1HK7A

Middle domain of hsp90
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
248
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Analysis of the Middle Segment of Hsp90. Implications for ATP Hydrolysis and Client Protein and Cochaperone Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords HEAT SHOCK PROTEIN HSP82
total genus 75
structure length 248
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hk7A01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hk7A02
2IOPA 1Y6ZA 3PRYA 1USVA 2O1WA 3Q6NA 2IOQA 1USUA 2CG9A 2GQ0A 2O1TA 2O1UA 3HJCA 1Y4UA 1Y4SA 1HK7A 5FWKA 3Q6MA 2O1VA 2CGEA
chains in the Genus database with same CATH superfamily
1JKJA 2R8XA 2J30A 5F9HA 3F49S 3IP7A 1MPXA 1C4XA 4JBIA 4P4NA 4EX6A 5EJ9A 4RZXA 3VR6H 4UM7A 4JI4E 2ZROA 3CLSD 2JLXA 5DX1A 1P1CA 1WDKA 2YXLA 3LT2A 3EXG2 5KSZA 3KE8A 4FUQA 3H9QA 4NNPA 4U02A 4BVAA 2PNZA 3U13A 1SH7A 2CMFA 3FCOA 3E61A 4TQUS 2R97A 4M1WA 4A0RA 4EPTA 1MQSA 3U3OA 1KZ6A 1YC2A 3D8HA 3G13A 4BKUA 2Q9BA 4UBKA 4IDPA 2YCBA 4S24A 1U1IA 4JL8A 3CTPA 3O2SB 3MLEA 1E77A 1GQQA 2CXTA 3AUTA 2QOEA 2O8EB 2AJTA 2ZE6A 1SOWA 2OFXA 4A8JB 3CLUC 2W6IA 1U8XX 4JLVA 4WESA 3UF0A 3SDBA 5HYVA 5AKGA 1KSGA 3DVLA 2W6PA 2ONZA 1XAGA 1Z2OX 2R79A 3FX2A 4LZNA 4QXPA 3RS3A 5AKEA 1NU8A 2CL5A 4MK4A 3ZDYB 5JRZA 4KN8A 3TLMA 3FPHA 2J5KA 3KYCB 4O4LB 4R9VA 2F43B 3CMCO 3H65A 1T29A 4I36A 4PWZA 4RVFA 2VDJA 4ZZ1A 4HNTA 3UA4A 2I33A 3VR3A 9LDTA 5KNDD 3MT7A 1QR2A 2ZBUA 5DX0A 1R6MA 5AP9A 2WWYA 2DLCX 3FPAA 5E0OA 5B37A 1ZN8A 4FW9A 4I3HA 2J5BA 1F06A 2JKZA 2HO4A 1T4BA 3C4QA 1IQUA 4TT8A 3PXGA 2Y1KA 3GRRA 4CMEA 2KB0A 5AM5A 5BQXA 1IBKB 1JQLB 3KS9A 4Y1RB 3SMVA 4HX2A 5E6SB 3ANMA 4OYHA 4WN9B 4YRJA 3I30X 1OGYA 5IYZF 4J2TA 5BSRA 1GEEA 1QFSA 1NFRA 3CDJA 4YMTA 2BP7B 5LLSA 2OL4A 4MIKA 1ORHA 4JDUA 3TS1A 2W98A 3O91A 1QKKA 5I7AA 3ABIA 4YPVA 4N5DA 2GEBA 1ZGCA 2G9QA 3IPAA 1IBKE 1Z33A 3LBYA 3ZHTA 4MV7A 1VHDA 3NWEA 3OIYA 1YCFA 4O4IA 1FFEA 1K7CA 1RLJA 1G2IA 3WWEA 1XNHA 2DFDA 3KKKA 3RC1A 4GOOD 2QPLA 5EPEA 3JRNA 3T4XA 2CYAA 1WUKS 1LD3A 1WPQA 4QM7A 1FFXA 4QUHA 4FR0A 1T4GA 3EYAA 3E7FA 1J9EA 3D7KA 4N6OA 2AN3A 4IINA 4FHGA 4QNKA 4CTOA 1E4EA 4HMQA 2QL9A 1E3MA 4MW0A 3OHPA 3H3FA 3DMYA 4LXQA 1T24A 2FWAA 4I1SA 4MI9A 2GSWA 4P8RA 4OHBA 3SJCA 1JSXA 1ORRA 1ST2A 2YY5A 4LQLA 3S44A 1T34A 3TLZA 4EJ6A 1UOOA 3KQYA 2QTGA 3E8MA 4LXUA 1KRWA 3DZIA 3MGBA 4DGQA 4ZODA 1G8MA 4JROA 1CDZA 4BFWA 3ZXXA 2UZ3A 4JGBA 1Q74A 4FFBA 4OMUA 3SS9X 3ETEA 5HE9A 1OFTA 4GLJA 5C1OA 5CA1A 1QWSA 4CM9A 1E60A 1TK9A 1A82A 1PX2A 2IEIA 5I7WA 3TGLA 1U63A 5JXHA 4TVBA 2EQAA 2Z5GA 3RE1A 2C9MA 1Z0WA 3UGJA 1RAGA 3SHFA 5AFSA 3A6DA 3ELBA 3G49A 5EHGA 3L1HA 1N2JA 2AHOA 2R6FA 4B47A 1RT9A 1LRLA 3GIWA 2PVCA 5NLLA 1N33B 3U1VA 2YX1A 1MQAA 3EHEA 3OZVA 4MQEB 1Y0BA 3M1LA 4IX1A 2OV6A 2FQXA 5A2GA 2RC5A 1U1FA 3VH2A 5CW1A 3S2FA 1VZ2A 3LP5A 4M76B 1ZS9A 2MSDB 3JU3A 2VDQB 4QGBA 4UXHA 5F35A 3GVHA 5LZ8A 4QZVA 3F5FA 2AKEA 3WY9A 1UXIA 4OU5A 1R9MA 2PFSA 1FXUA 1FVFA 2CLHB 2Q28A 4JAVC 5DW3A 3I9NA 1ZOPA 3ILYA 3OD1A 4KW7A 3K0SA 1OLUA 5JDIA 2NXWA 4HH0A 1OXTA 1LQUA 4WASA 4XVHA 4LVOA 4PYNA 1FRZA 2J32A 2O07A 5EIAA 3ZD9A 5K0FA 4BXOB 1QTIA 1ZRMA 2JGDB 4PG4A 1NNLA 1U0BB 4P54A 4LV5B 4M0EA 3ZZ1A 1E94E 2IHZA 2R8YA 4GI7A 2M6SA 3LYLA 3O9ZA 4K2AA 4I66A 3T1YB 4PAOA 1P1RA 1Y9AA 4HACB 3CWQA 1XQ6A 1YR6A 2FEPA 5BUCA 4HQOA 5CT6A 3UUFA 5ALKA 1S2OA 2PUDA 2QN1A 4KE6A 2YN2A 3QUSA 2Y99A 2OFPA 4PAWA 5HFAA 3GRZA 4D57A 1H4VB 1Q95A 1RHRA 1GT91 2CL0X 4JYAE 3AP3A 3GBPA 4IPTA 4KI7A 4IHJA 4RIFA 1HE3A 3SS7X 4J0EA 2MT9A 2DBRA 4CKEB 2J9YB 4DXAA 1RIFA 1SCKA 1JFFB 3O1LA 4OP1A 1H2XA 2IEZA 2EVWX 4PN7A 3HA7A 1V5WA 3FF4A 1CDOA 3LDFA 4CG1A 4H77A 4MUFA 3GRYA 2WWWA 3EXEA 1A5TA 4QJ5A 2DP4E 4WXRA 5BYJA 3GXOA 2Z5BA 2I7CA 3H6KA 2B6HA 2Z6UA 2PL3A 1C3EA 3W3AH 5CM2Z 2VXOA 3WBKA 5L3ZA 2ZBVA 4PN3A 1EA5A 2OESA 2FPXA 3U4GA 1EP2B 1MH1A 4KPEC 2OHJA 1YDMA 4FI3C 1K68A 4GECA 1AS3A 3FF1A 1PT7A 1BGVA 1CUFA 4REMA 1FX0B 4DCOA 5I7HA 2D2EA 2EFEB 3NT5A 1Z6YA 2BR2B 2ZXFA 3KR0A 5GPBA 4AUEA 4K9OA 1Q6ZA 3T34A 2FPPB 1VL5A 1U3DA 1YL6A 2HLDD 3E1KA 4IICA 2WYIA 2ZYUX 2GI4A 4RK6A 4U1RA 3ZDCA 1R27A 2VPTA 3B48A 3I8SA 4J4TA 3D54D 1HQYE 2PX3A 4NSNA 3QXCA 4MUEA 1DFGA 1K9SA 1PD1A 4R5MA 3I3OA 5K3EA 3UKDA 2CEKA 2X1HA 4XOUA 1ZUD1 3FWNA 1CBUA 3MINB 3UA3A 4GXRA 1CPYA 2XTMA 3THSA 2ZJ3A 8ADHA 3ISVA 3P0HA 1KAQA 1NI3A 3AEXA 3PC2A 4NARA 4DV1B 3VKWA 4R0MA 2CCKA 3CNHA 1VRCA 4YJDA 5HA5A 1QHFA 1U7WA 2HA5A 3L18A 4ZMRA 4BATA 3ER9A 4LBVA 5EAIA 5H81A 1UWLA 4NDZA 1JKJB 3FETA 5BV2P 3L77A 4KQHA 4MUJA 2E1PA 3I5XA 5LA6A 2JJ2A 5JWHA 1P4GA 1JQBA 4HT3B 2BMWA 3KU1A 4ALMA 4OUKX 4DV7B 4UU7A 4UBNA 4V2UA 4EYKA 3UWOA 3BA1A 1XDBA 3QKIA 3UAYA 1A9XA 4QBTA 1E3SA 2O14A 1F1JA 5A6SA 4K1XA 4OHCA 4NJMA 2YHIA 4OFWA 3D3NA 4RGVA 3QEOA 3S99A 3STHA 4FUTA 5ANRB 4E2XA 3ZD7A 5AJYA 2WTNA 3Q11A 4BY9E 2SICE 4J49A 2BE9A 3GH1A 3HBJA 3SY8A 4BGEA 1B8NA 3FRJA 5KU1A 4DRZA 4XYLA 3KZKA 4GRDA 4JJ6A 4AP5A 1Z5PA 1JI3A 3JWEA 2R66A 1KFBB 4RM2A 2XE8A 4GKKE 1EVKA 1XP5A 1EG7A 2B4TO 3JWHA 1DIRA 3MS7A 4W5HA 1WXEA 2IV2X 4O4HF 2B2XA 1CQIA 2OZLB 4USMA 3AZOA 3DTVA 3VJKA 4MYHA 4HYYA 4EZIA 5JARA 