2RF2B 3W61A 1TQLA 4DX6A 5FDLB 1WC5A 4DR4I 4IH5A 4DR1I 3HLUA 2RKIB 2PE8A 1Z0VA 2PSZA 2ACYA 1FFGB 1RI7A 3AJ1A 3JTNA 3OR1B 2JC0A 3KHLA 4IFDC 5KFDA 4ZJLA 4PQAA 1ZM3A 2W4DA 4URGA 2LYVA 4DV6J 3MR7A 3QBCA 4B3RJ 3D4JA 3OL7A 3BKTA 4OZLA 2LXUA 1O6XA 1SC3B 3H98A 4NMXA 7AT1B 1XC9A 1UWBA 1OYSA 5KT2A 2DEJA 2NLWA 4A8WA 2AMCB 4KGVB 2C3UA 4TLRA 4DX5A 1NKCA 1PGZA 3Q8RB 1HWLA 1RE1B 3EGNA 5DRQA 4EGLA 3WX4A 1F5CA 2ZWPA 2DCLA 3IXQA 3IWXA 2MQMA 1EETA 4CH7A 3FGVA 3MPYA 3TA1A 3Q8SB 4O3SA 2NN6B 3PIOQ 4A47A 1Q8IA 1FI4A 4C2MA 4WWSA 1T9UA 8ATCB 1LW0B 2H5IB 4ZHRA 2AX1A 2RJZA 3ZO7A 1TKTA 4L72B 1EKSA 2EW9A 3P96A 1BQNB 1Z5BA 2MY7A 1NZAA 5HMXA 2CFXA 1RADB 1VQ9S 5KFFA 4KIAA 2DIVA 2HHTA 1L5UA 1Z2ZA 4CLSA 1TV6B 1Z0TA 2MQ8A 4GVBB 4TNOA 1H73A 2UXCI 1X4EA 1Y7PA 2AV5A 3TUIC 3TANA 2JDJA 2RRAA 1AYEA 5J2MB 4N3OA 3KUEA 2DBBA 3M2VA 4OZNA 4WP9A 4RR5A 1N0UA 2AGQA 2CPJA 3EZUA 1FD2A 2J6SA 1HMVB 4J90A 2WW4A 1RTHB 4M5DA 3TA0A 2BM0A 1NH7A 5F8LA 1FRJA 3EYZA 4X4VA 2OD6A 4I56A 1U1QA 2XG8A 1QE1A 1CBKA 4K4TA 2YXLA 4ZN3A 1KQGB 2KFZA 2RRNA 1HNIB 2CXEA 2NUHA 2HK3A 4DR6F 1HD0A 1Q7YT 2FY1A 4JI6E 2Z5EA 2JE6B 5KFQA 5T7LA 4CTAB 3OTEA 4ZIVA 3MCMA 4MK7A 1TAQA 3EDQB 3M8QB 3M05A 4QQBA 3UDEA 5DDOC 2NN6D 3LWMA 3GV8B 1RJJA 3LANA 1WHWA 1GNKA 1RWPB 2GAGC 4PXDA 3US5A 3GZ7A 1RGVA 1JJ4A 2VQEF 3KKFA 2BANB 4NRUA 5KFIA 4E2FB 2M3DA 3OR2A 4ZPVR 3CJTA 4OMFG 4Q7AA 1TL3A 2HHVA 2CNOB 4FYVB 1QAYA 1LWEB 3K17A 4RUBA 5HVHA 3ZZUA 3EVOA 3N6MA 2QE5A 2I2YA 4GQUA 1HNZF 4KFBA 2WCXA 4QYZJ 4OX6A 3AY0A 4IH6A 1Y10A 1XWLA 2LECA 1NHJA 4U95A 4Z2XA 2J0XA 5KFCA 3R6LB 3FCVA 4HACA 1P1LA 3MAHA 5D78A 2ADCA 3ISZA 3G87A 3G82A 5KTQA 5A8RA 2RS8A 1IKYA 4KJIA 3A12A 2JL9A 1B3TA 3UI3A 1JK9B 3CT9A 1Y5YA 2ZOFA 4DV0I 3AD7C 3OTOJ 3TUZC 2V8GA 2RHSB 3TARA 4ZP8A 4OV6A 4PG7A 5D15A 1DRZA 5B7WA 4YB7A 1KVIA 1HNWJ 2LQ9A 1NK4A 1I5OB 1S59A 5KG4A 3D67A 3QIPA 1FK9A 3N0VA 4U7UD 3BZQA 2YKMB 2VL1A 4IG0B 4F2RA 4DZ6A 4KH0B 2VDHA 2OTJS 1WOOA 2FD2A 1DBDA 1XIQA 3NS7B 2JSXA 5KFAA 5C0XB 1RT7A 1ACMB 4RNMA 2F63A 4ZJOA 4AUKA 2CJQA 3V6JA 3FMWA 3JAMC 1NSPA 1SJ4P 4JI5E 2KFYA 2BJ1A 4O44A 1RA6A 2WVBA 4XK8C 1KN6A 3I87A 4HYKA 2QYCA 1RHKB 4WPAA 4YHHF 2BVZA 1KHVA 1UEKA 1NZ8A 4GKJF 2XCAA 1L3SA 1EARA 1RAEB 4N77A 5E3RA 3TO8A 3G6YA 1FX2A 3VAGA 1ZTTA 3C8YA 1C0UA 2EBEA 3KNAA 4TN2A 2FVRA 5HBMB 4LFBJ 2L9DA 4LF6J 4FPRA 2RILA 1RT3A 2MHEA 3NKYA 4TVAB 4X66J 3P6YC 3CTRA 1AB8A 3EGVA 2X3DA 3W66A 5IT9Q 4CO1A 2HFSA 3NCRA 1HHTP 2UZAA 2V8PA 3L4BC 2JNJA 1OY6A 2V4QA 1BWVA 2HHHJ 2FLPA 3A3NB 2UUBF 5DO2A 1VQSA 1N36J 4RW8A 2CPFA 5KT3A 3SYZA 4ECRA 1T05A 2PEHA 3IS9B 2CYYA 4USVA 1RWNB 2HVDA 5IM0A 4MU0A 3M8YA 2R7RA 3LP1B 2ZBKB 2M7SA 5ETRA 2W9AA 5C0XD 2K3IA 4LIWA 4AL7A 1RTDA 1M1HA 3PJ9A 2Y1RI 2UUCF 3RB3A 4LF7F 3VAIA 3T5HA 4CQ1A 1KQSR 3UCGA 2E9RX 3LPSA 2KFNA 1JB0C 2QIFA 3AQPA 2KYXA 4NXMF 3IBFB 3LF0A 1BLUA 3JSMA 4OZ5A 2C22A 1R8PA 3PR5B 5GAGU 1Q81T 2D7SA 4H4OA 1YVFA 4G1PA 2IRUA 2AJQA 4WF9Q 1IKVA 4LSNA 8AT1B 5AXNA 2QMXA 3Q86A 2MYFA 2DNGA 4PQUB 3G6ES 1VBZA 4JI6I 2ZH3A 4AIMA 3MEGA 4MFBA 3SSQA 2E5JA 2C38A 4KH1B 2I1RA 3Q0AA 3HVTA 3M8RA 3MMAB 4DV2I 5L1LA 2WVEA 1RT1A 5DS7A 1VRTB 4HR2A 2HGMA 1TL7B 1HR0E 2WRMA 1ZAVA 3D28A 5D3GB 2ZJPQ 4K2JA 2JEAA 1R3NA 3NWGA 3A3PB 4LFCF 1X31C 5HQ8A 2V67A 2BRKA 3MPWA 3WC0A 1FFWB 3PRYA 4DBQA 2ALZA 1JLAA 2MLZA 2ASDA 4QYRA 5HROB 1JJ2R 4G65A 2VFTA 3HVWA 4FVMA 2AZ3A 4DR4F 3NNAA 1HA1A 3MEDA 4UOHA 3I0RB 2LP4A 2HBYB 3D0HE 2ZM6E 1RCOB 3VAKA 2DPJA 2OUGA 4JI8J 1WJ9A 1PSDA 4NASA 3J7Z5 4DR3E 3KG4A 3D0IE 3DDIA 4NI2B 2J5AA 3TOQA 3CE8A 1OPZA 2VKRA 1S79A 2N82B 2OHDA 5LOQA 1F9HA 2YKNA 1N33I 4ZDNA 2VV5A 2NYHA 3BM7A 4IG3A 4JI4I 1SQGA 1FJ7A 3M2RA 4L76A 4EI2A 1YGYA 4NCBA 1K1QA 1ZH5A 1N48A 3NZKA 1J5EI 1AROP 1WOPA 2ZNYA 1X5PA 2BA1D 1XNQE 1DTQB 1PKUA 2BKNA 3E01A 2DRBA 1TL1A 4CO2A 4QNJA 3I4HX 4JP8A 4QOTA 3LA0A 4JI5I 4B3TF 2C39B 2ZKTA 4A8MP 5CQGA 4ZP7A 2M8HA 2P6TA 3A4TA 3EXYA 3ZZRA 1NBEB 4B3OA 3LALA 3WQPA 2KXHA 3AQOA 3W5XA 2QA4G 2KRRA 2A2DA 2LLZA 5A8KA 3OSPA 2V2KA 1WSVA 2IRYA 5CYQB 1ZM4A 4MKBA 3WU4A 4LCGA 4PYAA 1FWKA 2UXCF 4K5RA 3FBEA 4DDFA 3IP0A 4DV5E 3QMQA 2VQFJ 1RHUB 2ZJQQ 5HJYA 5JVGQ 1JXVA 2MQLA 1YTYA 1JLBA 4IOCQ 2DGXA 3CVKA 4NLTA 3ISND 4KV8B 2VC0A 4C98A 4LF5F 3H4LA 3K58A 1MU2A 1Z1ZA 2L3MA 2FY8A 4USIA 4NYPA 3QJLA 3MUTP 3PYEA 4EEYA 1N5YA 3R5JB 1QZRA 3CMQA 4BA2A 1UWAA 5F9LA 3UO0A 5EWEA 2CQGA 2JHEA 1MX0A 2E7XA 1SC4B 5FDLA 1UJ6A 3I55S 1SJRA 2CPYA 3CW2C 2RKIA 2HS0A 2YWKA 3CCUS 1NAQA 4FW4A 2BE9B 1VQMS 3OR1A 4ZVSB 2KG1A 1CULB 1WF1A 2PT0A 