1HK7A

Middle domain of hsp90
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
248
Chain Sequence
b'TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK PROTEIN HSP82
publication title Structural and Functional Analysis of the Middle Segment of Hsp90. Implications for ATP Hydrolysis and Client Protein and Cochaperone Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 75
structure length 248
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hk7A01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hk7A02
2O1TA 1HK7A 2CGEA 1Y4UA 2O1VA 2GQ0A 2IOPA 3Q6NA 2O1UA 2CG9A 2O1WA 3Q6MA 1Y6ZA 2IOQA 3HJCA 5FWKA 3PRYA 1USUA 1Y4SA 1USVA
chains in the Genus database with same CATH superfamily
1FFBA 4LRXA 5DN9A 4ZAYA 1OIVA 1UFKA 3OQJA 2MSCB 2W6ZA 3LUGA 4PLWA 4QIHA 1XRNA 521PA 4KTVE 5J5CA 3CF6R 4KRXA 5CJPA 3TTWA 4NWIA 3UMVA 2J4FA 2QW8A 1N92A 2NUBA 1J9GA 3VKWA 1VDMA 3JQQA 3G9TA 4JC0A 3H0KA 4FBMA 1NYQA 3AERB 4RK1A 3P9QA 3TSCA 1BOOA 5KTSA 3PS2A 1WZ2A 4JLJA 1IHXA 1XQWA 1WIWA 4I1YA 3PDHA 4HF7A 4HTAA 4KP7A 4PZCA 3HCNA 5DEIA 2P0AA 3E5NA 3S7TA 2QF7A 4F5YA 2HGSA 4C4YA 5IRCD 1VMKA 1S16A 2BR4A 3CE9A 1XU7A 2KQUA 3ENZA 1W19A 3K09C 2C5AA 1NAIA 3KJHA 4R01A 3LAWA 1USWA 2PL5A 1DPFA 2B8TA 2JKYA 1YTLA 3BORA 4ZEMA 1IVYA 3OEHD 3RTGA 4WZAE 2KHZA 2QAIA 3Q7IA 3SDBA 2X6RA 2EIHA 3DFKA 5EWJA 3JZIA 3KL4A 1MB3A 4HN9A 3PNMA 4HSGA 3CUUA 1C81A 2O8CA 3T4UA 3VR1A 4OKIA 3H6HA 4RTNA 3M3HA 4FB5A 3DVAB 1E2PA 1LFAA 1NSTA 3A1NA 3GNLA 3Q9LA 5IJ9B 2PQ6A 4NCKA 2FZVA 3FDZA 1HNWE 1KJJA 1J7JA 4S35A 2DX7A 4H6PA 1QIKA 4DFDA 3SWWA 1N2IA 1PDVA 4CIYA 4DXHA 5KBYA 2UVPA 3AFOA 4I4CA 4MUBA 5JYEA 2GZMA 2EFYA 4HX5A 2V3WA 4I46A 3ORQA 4BLUA 3KYIB 1O87A 4MVCA 4IUBS 3UGQA 4KFSA 5B3AA 1Z0TA 2OO5A 5A4JA 5EJMA 3OD1A 1NHHA 1B0PA 1JH8A 1ISPA 2KE5A 2WYOA 4J7UA 1CDDA 1A5AB 1QR2A 1W4LA 2PMBA 1GKYA 3UHAA 4EY4A 2IS1A 2YN0A 1P77A 1VJGA 1OHHD 1YZFA 1KZ9A 4FFPA 4ZEXA 4EAQA 5LFAA 3WBJA 4DW8A 1YDMA 4O4HB 1AX9A 4ER3A 1VB3A 5LMUI 4F2PA 1KFJB 3A9CA 1R3UA 3T7SA 3P0EA 1I3NA 3H4IA 5AHRA 1HGXA 1I2MA 5IM4F 2NAFA 3EMBA 4IUCS 5FA6A 3CF4G 3EDRA 2YHIA 1CZHA 4MKIA 2I7CA 2EFHB 3B38A 3IP8A 4OX9I 1L7QA 2AD5A 1MAVA 3DAPA 3OZDA 2HFSA 1CVIA 1L5NA 2RE8A 2PUEA 4IJWA 1QBKC 1ZVVA 1P1CA 3LGSA 1O03A 3P32A 2IYQA 1JEQB 5I7AA 1NJ5A 3O2SB 1Z07A 4DQDA 5I7FA 4M1OA 2HT6A 4I4IA 4R9VA 3FKSD 3F5FA 4GGOA 3C0KA 4PXSA 3V8PA 3BWYA 4KVAA 2D7JA 4XW2A 4C2UA 1XAGA 2VT6A 2XUZA 2QYSA 3OX2A 1CQXA 4MCAA 1WUKS 4K9KA 5ITSA 2PVPA 1TUBB 1SHTX 2KBFA 1FMLA 2J5RA 3P9CA 5IT0A 1NAHA 4EZEA 2C2HA 1GTVA 3ITDA 1Y4ZA 2VWHA 1S5PA 3Q5EA 4WASA 2UUAI 1K6JA 5HYVA 1X7YB 3UH0A 5CA1B 2MSLA 1U2DA 2XKAA 1OH6A 2WYIA 1JEAA 3LQFA 3QA3E 1JSLA 1XEFA 3LKVA 3WQHA 1O9BA 1ONPA 2FI1A 4YJFA 1WM1A 4FGZA 1G38A 1M8GA 4ND2A 4X8HA 2JBHA 4LQ4A 5FHRA 2Q0SA 3EB9A 4GGMX 1WMEA 4LXIA 4N5LA 1ZNYA 4O4HA 5DYGA 1E2MA 3ZWWA 3FOEC 1ABEA 1I7PA 1SUEA 2ZWPA 5BMOA 1ZJZA 4FWIB 3LA6A 4NNOA 3HH8A 4QPZA 2JD0A 3AKDA 2R8XA 3JSAA 5JNLA 2FJUA 4FEAA 3FETA 1ELOA 4Y9DA 3SDZA 4BAUA 2F17A 1GD1O 2J3DA 1AT1A 3QVMA 2WSBA 2GGSA 1VLZA 1B8OA 4IG9A 2LVBA 3QNWA 4G8JA 4Q47A 4ROSA 2QRNA 3DEYX 3K8QA 4O3FA 4ZVNA 5K9ZA 2XDWA 3ODGA 3SC3A 4EFDA 3U61B 2V9PA 5HF5A 4DR5I 1FJ2A 1NXOA 1SWVA 3DULA 4IUYA 3PLNA 4DLAA 4NU6A 1EE2A 2ERYA 4I4LA 3S2ZA 2D7CA 4J9VA 5CYFA 5JH7A 1RXEA 3FMGA 1C80A 1OPRA 1OTXA 2ZYUX 1KI2A 3IAM6 5K0SA 4P5DA 5DLPA 3T5CA 4FMCF 4E14A 1NN3A 3LE8A 1Z3IX 1K9SA 1D1SA 1M8JA 1NP7A 1TUBA 1U8FO 4JLUA 4PG5A 5E7JA 3S28A 4AJ4A 5EMMA 3RF6A 4FT4A 4C07A 4PSCA 1LVGA 2IPAB 2BA0D 4YJ2A 3CV3A 2VQEB 1XUOA 2H7YA 1Z6YA 1TM5E 3BXZA 1LBQA 4R84A 5FLKA 1RLIA 3F1LA 1CRZA 2ONYA 4REOA 4L4XA 3RR2A 4AS3A 3EGIA 4XIJA 3GDFA 1ORWA 5C7YA 5HKLA 1FA9A 3O94A 4L4YA 2ZG6A 3GLFB 2CV0A 3ZWAA 1NXQA 4URFA 1CZUA 3R3XA 1UM8A 3VTAA 1JHZA 1MO5A 2QZJA 1TZKA 2XMDA 4CV3A 3C70A 3WWPA 3HB0A 3PV0A 2ZJ2A 2RHDA 2WW8A 2WR8A 2WKWA 3H9GA 4QJ5A 2MYUA 2VDJA 3BHIA 2V6FA 4TMWA 3UHPA 3C4JA 3O75A 4MQLA 4RTMA 3FFAA 1P5JA 3H6KA 3TINA 1Y6QA 4PRVA 1Q84A 3MFYA 2JRCA 1Z74A 2V74B 1H22A 3W06A 3H19A 3OF3A 4OXIA 4MR8B 4GKJI 4LNUB 1R66A 1WZEA 3H3XA 3IO3A 4M9QA 3OE4A 1F0YA 1K8QA 2ATCA 3VAZA 5U9CA 4GMFA 3LBYA 4KGDA 1VHJA 4Q12A 4G89A 4QPJC 4LYYA 1WPGA 2IOYA 2YZMA 2GK7A 3NHPA 3OZIA 3HCFA 5FI5A 3I1IA 4G1CA 2FF5A 3SXPA 1OYSA 4BQRA 2H1RA 3N2YA 2HI0A 2NXEA 2PBZA 4LCJA 1PP4A 4WOJA 3ZBPA 1HYBA 2XY4A 3C3KA 3R0QA 4IINA 1SZDA 3AVVA 4R0NA 3CF0A 1R8XA 1QAOA 3JQRA 4FHCA 3AKEA 4K9SA 4FOTA 2XDAA 3ZQUA 2OV3A 2JLYA 1Z59A 1BVHA 4HX9A 1F7UA 5CBPA 1DAIA 1EDDA 4A10A 1UZLA 1NW6A 2FZ4A 3OIUA 4LDNA 1IIRA 4BVHA 3PJEA 5A4MS 4MIYA 1U8YA 2QNRA 3EIQA 2BOVA 3K0AA 3K2EA 4OA5A 3ZDYB 4DXAA 1JJVA 3EXAA 3TXAA 1TL7C 1BHSA 1XRJA 3HE3A 2YVLA 2Q5HA 1G3UA 1I7LA 1XC7A 2C31A 3PITA 4M89A 2JF0A 3RB8A 3VJMA 4ABYA 4F5WA 4H0FA 2ZBVA 4N5DA 1KRWA 4JASB 4FE3A 1B3BA 5JDIA 4J3DA 2I67A 5AXCA 2RK6A 1EB8A 4I9GA 2GRAA 5BVGA 3AR3A 4OX9Y 4N03A 2WLSA 1M2OB 2VRBA 7YASA 1OBHA 1XKLA 2O07A 4ALMA 3H9UA 3AR5A 5ICFA 4EG1A 1C7EA 3SQXA 1WD7A 3IURA 2FXIA 2PT5A 2NN6E 1THGA 4MR8A 2ZPAA 3NBYC 3Q9UA 3MPUA 4AKTA 2PEYA 3ZCPA 2W48A 4J76A 5KJ1A 1FNMA 4D99A 3HKEA 4W5OA 5CM8B 1SU6A 4RNCA 