1SELA 1FA9A 2UYCA 2ZJ4A 1IUOA 3GN2A 3PHHA 1I94B 3FGOA 1UFOA 2VP6A 1FZTA 4AS3A 5CPFA 5FOTA 3SOPA 2E2WA 2WTUA 1USVA 2CWDA 2Q21A 3PQCA 2VJYA 4AL4A 4UFPA 2WQ7A 3BXZA 4QYXA 4GKKB 3HRKA 4HDAA 4ZZ0A 2QNIA 2P79A 3BK1A 5GVRA 4CMHA 1ZVJA 2Y0DA 3K73O 1RBQA 3JYPA 4FGKA 4EG3A 1Y63A 2DHQA 3W5JA 3VXKA 1DX9A 4BQFA 2UUBI 1Y8QB 1EXNA 4YV7A 3QFCA 5FWDA 3C8HA 3AETB 3VPGA 1O6GA 3O74A 3TFWA 2GTIA 2KYRA 4B4OA 5KMGB 2RH5A 1ADBA 3FUUA 2FUG6 3GB9A 4XJTA 5BQ3A 2WKWA 3DH0A 4QELA 4W1RA 4ZU3A 1F4VA 3H18A 1VJGA 1TTTA 2H5EA 4R16A 5IFKA 4UTNA 1L0BA 4WADA 5ALGA 5C3UA 1KI7A 1P80A 4NECA 2AUMA 2R84A 3Q85A 4TS9A 1ZKMA 4WIAA 3HLTA 4ZC8A 2RI6A 3BXGA 3QK7A 1X0XA 1B16A 3T1HB 1MC8A 1KIAA 2AFIA 4Q7QA 3KSAC 4JC4A 1Y7TA 3C70A 4JSRA 5P21A 4X24A 1JSLA 1UEXC 3MBKA 5HXAA 3HCBA 1TAGA 4CUJA 1PYOA 4BFXA 3T1OA 1PFKA 3EGDA 2UVQA 3NWPA 1NHIA 4KXNA 3MMSA 3V4LA 1M66A 2ASEA 2WT9A 3OFNA 2Q3MA 1UKCA 1ESNA 1YR7A 2WSMA 4YUZA 2H08A 1YZNA 1U1CA 4TTJA 3PNBA 1S01A 4W5JA 1DFHA 4GKJE 4BBPA 4Z0HO 1VJ0A 1RQRA 3H8SA 3HDHA 1Z2NX 1Q3TA 3WK9A 4GE3A 1CUCA 4KI0A 4CMAA 3GVCA 5IJZA 4ZGWA 4NU6A 1QGUA 3WYGA 3TK1A 4ZGBA 1BVHA 3O4JA 4DR1E 1N8TA 3KKMA 4X8OA 3ZHOA 5DYNA 3UNXA 1OD6A 4EY3A 3EGCA 4EJMA 1TI7A 4A5SA 1PVGA 2AV6A 2CYCA 3A1WA 5DYTA 3B3QA 2EARA 1PVDA 2C29D 4PY2A 1WNFA 1Z45A 3QVWA 5E8RA 3X1MA 4KE8A 4CKWB 3CE9A 4WCVA 2H52A 2OORC 2WPDA 4C7OB 2HK9A 2IY8A 1EK0A 1V7CA 3FPLA 4QAJA 3A36A 1OU0A 2WSYB 4WZ6A 1R37A 1HTWA 3WB0A 5BUQA 2HA6A 4GGMX 3RVJA 5EKXA 1N32B 1NJFA 2B20A 4QU8A 4E94A 3V7YA 1DBIA 1AGPA 1G7TA 1OT3A 1VFNA 1V3TA 3G9XA 2VHQA 2HFJA 1BQ4A 3UC5A 5K0SA 1E1QA 3NLLA 3BTOA 2EIHA 2X6TA 4TQ9A 1V9SA 1V9LA 2VEOA 3QMVA 1XMIA 3QX8A 1H23A 1PG0A 5L8VA 3KKLA 4O2BA 5ALFA 1EFUA 3VISA 3PLAE 2Q3HA 4JMLA 4S0ZA 1B1AA 5C4MA 4A0QA 5DI3A 1TO2E 3WJ1A 1G98A 4L6IA 4LF8B 2HQRA 2YC4C 1RC0A 4OD0A 1IUNA 2E4AA 2O1SA 3GMDA 3T5MA 1ESDA 3MA0A 4FNMA 1ADFA 5FNVB 4JXZA 1XTRA 2QW0X 4XWKA 3CX7A 3PGXA 3KQVA 1OC2A 3O1IC 1ISGA 5DBFA 3FCSB 1CJMA 4HAZA 3O47A 1U0EA 2PUEA 1TMKA 1KQOA 1T5OA 2DF8A 4IFDF 4LF8E 1E64A 2PAFA 4FBMA 3REOA 2V58A 1UBFA 3E18A 1G21B 1ZINA 1ZK0A 1OHHA 1ZKDA 2UZ1A 4OO1A 1RAFA 2VF5X 3PXAA 1U28C 2OWEA 2RH9B 1QP4A 4ZI7B 3STVA 1RYYA 3DOOA 1QCZA 4KNWA 1KP9A 1NQXA 4H3HB 3EWAA 4Y6GB 5EZQA 3TRIA 3EFOA 6REQB 1F2TA 1WMAA 1LPOA 1A96A 2BELA 3FBGA 2PLNA 4YH1A 5A4AA 5HKKA 5ICCA 4Z53A 5I4CA 4B6SA 1YRHA 1JBQA 1KK0A 2I3BA 1GGHA 2QM7A 2QRNA 2VJKA 4DR7I 4IIUA 1EA6A 1N5OX 2A1UB 2A2DA 2Q41A 4OO3A 2VHXA 1K66A 2XWBF 2R1VB 4C2UA 3G2LA 4IIEA 1V5IA 3OBBA 1NAIA 2JAXA 1HLPA 3QU7A 2NAFA 3ANLA 4W9RA 2NOAA 3BHNA 1MQ8B 3I05A 1O94C 3NZKA 1E1RA 3O2JA 3QX3A 3UJ9A 4DLLA 4CM4B 4LZWA 4QXOA 5AVKA 2GFIA 2R1TA 5DHAA 3ELDA 3JASA 1GVHA 1DS6A 2OFOA 3K8ZA 5KX5A 2Z2ZA 4IZJB 4JI4I 3BL6A 3BXOA 3SI7A 2H1SA 1UMBA 4JBLA 5CVTA 1N2XA 1GFWA 1ZN7A 5JS2A 4OSPA 3U4DA 2FLWA 4ZYTA 5JZVA 3CLKA 4GLBA 5JYEA 4H0CA 5K4HA 1I7DA 4X65B 1G3QA 3TG2A 1QQBA 3QLEA 4OSOA 1P0FA 4E7OA 4PRKA 4OAQA 3OHSX 3CZMA 4LFAI 1CY0A 2PYIA 3G17A 3WJ2A 4B3HA 1LI5A 4F06A 2I2CA 3H6GA 2W2KB 1M6WA 1NT2A 1X1QA 1U5AA 2J9ZB 3WLMA 2PXCA 2WIBA 4RZ3A 4IFIA 3G59A 5IM5A 1XMOI 5FI5A 1JLRA 3S2UA 1XXHE 3R75A 2YMMA 3MWKA 2CHVA 4OBWA 2ZI3A 1HSOA 2ZJ8A 1L4YA 3VYSB 4ZTUB 1XEWX 2DCUA 1CW2B 2AG5A 1QGYA 4EJ2A 1D04A 2QJOA 4RLQA 3U3MA 1OI7A 1T9DA 3IOEA 1K4KA 4OB8A 5DP1A 2JCYA 2W5UA 3QPDA 4IZ6A 5DP2A 2NUPB 1TOAA 3A28A 2HSEA 2XMQA 2ZKLA 3BULA 4DADA 2WJHA 4I55B 2DKOA 3A06A 4FINA 1GJRA 3RC7A 5DH9A 4YO7A 3RFUA 1H7SA 2VAPA 4EECA 4CQNA 1JQ3A 3LUAA 2NP7A 4QUGA 4DIOA 2IE0A 3CKKA 3CTMA 2DETA 4IJKA 5DNEA 7REQA 1W88B 4M98A 1WUTA 2I6SA 3MTBA 3NNSA 3ERCA 4PFKA 3A6JA 4V3CA 3NIFB 5FTWA 3HCPA 5ERXA 1RXSA 3S55A 1G291 1H72C 2DPLA 3H97A 3VYRB 1FQWA 1E63A 2ZJ1A 2IX3A 4B46A 1XRNA 3IUPA 5J5AA 1A8PA 1B00A 1R6XA 3PGLA 1YFZA 4RD4A 2PPVA 2RKOA 5D6NA 1ZXMA 1J4AA 3FAZA 4ARAA 4RXUA 4XWTA 3K2QA 2VHYA 3D5EA 3TMAA 4XR4A 4M9UA 2WKPA 3X1DA 3EGVA 1F8XA 1YIAA 4N18A 5ALWA 4ZCMA 4JOBA 1NXWA 5GQSA 1H2AS 4HDNA 1LGYA 4N3BA 1X1TA 5DK4A 3WKCA 3OCUA 4IVNA 5T6MA 3ADDA 1JHOA 2VSNA 1SBNE 2PQ0A 3K8YA 3O8OB 4EHDA 1XYVA 3KR1A 4M0UA 2JW5A 1DWOA 2Q5QA 2PZFA 3AU9A 4IJWA 4DCSA 4DM7A 1M75A 4C2TA 3SLKA 1TF5A 4DXLA 3DMTC 5I51A 3N28A 3FSRA 3FG9A 4J7UA 2VLBA 2C0CA 4H1VA 4OJMX 1OAOC 4V0MA 5LD2C 4JVMA 4JUAA 2C5AA 3F6SA 1K6MA 4DG8A 4UOQA 1GTZA 2ZWOA 4AZ3A 3WKBA 2TMGA 4X45A 3EGXA 1QTNA 1V1MA 1GGJA 2PIDA 2XRMA 1FDTA 5I48A 1LS6A 4RPFA 2F8MA 3EDMA 2ZB2A 3HSYA 3V9PA 3WLQA 4JZKA 3ZE1B 1H0RA 3RSFA 5LNK6 4FLMA 1NVFA 4PWYA 1KBZA 1I33A 1OX4A 3PX2A 4TWJA 4G5SA 1PYDA 3N74A 4X8HA 2ENWA 4PPGA 4CM5A 3AUFA 3T5BA 3V8BA 3EVAA 3HXMA 4YDSA 3SQWA 2CFIA 1YQTA 2Q3JA 4OLAA 5DLYA 1NW7A 3PPWA 2FZWA 4CT0A 2BH2A 3FUCA 4I1VA 1JSZA 4X1KA 2AJ8A 3DHEA 5CIQA 4B43A 1DARA 1PL8A 3DMDA 4TL9A 3VH1A 3UHMA 2QJRA 3LUBA 3RSQA 1S7CA 5JAZA 3AHHA 1RM4A 3RS4A 3JZAA 5IKMA 1Y37A 5A04A 2XUHA 3BCUA 3UK7A 5IEBA 1G6Q1 4BZWA 1DAOA 4ZVUA 4Z8XA 3E81A 4BV8A 1DC6A 3MXTA 2Y05A 3QELA 3MTIA 1EUZA 4FE7A 2I1LA 3WGVA 4DIBA 4JLNA 2H1HA 3IVGA 3WL6A 1UP7A 2ZREA 2Q1TA 3AKCA 3EIUA 1AKWA 3IELA 4Y1RA 1PT8A 4XI9A 5ERYA 3M70A 2JE6B 2IF2A 2WYWA 5GOZA 3RVBA 3G8BA 5AOAA 1XROA 4ENTA 