3CCJS 1HIYA 4H4MA 3MM9A 4DV1E 4N56A 2QO3A 4WCEQ 4H54A 2WONB 4BCAA 1NU4A 3GPAA 4O4GA 4OIXA 1RTZA 3MEEA 2C2MB 5FD1A 3H40A 2HWHA 4PYDA 2YNGA 4GKKF 3D6MB 3O5TB 5LL6d 3RG6A 1CJTB 3NOCA 2Y1JA 3J7AM 4ZOSA 4KGMA 2PO0A 5EWFA 3T5LA 1WI8A 3U7JA 2XNQA 4MK9A 1RT2B 4PWUA 2DGWA 5K14A 1FFSB 2XLIA 1XMQF 3FDSA 1T3NA 2NXEA 3T5JA 3G9CA 3QIDA 5LJ3Y 2HFNA 3CWVA 3N6NA 1FDBA 5DROA 2MHNA 1HR0I 1MNEA 3PO4A 4NA1A 2J6TA 3AAWB 3K5PA 1RAFB 3KK3A 1BQMA 3NCQA 1TELA 3MM8A 3A8JA 4DV0F 1N34I 1LW0A 1NNDA 1HQEA 3KLIA 3I9ZA 4JBCA 1V3SA 3T1HF 1CJUB 1Y9OA 2J7KA 3S6EA 3KJVA 4ZP9A 1SIWB 3PYFA 3OL8A 1BQNA 1IBKJ 4C8OA 5CA5A 1DAXA 2Z2YB 3W60A 2GQQA 2XBPA 4WFNQ 1U48A 3JSRA 2Z2ZA 2J65A 4ZVHA 4ENOA 2G1HA 2MKJA 3H25A 2XY6A 2DRDA 1DZ5A 4MQYA 2VPWB 4G6VB 4ANCA 5HMYA 3WU6A 2R7QA 5J2MA 2C1EB 1TR0A 1N8RT 3RRKA 3BREA 1DTTA 3IRXB 4DR3I 3QJPA 5IWAJ 5H9EJ 4M5HA 1U8WA 1QSYA 1T02A 4DL7A 1DFDA 1G4CA 5DNXA 3DRRB 2CG8A 4OJGA 1PAUB 4AL6A 2I8EA 4WTOB 4AXIA 3CCRS 4FXWA 3H20A 2NSCA 3RBZA 3ENQA 4A48A 3PEJA 1HNIA 2IM1A 4EK2A 3W8GA 2VG5B 2VU5A 5KFEA 1NXIA 2F40A 3NNHA 2RE1A 8RUCA 3ILJA 2R7SA 2P2CB 2J8AA 3D68A 2WBRA 3C15B 1XNQI 2ASLA 2VB6A 3VVUA 3GR1A 4A8FA 5C42B 1XN9A 1VRUB 1MSWD 1NSAA 4U3DA 1JLCB 2HEKA 4IO9Q 5LMNE 2RQMA 3OVSA 4P2SA 2FZKB 4ZCKA 1UDOA 1P6TA 2ZDPA 3I82A 4NLYA 2QV6A 2ZH4A 1SH3A 5CAAA 1R8AA 2MJNA 2DNKA 1PVGA 4KAIA 4FYWB 1U4BA 1EA6A 1LWEA 3ONQA 4E8UA 3DOKB 1NUEA 3RAQA 3TUJC 2LA6A 4I7FA 3VTIA 2IAJB 3O1LA 2DR6A 4ZVGA 4C11B 4KQVA 4DV5I 2DD8S 3NMAA 3H90A 2MPUA 2E7VA 1M0SA 3T1AA 4JI7E 4C9DA 4RNOA 3MECB 2KN4A 2FJAB 4Y0FA 5K36E 4Q8FA 1YJVA 2XSFA 1PYTA 4FYDA 2XMWA 3L7PA 2YQ0A 1PG5B 2GNKA 3GTYX 5F3TA 1K8AT 2IM0A 1VMBA 2BE7D 4HH1A 4DCPB 1N0VC 3VZIA 3ETOA 4DV7E 4ETZA 1Q4RA 4M5IA 4JI6F 1S6UA 3HHLD 1KP6A 3VF0B 2GVDB 1D9AA 5IT4A 2PC6A 5K36C 3MI7X 1KVKA 3KG1A 1R0BG 4MU3A 1H7WA 2JFDA 5J1EA 4PAAA 3C16B 1P8GA 3K8WA 2YKMA 2LMIA 2AIRB 1SV5B 2R42A 3QO9B 3QWPA 1SKUB 2F7VA 1FNOA 2GQ0A 1EP4B 1HPZA 1HNXE 2EWHA 3JXOA 3BEGB 4DV1I 4AIDA 5C0XA 2GJFA 4X62I 3G71S 2CPIA 3KYLA 1N6QB 2CZVC 2G2YA 3D3CJ 1QAJA 4USTA 2WOMA 4DCJB 5K8MA 3BGRA 3GCWP 4WFZA 2ZBQA 5IQQA 2CVIA 2BKOA 1H2TZ 2AX0A 2HFUA 1QM9A 4X2BA 2OAUA 3TZWA 1RHYA 2N4DA 4LFAI 1BY9A 1M5HA 3BBBA 2B51A 1B4SA 2V6AA 1FTCA 4I2QB 4NOHA 4IDKB 1FJGE 3IGNA 3JYTA 3RJMB 1BE4A 2MLXA 1AT1B 3N01A 3X1LB 3R6GB 1WG4A 4HTIA 1N5VA 2VFSA 3DLEA 3DGVA 4OI6A 2FYXA 2BA9A 4ED0A 5C24A 4M5JA 2NXNA 4F3QA 3I31A 4ZLPA 4X4TA 4DF4A 1N33F 4ECXA 2ZD1A 6FDRA 5DZ7A 1S6OA 4JV0A 1NJYA 1WOSA 4FXVA 1ZPWX 5AT1B 3R7SB 1NKBA 2QLXA 2C3YA 3BB5A 3ZZPA 1YJWS 2FDNA 2CQDA 1RLCL 5A8WA 1S1WA 4CO0A 2UUAI 1ITPA 2KYZA 1TMJA 4TKTA 2B4UA 1QAXA 2XI2A 3KLGA 4J9VA 4DSKA 2V2QA 4JI5F 1NK7A 1LWCA 2M88A 5AE1A 2IMWP 2A18A 3J80Y 4ZPCA 1PCAA 3PG9A 2RDJA 1EIYB 4N47A 1BQXA 4IOAQ 4P7TA 3KMQA 2CPHA 2DHAA 4QWBA 5H1SV 2FC9A 2AGOA 5K36A 2K2PA 3R9LA 4X64E 2GIFA 1S12A 1UDQA 4L3KA 2ZUGA 3PHEA 1ICEB 3RTVA 1PBAA 3UWTA 1FNXH 5E3CA 1SH0A 1OWXA 2ROPA 1YJTA 2DGOA 1NK0A 2EC2A 1TL7A 3OL6A 4CLKA 3UCZP 2VA2A 3B6BA 2Z2MA 4DSJA 2GA7A 5HO4A 2VOPA 2HNDB 4KGKA 5J2PA 2JLEA 2Q66A 3M30B 2RT3A 4K4SA 4X65E 4BDPA 1NPKA 1TUGB 4DV6E 3R1LA 4V19J 4B3RE 3EPIA 1E6YB 3BQ1A 2XGQA 1MG7A 1FE0A 3SV4A 3NEKA 4U6PA 4JI7I 1IKWA 4JUZA 1Z5AA 1IUJA 2LKZA 4URSA 1IBME 1YJNS 4IFVA 3OFFA 1JLQA 3PCOB 5KG5A 1HBOA 1NEEA 4PABA 2WBMA 2J7UA 2BABA 3L09A 3P49B 2X51A 2PO1B 4OYPA 3IG1B 3OBIA 1B70B 2GJ2A 3M9NB 4NI2A 3KLFA 4L6V3 1GX5A 3ICLA 4LIRA 2RU3A 4DV7I 2W2QP 4V19X 2HRTA 1R6MA 2CRLA 4OZ1A 3FRZA 1RR9A 2M8DB 3FC9A 3MD1A 2ZE2B 2R2UA 1IKXB 2V2ZA 3R8YA 1H98A 4WKRA 3M2UA 4I2PA 2YX7A 2RHQB 4KYZA 4HT7A 4K0KJ 1NHIA 2AE8A 1VJWA 1HNXI 2GMLA 2XI3A 3N9UC 2QMWA 1HR0F 3K5MA 1DTQA 1WACA 1VK8A 1FESA 2F4VE 1MN9A 4P72A 1S1UB 5IT0A 1U02A 2R8HA 5DJBA 3CCZA 3LGNA 2GV1A 1EI1A 2C39A 1NB2A 4P71A 2PIIA 4FS1A 3DLBA 2G1DA 2GS8A 4LF4E 4PXBA 1UZDA 3D1OA 5JEAB 4RKUC 2XHWA 1YH8A 2ZHOA 3CULA 3AXKA 1HBUA 4QYZK 1VQNS 2B6AB 3H8YA 4JV5J 3NAHA 1S72S 2VZ9A 3CIMA 2H5JB 3SSSA 3BO4A 3H5XA 4F0MA 2HLUA 1Y4ZB 4DR5J 3C3LA 1FJGI 3AXMA 4DR3F 3JAMQ 2G0CA 4ED4A 3K59A 4IRKA 1Q0NA 2W2MP 4BHQA 3MMBB 3FSYA 2AJ1A 4U8YA 5C2CA 5GAHI 1BWEA 2QSWA 1IWGA 2YNHB 2AJ0A 3N6LA 1FKAE 5D4OA 2HAIA 5GVQA 3PO5A 2QLJB 3B78A 4ELUA 4PEOA 1U26A 3W1YC 2ZH6A 1GMWD 3OQ2A 2GHPA 3JB9k 1XNQF 2B9EA 1HNZJ 5LMUJ 4OZEA 3JQMA 1UVJA 2FTRA 2ABYA 2IYIA 4KHRA 4M95A 1S4FA 2OPPA 3MUMP 3MR2A 4F8RA 3RU0A 3HKWA 5D4NA 2B8PA 1IBLE 4FW3A 4ID8A 1HYSB 3J7AG 3KFWX 1YRTA 3TQ1A 4LQ3A 2IBOA 5LT5A 3E8OA 3B8HA 