1HK7A

Middle domain of hsp90
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
248
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Analysis of the Middle Segment of Hsp90. Implications for ATP Hydrolysis and Client Protein and Cochaperone Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords HEAT SHOCK PROTEIN HSP82
total genus 75
structure length 248
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hk7A01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hk7A02
1Y4UA 3PRYA 1Y6ZA 2IOPA 2O1WA 1HK7A 3HJCA 2CGEA 2GQ0A 2IOQA 3Q6MA 2CG9A 2O1VA 3Q6NA 5FWKA 1USVA 2O1UA 1Y4SA 1USUA 2O1TA
chains in the Genus database with same CATH superfamily
1RAHA 3RODA 3I4CA 3TR6A 4AC9A 2HCFA 3L6OO 1HE5A 1KJ8A 5HGJA 5HUJA 1HR0E 2RGBA 3AJAA 1CEXA 5K3SA 2HDHA 3M33A 1HNWI 1R12A 2G0NA 1DIBA 3AR4A 1L5RA 3LCVB 2VTBB 1VCIA 2BR2A 4X64I 1PV1A 3DGEC 3OOSA 3UM9A 3ZVRA 2FR8A 4ME6A 4P2BA 1IWPB 3IIJA 3PCRB 3QELB 2Q29A 2YXLA 3CEHA 4D96A 4EGFA 1CEEA 2CGEA 1U8EA 4XIJA 4JMLA 5JANA 1IZ7A 2VQFB 3PD7A 3B5JA 2ZCJA 4B4VA 4CEIA 3ZDRA 1J23A 2VXCA 2YWXA 4XH9B 3MNFA 1IXZA 1RT9A 4PLPA 4YDQA 4K86A 5K3BA 2JFNA 3CW8X 1I0LA 3H5LA 4AD8A 4UHEA 1P2FA 3QLTA 3RVDA 1NOJA 3OTGA 3AFNA 3PEVA 4JBWA 1A76A 4ER5A 3R4VA 1H23A 3DCNA 4DWOA 1U4OA 1ZVKA 3MJDA 1NZDA 4MQFA 1V6CA 1Z33A 3VDQA 3ZE0B 1GAEO 3ZY2A 4EGAA 1EA7A 2CB0A 3KR0A 1AV6A 5IT9A 2M1ZA 2QTCA 4R31A 3VNRA 2X77A 4EA9A 4FDAA 2Q3FA 3BD6A 4M83A 4MLDA 4R83A 4V0SA 4OMDA 3EXAA 2H9YA 3LVBA 4Q12A 4GR4A 3AJEA 1N6OA 2QTHA 4WWHA 3T38A 1B8PA 1G55A 1QM5A 2A1IA 2CDAA 2JGAA 3EWIA 3I1IA 1KDYA 3RTEA 4YP5A 4DRXB 4C4SA 1V3TA 3ND6A 4QUKA 2C97A 1RP1A 2QLJA 3C7DB 3SHFA 5D3QA 4QLBA 2HU7A 3CZCA 3ED1A 4MO9A 3V48A 4OLAA 2HSJA 3GAZA 1BKYA 3A1FA 3EAQA 3G3EA 3HDQA 1SXJB 3DBLA 3DBRB 1XJQA 3DF7A 2HHHI 5TMDA 3CY6A 2IU3A 2PU7A 2VT7A 3GF4A 3NTVA 4XGRA 4R0MA 2ZJOA 1EEXB 2AOUA 2VPXA 1PJTA 2XDYA 1MF7A 4HRXA 4KVFA 3RCBA 5KYYB 2VF8A 3FFBA 4FFBA 3WB1A 1N2XA 1TJYA 1U2DC 2CCKA 2FZLA 1YMQA 2V6MA 1GNRA 4JVLA 3WFIA 3ZGXA 2PO1B 1Y3FE 3FIUA 4FR2A 3T3DA 4HUJA 1IY9A 2FSHA 2RIPA 5EMNA 1MVNA 4ALKA 2PUHA 1X7GA 2W6ZA 4IVQA 4JUAA 1U1IA 4RLQA 3WGKA 4FJ1A 4DNQA 2O5CA 2QB5A 4N03A 3G2IA 1T5TA 2YMLA 3CH6A 4P4UA 5JAZA 1IK6A 1GILA 4F92B 2GXAA 1FK8A 3L7AA 5T4HA 1FJGB 2H8KA 3T7KA 4IZ6A 2E6KA 3H4VA 5F35A 3OLXA 4DLSA 1ONOA 5D6OA 5E6UA 2CN1A 2ZYTX 5AI4A 1W0KA 2I03A 3C5EA 4K3UA 2IS2A 5AVKA 3I8XA 2VPQA 1YQUA 2L82A 2QJFA 2H8GA 3CZMA 3R75A 2CVZA 2H2WA 4N7RA 1TA4A 2PH3A 3DDHA 1KOJA 3SOZA 4Y1RB 3W4JA 1FUEA 1Y1KE 3WO0A 3WFZA 1E62A 2DFTA 3EG9A 3WRWA 4ZAZA 2VNAA 3HHEA 1TA9A 4EZIA 5ABPA 1OPXA 3IT1A 5I01A 2ZETA 5JFGA 5JYBA 1T0IA 2MINB 2OGSA 4FEYA 4OZEA 2BFFA 2VJBA 1RYZA 2C92A 1FW8A 1RMQA 2BEUB 2WJWA 4P3KA 2PUJA 4UUBA 1G9TA 4XB2A 5FR1A 3NDJA 3PPWA 5G3ZA 1C2TA 3S2SA 4JYAE 3BK1A 1BVHA 1XKQA 4DUYE 4WECA 1D1TA 3IP5A 2WJPA 3N39C 1H4TA 3R6WA 2HRRA 1UT6A 3O7MA 5DNDA 4R8RA 1EQ2A 2J3HA 1UWLA 3A28A 1U65A 1S8NA 4MKHA 5HF6A 2F1JA 3W6OA 2H5IA 2DF8A 2AZMA 2P0EA 4QYWA 4BKQA 4IEFB 4C4OA 4D8XA 4GICA 1IBMI 5FWDA 3N86A 1G291 1JR3E 2WD8A 4R54A 5AW0A 4ZQGA 4PNPA 4II3A 1Z5ZA 4AQ7A 3D3JA 1UPCA 3BORA 2XECA 3G9UA 2HREA 1JT9A 2UUOA 2ZLBA 3OE1A 2QBYA 1OFUX 4PG6A 1CUJA 1QAOA 4XVQA 1RPTA 4ND5A 3P9YA 4KMRA 1YHYA 2XUAA 3DGFC 5CAEA 5ALNA 2R5WA 2Y9MB 4ZOEA 2ATVA 3TXYA 2R6FA 1S1MA 2QSUA 4TKUB 3CZAA 2L17A 3PWKA 3DC2A 1C2YA 4YPFA 1T6YA 2MYNA 2HEIA 3WRXA 1BCRB 3KSMA 1F48A 4QDZA 5JSQA 2WYWA 3NJ8A 4KHPI 1G4HA 2VZ8A 4GKBA 1TTPB 1RPJA 1JSZA 4TKZA 4EUNA 4PHHA 3DBOB 5CLJA 1SXQA 2I71A 1UANA 3CWZA 3KOUA 4AW9A 3TR0A 4INPA 3PF8A 1CZUA 1O6GA 4FFPA 1DWPA 5FKJA 1J99A 1MX9A 2O52A 4DWJA 3DONA 1KDOA 3F8WA 5JNLA 4R1UA 1ENYA 2CFRA 1KI7A 3DO5A 2FMHA 4JOBA 4HV4A 2EX0A 3KU1A 3R09A 4HNAA 3LECA 3K72B 1RXUA 3BBLA 1QZUA 1T1GA 1EFRD 2PKEA 2IXBA 2EYQA 1QIFA 1TQ4A 2NU7A 4B3GA 4F8YA 1E2JA 2VP2A 3U62A 4M7PA 4DB2A 3EEQA 1TYBE 1PYOA 3N76A 2ZQYA 3OUUA 1Z0AA 1DIRA 2XCIA 1L8LA 1L7PA 1QTRA 3E9YA 2DKFA 2LCFA 4MGEA 5ICFA 1T34A 1OYRA 1U1FA 4IGFA 4BFSA 3OURA 3BMQB 4M9QA 4OI4A 1NDHA 3C6QA 1V47A 3HA2A 4BJ6A 4EF4A 3AF2A 3JR3A 4LDRA 5H3CA 3RFXA 3VU3A 2P2YA 4DMUB 5FTMA 4C5AA 1Q1QA 4CGYA 1JIQA 1K5HA 4QDJA 1RZRD 2ZS9A 3QYFA 5AXDA 3B5IA 4EFMA 1X38A 4E03A 2FMUA 5B3JA 4GKAA 4GS5A 3NB0A 2XBMA 2C95A 3RG2A 3I12A 5JEAA 2JIQA 4FXOA 4BRZA 1HNZE 4UXJA 5B2EA 4ZWNA 1SQ0A 2OOSA 4AKGA 1UKCA 5C35A 3GLGA 4U7FA 3S55A 3WP1B 1GP2A 1FVFA 5LQDA 3A9UA 1UJ4A 1IM8A 4WXHA 5I51A 3AXSA 4E09A 2W6JA 2FN7A 4OLHA 2ORWA 3HM9A 2QJWA 2LE0A 5E1MA 5L3QA 2DHEA 1OSNA 2VHEA 4L2IA 4B3IA 2PVPA 1U3GA 5IYZA 5BSFA 2B4TO 2LXNA 4NMMA 4BTVA 3W2FA 4QJ5A 3V1MA 3A36A 1DKQA 1ULAA 2E89A 2EJBA 2F3UA 3JYPA 4GUAA 4NYIR 4PGHA 4TV8F 4UE6A 2QQ0A 3BAZA 4O2RA 2KLHA 3IBYA 1VHWA 2E3JA 3H1CA 2XYPA 2ZWAA 3LGSA 1IG0A 4LGMA 2J9FB 2ZVPX 4E7OA 3QEAZ 3I9MA 5BPFA 1G3RA 4MOWA 3LG2A 2BGKA 4OQ4A 3FETA 5EJMA 4IDNA 2FRDC 3PGKA 2FTKE 2H2FA 2YVQA 4DM7A 3F96A 2IS6A 1L4LA 4FW9A 3R5JA 2MYTA 3CB2A 1AT1A 4N3GA 3EFOB 3KXKA 4BGVA 1DC8A 1P33A 1BX1A 2J5QA 1SZPA 5KC8A 3GB9A 1Q50A 4F38A 4DR1B 3O82A 1TVCA 3ZVKA 2G83A 2IYAA 1QE5A 3WNVA 3GDGA 5CVDA 5ALVA 4RLFA 3QA9A 2F3SA 