3QX7A 3RTDA 4KP7A 3L1VA 5FV7A 4EF4A 4EP1A 1CUUA 4EOGA 1TO1E 3C3WA 3GOHA 3OPVA 3D6AA 4BN0A 1JR3A 4N7BA 1SOUA 5IDYA 4B4VA 3A6HA 4HFJA 1GLNA 1WIWA 4RD1A 4TOIA 4FB4A 3R9XB 2BMAA 3T41A 4GOMD 3K31A 5EY5B 3NTUA 4AYTA 1DBSA 4PYRA 1MG0A 3F7OA 4XSGA 3CVUA 1GV1A 4DV4B 2LUOA 4EG5A 3KUDA 4P83A 5EJ5A 2QM0A 4X61A 3QQ5A 5L3VA 4DQXA 2OSBA 4B6FA 1AKUA 3H86A 1U8ZA 2UXCE 4NFYA 2CDRA 3T7EA 2Z83A 1WD7A 2IS6A 2FMHA 3PC8C 3Q1LA 4RV5A 4DANA 1U2TA 1E2UA 1MG5A 2HTEA 3ZXIA 1BO6A 3BB1A 1P5RA 1SO8A 3H13A 1QGOA 2QZPA 4XUGB 2GLTA 3G5TA 2V0GA 1KEPA 3NQ41 3V1MA 2CUKA 1AV7A 5B7PA 4P7FA 2PM8A 1KRXA 5EESA 2Y9MB 3OKAA 4WY5A 4ESOA 2UXCB 1M83A 5ER6A 3LXXA 4FDAA 4PZ0A 1TK2A 3C97A 3H1PA 1HH4A 3LKVA 5BSUA 2P9YA 4KLAA 4KR7A 2RGUA 3GFGA 4I19A 2GCPA 2C58A 4MVJF 1YZTA 3LUFA 5CA1B 3WLKX 1HYEA 5F9FA 1CUBA 1J5EB 4KLNA 3JQBA 1VE7A 3GVPA 1CEXA 3QP9A 1KOFA 3D0QA 3G85A 4Y9TA 3H3XA 1J1IA 2DU8A 2WPDD 2UU9E 2A78A 3HYTA 1WDWB 2WOOA 2I2FA 1N5JA 3QI7A 4GYJA 4D74A 2GBIA 1P2DA 3CNLA 2AZ4A 1PKXA 3FB1A 3KZNA 5T64A 4DHEA 4DR7E 2LPMA 5EIBD 4DV5E 4MW5A 5JCOA 4A6XA 2BTQA 1I3OA 2VDKB 3IEUA 2B78A 4O4JF 1NOIA 1QFZA 3AVVA 1P39A 3HBFA 4H17A 2OHFA 2WA1A 1REQA 1T2AA 4INPA 5ECDA 4PRZA 4EB8A 5ITVA 1CR4A 1UDQA 1RM0A 4JR1A 3MTDA 5EMKA 2ZJ2A 3ZY3A 1JSRA 5KINB 4MU4A 4MS3B 2HZBA 1NNSA 4H6WA 4TZ0A 2II6A 3ZY4A 1LFAA 3Q1KA 3RS0A 1MAUA 4F2WA 3UJAA 1U81A 4A9AA 4CLHA 5HCNA 1HR0B 2VZLA 4B5LA 2VPYA 1KMNA 5FPTA 2FK7A 3Q7PA 1PJCA 2PZKA 4Y2UA 4RJ2A 4HYQA 4LTNA 5COAA 4US2R 2AMYA 3R4CA 3R3UA 5JAUA 3MGCA 4HGRA 4PXAA 2YHSA 5A0TA 1G63A 4BA1B 2Q0XA 2D4AA 2DWOA 2QPOA 2XXJA 4PEVA 4HXFB 2ZBKB 1BFDA 4NBVA 4AKSA 2K87A 2YIDA 2XVAA 3KD2A 2DTDA 3C5WP 5KNBA 3NBZC 1HR0E 3K71B 1OSNA 2BEVB 2DH6A 2R3SA 3Q7RA 4L27A 5F7OA 2W2MA 1Y9ZA 3E58A 3HBAA 5E6UB 4HQRA 3D7NA 3SHWA 4XZ3A 4DQKA 4E6PA 3V1NA 5FPKA 2ZS9A 3NJRA 3MS2A 4GH5A 2BZ1A 4URXR 1XOIA 4EI7A 2FXVA 5JFOA 5BNZA 2LW7A 1EMDA 1NPYA 4HCJA 3K0AA 3OE5A 1FBTA 3FTCA 1ZOLA 1I30A 2WMNB 3H9JA 1X3LA 4MYUA 1HNXE 1T5DX 4UAGA 5FEMA 4AECA 2GRAA 2BM9A 1PFUA 1X19A 5EE5B 1NVVR 5FPHA 2XLCA 2ZDQA 3PNLA 3UH1A 1JJAA 3ZDXB 1QCCA 5LMUB 2A86A 2D2FA 3TNDA 1DAIA 4ICIA 1BOFA 2R87A 4Q3KA 3EFHA 3RIEA 1PAUA 1QPGA 5H3HA 1IXKA 2QQ0A 1OB5A 2V2ZA 2XCIA 3N2YA 1ID1A 4D9IA 2OV1A 5J4VA 4BNHA 4WK4B 1I1HA 3N8DA 3B20A 3L46A 1JQDA 5KTKA 4YT5A 4PX5A 5EJ8A 2NTJA 3DEJA 2XZLA 3DCYA 1HEIA 4OHKA 5FH9A 2IOYA 5AKJA 2E5LI 3YASA 1IJKA 4B81A 4HDSB 3ZYZA 4EKNB 1JU3A 3FZGA 4E5VA 1QKJA 2F1JA 3EPLA 4E31A 3CCCA 5BN3A 3U7GA 2H4JA 4KZKA 2IITA 5KNCA 2GYYA 2A5FA 2B61A 2OO3A 3F3MA 3GDWA 1NYQA 2YN4A 4I4IA 2O0LA 2ZFUA 1SIOA 4LXTA 5SYAA 3C1OA 2IUFA 1H85A 1U2GA 1YU6A 2P1RA 3QV1A 4L2IA 4BOYA 2G76A 1HQCA 2ZSIA 4HWPA 4FC7A 3OPYA 3GLFE 2ASVA 1A04A 3FVQA 2XH8A 1KFJB 4WN9A 1ZGAA 4U3DA 1EWKA 3J7AC 4K5QA 5BRAA 3QLVC 4TYQA 3HNOA 2Q4OA 3MWYW 4WBSA 3NALA 2WIFA 3N53A 4IS9A 2ODNA 2PZMA 4HX5A 2XGGA 3EZGA 2AFRA 1KZ7B 4FJ1A 5TVKA 3SSNA 1XB2A 1D2EA 2AX3A 1Z8DA 2KBFA 3EPRA 2CD9A 3OI7A 4E6EA 1U99A 4AMBA 1XK7A 4GLLA 4LOLA 3K6SB 5IZCC 2Y77A 3LLSA 3N07A 5L9AA 1ES9A 2VHWA 1ODTC 4Q6BA 3LBHA 5EMNA 4DPKA 2QY9A 2FQYA 3B3GA 2WAYA 5BV7A 3FLEA 4WWHA 4OG2A 4E51A 3I2YX 2P2LA 4J6FA 4RA9B 3U40A 3JATA 4B6OA 1RXIA 4BLSA 2J65A 1L1QA 2E37A 2A33A 4IO1A 3D31A 3NOXA 1NMQA 2CDBA 2G6TA 4RVDA 4CU5A 4MICA 1GAJA 4KAFA 1EP3B 3S70A 4KMOA 5K36D 5C35A 4EO7A 2AH5A 1XPUA 1P31A 1ZNQO 3FFTA 4YDHB 1UXGA 2C57A 4QHSA 3DVAB 1A77A 3ASZA 4MQUA 3PFBA 1TU0A 1Y42X 3MBOA 1XCMA 2Z2XA 1LX6A 1AXRA 3VC3A 1Y8RB 4R6WA 3R40A 2FRDA 4J4HA 3QZUA 4MV6A 1AGRA 3SSAA 5I8ZA 2WUGA 4GM4A 4XOIA 4EYSA 2NU7B 4EUNA 1HZJA 3RJ5A 4RHXA 4B32A 5JBIA 3LZDA 5ADUS 2PV7A 5LZ9A 3HL4A 4IUYA 2BL4A 3H2GA 1E6MA 2PRYA 3EVFA 4JU9A 4LDRA 4XASA 1MX1A 4YCBA 5ELWA 1Z5WA 2AE1A 4D4JA 5BQFA 5IKXA 2Y8EA 1CQJB 1H1LA 2DHEA 1QF6A 5EJEA 1RADA 3OQBA 3QVMA 1EWQA 2V6BA 4E5YA 1U0RA 3V3KA 2VQFB 1G5FA 2G6BA 2H5LA 1ZK2A 2TRSB 4G86A 4ONEA 3I64A 4UMVA 3RRJA 4JMPA 3MAAC 4CHGA 4W5RA 4ESVA 2FETA 2C7OA 1V3VA 5T8KA 1O08A 1J8MF 1NXOA 4FXPA 3L9WA 4MQ5A 1WQ4A 4TMZA 5HOEA 4CF7A 4LSWA 5KSYA 2GF0A 4JI8E 1GTG1 1CSEE 4ZI5A 2PGIA 2IIVA 1VL6A 4G4IA 5AW8A 5FBVB 1L4GA 3GU3A 1M76A 1TJ5A 3PJFA 1Y6RA 2H2DA 1YO6A 5F3RA 3R9IA 2V1UA 1T3ZA 2YJ5A 2BR5A 3DYBA 4AJ1A 1L4NA 1N4DA 1POWA 4LF5E 3WU4A 1A5ZA 2G06A 2E5LE 1CR1A 3MJTA 3ELWA 1XNRB 2QHXA 1CVRA 1RAHA 2BT4A 4MWDA 4XXHA 3K5HA 4COOA 4EYGA 1R6LA 2HH9A 5D7NA 3T54A 2WW4A 3VO9A 4QBGB 5C32A 2IL1A 3FOAA 3LPMA 1I4DD 1M33A 4HB3A 1B0AA 3HU2A 1ULTA 4JU8A 1RBYA 3WV5A 2DR2A 3KXPA 4JI0B 3RRNA 1D0SA 3ORFA 3BRWA 3H4VA 2C5EA 2EEPA 2IYOA 4GDMA 2WZBA 3UHOA 2ZPUA 3W90A 4A8HA 1V8FA 2IHVA 3LQ1A 2AL7A 3GJ7A 3LAWA 4QHYA 3KSDO 4JP1A 5CBPB 1G0OA 2V54A 3O4GA 1SUEA 2OZVA 4R1LA 1PFYA 2PVPA 4CM9D 5HZGA 3T7KA 1FFHA 4I81A 1FNBA 1EG2A 5T4EA 2WNSA 1SXPA 1COWA 3MT0A 2GO7A 1WUHS 4RNDB 5HF9A 1FNNA 5AMXA 5HVNA 5HUQA 5I8PA 3SBDA 1ZBQA 1TECE 3GRKA 1BWPA 1I6WA 3F73A 1P8AA 1I13A 2AN4A 1Z6AA 1DTEA 2WJ4A 5AW4A 3ICEA 2DFKB 1YGPA 1D0IA 3KELA 3LNTA 1TPYA 4H3VA 4IKOA 1WR8A 5J2UB 3S1SA 3O38A 1W73A 2P9GA 1HR0I 3IR7A 1EE9A 4JI7E 1UAYA 3A6KA 4NU0A 1POXA 2FXIA 4IWXA 4LJKA 2V6IA 3O8QB 5BW6B 5C8VA 3DZBA 2AD5A 