5LQRA 4QWMA 2NQ2C 1G63A 1SXGA 3MLEA 3ER6A 3PUWA 3LUHA 3PQ8A 4NP6A 1RYHA 3JYOA 2QMUA 2GYWA 4O02B 2JIMA 3QUQA 3VGJA 3X1ZA 3M1LA 1N33E 1BWRA 1YR3A 2AOUB 2ZT8A 4PSAA 3WISA 4B8YA 1YS6A 1F51E 1QRDA 5JNWA 4QEKA 2ZSFA 4LPFA 3WFZA 5K2MA 4LZJA 2VXYA 4E5NA 4O2LA 4BFZA 1KQPA 2P30A 3AR7A 1DDIA 3KSUA 3PC6A 3PR1A 2VYVA 5AVZA 3OU7A 1IUNA 1GYQA 2VHCA 2W2KB 4Q1AA 4RPLA 4X7MA 5FUXA 2Z5CB 2OE2A 4INAA 2IPLA 3V9PA 1XMQI 4BNHA 1O5TA 4JC4A 4PZPA 4OP2A 4M0CA 3ZTTA 4TKVB 1NDHA 2XB2A 3TQFA 4WZBB 4UOZA 1WJGA 3MQ4A 3U81A 2W2OA 5C5DA 3HKDB 1EKXA 3UGJA 1VLHA 2DEIA 4NCNA 4ND8A 1L4KA 1EAMA 1FFHA 3U1BA 3ILSA 3FRIA 3LW8A 3ZJUA 1LXCA 3K4PA 3QOYA 5AVRA 1BXKA 3U7IA 3VVBA 3AI3A 3PEWA 2HRDA 1U2PA 3HJCA 2E5LB 4JI0B 5LLSA 3W4IA 3RUIA 3EVBA 1DIAA 2XZLA 2BMEA 2E5FA 2PNZA 5JD6A 3SC4A 4P54A 1Y4DE 1HL7A 4CF7A 5IT4A 4CNBA 1BIFA 1R50A 5EZYB 3S2YA 4IJUA 5CG2A 5KINB 2G5GX 2Y3IA 4HI0E 4N49A 5JCOC 2PO5A 4BA2A 1GGEA 2YH2A 4AJEA 2JEZA 3W5IA 3WL4A 2GBPA 3WL5A 2NTJA 4R31A 3JAMA 3U6BA 4LFAB 4J3JA 4PIMA 3NHZA 2Z1NA 4H6XA 5YASA 1EX9A 1TJ5A 1XHKA 1XVUA 1E3QA 1THMA 1YR6A 3H99A 2AOUA 5DSZA 1IEXA 4UFNA 4KYIB 5TJHA 5GOZA 3O8RA 1IYZA 4KOEC 3HJUA 3MJRA 1EVKA 3DE1X 3A4NA 4XM2A 3ZKAA 4EY6A 1KNXA 3PYEA 1RR6A 4IDOA 4ZCPA 2WFMA 5SY9A 1G8MA 3FI9A 3HU3A 4B3JA 3DG9A 3T38A 3O2QB 4HNSA 2NXCA 4RHEA 4OXQA 3RHZA 8ADHA 5JHHB 2C7PA 2I55A 2CK3A 5B7PA 2G36A 3UN1A 2J30A 3WR5A 4TMYA 4M9RA 3ZE7A 1XU4A 1E6EA 1SU4A 1NWHA 3F7TA 4WZBA 1E2BA 1UM9A 4U3JA 2X1VA 2EXXA 5AI4A 2QLJA 3HKDA 2JHPA 2Q4TA 3LP6A 5TJ9A 2JFVA 4OFWA 3SQNA 5EJ8A 1ENOA 3REFA 1SVIA 3PHJA 5TQ2A 3VPDA 4K0KB 5EFZA 4JCOA 3ZHOA 3BIOA 1QGAA 2DM6A 2UUCI 5DBHX 2O8BB 1ZIOA 2ZJBA 3ONEA 1UANA 4PYNA 4B3XA 5IXJA 4UQLA 1YJCA 3VISA 2R0QC 2IDJA 1PSDA 3AEQB 4FD2A 1ZWKA 1S3FA 2VPXA 2RH9B 3GLKA 4KGZA 2HO5A 4KLZA 3IIKA 2GDJA 1OREA 2VZ0A 3PGKA 2IEZA 4HYEA 4PZYA 3CZQA 4H08A 4KMSA 5AKYA 5CA0F 1A7AA 1EK0A 2HCRA 4NECA 5AVVA 2CE7A 1OSNA 1K06A 5JZSA 3EZLA 3HR8A 2BE7A 2EKQA 3G0CA 3MERA 2J6BA 4MUIA 5FB3A 4F91B 2VZLA 3HGMA 1JS1X 3OZCA 1FW6A 4AJ1A 4HNRA 3GC6A 1U9ZA 1ODKA 1Y9DA 4FHGA 3DDWA 4CXMA 3OLYA 4RA6A 4NE2A 1QYWA 1UPAA 1XO1A 5K3FB 1YB7A 1ZA2A 5TMBA 2WWIA 4GLFA 3R9WA 4OQDA 3IXLA 2ADOA 3CINA 3M8KA 1KVUA 3QH4A 3NTRA 4I5IA 3ZH9B 1I1OA 1JPJA 5LOVA 3B4TA 1GA6A 3MSCA 2AZXA 4KHPB 1REQB 3ZZNA 2YY6A 4L0CA 1MAAA 1FOEB 2ZB4A 2XMGA 3MJCA 1J23A 2D8AA 4NBWA 4YJHA 3G1TA 2RI1A 2VOEA 3OMWA 5JXWA 2RB4A 3ZHSA 4J49A 2P2SA 1ZVJA 1LSUA 2DBQA 1MTOA 1L7VC 2FEPA 4W8HA 3ZBTA 4E3WA 3D5EA 1NT4A 2NYRA 2P6MA 4OH1A 4RFVA 5A7GA 1VL6A 3TL2A 4YY3B 4UUQA 2FEWB 4UTPA 5JLAA 2IEGA 3NRBA 1M0SA 3LCMA 2BDEA 3R7DA 5K09A 4EUNA 1G8PA 3FPCA 5JALA 2EGUA 4MRRA 1ZN8A 2NN6D 2A5DA 2JEYA 3AEQA 3N8KA 4Q03A 3NTVA 1WMFA 1GRVA 1N4DA 1T10A 4P7AA 4EHAA 5KDOA 4BMCA 4G0YA 5DGTA 1GUDA 2F48A 3IMFA 1UDAA 2PYZA 1ZXNA 3L6CA 4MR9A 4FCTA 2QENA 1UPUA 1IXSB 1CVLA 1TCVA 5DGDA 4EF6A 5AVJA 4HXGA 2WM2A 3KJNA 3WOHA 2LD4A 2R6AA 1RJ9B 2KPOA 3QSYA 3DEIA 1Q11A 2JLBA 4HSEA 5ERGB 4XWAA 1DKMA 4ZVSA 1TCCA 2GLUA 2WZQA 3DW3X 4G9GA 1P44A 4XR9A 3Q6NA 5K3FA 4MAAA 5EHQA 4L28A 1N78A 3Q0IA 2IV7A 5BN5B 4QXQA 4QRHA 4Y2YA 3KUKA 5C4MA 1GILA 4EW3A 1R0WA 4MQ5A 4KFCA 5JDCA 4DV1B 3E9MA 3IEXA 3DFMA 4IUDS 3PEYA 1ZIPA 1SU7A 1WUYA 3IXQA 1IBMB 4DEYA 2JLSA 5CA1A 4WZ6A 4H60A 2QN3A 1DBIA 4YUZA 1ZM9A 2OCYC 1SG0A 5C8DA 3E9EA 4PXAA 4PYMA 2B69A 3CSUA 1SC1A 4PNZA 4UEQA 3KJQA 2FPIA 3DTVB 3U3RA 3WJ2A 1DT5A 1NR5A 1RJEA 1G8SA 1HDYA 3I45A 4Q3KA 1KC1A 2OB2A 2LNDA 3UW1A 3OZEA 3HYTA 3KSRA 4TKUB 1Z4JA 4CCAA 1UC8A 2PCJA 2OCLA 1D03A 1XLVA 4YRKA 3T0IA 4RD1A 4DG9A 1C9DB 4WA8A 1BHQ1 3U4QA 5HHTA 3TH5A 2D8MA 3NQ41 3UC9A 3A9VA 2XB6A 4MCHA 13PKA 5T8KA 1IWPB 1QFJA 2Y0CA 3GEEA 2V58A 4NMLA 1X1EA 3HA5A 3I23A 4Q1FA 4S12A 3ZCRA 2FFBA 2PGNA 3WL6A 4DNPA 3FMFA 4GXTA 1HTTA 1ZMRA 3DOCA 3C6KA 3NV9A 4C0JA 4CDMA 3ZQ6A 1EX7A 5CT5A 4I1UA 1BQEA 2HHLA 3ABZA 1UKCA 4MSUA 5EIWA 2BONA 1VE9A 2PD6A 5FQOA 1OXMA 1RJ9A 2E48A 1DKPA 2J09A 2WSMA 3FDJA 3IUMA 1BKDR 1OYYA 2NZJA 4N9QA 2VUTA 1ICEA 2W93A 1EFPB 1K7FB 3GOQA 3TIIA 4ZHQA 3KD3A 1BFUA 3TR6A 4ZMSA 1RPZA 1UPCA 1RRMA 4JIMA 3FCXA 5H4HA 3M6MD 4DR5E 4JWTA 1Q0RA 3GT0A 1ECLA 1QRRA 3ZNOA 2GN1A 1RR9A 4DNQA 2HEGA 2LGJA 2BIFA 2QVXX 4P4NA 4BBJA 1F1JA 1XZHA 3L8EA 3RIGA 2DC1A 3EXHB 4PAMA 4CKEA 2ZYDA 4FW8A 1EWYA 1Z4MA 3E15A 1GLVA 2QLMA 3OJWA 2XRYA 5BSFA 3AM1A 3VC3A 4IFDB 3ELWA 2X5KO 3IQWA 3V4FA 1SOAA 4A8HA 5KSWB 3FYUB 5BRJA 1R6XA 4JBLA 3BFXA 1GYRA 4HADA 1XTUA 3RKRA 3RS4A 3GPLA 3PS3A 4AULA 4E88A 5DNYB 3ZWDA 1N2JA 2B1JA 2FQQA 3UEOA 1E2LA 2UV8A 4C4AA 2UYQA 3C3AA 2EATA 1OBFO 1TO1E 3F97A 3FPGA 5F3RA 4CMCA 2ZM5A 5IF9A 4M87A 4FMDF 2UU9E 3EEYA 2D54A 4IO0A 3OT5A 2HREA 3LC2O 4WCVA 4DC1A 5I8WA 3HWSA 2G63A 2PGJA 4DBVO 3KCNA 5D1NA 2FWPA 2GARA 4DV7E 4QOGA 1F3OA 2GJ9A 3E3NA 5FPPA 4HXYA 2XWBF 3TSWA 3C1OA 2RKWA 3LDUA 5DM2A 5INTA 4DV6B 1LNQA 2WP8J 1H1TA 3DL0A 3UJ3X 1EP3B 1H6BA 3QHQA 4WK6A 3FN4A 2R60A 2XR1A 4MU1A 2GEBA 2YC2C 4MIOA 3TZHA 4RX1A 1RW4A 4IVRA 3WZ2A 4L4ZA 4LHWA 3BJZA 4X85A 2OV4A 3QELB 4DPWA 3A04A 4RVOA 5DT9A 3ZHYA 1C3LA 2PMEA 4ZQHA 3S5UA 2IQIA 1HYHA 4ENRA 5JFGA 4S2UA 1EFPA 1RM0A 5EP4A 2CV2A 4IXTA 4LV8B 4D44A 