1ONSA 4TTVA 3OZIA 4M1WA 2O59A 3IJPA 3OM1A 3O4VA 1E7YA 2ZUEA 1OH6A 2P27A 1N5KA 2UYGA 5K36E 3NT2A 5BSVA 3BC1A 1A4IA 4OFZA 1NR1A 1WXEA 3Q98A 3I6IA 3MCTA 4HDKA 4IOKA 5T6MA 3VRHA 3R40A 2QL7A 3D8NA 3HDHA 1USUA 2BGJA 1FJ2A 1XEAA 1SHUX 2BZ1A 1P1KA 3AUTA 2BMEA 4JB3A 3N8NA 2QZSA 3OSZA 3MELA 3FPEA 1Z38A 3X1KA 1WXHA 2NZUG 3DL7A 5LZ8A 4BNDB 3AVQA 5LQRA 1T4GA 2VR1A 3VYVA 1HKHA 2QTVA 1EJ0A 4HPJB 4TL9A 5AHOA 3ILSA 5DTIA 1AQUA 1E8MA 3EBOA 4I08A 1U8TA 5FUVA 2MOKA 1NBMD 3GRUA 3EJ6A 1TPZA 5LD2C 1N7HA 5J43A 1ECFA 1N6RA 4GVXA 2QTBA 2ZE7A 1A72A 2YJ3A 3G0GA 4PRZA 1NTRA 5CVJA 3KQNA 3PE4A 4PZZA 2ORIA 3KAQA 4RFSB 3QNMA 2WICA 1TADA 3L9XA 5HBGA 1P44A 2Z6QA 4IFDC 4IDOA 4QGAA 4YJFA 3QXXA 2Z57A 3AEQB 1OIXA 4PTLA 4Y2SA 5DXFA 4S1NA 3OZ7A 1XQWA 3R20A 1SOVA 1DINA 3KPWA 4Q9AA 3W8EA 1KZGB 4BVEA 1O0BA 4P9NA 4J1TA 2PT5A 1EH5A 2AK3A 3X1WA 1VE5A 2D5AA 1Y42X 1YVEI 5DI3A 4BECA 1HNXI 4QAQA 3FPHA 3PR3A 2YHBA 4JI3E 1K5GA 4B6RA 1S2DA 4XWAA 4P3XA 5JROA 1ZJ4A 4DV5I 1WCV1 2C8VA 2VNHA 1BDMA 3LC7O 5E6SB 1KK3A 5EVJA 3BCUA 3DM9B 4MVJI 1EG7A 1O57A 4WT7A 3KLMX 2PPLA 4PM4A 4X62B 4L5IA 4KV7A 2BBOA 4GGOA 1T5OA 3FD8A 3KKEA 3TOVA 1F6BA 5U4QA 3ORFA 4M0EA 3LPLA 3HFJA 1VE6A 1VSBA 1YONA 2BFOA 1Z2PX 2FHPA 4EJ0A 2PUVA 2H1RA 4DQ0A 5B1YA 3OFKA 5DNCA 3IA7A 1O2DA 1Z2CA 1Z6QA 2FCAA 3BN3A 1DWUA 1EXMA 4KR3A 5J9FA 1CF9A 3GGDA 3NCTA 5DKFA 5KSZA 4M8SA 2RH5A 4J07A 4XRRA 1OH8A 2Y77A 1QIJA 2BEKA 2QD4A 3C4JA 4MUBA 4O25A 2WJYA 3NGXA 3EFBA 1XTRA 5DOZA 3W6NA 2UXCE 2Y1FA 3TPCA 2JGIA 4EKEA 2W71A 2XVXA 5AKYA 1Z4LA 2ZE6A 3A1NA 1THGA 5ICSA 3NWJA 1C1YA 4LOAA 4Q3EA 5I4BA 2C5BA 1JIIA 2WK1A 3ZOZA 1M7HA 2QJTA 3U7FB 1U0BB 3GMSA 1YA6A 4BEWA 1EGQA 2EP5A 1PK9A 3SF0A 2O7QA 1QO0D 2XKAA 5AJVB 5IWAB 4DB4A 4PLWA 5ELMA 4YYEA 2AC7A 3I52A 3PR1A 4NULA 5EEHA 2O8NA 2GK7A 2V8OA 3ZE9A 4YO8A 4R0NA 1ODTC 3CZ9A 4EG7A 1OBHA 2E1PA 5CYPA 1KI3A 3MT9A 4CIWA 3C3MA 2H3EA 4JS0A 3CX6A 1YHCA 4M9UA 3HA7A 4PFKA 4IG4A 1FNMA 5IKXA 3FNHA 3HJGA 2C20A 2QMYA 1B8UA 1R0CA 4FFBB 3PXAA 4N3BA 3PWSA 3TB4A 2OO3A 3NT5A 2VO1A 5CMLA 4YAUA 1ACMA 2ZQ5A 5DFAA 4QGBA 3WL8A 4WI1A 2WDZA 3LP8A 3RTDA 4BKPA 1U9IC 1JDBB 4HFMA 3FCOA 4RXUA 1OXVA 3FJYA 5ES3A 1EUCB 1RQLA 2YJTD 4D9FA 1LDEA 3G89A 5JAQA 4NV0A 5EXPA 2X5KO 3B78A 4V0MA 1B14A 1FXWF 2PLFA 3NM4A 1P1JA 1XDSA 1W36B 2PLWA 3R7DA 3H1FA 1TK2A 4IDBA 4OQNA 3EXG2 3W06A 3W3AA 2R79A 2HZBA 1LW6E 4B3RI 1U31A 2Z2XA 1JQBA 4IGKA 4E07A 2O2HA 5GAJA 2IPNA 2Y2UA 5C0XC 2F67A 4JGGA 1OT5A 2OV4A 3E9RA 3FPGA 3G17A 5JTTA 2F1IA 2FUEA 2F8LA 4HNTA 3IRVA 2HH9A 4S04A 3GGPA 1YE8A 1RSZA 2ZJ6A 4BQOA 3EEBA 5KCMA 5LDHA 1ESEA 1QO7A 5BMOA 4DR5I 2D06A 3RTAA 4TTQA 2QE7A 2IDJA 4YRRA 1D2HA 3HLTA 4I4LA 2DQYA 4LF6E 4LYJA 4MQBA 2GO4A 2PKRA 3EZXA 1WMEA 3EZ7A 1YASA 3GBPA 4LXXA 5LYYA 3U3MA 5HIMA 1U8ZA 4L4RA 4F04A 2AX4A 3QF4B 5FIUA 3G5AA 2IZZA 3VKGA 3C6BA 1OC4A 2UXDE 3GZJA 3QE4A 3DHWC 1WPRA 2WF7A 5KYWB 4XRGA 3WLFA 1UM9B 4M1EA 4BV2A 1SMKA 3LFTA 4B6SA 3EDCA 4IX9A 3N0WA 2CF5A 2ECOA 1EQAA 3DMTA 4XM0A 2QX7A 2CNBA 1SCDA 1TMKA 5DHUA 2XZLA 3WMRA 1C1HA 3LSTA 4HLDA 2BCJQ 1BHO1 5IUJC 4G0YA 1NYTA 2YS6A 5JEAC 4ND7A 5TPZD 1U3CA 1TCUA 3AF3A 4Y2HA 3TAUA 3HULA 2YDXA 1MJNA 1ZUNB 2ZULA 2DUWA 3JYNA 4QYIB 1KH3A 4P86A 4UDYX 5K20A 1KA9H 1K7FB 3A6KA 4MKXA 4WZ6A 1CQJB 3WYAA 1P31A 4TN1A 4Z1MD 4H77A 2CVQA 1L5GB 3QENA 3BERA 3AESA 1EGVB 3HYRA 4UT4A 1YHNA 2WIKA 2XE7A 1R66A 1O89A 3U9LA 5FPTA 4FFOA 4GPAA 2DJ5A 4HQRA 4KQCA 1Y6RA 1EXNA 2WT4A 1XMXA 3CNNA 1Z8FA 3ASUA 3C5VA 4KKXB 5CDFE 3IPRA 3I64A 1KY2A 4DWWA 2UZ4A 3EVGA 4CN8A 4IDDA 4A16A 1JG4A 5FA6A 3OT5A 3SSAA 4L78A 1NYQA 2YWRA 1T0UA 1SXJA 3DBLB 3F5QA 3V80A 2CBZA 5KTOA 2H52A 2B78A 1BDIA 1XMQI 2CK3A 3S1AA 5AH0A 3QBEA 1ODCA 2NO7A 3CO5A 3Q1LA 4V2UA 2H06A 2JD2A 4H17A 3FDJA 4HYQA 4BS9A 4HSGA 5EXTA 2GAFA 4AQYI 3P0HA 2UVPA 1GYRA 4OXQA 5KAMA 1FNBA 3FYSA 4IUDS 2PJDA 3UAYA 3K0FA 4HQOA 2GQ0A 5DHRA 2PV7A 3U4GA 1O03A 4RVCA 4OO1F 1M2HA 2X14A 4A91A 2IKSA 1MX0A 2ARKA 1VTKA 4A36A 2NYUA 3M1AA 4EUEA 3K85A 2C2MA 3GJ5A 4ER0A 4PZ9A 3TNJA 4XB1A 2AR0A 2ECPA 4JVSB 1GAJA 3WRXC 4WINA 2FPGA 3T15A 2XYGA 3Q9NA 3E5RA 4IZHA 4RU1A 2Y1DA 2SCUB 1L5LA 1GLVA 1IHDA 5I7HA 2H16A 3AUUA 2KSQA 3PKIA 1TCVA 4B4KA 2HCJB 1Q6YA 3JQ9A 4DEXA 4E1BA 3LBHA 4IO1A 3GLIA 3HJAA 4GYYA 5DGXA 3UW1A 1UIRA 1EZZA 5B12A 4NVRA 4ZVIA 1PLJA 1W75A 4MPDA 2YIMA 4W5HA 5GJCA 3CIFA 2JATA 3JAMC 1CJVC 2QMQA 1P1RA 5AHXA 3JQAA 1ELOA 2W4IA 1KKLA 3KAKA 3VR2A 5BRNA 4HPXB 2OHIA 1TUBA 2ZRIA 4BB6A 3V4PB 1AF4A 3GLHE 3YASA 4DJJA 5KQGA 2GM5A 3M6LA 2PUAA 3VZCA 3QPDA 3WKCA 5BUZA 2NZ8A 5E38A 1WAMA 2OQ2A 3Q72A 4L5JA 1QF6A 2BF7A 1RQPA 3IEKA 4NK4A 5CA0B 1SCNE 1EKXA 2WTMA 3WU3A 2OGZA 3O83A 1KTIA 3E9MA 3L0YA 5LUAA 3EZGA 4MUMA 2BYTA 5DJ5A 1VIVA 3JD0A 4I1SA 2KBEA 1NUQA 4UVHA 2QTVB 3EH1A 4BVFA 4V03A 2PXAA 4KQ1A 2Z2ZA 1PFVA 2IP4A 4BGUA 4EHAA 4DZTA 5I7WA 2JLBA 1C8BA 2VC2B 3W2HA 4DV1B 2C8LA 2QBYB 2VZ0A 5A2GA 1WCXA 3K70B 8ADHA 2X6TA 4K6KA 1XWFA 1NQUA 2J9ZB 3WL6A 2C61A 1B1CA 1D03A 1KI4A 1WMBA 3HP1A 4WZAA 1U90A 3R7LA 4CWAA 3VJRA 4OQPA 4MWCA 3L4BC 3WYFA 5C4IA 4PYLA 3D43A 1VBNA 5A4DA 1HFWA 3FTFA 2PH7A 2B6NA 3FVTA 3MJHA 1EP9A 1F3OA 5DVZA 4PXAA 4WCFA 4LBVA 1K7XB 1T4MA 