2A9KA 1GD1O 2CHEA 2IEGA 1HLDA 3PJDA 3Q3HA 4Q7KA 3M3DA 4ISCA 4X20A 4DXDA 4BA2B 1QVAA 1FMFA 5JQGF 2OC9A 2QTMA 3OTQA 4Q9DA 1UJBA 4FKMA 3DEHA 1YHZA 4YHHB 2F8SA 4BP1A 4F93B 3C6ZA 8LDHA 4ZKDA 3DWFA 4EVRA 1WJGA 4PNHA 4IUBS 3GW8A 4NXMI 3V33A 1GZ4A 3H42B 3PWKA 2BR4A 1FXSA 1MR3F 1TNDA 2YC2C 3OSZA 4M99A 2IWHA 1CV2A 5K3SA 4YJ2B 3L41A 1U2QA 2Y1LA 1WO8A 2EGGA 4EPVA 4EFKA 2WR8A 1U8AA 4XE5A 3HZHA 3E7WA 2ZSKA 4OOEA 1DIAA 3NHSA 5TPZA 3W1VA 3I83A 1M34B 3C3MA 4QOSA 5AM1A 4RJKA 3IO3A 3MK31 3S40A 2P68A 4I6EA 3AP1A 1LBSA 3SEQA 1TCVA 2X8JA 3O8LA 4HZGA 3FRHA 4EPYA 1E2KA 4G84A 5HX7A 3WDMA 2HU8A 5ALSA 1GQ2A 4Q1FA 1F8UA 1US8A 1NW8A 1K7FB 4RY8A 3U9LA 1S3IA 1D2HA 1JEAA 1JDZA 4QKQA 4ILKA 1IHYA 1M34E 1T9GR 2ZS8A 3DE5X 4M87A 4O2LA 3RANA 5C0OE 3ZGNA 4LY6A 4FYVA 4Q05A 3FPKA 4MV1A 3GT3A 1UDNA 2A5JA 1KJYA 3IJRA 1WMBA 3ESBA 2BN4A 4DUGD 3GEHA 4I0WB 4AI6A 2A59A 5LQSA 5EE3A 3TLXA 3L6UA 3NB0A 5JAOA 3D4PA 2PU5A 1ZJ6A 1MC1A 3FXAA 4XQEA 1B6TA 4ZRDA 3VDMA 1O97D 3ZCPA 4D4IA 1AO0A 3QY9A 1N0WA 2BA1G 4G8DA 3J7AM 2FPMA 1RCFA 1AUOA 2HMWA 1P1IA 3KB6A 3OESA 1QLWA 2ZUWA 5JZSA 4CV2A 5ADHA 4HPWA 3H8JA 1HURA 1M2VB 1QP8A 1XA3A 2R7MA 4NCAA 2XUOA 4XLLA 2WFZA 2BEKA 1U7OA 4A8TA 4Q4DA 4EA8A 5EJ4A 3L8YA 5AKZA 1TXGA 3TTXA 3EIEA 2NO9A 4NIMA 2J46A 1P4JA 3TR0A 3W6ZA 5BORA 3TTVA 3U60B 2XUJA 3DF7A 1SKAA 3FHTA 2P3SA 3FZYA 3HKBA 1X8LA 4IEIA 3SC2A 2FYTA 4AB1A 4KYUA 2VUTA 3I4FA 1DQZA 1Z29A 4R81A 1A27A 3NANA 3MUOA 4G5OA 4QL3A 3ZQ4A 2WG2A 5C53B 4PLVA 2QT0A 3SJ7A 1WMFA 3EDRA 4FHEA 5JCOC 4GR4A 4TS3A 2XF2A 5ESWA 5GONA 3RODA 4X65I 1LF0A 5E6RB 3S2ZA 4ZZIA 4DR1B 1VGVA 2JEBA 1VSBA 4FJ2A 4NK5A 4LJYA 1GADO 5LQCA 4JCOA 1KVSA 1Z63A 1L8XA 1P2SA 5DDIP 2PY6A 3OJOA 5LU8A 5LB2A 5T7BA 5KKNB 1C1HA 2GEFA 4DHWA 1GZUA 4KQMA 4NYIQ 1JHYA 2Q99A 3IOCA 4BX3A 3D6UA 1FPQA 1T6NA 9LDBA 4GI5A 2DUWA 3CEHA 1FFSA 4UU8A 5FBHA 1CQWA 1N32E 1BMQA 1GNSA 1CUAA 1XZHA 4UTZA 3GFTA 4BC1A 2W2OA 1QGDA 1I2MA 3ZGOA 1NVTA 4DCJA 2YZGA 4L0MA 1CF4A 1SCNE 1G3MA 3FLBA 3VTKA 1IHPA 3G88A 3N3AC 1HGXA 2IVFA 5KVVA 1PSDA 4O1IA 2R0QC 5L3JA 4XDHA 5REQA 2FHSA 3FFXA 2Q4EA 3MD9A 5JNRA 3A11A 4NYJR 2X4DA 3BZBA 4G0VA 1DEXA 4JJZA 4Q4HA 3V48A 1C9JA 1E3WA 4GMKA 1X1BA 5IXYA 2JGJA 3DMPA 5DT9A 4CETA 2VTBA 3IQEA 1CY2A 3EQZA 4HUTA 5UKDA 2B99A 4UPDA 4HFNA 4QGGA 3MCWA 4R2KA 1VJCA 4BQPA 4GX5A 1KK1A 1SXJC 4MX8A 1ZC3A 4JI6I 4URYR 2OQIA 1G16A 1Z2CA 4MYRA 3H9UA 4XD7D 1UC9A 3RO7A 3A3NA 1T8TA 1WZUA 3SBEA 5DWQA 5JLJA 3EA4A 1MW8X 1RZ3A 2R4TA 3GVIA 1H0SA 2D7CA 2IHTA 1EFRA 1E89A 4ZA2A 1E1NA 3HFSA 2JL1A 1NKSA 1SKYE 1SK9A 3BCSA 3II6X 4IMPA 4YECA 3S3TA 1YB7A 3VSBA 4MV4A 1JFVA 2UXDB 4DBVO 5JH7F 1XNQE 1KOJA 3GI1A 3IE1A 1GT6A 1BVUA 2NUAA 4MYTA 3THRA 2F1RA 4QD3A 2OGZA 4CIXA 1E2GA 3B8HA 2B4RO 4TKVB 1B6GA 5A5GA 1JKIA 2AR9A 2LVBA 4R9NA 1JR6A 3Q7IA 4E1BA 3WGHA 4Q5IA 1E1CB 5EKWA 2WMYA 3ZV3A 1Q83A 4X1IA 1K2VN 3KB2A 1HUQA 5BN5A 2I8CA 2A92A 4M8NE 4HDMB 2QZ9A 2O0HA 3RT7A 1XQYA 4IQ0A 1XTVA 2PKCA 2QGNA 3LO5A 4WY8A 5IWAB 4GU5A 4DQVA 1MZVA 3HDVA 5GJBA 2G07A 4RZHA 5E4FA 4D4LA 1IEXA 4XQ9A 2B92A 3U61B 4HG2A 4EQ6A 4S1PA 2VJCA 2DBQA 1PEYA 3A9TA 3O3OB 6REQA 1HEYA 3BIXA 4EHJA 3BZWA 4J1QA 4ACBA 2XA9A 4IQ8A 4BRZA 3R0ZA 4EITA 3NHYA 3Q0IA 2BFFA 5JC1A 4JJIA 1P1BA 3UHAA 2WZQA 1ZH2A 3DTYA 4UE6A 5KTOA 4LF6B 3E4DA 2EATA 2GCNA 4OPMA 2HM7A 4B4UA 1RWNA 3KPJA 1A71A 1GAQA 3I9KA 1F0NA 3QHPA 1O96A 1E9AA 3W5AA 2B4QA 2VWHA 4RJLA 1JHVA 4QT4A 2FEXA 4OXXA 2ALJA 2GSDA 2ODAA 4H4EA 1SOVA 5D7BA 4ZWNA 1SUAA 4FYPA 4R3UC 4BWYA 1X74A 3QU2A 2C82A 5JNSA 2P6RA 3MERA 4IFEA 2OYRA 4YHBA 4L78A 3BIJA 4HPJB 4TT3D 4X95A 3TAUA 1RP1A 1LI7A 2XMDA 4ZU1X 5FA6A 3EEBA 5LLTA 1QIKA 3EEOA 2JGEA 1DJMA 2BGWA 1K75A 2P9JA 3TEJA 3G8CA 4R6XA 2V7GA 4RM3A 3NYWA 4JBWA 2A4MA 3CH7A 1S1CA 1RZRD 3L0DA 3JQPA 2RCYA 3HVJA 2SKCA 3PI7A 1XEXA 1VP9A 3LF1A 3RS2A 4YMVA 3FTFA 4D44A 3PNPA 1OBHA 2ZRNA 5AESA 5ICSA 2C9ZA 3EDOA 4LBWA 3B3JA 1LV8A 2R00C 1JU9A 2G9ZA 4KSBA 2FP4A 4MWCA 1JB1A 2XGJA 3HDQA 4LJ8A 3KTAB 1KSFX 4DIDA 1IVSA 4MVYA 3Q9SA 4J6EA 1D4AA 3DQQA 3MWFA 1UODA 5BXYA 3AERB 3DLPX 4UBIA 4UW9A 1IZ0A 1SKUA 1WE2A 1MIOB 2FF7A 4GKKI 4LJ7A 4EY6A 2IS4A 4Q1AA 3B9BA 3IIMA 3TOVA 4HD8A 1UZUA 3N6RA 4ZV7A 5C34B 1NQWA 4YXWD 6NULA 4GOXA 3WK7A 3IAFA 2F67A 1PG2A 2LKDA 2H11A 1ZL0A 3QVJA 1OVGA 1PK9A 2B7CA 4Q93A 1CUWA 1HRDA 4NDAA 3V8RA 5BT8A 1MLDA 5F51A 3H2YA 5LJLA 3D3WB 4GIBA 4IRUB 2CXPA 2P2SA 1JECA 3CF6R 1D7AA 1GYRA 2J67A 2WIDA 1S4EA 5HJ2A 1J0XO 3L05A 4DR3E 2ECOA 5FJJA 4DRYA 4J8PA 1T0BA 1EJBA 1H8ED 4QBHA 1R6AA 2GKGA 1DXYA 4JHXA 3AEQA 2P5SA 1TJ4A 1F8YA 3CW9A 2O2DA 4WQMA 5ENVA 3QVGB 1UBLS 5BQPA 4EB6A 4LV8B 3KJQA 1T6ZA 5AW6A 2RHWA 3OJWA 1F8FA 2J9FA 2G82A 3PGMA 4YHHI 1HE8B 1HQDA 1YS1X 1O58A 4HEHA 5E9QA 3KBOA 3WLNA 1CT9A 5EWMA 2BHTA 1PQ4A 1G8JA 2I67A 3ABOB 4IJ6A 4DR6B 4A5OA 2C59A 3PIDA 2NN6D 3OZBA 4MROA 4TL8A 1RR9A 1JVSA 1VDZA 4DAEA 1JHZA 1VE6A 3RRYA 5CB4B 2WTEA 4C0BA 4N8EA 2P1ZA 5JIBA 3DUFB 3E0QA 3KHUA 4BFTA 2X9QA 3DNFA 1V5EA 1V6SA 1M6NA 1MO2A 2HCBA 4WERA 4LKRA 5I5GA 1QK3A 3W5BA 4LFCI 2OPBA 1H8HA 1T5BA 4P82A 1N9GB 3E05A 1NI5A 3DNPA 1OXUA 3ELYA 3R7WB 3ZWAA 4EKIA 4F1KA 5C1DA 5TGZA 3TTYA 2HA4A 2IEDA 1AQ6A 4P5DA 