1E1NA 1U0FA 3CPSA 2GHTA 4HGRA 1NFRA 2IPXA 2G1KA 2QJWA 1FTYA 3RGGA 2Q28A 1MG7A 3ECCA 4UDNA 3AR4A 1GGVA 1UOOA 2P90A 3KEFA 4W1SA 5I7HA 1THZA 1ZIXA 2EX1A 3BE8A 2FOLA 3MD9A 4KZKA 4NOKA 2EJTA 4KQ2A 3LIPA 5HE9A 4W7SA 3OZFA 1TQ2A 4PXYA 2TMKA 1PO7A 1DSSG 3FE2A 3KVOA 3N59A 2MWMA 3ZW8A 2MSEB 2AMJA 2R6GA 1E62A 3KQWA 2YXNA 4CEHB 4N5NA 1RHQA 3UIEA 4GMKA 4NZ9A 4B3TB 1B62A 4QRIA 2BI4A 3RJ5A 3OQNA 4V0KA 2ZFUA 2VKQA 3DHNA 3EJWA 4OAOA 5GGXA 2QE7A 1VSVA 2HA5A 2JCYA 3FTPA 5BO5A 3DAHA 3G2NA 1BU5A 5BP7A 1ZK3A 4H17A 1FFWA 3GROA 4F21A 4AYTA 5J58A 2VP4A 1SH7A 1YB6A 2D2EA 3N5KA 2D13A 3OY2A 4ZI5A 1KSFX 4HS9A 3KQTA 2X4LA 1TVKA 3LVQE 4J16A 4EO4A 1NXSA 3JAKA 4RF2A 1JHUA 3GCWA 2C2YA 4DVJA 4PS1A 3HYRA 1ZXXA 2GZHA 2UZIR 4QGSA 3GCZA 1YKSA 7ADHA 5EJ7A 1N6HA 3I61A 3KQNA 4C5AA 1L7RA 4N65A 1VOTA 2I71A 1CDZA 4FDMA 2CDCA 3MGCA 4LYAA 5B2EA 2GNOA 3A1UA 3FX2A 2EKZA 3IKVA 3IOBA 4HLUC 4XYLA 1MGOA 3I9KA 5JR3A 3WIBA 3RHFA 2J3MA 1L5WA 1V39A 4NCBA 4HVTA 1KDOA 1UJMA 1H3FA 1T8SA 2FG6C 2G09A 2OAEA 2I29A 3AR6A 3NT5A 4QOSA 2Z9BA 4TS4A 5IJAA 2A0FA 3IEKA 3F46A 1XNQB 1X19A 3ASZA 3MMNA 3IAFA 3P3GA 3AF2A 3HR7A 3AESB 3A9TA 3WBKA 2GO1A 4XE5A 4MVJA 1U0OC 4IEEA 5IK2A 3F5MA 1Z7EA 4ZCMA 3RABA 9GPBA 5L53A 2QUKA 4GOND 4QSMA 4UHJA 2P35A 1EDOA 4BO6A 1K4MA 1DE0A 2ECPA 2IHUA 2SNIE 3B70A 2F64A 3U26A 2FSPA 3K9LA 4LMBA 2D5CA 1DJPA 3GN2A 4OFBA 5E9AA 4PAQA 4J3FA 4ZANA 1JHAA 2C2BA 3VR5H 3MTEA 5ESRA 4ABTA 3R40A 2EHJA 3B7PA 4G67A 4ZO6A 3ZLBA 1ZOLA 4RPFA 4WAUA 1FP2A 4YAOA 1ND5A 2ZROA 3PYGA 2ZUWA 4N1AA 2EU8A 4MUKA 1OVMA 3DEZA 1MAWA 1DMRA 5JEDA 4O4LF 5IXYA 1EA6A 4XIYA 1RRGA 4C0HA 1T3ZA 2V2VA 2A30A 2IYVA 1XNRI 3L1HA 5CFPA 1TTTA 3JVEA 5CW1A 5T57A 4LF8E 1E3TA 1H4QA 1QKJA 3AFGA 5F5NA 1GEEA 5ESDA 4GDMA 1ZRNA 2VESA 2VJYA 3GONA 4IY1A 1MX0A 1SPXA 4KUGA 3VVLA 1E9DA 1DVRA 4N3GA 3LK6A 2B94A 3GVXA 4UC0A 5ALQA 1E4EB 1F14A 1DXHA 4L9SA 1RBQA 1A4XA 3V8BA 3OCZA 2ZM6I 1UZNA 4ZCIA 3DLHA 2WAYA 3ITNA 4NZYA 3U80A 4G5RA 5B4UA 4B34A 2OBBA 1J0AA 1DQZA 2XUHA 1ZEJA 2GN2A 2QSUA 1CUBA 3IE0A 3PEUA 3OBBA 3AESA 4IYRA 2FQWA 2EFCB 2G6BA 1Z88A 6REQB 2HUPA 2XOKA 3IMKA 4MCJA 2ECQA 5BQ5A 1PW5A 4N47A 4D0RA 2PZFA 4BHTA 2FRDA 3UCXA 2NO0A 2HMAA 1OX5A 3M85D 1ST2A 1N2SA 2ZTMA 3JQBC 2HN9A 4HAXA 4ROTA 3ZK8A 3PS9A 1ES9A 3PGVA 3VSDA 4Z6KA 5JROA 1XKXA 2LR0A 2QTHA 5DI3A 3E8MA 1L4HA 1E3IA 5B53A 4LNHA 4A23A 5AW4A 2CF5A 4OB7A 3GDWA 4HXEB 1LQUA 3H9CA 4QX6A 1ECGA 1FJXA 5KTYA 2V0GA 1Z75A 1LLCA 2Z9DA 1Q1QA 1U11A 3D3NA 1N1GA 2X7IA 1KJZA 2G25A 3IERA 3R75A 3CT4A 3FCSB 1GAQA 5DTIA 3D7LA 3QYFA 2W0MA 4YCCA 5FDFA 1FRZA 1IM2A 3C3DA 4FMBB 3GLIB 3MGBA 1JE1A 1KIAA 1D7AA 3P4XA 3MGAA 4GMHA 4EGAA 1P5RA 3F4LA 5HKAA 2PDAA 3K85A 1ZL0A 1ZNXA 1P8JA 4HEHA 3TFWA 3S1SA 4XUEA 2ZBFA 1N75A 3NAQA 1XJQA 4IQ8A 4JXXA 4QQNA 3UQYS 2PXHA 1LTHR 3EF1A 3B8HA 3GH1A 1CP2A 1MQSA 1O58A 3V5NA 4UDOA 3ZQKA 5ICMA 4X62B 1RWPA 4B74A 4BN0A 1IBKE 3CCBA 3ZDQA 1E4EA 3FZYA 1GQOA 1QWSA 4CMEC 3E7DA 1BHJA 3SN6A 1Z2PX 2YV2A 4G56A 5SZIA 1T4DA 2B1IA 3GRUA 3QYAA 3FYHA 1NNSA 3TKYA 4BWVA 1E6WA 1YK0A 1JHYA 3B1ZA 2XA9A 4BRUA 4DJEC 1VPWA 1M76A 3CX8A 1PGNA 1QHIA 2PD4A 3CZMA 4WLFA 3EPPA 4RD4A 3ROZA 1ZGAA 1JDVA 1GCIA 1LH0A 4U0JA 2XD4A 2E1PA 1NYRA 4CF6A 3BD9A 4QBHA 2PS1A 3F6SA 5I5EA 2ZSUA 3TFQA 2E4ZA 4PGAA 1HEIA 1QK3A 2GKGA 1X1RA 2OK8A 2YXDA 1AGRA 2P2NA 4X6YA 4CF5A 2ATEA 2CDBA 1YB5A 1EK1A 1C14A 1FU7A 1KPHA 3KZOA 3F8TA 5CNKA 3SBEA 1RLTA 2FQXA 4W5JA 5LUBA 4CR7A 2QV0A 4DQLA 3O1HB 5D51S 1TB4A 3OC6A 1N2ZA 4MYUA 1TM7E 1XHEA 1Z83A 2NIPA 4GMDA 4LE0A 3SJAA 4A27A 4C4RA 2QRHA 3NMUF 5CB6A 2O54A 3ZV7A 3PGXA 5JSYA 1GEGA 2G9UA 2QG9A 1N2HA 2CYAA 3LHKA 1OU0A 1KTIA 1DAEA 1IHPA 1V5WA 1VMIA 4QYSA 3TBFA 1GSOA 3HCAA 4NDZA 5EQFA 4RPKA 1C9JA 1QONA 3IQGX 2J6HA 3ZY2A 3OFJA 1D0VA 3FUXA 4NIMA 4X0EA 1OXSC 1JFLA 3QXGA 2QK4A 1XA3A 2YWXA 2GO3A 4OY3A 4BGDA 3MIIA 3MOIA 3PIDA 5THKA 5ALWA 5ALRA 2F3RA 3M6WA 5ILOA 2P1ZA 2B2XA 4QDUA 2QTAA 1LK5A 4PSUA 3QBTA 1NY6A 4OQMA 4ZP1A 1XZEA 2D1QA 1WXDA 2DKNA 1W9MA 2J3KA 3F1KA 4FPXA 5DISB 4AJPA 3WP0A 4ARVA 4F71A 2ZYIA 3VR2A 4BVBA 1DKNA 4MS4A 1UKVY 2W2QA 3AVWA 1E9SA 2P4SA 2VNHA 4QASA 3NHBA 4JOQA 1Z6TA 2AI2A 1XKQA 5BR8E 3VO2A 2KMLA 1NDUA 4OO1E 4D26A 2D74A 1S2OA 2OG1A 2QPTA 3DXXA 3CZCA 2MSWA 5KYTA 1YJBA 2HK9A 2PSFA 3MINA 2ZEJA 4PQGA 1CUFA 4WY2A 1P73A 1UP4A 3PWZA 5JE8A 1GTZA 1MGPA 5AW6A 4K26A 5CXSA 2VP6A 2O7QA 3ECSA 2O2IA 3H7IA 4JBNA 3BMCB 1NMSA 3H9BA 2P0YA 1EHYA 1SD5A 3L06A 3S0JA 4KE6A 2O1TA 1E1LA 3V6MA 3QRWA 1PWYE 3WLEA 1L4BA 1EIZA 1P7WA 2M6RA 1HPLA 4KTTE 3O0DA 1K8RA 1QNFA 1W1IA 4PLZA 4Z3OA 1ODCA 1B42A 4BGUA 1BKSB 3ABIA 4G0OA 3T3NA 5JI3E 4JI4I 1TQDA 3RBAA 1FRVA 4E6PA 4RENA 1GPJA 3DF9A 3M1AA 3R7WA 2ZKLA 1N8KA 2WWVD 4OK6A 1HE5A 1T8RA 2GBFA 1XVVA 4N0DA 3AHDA 2JHAA 4AYXA 2B1GA 1UKYA 3COZA 3HCPA 3QEMA 4PRLA 3MS4A 1X42A 2ID9A 2LDXA 1A6FA 2Q5CA 2XTAA 1KETA 3QPAA 1EDZA 4HAYA 1E7MA 4QGBA 4UUBA 5EE5B 3LTNC 3GFBA 2P5SA 5F23A 4TMKA 1LSSA 3TMAA 3WI7A 5KSOA 4NHEA 3A14A 4IX1A 3B3FA 3Q3JB 4LFBE 3H1GA 2P9YA 3NFYA 2P9BA 4Q00A 1T6ZA 2PV7A 4Y1RA 1Q57A 5C0OE 3RYTC 2DFVA 1QRAA 4LECA 3WRWA 4EYOA 3KX2A 1AUVA 1HNNA 2DHQA 2DH5A 4HDRB 2BM0A 2JARA 4BC1A 2IUUA 4JGBA 4EGQA 