2CL6X 2QPLA 1K3UB 2QLNA 2HADA 2R25B 4GMGA 4Q82A 4UHDA 2WJIA 1Z47A 1IY2A 1X7YA 2GLTA 3B3GA 4N6NA 1LNSA 3B9QA 3U3KA 5FA5A 1NVXQ 2WV9A 1UXOA 2Q99A 3R7FA 4MCAA 4H27A 4U9UA 2ZRLA 3QPBA 1M3SA 1Q0PA 2UXBE 2PGJA 2RAPA 2Y0PA 3HVKA 4QOJA 3SLKA 1NY5A 1K66A 1W2GA 4FBGA 5LXTA 3OQPA 3SEZA 5KI6A 1T36B 4GX2A 2QRPA 4JI1E 1QVWA 2J45A 1EWTA 3UQYS 4HQFA 3V6MA 4YRSA 4IQGA 3RIHA 1Y0BA 2ZWMA 3EEOA 3TMYA 2I7TA 1T5IA 1EXDA 1HQCA 2PT7A 2ZI3A 4KQGA 4NXNB 1QLWA 4UM8B 3IR5A 4RFLA 3ZWQA 5ALWA 4DXAA 1RC8A 1KK2A 2YS7A 5EIBC 4R51A 5NULA 3T7RA 3OKFA 2CV0A 4HTFA 3G6WA 3LZDA 1J2UA 1KRWA 3F2IA 2EX4A 3MTAA 1IWOA 2FMXA 4FFVA 5BOSB 2Z8ZA 1SU4A 1ZWLA 1DL5A 1KYZA 3HEAA 2DR2A 3Q1QA 5LP6C 5LP6F 2Y1EA 1PJ2A 2FW0A 1F38A 2FF5A 2OCYC 1BS9A 5EXDA 3C1AA 4DSUA 3REOA 5C18A 4BVHA 3DB2A 2G9VA 3IIEA 4LBYA 4U7DA 3I6MA 2L69A 1NLMA 4FQ8A 3GJXC 4CL2A 2FLKA 3RJTA 5JQWA 4HDNA 4Q15A 1SA0B 1W0CA 5HSGA 5IBPA 3ZI7A 3KSUA 1KPGA 2FSIA 5LM3A 2HHHB 3K6KA 5JEAB 2VESA 2Y68A 3D54D 1IONA 1UAGA 3GXBA 3VM6A 3NHZA 4RD0A 4RDHA 1W59A 3IO3A 1RE1A 2R3SA 5BV2P 1M6VA 1BCSB 1P0PA 1CDZA 4JLUA 4BUJA 1NXSA 4C22A 1DVRA 2W5UA 5CIQA 3FZEA 3AI3A 4CEHB 4DR1E 1FKAE 1Q3HA 1Z62A 3CSSA 3HKBB 1GRVA 3N0RA 5DEIA 3X1ZA 1GZHB 1JSCA 1JA1A 3W5VA 5ICGA 4P38A 3P0IA 4YJ3F 3Q4GA 2BGIA 4PPQA 4C2AA 2P68A 8ATCA 1AZSC 1RJGA 1IBKE 4FB4A 4XWYA 4K9KA 4XI9A 3RT9A 1CJUC 4IDQA 3UTDA 1NM5C 3QT8A 1JAYA 1Q0QA 5IDYA 3ZZMA 5DBFA 4BQSA 1UH5A 1Z0CA 3B6EA 4O29A 3FNGA 4QXPA 4YACA 3GWGA 4F6LA 5B4UA 2J3LA 2DQ4A 2M32A 1PDVA 2UKDA 3C7KA 3M83A 2FQYA 3P9NA 2H2DA 4WPGA 1R50A 2ZBEA 3E81A 3UAOA 3RBAA 4BU0A 3CVXA 2Z6AA 2WTUA 1QQ6A 1SKAA 2LZ0A 1XMIA 4N6GA 4CM1A 4EITA 1B74A 3BWEA 3E82A 3M85G 1XZBA 4N3NA 3M4XA 4YRAA 2HSEA 1WZIA 2LIVA 4KLRA 3MF4A 5B1EA 1XWWA 2V96A 1SVOA 2Z04A 1Y5NA 3QV2A 3QFRA 1D6TA 2GJSA 3IBGA 3PC4A 4HMPA 4YV2A 1K2VN 2NUPB 3AOGA 1K4YA 4NMWA 3KWMA 2IV2X 4CM9D 4Z9YA 1EUZA 1HDEA 3K2BA 1NVGA 4RZIA 5KOJA 1Q74A 1LBQA 1ZWKA 2JIOA 2DTEA 4YY3I 3SDBA 1NAIA 2VQDA 1RZ3A 1W76A 1Q0HA 2NSJA 4MPJA 2CVEA 1D4ZA 1Y1TA 4G0NA 2W2KB 5DX8A 4ZAGA 5A4JA 3OOJA 2DBVO 4X92A 1JVBA 4R7TA 1NVAA 2O8FA 4IW3B 1T9KA 4YCAA 4B73A 3K31A 3PJDA 4CQNA 2OEPA 1L5NA 1CRWG 3H2ZA 1ZVJA 1AB5A 3F2VA 5D5PA 4B3DA 2PSHA 2JHPA 4KUHA 1SC1A 3UXMA 1RMTA 2IA5A 2OAGA 1IIBA 1MHTA 4UM7A 3L04A 2AQ8A 3VTFA 1H2WA 1P2GA 2OGWA 3B9RA 2GA9A 1R5JA 4RAOA 3BL6A 2WRZA 1HT1E 4I6EA 3BE8A 3C3YA 5A0VA 2GTHA 3SX2A 5F7XA 3U26A 1KFJB 1KYXA 2HFKA 4G1FA 1RXYA 2JS7A 3ZGZA 1EBFA 1KJZA 1CUBA 2W70A 4ARIA 2HMSA 3A9VA 3JZIA 1E69A 2ZU6A 2XB4A 5FJIA 4E0BA 2Y92A 2NN6F 1E4EA 4B2PA 4GWKA 4ZOBA 2AE1A 3FR7A 4B3SI 1OCEA 3MJRA 5H1YA 2VJNA 3K73O 2C77A 1VL8A 3PA8A 2WG2A 1LPBB 4XOIA 4X8HA 4LF8E 3DAYA 4MZXA 3OFNA 4Q9IA 2QZ9A 2C0CA 1OYOA 4DUPA 1OLXA 3LCMA 4LPKA 2GYYA 1XXEA 1RYFA 1Z4OA 2IPXA 2L42A 4AMBA 4DLPA 3DVLA 5D6NA 2UU9E 3FCSB 4E22A 1CW2B 4KAXA 2N75A 4H59A 3SHTA 2HGSA 4FDMA 1LVUA 5IXSA 2JJ1A 4YMGA 1EYZA 1VP9A 1ZOSA 1WHSA 3AFGA 3NVAA 4DJDC 5HZMA 2RBEA 1E3QA 3MBKA 5EJAA 5JWOA 4RKWA 4ZYLA 5EWJB 1GSOA 1IH8A 1T25A 1NJ6A 4QUAA 3OT4A 4WCFB 3LY7A 4IRUB 2OWEA 1DC5A 2C5FA 4XUEA 4R7ZA 1JVSA 4C3ZA 3OLCX 2DWPA 3T5PA 3LQKA 1H74A 1L1FA 1GTZA 5FTNA 3W5SA 1G20E 2Q2QA 2VAXA 1QFZA 4JX9A 3O8RA 5IXYA 4U5XA 2XXAA 5G1NA 4JLMA 2GB4A 3M3HA 4YFYA 1D1SA 4XQ9A 2VP6A 2GCGA 3FSJX 4FDUA 1IOWA 5B7QA 5IZ4A 1KZ6A 2O2ZA 1U0NA 4I66A 1D2CA 4POAA 4QASA 3RUHA 1E1QD 4B35A 4RTQA 3LRPA 5L6LB 2QYTA 2QOEA 3A6HA 1VP3A 4LV5B 2ZI9A 4BIMA 1RYHA 5BT8A 1MLDA 5BOVA 4JYAB 4H7PA 1FP4A 2N3ZA 5C0XF 4L5BA 1RR6A 1LEHA 4IDFA 4TT3D 4F3KA 4P34A 3JR7A 4P82A 4RIEA 3DD6A 1ECJA 3LXRA 4C05A 3UMYA 1G21B 1Y5RA 1GGMA 2FN3A 5IDVA 3CX4A 5KQSA 1Z4PX 1ZJ5A 4UMDA 1V8FA 2IZ0A 3D7KA 2B21A 2B2NA 4FN4A 4WCVA 4MVJF 3G0IA 1SXPA 1MJFA 2ZJZA 5KU7A 1BDJA 2P2LA 1Q92A 1NU6A 4O4HF 3W5HA 2Q1YA 1Y9EA 3TOCA 2I91A 5JS7A 4QL3A 3O9VA 1TT5B 2BGUA 3K1AA 4M9ZA 4Y9RA 3ZK8A 1BFUA 1E2NA 1NNEA 4B3SB 1HSOA 1WRBA 1XDBA 2QL6A 3L1UA 1AIPA 4YP1A 1RMYA 5C3UA 4G1UC 4PBSA 1W49A 2FP4A 2GKSA 5M29A 2J3QA 4PO8A 2AXNA 4QATA 2RHJA 3F98A 2PH5A 1GWNA 5U1PA 3C0KA 3VMFA 4CQLA 1AQJA 5C0XA 4O08A 1CUYA 2YN0A 3OPQA 1Q7GA 2HU2A 2G4CA 2EWWA 1XD9A 4LY0A 2PA0A 2WMNB 1XHFA 2HIHA 4PWYA 3VGPA 3CVJA 4GXTA 5SZIA 3AEUA 3PWTA 2Z3ZA 4IXTA 4OQLA 1XZJA 3HR4A 4YDHB 5KREA 4LNUB 4LXHA 1KAGA 4ZI2A 4A6XA 4DV5E 3PENA 2Q0QA 4H7IA 4JLNA 2Q3BA 3RS3A 2W2QA 3RS9A 3HEMA 5L7YA 4N65A 4ZO7A 1ZK3A 3BSSA 3ZWVA 4JUIA 3GP8A 1BXRA 1GRNA 1E3MA 1K0UA 4PRLA 1J97A 3QEMA 1R8XA 2QG9A 4KFTA 4KSYA 4NONA 2GASA 4LWZA 3AHIA 4MYHA 4I55A 2PAAA 2AJLI 4C14A 4DPTA 2QY9A 1Z7WA 5FEMA 3TTTA 3VMMA 3OHPA 4DLZA 1PL0A 5IFLA 1K8RA 1MB0A 2C7VA 5KTNA 4IZJB 3HL4A 2W58A 4N3CA 2NO0A 2D5LA 4WXPA 2YNMD 3QTBA 5AW3A 2BTQB 4QRDA 1YNSA 2CD9A 4RESA 3TZLA 3VR0A 4EQ6B 4RVSA 2H4HA 1Y6JA 2BUBA 3IAAA 1IY1A 1NQAO 4AECA 1E4OA 1IU9A 2CW5A 2J5KA 3CT4A 4NL4H 4L6IA 2O5VA 5CURA 4MWGA 2H1IA 3VR3D 2Q4EA 2WWTA 1VZ2A 1JR3D 2P2GA 2XUIA 2QAIA 1ESMA 3ICWA 4JYMA 1CQIB 5BVHA 3K96A 1VC2A 4DQDA 4RABA 4UKDA 1KI8A 2PS3A 5BPHA 1DBVO 2XQVA 3PUHA 4H3VA 1ST2A 3OZDA 1HDGO 3B1YA 3OESA 3ZCQA 4RPGA 4ZA2A 1KDRA 3JQEA 4EECA 5I45A 3QOYA 1FMCA 2GZRA 4AZWA 1T5SA 3OPYI 