4BGUA 3EF1A 3G9ZA 2UKDA 2CMGA 2RGAA 2D4HA 3I2JA 2EZ8A 5AHRA 2MMCA 2VPWA 3PL5A 4HRXA 2XUDA 1P1FA 4QLAA 1KGSA 2C38A 2R47A 2HA2A 1MCZA 4HZIA 3VTFA 3OQIB 3QPCA 4IXNA 3ORSA 5C1BA 1QG0A 4DEYA 4KO1S 4RXMA 1FP7A 3UOWA 4KITB 3OJCA 2TSYB 4KVFA 1QHGA 1YK1A 3T0GA 1WXGA 4POOA 1C41A 3ZW8A 4UHEA 5FPQA 1O54A 1NJ5A 1CC1S 3AYXB 4B79A 3BWXA 4OYLA 2TMDA 1TMOA 1D9XA 1P4AA 4YRQA 3KPWA 3MTAA 4E0BA 2BBWA 5ALMA 1J5XA 1PVOA 1JXOA 2V55B 4G4SP 4RFSB 3QPAA 4V0QA 3LKZA 3OE4A 4PVDA 3ROMA 1IZ8A 1G8FA 2C0PA 3EY9A 2JLUA 4J16A 2NUTB 3F6BX 5CH8A 2VHCA 3O4HA 4PYKA 4DQUA 2YJGA 4DDWA 2IGTA 3P2JA 3OAAD 3CF0A 5A03A 4MPJA 5T4BA 4J7XA 2E4XA 3DMNA 3I6QA 5IABA 5JY1A 3DFZA 3O0TA 2J6CA 3HMQA 4PS1A 1YE8A 3TTWA 2GK4A 2BRUA 4MRVA 2P69A 2XECA 1G5IA 2O5RA 4OXYA 1Q44A 4V1CA 4AZVA 3DFFA 3EF0A 3GAFA 2D3TA 1F6DA 3P0RA 4TQGA 5FNVF 3VO2A 3K8QA 3UIEA 1ADYA 3UXHA 4JI7I 3CX6A 4EDFA 2W2LD 3I42A 1K8ZB 4MLZA 2IXBA 4X64I 3R9WA 1QS0B 3HEMA 1WSWA 2C84A 4QNNA 3H7AA 4DV0B 2FFQA 5JJCA 1XPRA 2LDXA 3NYRA 1JBEA 3H5IA 3JCZA 3O21A 1DQPA 3E9NA 3ISTA 5F1PA 3TDKA 3VC2A 4PBSA 2VJBA 4ZMSA 3N8IA 2H0AA 3MHPA 2M9MA 3HR7A 3OU6A 2C88A 2QLNA 1T4CB 1Z2AA 3K0CC 2QZ4A 5EGNA 3V80A 4BGDA 4JVSB 4X41A 4YIKA 5ALEA 3AIMA 3V4OA 4AKTA 3J80C 4H60A 2BGJA 2CGEA 1KY2A 2GD0A 4OK3A 3BDAA 2IPNA 1QCYA 3A27A 3KB1A 1ZM7A 3NAZA 3UMSA 4C4TA 2IV3A 4E1VA 2GJSA 1BXGA 2NQTA 3OOWA 4WN3A 3G5UA 4X54A 1YK0A 4H3SA 4D4KA 1V2GA 5C46F 4BASA 2VT2A 1KQNA 4B7ZA 3E8XA 2QW8A 3C48A 3A26A 5J2TF 4DLRA 3Q7QA 4XYBA 4HY3A 4IR7A 5DM4A 3AT1A 2V6JA 2NO4A 3HVKA 5ECGC 4KXQA 3AHIA 1RXYA 1C81A 4FGJA 3DOCA 5EQFA 2M6KA 3CZCA 1Z6QA 4IG9A 4B82A 2R48A 5CK4A 3JYNA 1KAHA 2COUA 2YXDA 4KPYA 1T2UA 3P3EA 4OZEA 1T1RA 1K8QA 2ZCUA 5K36C 1G21A 4V0LA 4KGXA 3K6RA 3DZ8A 2WKQA 3LUDA 3PWTA 3DKVA 2M1XA 3MB5A 2LNDA 4Z7CA 3IJ5A 4W7SA 1MZPA 2FZ5A 4IGFA 1V5GA 5AW9A 3TIXB 1P1HA 3WYCA 2DGDA 1ZGHA 1KZGB 1ZL2A 4YP9A 4LHVA 1HNXB 3UMRA 3AMVA 2XQGA 1O5TA 5LWHA 5AWFC 4Q3CA 4LECA 1Y8CA 4YP0A 2VZ0A 5HCIA 2OPHA 3UT6A 1YFJA 1PF7E 2FUCA 2IXDA 1UEJA 1FNCA 2E89A 2G36A 1AGXA 1FP6A 2QLFA 3SC4A 4NBSA 3JQAA 2PZBA 3B70A 4K40A 4TZKA 1VL0A 1R8QA 3KTAA 4NBUA 1ESCA 3ZJVA 3CWVA 4ZJYA 1C9NA 3ED1A 1W34A 3IFSA 3GLIB 1XDDA 2VATA 4E14A 4CLRA 5A06A 4BQSA 1T8PA 1CIVA 1HRKA 2WUVA 2Y0CA 2HHHI 2PGXA 4BMCA 5A5EA 4WH0A 2V7WA 3K9CA 3UK2A 3CT4A 4FFSA 4MR9A 2JLCA 1IUPA 2PZLA 2QEQA 1P4RA 3U31A 4FWGA 1Z5CA 1NNUA 2YHBA 1FFGA 3DBHA 4MP3A 4R05A 5EUCA 1VE5A 3ETGA 4BWVA 4YMLA 4CMKA 4H1WA 5HK8A 1K3TA 1U5BA 2GNOA 1BHJA 1F2UB 2LDBA 2FFJA 2V7UA 3DA8A 1CRLA 1QKIA 3QKWA 2WFLA 2P3LA 2WU8A 4HACA 2X1MA 3D6HA 2R11A 2VVTA 2IH4A 5FD8A 3VZDA 5KJCA 1I1OA 4F60A 1QQ6A 1AF7A 1G18A 1MIHA 2HCJB 4QO8A 4YTEA 5JNWA 1CS4C 1S0UA 5IM4F 3HL0A 4F9GA 3ABQB 4ZCTA 1RKUA 3U44A 1VI2A 5A2QQ 3PX7A 2HEIA 2QP4A 3D2LA 1N3LA 3WU5A 5LXTA 4N8SA 1GAWA 2QD2A 5DFAA 5DMHA 1Z0BA 1Z15A 2EZTA 2HJ9A 5CGQB 1PBNA 2ONCA 2ACEA 3I4LA 5AVWA 5EINA 1OY1A 1XJWA 4DSZA 1TAHA 4XTRA 1NE2A 1N33I 4HEA6 3WL8A 3KIPA 1LX7A 1ISMA 3E27A 4QU9A 1BXRB 1YQGA 4REOA 5JEEA 4JC8A 3L79A 2FV8A 5H4HA 2D1TA 1T13A 2JIQA 4CF6A 2GM3A 4P5EA 3TW4A 4Q9KA 1WBJB 1WCXA 2CJWB 2GZ1A 2QYTA 4G4JA 4UJ5A 1F3LA 1T36A 2J3QA 2OUKA 1OMOA 3DBHB 4CIBA 2D1QA 2AF4C 3AONB 3PRKE 5KC9A 1HM5A 2DHDA 5FOQA 1NV9A 2J5XA 3UPTA 2GO4A 3PCRB 4BNMA 3FIJA 1C8VB 1YBMA 2CNKA 2RE8A 3OTIA 3EE6A 1N36I 5C4IA 1EYZA 1R9NA 2VNSA 2R7KA 4BAUA 1VLLA 5T3UA 3E3AA 5JQWA 3KKZA 2E55A 1E2QA 1X14A 3JAMC 2YY6A 4K26A 2BCGY 1LY1A 3LVFO 4A1OA 4HH4A 1LSJA 3UMFA 1SU7A 4KEAA 3BE5A 4WFQA 5LIPA 4BO8A 4Y7DA 1VKHA 4R2XA 4DA0A 4F72A 1V8ZA 1V11B 1EJ0A 1F5NA 5CCDA 3UK6A 4GQIA 2HF8A 3FKSA 3GZNB 2C2BA 2PKRA 1V3QE 2C4HA 4RQBA 4XYGA 3NXSA 1T9HA 1H5QA 3NBXX 1QH1B 3PHCA 3PJRA 2QVXX 3GEEA 3K6JA 4HSGA 4ZVQA 1UBNA 3C3BA 2K2WA 5FOXA 2Q27A 1R8SA 3PC3A 1U7HA 2VJDA 2YXPX 3DTTA 5C5CA 3RHTA 1BU5A 3OZGA 3FWPA 2FN7A 2FI1A 2BI8A 3R2JA 4ZOQI 4I3GA 1H3FA 4Y6QA 3IAS1 1KI9A 3S1LA 1DINA 2QORA 5EP3A 1R74A 2PZ8A 2WT4A 5EJMA 4HLNA 4IZHA 2PSSA 4C7BA 3MMXA 1A4RA 4C4SA 3O9VA 1DX4A 1WV1A 2O52A 4G09A 1GXSA 2G1AA 4IMJB 4RD2A 2AXNA 3ZI7A 3ZKAA 1T2NA 3K15A 3PFGA 2X4LA 3RT1A 3DAYA 2GEUA 2I1VB 3H1AA 4MUKA 3M33A 4MRSA 1VSTA 3GT4A 4OB6A 1R0RE 4OH1A 4X1IB 3WK6A 4Z7JA 5A3RA 4ENQA 1K27A 3AFOA 4GMXA 1JR4A 4U7PB 5FI3A 5JYCA 4HADA 2G0NA 3W78A 1QV9A 2VH1A 5EGSA 4BNVA 2QUAA 5GJWC 2HQBA 2XT0A 1U8YA 1Y80A 1TRKA 5ERGB 4M0CA 2F59A 4KQKA 1X9HA 2B4YA 4PYMA 3D2AA 2Q45A 1RWMA 1GU0A 4FYWA 5IBQA 3RYCB 3HK2A 3MSXA 4X90A 1SD5A 4G8CA 2B0JA 3RQIA 4JKOA 2WDZA 4LDPA 3T99A 1QNFA 3LDUA 2XUAA 4KAJA 1GRVA 2PLRA 3B9PA 4RDCA 3UMJA 1Y3BE 3RUCA 4EYOA 2HPHA 5D01A 4ZVOA 3HY3A 1HKUA 1RQXA 3K6KA 3WA6A 1QVVA 4NMHA 4NQRA 1FDIA 4GYYA 3WKDA 2F3PA 5EA2A 3IP9A 5GMOA 4X97A 4QWWA 4CF5A 4FFBB 1O03A 2E85A 3ET4A 4PPNA 3TSWA 1JA1A 2GZ2A 1Y6FA 2OY0A 5LYYA 4QXQA 1LPNA 1LH0A 3MNFA 3U4QB 3WOHA 3DOFA 1TC2A 2EKZA 3IESA 3TN7A 2B0CA 2I4TA 4X64B 4ZHSA 5A4DA 3PDHA 4QJ3A 3R9XA 1JH8A 5HR5A 5E1DA 2Z43A 5JWOA 3WU6A 5KI6A 2DBVO 1VG1A 2ZTVA 3KJNA 3WIUA 3TSZA 1NF9A 3OQPA 4QNMA 4X65E 1E2LA 5JAPA 1NSTA 5JATA 5F1OA 1R6UA 4IOKA 5KYVA 1W36B 1P75A 3A1VA 2FSUA 2J5RA 2X41A 3BE8A 5EUMA 3AV0B 4JV5I 