3OTOE 3J7ZT 1KFSA 2DO4A 2NS1B 1UFKA 3ZFVA 4DV5F 1MU5A 3GSDA 1HNWE 5EX3A 5KFYA 4KT0C 2ZC3A 2BUNA 1HQ2A 1DURA 1WF2A 2H51B 3W5YA 4KTQA 4OYWA 4IO1A 2F1DA 1DLOB 4DSFA 1U0HB 4DV3J 2HQFA 3R7BB 3W64A 1Q53A 1X8DA 1C4CA 4OZ2A 4DV4E 2FJBB 4DV6I 2HKJA 4B3RI 2PA3A 2MDAA 4ZPWR 5ETOA 1FDNA 2XO7A 4QWAA 2V8HA 3L7OA 1Y5LB 3ZZZA 1T9VA 2IRXA 3CDUA 1RUSA 4KC5A 3E3XA 4OZ3A 1RACB 1RA7A 3J81Q 1RB0A 2FLNA 4IFYB 5KFSA 3VGSA 2HRYA 1X7VA 3IA0A 2W7PA 2WP8A 2MB0B 4DV1F 4NX9A 2H65B 2B9XA 2OO4A 2GX8A 3IRXA 1OSDA 4NYOA 4PUOA 3DMJB 4X62F 4LF6E 3KMSA 5HAOA 1NK6A 3R5CA 2G13A 4PXEA 1HWIA 2R7WA 4FKYA 2Z5CB 3DI6B 5T14A 2UUBJ 4UQGA 3BV8A 1M5PC 2ZEJA 4ED8A 4MU4A 5BJRA 2HHHE 1VC6A 3IBWA 4EBCA 2LFVA 1S48A 5J1NA 4F02A 4A8SA 4JI2J 4CT9A 3DDNA 4GVLA 3TRGA 3DN9A 2VG5A 4O4RA 4ZCIA 3PW4A 3NOGA 1TK8A 3R2CJ 1CJVA 2AJ4A 4PWDB 4GMKA 1RXOB 1TL5A 1FEEA 1NDKA 3HK2A 2ZHAA 9RUBA 2BJ3A 3HP6A 4C8MA 3FKBA 3LUYA 2WSFC 4F0KA 1UWBB 3KJNB 1YQHA 2J6UA 1GT8A 4J37A 1ZTWA 1AZSA 1FX4A 4LR7A 3P5TL 5KT5A 2H4YB 4ANEA 1KTQA 1XERA 1WHYA 2RDIA 2YY3A 4DR6E 2IAJA 3EZOA 3LP2B 3GMEA 1D6TA 3A3OB 1EETB 2HPUA 2QL5B 3HFZB 3HZEA 3KJQB 3MMCB 2Z8QA 2NCKL 2LJPA 1SJ3P 2UUAF 4DSLA 1PJ5A 2OEKA 3RBXA 5EL9A 1VC5A 2E29A 4K2XA 3KK1B 1U2RA 1V3ZA 2ALYB 1QY7A 2DY1A 1U45A 4B02A 1RT5A 1SBRA 5A0YB 2G0JA 3HXMA 2MZ1A 2VKZG 1T11A 4ZVQB 1G7CB 2V94A 3P4UB 3MEKA 2Z30B 2BACA 2C37B 2XMKA 5M2PA 2ATLA 1IXKA 4USUA 3V6HA 3M2VB 4CRJA 2F1FA 4ECYA 3ENAA 2W24A 4C8NA 5F8HA 4JI1J 1SV5A 1BKNA 3W7BA 4X4NA 1YBAA 4WU3A 3HT3A 1F9EB 1EP4A 4M5DB 3VGUA 3L7ZB 5LMNF 3GCXP 3EVMA 1LW2B 3RAMA 4IR1A 4ED3A 4DN9A 3UE2A 5HSPA 1IBLI 2IVFB 4N8NA 2J9EA 4JI8E 1NCLA 1H6KX 3ITHA 3BR9A 4USWA 3SCKE 4M5KA 4NEZA 4BLGA 1DJ0A 2O3DA 3OTOI 2ZFHA 3IWNC 3PXGa 3ZTPA 3DLJA 5G4DA 4CNZA 3BGOP 1RISA 1HNWI 3W5ZA 3BSCA 2AHOB 4JI7F 3KLEB 4X4QA 1XTZA 1K73T 2G2ZA 1M90T 5THWA 4EYHB 4N7TA 3CXCR 1G3OA 3CJSA 2UXDJ 5K36F 3TWZA 5CABA 4RW4A 4IFDB 3N4WA 3HT0A 1WTBA 1T94A 3OR2B 1C2PA 2CDQA 4LUBA 3VAMA 2UU9J 2XS2A 2Q79A 4FP9A 2I38A 4ED1A 2L48A 4QIWD 4QU6A 3HCXA 2A6MA 4DUTA 3ETMA 4B3TJ 3CC2S 4DV7F 4N41A 2X36A 3K8VA 3P8BB 4ZLLA 4RNFA 2V50A 4URLA 2ZOGA 2ZWOA 3IM9A 3M85D 1WNEA 5K8NA 1P9QC 3LOUA 5KFTA 1M5VC 5HP1A 4KFBB 2AYEA 4XDDA 1F5AA 1RBOB 2MY8A 1C0TA 2VH7A 2GO9A 2R7UA 4K4WA 5JEAE 1SQFA 4NEYA 1HNXF 4HACB 1GAOA 1RAHB 5KFWA 1N4LA 1K0TA 2H3EB 3G82B 5A8RB 2HG4A 2UXBE 5F8GA 4LFBI 1IKYB 4LF6I 2DH8A 2CA9A 4EBEA 5HVGA 4AXJA 4X66I 3IN5A 5CCMA 2IYGA 1GXTA 3I5BA 1SVDA 3K5LA 2FIUA 4LF5J 4DUZJ 3GV7B 2CQCA 4CYUA 4TYAA 4RU2A 2HHHI 4Y2AA 3MXHP 3PEHA 1XMBA 1VQPS 4ZLJA 1N36I 2PMZD 3CSKA 3KWMA 3RAXA 2UV8A 3M8PB 1PC5A 3TAPA 1S0MA 1NSKL 4Y34A 2HHXA 3Q89A 1AA1B 3S01A 4NYZA 3H7HB 1S9GB 1OYDA 1F2GA 2NXJA 4RO0A 1V5VA 2YQ1A 3D9BA 2E5IA 1D9DA 1H72C 2OJ3A 2DKOB 3QGPA 2GO4A 1RT7B 4IZJB 1FJGF 3CJ5A 3T5KA 3QNWB 3GLLA 3RUBL 2OPRB 4ZITA 3W63A 1AFIA 3NG8A 2EG2A 2XYGB 1FRIA 1TKZA 3BR8A 1TK0A 4O44B 4K4XA 2OPQB 5GAEI 5BYQA 3VAHA 3QAEA 2KHDA 5CHCB 2OGUA 2XB2D 1P27B 1WELA 4TQRA 4PRFA 2CJBA 4GKKJ 3J80C 2YKOA 1E6YA 2P8IA 1D1UA 3QRQA 4ES2A 1C0UB 3AH6A 3MZIA 4KKOA 2QLWA 1Y0HA 4MYUA 1VOMA 1XBWA 2M0GB 2O67A 3ZNUA 2C42A 4IYQA 1RT3B 2HQCA 5KFKA 5HMWA 3MAAA 1XMQJ 5H9EK 4TQSA 4NZ7A 9ATCB 2IY5B 4JI0J 3BQ2A 2A1BA 1LKZA 2ACMA 4EZ6A 2OPSA 4DU7A 4RW8B 4OQJA 2NUUG 5JXSA 3NGUA 2QEXS 4FYXB 4F4AA 4DV0J 5AE2A 5IM0B 3KJFB 4LFCE 3T1HJ 2J76E 1RCXB 1SI9A 2SXLA 1VGYA 1VRQC 1CQNA 2XGPA 3QGGA 3HD2A 5CD4A 1RTDB 3W9HA 3QSYB 3EE3A 1IBKE 2EEYA 4DR1E 3ISNC 2MXYA 3PR4A 2M70A 3EJMA 3AFGA 4P2FA 4DSIA 1B99A 3JSMB 3NWRA 1UZHA 4YR3A 2QYGA 2VFUA 4C8YA 4H4OB 5AJ3J 4F2SA 4KQZA 3VAJA 3PJWA 3H4BA 2Z0GA 3LGHA 3F0NA 4RUHA 1R6LA 2C2NA 1S1UA 1HD1A 5H9FK 4AFFA 1IWAA 4JI8I 4ELVA 5J2NB 4LSNB 1ZZFA 4OYMA 1FD8A 4ED2A 4DV6F 2KB2A 4B3RF 4IS9A 3JAMU 3T1YJ 5IWAE 2O5DA 5JEAA 3MEGB 4I69A 5HL7Q 3OW2R 1JJCB 4MFBB 3ZTQA 1FEHA 1KD1T 4F4WA 4HI2A 4HDHA 4URQU 5IOLA 3HMJG 2MZSA 2LQJA 2UVUA 3DU5A 4YY3E 3PW0A 2ZZMA 3THVA 1IBMF 1GTHA 2R2TA 3WU3A 1F1BB 2DHXA 1VHFA 4A8YA 2BQUA 2XLKA 3OHAA 2HRUA 5G0RB 3PS1A 4B9LA 2XMUA 3RW7A 4ALZA 2CGEA 1WKKA 4YS2A 4C3KA 3P76A 4Q43A 2DCUB 3C2PA 1LXNA 1Y11A 1R6VA 3GU0A 3BBCA 4RX6A 1WTFA 4FDFA 3SI8A 2HQ3A 1S57A 1T03A 1UDSA 1VI7A 1EB0A 3FZBA 3V2UC 1FERA 1S6QB 1KSPA 2W9CA 4ZPAA 4K8RA 3KK2A 1I6JA 3WX8A 2CQIA 3MEDB 3CCES 3GYXB 1TKXA 1S16A 2W9BA 4DL0C 2UXCE 3M6XA 2CG4A 3FBBA 4KHPJ 1CSJA 2PO2B 1Q7LB 3AOAA 1HHSA 3GIIA 1RHRB 5IXUA 1JLEA 3BKFA 2VQFI 2BJDA 5HMZA 2BJEA 4N76A 3KLHB 2E5GA 3DLGA 5FLXY 2IPOB 