4CTKA 3P2IA 4B6PA 5C5IA 2GPAA 2HOQA 5KNCA 4II2A 4RVFA 3ZIAA 1XZIA 3RIEA 5JAUA 1JX6A 3WK9A 2WKWA 1JKFA 3I4FA 4YPVA 1KORA 2Q1TA 3PVSA 2NNWB 2WILA 4W9NA 1QVAA 3KQKA 3D1LA 3CV3A 4IDHA 4JT4A 4JD5A 5FHQA 2PY6A 4L16A 4XGQA 1GUBA 4DY4A 2AZXA 2EFGA 2DUNA 2H18A 5TIIA 4MIKA 4JEHA 2OZVA 4PG7A 5TMBA 3UCXA 3UHFA 1ZY2A 3SQOA 5AW8A 3H2YA 4ILEA 2G5PA 5FQOA 1VCMA 4UOZA 1PRYA 3D4JA 1J2TA 3BVPA 1IEWA 4WXRA 2FKNA 1X1SA 5F3RA 3GJYA 1G21E 1BE6A 2XITA 1YS4A 4KBYA 5F2EA 1DQNA 4BQEA 1TUIA 4IIXA 1NI3A 2ZSDA 4HTFB 4ND3A 1ZL2A 3AUYA 2R6HA 3VFDA 1N0HA 4U1RA 5KQPA 2VQEB 3JVIA 2VSOA 1XLVA 3SBEA 3ICPA 1MC8A 1P4JA 3JVUA 3ZJUA 3IXMA 4Q1VA 3VPCA 1ORRA 4DPLA 5A2QA 1M6YA 5CEJA 1NW6A 4IOLA 3GELA 4P4GA 5K0LA 3ICVA 3OIVA 4N82A 4NCHA 5DX1A 2WSIA 2HEGA 4B82A 4CF5A 4M0LA 2QVLA 3CZRA 4YUZA 1MMFB 1WKVA 2XUHA 4Q93A 5ERGB 1MB3A 3R0JA 4ZRMA 2OAQ1 1THZA 1UJNA 3DJYA 2CZGA 4MVJG 2DU8A 1MRNA 4C01A 2AI3A 3FZYA 3B48A 4IFDA 3H65A 3D6MA 3HVHA 3UJ6A 4ALIA 4NBRA 3O3CA 4CHTA 4ZXPA 1U5AA 1VM6A 2IIBA 3A14A 2QZJA 3QHAA 4GZLA 4XJVA 4ZO8A 2CE2X 3B1ZA 5K36B 1KK0A 3N59A 4INOA 3CJQA 4ZAYA 2R97A 2WWFA 4OX9E 1BDBA 5BW6B 1LQUA 5ALTA 4YQEA 4BX9A 2D5BA 3ST7A 2H65A 4ESEA 4BMPB 4MP6A 2H1WA 1FX1A 3USZA 2Y76A 4C4XA 4NXME 1UP6A 2PRSA 1D0IA 2V7QA 2V7GA 3A2LA 4F8EA 4QQ8A 3DOJA 1N0IA 3THYA 5LA6B 4BWFB 2HKJA 5BWLA 1LF0A 3PYFA 2FSPA 4JN6B 3TB6A 2WHRA 4G09A 5LMNB 4LCFA 3CH5A 4R9UC 4M89A 3K17A 1UKZA 3I37X 1M6WA 1QGED 3SI7A 4C0BA 3AQ4A 3BE4A 1YS7A 1N36E 5A4MS 2NO4A 4Z0HO 3TJMA 1WD5A 5MHTA 4HWTA 3GRZA 2CSXA 1ADYA 5B1HA 4EVIA 1MZPA 1U0JA 1IN1A 2PD4A 3ER9A 1BJTA 2JBAB 2HLNA 1NVUQ 4E3WA 3GFFA 4I5GA 1FVOA 2CEKA 2V5AA 3OQ1A 5D01A 2D00A 2N9UA 5CX1B 3TD6A 4CYMA 3G9QA 4HACB 2IW1A 4C0WA 2ZM6B 5EWJA 2V4UA 1NW5A 4JR0A 1QPBA 5BQPA 1AKTA 4X6UA 5MF6A 1P19A 5FV4A 2YCBA 1UAYA 1A04A 1TIBA 1LK7A 4J3JA 2QGZA 1LKZA 2ESRA 2QR3A 3KBOA 5BN1A 2FG6C 1OHHA 3AL0C 1NQ5A 1P5RA 4PNZA 3WIBA 4NEQA 4WX2B 1W1UA 3L0DA 4OYYA 1CY1A 1T2NA 3H0KA 3NR2A 3C41J 3EMDA 4I6GA 3FMIA 4QBIA 5JNSA 1VOTA 1PJQA 3JQQA 3PNBA 1NN0A 1ZJJA 2P6NA 4I2NA 5A3SA 3WNZA 1EX1A 6ADHA 3AGPA 3C6ZA 4I3HA 1Q0TA 5KQLA 3I2IA 1N6PA 3NNDA 2R7AA 3C7CB 3C3JA 3VUFA 1Z0TA 2FG7C 1RQ2A 1GEGA 3QPAA 1GTG1 3ESRA 4JI5B 3GLQA 3F6EX 5AI9A 2IUUA 4D02A 3GZNA 3D8BA 1SXHA 3KELA 3NCHA 3D7RA 1ACLA 1DRJA 3U1TA 3IP3A 4ZT4A 4L3WA 3OX4A 1L5VA 1IHPA 1T4DA 3CTPA 4NE2A 1EU1A 4QEKA 4ISBA 4WNAB 3DKPA 4DUGA 4AQYE 2FMTA 3M8KA 4Z1OA 2XGJA 4F9FA 3BE6A 4JHXA 2JLQA 4Q03A 3PC6A 4FGLA 4AXBA 2VG8A 4KEAA 1KQOA 1KSFX 1NQXA 3R3JA 4OMFG 3IVXA 3MYRA 1NV8A 4RMIA 2CWDA 2ZTSA 4UHJA 4UTXA 2O5RA 1AKVA 3OTOB 1U6IA 4S35A 5BVGB 4B45A 3I6BA 1HE4A 3T9CA 4HWOA 5CFLA 1I13A 1VGQA 1ZKDA 1CR4A 3KKPA 1W36D 1JJFA 4C4AA 3HV0A 3PTZA 4ZHQB 2UZ1B 4M3NA 2BT4A 2GD0A 4OP2A 5D3MB 5G41A 4FIZA 4UZSA 2ZIEA 4TROA 4L0QA 5TPWB 4CF7A 3K20A 1M66A 1O95A 1XLWA 3D4IA 3I5YA 4P31A 1WMSA 1XYYA 4LPSA 3E2IA 4LQDA 3EDOA 4CKWB 2QRMA 4ZMSA 1G2IA 2F00A 2J0QA 4IDAA 4GZ6A 1WPQA 1U9JA 2F2TA 1L4KA 2QNIA 1C9JA 1MOSA 3BKXA 1H6CA 2VPTA 3PG5A 3QVKA 1UBMS 4JMPA 3CMCO 3FUTA 2VP3A 4L4YA 4HX5A 4IGIA 1AZTA 1NSYA 2W8BA 5BQ5A 1C7JA 3BEOA 3AVYA 2PNLA 1MX3A 4C6SA 4CL8A 1GU0A 2HQBA 3GJ6A 2GVDC 2XCTB 1VG8A 5IPFA 1VMAA 2ODAA 3LT0A 1WUJS 4N49A 3L1VA 2W2VA 4DDTA 1ISPA 1T29A 1ZFNA 4JX8A 4PFSA 4DR4B 2HHJA 4EUSA 1MRZA 4WE3A 3P2JA 3WGUA 1WVMA 2BKUA 1AKMA 5FR2A 1G4AE 3INRA 1N4AA 4BYMA 2WHPB 3NAZA 5AVRA 1JE0A 3QG5A 1LZKA 3KFVA 3GDWA 1E2LA 4B2YA 3W5CA 3COVA 3NLLA 2DR0A 5FAXA 5TQJA 4LOJA 4ZQFA 5K1ZA 4ZK2A 1P6QA 1NPDA 3TCNA 1V11A 3V7UA 4FKBA 4H6WA 5LYJF 2HJGA 1EVJA 3I6YA 2QTZA 4KE9A 5JO9A 5DRRA 2AF3C 4D8WA 1PBTA 5H9WA 1EWRA 1WXDA 3RS5A 1WS6A 1JXMA 2ZJ5A 1D09A 1GPYA 1XCBA 3EPJA 4FKZA 1PKEA 5D1HA 2W6OA 1KO7A 4OSOA 1X1CA 1GQOA 1ULZA 1XQVA 2I2XB 3DKVA 2JGNA 3M6FA 1KIJA 5JZMA 2GILA 3V7FA 4DF3A 3SP1A 4KAFA 4Z4HA 5F4BA 4E94A 2V58A 3OPMA 3NO4A 3FFTA 3M6IA 2P6PA 1NLUA 4U3DA 4DLUA 3KALA 1FFEA 1UFVA 4HFRA 3RTGA 3MT8A 3JQBC 2PK3A 3IBFA 3FWHA 3MB5A 4B5KA 4BQFA 5EHXA 7MHTA 3U6BA 1N1DA 1W5TA 2C8KA 4M9XA 1G3MA 5AOBA 2ZM6I 1MUUA 5LC1A 5C31A 3MCVA 3U7JA 4KHPE 4O4IA 3UBMA 2JHGA 2OESA 2AHRA 2QVBA 4ZCQA 1HRKA 3RRXA 4CM3A 5KNDA 2QRUA 4H2DA 4CU5A 5AOAA 4YHHB 4JI7B 3PBKA 2XLBA 4MTCA 1L7RA 4EPYA 1HDRA 3ABQB 1IHXA 5FLYA 3ETCA 2QORA 1YVDA 3QE3A 4Z8XA 3ZUGA 1FRVA 1XYGA 1UZNA 1VGVA 1ISJA 3IV9A 4BO8A 4XSGA 3VZDA 1X87A 2FLVA 2OUIA 3BK2A 2ZVJA 3E9EA 5HF8A 4LF7E 3U3OA 3DE7X 5DW0A 5L53A 3CW9A 1CFZA 1FDIA 2YOFA 1NR5A 3DQQA 3TQOA 5JSZA 4U4AA 2XD9A 2VF3A 4A82A 5AKKA 3RVJA 5AOVA 1U81A 2J6HA 1U3DA 3X2EA 3CUSA 3RBVA 1VSTA 3DOUA 4S2EA 5EIEA 3QVGB 3G1UA 3TW8A 4CKEA 1CJTC 1WE2A 1SOAA 3ENVA 1QHSA 3KQQA 4RPIA 1SQFA 1ZIOA 2AVDA 1ESDA 2AXQA 1GN8A 2H59A 3FLMA 3KQYA 4OIMA 4JL6A 1K5DA 4ASUA 4QYSA 1TJ4A 1DRVA 1TIKA 3ESDA 1KBZA 2WP8J 3Q5DA 4OTZA 2ZR7A 3JYOA 3WK7A 5DLYA 5A7FA 1F60A 1HDZA 1JSXA 2RGNA 2XCQA 3UYLA 4NC9A 1NJ8A 4G4SO 2H0QA 1J0BA 4E21A 5JALA 3TLCA 3TGPA 3ZHYA 1BW9B 1QGUA 1T2CA 2V54A 1U2EA 5C4MA 1NG1A 4KXXA 3FPFA 4DQXA 5BSGA 1UK9A 4Z9AA 2GSWA 4MKZA 1AO0A 3KR2A 1PJSA 1UADA 4FUQA 5HK9A 4XFKA 5IAOA 2C94A 5ALHA 2P9GA 2XWBF 4N5NA 2P7HA 5E2IA 4NBKA 