3KX2A 2Q4TA 4XB1A 4UEJA 4O1HA 1XJQA 1Q0HA 4N47A 1VCNA 1A9TA 4BLWA 1DE0A 1ODKA 2EZUA 4LK2A 1Y1QA 1EFKA 2CLOB 1UXJA 3LX4A 2AFHA 2X1VA 4YPFA 4R8MA 3HG7A 3NIDB 2LRHA 4O63O 5AW2A 1C1DA 3BFXA 1RQGA 5FOSA 2BEJA 4RVUA 1BX3A 2KBEA 2FB9A 3VGPA 1M2NA 2PEYA 1TQDA 4UM9D 1YDGA 1ZK3A 1XX6A 2O1UA 2AS0A 2PNFA 2R1VA 4W8OA 3F3SA 2OG1A 2N42A 2ACKA 4NDNE 1DO8A 1E6WA 2P4HX 2GNPA 3DFIA 4ZCPA 4V2IA 2ODBA 1GL3A 2P5YA 3B6KA 4P32A 2Q3LA 3RDPA 4BUJA 4B44A 2O7VA 1K0FA 2I7TA 5K36E 1EX9A 2ILTA 1NLUA 1GILA 4MVCA 1A4UA 1J23A 4A23A 2WFMA 3BTSA 1UMDA 4ETIA 4LWOA 1E3HA 3MELA 1AS0A 1S7GA 1PJSA 4MZXA 5HIJA 2R7AA 3MT8A 2RHGB 3ZW7A 3CJTA 5JMOA 4LRWA 1F38A 1SD1A 1EFPB 1VHLA 2VHVA 2GA9A 3M4XA 5FTNA 3P97A 3RAJA 4EKGA 2BI7A 2DHCA 4J4BA 4IXWA 2IYVA 3QVUA 3W77A 1KIJA 2WYVA 2YYSA 2ZYTX 3DD5A 3WDLA 5G3YA 2O8FB 5EJFA 3OOYA 3OD5A 4TWAA 2EFYA 2VBCA 3AR2A 4J3FA 4JOQA 3URKA 1J9GA 2WV7A 1J21A 2KHZA 2ZRCA 3BK7A 5LQMA 5MN6A 1M8KA 3HRIA 3ECSA 2RGNA 3P71T 4KWHA 2FPLA 1M2OB 2X2OA 3AGQA 4IHQA 4EGCB 1QIMA 1CZNA 4AAYA 3EUAA 5I9NA 2FMFA 4KFSA 1OOEA 1KYYA 2VSFA 4P3OA 3E9MA 1T0PA 2JCBA 1SEPA 2P4UA 4KBFA 1DRVA 3SAJA 1OCEA 1IQPA 1PK7A 2TMYA 3AHFA 4U2EA 2I6GA 3B7GA 3NTRA 4L0DA 1TRHA 2KMLA 4DT1A 3I2FA 3NHZA 4EI2A 2CXUA 1TEHA 2A5YB 2JFOA 3WLHA 2YWFA 1YD7A 2QX8A 1RC8A 4MQFA 3DMGA 2ZVDA 3SU8A 2CXOA 1YJCA 1E6CA 3AF4A 2R5FA 1YS9A 4MB0A 4ZI7F 1W5TA 2PWBA 1VYUA 2CFOA 2C5HA 4PM4A 1N6HA 3HO8A 1HX7A 4J3JA 3CIFA 3HN2A 2FZGA 1ESMA 2GUGA 2YVKA 4S3MA 4YCNA 2PUJA 4K2HA 4BMVA 1DC5A 3HYNA 2OFFA 2BDTA 5HS4A 3TF5A 2NV6A 3I1IA 3LVBA 2XUQA 3L7AA 4YJFA 4YR7A 1KC1A 2VF7A 3QKTA 5DCYA 2CXXA 2L17A 1BCRA 1HDYA 2YZ7A 2A30A 2Z2KA 3SF8B 2WDPA 1K98A 3ICVA 2N9UA 3KSUA 1ADGA 3KOWA 1HEUA 4IHAA 1M1YA 3ABRB 2CJWA 2Q5IA 4B3TE 3L4BA 3HB7A 4RXTA 5J1SB 4FR5A 1UC4B 3UUGA 3ANYB 4OK5A 3JAMA 1ODLA 3SR4A 4RKYA 1TKBA 4C4AA 1QJCA 4J43A 1U4NA 2JA2A 5KOHB 2GTHA 3SQDA 5FLXQ 2Y76A 4BLOA 3PS9A 2G77B 3H04A 4N82A 2CLLB 5T41A 3TZQA 3WXBA 1YDHA 2YWCA 1QZTA 3OEHA 4H4DA 5AI6A 3REFA 5I45A 3TJZA 2PCJA 3JVUA 4MCHA 3H1BA 3P9YA 4NX2A 1PKEA 1ULUA 2AK3A 2IRWA 4X3OA 4DL9A 3S5UA 2CEAA 5E6SA 2GESA 3RTGA 4ZYVA 3NTVA 5LZ2A 4N48A 1D6JA 1HFJA 1E9EA 3KYDB 5I7FA 3S2EA 4H0FA 3DAFA 2YJ4A 3OQHA 3GLIA 1X1DA 4LF7I 2WZCA 4EDHA 4CMJA 3IBTA 2J3DA 1XU7A 2C07A 2RHTA 5GINE 1KOLA 1PZEA 3RQSA 2O7SA 1E5LA 1ZQ1A 3D7RA 4K9SA 3ROZA 3W1EA 4BXOA 2ZKIA 4TLAA 4NATA 5I5EA 5CT9A 3GMEA 3AR9A 1DOHA 1K0UA 3BF7A 1SBYA 4KG7A 1YB2A 2Z57A 1UK7A 3KJIA 3DEZA 3IQZA 5KYWB 4F4IA 3HR4A 4G4GA 4ZOLB 4WUDA 4MWBA 4TLEA 3FDZA 2JLRA 1SUBA 4F9TA 4C3ZA 3FCXA 4MGZR 3O90A 2GWHA 4IDNA 4ZDIA 4YDRA 2NN6F 2PGAA 3LXMA 2RK4A 2RC6A 2WFLB 2NUPA 2A9OA 4JX8A 3SSOA 1E2HA 5AK6A 4TYYA 3RBXA 3IAEA 2A3RA 5IUKC 4Q9JA 4A8JA 4A92A 1PTKA 1YCHA 3VA7A 3GLHA 3M4NA 1CJBA 1Z5OA 2SECE 2QD5A 5HRUA 1GWNA 3OMXA 4M1SA 4GS5A 4XX0A 5DNAA 1WULS 3ANNA 1W8IA 2QMZA 3DNMA 4DCUA 1VKNA 1QMGA 4GXTA 4UHHA 3ZDZB 4X1OA 1EUDA 4LRXA 2GKSA 4YEDA 4DV6I 2FUNB 3EIOA 3LF2A 5F64A 2H0RA 4YFVA 4ABYA 2BA0G 2C1XA 2FDCA 1H5NA 4RGYA 4IJ5A 2DM6A 1S2MA 5FB3A 1YQWA 2WLTA 2FW8A 2Q0QA 1XVLA 2FCRA 1D8TA 3CPSA 3FNGA 2GPBA 2C0QA 1JKFA 1L7VC 1TKAA 2MSEB 2BHLA 4OJYA 1RIIA 3LY8A 3OZTA 2B2NA 4TMVA 5AI4A 3LL4A 1OXXK 3FLMA 4TXLA 2AJDA 2UU9B 4JFAA 1PU2A 2PGJA 3OFKA 3FPCA 1U02A 4XRRA 1PNTA 3NXKA 4E33A 2BCEA 2AJCA 1K89A 1W2HA 1CZRA 1YIOA 5KOJB 2ATXA 1ABBA 5CJ2A 3GRAA 4EG0A 5HEKA 1Y60A 1QBGA 3NMUF 3WLSA 1RVDA 2GXQA 5EMJA 4WLEA 2IZZA 1E1DA 3B2NA 4EIWA 3U6BA 4RTLA 4DIEA 1HA3A 4NEQA 4U2BA 2AF3C 1DBQA 3ORYA 4BAGA 3ZVLA 4DY6A 3LQ4A 1ODCA 2FUKA 1CU1A 1XSEA 4HGOA 4OQXA 1FYWA 3CO0S 4OF4A 4HTFA 3T5TA 2PO1B 1RLMA 3LC0A 2RGGA 2Y6VA 3K4HA 4PC6A 4WW0A 1KMHA 3BH0A 5E9AA 1QO0A 1GFSA 2QIPA 4C0HA 4EYEA 3QUCA 3EZYA 1O0SA 4QJ4A 4X85A 4CN8A 3DYIA 3JQFA 3AVTA 1B41A 1DQSA 2F2TA 3N8KA 4HXYA 2D0PB 4GG1A 3UMVA 3KLBA 4BMDA 3KE9A 1OH5A 1EFVB 4HK4A 4Z49A 4FYHA 2ZJ0A 1KI2A 4EGSA 2ZI9A 1UPBA 5FOVA 4DV5B 1YZGA 2YV5A 5I47A 2F4VB 4G41A 1PL7A 4TVKA 4JI1B 4BEJA 2JGIA 2MR5A 4XTCS 4DNPA 2J1LA 2N1BA 2FR0A 2PGLA 2X7HA 5FFMA 3CR3C 3IR6A 4WDRA 4WV3A 1GGMA 1CUSA 5D51S 3Q8KA 3B6JA 3MTJA 4TMTA 1L4HA 1PUIA 2VBFA 1VGRA 3IPLA 5FORA 2ZUEA 3C6XA 2OXTA 3NEAA 4U8HA 5IYZA 2XV1A 4IDDA 1P45A 1VLQA 3ASVA 2O5EA 1RJWA 4Z4EA 3NV9A 1IFXA 1Y3CE 3SF0A 5LYJB 4CCSA 3BMCB 1K2WA 6CHYA 2P2DA 1N3BA 3RREA 3BAZA 3T52A 1HBJA 1RLIA 4CG2A 3PTZA 3FR8A 5DSTA 4CQMD 4YJ2F 5CLHA 2ZTUA 1THGA 2EJUA 2XQFA 1C0IA 2CVHA 2HLHA 3NHFA 3DLAA 3SIRA 2HQ1A 1Y5NA 2ENUA 2D5IA 4K9NA 2BMEA 1JHMA 2I1QA 2MYUA 4JB8A 3WGYA 4D8TA 4BA1A 1XA0A 8GPBA 1G8PA 1QHIA 3KWLA 2J6BA 4KPGA 5FULA 4WNIA 4KFCA 2QTVA 3WRVA 3NGLA 2AEMA 1M74A 2X8LA 3EEIA 4MO2A 4PO1A 2IV7A 1M2OA 3KAPA 5LXTB 3OA2A 2IS1A 1N2BA 4QM6A 2I4NA 2ST1A 4Q9HA 4RVHA 1QAMA 5E4JA 2WM3A 3VPAA 3VU1A 5BW4A 2YICA 2VZ8A 5GIPE 1HNXI 2XMZA 2GB4A 2H06A 1Q0SA 2WU4A 2Q1YA 3BHIA 5KYNA 4JQCA 1MIOA 1CR0A 5FBQB 1XJCA 2UUCI 4BA2A 2X9LA 1N6IA 1IN8A 5BN5B 2CV1A 3KEMA 1NI4B 3SX0A 1JALA 4LY0A 3TMKA 1C0KA 1K7YA 4M0LA 4GP7A 3NBFA 4N49A 3RYHA 5GADl 2G1PA 2B1JA 3ZK8A 2X6QA 3PC6A 1MNQA 3NHUA 1W93A 4BTLA 3P96A 1Q77A 3MRSA 1ULBA 2KJQA 3IE2A 1XP8A 4ERXA 1E62A 3VBEA 