2O1UA 1S1TA 2NYIA 2WNRB 3SSRA 4UZBA 3ELHA 4OJ3A 2DT9A 4USHA 3TVZA 2PNLA 4O3PA 4A8KA 4F26A 2YKNB 4CM2A 1GQEA 4IG3B 5HANA 1W2IA 2YTCA 1RYRA 1QAIA 5GAGI 4E0DA 1M5OC 5KG6A 3DRPB 2CZ9A 3WC2A 2ZITA 1F9FA 3DM2A 2VBZA 3QT5A 2HBQB 3A8IA 3UN5A 3LO3A 5DLGA 3NS5A 1U7LA 1UL3A 3UPFA 2BE2A 3W2WA 2MQNA 1TL1B 5DG7A 4AYBD 5E33A 1JNZB 2I0XA 4IQXA 3H5SA 1DLOA 4WP3A 1U0HA 4FVCA 2CQ2A 1WC6A 1Z0CA 3J81U 5K9FA 3SDEB 1BHNA 4ZKAA 2HHPA 2HNZA 1IR1A 2ZOMA 1RDRA 4B3OB 4J9RA 4LR9A 3V81B 2CZ4A 2KHCA 3RGIA 1OIAA 3BKUA 3VR1A 5KFRA 3I0SB 4CZCA 2ZNZA 2GW8A 2BKPA 1XMOJ 5A8KB 2VG7A 1FKAF 4HHHA 3K85A 3T41A 5D0HA 4FXDA 1Z2LA 5HLFA 1SJ1A 1SL1A 4C7QA 4DQSA 4DL4A 4C8LA 1MN7A 1NJWA 4CO4A 1FXLA 1UVMA 2WZ1A 3ZNJ1 2OEMA 3U1NA 4QIEA 2DYAA 1OYPA 3HSDA 2D3OR 4GO5X 1VLYA 1Q5YA 2E1PA 4NE9C 3Q8QB 1RABB 5AXKA 1MU2B 1NSQA 2F8HA 2R8GA 1J27A 4I1TA 2QJ3A 1IBLF 2PGCA 1N5YB 1CC7A 1T95A 3TX8A 4IFDE 4EYIB 2Z5CA 4ICLB 3C6TA 4LOMA 3MTKA 4LF9J 3OTOF 3DXBA 1Q8BA 1REVB 1RHJB 4ZVIA 1IBKI 2IA0A 3NCPA 1HNWF 2K3KA 2V4RA 4RUCA 2OD4A 1OS5A 1EQMA 1Y4UA 4Q0BB 4V1Ak 4DL3A 3DRYA 1JLGA 3NGSA 4ZIWA 1UEVA 2K1RB 2ZH9A 1N5QA 4PWDA 3J7YU 3KDNA 2DEIA 4ANDA 3T9NA 4KB7A 4H4MB 3MM9B 2DNQA 4Y6IA 2R8JA 5EUHA 4YN3B 4OI0A 1N32E 3CDIA 3DXSX 2J0WA 3HHLC 1LK7A 1B0TA 2HHQA 4DV4F 2YWGA 4O4GB 4NMLA 3MEEB 4J9UE 3WBZA 4PG5A 2YNGB 4R8UA 5IWAI 3UVJB 1R89A 4WTYA 1TVRA 2PO0B 4R1FA 4WJBA 6AT1B 4X4RA 2D9PA 1A7GE 4BC9A 4R25A 2EC0A 3J7A1 4YY3I 2XEXA 5I3UA 1WWHA 4U96A 5K14B 3UD5A 2RQ4A 4UW2A 5LSRA 1P1TA 4WK3A 1VK3A 4ELTA 3LP2A 4ZMMA 4N5SA 2P5VA 3DLLQ 2C2OB 1Q79A 5KT7A 1Z5CA 3MMCA 1KQFB 3R5DA 3IM8A 2HNYA 2JEBB 5DZ6A 1JWWA 3KK3B 4LF6F 1BQMB 2GC8A 4DMZA 4X66F 1LK5A 3MM8B 3Q6MA 1HQEB 3KK1A 3KLIB 2J0SD 2DY9A 4B9VA 1HKAA 3KJVB 3GONA 1Q5VA 2UV8G 2K7JA 2BJ9A 1X5OA 2HHHF 3LGMA 5ETMA 5A0YA 4I6WA 3QFHA 5IS2A 5L1JA 4LR8A 5GADU 5LL6R 1FWLA 4JYAJ 2BW2A 1EZZB 4ZVEA 1UFLA 3GG0A 1C1CB 2A0FB 3TEGA 1KBRA 5KFOA 2C37A 2BA0G 1U24A 1K44A 1H74A 3IAS9 4AT1B 6FD1A 5LSLA 3PVXA 3HO1A 4DEZA 1TP7A 3ILLA 1BD6A 1RLDA 1DTTB 3SBMA 2D69A 2MLYA 3GJSB 4O0IA 3M8ZA 3L7ZA 2PI4A 4DX7A 3CD0A 1LW2A 5B0FA 1Q1KA 4YDDB 4AQYJ 1NHVA 4MDTA 1YZ7A 3MOJB 3P5BP 4TU9A 4RZRA 5HQMA 3UDVA 5M2RA 2WK4A 4Z37A 4F25A 1UP1A 2V8DA 1X4AA 2QFJA 2JFKA 4U8VA 5GMKa 3CIZA 3KLEA 2RIJA 1SIZA 3OD2A 1ZBTA 5B0EA 4DV2E 4OX9J 1B7FA 2IJRA 5ETNA 2VODA 4IFDA 3B4TA 2O1WA 1UDNA 3K5OA 4K0KE 1HR0J 3FCWA 2O01C 5JVHQ 1K47A 2B5JB 4MIAA 4USKA 1NJZA 2LA4A 5E3QA 3BPDA 1UJ4A 4I7FB 4TY9A 2NSBA 4DU8A 3PY8A 4MIBA 1Q8KA 1FWPA 2XNRA 5L3JA 4JV5E 2FJVA 2ZM6J 4B3SJ 3QRRA 2OH2A 4O0NA 1Y5NB 2FHOB 3AB2B 3SCLE 4JI8F 2LDYA 5CCLA 5DQGA 4TXSA 4F4XA 3G8QA 4Y2CA 3DOMB 3FEXB 2XMVA 2ZVSA 1N33E 3BDEA 4UZCA 1H38A 1YITS 2ZC4A 4Z7CA 1X5TA 4EZ9A 4JI4E 4KO0A 5J1EB 2Y1LB 3PW7A 3SQOP 3M8PA 5AXMA 2KVQE 4CLLA 4OJ1A 2XWXA 5CYJA 3D1QA 1HPZB 1S9GA 4B9UA 2PMWA 1J5EE 3A1YG 3WIVA 4YFUA 4IZJA 4MKAA 1N32I 2Q6BA 1NLKL 2W01A 2OPRA 5LMUE 1R27B 2HAFA 2HWIA 3BGFA 3FFIB 5C2GA 3QT8A 3HPOA 4MK8A 1LV5A 4X4UA 1FKPA 2ZBRA 2WOMB 2OPQA 1O8BA 3D54A 3BGRB 3MAQA 1YBTA 2W2OP 2AEFA 2LQ8A 1EKRA 4DZDA 2HYIB 2CG9A 1TL4A 5IV3A 3D6HB 3R5AA 5JEAF 1VDHA 3DGPA 3RRHA 2YNFA 3NXZA 4ED6A 3TZXA 3TUPA 1B0PA 4ID5B 2UXBF 4AE5A 1MMLA 4F50A 5L38A 1ZAXA 3P3DA 3JYTB 5HJXA 2H5EA 2VQFF 4RWXA 2PEBA 1J5OA 1KONA 1VJQA 4QWDA 1S97A 3DLEB 1IR2A 4FBUA 2HFZA 1LFPA 3CNQP 5C24B 1JMTA 1YHQS 4WBFA 2Y0BB 4EMDA 2X3GA 2ZDOA 2M52A 2KZMA 2ZD1B 1VCTA 2N7CA 4DV3E 1S1XB 2AQ4A 5A2QY 3BSOA 1F2HA 1XK8A 4DQQA 3FBCA 1PBUA 4J9SA 1TFWA 1AUSL 2FC8A 2ASYA 2YH0A 1WG5A 2HMIB 2A6OA 4QCLA 5A8WB 1S1WB 4UUXA 3UFCX 4KBIA 3PFOA 3DLKA 5E3AA 2AEMA 3R7NB 1CS4B 3MURP 3KLGB 2XZWA 2XZDB 1DQ8A 1S1VA 1CLFA 4RWWA 1ZXMA 1LNQA 3VQSA 3SFGA 2Z56B 1LWCB 4Q2LA 3K7RA 3OTBA 4OV1A 2CQ3A 2F8EX 2F9DA 4A4JA 1RWOB 5J2NA 1GEHA 2AT1B 1YHCA 1XEZA 1JNRB 1R43A 2HGLA 2VG6A 1HQUA 5K36B 1LWFB 2VPYB 1F5BA 1KEKA 2ZUAA 4WUBA 1VQYA 4CIOA 1OSCA 4P10A 2W25A 3DKDA 5D6GA 2CVEA 1RT4A 5BR8E 4XO0A 4JI2E 1ELOA 2C3OA 2GHWA 5G0RA 2E5LJ 2DR5A 1S0VA 1H7SA 1U1LA 5B0CA 4J9NA 4KSEB 5ETQA 2IMOA 4K0KI 1PO6A 2KXNB 1X4FA 4ZLNA 3KLVA 3HVRA 4J9PA 1VQ8S 2NXCA 5J2PB 3DLHA 4HI1A 1N34E 1N5TA 1I94J 3MDFA 2JWNA 2B0GA 1HL6A 4DQPA 3PKMA 4OI3A 3ULHA 5L1KA 2O1PA 3ENVA 4MMOA 1WHXA 4OYIA 2FB0A 3T6BA 1S6QA 3OV7A 1IBKF 4DR1F 1IKWB 2YWHA 2JVRA 4ILRA 4ZVOB 1SCJB 1TK5A 2IC3B 2PDAA 4ZVPB 4KHMA 4IFVB 4JV5I 3RR8A 2EK6A 3SCIE 3FEYB 2G0IA 3GV5B 5EHHA 1R0AA 1JLQB 2E7WA 3PRDA 2PO2A 1SB6A 1HBOB 1AXQA 3Q83A 2KRBA 2F8MA 3BS9A 4ZK7M 