4C04A 1HT0A 2LGJA 1JEYB 1BS1A 5F33A 3TDNA 1B93A 4IXMA 5AVYA 2WUFA 5EINA 3GN2A 4F85A 2G28A 3EOZA 5CYFA 2BFBB 2MSDB 3EPPA 1N1MA 1NXXA 3RS7A 3T94A 1Q44A 2EFYA 3OTIA 3GD7A 3S2EA 1XJWA 4MH0R 3C43A 4FW5A 2JLWA 1A96A 4BN0A 2WFZA 4RD1A 3UHPA 2QJRA 4OJKA 2C2KA 5HFNA 3BTSA 1WNTA 1A7AA 2UV8A 1XSEA 1X3LA 4MROA 1MW9X 2JFZA 2WNSA 1A5TA 1KXZA 1AXEA 1U7OA 4HAVA 1OAKA 2OE2A 4Q48A 2FPGB 4FYYA 1PVGA 2II6A 2FPLA 2R1VB 3PNVA 4TRJA 1BMTA 1U7UA 3O9MA 4BKOA 4JJFA 2DWQA 3JQGB 1ZICA 4NCXA 2B5OA 5KWVA 5BSRA 2GUWA 1EDZA 1XEWX 4KC0A 3FHTA 2WZQA 2EU8A 4JLWA 1L6IA 1I2BA 3O94A 2RKWA 3LQ4A 3K0HA 4KR6A 2ZJ1A 5EN4A 1J0AA 1RYEA 3QBJA 2A7QA 3IO5A 3E9DA 2J0EA 4HH0A 3KYCB 4IH4A 1NNI1 2R44A 3L6EA 1ORVA 5DE3A 4CE6A 4BJ1A 4RPLA 4BBAA 4LFCI 5FLXQ 4Q02A 2VCYA 3TLGB 5AKXA 2JHCA 1BWPA 1HGXA 4DDWA 2ZRPA 1ATIA 3ADBA 2QMHA 5ADUS 3KZOA 2XT0A 3EX7C 5BMVF 3HSKA 5IAJA 1JKXA 4BNZA 1Y3BE 1DZ3A 3PDUA 3PRYA 3W34A 1NHIA 5G0UA 3KPUA 4A73A 4JI7E 4H7JA 3S6JA 9GPBA 4LSWA 2V7TA 3P3GA 2Q1UA 1TD9A 3OPNA 1XLTA 1GFZA 1UBJS 5F2KA 1UMKA 4YAIA 2B4AA 1IQUA 3I0NA 1EUDA 3OOWA 4KNWA 2VT6A 1GDTA 1T10A 4KH1A 5L3VA 1WP9A 4I14A 3ZKWB 3CC8A 1QUEA 3ZW9A 4BBZA 2YVUA 1JEDA 3RROA 3L0SA 4RBNA 2TRSB 1CB7A 1R0YA 3L79A 4MR8B 2C1EA 3BPSA 3AL2A 5T5QA 3D6FA 4YDSA 3QIVA 3HBFA 2Q1SA 2HHAA 3HUDA 4RY2A 1VL6A 1SKUA 3LFHA 2I7CA 2W37A 3UMCA 2LKCA 2SKEA 1IB0A 3ZDZB 2R8OA 5E9AA 1F4LA 3EQ8A 2UXDI 1XMOB 1PI3A 1ZC4A 2H48A 2Q21A 3DOCA 3F4LA 2VYND 4BVKA 1W47A 2QUHA 3EQ2A 3P2OA 4JUFA 4BVLA 2IU0A 4DEYA 2A3RA 4LOHA 4Q6BA 2YVLA 1H2AS 1O97C 3S2YA 4LDPA 3NVMB 5IMSA 4EPWA 1DG9A 2J6BA 4GSYA 3FDZA 1YDFA 4V1CI 1UKEA 4G5RA 2PJUA 3ND8A 5IJ0A 4L4ZA 4DU8A 3C1OA 4R2JA 3MMXA 3LCJA 3PGLA 4FMPA 4P1ZA 2XR1A 4PHFA 3G0HA 3GUUA 2G8NA 1OBVA 2CCGA 3V4VB 3WIVA 2Q3LA 4MR9B 3S29A 3ZHTA 2CC2A 5HIIA 1ODIA 1U2TA 1TRHA 1Y33E 2FEPA 4WH0A 1MZVA 5CB4A 2VHTA 2WTAA 3UH0A 1QE0A 3JQFC 3LIPA 3WAKA 1IZZA 2JFWA 2VDLB 2Y1KA 3DCYA 3K8OE 3Q7PA 5AMXA 4F4HA 4XAQA 1L1EA 4Q4HA 3JWPA 4D3DA 1TU4A 4OOFA 4TXNA 3TIVA 4RCZA 3MINA 1JDPA 4W9RA 2Z98A 4AQDA 4E15A 2Z2KA 3IP7A 2XNDA 3ILHA 3WQBA 5HWSA 2I2CA 3UHMA 4LJAA 4GGPA 4R2KA 1UJMA 1FFGA 1XNHA 4IJVA 4ENVA 5B6PA 5HRAA 4Q3BA 5J4VA 4EPXA 2HJRA 2CLMB 4L1KA 4Y2PA 5EOVA 2QN7A 3MWJA 1KVSA 2DPHA 1II0A 2DFKB 3K2QA 1KFCB 3Q88A 6GPBA 3BZUA 3ZDDA 3VKHA 3W7BA 4NAVA 1PHRA 2PYDA 4WMLA 2QD5A 5JU6A 3EVNA 3GJ0A 1X1AA 3ZWWA 4IF4A 1YU6A 3IAUA 4O02B 4PLCA 2D3TA 3GT7A 4KGZA 4AI6A 3AEXA 3S8EA 1O94C 4WK2B 1B62A 4DIOA 2NVUA 5ENDA 4Q1AA 1Z8NA 1Z0SA 3PYLA 2YHUA 3N70A 2P3QA 1GR1A 1FQWA 2EGHA 2CVFA 3FYUC 3Q0TA 2YZ2A 4X65B 3PJGA 1XELA 2EATA 1USVA 3IELA 3O8NA 2IUTA 1YBMA 3CB4A 3GCDA 3I73A 4MHTA 1DJNA 4IMJB 1WXWA 3UXYA 1ZU5A 2ZSHA 4EHBA 1HG1A 5CFMA 2P1ZA 5HQJA 3QQ5A 1P1CA 3DFUA 1KKUA 3EN0A 3ORHA 4N7BA 2Z30A 3PP8A 4MUJA 4DIBA 1O5IA 2GN4A 1QUFA 4QTUB 5F77A 1MB9A 2YZMA 1N92A 2XUDA 3N07A 2DEIA 5CLLA 1QVZA 4EFNA 2NPFA 2LJPA 1O58A 3GONA 5FBQB 5FWAA 5C7LO 4O6VA 2VBFA 1XZNA 2FW1A 3N2KB 4WY5A 3RSCA 3AVVA 2VP5A 1EBBA 4BC1A 5JDIA 4AU1A 5SYMA 4PHCA 2AW5A 2ONZA 3ZC3A 3R23A 4G0ZA 5F76A 1YL5A 3ROGA 3V7WA 2QDXA 2WUEA 3TNFA 1XA3A 5GY7A 4PLYA 1OJ7A 2G76A 4KTTE 5DU2A 3K6SA 1MX1A 3QEOA 3DEHA 3F6PA 4OA8A 3OTQA 4G9GA 4JEMA 2HTEA 4B85A 4EFDA 3SJUA 1YCHA 4TN5A 2NZWA 5T3YA 4JV5I 5CA1B 1ZMOA 2QK4A 3IQZA 3L2OB 1U5BA 3LY8A 1ZRSA 5JVDA 3OAAA 2ERXA 3NFRA 3UK0A 1DIGA 3RYHA 3MSXA 2I78A 4BDTA 2AQHA 4ZVQA 4XEUA 4A0QA 1K88A 1Y63A 2VS1A 1D9ZA 4TSKA 4CLEA 3VHRA 3RIXA 4B7CA 3A4VA 5KYXB 3R7BA 4BZWA 2YJ4A 2MMGA 1G6Q1 1SCQA 2J0UA 2ST1A 3ECCA 2IYSA 3D7SA 3FTPA 5ERXA 1DQYA 4RH0A 5BRJA 4GI7A 4IIJB 1BDHA 4MUAA 5KOYA 5EKDA 2Y9PB 4Y9UA 1JQLB 5DP1A 3ZV6A 3PS3A 2RI1A 3NC4A 4E5PA 2GEKA 4MIYA 1RRKA 4KWEA 2CMFA 4HAOA 1VE1A 4U2KA 3OIDA 4FYXA 4MPPA 4MVCA 3QSGA 5IJ9B 1T3ZA 3ZDEA 2VJKA 2CWWA 3LYLA 4UFNA 1P2UA 3TDMA 4E7PA 4N0PA 1XZHA 1P2DA 1G2PA 2PX8A 2NUAB 3H9QA 4GKKB 5E1BA 3GEDA 4OMCA 1WW2A 2ERYA 3IKMB 4BIIA 1ESCA 4GPBA 1BN6A 2RARA 4CEJB 13PKA 4J9UE 1TK9A 4EUHA 4DR6E 1FNCA 5AK6A 4AZ0A 5MDHA 3EVFA 2BGNA 4URXR 2EG9A 5C9ZA 1RLIA 2R96A 3DV2A 4GZMA 1PEDA 2A9RA 5DGCA 3REGA 3T9AA 1PQWA 1GZ3A 2GO1A 2WNIA 3P4UA 5AJZA 1KI1A 3TNLA 4BLVA 2V7UA 4CLOB 1Z35A 2E87A 1K7YA 4HATA 4PQGA 2PL1A 3OF3A 4YBRA 2QYHA 2BHSA 3HV2A 4LY9A 4OHCA 4I4IA 4TKVA 4NJEB 2PUCA 2FZEA 5L4LA 4TLAA 3KQMA 5JRJA 1EI1A 1IZ9A 1K75A 1H5UA 1V7PC 4JKYA 3STWA 5IDWA 1NMQA 2CXQA 2ZR0A 1AO3A 3EFEA 3NHFA 4H6VA 2ZANA 4ZZ2A 1YJXA 2D0IA 4DG8A 4Z7QB 1Z5WA 5KTPA 3MZ0A 4GBMA 3ZKWA 3SQWA 1G7CA 1Z7YA 1ZGJA 4CKXA 1OLXB 2FDRA 3GRFA 4R9VA 4QVGA 1APBA 1KRHA 2I2BA 4QGGA 2PKCA 7AT1A 4Z6KA 5FLXC 3HU5A 4WFIA 1BWSA 2Q3CA 3ZZTA 4CKZA 1ADBA 2VUTA 1ZMRA 4EJ2A 1DEOA 3IR7A 1PX0A 3KJZA 1PL6A 3PXUA 1UPUA 2BM0A 3DR3A 2GJ8A 4KXWA 3T9BA 1AKWA 1W5AA 4IIGA 4QM7A 1SVWA 3VR6H 2C5GA 1P7PA 5AFSA 1MP0A 2OLEA 2BIFA 1R1DA 1YFJA 4B3HA 1E0DA 1ULSA 4GMHA 3U7GA 1LX7A 3TLMA 2VAPA 1HE1C 4IJKA 3INGA 3L0BA 4DBVO 4IFDB 1GTJ1 5CJPA 3RK1A 1SPXA 4X5OA 3W3AH 4ZICA 4GC5A 1L4EA 4WSOA 1HX7A 1QC5A 3J7TA 4GHWA 5FOXA 3OZUA 3LY9A 2HHCA 2D59A 2GAIA 4DAEA 3OIYA 1ZSNA 1NZ0A 1KIAA 3UJCA 4EEXA 4J0DA 1RRFA 3AERB 2X41A 3I0MA 1L7XA 1ES9A 5CBPB 