1KYTA 5IPFA 1OI4A 3KSRA 4DUYE 2GHIA 1XEWY 2AFHB 3IILA 3L02A 4E22A 2YWHA 2G25A 2MU1A 1X1AA 1FU8A 4Q9LA 4MW4A 2Y4NA 1E7RA 3PGVA 1KPGA 1GG5A 2FN8A 2OBYA 5L3RA 4M0DA 5CT5A 1TAQA 1GL6A 2G7MC 3OZCA 3VVCA 3UANA 1T9KA 2Y67A 3DZFA 1N34E 1WVIA 2XNKA 2IS2A 4UUPA 3QKSB 2BEWA 3OPYI 2WJ6A 4ML3A 2QX4A 4X8MA 2C7RA 5JJLA 1IHDA 4ZVVA 1U80A 2HEGA 1WOYA 2G9NA 4H7FA 4HDKB 4RZUA 4I4TF 5CHEA 4BNTA 3GLFB 1B73A 2HJRA 2YRWA 2Q5EA 3W5SA 1P4HA 5DRQA 2G0AA 2WP0A 2Q62A 4E2YA 4EUKA 1UWVA 2P8JA 1PFQA 3WB2A 5A3JA 4WZAE 4DV5I 3BSYA 4TXHA 4UD2A 1VCIA 3ZJ5A 4KIFA 2GXSA 5FFNA 1R0WA 1LU9A 1NL3A 1I3NA 1PJTA 2QP9X 2C3OA 4HAXA 1LLCA 3TQRA 4DBLC 3ESZA 4DCGA 1WB5A 1QH8A 1ZWLA 3RWOA 5C2JB 1BVYF 1W30A 2V03A 3KQMA 4G5RA 2EYUA 1R3DA 1LTKA 5HK9A 1JH9A 1U11A 3P20A 2VBGA 3QHQA 5F76A 5LR6A 1U7TA 3O1JC 3R6WA 1ISJA 4HQNA 4I50F 5DE3A 4AS2A 1KI8A 2NX2A 3BQNB 2WWVD 5AM3A 3V7UA 4HKTA 2XQIA 2QTCA 1LA2A 1W8DA 1U2DC 5LPNA 3RK0A 4AJNA 5GMDA 1UP6A 2CDAA 2CNLA 2NADA 3EDQA 3LTOA 3A0UA 2GERA 3A2MA 1YHNA 4MPTA 2I03A 1L5ZA 3S7ZA 1NIPA 3RYCA 5ALLA 4JQZA 1PD0A 3JASB 3PLRA 3VKVA 4KIGA 4LF9B 1AD2A 4LCEA 3S8EA 3BXXA 4B83A 4NYJQ 4GGOA 2ZR8A 5CPBA 1QRSA 1KTVA 3OZ7A 3ST7A 3T7JA 1V16A 2B30A 1PBTA 4QYIB 4R2LA 1QH0A 5FUMA 3NX4A 4C5BA 1Z16A 1RYNA 1UH5A 5EYPB 2WIKA 1F9AA 1NW3A 3KQTA 4N65A 4KV7A 4ZMBA 5TPWA 1UR5A 4BNZA 1RXEA 3M1AA 2VAWA 1W19A 4QQNA 4URZR 3ZUGA 5AVZA 3ACDA 4W82A 3DKPA 3TD2A 2X3FA 4K3VA 3QEKA 1N2GA 2NO5A 4DV0E 2BFCA 4DC0A 1KVUA 1T5HX 2GEVA 3L8GA 1UBJS 2WVJA 3EOAI 1P72A 2X8BA 3FNHA 3MUEA 4ENWA 1WB4A 1P9NA 1RQPA 2NPOA 2O3UA 4G0UA 3PEYA 4JLJA 5HIIA 1PDVA 3M4ZA 1N2CB 3JTEA 1GARA 5ALHA 1LZKA 4CVNA 2QN2A 1RKXA 2ZK7A 1TVCA 4LHXA 4Y6RA 4N0EA 4BJ1A 1CQZA 3A3YA 4MKXA 3HHPA 4MAFA 2RIPA 3PKIA 2BGTA 1F17A 2XA2A 3B2QA 3F98A 4LE2A 3R7SA 3WHPA 3FBTA 2BBSA 2R25B 3I0NA 2X14A 5HF6A 1TC1A 1YBHA 4P7JA 4MGKR 4IIJF 1RI4A 2RG1A 4P33A 1KORA 1N2CE 3OLVA 2ODPA 1HOXA 3R3HA 2NT3A 1ZMRA 2Q6VA 4ODIA 1RXWA 1I1QB 3AXSA 2GN9A 5BN4A 1HYGA 4FYMA 3L8MA 2XCRB 1NURA 2RI0A 1CERA 3B1WA 3MEQA 5DOZA 4D3SA 3ANTA 2IXTA 1R0LA 1TVEA 3IAM1 4PZYA 4F4UA 3K09C 4DQLA 3PA6A 3OY2A 1KMIY 4Q9AA 5K3OA 1U9IA 1JT9A 4E88A 2J0QA 1AK1A 4L8WB 1AQUA 4CNQA 2RSLA 1Z4OA 1AKVA 2ORYA 4WY2A 4E11A 2O3TA 3A6GA 2A1TS 1UC5B 2PU7A 2R5WA 2JKYA 1AQIA 2ECPA 5FCDA 2PJRA 2O4CA 3MIIA 3DWGA 3G0GA 1GDHA 4P35A 3TI9A 4AF7A 1XTZA 3SZOA 3P2OA 1EDDA 1C9DB 1SXJE 1CY7A 2XF8A 3EUFA 3FSEA 3UJ3X 3TFOA 1ODJA 5KOIA 4YQZA 1F7VA 2RB5A 3HU1A 1VKOA 1DDGA 2IXGA 2NSJA 3QH4A 3BMQB 4HX9A 4Q9IA 5CDTA 5IT0A 4P58A 4WNAA 1QFYA 4KPUA 4HNSA 2QUBA 3GF4A 2OVFA 4OXIA 5CHYA 3CRVA 2B7BA 4G4SO 3CH4B 1C2TA 1X7WA 3W3ZB 4E5PA 2X9VA 5FV4A 2V5UA 4JI7B 3QUAA 3HGTA 1PW7A 3L6EA 3UOAB 1A9RA 4IZJD 1O8BA 1WF6A 2DR3A 4R31A 4HDMA 4XX0B 3IE0A 1JWLA 3G2MA 4QUJA 4UUAA 3T3EA 2ZIFA 4N7MA 4G81A 1KJ8A 5EMHA 5JDCC 4D80A 5SY4A 3U0BA 3GLIE 3LT5A 1XQ1A 3IULA 1HYQA 4J3DA 3DOHA 4L07A 1JB9A 4HN4B 4UUMA 3E03A 3D4NA 4M1QA 3CRRA 3V4RA 1F51E 2RKBA 2J3EA 1MRZA 2ATEA 1RM5A 1TQ8A 5CIYA 1I94E 2PA0A 3RJTA 4UNQA 3NWBA 1A7JA 1UUFA 3LZCA 4D8UA 5B4VA 3MZ0A 2A0YA 2NU8A 3I6BA 1IDN1 1O95D 1GLVA 1V6CA 1E92A 1VE1A 4S1TA 4C06A 2P41A 1AHHA 1DIBA 4HXEB 4LF9I 4QEZA 2A14A 3UTCA 1HMYA 5FAXA 2R68A 1UM9B 4H31A 3OQNA 3VU9B 2PMWB 1ZR2A 2OI2A 3CNEA 5J58A 4ZHQF 4OTZA 5B2ZA 3ND6A 1DJOA 1DLIA 2QVZX 4H1TA 3PJEA 4HAUA 4HOYA 4LWPA 4TLDA 1WX1A 1ONNA 3I61A 4RULA 2R85A 3RU3A 1EB8A 1FLAA 3GELA 1M5TA 1QHEA 1D1TA 4P86A 4F6RB 2PEZA 4IWYA 4JLKA 5C0XE 4BO6A 1U9JA 1KH2A 1M0TA 4MRMA 3KL4A 3ZX5A 4RTNA 2C7QA 5FWYA 3HC7A 1J25A 2PH5A 3NGXA 1T3HA 1ZC4A 1ZK4A 3L4SO 5A1JA 4RCVA 5DISB 3EW7A 3RS7A 3SFZA 1WKCA 1ISPA 1XRLA 2H1IA 3K0CA 4ZT2A 1XZJA 3FYSA 4MCIA 4XPIB 4HS9A 5B7NA 4K6OA 1Z6TA 5F7XA 1V8DA 3ZCSA 5JV5A 3E23A 3WTCA 1OLOA 4MVJG 2CB0A 2H16A 3PITA 3A31A 3SKVA 4DQDA 5H8WA 4RACA 3AVYA 3O2NA 1AKRA 5BR8I 2HU5A 3VNBA 3VNVA 4OYYA 4BEWA 2BVNA 4DLNA 5CDFE 4RS4A 1ECGA 3TVDA 3WDKA 5KC8A 3KJHA 2J7KA 4JYBA 1KZHA 3H4IA 3IBGA 3ELUA 3STXA 3R0JA 1I32A 1NF8A 3SXJA 3U39A 3OO0A 1S4QA 1YONA 5DGXA 5U4XA 2P91A 2PUHA 2JJQA 3KZXA 1V5FA 4IDFA 4MHSA 1J8YF 1G5HA 4QSMA 4YP1A 1AF4A 2PBFA 3C5CA 1W1IA 4DM3A 5A4MS 3RHFA 1H2RS 4EATA 1A2KC 4UVIA 3N5CA 3V8VA 3H2BA 3L8FA 4OQPA 3W6PA 4E46A 4DDUA 3SYKA 5CB4F 3HXQA 3K0FB 5FR2A 2ZITA 4WXEA 1QYXA 5FPPA 1VJRA 2AFIE 3BAFA 1ODIA 4AY3A 1U2ZA 2BRUC 1SNYA 2O3JA 4Q1DA 4H7DA 5IG2A 4US0R 2WI8A 4ED4A 3L07A 3Q7SA 1SHZA 3EZ2A 1RYFA 1N57A 3B85A 4IIJA 3NRBA 4F97A 3M34A 3VU3A 2OECA 5AVOA 4JV5B 1F0YA 3BHMA 1UOQA 1SG0A 1TYCA 2ZBQA 3O6VA 4FNOA 4GPEA 4L6CA 3VPXA 3PUKA 1YI8A 4B6QA 3NASA 5C7YA 2WQ6A 3O8DA 4DB2A 5JALA 2SKDA 1KJZA 3V8NA 2C9DA 1XZNA 1HDRA 1TEXA 2ZTHA 1KU0A 3CKYA 4JQSA 1ECJA 4RD0A 2DULA 2YQ5A 3GC6A 4IFTA 1U4OA 1GUBA 2PUTA 5IK2D 2YXEA 2CHUA 3CC8A 2YWBA 2QAIA 2P9EA 1DU4A 3OQMA 3ZDBA 5FPSA 1GCIA 3SHQA 4EHFA 1OWOA 1ECLA 3PF9A 3QMWA 3V32A 4WJLA 5C3MA 5EIEA 3O8CA 3OTGA 3U4MA 4NG4A 1J8QA 4YX9A 2P2GA 4HUQB 2A0XA 4LN1A 3TEMA 3WKAA 3F7MA 4QBFA 3WMGA 1AZLA 1NI4A 4EL0A 5A2QA 1AG9A 3QLUC 5SV2A 5JOQA 2PNZB 5JCJA 1XNQB 3A8TA 1GHTA 1W5FA 4RAQA 4DMLA 4V1CB 2WAXA 1JNYA 2TMKA 4D8YA 3WA7A 3T4UA 3WIVA 