3A7EA 3T5DA 2BBSA 4BJ3A 2ZJ3A 5A5DA 4Z7QB 5DYNA 3LI2A 1PG2A 1KYVA 1WVMA 3VR6D 1TVEA 1M54A 2WZBA 4HGZA 5A9RA 2HEIA 2KJQA 1NDQA 4C06A 4EVIA 2CLDX 4E7PA 3SC6A 2FDCA 3LTOA 5GZ6A 4ND5A 3NOQA 5FLXQ 4OI2A 2XIJA 3I0MA 4MQFB 5CEFA 2J32A 2JIPA 4L8YA 2PS9A 2ZWMA 3R9KA 4J1TC 1KF0A 1KARA 2EW2A 2W6MA 3BK7A 4ISCA 3BMQA 3EEOA 1Y1TA 4KC0A 2VIIA 4B6OA 1HEYA 3VU9A 3HLYA 4RTOA 2YUIA 1H5NA 1ZH4A 2A5GA 3E1SA 3VOSA 5BSMA 3TEMA 4J75A 2NPOA 2IYRA 5K3AA 1O7JA 3E9DA 2G5CA 2BKEA 2Z0MA 1QDLB 2XJ9A 4Z0PA 4JK3A 2HBZA 3QW2A 3R3JA 2CNNA 1N8NA 1G5RA 3MGGA 4NDNE 2FMXA 2C5LA 3V2UC 2MYPA 3ENNA 1I1NA 1YCGA 3T1YB 4BNVA 1WW3A 4OFZA 4TZ0A 4GOJA 1IBMI 4O4IB 1FCJA 1AF4A 3KWJA 4BUJA 5EMLA 3VDRA 4BJHB 1XRRA 3PHGA 5FNVB 1ZMTA 4KQ6A 1JIKA 2VSQA 3V7FA 1YBAA 4BLQA 4RY0A 2DPGA 2Z8YM 4I2VA 4WH0A 3GEBA 2AEFA 2H1VA 3D3WB 3BFKA 4TGLA 4BEJA 1WULS 1PI3A 4ZIRA 3RV3A 3BTOA 1QXSA 3BAZA 5EIAA 4UVIA 1B2RA 3STUA 4CTMA 2O1UA 1TM3E 1HV8A 5KYWA 3NHFA 2ZRFA 1KJQA 1T9KA 1BZYA 1J21A 2Q8PA 2ZSDA 3RDPA 3RC8A 2YWCA 1FTWA 2X36A 3IIIA 5JMOA 3KZVA 1YB4A 4DUYI 1RD4A 1L5ZA 1Z73A 2PXAA 2JK1A 3ESCA 3GMTA 2I76A 3L43A 2ZJ4A 4KE9A 1OLSB 1DL5A 2HX1A 1ISIA 2ZWAA 3NB0A 5J59A 1ADCA 1H1DA 2VDKB 3KTOA 3DO6A 4TV8B 5AI9A 4S04A 1LDYA 3DDOA 4JEMA 4EMBA 1QU3A 3ZDFA 3FA2A 1H2XA 4PCAA 3MCUA 3TFOA 1I1QB 5AJVB 4HGOA 3EEFA 1XRQA 4RF4A 4X8OA 1W8DA 3ABSB 1LJUA 4O4LA 4LYDA 4O2BF 2JNWA 3TB6A 2EBFX 4CETA 6REQA 1RKBA 2NU9A 5EIEA 5JV5A 3LRPA 3EDMA 4G81A 1KJ9A 2A9VA 1ZM3A 1M83A 1U65A 4TLLB 4IGFA 5LQKA 3FWHA 4D3DA 2ZDQA 4R5MA 1N5DA 3FTNA 2ZZMA 1PJLA 1N0UA 1WUIS 4DJJA 2W70A 2OQRA 3LSYA 1H9AA 1LX7A 3ENQA 4R9RA 4RL6A 4D43A 1PR9A 2C88A 2F3PA 1FWKA 4NE7A 1T3HA 3PFCA 1RRCA 1G291 3HYLA 4M1WA 4Z99A 2FPGA 5PNTA 5I7UA 2QE6A 4OO1D 1PLLA 1SB8A 3D3WA 3H5TA 1RWMA 2J5XA 1HO3A 4WINA 1A95A 1I3OA 3T3IA 1E2KA 1DELA 5HMLA 5JXIA 5IKXA 2NN6F 3P27A 3PFIA 4B1FA 3CZ9A 2CXTA 4J0EA 4URLA 3NCTA 4HVLA 3I5AA 2X5NA 1OXTA 3KJFA 5FL3A 5H0IA 1NXWA 1R37A 2QQGA 3AETA 2CXHA 3D1VA 4PPNA 4QU9A 1FUUA 4N5MA 4BX2A 1O6CA 5B6IA 1KZYC 2JIQA 2MR6A 4BMOB 2DBYA 3EODA 4LOMA 4GPTA 4KQ1A 3ZZTA 1QHGA 5J2UA 1WY7A 2RHOA 2X8WA 4TYNA 2C39B 4GOLD 2OM2A 5BMVA 3LXMA 3UZUA 2YXBA 2ZTVA 3HXLA 1ZK1A 1D0IA 2Q3HA 3ESQA 2I5PO 2WUEA 1V45E 3BQNB 4HOYA 1QH9A 1WDLA 3P76A 3AV3A 3AOEA 4U4AA 1UBEA 1D9XA 5EUMA 4FI3F 5F76A 3ONNA 2ZUBA 1UXGA 4MVYA 5EJ2A 1YR8A 3MRTA 3P4YA 3D8SA 4MVJP 3K1AA 1SEPA 1WQ1R 1DJMA 4TRRA 3T1HB 5HF8A 2AF4C 3MCAA 5E2AA 5FLEX 2CF6A 1J0EA 2J9XB 2X8BA 4R8MA 4DDVA 4I55F 4YA6A 4P9NA 4V0LA 3BCHA 2AXNA 1M9NA 2JGNA 4EI8A 3L07A 3GBSA 4FGSA 4G5YA 2JIZA 4KKVA 4ZVLA 1FVHA 2QU7A 4IZHA 2OBNA 5CVCA 4F9GA 1TM1E 3SHFA 3PQ3A 2ACWA 3IAXA 1N8TA 1XZDA 5LN1A 2Z2KA 4C5CA 4HNQA 4YQFA 2I1WA 2BH2A 3MK31 1H23A 1V2HE 2ZRQA 4D9HA 2AEJA 3N2KB 3DDZX 2O5CA 5KC8A 4PONA 4CNQA 2ZM6E 4HJXA 4AXBA 2IVZA 3BIXA 3EXIB 4WZAA 1UBCA 4HDMB 3ED5A 3ZY3A 4LWZA 2WYHA 1ENYA 1F4VA 1OT5A 3CG4A 1D4ZA 3OX4A 1GA1A 4B45A 1NZFA 4AX4A 5I7RA 3WRXA 3CUTA 2RBGA 4QEZA 4LF4B 3HO1A 5IH7A 1MKYA 1I51A 3THOA 1GP2A 3GAMA 5HG0A 1IHDA 1O95D 1T1JA 4QO8A 1XWIA 4OHBA 4OUKX 4F60A 3UJPA 4KDRA 3E35A 1A27A 3OZTA 1N2XA 4BAGA 4BTEA 1QOZA 3DXZA 3Q0EA 1QDUA 3OCVA 4CIWA 3AI2A 3OZAA 5LZ2A 3RYIB 4CKBB 4LI0A 4BFUA 2P41A 1U0GA 4LF9E 2AV6A 2ET6A 3JR7A 5IJXA 1D2RA 1GSHA 3L8CA 5CP8A 3S7ZA 2IP4A 3O8LA 2H4JA 1RRKA 4GEKA 5ITWA 4BVKA 5J23A 2D7DA 3HLTA 3DKKA 3ZYCA 2ZS8A 1G20E 4IMPA 1E8DA 2Z2IA 3RG8A 4LF7B 3CEAA 1QGYA 3DWEX 1ZKMA 5ARDA 4C0QC 2H59A 4CQMA 5C0XB 2J59A 4Z4IA 2CUZA 4LJYA 1N9GA 2DHCA 4XWYA 3NAGA 4MRPA 3B53X 1NWCA 2IP1A 4KNVA 5K3BA 4JQOA 3DYIA 3EIFA 1U7UA 4LJKA 4UHDA 3VDMA 2OP1A 4HRXA 1VL8A 2ZRPA 3LQRA 3W78A 4CM1A 1MPTA 1RZVA 4TKZA 5KVSA 4EBBA 3J81k 1L7XA 3AUXA 4CIDA 1JU3A 2Z5BB 3HFRA 3KQKA 4PG7A 4BQIA 4WVFA 1HNZI 2OECA 3SGLA 2C5HA 3Q85A 1AQLA 3H3JA 4NXMB 1MJGA 4WLUA 2QU8A 1Y5IA 3LY7A 4NH0A 4HDMA 4ARZB 4AZ0A 4F06A 3HP1A 2QMZA 1H4TA 1AXGA 1EFHA 3OURA 2B78A 1LJLA 2PLNA 2PN1A 3B3GA 1E59A 4KXFB 4R6XA 3T7AA 3L6EA 5K0BA 3PIRA 3QNUA 4MKXA 4NMHA 4DCPA 1FF9A 1TFRA 3JQAA 3RT1A 1MHPA 2C37B 1J33A 3NGLA 4BVLA 1YZ3A 2XAUA 1JFVA 4PVDA 5E6UA 5H83A 3TBHA 3J7AC 1R9NA 4EF5A 5JEAC 2BI8A 2GESA 2WFLB 1BA3A 1KYIA 2C04A 2FP4A 4QYMA 4QT0A 2X86A 4AQ7A 1L7NA 2NSDA 1UK9A 4HEJA 4J07A 4KO8A 4TSFD 1CXZA 1RMYA 4I66A 3AHHA 1SKBA 2GXUA 4B7XA 4BNDB 3MT7A 4TSKA 3I83A 3MQ2A 5AHKA 4EHLA 2IZ6A 1X8JA 2PKYX 2P6UA 3PZRA 4J8PA 2CFCA 2Z1DA 3A10A 3W1WA 2ZU6A 3IHLA 3KLMX 5AJTA 1T36B 1RI1A 2VRCD 4CG0A 1MIOA 4EJSA 1TKRA 2UYHA 2UZAA 3Q41A 4QJ4A 4WUDA 3MYRA 3SBDA 5JS2A 2ZCVA 4IIVA 4AJJA 1J8VA 3A3KA 4C4ZA 4CMIA 3I5XA 2K5UA 3MCZA 1UXHA 1L1RA 1IAQA 3R1IA 3R41A 4YK7A 5HIIA 1KJWA 3DE5X 4DR6E 1JPUA 2OBMA 4ZREA 1GQYA 3JTMA 3GX1A 1L5MA 5H82A 1PNQA 3LWBA 3KKEA 1QF6A 1S3IA 2I6GA 3A2LA 4O2RA 5CJJA 1TJ3A 4HQNA 3KR9A 2Z5BA 1LK0A 2W4MA 3U7GA 3MBKA 5K36C 1H0HA 5FBKA 1C4WA 3B1XA 5B1EA 2P9GA 2ZJ6A 4WNAB 1NY5A 1BO6A 2IH2A 1ODJA 5ALXA 3O5AA 1VG9B 2CVEA 4AJHA 2JIRA 2YIJA 1AZTA 4RFLA 1ESZA 1VJ1A 3LX6A 3PNLA 1EUCA 2KYRA 4QNNA 5AW5A 3H05A 1E7WA 5ALMA 1G9TA 1SBCA 2C4KA 5J63A 3PVZA 1Z6ZA 2O05A 3ZTWA 2LDBA 2X41A 4K9MA 3GJSA 1AK2A 1WUHS 4URZR 4FM9A 