3VH1A 2BMDA 4G36A 1OT3A 3CF2A 2HTFA 1RWPA 2DFLA 3KUDA 4DTCA 3QMPA 1RIIA 2G1KA 3WP0A 3QX3A 2F9MA 1POXA 2R1VA 1FJGI 2QN6A 1UDSA 2FQ1A 2P3SA 4BGIA 4MRRA 3SIPA 3N74A 3PHCA 4FE4A 5LP1A 1E0SA 3QBDA 1SD5A 2H4WA 4Y6SA 4ZVLA 3KXLA 4ARSA 3JQ7A 5BMVB 3DVAA 4UEKA 2ZP1A 4F2WA 4X1KA 4ZALA 5LKRA 5AKHA 1XWIA 1M34E 1NF8A 4FFLA 3X1XA 3KKKA 5LIRA 1UUFA 5E4TA 4QRHA 1N5LA 3MXOA 3AR2A 1HDIA 1XMPA 2BFBA 3O6VA 3EJWA 4IJ6A 5EUBA 3TD9A 3GD5A 5GADl 2VJQA 5CBKA 3DVRX 3ADCA 2WAOA 3FH0A 5GMEA 5DBOA 4XQEA 3OAAD 2IYEA 2MWMA 1UDQA 4AY3A 1ODLA 3DNMA 5HPYB 2ODWA 5JCPA 1JDBC 2E1RA 1QFYA 4JI3B 4B3SE 2O14A 1Z18A 3DHVA 3P2EA 4MA4A 3HJUA 1X7XA 1XU4A 3NS7A 1MC4A 3QVSA 1H3EA 2ZWIA 3GNLA 5DWDA 1WV1A 2OBLA 3DZKA 2YJ5A 2EX1A 1BKNA 1EUDB 4WFJA 3QVLA 2Q7OE 3OZCA 1GG2A 2COUA 3GK3A 3LUGA 5T41A 6ABPA 4EY5A 1CIJA 5SZHB 3LK7A 4KX5A 3DSRA 4WKCA 2GCOA 5T4FA 3ZGYA 2B5VA 2PYIA 1IYZA 5FWYB 4HDMA 4RTMA 1Y9AA 3UMRA 4PYJA 1BE0A 2B3DA 4H35A 1RQRA 4RKYA 4S1TA 4DT1B 4BPBA 3GCGA 1T8SA 1PK8A 2HSZA 3CLUD 1DXYA 4HWKA 3IMGA 4L0DA 5DM2A 2HHHE 1YDMA 7GPBA 3FYDA 3KYIB 3B3QA 4C4PA 5DRYA 1A2OA 3OTWA 2QYSA 3EY9A 1UP4A 1T5LA 2H7XA 4QEZA 1JFTA 3HMKA 3THOA 3JAKA 1Y3HA 7YASA 2LIPA 1AKNA 1R5OA 3PYDA 3WDMA 2WV7A 3NXSA 1G0NA 1UPBA 2IYQA 1PN3A 2AG0A 1MH9A 4ZN6A 3GFPA 1X8XA 4Y9TA 3MG9A 3SQNA 4KE8A 4JODA 5EQFA 1VYUA 3MWFA 4S0ZA 4OHMA 1JDUA 2GNOA 5BURA 3UATA 4C88A 2A1UA 4F60A 2H0RA 5KHAA 2H2IA 2JCBA 1AHNA 5EJGA 2IZ7A 1P1HA 1E2GA 2XB2A 1GZ7A 1EUYA 4BNMA 3CISA 4BO3A 1T8RA 1F5SA 2O50A 2W2LD 1U0RA 4BEVA 4HRYA 1OGYA 4UVDA 3SZLA 1B26A 3LGXA 2OT3B 1HYBA 3TW8B 1PEYA 4KFRA 1NHJA 3KSDO 3UT6A 1AURA 2FPUA 3IDZA 2P1RA 4RA6A 2Z5EA 4FFSA 2VYVD 5LUBA 3T0IA 4UQLA 1OJLA 2VLIA 3EXFA 4AUNA 5MGNA 2C37A 1DFHA 2ZJ3A 3WNCA 3RUEA 4PG4A 1ACJA 3ADKA 1I2ZA 4G4SP 4WJZA 3BB4A 1AHHA 1JR4A 5IJ0B 2VLBA 1EFPB 3JRXA 3TJZA 2KYRA 4UAUA 2RB4A 2ZYRA 5L3RA 3F78A 4NZMA 3OZWA 3WIUA 2RAUA 621PA 1XNRI 1M33A 3IESA 2DB3A 2XBUA 1O96B 4QREA 3SR4A 4GVPA 4DLXA 6REQA 3EGOA 4Q3LA 1IVYA 4IR7A 1M0TA 4PO1A 1XRSB 3AI1A 5K0CA 3D0KA 3GLLA 3BGSA 2V5UA 3OZTA 2O3TA 3DE3X 3H83A 5HFJA 2P4EA 3VVCA 1ZS9A 1GSIA 5KMGB 1SM4A 2OAEA 3Q11A 5EXSA 1ZESA 4ZYYA 4LFAE 4DNOA 1U11A 4AS3A 2QU8A 3FPBA 1AS3A 3ORYA 3KIPA 4C0HA 4M1ZA 3MJTA 3TYXA 3IGFA 3UXEA 3TPZA 1TW2A 2FX2A 1BYIA 9LDTA 4CUZA 1Y80A 4RSHA 3V1KA 2OA0A 3NX4A 2GK4A 3I9V1 2VK4A 4WUDA 2HPVA 5JWHA 2AKEA 1M1YA 3EXEB 3N28A 2A9KA 4HWGA 5EGSA 4O63O 5C34B 3KQSA 5C5DA 3ROMA 4LF6B 3CO0S 3QVVA 1SCAA 1PUIA 1Z08A 4BKUA 1EVQA 3TTYA 1WDMA 5IKEA 1E77A 2VQ3A 5IASA 4B6QA 3QE9Y 5B3LA 2FFRA 1IBSA 3G2LA 4FX5A 1W2WB 3IHTA 1KSHA 2DFDA 4V1CA 4YUAA 4W4TA 5KX5F 3BB3A 3QU5A 1KE2A 4J91A 2QR5A 2ZYIA 1DP4A 1LRKA 2W4MA 2YBEA 1KNXA 1TEHA 2BBWA 3LM8A 2C5LA 4HQ6A 4D74A 5C52B 3GC6A 4IIJF 5BN4A 1KARA 4QFMA 2G8LA 3KKZA 2MCFA 3Q3IA 3KV3O 4B3ME 3EMBA 2JD1A 2GWRA 2Z6VA 1Q3TA 1PJLA 3CRNA 4YP0A 3WXBA 4C6TA 1KDPA 1E8NA 4P52A 1E79A 2QMOA 1E59A 2QRKA 3CYFA 4OV6B 4M0UA 4NU8X 4DCVA 1YQQA 4ZVUA 3U16A 4QGSA 1CK4A 1B3BA 1TRKA 2J67A 2Z4RA 1ZL0A 2VWPA 5K3DA 3PSAA 3PFCA 1XMQB 2FFJA 3B53X 2XWPA 1JGTA 4BP1A 2VYNA 1XMOE 1CDEA 1NBME 1NM5A 4HDAA 4XVRA 4RF2A 3I2YX 5D84A 1Q83A 2QSJA 3IP1A 3QX9A 3ZN2A 5C8DA 1ADGA 3TBHA 5HW0A 2HFUA 1NF2A 3EZ6A 2LNDA 4JLJA 1XMSA 5COBA 3TBKA 5BOSA 3OP1A 2Y4OA 1PWYE 2PRIA 4PGMA 1UWCA 2BW0A 2GD1O 2IY8A 3QMMA 4H7HA 4RE6A 2P6UA 2Q2NA 1ZCFA 2OBFA 3QUAA 1K97A 5FT9A 1T43A 2QHXA 2VN8A 3M9LA 1L5HB 4GPEA 3Q3HA 2FAXA 2HNAA 2EQAA 1RXEA 2OXFA 1FYDA 1GD1O 1T1SA 3E8SA 3S4YA 2B61A 3K3PA 1P77A 2JIRA 1ORDA 4OHKA 4MEAA 2F3TA 3OKCA 1Z56C 2W00A 3R3YA 3H8VA 4D56A 2R87A 3ACBA 4EWLA 1KQNA 5BO5A 1KH2A 4EI9A 4M8KA 2HMTA 3PKJA 3HXTA 3KLPX 4JCCA 4K1LA 3T1HI 5FOQA 1DARA 2O2CA 2Y3IA 3SVTA 2CXUA 2PMEA 2GBIA 2HMAA 1XRJA 5FOUA 1O6CA 1AX9A 1LI5A 2ACKA 1ULHA 4KBFA 4BQQA 1Z4JA 4WUTA 3STTA 3LNTA 3P4YA 2PZEA 2TYSB 1W9HA 4MVJH 1YDWA 1J00A 2Z09A 1GQFA 3S7TA 1QHIA 2OVFA 3JPYA 1S8AA 5BY2A 5LQCA 2ZQZA 1PR3A 3WQQA 4RIFA 3IILA 3N1UA 2W6JD 1T9CA 2ZT6A 4KI0A 1YI8A 1KVRA 1XQ9A 3AJ8A 3OKPA 4C1BA 4YT8A 3GFRA 4C0LA 5F7JA 1TQDA 3EZ9A 1OGIA 3GAMA 5EQJB 5L45A 2YY6A 4D3FA 3TLJA 3V5RA 3AYZB 4IQ0A 4DLTA 5ITZB 3G0CA 2V1XA 5DNUA 4YLEA 4BN4A 1IUKA 1FL9A 4RGYA 4LDQA 1JLLA 4YP7A 1O87A 2Q0XA 3A32A 2YYYA 3I09A 4HXGA 4J0GA 1M6NA 3F1LA 4G0OA 2JD0A 4NWIA 4OL0A 5LQNA 3F49S 3DDWA 2VYVA 2N0SA 3PHIA 1V8PA 4TXJA 1JFVA 2ABWA 3D1VA 3D59A 3TZHA 1SRQA 1U1GA 4R1MA 1NYRA 3CUEF 1KEKA 2V7BA 4MQ6A 4WQMA 1M1ZA 1GQRA 2ILVA 4Z54A 4FT2A 4X95A 2Q7DA 2ZG6A 4P8RA 4A03A 1BX3A 2G08A 4ONEA 3LP6A 3SC6A 1UPXA 2X40A 3WK8A 2A6PA 3TX6A 3BRSA 4HGYA 3GUVA 1KFEB 5JNTA 5K36F 3OZAA 1H2RS 2WE7A 4FD2A 4IY1A 4KXMA 2X5JO 4DPUA 2W42A 2GSDA 3GBSA 4IHKA 2AC4A 4L27A 1IY8A 1KF0A 4NBVA 1VLZA 2A57A 5AM0A 3SIWA 4W5RA 1BMFD 1UBKS 4IIFA 2LW7A 3FNEA 1UC5B 4ENWA 2UDPA 1DLIA 3WKEA 3GDHA 5I7EA 2B7BA 4Q00A 3NKLA 3I32A 1B0PA 3R6TA 1D7AA 2I65A 4R1TA 3V5NA 1FB5A 1PIWA 4HXEB 4DMFA 4HWRA 5LZ9A 3COSA 2IUFA 3MYYA 5CR9A 3C4VA 2ID7A 3T5GA 1T9GR 5IEBA 2FWRA 2ZEJA 4UTZA 3AB3A 2ZUCA 3WQHA 4DSOA 4MS1B 4MHOA 2FWMX 1ONPA 4N3AA 3CQ9A 5LZ4A 1L3IA 2VF7A 2PBRA 5CGQB 4G37A 1UBGA 3WLHA 1MIHA 3HMQA 1LBHA 