2UVRA 5L9XA 4DR5I 2ASJA 2K8GA 3KLHA 3KLFB 3MR3A 3PV8A 3C19A 5LXYA 3ZZOA 5K36D 4CLWA 2WNRA 3M6VA 3QSIA 5IWAF 1YRXA 3LNUA 2D9OA 3HSZA 1RWKB 1VIOA 3DCAA 4U67Q 2IOQA 3GFYA 4YY3F 1RSCA 1Q82T 3U1MA 4QR2A 4ERDA 5KFGA 3DRPA 3M2UB 4I2PB 4IKAA 2Y3YA 4DR7E 4J9QA 1KLMB 2B9WA 5KAKA 2AYGA 1OPIA 1SJFA 4WIQA 2DH9A 5LMUI 3C66A 4DHVA 1AFJA 1N54B 4JI1E 5LMNJ 1UW9A 2GQCA 1JLFB 3SDEA 4DQIA 3MPUB 4ECUA 2VFVA 4TLQA 3V81A 3DYAA 4PPZA 5FLXC 3TZZA 3I0SA 1R7IA 1HBUB 4CLFA 4PG6A 1VYAA 1BMQB 3D6TB 1R6YA 3CJ3A 4RU9A 3M85G 4FZVA 4EUVA 2HVHA 2YQ3A 3AJ2A 1KIJA 2C2KB 1YJUA 4FF4A 3CPWR 3BH6B 4ZS6A 3QLHA 2R7XA 4BS2A 1J2VA 1NK8A 4RNNA 2CPXA 2EFNA 3AOBA 3MM7A 4HH0A 2FVPA 5KFXA 1VQ5S 2UUWA 2AD9A 3JTPA 2B3TB 2GGPA 2R7VA 3M1VA 2XMAA 4H4KC 1WSRA 2UXDE 2CJKA 2XSJA 2OP5A 4I64A 2M5YA 1YWXA 2CQ0A 1WD6A 3QT6A 4DV3I 1WC4A 4LCHA 3J80Q 4F4YA 1X9SA 2F9JA 1E3HA 2UU9E 1VLOA 2RSQA 4ICLA 4MH8A 5E2QA 4HEA9 1XNRJ 2JT2A 4O3RA 5C25A 2OEJA 2C2RA 2DO0A 1REVA 4FPIA 5E7OB 1QLNA 4K59A 1RTJA 1URNA 1YK9A 2EI5A 3H2VE 1JX4A 4Q0BA 2QT7A 5IV4A 2K1RA 3P3CA 3GB0A 4YB1P 1VHIA 4B3MJ 1OO0B 4FBTA 2OPPB 2YWEA 3W9JA 3PIPQ 2KVIA 1RWUA 4X62E 3BO2A 1WEZA 4DFKA 3CJKB 3M7VA 3CGIA 5KFHA 1W7WA 4ZPDA 2Z5BA 3UVJA 4ECSA 3TVYA 3DRXA 1RAJA 3GE9A 3GWCA 1WC0A 5T41A 2UUBI 4DUZE 4CLTA 5F8IA 2AU0A 4DPWA 2V34A 5BR8I 4NA3A 2Q2EB 2YKQA 2X1AA 2ZBPA 4KGZB 4JI2I 5CYMA 4PU9A 2KG0A 4YDXA 2DHSA 2DGUA 3TQEA 2V5HG 3D5MA 3CDWA 2IOPA 1S9FA 4LFAE 4P74A 3M9OB 1WORA 3R2DJ 5L8RC 3IC1A 1S6PA 4NLVA 2JEBA 1GXLA 2XCPA
chains in the Genus database with same CATH topology
3PYEA 2F4VI 3JAMQ 1UEKA 4DR1I 4DR4I 4YY3E 1B63A 5LL6R 4ED4A 1FWLA 1Z0VA 1XMQI 1BKNA 1QZRA 3WU3A 1ZM9A 5IT9C 2VQEI 3Q1QA 4JI0I 4USMA 2NPFA 1XNRI 1H74A 4LF4I 1PKPA 4WUBA 2CGEA 1MX0A 1H7UA 3WU5A 1ZM3A 4PRVA 2VQFE 1Z0WA 1IBLI 1ZXNA 5BR8E 4JI8E 5IT9Q 3D4JA 1FKAE 4JI2E 1ELOA 2HFSA 1KTVA 2HFUA 3ZM7A 2V8PA 1H7SA 3B78A 3OTOI 3T1HI 4UTGA 2BV3A 4K0KI 2DEJA 5A2QC 4LFAI 4B3MI 4DV1E 4LF9E 4MYTA 2UUAE 5GMEA 3V2UC 4P52A 4Z7YA 1HNWI 4DR5E 1FJGE 1HNZI 4DR4E 1N34E 1USVA 3PYDA 1NZ0A 1S16A 5A2QQ 2VQEE 1PIEA 2UXCE 2ZBKB 1XNRE 3J7AM 1XHKA 1FNMA 4LFBE 4WUDA 1IBLE 4X66E 2VQFI 4DV2E 3HULA 3LPSA 1FI4A 4P7AA 3J7AG 4JV5I 2O1UA 2O1WA 2X36A 3B8HA 4HY1A 3OTOE 4DR7I 2PNLA 3CWVA 4K0KE 3T1YI 1Y6ZA 1HR0I 4B3ME 4URLA 1Z5BA 2UUAI 1K47A 1MU5A 1N36E 1Y4SA 1HNWE 1USUA 1HNZE 4DPXA 4DR5I 4DXLA 4USKA 1N34I 1Z0TA 2CZ9A 2V2QA 4JI1I 4JI6I 4JYAI 2J7KA 4PRXA 2ZITA 3PYFA 4HACB 3LNUA 1H73A 2PNMA 2UXCI 3QT5A 2X7IA 2UXBE 2A2CA 4FW9A 1KKHA 4N3OA 4DU8A 4LFBI 4LF6I 1A6FA 2IOQA 3Q6NA 1N0UA 4DV4E 4X66I 4DV2I 4DV6I 2HKJA 2WW4A 4B3RI 5L3JA 4JV5E 4B3TE 3WU6A 3P06A 2BM0A 3LTOA 4DR7E 1Z0CA 2E5LI 4X64E 3T1YE 2VF3A 3M6AA 1HR0E 4FWGA 2HHHI 4FWHA 1VISA 4YHHI 4AQYI 4DR3I 1N36I 4GKJI 3K1JA 5LMUI 2R3VA 3J81Q 2HK3A 3K85A 2Z5BB 4JI1E 4JI6E 2Z5EA 3PRYA 1I94I 4JYAE 4WUCA 2UXDI 5GMDA 1N33E 4DPTA 4IZJD 1S4EA 4KHPI 1H72C 4Z7CA 5FLXC 2UXBI 4JI4E 4IZJB 1Z0GA 4LF6E 2UU9I 1Z0EA 4DV4I 4X65E 1ZM2A 4DUYI 4DPYA 4DV6E 1NHHA 4B3RE 4OX9I 1RREA 2Z5CB 4B3TI 1KIJA 5FLXQ 2E5LE 1J5EE 4LF5E 4X64I 1MG7A 2ZM6E 4IZKB 1XNQI 2HHHE 4IZJA 1N32I 4YHHE 4AQYE 4JI7I 4DR3E 1Z5AA 4GKJE 5LMUE 1IBME 3QT8A 2Z5CA 3J80C 1DARA 3ZKDA 2HK2A 1I94E 3K17A 4NXNI 2AJ4A 5LMNE 2UXDE 1HK7A 3ZZUA 4MYUA 4IZKA 4ZVIA 1N33I 4KHPE 1IBKI 2UUCI 1Z59A 3QT6A 4DV3I 4LF7I 4JI4I 3J80Q 2CG9A 3ZKBA 1PVGA 1Y4UA 4UT4A 2UU9E 4X65I 4DUYE 4DV7I 4NXMI 2HKEA 1EA6A 4OX9E 1NHJA 2DEIA 3J81C 4HACA 2UUBE 1J5EI 1RR9A 4LF5I 4DUZI 3B82A 4DR2I 4KQVA 2ZM6I 4DU7A 4DV5I 1XNQE 4B3SI 1WUUA 1N32E 4JI7E 4XTJA 2V2ZA 4LF8I 4DR6E 4DV0I 1IBMI 4LFCE 2V2VA 3ZZTA 1XMOI 3HJCA 4JI5I 4RPFA 1NHIA 4GKKE 5IWAI 1D6TA 4NXNE 1HNXI 4JI3I 5LMNI 3QT7A 4R1FA 4EMDA 4HXZA 4X62E 4M1KA 2OI2A 2LJPA 1IBKE 2F4VE 2UUCE 4DR1E 1OJ4A 4DV3E 4LF7E 4YY3I 2XEXA 2O1VA 1XMQE 3V5RA 2EFGA 2A2DA 1N0VC 1EI1A 4DV7E 4NXME 2Z5BA 1ZM4A 2E1RA 1U2RA 4JI0E 2GS8A 3WU4A 4LF4E 1Z5CA 2BM1A 1FWKA 4DPUA 2UUBI 4DUZE 4DR2E 1Z0BA 1KVKA 4HYMA 4DV5E 4B3SE 3PYGA 4JG4A 3F0NA 4DPWA 5FWKA 2V34A 5BR8I 4JI8I 2Q2EB 4JI2I 2O1TA 4LF8E 4DV0E 3Q6MA 4PU9A 4DR6I 3JAMC 1XMOE 2R42A 3ZZ0A 4LFCI 4JI5E 3T1HE 2GQ0A 2IOPA 5IWAE 1ZXMA 4I3HA 4GKKI 4FN5A 1B62A 1HNXE 4JI3E 4LFAE 3GONA 3H4LA 4DV1I 4LF9I 4FWDA 4X62I 1FJGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYE A;  2F4V I;  3JAM Q;  1UEK A;  4DR1 I;  4DR4 I;  4YY3 E;  1B63 A;  5LL6 R;  4ED4 A;  1FWL A;  1Z0V A;  1XMQ I;  1BKN A;  1QZR A;  3WU3 A;  1ZM9 A;  5IT9 C;  2VQE