2VYFA 3L92A 1SQ5A 3C3CA 4ZKEA 1JXMA 5BV2P 8OHMA 2OCKA 1HZZA 4ALLA 4CTJA 1FUIA 3U3MA 4DPYA 1I8TA 4KITB 3UPTA 1QVZA 1P7CA 3X0DA 4FW6A 1IJEA 4DY6A 4MV1A 1T36A 4MTCA 2J9FA 4X1OA 3QUCA 1EFVA 3TTVA 5AICA 2PH1A 2XUAA 1YR7A 2B5OA 2AZTA 2QTCA 1G3RA 5LA6B 3ROMA 1J9EA 2FUCA 3DE0X 4N82A 2PNJA 1FEZA 2ZE7A 4WGGA 4CCYB 3RVJA 2CJYA 3O9VA 2YWBA 2J5BA 3L77A 4AB1A 3GLLA 1XZPA 2O1EA 2GZAA 3KELA 3P0IA 4YI5A 2OHOA 5C35A 3CURA 1Z22A 2GJSA 3C8HA 4J0QA 5JPDA 4R05A 4DCCA 1DMSA 1KY3A 4W99A 1SUWA 1P7YA 1CZOA 3RFXA 1JDPA 2GF0A 2M2IA 5LBIA 2ZW9A 3PHLA 4Y7DA 1E3SA 2XHZA 2HK6A 1CPYA 2ZS9A 2WF5A 4MUAA 5AM5A 1WUJS 1PEYA 1RE0A 2GT1A 3DAGA 3ISVA 5ERYA 3INYA 4RVUA 1H8HD 2JLZA 3K9NA 5KYXA 1RWVA 4DPUA 2NV6A 2O2GA 5AVSA 5FEUA 1Z18A 1Y48E 4N8EA 3FVRA 1FUKA 5K8CA 3S81A 2FPRA 4X1IB 4QM7A 3CVXA 3O8BA 5DSXA 2CUTA 4DMHA 1CZRA 1XF1A 2C1EA 2E1RA 5H59A 3CH5A 3KOYA 1U8AA 1ZCZA 3QFSA 3MTAA 4QSHA 3TXYA 3FFWA 1WXHA 1PGPA 1E9EA 1JR4A 5KMGB 2P2CA 3K94A 3DOIA 3EZ6A 2O7VA 4PTLA 1LRKA 4ERXA 3Q2IA 3JWJA 5FL7D 3LXXA 2CLMB 4Y1GA 1U9IC 4IHJB 3VHRA 4A26A 5A1TA 3S8YA 3K09A 3EWIA 3GEIA 2B9VA 2BCJQ 5H9VA 2YJZA 1MO3A 5DI9A 3AEZA 1Q44A 5AVKA 2J3LA 3I28A 5G2OA 1TECE 3WB1A 1RI5A 3F0NA 4DAOA 1PZMA 4RZSA 1A2KC 5JJCA 1TGVA 2OWEA 3O92A 4G4SP 1E92A 4AJKA 1CNMA 1I5OA 2O20A 3AT1A 3BULA 1E3WA 4ZVMA 4CN9A 3A2KA 1R9GA 4L50A 3O47A 3HSKA 5F51A 5LBUA 5IC4A 5LP6F 1KDTA 1P72A 1XTPA 2ZPTX 3WLIA 4AIRA 1PK8A 3ZCVA 4F72A 3EWNA 4WXPA 3KC2A 4DCMA 4P7JA 1NE2A 2HRBA 3HO8A 5JTUA 3U7QB 4QUAA 1P4JA 4HFMA 1ESNA 2VP0A 2NN6A 2H1OA 5ICSA 4CKWA 1WF6A 5JSHA 3AHFA 3FCOA 5LLDA 1GV0A 4FR2A 2QRGA 2JIBA 2XXJA 1HQDA 5FA5A 4DR2B 1QGUA 2NUAA 1Z25A 5FAXA 2COKA 4JEUA 3EX7C 3JRXA 4IXNA 3AJEA 1J0CA 1IBLI 2BHLA 3KHUA 1QG2A 4KB5A 5IVPA 1PVGA 2PKCA 1GT91 1VJRA 4S1WA 1MV5A 4JA0A 5E7IA 2QSYA 4WEOA 4GSLA 4G5QA 4CI0B 2G1JA 4U2FA 3GZNB 3WQSB 4Q4AA 1WHTA 3K9FC 1EVEA 4DUYE 1YZUA 2D2XA 2QTBA 3H1FA 3DV9A 4PHFA 3EFBA 3FCEA 1VKRA 1L8QA 1Z39A 1C7RA 4YMGA 4F4CA 1JSRA 3ABQB 3H86A 4LSGA 2ECKA 3WV4A 2H2AA 2WNRB 1DB3A 1QQTA 2IOFA 3AFMA 4PLPA 2BCEA 3WMRA 2XYGA 2VYNA 4P38A 5AW0A 2ZBEA 1H7SA 4S1NA 1HT2E 3DMGA 3IP1A 1KOGA 5BW4A 3T52A 3HUEA 3K15A 2FZEA 3T5MA 1E8NA 1Y1PA 1JIQA 2QVGA 3AM4A 4I55A 2I7VA 5EWLA 2ODQA 3GNTA 3LKDA 4NY1A 1LPSA 5HWSA 3B89A 3UJAA 2HQBA 3OFNA 2F1IA 3JASB 5JEAE 3THYA 4FKBA 2ASEA 4FDLA 2ZATA 2E49A 4QT4A 4WL0A 2N75A 5BV7A 5EMHA 4I3HA 1P6XA 4MOWA 1JDTA 1JMVA 3RWOA 1ADYA 4R2IA 2O8FB 3JAWB 4KVFA 3KCQA 2PO1B 2J3JA 4WN9B 2PLAA 1QKKA 2H52A 4U5QA 3EQ7A 4CG1A 3SHVA 4DDKA 1ZN2A 4EG5A 4ZICA 1QYCA 1DOAA 3OJFA 4YP9A 3AF4A 4HQKA 1PCXA 3NBZC 3OO1A 4OQQA 1TMYA 4BWYA 4X94A 4L3VA 5HKKA 3KP1A 1EFRA 2AEMA 1S4MA 1A04A 1OFUX 1P2VA 3OJLA 1RM3A 1XVAA 3U9LA 4PRKA 5BN4B 4AECA 2DBZA 1VP9A 5F73A 5JZMA 3DGEC 1I5EA 2RAVA 1VXRA 2VO1A 2X8JB 4HUQB 5T67A 2IS4A 3GZNA 5EQJB 1DADA 5ARBA 2PY6A 4EL5A 4RQAA 3E58A 1DJQA 4JI2B 5AKLA 2GTIA 2O23A 1S0UA 2VCYA 3UXMA 3U1YA 3DW1X 4TLMB 1OIXA 3OECA 4F4DA 2N0SA 3L4BC 4MGYR 5H80A 3CNOA 3CW2A 2JFZA 3RT7A 2A2ZA 2X0JA 4MRNA 3ZHRA 3BWVA 1H74A 2H8GA 2QZ4A 4BPBA 4D4GA 3EQZA 3L4JA 3OOJA 1RKQA 1XZIA 3O82A 4S1OA 1K75A 4Z9AA 5FH9A 5ALDA 3GMDA 2Q62A 2BGLA 3WK8A 5TGDA 2FP3A 3V8QA 1FDWA 4K9RA 4LFCB 4BKPA 4CGZA 3NV7A 4DJDC 4A6DA 1RAAA 2EIXA 2VJQA 4EKEA 4JHLA 1XEAA 4G84A 4R1PA 4YJKA 1BX3A 1A1SA 4HQOA 4Q66C 3KU4A 4JT9A 3SDSA 5C18A 5F77A 3CVJA 2PX5A 1W88B 4MQEB 3F8SA 2OENG 5A3VA 4OU4A 1I33A 1RIIA 4WN9A 3IVXA 3VYTB 4A0SA 5MGNA 5IW8A 5KYYA 1YQ9A 4QYIB 3WDKA 1GZ5A 4N3CA 1NQ5A 2YIDA 4GZLA 2WT9A 2B4AA 2IRWA 2BRUC 3BMNA 3RVDA 5CLJA 1IM8A 1MQ9A 3P2EA 5ECYA 5EMNA 1Z15A 4P08A 1VBKA 5HGXA 4JI7B 4IOLA 4Q24A 5IM5A 2WNIA 4X20A 5BN4A 1OLXB 1H8EA 3NDBB 1FL9A 4WKGA 3BMOB 3VPBA 1DIRA 4JP2A 1NBME 2V65A 3IQFA 1C9NA 4HQFA 4LXQA 2GYYA 2VQ6A 3ZDEA 1GPH1 2QM0A 1F4LA 2XUDA 5LMCA 1P2GA 1UOPA 3RHTA 1JDSA 2BFBB 5JYCA 1WKCA 2GYUA 2R1UA 5IVKA 3NJ8A 3GEMA 4UMEA 5T4BA 3TO5A 4DPTA 5TMPA 1EWVA 5FO0A 3F8WA 3B6JA 5DYWA 3OKFA 2DFDA 3AB8A 4TUYB 4D2IA 4F1KA 4CJXA 3IIMA 4H1TA 3TUIC 4HNTA 4QYXA 1T9GS 4BYGA 3MWKA 4PSDA 2ICAA 4QUDA 3WZMA 4I5EA 1D09A 1U04A 3UF0A 2YQ4A 2I9KA 2WY2D 4IIFA 4EPYA 5IJ0B 4LXUA 2JKVA 1W35A 4HX2A 5IS2A 3LWNA 4X64I 1WEHA 1EJ2A 3CG0A 4JI8I 2Y1GA 3N76A 1DTWB 5M5BA 5C51B 1UJ2A 5AOVA 1G8GA 4NEHB 1EYZA 1U90A 4V03A 1YH3A 4BNNA 1K97A 4Z9XA 3U40A 1W88A 1IQRA 1KI9A 4UQOA 1MH1A 1L5KA 3KQYA 4BA1B 4YJGB 3ZK7A 1EQAA 4M1MA 4QYIA 1T1IA 5ISMA 4NEGA 1VIMA 4QOHA 2WP8A 1VL5A 2G5PA 1AGYA 3DH0A 3DO5A 1CFJA 4L15A 5L51A 1ZQ1A 2ONCA 3AVOA 4FSHA 1PJAA 1O6FA 2V34A 1AZSC 4LBWA 5AHWA 1HNZE 1N34I 2GNPA 3RIYA 3FCCA 5T3UA 5L6LB 1OLXA 2O3QA 3H2YA 4FIDA 3UCFA 1MQ8B 4O6VA 5KTTA 3QVWA 3BDVA 4HNUA 3VRHA 2GFIA 2O59A 1S2LA 3BYZA 2JGFA 3QXSA 4RVCA 3TDKA 3JQFA 3NBMA 4AY2A 2X22A 3KOXA 5L3SB 2QEQA 5F1KA 1CQIB 4QODA 1FYWA 2PH7A 2RKOA 3UGTA 3WU6A 4MDFA 2TMYA 3SEQA 2NVOA 4YP5A 2Q3FA 3SVTA 4EIWA 2PZKA 3FIJA 1M75A 3OPYA 3R0VA 4H4EA 4LZAA 4PEVA 4WV3A 3USES 2HHHE 3AM3A 3UHJA 3WGVA 4M0UA 5I9TA 1W0KA 3GRPA 3A2MA 5TVGA 2REQB 2FMFA 4TZKA 4KK3A 4BO9A 4HN4B 2QPAA 5F3WB 3T7IA 5CVUA 5KOIA 3OZXA 4M1SA 4HAIA 5AKXA 2VG8A 5AR1A 2WD8A 4BMZA 1YD7A 4IFBA 