2R5FA 1EM8B 3HABA 1IN7A 1X7DA 3DD1A 3HCWA 4INAA 5D86A 3ZVLA 1CY2A 4BZPA 5JDCA 4XARA 4JI1B 3IEUA 2AT1A 1QHFA 4FUTA 1T4CA 1YJBA 1R0LA 2WF8A 4X94A 3A3YA 5JWRA 3MIZA 3E23A 3RHFA 3U60B 4IVPA 5BQFA 1PVDA 3K70C 4QWWA 3UT0A 1XVUA 2I67A 2AJDA 5B2FA 1J56A 5CD1A 3NDBB 1XHEA 2D8AA 1NLFA 1N0VC 4I2VA 1Q1NA 3EMVA 3PIRA 4UPEA 1N2HA 1DJQA 4DARA 4HRAA 4ENUA 1D4FA 1BX0A 3MWDB 3PEWA 3PD1A 3I34X 4MV9A 1FTWA 1Z8HA 1GJRA 3MM4A 4RKQA 4NU6A 1NATA 3N6XA 4A10A 1X94A 1NXWA 5AI8A 5DGDA 2JFXA 1E6CA 4ZOAA 1KP2A 2PGLA 3TK1A 2BELA 2GEVA 5M34A 2C3YA 2D2IA 1E20A 1S2IA 1UXIA 3IXLA 5IP5A 1SR8A 3HDVA 4KI7A 3ELYA 1PX2A 2A5JA 1WX1A 3DNFA 5IAGA 5JCOA 4LFBI 3O4JA 2BHTA 2FFAA 1CHDA 4NMLA 3L7LA 4UDNA 3GEEA 3REQB 4HNVA 2CXPA 1H4SA 1Q1ZA 3E3NA 3Q40A 4D8UA 3ZKDA 1QYIA 1BROA 1BSVA 2JJMA 4N40A 3GEHA 2UXCB 3FGOA 4CR8A 1GNTA 2CDNA 2OCBA 3H4IA 2C0PA 2XEDA 1BMQA 1LC0A 4G1CA 2REQA 2CL5A 2NXEA 4GOLD 1RXWA 4RNDB 1VG1A 1URPA 4GYKA 3EWSA 2DWUA 2YFHA 4UU8A 4EG6A 1JHYA 2XDAA 4OMUA 4MSUA 5IWAE 4HQKA 5J2UA 1H7SA 2BFEB 1C7EA 5A3RA 2ZIUB 4RK1A 4GR5A 2KJQA 4MW1A 3IEMA 2GJKA 4NDAA 2WNRA 1CEQA 2EBWA 2Z4TA 3AM4A 3JZFA 1OLSB 2IODA 4KZKA 4B6OA 1WCIB 1VLQA 2R4TA 3DB1A 2RI6A 1QYWA 1Q21A 2GPYA 1CB0A 1VCOA 1X9IA 2OSVA 3C4QA 3JAKB 3MS4A 4QTXA 1GRRA 1KJNA 5ER6A 3ANYB 5FTWA 5TR9A 5E8RA 1QG6A 1SBHA 2ZPUA 4RQUA 1V5GA 3B8HA 3PHLA 1NY6A 3UF0A 3WHKA 1NDQA 4M0FA 3U5TA 4TQGA 2PSSA 4ENRA 2IPMA 3E48A 1PHPA 3GJ4A 1JVNA 2UZAA 2VZ9A 4IF6A 2B1RA 9ATCA 4LF7I 4G8CA 4MB6A 1I3KA 1OAOA 3LIIA 2AC2A 4PANA 4YTEA 5BR4A 1OWNA 2IGTA 3CEAA 3WS7A 2ZJBA 5BW5A 4D9NA 4XGIA 5JTUA 4YEDA 3AHGA 3E35A 4LRQA 3RVRA 1CNMA 1UBHS 4FW8A 4N7JA 1VL2A 1XXHE 4Y98A 4ZCLA 4A5OA 2UUBB 1U5BB 3F5MA 3N53A 5AW6A 3FGZA 2XCRB 2ZM6E 1H72C 1W5SA 2RHTA 3QJ5A 4J8PA 3IDSA 4LKRA 3G7SA 1EGHA 4UUAA 1DCTA 3L4KA 1D2GA 1BH6A 1BJKA 1IZYA 4K05A 4LZNA 1BXGB 3R1IA 3SJAA 4LF5I 1P0QA 1XFDA 4HS9A 5AXAA 3NYQA 3LUDA 4N4AA 1IVNA 4FWDA 4LNHA 4P4SB 4DLVA 2D2FA 3WGIA 1N7GA 1TM3E 2B92A 2YX1A 1NI5A 3MC1A 3OE7D 1J5XA 3RAPR 3H2BA 4O1MA 3WTCA 1VECA 2BHNA 3PUKA 1P1IA 4F4DA 1P75A 1RWMA 2IGBA 2JGMA 5ES4B 3AC0A 3SN6A 4ES6A 4AIDA 1V8BA 1DAPA 4G65A 3D3EA 4CNQA 1L4MA 4I3FA 4MXDA 4DIEA 2PBZA 4PU9A 1RRGA 5CFQA 1DELA 1TM1E 3R77A 1XG5A 5T8KA 1LI4A 1FSGA 1G19A 1A82A 3QF4A 1S4EA 2ATXA 4YS6A 1GPLA 1X39A 3LI2A 4ND8B 4ZGWA 3BYZA 4B3RB 1UC8A 2M9MA 3WSWA 1A9OA 3F0NA 1W35A 2B8EA 2GESA 2H1SA 2OM6A 3NTRA 2UVPB 1OX4A 4NCNA 3TOSA 4D26A 3TG8A 1J5PA 3D4OA 3MTEA 4OHBA 1V48A 4XLZA 3W2EA 2OCGA 4DQVA 1RWNA 5JBNA 5DTQA 3PLRA 3ORSA 4N0EA 1KEUA 1M1YB 3EXEA 3GLKA 3H1PA 5GVRA 2MYPA 2VRBA 1K1EA 1CPYA 4BV8A 4D9BA 1RXCA 2AMLA 2INGX 1KSJA 5T67A 3UZUA 2NZ2A 5K01A 5H80A 5ITZA 1J1IA 3FJOA 4NXNI 2P5TB 2NU6A 3DZHA 4IJUA 4X1IB 3V4FA 2ZYGA 2ZE5A 1UWVA 2E6UX 3N5KA 3DMTC 2P11A 1U6KA 1RWVA 3NRCA 1JMKC 3SIRA 1Z06A 2AJCA 1JAIA 2NU8A 3NBMA 4BWVA 3A37A 1HEIA 4HDCA 3TRJA 4GOKA 1WVIA 4WNAA 5EZ5A 3M4JA 2W6IA 2CMGA 4PE5B 3EBPA 3J7AG 2OWDA 2H54A 3SY8A 4L85A 2VXBA 4E4YA 5I7FA 4ESVA 4UBNA 4V0LA 5BN5B 3AR3A 1O5OA 1S96A 3U3RA 2AN4A 4MKFA 4ZMRA 4K2AA 2WIGA 4I9FA 3JAWA 3E70C 4O4HB 3RKSA 5FNVB 1KOGA 5ELLA 4HGOA 3OICA 1P0IA 4B7XA 1QHGA 1SCBA 3LAWA 1WUHS 1LLQA 5J2UF 1RJEA 4RELA 1QRUA 2WPNA 2HBRA 5LLTA 5LOVB 2E4AA 1IIRA 2YW2A 4KO3S 3VNVA 4TZ6A 4YB8A 4JY7A 5CA1F 1DOZA 4M7WA 5AK3A 1I5RA 3L9WA 4GX1A 1C30B 1RKBA 1ZR2A 1GL3A 2DQZA 2NZYA 3M1IA 2PQ2A 4MI6A 3OLYA 4PSKA 4X00A 5CM2Z 1X2EA 2ZYWX 3CPSA 1UP7A 4PZDA 4YJHA 3PLNA 2OHGA 1U99A 3WADA 1ZW1A 1L1QA 2YFYA 3LC0A 5IEJA 4DV6B 1M10A 1SIUA 3DHYA 4KQMA 2BM9A 4RPKA 1L7DA 1G5QA 4OXNA 5FOWA 1JKJB 5ELWA 1AF7A 1PV2A 1JP7A 5CXSA 1TVEA 3AL3A 3ZR4B 5HX7A 5KHOC 3EYAA 5DF1A 2BEUA 1X9HA 3MFQA 4OIFA 5DZSA 1Z6ZA 4M1OA 4L5CA 3BIFA 3BFXA 3JQ7B 3VV2A 1C80A 3UHOA 5BMVA 3P45A 1C7ZA 2YUIA 2H1CA 1EVIA 1Z22A 2I2FA 4OQYA 2HK8A 3N7TA 4HYEA 1W85A 9MHTA 4M1YA 3VR5A 5FO1A 2QSYA 1M72A 4M88A 3RE1A 2EZ9A 3MHTA 3REQA 5HKOA 2FRVA 2GYWA 4QUGA 5K6AC 3F47A 3H97A 1M5TA 1OX6A 4KWHA 3NV9A 1XVTA 4L22A 2HXSA 5E3JA 1OYSA 1JQJC 3WY9A 4JITA 2EJCA 2XWJI 1G5FA 4IX1A 4I3GA 4HN9A 1B15A 5EGNA 3H9UA 3HCNA 2UXBI 1EFVB 4WKPA 3RIGA 4BOYA 4MQEB 1WKBA 1KZ9A 3SAJA 2ZYHA 3A70A 3MMPA 4FC6A 1JBQA 2CMDA 2V55B 3KDAA 3L1KA 4FN5A 1LJUA 1RQXA 4YCJA 5TEWA 3RJ5A 1OE0A 1SJ9A 4HG2A 4HXYA 4JQCA 4ND4A 1MPTA 5EE1A 2BFEA 5K8IA 3DZCA 3E18A 4I4TA 2H9IA 3AKEA 2W6QA 1VJCA 2A0FA 4H0CA 4MLPA 2J09A 4M1KA 3EHDA 4KDFA 3N2EA 3T1VA 4PZEA 4OSPA 3T7CA 4GP7A 4HMQA 2IOPA 4BAGA 1VA5A 4NYIQ 2COEA 3GFVA 1D4OA 1RM4A 1CERA 4HLNA 5F5LA 5CCEA 3IVCA 3L07A 1VDMA 1E2FA 3ZVMA 4NENB 3PB3A 3EEFA 4KXQA 1YU9A 4RQBA 5L8VA 2F55A 4R4JA 3RDPA 1E0JA 3EVEA 4NMHA 1X1TA 1IBLI 1DAIA 4RJ2A 1CEYA 4R1NA 3RASA 2GHIA 3WJ2A 1MAVA 1XA0A 1ZNQO 4BVGA 4L5YA 4UXIA 2VZLA 2ZB4A 1T35A 1PS9A 3TX2A 2OBXA 2ZVDA 3JU3A 3WGVA 1IG3A 1SBNE 4LOIA 2AEMA 4NBTA 4TKLA 4YAWA 1FWKA 1S6YA 4CCAA 4ZYXA 3OA0A 3NW9A 5D5QA 1YBVA 4JIMA 2GF9A 1IDOA 2BDEA 2PWYA 3V6LA 3GUCA 1O8CA 3E1GA 3TIGA 3WJAA 3PXEA 4YLGA 3GLIE 4Q9NA 3L1JA 1B00A 1KZYC 1POWA 1J8FA 1ZH0A 4GPTA 5F1YA 2FRDA 4IL5A 4NK5A 2OXIA 1JEEA 2I9KA 3GJ8A 2WABA 3G1WA 5JCOC 1JG6A 2B0JA 4TWJA 3HKEA 5ESWA 