I;  3Q1Q A;  4JI0 I;  4USM A;  2NPF A;  1XNR I;  1H74 A;  4LF4 I;  1PKP A;  4WUB A;  1MX0 A;  1H7U A;  3WU5 A;  1ZM3 A;  4PRV A;  2VQF E;  1Z0W A;  1IBL I;  1ZXN A;  5BR8 E;  4JI8 E;  5IT9 Q;  3D4J A;  1FKA E;  4JI2 E;  1ELO A;  2HFS A;  1KTV A;  2HFU A;  3ZM7 A;  2V8P A;  1H7S A;  3B78 A;  3OTO I;  3T1H I;  4UTG A;  2BV3 A;  4K0K I;  2DEJ A;  5A2Q C;  4LFA I;  4B3M I;  4DV1 E;  4LF9 E;  4MYT A;  2UUA E;  5GME A;  3V2U C;  4P52 A;  4Z7Y A;  1HNW I;  4DR5 E;  1FJG E;  1HNZ I;  4DR4 E;  1N34 E;  3PYD A;  1NZ0 A;  1S16 A;  5A2Q Q;  2VQE E;  1PIE A;  2UXC E;  2ZBK B;  1XNR E;  3J7A M;  1XHK A;  1FNM A;  4LFB E;  4WUD A;  1IBL E;  4X66 E;  2VQF I;  4DV2 E;  3HUL A;  3LPS A;  1FI4 A;  4P7A A;  3J7A G;  4JV5 I;  2X36 A;  3B8H A;  4HY1 A;  3OTO E;  4DR7 I;  3CWV A;  4K0K E;  3T1Y I;  1HR0 I;  4B3M E;  4URL A;  1Z5B A;  2UUA I;  1K47 A;  1MU5 A;  1N36 E;  1HNW E;  1HNZ E;  4DPX A;  4DR5 I;  4DXL A;  4USK A;  1N34 I;  1Z0T A;  2CZ9 A;  2V2Q A;  4JI1 I;  4JI6 I;  4JYA I;  2J7K A;  4PRX A;  2ZIT A;  3PYF A;  4HAC B;  3LNU A;  1H73 A;  2UXC I;  3QT5 A;  2X7I A;  2UXB E;  2A2C A;  4FW9 A;  1KKH A;  4DU8 A;  4LFB I;  4LF6 I;  1A6F A;  1N0U A;  4DV4 E;  4X66 I;  4DV2 I;  4DV6 I;  2HKJ A;  2WW4 A;  4B3R I;  5L3J A;  4JV5 E;  4B3T E;  3WU6 A;  2BM0 A;  3LTO A;  4DR7 E;  1Z0C A;  2E5L I;  4X64 E;  3T1Y E;  2VF3 A;  3M6A A;  1HR0 E;  4FWG A;  2HHH I;  4FWH A;  1VIS A;  4YHH I;  4AQY I;  4DR3 I;  1N36 I;  4GKJ I;  3K1J A;  5LMU I;  2R3V A;  3J81 Q;  2HK3 A;  4JI1 E;  4JI6 E;  1I94 I;  4JYA E;  4WUC A;  2UXD I;  5GMD A;  1N33 E;  4DPT A;  1S4E A;  4KHP I;  1H72 C;  4Z7C A;  5FLX C;  2UXB I;  4JI4 E;  1Z0G A;  4LF6 E;  2UU9 I;  1Z0E A;  4DV4 I;  4X65 E;  1ZM2 A;  4DUY I;  4DPY A;  4DV6 E;  1NHH A;  4B3R E;  4OX9 I;  1RRE A;  4B3T I;  1KIJ A;  5FLX Q;  2E5L E;  1J5E E;  4LF5 E;  4X64 I;  1MG7 A;  2ZM6 E;  1XNQ I;  2HHH E;  1N32 I;  4YHH E;  4AQY E;  4JI7 I;  4DR3 E;  1Z5A A;  4GKJ E;  5LMU E;  1IBM E;  3QT8 A;  3J80 C;  1DAR A;  3ZKD A;  2HK2 A;  1I94 E;  3K17 A;  4NXN I;  2AJ4 A;  5LMN E;  2UXD E;  3ZZU A;  4MYU A;  4ZVI A;  1N33 I;  4KHP E;  1IBK I;  2UUC I;  1Z59 A;  3QT6 A;  4DV3 I;  4LF7 I;  4JI4 I;  3J80 Q;  3ZKB A;  1PVG A;  4UT4 A;  2UU9 E;  4X65 I;  4DUY E;  4DV7 I;  4NXM I;  2HKE A;  1EA6 A;  4OX9 E;  1NHJ A;  2DEI A;  3J81 C;  4HAC A;  2UUB E;  1J5E I;  1RR9 A;  4LF5 I;  4DUZ I;  3B82 A;  4DR2 I;  4KQV A;  2ZM6 I;  4DU7 A;  4DV5 I;  1XNQ E;  4B3S I;  1WUU A;  1N32 E;  4JI7 E;  4XTJ A;  2V2Z A;  4LF8 I;  4DR6 E;  4DV0 I;  1IBM I;  4LFC E;  2V2V A;  3ZZT A;  1XMO I;  4JI5 I;  4RPF A;  1NHI A;  4GKK E;  5IWA I;  1D6T A;  4NXN E;  1HNX I;  4JI3 I;  5LMN I;  3QT7 A;  4R1F A;  4EMD A;  4HXZ A;  4X62 E;  4M1K A;  2OI2 A;  2LJP A;  1IBK E;  2F4V E;  2UUC E;  4DR1 E;  1OJ4 A;  4DV3 E;  4LF7 E;  4YY3 I;  2XEX A;  1XMQ E;  3V5R A;  2EFG A;  2A2D A;  1N0V C;  1EI1 A;  4DV7 E;  4NXM E;  1ZM4 A;  2E1R A;  1U2R A;  4JI0 E;  2GS8 A;  3WU4 A;  4LF4 E;  1Z5C A;  2BM1 A;  1FWK A;  4DPU A;  2UUB I;  4DUZ E;  4DR2 E;  1Z0B A;  1KVK A;  4HYM A;  4DV5 E;  4B3S E;  3PYG A;  4JG4 A;  3F0N A;  4DPW A;  2V34 A;  5BR8 I;  4JI8 I;  2Q2E B;  4JI2 I;  4LF8 E;  4DV0 E;  4PU9 A;  4DR6 I;  3JAM C;  1XMO E;  2R42 A;  3ZZ0 A;  4LFC I;  4JI5 E;  3T1H E;  5IWA E;  1ZXM A;  4I3H A;  4GKK I;  4FN5 A;  1B62 A;  1HNX E;  4JI3 E;  4LFA E;  3GON A;  3H4L A;  4DV1 I;  4LF9 I;  4FWD A;  4X62 I;  1FJG I; 
#chains in the Genus database with same CATH topology
 3OHB A;  3OUY A;  4DLE A;  3KG0 A;  1KC8 T;  2XO6 A;  3UD3 P;  4IFD F;  2DR9 A;  2IBK A;  3I32 A;  4NLD A;  1E6V B;  2N7Y A;  3VZH A;  2GMJ A;  1ZA1 B;  5HK4 A;  3SMZ A;  2OEL A;  1WEX A;  4DFJ A;  4PRV A;  3HSJ A;  1HWJ A;  1X4H A;  1ZXN A;  4RNH A;  5EN1 A;  4ZPT R;  3WIU A;  4RW7 A;  2NR0 A;  1X4G A;  3IR5 B;  1NB7 A;  1C1C A;  1KTV A;  4J9O A;  1IM4 A;  4NZ0 A;  1DQ9 A;  2WP8 B;  1S76 D;  2BV3 A;  2R7O A;  4RBV A;  2UUA E;  5GME A;  3BF4 A;  4PUO B;  4L3N A;  3BGL A;  1N32 F;  4BBY A;  1L3U A;  4MJK A;  5A6P A;  2MKK A;  3BSA A;  5KFJ A;  3KUH A;  2R7T A;  3T19 A;  4H4K A;  1C4A A;  2QLF B;  4NLP A;  2PA8 D;  1WKL A;  3TX0 A;  1RK8 A;  4D3G A;  3PRB A;  3VVT A;  2MKI A;  2HZV A;  1PIL A;  3OFE A;  3VQT A;  3MFI A;  3OTD A;  4LF2 A;  1FE4 A;  4A8O A;  1R31 A;  3GP9 A;  4DL2 A;  4DUY J;  1G2E A;  3GLJ A;  4EO8 A;  3FK4 A;  2YX1 A;  3FSI A;  3Q8U