4MB6A 1X13A 4E30A 5AUNB 3HCOA 1QC5A 2VPWA 1MO4A 3EXEA 1EK2A 3MFQA 2ZT6A 1DDGA 4NBLA 3T12A 5IFLA 3FG9A 5IZCA 5JXGA 4ETIA 5BSUA 2HQRA 2WSIA 2QM3A 3O4JA 3UH1A 1RKXA 1A9QA 1WB5A 2WIJA 5HOEA 1AS0A 1CJKC 3DBVO 1G4UR 4BA1A 1PNRA 4RVSA 4P81A 3NFRA 4EZIA 4MLZA 2PR7A 5FLXC 5DBOA 3V46A 4BWGA 1CY6A 4MR7B 4UHFA 5LQMA 4LOHA 1YJAA 1K1EA 1XYVA 2XT6A 3LK7A 3Q88A 2GM3A 3RTAA 1NSFA 2Q46A 1FZTA 2CMGA 2GETA 3N87A 1O6GA 4H7HA 2WQ7A 3QBJA 4L2IB 5JO9A 3A11A 3BN3A 3II6X 2EJUA 3CWZA 4XD2A 3SQMA 5MN6A 3U3XA 2ZVDA 2XECA 2HL6A 5LNK1 2PZJA 2ZBRA 1QGOA 3HM2A 5EEGA 2V8PA 1AKVA 4LQDA 4JCCA 4QHYA 3RT9A 4OO1F 1PLJA 1T2UA 4M1KA 4GHWA 3HGQA 4BJ5A 3R3UA 3UWKA 5EGNA 2HH9A 3U3DA 3IULA 3CRRA 5F12A 3F2VA 4Y6LA 2DUJA 2WT8A 1N6IA 1OJ4A 3KRNA 2FPWA 4CMJA 3LOUA 4MLPA 5FWXA 2V5AA 1VHWA 3TXXA 2DH6A 2Y0DA 4WLOA 3WHPA 4HPJB 2CNLA 4L76A 4TTAA 3VR3D 4MRSA 2D06A 3PJRA 2ZCJA 3TSZA 1IY1A 5JRJA 3RS9A 4DMKA 5ICCA 3P19A 3R23A 4WE3A 3BHJA 3VU1A 3D3JA 3HUFA 5JCOA 1ZY2A 5J5AA 3ANYB 1DAGA 1JFFB 5K8TA 2D59A 1X39A 2FR8C 4GYKA 2B82A 3DEFA 2XNSA 3TNYA 4ZJZA 3PYFA 3CXUA 3H9JA 4KQEA 5EE0A 2QA5A 4WLNA 4NBKA 4JYZA 4DSAA 1CR4A 2RGGA 2JGJA 3SF8A 4KPFC 3UPDA 1B1AA 1CY2A 3OPMA 4CG2A 1ZCFA 2O57A 1Z4NA 4BNYA 1JHMA 1GR0A 2ZRNA 4ZPJA 4C30A 8ATCA 2AQHA 4G5GA 4QU0A 3N3BC 3EDQA 5DASA 4DIOA 2G76A 3H5RA 2IEBA 3WU4A 2XDYA 3R0ZA 4OCZA 1E9FA 4RORA 3VTFA 3K70D 2IA5A 3TEFA 2Y27A 4HWTA 4QFMA 1UKEA 1TF2A 3V9AA 3CSSA 1RHMA 3NM5A 2F1DA 1AB5A 3EK2A 3DVRX 1HE1C 4D4MA 3GF4A 2VI5A 3JZAA 4FHFA 3R3VA 5B6PA 2LCFA 3QTTA 3W9UA 3OEYA 3VPHA 4RAQA 4C04A 1XYGA 2FF7A 4UUMA 3OFKA 5F3DA 2VPIA 3VDXA 4MYSA 3UUWA 3KQHA 2IS6A 1UWLA 2V54A 4ZTBA 3W9BA 5IAOA 3EOBI 5GJVC 3ZKWA 3CCFA 2YTZA 3EFEA 4NG5A 3PNOA 1L9XA 1NATA 4GGPA 4U2GA 4U5XA 4X8LA 3V8VA 4DIMA 1Y4AE 1L6IA 1BMDA 3DFIA 1P0IA 4MRVA 3ZLVA 5J1SB 5GVRA 5JAZA 5CR9A 1Z0KA 2P68A 3IV7A 4FZ3A 4C6TB 4RW0A 5IBCA 4QOEA 2HUNA 3B1KA 4HBZA 3ZVLA 2ZJ8A 3F96A 3C43A 4NBVA 1R6VA 2WIDA 1M10A 5U4QA 1DZIA 4W8OA 4DV4I 5KQGA 4UOEA 2QB5A 2WHYA 1U0HC 4I8IA 1HNXE 2P9JA 2VTVA 1QZZA 4RE6A 5KOYA 1NVMB 2R5WA 1QPZA 2E4VA 2RGBA 1HT1E 1D8AA 2XZDA 3VX4A 4DLYA 1A8PA 5IKOA 3UG6A 5CLHA 1N9ZA 4DR4E 1NVFA 3M9XA 3ZHQA 1R5BA 2F43B 3O2JA 4TS3A 2AL7A 1UBJS 1W4RA 3T3DA 4AWBA 3FAKA 4DWVA 4UMVA 2B98A 2I2DA 3GGOA 3DD1A 2DRIA 1AUQA 1KRHA 3SJ7A 2VDOB 4A3SA 2ERXA 3TQSA 1KO4A 2ZR7A 1WE2A 4DANA 1Y5LA 5JWRA 2VH5R 4O59O 3GZJA 1G2OA 3L2OB 4HAWA 1JWAB 1WZNA 2X1HA 3GRFA 4FYXA 3ZHXA 4G4GA 2C2GA 1QG6A 4DR3B 4P53A 3PPVA 4ZOLB 1YULA 4PNPA 4YAJA 4BJ1A 4FLEA 4K8OA 3DT8A 3QVGA 2O3RA 1VXOA 2RJ3A 5FTNA 3TGPA 3IUEA 4L16A 2XADA 4O0LA 3L82B 1BX1A 1SKAA 2DGDA 4P82A 1FJGB 3F47A 2V2ZA 3ZPXA 2WIAA 3G8CA 3H8VA 3LECA 1ILEA 2CVPA 5E9WA 4HBGA 3WDLA 4I4TA 1UC5B 3H2IA 1Z6PA 4XGNA 3LZDA 3BWEA 4FMCB 3OQHA 4EGJA 4LJRA 3ZV4A 2IZ0A 3FLBA 1XF9A 1K7XB 3HV0A 2IHZA 3COWA 3NYRA 1YSCA 2PBFA 3EQ8A 1GY8A 2P77A 4OEHA 5G40A 5F64A 4Z8XA 1GKKA 3R3WA 4BKUA 1HLPA 3CRMA 1KH1A 5AT1A 3QU5A 1FDVA 1GFZA 3OJ0A 5KYVA 2FLVA 4HNVA 2HFUA 3BX1A 3IBYA 2CFTA 1YMVA 2SKEA 1TQHA 2LZ0A 4FWBA 4B3RI 2VKTA 1KE2A 1UBUS 3OF2A 1H5UA 1MU0A 3GH3A 3UMSA 4DV5E 4XEUA 5CFRA 1DQNA 4MEBA 1US8B 3W7VA 2I62A 3DL4A 1X8LA 4Y2TA 1RWKA 1YQDA 4TTIA 4DNOA 3OTOB 2TMDA 4QREA 4BX0A 2RGNC 1YWGO 3W6UA 4FFBB 3G0IA 4YTEA 1S3GA 4MH0R 3K0EA 5JAQA 1NG1A 1HZJA 3QHPA 3V1UA 1OXBB 5B7QA 4M49A 2VF5X 1P9WA 2YRWA 1GTMA 4WJLA 1UKBA 4ZOLA 1E58A 4IJKA 3RIXA 3GVHA 3EFHA 3J81Q 3DD6A 1MP0A 3OLQA 4Q4JB 2G9NA 3LO8A 4JB8A 2Y0PA 4KGVA 1TI7A 3L6DA 1T2VA 1N2GA 1B63A 3DE6X 3HMQA 1VFNA 1Q7GA 3L8YA 4CMBA 2AEEA 2O2ZA 2VDWB 4HDKB 2NXWA 5H3HA 2ZXUA 1GU7A 2Y66A 4HXZA 2PSDA 1YUBA 2BEUB 2AOVA 1PLKA 4YRCA 5KIAA 4G0VA 1NLZA 4NPCA 5JS1A 3KEGA 1ZH6A 4Y2UA 1IEWA 5IF3A 5AHOA 3G59A 2W2PA 1CEEA 2HA6A 4MW2A 5DN6A 4I99A 2WNHA 4JI1E 4YMLA 1WY5A 1PWEA 5DDIP 5DROA 1GCUA 2PLWA 3RJ9A 3ZGXA 2FWMX 1JB9A 3SS9X 1CNEA 2JCBA 1GQQA 4NZOA 3AWIA 2OHJA 3DZGA 3FNFA 2VHUA 3WXMA 2FWIA 3ELYA 2NPIA 1AGPA 2BGNA 4YRSA 5LIRA 1JYFA 1DXQA 3ZXSA 4QXMA 4A9AA 2W2LD 2DPLA 1MRSA 1KDPA 1Z38A 3EEQA 4MKGA 1I10A 4WDQA 4US0R 5CD9A 4TT3D 3PUIA 2JGMA 1J9ZA 1OZGA 1C4OA 3PNBA 3TLEA 1T26A 3QIAA 4L95C 3NI2A 3G9ZA 1E6CA 3PK0A 4JS0A 1ATZA 2OM6A 1XEWY 3C5CA 1UMCB 4B3SI 1E2HA 1HR0I 1U7XA 1R00A 3MMPA 2B3DA 2BEJA 3QG1A 4NYJQ 1O97D 1OH7A 4GC9A 1J25A 1GUFA 5AJYA 1CUWA 1EX1A 1EJBA 3DAFA 1SUBA 2ES4A 4MQYA 2XTNA 3GA0A 3HZRA 5IXSA 4DR1B 3K4HA 4HCJA 4BLVA 4DIKA 5BVHB 5JU6A 3QWIA 4FW5A 2G0NA 4LZOA 4Q1EA 1K5DA 1JU4A 2JLRA 1DWQA 4ZCQA 3UHOA 4ZI7F 1EBFA 4P2GA 1QO9A 1LK7A 2J85A 4P58A 4FWTA 1T2DA 1KS9A 1P7ZA 4I50F 3U4HA 3W5CA 2GK3A 3V8NA 4M6WB 3AF3A 1X7XA 1MA3A 1K3UB 2AI1A 2M9MA 3INRA 2BEUA 2HTEA 4GUDA 2C8VA 4LE2A 4WUBA 721PA 4AI6A 4F11A 1QO0D 1XXHB 3GPBA 2R42A 1FTQA 4KRGA 2XODA 1IIBA 5COBA 4LGCA 4EG4A 4R8RA 2HQSA 4YAIA 4KO3S 3UXEA 2OV2A 3KAJA 4ARCA 1SUFA 1DKOA 3PQ2A 5IHXA 4MW1A 3ITKA 1VIYA 4E2ZA 4ZO4A 4D96A 4M99A 4RMIA 4B3BA 1DUIA 3I0NA 5LZ7A 2PUVA 4N48A 2C58A 1U2GA 2MJLA 1STOA 2J0EA 1YHZA 3IP5A 5ELWA 1ZOIA 2MSKA 3OOYA 5AJWA 5H16A 4V1CA 2OC4A 3P9NA 3TIXB 1M6HA 5HUJA 2XVYA 1NM5C 1NBWB 1WSAA 2AHOA 2PMWB 1FS4A 3D6NB 1UDBA 2PEZA 2VDVE 