3O8BA 1HLDA 2NVOA 2Y0EA 2AMVA 1C0PA 2WJGA 2ZS8A 4LTDA 2CD7A 4B76A 1P9OA 3DOFA 1YK1A 4ZTBA 2CUZA 1LFDB 3R3VA 5JC1A 3ZHRA 4JBIA 4ZC8A 3M6AA 1BEUB 3GRKA 2LP4Y 4CFSA 2WSBA 3HDTA 1IFXA 1OLUB 2VFAA 3GH3A 3KQPA 5IT9Q 5IDQA 3RRJA 2QZPA 4P33A 1W4AA 3VU9A 3T1OA 4XM1A 2J4FA 1USWA 2G5CA 3DW3X 3LLSA 2KLBA 1RFGE 3GLTA 4QGHA 1GL9B 1EHIA 4KIGA 3U4MA 4YCLA 2WTXA 2X9GA 4BRUA 1WZNA 4CIYA 4P3YA 1NXQA 3QEBZ 2XTJA 4CDNA 1D2EA 1JZSA 3PI7A 4FK8A 5EPEA 4AZSA 2FZCA 4YCBA 4HN2A 3U3ZA 1Z12A 4CLRB 1LS6A 3C3XA 3UJBA 2JLUA 1I7LA 3R2JA 4BEJA 4W6ZA 2ZRFA 3N2KA 4EJ6A 1YZQA 1ZN2A 2E21A 4XIIA 4JUDX 2AMFA 2FSVC 4I9NA 1NUTA 1OIWA 2XDQB 3A1CA 3TMKA 2C9OA 4TLMB 5EHQA 3U7IA 1CJCA 4LFBB 2OZKA 4E1AA 5IM4A 2C9CA 1D2RA 3ZU6A 3WHIA 1M7GA 1E7RA 1FFAA 1SK9A 4I5IA 3W9UA 1SUIA 1HOXA 1J39A 3JVEA 5KYVA 2PNFA 3W77A 2BTEA 1YAJA 4AROA 1UMDB 3OD5A 1JI0A 1SBZA 1N25A 1M34A 2DHCA 5FL3A 1W0JD 4PG5A 4S1WA 1UPFA 1E2QA 4YI5A 4Y2UA 5REQB 1DUVG 1V6SA 3WDKA 1W581 1L7VC 4FMDF 1T5DX 4DCGA 5JJKA 2RH9B 1G66A 3QWBA 4OREX 4UHKA 1JKIA 5DW3A 3TQTA 2OORC 3TLGA 3V4OA 3ZV7A 2VWGA 2W90A 5DSTA 1JLLB 3KQLA 5JSZB 3JQPA 1VMKA 2AA3A 1NBIA 1A2QA 2J87A 3QXGA 4L73A 5SY9A 3SZRA 3TE7A 3ZWNA 3UK6A 4D3ZA 4EB3A 2B8NA 2B8TA 3WZ2A 3T3NA 3BEDA 4YJKA 4Z7NB 2VBGA 1BVRA 5CP8A 1NC3A 1EAYA 2OY0A 5FTKA 5I9BA 3LWZA 2NQ8A 1SNYA 4U2DA 2ZPTX 4PGAA 4URWR 3ZGOA 4ANFA 4BJ5A 4WOJA 4CTJA 5AICA 4WJKB 1U7TA 2PUFA 2IYZA 1QZ3A 1XAJA 1QKIA 4MRAA 4FT4A 4PZ0A 3DPIA 4O33A 2X9LA 1JQKA 1K3FA 2FI1A 1MGOA 1RHKA 5AK4A 2IEDA 1ODKA 3I2FA 5GONF 2WQ6A 3AIOA 3FRIA 1XNRE 2AH5A 1T8YA 2R65A 3PQ4A 4QVKA 3DTVB 3L7ZB 2P78A 1YULA 4UD2A 2GAOA 5FFMA 3AKZA 2O54A 3CLKA 4KSCA 1V9SA 1ID8A 2OZEA 4XD7D 4AZ0B 3ASZA 2FQXA 3JQFA 2CJXA 4ZDIA 4XCQA 1ITZA 2OCAA 1TM2A 2C39B 1JEAA 2GN9A 4D4KA 2JAUA 1PWEA 2ZIWB 2DRIA 2X0NA 3FMGA 3OM0A 5M7EA 3UFXA 4ROTA 3VAZA 4EUKA 5C3MA 1DAKA 2LV8A 3AFMA 2PBLA 4R9SA 1ECLA 2IE8A 1Y7PA 3BDVA 3Q1KA 1EJ6A 4MZDA 5A06A 5L9AA 3KWLA 4OHVA 2VVTA 3GLFE 2GHRA 3MW8A 2OQVA 4NY1A 3FCEA 3JASB 3KLBA 2P75A 2YC2C 3LO8A 4OH1A 3ZNQA 1WDTA 2YCLA 3ZTWA 4BO2A 2QENA 2ZDGA 4ZT2A 3X1JA 4BP9A 5CB4F 1SC3A 4Y6GB 1VKJA 3KDSE 1NZFA 4GQAA 3TRHA 5FBVB 4LPFA 4DAOA 5L7TA 1XNQB 5G0VA 3BXFA 3K9WA 4OHPA 2GBPA 4USMA 2QUAA 3MWEB 2AFRA 4OY3A 4RXMA 3U2QA 3D9QX 3ZE6A 4X65I 1QHHB 3EGWA 3TI9A 2GEFA 4TVBA 4FYVA 2O8FB 5EPOA 1N32E 3QHQA 3QJGA 4KLNA 2AG6A 3FX2A 5ALLA 1Y8AA 2JEOA 2Q3DA 5ITSA 4R6WA 4R1LA 3D6VA 1W85B 3Q87B 4E13A 4Q37A 1L5ZA 3ZWYA 3JY6A 3Q9UA 4EMDA 4Y6RA 3UPTA 1G7RA 4PS0A 3QKSA 1XVVA 4TL6A 4GLJA 2DEUA 2QG4A 2I1WA 1KDVA 3P9IA 4DC9A 2QI9F 2X1LA 2YXBA 2AYYA 5A62A 4HH1A 2GZSA 4G4IA 4GE0A 1ZGGA 4M86A 1QV6A 3WIEA 1BIFA 4YCNA 3PQFA 2B4RO 4ZP1A 2BFWA 3ILVA 4WKNA 3SM3A 5KX5A 2QRJA 2NO6A 1E32A 3G68A 4WN9B 4YMTA 5DLQC 1ZDMA 4DCUA 5CDUA 2JJ1D 2CVPA 4TLBA 1N33I 1Z0DA 3NIBA 3O7WA 4CM7A 2Q4BA 2WAXA 4P4LA 1SG0A 3GJQA 3TZBA 1WLSA 1GGKA 3H16A 5CYGA 1K4MA 1QXSA 2JFUA 1DEAA 1VE3A 3K16A 4MUYA 4NFLA 1J1ZA 3PITA 4HZUA 1R64A 2ZKLA 2Z9BA 5ECDA 2JRCA 3E2MA 2QA5A 4ZGBA 1Q2XA 3PDWA 4QNNA 3W5UA 4E32A 4DV2B 2IJGX 4NHEA 3GDFA 3SC2B 3IPCA 2W98A 3ETHA 1YS6A 3CW2A 2HK3A 1MEEA 3ZXSA 4Q7QA 5JECA 5FL7A 1VLJA 2PO7A 1OOEA 1QB8A 4G5YA 4E30A 4PAMA 4R6XA 2NN6E 1EUCA 4Y30A 5ETJA 2YHIB 1OXMA 2ZUWA 2UVQA 1QYRA 3BTOA 3OMWA 4KR0A 4R40A 1FW6A 1U63A 3VO8A 4DCTA 3PF9A 5LYJB 2AJ4A 4OM7A 4A0RA 3H7AA 1UEIA 1J06A 3VPHA 3I62A 5IC4A 3GEIA 1QK3A 2PWAA 3NTUA 3WSTA 4M38A 3WLPA 1GCOA 1NBHA 4HQNA 4WTOA 3REFA 2PFSA 1XRNA 3KVVA 4ND2A 5KPDA 1AQIA 2F17A 5JZVA 4U7JA 4JAVC 4BZXA 4IP0A 4MW2A 5ALOA 1ZP6A 3RSQA 2GZAA 2GZDA 2JA2A 4IS2A 1KFBB 2EKPA 3KUCA 4J1NA 4JQOA 3UK1A 2R0QC 1RZRA 3O84A 5HJ5A 5JHHB 2ETXA 5JSHA 1G8JA 3ZHQA 2O1EA 4G63A 1LBEA 1V7QA 2Y1LA 4HDRA 3EZFA 4EI7A 2VBIA 1SUEA 4Y9DA 3MGGA 2PJRA 1R4MB 3FHLA 1UDNA 2MINA 2P30A 1RYDA 2I6FA 4OATA 3FPCA 3HVUA 4LBZA 3MWDA 1Y6QA 2I99A 1LI7A 2OV3A 1L4UA 4RPCA 3ORRA 4B3FX 3DLHA 2XQJA 2FJ0A 3GGCA 3LHDA 4IGAA 1YKFA 1RRCA 1WO8A 1OWMA 2LWIA 3U3XA 4EOGA 1VHLA 3MJSA 5A4FS 2FLWA 2BWJA 1AKRA 3QFSA 4U2BA 4C6TB 1YUMA 1X7ZA 1DU4A 4KJXA 1QHNA 4N01A 4MWTA 1VI5A 3VHXB 1TB4A 2R48A 2ZB3A 3MRSA 5JMOA 2YZKA 3F5FA 3RW9A 2FX3A 5K36A 1F14A 1Z13A 2D54A 6YASA 2QRZA 3TR5A 1WU8A 1VJGA 1DKUA 4TYNA 1TZJA 3P20A 5LMUE 1SKYB 3CKYA 2JFHA 3D31A 4TWZA 1A3CA 1JHQA 1IRIA 1JEQB 1PCXA 1PZNA 1U02A 4IMIB 5K09A 3LX5A 3SJCA 1N2CB 1R6DA 3GCZA 5CDHA 2WLTA 3EB9A 3RR2A 4XR4A 5ILGA 3R9XA 3MS2A 4MVJD 3TG2A 4QC2A 4C76A 4UZEA 1XPOA 1FYWA 2E9SA 2RHGB 4QU9A 1JLRA 1LLUA 3PEUA 4EARA 3DPSA 1UFKA 1T0JB 3HKCB 4LZJA 4BNUA 2B8JA 2BFCA 2YINC 4NG4A 5I4CA 3M7ND 3L8CA 3ICEA 3G5TA 4GP6A 4MQ4A 5JEAF 2G4LA 4DA6A 3TZEA 3NBQA 5C1IA 1WXQA 1NBWB 1QX3A 3KR9A 2RCYA 3OCXA 1YI1A 2VDOB 5DROA 1QSGA 3IUYA 1ZK2A 3KRTA 3FM9A 4O4LF 5TJHA 2ZBDA 3DJFA 3TSAA 5F7OA 2VH1A 2NNLD 3AW8A 2MJLA 4CJXA 2H7VA 1I6KA 3KFLA 1PT7A 3KYDA 2F7SA 1E7MA 2CHEA 4EMBA 1QQ5A 1N8SA 1JR2A 5D3ZA 3GJ7A 1Z88A 3LBFA 5DLEA 1AM4D 1RW4A 3NATA 2BZ0A 2FB9A 1C1XA 4C21A 2XTMA 4OHYA 1V6AA 4PPNA 2PD6A 1JXQA 2GA8A 3QLUA 4TLDA 2ZRBA 2R47A 5CLGA 1P73A 4KXVA 1XLUA 4F0JA 4IKPA 4O4IF 1QIHA 2VPIA 5JEAE 1ZQ1A 2P0YA 1GKYA 3DDCA 3HHPA