3EXFA 2CLEB 4MDTA 2JK1A 4OHVA 1ZUNB 2A57A 3NKFA 2UXBI 3PX3A 5TQVA 4F7WA 3LY9A 5B4TA 3BRSA 3RSCA 4AIIA 5AW0A 1E1QD 4QAQA 2FJUA 5JS8A 3ZGZA 1GITA 2X5OA 1IXRC 1GSIA 1XCLA 4LQCA 2CMHA 4YMUA 5BV0A 1PR5A 3M9WA 2CV2A 4HTFB 4F4DA 2B8EA 4C5CA 4G37A 4NK4A 4WD3A 2ZZMA 3X1XA 3C74A 1G3UA 4EY8A 2J09A 1A8QA 3OIUA 1FU7A 5KTNA 4KVAA 1NF3A 1E4VA 2YNMD 3A4VA 3GFVA 5FBWB 4B85A 1CNFA 1Q0ZA 4MA5A 2WTMA 3NEYA 2RK6A 1NE7A 1SKYB 4ZVTA 1NJ8A 3RVRA 3HDJA 1XFDA 1PDOA 4B3SI 3VAZA 3GGPA 4FHCA 5DTJA 3WWPA 1EBFA 1BXRA 2H00A 2H2WA 2W2LA 4XPZA 1ZUWA 1JG2A 3F96A 4NH4A 3FHOA 5G0TA 1ULZA 3EPHA 2XRZA 3C3AA 4DR1I 3FPGA 5AK4A 4UVDA 3WX0A 3QNMA 4GQUA 4MKFA 4ATNA 1Z2EA 5CB0A 3RF6A 3C45A 4BO4A 4C2AA 2AZXA 2REBA 4FVTA 4B3GA 2ZPAA 1QGUB 4DMUB 3WI7A 4BRWA 1OHHD 4GYWA 3FMGA 4AJJA 1HLGA 4DJJA 1ZUNA 2FUG1 1J06A 2VP9A 4NHOA 3DO6A 4K46A 1F0PA 1O6ZA 3AUYA 2HCFA 5EWJB 3KFXA 1FTSA 2VJPA 1I6MA 1WHSA 2W9XA 1UL1X 3COPA 2DFTA 3ROEA 1B14A 2B69A 3OUZA 4Y7CA 1L3CA 5EL0A 3MAJA 3KCQA 3THYB 1ID8A 1GSOA 1M8GA 3AI1A 4AZTA 4A27A 4KDEA 5KU7A 3CEMA 2BJVA 4OHZA 4DV2I 1I24A 2H51A 4NENA 1XTTA 1XWWA 5BW5A 3D9QX 3KVVA 5TV2A 4DPMA 4DS3A 4OUDB 1D2CA 4HYTA 5EJGA 4AJ2A 5JBQA 1WXWA 4KH0A 4WOPA 3C3DA 4CL2A 1PK8A 2VRWA 1PG5A 2CN1A 4P0QB 2VPPA 3TNJA 2CFTA 3EPKA 1PT5A 2RFLA 1N2SA 1II8B 3D64A 3OT1A 2NVWA 3LCUA 4RY9A 3OCVA 4YLYA 5IULC 3I32A 4O2AB 4FP9A 4NYMR 3M83A 1G20E 4JJ8A 2NTYC 1ZGBA 2BUCA 2I4MA 3TW0A 5K6RA 1ZFNA 3AETA 4LYJA 3T95A 3TLYA 3OF3A 3J80Q 4ZYXA 5HHTA 2R8ZA 1R4NB 4IYRA 1CEYA 4OXNA 4QREA 3TMYA 2WPNA 4MRNA 1JWBB 2Q1XA 3IODA 4PHCA 2GYWA 1I4OA 1IIRA 1XO1A 1OBVA 3LHDA 4G5QA 4UTRA 3E1SA 4XM1A 2GAIA 1X42A 2FMUA 4G23A 4MKHA 4UNPA 4QQRA 5CH5A 1OREA 1IC6A 2A9FA 3AESA 2Z6AA 3FYUA 2QLTA 3FOZA 1KP2A 5BO5A 1YHCA 1HTTA 1NXXA 4XDYA 4ZDWA 5K3AA 3LH5A 3ZY2A 5DNYB 2FPKA 3S2IA 5EUQB 5AK5A 3EEQA 4NG5A 1VISA 4HYEA 4KYVA 5JJIA 1KQFA 4YY3I 2H7YA 2R751 2DQ4A 3KUCA 4NJOA 5AVQA 1FS4A 1WW8A 4MYSA 4GX0A 3TZBA 4YP6A 2C20A 1UKAA 4FNGA 4LI0A 2I7VA 4RHEA 4H6VA 1SC6A 1XZDA 1ML4A 3OCJA 5JNTA 3OZWA 3B78A 2QYHA 5ER9A 3RIGA 3B4TA 1L7XA 4B31A 4WLUA 2I65A 2PBZA 3K0BA 4A82A 4PZCA 3DVAA 4MGHA 1HL7A 1CF9A 1Q22A 2CNWA 3DZKA 3LNCA 5BMOA 1E5XA 2P4QA 1YT5A 3HWRA 1WCIA 4TS4A 1DCFA 4NCXA 3OC6A 4RF5A 4F5EA 1A5AB 1JEDA 1LSUA 1R0YA 1MC4A 2XNCA 3MTQA 2AOVA 1AXGA 3GJ8A 1FVHA 4IEEA 3LGXA 1EM8A 2QU8A 3PYMA 5CMLA 3UT0A 3FCYA 1Y1KE 4DR6E 1IN5A 2WM2A 3O8OA 4HDKA 2BAGA 4X6YA 5A5VA 4IDOA 2HRCA 1BRMA 4ZT5A 1K5GA 1X7ZB 2W8ZA 1SN7A 1W46A 1IY1A 3W5DA 3MRTA 3K17A 1C0EA 3GEDA 2HFKA 1PR6A 1LVHA 3D4IA 2OHHA 3P0IA 2P40A 5CYOA 5JASA 2B1IA 4R7GA 3JWIA 2PMEA 4MRPA 1L4MA 5HMLA 3OZXA 1MBZA 1RYEA 2V74B 1AMOA 1ZM4A 1KQPA 2HCTA 1ZGZA 2HGSA 4L7QA 1X8JA 1J2YA 4LGMA 5AI5A 4F1JA 2I55A 2V45A 1E3IA 4LWQA 1JL3A 2I78A 1H5UA 4JKYA 3DL4A 1E7QA 2GVDC 1IOLA 2I87A 3E7PA 3HA5A 4MQYA 1YVDA 3KT3A 2PGDA 1FTNA 1Q1BA 3QNWA 2OP1A 2ZWIA 2DUNA 3K1ZA 4CV1A 4YAGA 3UAGA 1MHPA 3DE0X 2CLFB 1U4SA 1VB5A 3F2VA 3OPQA 5DBHX 3QMMA 3IAHA 4FSHA 1V2HE 5EZ5A 1DTWB 3PD1A 4NCIA 1I5OA 1U0OC 4OO1E 2Q2VA 1LPPA 3EWNA 4H6XA 5ARDA 3W2TA 3WSTA 4YK7A 2ID9A 4KUGA 1XKTA 1GG8A 3COWA 2Q9CA 5TMBA 4BKPA 1PKPA 3FE2A 1L7AA 4EG7A 4UUNA 2WTXA 3BK2A 3TIGA 3I92A 4A2WA 4EUHA 4IMIB 1P19A 1W59A 3CH5A 2X0DA 3DT6A 1SXJA 4Z1MA 3U44B 2NV0A 4TYWA 1RAAA 5TB5A 2PUFA 2YRFA 4OY3A 5KYTA 4EW6A 2ZIEA 1E6KA 2NG1A 4OO1B 2VKTA 2VOEA 3LOPA 3PR1A 2ISSD 2P0YA 3QWAA 3LT4A 5J5CA 4AKIA 2JCSA 2XZPA 4PX9A 2JIBA 4ER7A 3MGKA 2ERXA 3C8MA 4BNKA 3FOBA 4D9EA 3BDIA 4DREA 1HQKA 2YWDA 4L8VA 4JP8A 1Y7HA 1ORWA 1RJDA 5KNCD 1U8TA 1SOMA 2PMDA 2RJOA 1GDDA 2Z1NA 4DV0I 3NR2A 4L75A 4PV7A 4XKJA 3SC3A 1Z5NA 5J2TA 3OJEA 2VRCD 4ETNA 4D3FA 3I3SR 4PGMA 1XZQA 3AI3A 2FZEA 4P4UA 1WKBA 2PJUA 1SHTX 3EDYA 3F9RA 1GV0A 3GY0A 3NC4A 2H63A 4YRBA 1D2GA 4AUMA 1LDEA 1CIJA 1G1AA 1GKIA 1UXOA 1JG3A 3IH5A 4M6WB 2G04A 3HFGA 1Z83A 4LRUA 2HDHA 2W90A 3V6LA 3NU1A 4OOFA 4RMIA 4PZAA 3FCEA 1SC4A 3H75A 3LECA 3LQQA 4JVOA 3WGMA 1CEQA 1E2EA 2HBRA 4TKMA 5EUBA 2A1TR 2ZUCA 2OCIA 5H16A 4LE1A 1R00A 3T1VA 2VIIA 5JXIA 4Y18A 5D6OA 4JR0A 3VUFA 4NKRA 5GWXA 1ZO8A 3FRIA 5AHOA 5LBUA 1QC5B 3D4LA 1CUZA 4RX1A 4XGRA 1N1DA 3OCXA 3R5KA 1TLTA 5E6RA 5EP2A 4Q37A 5G4LA 3SLRA 4WRRA 4BMZA 1LDGA 1YA8A 1MFZA 4CMBA 1QO7A 1U1DA 2M2IA 4AJLA 4IDBA 3DV2A 3I37X 5TSDA 1NBHA 2G63A 3A9RA 4U9IS 2V7QA 4M46A 4EELA 2QAGB 2C5GA 3KAQA 1P9LA 5EXPA 4JYAB 4DUPA 3E53A 4ZXPA 4A91A 3ZJTA 1FFXB 2SCUB 4XQCA 3I6YA 1I14A 4ZO8A 1NVBA 4EEKA 2CDNA 3SZRA 4B6RA 3A32A 3KM0A 4Q4LA 1RBMA 1TVKB 1LFDB 3LSTA 3N0WA 4O4IF 4AX4A 1GXSB 1ESZA 1T3LA 2PQ2A 2RGDA 3KZVA 4AYXA 2GS9A 3H99A 4EHHA 4I9NA 5K1ZA 5IDVA 1VE9A 1XZFA 1JMVA 3QT8A 2R6CA 1V25A 1VCMA 2YFQA 3NDIA 3R24A 1YZ3A 4K05A 4WZZA 5HF5A 1AK2A 1B0ZA 3RU7A 4J0HA 3TRHA 3BVPA 3PDIA 4JUDX 3WNCA 5DTQA 3GQBA 3VZRA 4JQYA 2OYCA 1KP3A 3H0EA 1YJXA 1HDXA 1UBGA 2YYAA 4G63A 4IVQA 2RG7A 2W0MA 2ZEJA 2HIGA 4LOIA 5F3DA 3AY7A 3RNLA 2BYTA 2WE7A 2WVHA 4G0MA 2VAXA 5DLQC 1RVV1 2PKQP 4NS4A 2CW5A 2Q2WA 3U62A 2EHDA 3KSBC 3PKZA 5H70A 3K92A 4CEIA 4ER6A 2W11A 2XCLA 1THTA 3BC1A 3NBMA 3OTHA 4GEGA 4IQGA 1VFPA 4IYJA 3RTBA 4OLBA 1P1JA 1QBKC 3IJPA 4L9SA 1BDBA 5B3LA