4DV2I 4EWLA 5DXAA 2Y8EA 5CVVA 2PD3A 3M5DA 4JI6B 1WOMA 3QEAZ 1D9ZA 2Q3BA 3EXFA 2HO4A 3UV3A 4BLTA 2VWQA 4DZRA 3QF7A 1FFSA 4KQ9A 5DO9A 4ER5A 3HB7A 1RS0A 4TM7A 2VJMB 3C3JA 3OE7A 4GPEA 1A2OA 3P06A 2OGSA 2Q5LA 4XYEA 3SKVA 2IKQA 2XXAA 4HZUB 4B6RA 1RWQA 1NU6A 4XJSA 3D2LA 4MI1A 5BVHA 5I4BA 4J0JA 1DUSA 1ZBQA 4ND3A 4WOKA 4FW9A 1IK4A 2FSFA 2WMDA 4MICA 4B5KA 2D3WA 4AAYA 3FVQA 1Z2CA 2UAGA 4IR7A 4EHKA 5KUTA 1NXPA 3I53A 3IVGA 4C2TA 3C5WP 3LQ2A 5CG1A 1EM8A 1W9HA 3HG7A 2BFFB 4QPPA 1BXZA 2FN8A 4DUZI 2WNSA 1G1MA 5JFOA 2H1IA 2XVMA 3EGXA 3TD2A 2C42A 1CS0A 1LUAA 4B6PA 1UEJA 3ZC3A 5JTTA 3SZLA 1G8KA 3VH3A 2YL2A 2PWBA 2P4HX 2J3IA 1OTHA 3KUUA 1PBTA 5LD2B 2NSLA 3V7UA 4R8KA 2XW6A 1P61B 4OAPA 1C3VA 1XP5A 1C1DB 1NI4B 1DIOB 1Q91A 3DE7X 1LRJA 4MO2A 1VI5A 3ZVNA 3MSXA 3R3HA 4HLUA 2ZETA 1EK5A 3NYIA 4IF4A 4QTZA 4RV5A 3FWYA 3PC2A 1P80A 1TRKA 4ZOQI 3QFRA 4IXMA 2ZBGA 2RH5A 1KJ8A 4P7FA 3SS7X 1VE6A 4XXHA 1MXHA 5JHGB 4Q9NA 1EVQA 1Q0QA 1Z5VA 2AOTB 2R11A 2JAXA 1MEEA 2O3UA 2II6A 1EP9A 2Z57A 4Y30A 1FYXA 3UJ8A 2JFOA 1BDHA 3AINA 1OFUA 2GDZA 2EF0A 2X3YA 1BFKA 2BUBA 1RDFA 1XJWA 4RD0A 3EJ6A 4S05A 2AJ4A 2JFYA 2QUAA 4LRSB 4FJ2A 4LYGA 3CNQS 4QATA 1YDFA 5ANRB 4E70A 3KJZA 4R3WA 5DM4A 5CA0B 1NUQA 1E0DA 3I3OA 3L0CA 4QGHA 2JZOA 1J8DA 3Q3GE 4ZZ2A 3HXPA 3KVYA 3W05A 2NUTA 2OB1A 4ZCSA 4CYMA 1CEYA 4JYAB 2VA8A 1T5IA 3MF4A 3Q7PA 3HL0A 3AX6A 2HAEA 1EA7A 2C9YA 3AIIA 5F5XA 1ZKDA 3FWKA 4GXRA 4ML3A 5JNVA 1FY2A 4GSKA 4P7GA 5DB4A 2OTCA 1F48A 1WZIA 3CJTA 3CLUC 4L51A 4RTSA 3HXQA 2XQKA 2GF9A 2YXEA 1H2EA 2G80A 3O74A 1B14A 4GRDA 1Q2XA 4OHKA 4RSRA 1WUTA 3RE1A 1Y8RA 3ICWA 3WSTA 3ESDA 4EQ6B 4B81A 1XMSA 2QRKA 2WK1A 2YYZA 2PHZA 1J00A 3TKAA 4AS2A 1S2GA 2VSOA 4NEQA 4Q7JB 3FZNA 4E13A 3F6CA 4DJFC 1NN0A 5CU7A 2DFTA 2ANCA 4URVR 3OPNA 4ZC1A 3W5JA 1NR1A 4Y2XA 3ZCXA 4HACB 3O31A 3LPAA 4PW0A 1NPTO 2ID4A 2YUTA 2IGBA 3EUEA 4PC2A 5JAMA 3UJNA 2Q7DA 3FUCA 1BCRA 1YZVA 3A32A 4L27A 5AP9A 3AUTA 2BZSA 2ETVA 2CFRA 1WLSA 1WDTA 2AE2A 4FEYA 1U7OA 2LKCA 3JQBA 3PJDA 4QNJA 4QBIA 1CQZA 3RTBA 2ERCA 3WKEA 1WABA 4C7VA 5FWYB 2PSJA 1ZUHA 1MX9A 1KXZA 1Q7RA 3GXOA 4EARA 1OFVA 4DLUA 2P91A 3EC7A 3PD1A 3Q72A 3NUGA 4LRUA 4PWYA 2BTEA 2JI9A 2EWWA 3L7ZB 2IXEA 2YZ7A 3I01A 3KQOA 3QEKA 4QPCA 2V5UA 3PI6A 4K86A 1AKUA 3HVIA 1ICIA 2WTUA 1E1QA 1XFAA 1QE5A 3D1JA 2NWQA 2OORA 4AX8A 2YICA 1O5OA 4ATNA 4OLJA 1Q50A 2DLCX 3CQ9A 1ORIA 3C1UA 1P7PA 4EA9A 1P9OA 5CDFA 2JEBB 2ID8A 1K27A 1P9NA 2C4VA 2B4KA 2IYWA 3OIDA 3RS3A 3WGHA 3S5JA 2AYYA 2QVYX 3DZBA 3GVPA 1JQEA 3NBXX 5AMXA 4CM5A 3ZDAA 1PUIA 3A6JA 1USIA 4HWOA 3DNPA 1KTVA 1JG1A 4M9ZA 1U1IA 2WD7B 4DJ5X 1NJ6A 3A4MA 2BM1A 4M1QA 4B44A 3KB1A 1C8LA 1MX1A 1WDMA 2X13A 1T9ZA 3AU9A 3EVAA 2FR1A 3OJOA 2VUIB 2BFDB 5ALEA 4LF8B 2AWOA 1X15A 3BQ9A 3HNOA 3L9WA 4U7PB 3I04M 1FFCA 2P6OA 3RK4A 1D8TA 3CUKA 3WXBA 2D5BA 2XHEA 3MOSA 2WQ6A 4HMOA 1MB0A 1EUQA 3P9YA 3IUBA 5IABA 4YWHA 2YNMD 1QOPB 2AMVA 1M6WA 3BK2A 3GAZA 3EVTA 3LX4A 5FUBA 3EASA 2XCIA 2I91A 4FVTA 2NSJA 1F20A 2WWFA 3B6EA 4M54A 5EIOA 3TRJA 2GCPA 1U5BA 3EMVA 3P96A 4QXRA 1KI7A 4NS1A 5LWQA 2POQX 4OP3A 4F12A 1TA4A 4QPNA 4R2KA 5F52A 4BV3A 1SUSA 3CUEF 1IPEA 5EZ5A 4BX8A 4BQSA 2D1YA 3LKZA 5KNDA 1H66A 3I5UA 1I6MA 1UAAA 2C2ZA 1A4IA 3BT7A 4D56A 1VB5A 4Q6WA 1SK8A 3I6IA 3UWPA 1A9SA 1QIMA 1GUAA 4AC9A 1P39A 2NX2A 2PUTA 4K6FA 4UCQA 1FP6A 3GUVA 3GW8A 1YAJA 2YV3A 3HBNA 4EFNA 1NMQA 2H63A 2I22A 1W85B 4UBIA 5BNIA 3SHQA 5DEOA 1AQJA 4MLDA 4QDTA 1MVOA 3DGFC 1EU1A 3BL8A 3TDMA 2C84A 5TQJA 2F62A 4EECA 1SBQA 3DC7A 4V3BA 3KG2A 4L0MA 1Y1KE 4ZOCA 3TZ6A 1Y5YA 2JHGA 1V7QA 1BX0A 1TLTA 2Z95A 4H59A 4LJ8A 4QVGA 2OGZA 4E5DA 1YR2A 4DQUA 2PR2A 2VLIA 1PT9A 1V5IA 2A1UA 2L17A 3CEJA 3GLQA 3KT0A 2QYHA 4BNWA 2QTZA 2C9ZA 3N8NA 2J3EA 3HWX1 4EG3A 5ECWA 3FSGD 3DTNA 2XQFA 5HZGA 3GPCA 3UOGA 4B6GA 5DU2A 1E1RD 4UUAA 3B48A 4CW7A 4FMDB 2X4GA 5SV2A 4JELA 5A9SA 2R2GA 1G6KA 3L41A 3PUVA 5K3CA 3HKCB 4FYMA 4WECA 1CB7A 4A8PA 2WB4A 1ZUNB 3HSSA 2PUCA 4GYJA 1TUEA 2FZ5A 4P52A 4HH4A 4OH7A 5A5EA 1D2GA 1DBRA 2IKSA 3I6YA 5ALGA 1T25A 1ZLXA 4YHHB 1XCPA 1YS4A 3TTUA 3A3PA 5IZ4A 2WDPA 5CHEA 1PZGA 2DBVO 3FDFA 4BCDA 3UOWA 5THQA 5FUQA 4OK3A 3D0QA 3LUAA 5BXYA 1XCOA 2QN2A 2VEOA 4LHSA 5DNWA 1AS2A 2X6QA 5DOZA 1DU4A 4G0XA 4MZXA 4HC4A 3WIDA 1E2IA 2C59A 2OZLA 2WKRA 1NKTA 3P7MA 5K0EA 1B4DA 5LMNE 2AOWA 2BMDA 3KOOA 3QENA 3B1WA 2Y0EA 1Z4LA 4KRFA 4UAJA 4AQYB 1CK4A 1LQTA 4FN4A 2IU6A 3EVFA 5GJCA 4DBLC 2NP6A 4F2DA 2UUBB 4JT4A 2OPHA 2AZ4A 1LLUA 1PJ3A 2GPSA 4Q3NA 1UR5A 3ZDCA 5B58C 1O9GA 5HIAA 1ZCAA 2Z4RA 3EA4A 3JZDA 2IYAA 1SCBA 4HZIA 4DMFA 4IIHA 4BO5A 3CZ4A 5B58T 3D7KA 5AVUA 2CBXA 1PKXA 3PE6A 4KVGA 3EBOA 4RMJA 3UXHA 3VR4H 3ZUGA 2C4WA 3TGWA 2A33A 4DR7E 4YJ3B 4KFUA 3OLWA 2X40A 1EWQA 5DP2A 3CLTD 3PVCA 3IL2A 4QQRA 3WGJA 4HNHA 1N2CE 1QVWA 3KV1A 4Y2JA 3WJAA 4EUKA 3QOWA 4MVXA 1TEVA 1G20A 1V1MB 3NHAA 1OWOA 1K4YA 4KXQA 1YZYA 5EIBD 5C3UA 1T9GR 4IS9A 3A8TA 2OR3A 3W1VA 3H1CA 3Q40A 2WJJA 4D3FA 3EZNA 5BV1A 4HPXB 5TT0A 4H7PA 2XQGA 3GCMA 3E18A 1XROA 1U1DA 2EFDB 4I1SA 4R2JA 4X1KA 4B09A 1XJ5A 2J9GA 5FTJA 5LQJA 3HEBA 1Q1GA 1GUBA 3OLXA 2Z5EA 5BUCA 1I24A 1H0SA 2O1VA 2I9PA 3E2MA 4LY3A 5AXAA 1NHWA 3WNDA 1BW9B 3CNNA 