A;  1CJV B;  2B56 A;  4K4Z A;  4X64 J;  4M5M A;  4DR7 I;  3AJD A;  2Y1I A;  2W2N P;  2OLW A;  1PYS B;  1RHM B;  2G4B A;  2WAQ D;  1EX8 A;  2HS4 A;  3C6U A;  2I5J B;  4ED7 A;  4QWC A;  4MKY A;  4DXL A;  1YIJ S;  4FW5 A;  3JSB A;  4NXN J;  4I0W A;  4JI1 I;  4RBU A;  3M6W A;  3ZZY A;  1NH8 A;  1AZS B;  4YQW A;  1SUQ B;  2B5J A;  2A10 A;  4X65 J;  2CPE A;  2CKW A;  2AZ1 A;  5H9F J;  4QW9 A;  4KE5 A;  5DM7 Q;  4KPY A;  3FQL A;  3GG1 A;  4HKQ A;  3H59 A;  5D77 A;  1TAU A;  1VQL S;  4DR2 J;  3V4I A;  1CJK A;  3LPE A;  5CD4 H;  3W3S A;  3T1Y E;  1RZM A;  4ER8 A;  4OYA A;  1APS A;  5EGY A;  5DQH A;  2RAQ A;  2RQC A;  3NY0 A;  4WII A;  4LF8 J;  4Y3C A;  2DNY A;  3K1J A;  1IBM J;  2IIH A;  3PX4 A;  4NCA A;  2R3V A;  2CJY B;  4LVO P;  4LJM A;  4R0J A;  2FJX A;  4OZ0 A;  4CM0 A;  4JI3 J;  2UXD I;  3NS6 A;  2CPZ A;  2JJ4 D;  5CZV A;  4CH0 S;  4F3O A;  2HHU A;  1RT5 B;  1O51 A;  1QDU B;  4FNH A;  2HFV A;  3LP0 B;  1SL2 A;  2GHV C;  4B9M A;  2L41 A;  2UU9 I;  1ZM2 A;  4R0E A;  3DOM A;  4B3T I;  4IRD A;  5F8J A;  1KHW A;  4X4P A;  1XR7 A;  3NGD A;  1WC1 A;  2WVF A;  2MMY A;  1R8B A;  3WHI A;  1Y3J A;  4DV2 F;  2DNO A;  5C5J A;  1HBM A;  4BA1 A;  3LWL A;  3ZKD A;  2HK2 A;  3VAL A;  2QL7 B;  2M9K A;  4K0K F;  3QAU A;  2UUT A;  3DOL A;  2DPI A;  3RBE A;  3OPK A;  2F4V J;  3KUG A;  2DRA A;  4KHP E;  1SC6 A;  4WZQ A;  3TW0 A;  2JRS A;  2QLB B;  1FXR A;  3FFI A;  4ILM A;  4UT4 A;  2CAD A;  1QD1 A;  3NGT A;  3UD4 P;  3ITH B;  1C1B A;  5B0G A;  4L74 A;  4LF4 J;  2MKH A;  3BO3 A;  5IT9 U;  3OFG A;  2QA2 A;  1ULR A;  4RW9 A;  4LF5 I;  4DUZ I;  2HBZ B;  4LQ9 A;  5IC6 B;  2DIT A;  1WUU A;  2F65 A;  2BR2 B;  3OXL A;  2R9L A;  1KWM A;  1RT6 A;  3H5U A;  4NLS A;  3VCD A;  4J7C A;  4ITS A;  2HQD A;  3HJC A;  4JV5 F;  3D2W A;  4RW4 B;  2I6W A;  4UOC A;  2E1C A;  2AEJ A;  4ID5 A;  1VBX A;  2FHJ A;  4FKX A;  5D0E A;  1DHM A;  2Z58 B;  4NLQ A;  4DR5 F;  2AF6 A;  5GAE U;  2W2P P;  2CJA A;  3W65 A;  3BN4 A;  4YR2 A;  2GFF A;  7FDR A;  3MHY A;  3EMT A;  1S10 A;  2EFO A;  4FYY B;  1NRK A;  3VAF A;  1WKJ A;  3RB6 A;  2ZH2 A;  2UVV A;  1Z0B A;  5HP1 B;  1OY8 A;  1AUD A;  4JI4 F;  3AOD A;  1S1X A;  2P9C A;  1M1G A;  3TJA A;  3TA2 A;  1C0T B;  2O1T A;  4G3I A;  4QZV B;  2QL9 B;  2MZJ A;  1XMO E;  3NBP A;  2Q3P A;  4GKK I;  3KOA A;  2HMI A;  4CNY A;  1J5E F;  3IR6 B;  4DX8 H;  3VHQ A;  3K2Y A;  1K9M T;  1MWZ A;  4OI4 A;  4HTJ A;  2Z57 B;  3TYT A;  2WSE C;  4DSE A;  2EKN A;  5LMU F;  1CS4 A;  2B7B B;  2V4J B;  2B4P A;  1XMQ I;  2PN6 A;  3QGI A;  3B4M A;  3CME S;  2BX6 A;  1U0S A;  3S8S A;  4JI0 I;  2CQ4 A;  5EWG A;  3MGJ A;  4CYU B;  3W2V A;  2FVQ A;  3OTC A;  1HI8 A;  3SZ2 A;  4OJH A;  1D0E A;  2YPY A;  1IBL J;  5IFM A;  2R2S A;  1VR6 A;  1X5S A;  1YI2 S;  1IVZ A;  1FRX A;  2VBX A;  3GIM A;  1LWF A;  5HVF A;  3T1H I;  2DNL A;  3K89 A;  4B9N A;  2JVO A;  5A2Q C;  3KHG A;  3I5A A;  2Y8Y A;  4LF9 E;  1RQ0 A;  1YJ9 S;  4M5L A;  2CNN B;  3QZ8 A;  4JB8 B;  3I4P A;  4IQM A;  4W92 B;  4G1Q A;  2HFO A;  1RWX B;  4HHU A;  3PYD A;  2ZH7 A;  2O3Z A;  2BYC A;  2GO3 A;  1F60 B;  1TKZ B;  2LEA A;  2U1A A;  4NWB A;  2E9T A;  1S7H A;  2XLJ A;  2GO8 A;  3CCW A;  2L9N A;  1FJE B;  4DV4 J;  4DV3 F;  4CH1 A;  1L3K A;  3TI0 A;  4KR0 B;  4DI6 A;  2MEW A;  2L08 A;  5DRP A;  3R5B A;  2KM8 C;  3F73 A;  4BWJ A;  3BBF A;  4KKO B;  4OYO A;  1OMS A;  3T1Y I;  1IN0 A;  2MGZ A;  1YX2 A;  4ED5 A;  2J8S A;  2DJW A;  3GIR A;  3CCL S;  2R8I A;  5DDP C;  1Y4S A;  2ROG A;  5D0R A;  2V0N A;  3MAA B;  4DPX A;  1RU2 A;  2QA1 A;  2IC3 A;  2JX2 A;  1GFW B;  3G4S S;  3GCM A;  2YVS A;  2C3P A;  2P9E A;  4F0H A;  3WZ0 A;  4KY3 A;  2X7I A;  2LQ5 A;  2OPS B;  3G8S A;  2KDO A;  2KI2 A;  1KKH A;  1JXL A;  2IFX A;  3PTW A;  2IVM A;  4WXO A;  4ZJQ A;  2AYB A;  1RKI A;  4HL9 A;  2EBG A;  2FVC A;  4OO1 E;  2DH7 A;  3A8E A;  2CNK B;  3M6A A;  4J91 A;  3CMA S;  2KZZ A;  2XYP B;  3A13 A;  2BA0 D;  3ET6 A;  1SH2 A;  5BR8 F;  2EKY A;  4JI2 F;  1CQM A;  2ILY A;  3LPY A;  3TEH B;  4JYA E;  1KLM A;  3Q22 A;  4KHP I;  1G6B A;  5AE3 A;  2BDP A;  4OO1 C;  3D1H A;  3FEZ A;  5IQ6 A;  4DG1 A;  1ZAW A;  3HZG A;  5J2Q B;  1N34 F;  3Q23 A;  1NHH A;  3PNI A;  4ZN1 A;  1JLF A;  1Q16 B;  3OVB A;  2B7C B;  2VPZ B;  1KOO A;  3UHM A;  2YX4 A;  2FHM A;  3MOZ A;  4Q44 A;  4WYL A;  5A76 A;  3IBC B;  4AQY E;  1D9F A;  3PW2 A;  4WP8 A;  3CD7 A;  4DR6 J;  2NZ4 A;  2HW3 A;  4JV2 A;  2ZZN A;  2W7A A;  1IR0 A;  1DAR A;  2LXI A;  3F56 A;  3J80 U;  2RML A;  1HK7 A;  4Y2I A;  1MW7 A;  1UVK A;  4F4Z A;  1D8Z A;  2HHS A;  4K4V A;  1VC0 A;  4ES3 A;  1Z59 A;  5LXR A;  4C0H A;  4P2M A;  3ZKB A;  3TAQ A;  4IH7 A;  2VQE J;  4OX9 E;  5DGB A;  2FJD B;  1T03 B;  3J81 C;  1ZYQ A;  2NZC A;  1YZ6 A;  1EJ7 L;  2B4V A;  3G2X A;  1U1M A;  4LSL A;  2W9C B;  1Q8L A;  2DXD A;  5F9N A;  4U9R A;  1TTH B;  3KK2 B;  2A3J A;  4O3O A;  1P42 A;  3N79 A;  2KU7 A;  4XPE A;  2HVE A;  3LAK A;  2V2V A;  3LQV A;  1TKX B;  1XMO I;  3CJR A;  2HQI A;  2W9B B;  1VQO S;  4RPF A;  5KOX A;  5F0W A;  1KS2 A;  4O3Q A;  4DR7 F;  4F04 B;  2LU2 A;  4QPX A;  2B8Q A;  2OI2 A;  2R4F A;  3UCU P;  5K8P A;  4W98 A;  1JLE B;  3V5R A;  2LQB A;  3C14 B;  4WFX A;  3DLG B;  1UVN A;  3PHT A;  1RAI B;  1S1T B;  2XUL A;  5JEA D;  4FF2 A;  4JI1 F;  1MRO B;  2D41 A;  1F0X A;  2BJ8 A;  3O6Q A;  1KNZ A;  3BYR A;  3CJ4 A;  2K06 A;  2DR7 A;  3CJK A;  1IQT A;  4B3S E;  3PYG A;  3KHR A;  1H3D A;  1H2U X;  2WVC A;  1NDC A;  4IOB A;  2HVZ A;  1S77 D;  3T3F A;  2K7K A;  4DN0 A;  4EWT A;  1YJ7 A;  4OHW A;  1VQ7 S;  3CO9 A;  3DM2 B;  4W4M A;  4J5O A;  1RWW B;  4LF9 I;  1URR A;  4B9T A;  4P6Q A;  1T9Y A;  4CT8 A;  3NL0 A;  3OJU A;  2NN6 E;  1WI6 A;  1RKJ A;  3R5G A;  2BE2 B;  3W2W B;  4DS5 A;  1N88 A;  5JMN A;  5IZH A;  2CUY A;  1ZM9 A;  2FZC B;  2RU9 A;  3R27 A;  2UXD F;  3E51 A;  4OO1 A;  4U7U K;  2HNZ B;  4DS4 A;  2FUG 9;  4DJB A;  3MM5 B;  2P6S A;  1Z0W A;  2FQQ B;  2BOP A;  3V6D B;  5ETP A;  2UU9 F;  2VG7 B;  2ADB A;  2NN6 C;  3CCT A;  1GH8 A;  1E6V A;  4OX8 A;  3OVA A;  4LRF A;  1UTA A;  5HLF B;  1UPM B;  3GFZ A;  4UTG A;  2RS2 A;  1FRH A;  1A0O B;  4YHH J;  1B64 A;  4GKJ J;  4L73 A;  4ZVF A;  2RDD A;  2OML A;  3PX6 A;  1USV A;  1R0C B;  4C3M A;  3FUY A;  3JSY A;  3QFW A;  1VQ6 S;  3POT B;  5L46 A;  2POK A;  2UXB J;  2YH1 A;  4LFB E;  2GAH C;  3U02 A;  4WUD A;  3D3B J;  3THP A;  4X66 E;  3CCS S;  4FNI A;  1FCA A;  2PNZ B;  2QG9 B;  4P7A A;  1YBU A;  5L39 A;  3C6T B;  4XIU A;  1CG2 A;  3RR7 A;  1B0V A;  2RD5 C;  4NLG A;  4DUZ F;  2AKW B;  1FRK A;  1N36 E;  1USU A;  2J7W A;  2BQR A;  1U47 A;  3UQS A;  4CLU A;  1JLG B;  2JOQ A;  2WB1 D;  4JYA I;  2R2R A;  1HW9 A;  1S99 A;  1YKW A;  5DM6 Q;  1T7P A;  4LFA F;  2UUC J;  3FZ2 A;  4LF7 J;  2I5J A;  7FD1 A;  2RF2 A;  2WSC C;  2ZJR Q;  5EX0 A;  4F67 A;  4NXM J;  2CJX B;  1SXL A;  2ZBI A;  4R8U B;  1A6L A;  3N28 A;  3LTO A;  5KFU A;  4F3M A;  1AW0 A;  1TVR B;  4IR9 A;  1S7I A;  3H4D A;  3BN7 A;  1O5J A;  4GO7 X;  4FWH A;  1SUQ A;  4FF3 A;  3QJJ A;  4AQY I;  4LBH A;  5I3U B;  2CAJ A;  3SXL A;  2AW0 A;  1EHW A;  1KDN A;  4CI0 B;  1ZA2 B;  2VIC A;  1X4D A;  1TUV A;  1JKH B;  1ZPV A;  2UP1 A;  2D1C A;  2BEF A;  2XY5 A;  2Q1L A;  4LRE A;  1RTI B;  3PDN A;  1S4E A;  2LEP A;  2HNY B;  2RVJ A;  1RAG B;  1RBA A;  3BQ0 A;  4ZVT B;  1VQ4 S;  1RAO A;  2MQO A;  4J9M A;  2IES A;  4OX9 I;  1XR5 A;  1RRE A;  1SKS A;  1VIX A;  4ATN A;  2QA4 S;  5FLX Q;  4OZJ A;  2E5L E;  4JI0 F;  2X1G A;  3GJT B;  3DHX A;  3DRS B;  3LP0 A;  5I4M A;  2NN6 A;  1PYO B;  4LFC J;  4OYB A;  3CC7 S;  2DTJ A;  2OIH A;  2VOO A;  2KT3 A;  1I94 E;  3S7R A;  3DHW C;  1RWV B;  5KFZ A;  3AT1 B;  1U2C A;  2OSQ A;  5C0X E;  2LXF A;  4DR4 J;  4DR1 J;  3DNC A;  2DXE A;  5U47 A;  2PI5 A;  3EIC A;  2MTL A;  1TV6 A;  4J9L A;  1GMU A;  4GVB A;  2DNZ A;  4F4K A;  2ILZ A;  3G8T A;  2JC1 A;  5F8N A;  3CD6 S;  4XAK A;  3JTO A;  2ZM6 I;  2E9Z A;  2GJI A;  3DD6 A;  4B3S I;  3VGV A;  5AJ3 F;  1FJC A;  3HM9 A;  5IT9 Y;  3HHE A;  3MCS A;  3X3U A;  2KL8 A;  5C0X C;  1QUV A;  4YB5 A;  3W62 A;  3J7Y I;  1WEY A;  4WXW A;  2G2O A;  1HMV A;  1RTH A;  3O44 A;  5CZX A;  2LU1 A;  3QGH A;  2QN6 B;  1U1R A;  2DGT A;  2LDI A;  2AWZ A;  2MQQ A;  3M4X A;  3T1Y F;  3CED A;  3FBF A;  4FW7 A;  1UFW A;  4LVN P;  2DHG A;  3AB4 B;  2BR2 A;  4P7V A;  4YY3 J;  1OJ4 A;  1RAA B;  2O1V A;  4KRW A;  3PW5 A;  3FCH A;  2J0Q D;  2F3J A;  1UAW A;  2JE6 A;  4F36 A;  2RQK A;  4CTA A;  2CWX A;  4Y28 C;  2WW8 A;  4BWM A;  3P3G A;  2KO1 A;  2CQ1 A;  3HHL B;  3M8Q A;  5FWK A;  1Y3K A;  3M32 B;  4WKY A;  4C6A A;  3D66 A;  1YJR A;  2HIQ A;  1M1K T;  1FA0 A;  2GMH A;  2O66 A;  3D6F B;  2CPD A;  2RH3 A;  1WC3 A;  3MMJ A;  2BAN A;  3GIL A;  2XY7 A;  5DET A;  1H0H B;  1OYR A;  4MIW A;  3HHD A;  2H4W B;  5LJ5 Y;  1UVI A;  1Z4U A;  3PM9 A;  5DGA A;  2X