3PHBE 1RLMA 4XZ3A 1AMUA 2HKJA 4XTRA 1PFWA 4PBTA 4PLGA 3IALA 3IIJA 1UFVA 4X7PA 5GONF 4J1TA 4AN0A 2O1SA 3LC0A 4RZHA 5NULA 4DCNA 1R4AA 2Z5VA 4Q01A 2BF4A 4YO8A 3UVEA 5T6BA 3PXGA 5KNCH 1DAFA 1Y7PA 2WTBA 2XPCA 5EP2A 2P1RA 3ND9A 4JG4A 3T0FA 1GHTA 1BXGA 2EFGA 3MT0A 3DUWA 4JBIA 3W77A 4MS3A 3RVOA 1U2SA 1ZFNA 3PQ6A 1KBQA 4S1PA 1EFCA 5AW1A 2WIGA 3MTJA 3OTGA 2R8EA 3KZXA 4MB0A 3V2UA 2V2QA 1DCMA 2FFQA 4KPEC 4ER6A 3EVNA 3IEUA 3B20A 2HT1A 1YS1X 1T5OA 3RSFA 4GR5A 1T5HX 1NXTA 4LOJA 2OLEA 4HTFA 1ZAKA 2PQ2A 1TAQA 2HBYA 1Y7HA 3RUAA 2FK8A 1S2IA 4MW6A 4BWFB 3D4PA 3TJRA 3GFQA 1OY1A 3JPYA 3R7BA 4BFWA 5DYYA 1MPXA 2W6PA 4G63A 3U3KA 5I3ZA 4LDZA 4ZT4A 2G07A 1E60A 1KU6A 4GBGA 3SHOA 2FLWA 1R6TA 4M9XA 5ALOA 4F38A 3F0TA 4KLNA 2OMEA 1F0PA 4LQCA 1IONA 1NVUQ 2VXOA 2ABWA 4RLFA 1XD9A 5KDDA 1Z29A 1SA0B 5FP0A 5TQVA 3MLAA 4NV0A 1PS8A 2YW2A 4R1OA 1QHEA 1JW9B 4N76A 3PEVA 1DO2A 1ONNA 4B3ME 1NBHA 1X1TA 3CKKA 3H8SA 4GPBA 4OXYA 2CMDA 4PCLA 2R9VA 3MWDA 3TIGA 3SPXA 1ZGCA 2E5LI 1QIHA 4X1YB 2CLKB 1FXUA 1GNPA 3DEAA 3HPRA 1EVYA 3H2ZA 3KKLA 4RGYA 3TW0A 3RJTA 3WYAA 3VAAA 4F5ZA 1XVIA 3TD6A 4NPHA 3VC7A 2N1BA 1DIHA 1LDNA 4NVRA 1K2VN 4DWOA 4EPVA 2UXDB 3D6MA 3K2QA 3MJTA 1SVKA 1YGPA 1QFYA 1SQSA 3Q0TA 4UNNA 1EEXB 2PX4A 2VSFA 3UK6A 1TEZA 1PBNA 4J1SA 1Q3KA 1SGWA 4FQ8A 3OAAD 3H1PA 3FOZA 1UOEA 3THWB 1K6EA 3QXCA 2IYXA 1RAGA 3M6VA 3DCNA 5K4GA 1CJCA 5G41A 2F4VB 4Q7LA 3GLHB 5CB0A 5E6RB 4HG2A 4ZWNA 4K9LA 2JGDB 4GP6A 5DYTA 4CTOA 5E4YA 3PFBA 2W2NA 1G8YA 1V11B 3IP9A 4GWLA 5DHSA 2C4TA 4B7AA 4DMRA 5A6VA 3HNPA 1QQBA 3DLCA 1WF3A 4QTTB 2WBLC 3ZS8A 2XT9A 3BFJA 1UP7A 1AOXA 1G55A 3ZKBA 2VHEA 2C97A 4OU5A 3WRYC 2OCXA 1DX6A 3BTSA 4B9EA 1HDGO 4N4AA 3PHHA 4F0JA 4HMPA 2XQVA 3VPSA 5J4YA 4K1XA 3IBTA 3CTPA 1C1XB 4XM1A 2BE9A 4ENWA 4PO3X 1TXGA 1TT5B 3MMZA 3PGJA 4TM8A 2XOXA 2H5IA 4QQFA 4D9EA 3THXB 2EGGA 2UXCI 1EBUA 5KQRA 1K3FA 4DDMA 4ZT5A 1USKA 3RKUA 3B78A 4XSGA 4Z7OB 2OCIA 3Q7TA 4LKRA 2BCGY 4F92B 1W7AA 3COJA 1ETHA 1UBKS 4X6LA 4B3FX 2YFYA 3TOVA 4JODA 4XIGS 3VR4D 4NMWA 5J3JA 5DIZA 2P2DA 2IUEA 2X2FA 4PO8A 2PZLA 4RF3A 2BY4A 2VBFA 2H2FA 4KO2S 1Z0IA 4U7HA 4OI1A 2YY7A 1MFZA 3UWOA 4G85A 2QZZA 4B4OA 5A4FS 5JS6A 1YBFA 4GI5A 2JJ2A 1KDZA 2BF7A 2HJGA 1Q7EA 3QEOA 1T29A 1NJFA 1P4HA 3I1FA 1GLGA 1E9AA 1MEOA 2C54A 3CONA 4RD3A 4DDHA 2ZIZA 3KYCB 3EVGA 1J90A 1XXLA 1V11A 1ZGGA 2WICA 4J91A 4WLEA 5BQ3A 3L40A 1XLWA 2NP7A 3KUCA 1HFJA 4GZ3A 3WU5A 5BV0A 2FAXA 4NABA 2RHMA 3V7NA 5D85A 4YT2A 3IQEA 2WYWA 3VX3A 5FIUA 2VF8A 1LV8A 4C78A 5BYAA 1W48A 4PLHA 5DGHA 2GRJA 1PDWA 4G25A 2HK8A 3U44A 1AQYA 5LJIA 4B2LA 4X66I 2EJWA 3F49S 1EFUA 3R7LA 3UOAB 4BP1A 1SBHA 3PQFA 1Y0BA 2XA2A 1U6JA 4L5BA 5AKJA 1JEEA 3KJEA 4B33A 3IVRA 4OBXA 1RXIA 4JKOA 3TI9A 2V7PA 4CM4A 2RD2A 4REQB 3G5LA 1E9CA 4ZCLA 2Q1WA 1JG3A 4IXDA 4AMUA 4DIFA 3K92A 5GP1A 3DA8A 3HVUA 1UBSB 4JJ7A 1M1YB 5ITZA 3LM8A 5I9SA 3BGIA 1HE2A 1E2NA 4KIGA 3VZRA 4DL9A 1RXUA 3RS8A 2MTBA 4D25A 3CDIA 3NKLA 5TE9A 3CVVA 4QDZA 1JLLB 3M7ND 2HA0A 3GHHA 4RD6A 1ZMXA 3BXEA 2HMUA 2VJCA 3E53A 1RWXA 1NQUA 2LE0A 3HFJA 3K72B 4YBZA 2PWPA 4KR2A 4KQFA 3FNQA 4W1PA 5CFZA 4AS1A 4U2EA 1KORA 2N3ZA 4ZYWA 2WQZA 4KN8A 2G1UA 1IDN1 3BGOS 5J2TF 4TPKA 4L8LA 4G0ZA 3LF1A 4KDEA 3RD5A 3RCBA 2ZRAA 1HYEA 1I6KA 5BN3A 2EP5A 3CMCO 3NH9A 1VKZA 3KWLA 1H4SA 1A5SB 2Q4EA 3J81C 2CDAA 2OFWA 3VC1A 2X0FA 1OASA 3I9V6 4DQXA 1FSZA 3JQ7B 3UTCA 1T4BA 5K36B 4OPMA 4KYVA 2QVLA 4FFDA 5EL9A 3FMOB 4GVXA 4EG7A 4Z4GA 3LUBA 4KBFA 4XPIA 4FYVA 4DPKA 3BD7A 3WIOA 1A97A 4AIIA 1OVGA 1S7CA 1KI6B 2XUIA 4JQZA 5TS2A 2O8EB 4FNAA 1GPYA 4EA8A 2C2MA 2PIAA 4NJMA 2EEZA 2QQ0A 3EXG1 4F9EA 5JEAA 5K6AC 1T35A 3V48A 3NIDB 3A3YA 4X8MA 4BS9A 4FS3A 3NNSA 3ZXIA 1YJ8A 2J5KA 3B5EA 4CLRB 2C9DA 3YASA 1BYIA 4NZPA 2QX6A 1I13A 1VI6A 5I9LA 2XCLA 1O3YA 3BKXA 5KKNB 2SCUB 3F6PA 5A5FA 4ZAWA 1LW7A 2PWAA 1QOQB 1I3CA 1BVYF 4F2GA 3W6ZA 3WOVA 1DPGA 2JL1A 5C9ZA 3U7JA 1JTEA 2ISCA 3CRVA 2A9JA 3LPNA 1UMDB 1BRMA 4GE3A 1E9BA 4E15A 3TQQA 1YZLA 5BWNA 2ZYRA 2NUPA 1UK7A 1KBOA 2ZB3A 1EZ4A 1N3LA 1U99A 3EE6A 4BNFA 1KERA 3WA7A 1CRPA 1BE6A 1JZSA 1PYDA 4JX8A 4WBNF 5JSZA 2DQKA 1FRNA 1TU4A 1CTQA 2VCEA 1JVSA 3U4IA 1JALA 3IAHA 4O4JF 3U4DA 4DY4A 5HJ5A 3C4QA 4HYYA 3TRFA 1OGJA 1S02A 3BZWA 5HUHA 3K0CC 1VA5A 5IYZF 1PL6A 2ZB8A 2E6KA 2CE2X 5B30A 4OXXA 3X1XA 2QSJA 5BWLA 5K36A 1BKYA 2BVNA 4PICA 1JQLB 2UZ4A 3ZWOA 2VQEE 1PGOA 1RFLA 1C0KA 1J1ZA 1BDBA 3N8DA 1C9KA 3DV2A 4AW9A 2JFUA 3IKTA 2N1MA 1NQXA 4UARA 2C3OA 4FQ7A 4M60A 3H2GA 1Y9JA 2JJ8A 1R6UA 4RKYA 1SPBS 2Q7XA 4CQLB 2BFAA 2W43A 1WCXA 3A0RB 4EL0A 4YRGA 1VRWA 3RS5A 3G2JA 3WWEA 3GLFE 1YVEI 1ZXBA 1M1ZA 3BWCA 2CSXA 5IDXA 2XWJI 3PFFA 2ACVA 5L3ZA 1SHKA 1W4BA 3FGNA 3L4SO 4IZJA 5EUQB 3EIXA 4B6JA 4D4LA 1V1RB 2C9BA 3NBAA 4J1NA 5BV8A 4KR0A 4Q18A 5KX5B 5JMWA 3ZCSA 2ZJ7A 1M6VA 3R76A 1K0FA 1KAQA 2YOFA 1XFDA 4RVGA 4WCDA 4UREA 3LT4A 4W5NA 2W4IA 1Z35A 1B0ZA 2I4IA 4C05A 3MTDA 4G0MA 2YWHA 4P1ZA 4RFSB 1N5MA 1C0LA 1ZI8A 3IUNA 4Q4DA 4YC7A 4DV3B 2ZWIA 4F6LA 3ZY6A 2HF8A 2J6CA 4CMHA 3WYFA 4NOJA 1Y6FA 1MAHA 2WM8A 5KOJB 1EUDA 1E8MA 2AH5A 1UMDA 4KH0A 1MOSA 5AXBA 4JFAA 3UMCA 4Z4FA 2BFOA 2RFLA 1Q20A 1K88A 4GQUA 1NBMA 1Q74A 4MVJI 1ML4A 2FZLA 1Y3DE