1HK7A

Middle domain of hsp90
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
248
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK PROTEIN HSP82
publication title Structural and Functional Analysis of the Middle Segment of Hsp90. Implications for ATP Hydrolysis and Client Protein and Cochaperone Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 75
structure length 248
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hk7A01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hk7A02
2GQ0A 2O1TA 1Y4UA 1USUA 2CGEA 3HJCA 3PRYA 2O1VA 3Q6MA 1HK7A 1Y6ZA 1USVA 2CG9A 5FWKA 2IOPA 1Y4SA 2O1UA 3Q6NA 2O1WA 2IOQA
chains in the Genus database with same CATH superfamily
5SICE 3CEAA 5BWOA 1VSTA 2XT0A 4JC8A 5B1HA 3R6DA 2ZB2A 4Z3KA 1U9IA 4BVAA 1DKOA 2IUSA 5F3WB 4DNPA 1OV4A 1PI3A 3FFAA 3IPRA 5DE3A 3R5SA 4MU4A 1RD4A 3HU5A 1V7CA 4FJ0A 4OEHA 2ZJ5A 1R0RE 3BK7A 4RK6A 4HWRA 1ULZA 3PK0A 5CXUA 2XMRA 3SF8B 4C6SA 4C87A 4TMVA 4AS1A 4DMUB 2UKDA 3O2NA 3E7XA 4RVGA 3HHEA 3I3SR 2EW8A 4PHGA 1LTHR 2Z4TA 5JNLA 3M85D 3NG1A 5K36E 1ZBDA 4AAYA 1OAOC 3ANSA 2D4HA 4JI6I 2RHHA 3HSSA 3MWEA 4MV9A 4UFNA 2R62A 1DRKA 3CXUA 1ZICA 2F17A 3H99A 4TL8A 5T5QA 1JDZA 3PXUA 1GCAA 1TT5B 1UPFA 3QLTA 2WFZA 3KJHA 3WS7A 2WNSA 2GPJA 3B6ZA 1OTYA 4FYVA 6REQA 3E7PA 2UZ1A 3TB6A 4X6XA 3R9WA 1II0A 1DBIA 3VSAA 3WLJA 1CR1A 5DNWA 1E5DA 4CTMA 4D0SA 1RMQA 2GPNA 3HEMA 3F3KA 5EGSA 3NI2A 4WGFA 5GV8A 3ICWA 1I7NA 2ZUEA 5E2AA 2XPCA 3M85G 1M73E 3ADDA 1SHLA 4B79A 1ZSVA 2BKAA 2RI1A 3EDMA 3UICA 3O90A 3TM5A 4DMLA 5KO2A 2E4WA 4JT8A 1U2GC 4JHLA 5I48A 2PX4A 4QBHA 2HBYA 4DPWA 2PS1A 3BCRA 3TO5A 2PRSA 4D46A 3NNSA 1I33A 1X19A 4PX5A 2VYVA 5FUVA 3ID6C 4MQ5A 1KJ9A 4Z0TA 3ZUGA 1PS9A 1P9NA 1CNFA 1FOEB 1C9JA 4Q9NA 4DUZB 4IH1A 3ZD8A 2C9OA 3D8RA 3WU6A 4BO5A 1D8AA 1SZJG 2P4EA 3WQBA 3C7TA 5FTWA 1AKNA 2Z56A 5CLJA 1YFJA 1W8IA 2QZJA 1ZHFA 3ZHSA 4CRWB 3V00A 2GSDA 3FZQA 1U7XA 4ND2A 4J2TA 4YJ3A 4E5YA 3EPJA 3HQ4O 4K26A 3RCBA 3SAJA 2O8CA 5A4DA 1TC1A 3ROFA 3SK0A 3G59A 4XYBA 3L8ZA 4JMPA 1I6WA 5LXTF 3T1HE 1A4RA 4DREA 3H1BA 4K9DA 3CF2A 5EE5B 4RHFA 1HKHA 2BMAA 4BKQA 2FSVC 1W581 3VVMA 4DLRA 1I7PA 1FDWA 2P8SA 3CKYA 4JJKA 4NLLA 1HEYA 3P19A 4RW0A 2IZ0A 4AX8A 3R5FA 4KYTA 3DW1X 3OOHA 3FG9A 1C7EA 3M89A 4PG7A 1XJWA 2QPOA 4JLBA 1E20A 1XQVA 1Y4DE 1R18A 4IDEA 2V54A 3C6BA 5IJWA 3AUYA 3E4CA 4YCMA 1ZOPA 1EI9A 3H4LA 2OBFA 1PUXA 1RPTA 1S2MA 4LOMA 2G8LA 4CTKA 3NR2A 3L9XA 1OXUA 3KFVA 4WY5A 1JEYA 3VR2D 3QBDA 3A05A 4ZAVA 1UPTA 1T4CB 2H54A 3OLQA 5BO5A 3VU9A 2AV6A 3V2UC 2V7BA 1ORRA 1B8NA 1IEWA 3PICA 3PKZA 1NNI1 1KU0A 3IDQA 3BGDA 4TTVA 2N42A 3P0RA 5AVYA 3KS9A 1UKYA 1ZVVA 3FNEA 4L5IA 3CPSA 3L0YA 3JQRA 3W9BA 5C7YA 1L5KA 5JFOA 1F6BA 3GN2A 1JDBC 1XEAA 3ELYA 3D6MA 4L78A 5GGXA 1U3FA 4ZALA 1XYVA 3JATA 4ALKA 4BN5A 1N34E 4BV9A 2VTDA 2C2BA 4NFHA 5HTKA 4Z5XA 1UBGA 4LQDA 1VMDA 2WJGA 3K4PA 1JBEA 5FBRB 1TI7A 5KKNB 5DGXA 5EE9A 4Q03A 2PUDA 2B1IA 3OIWA 2JGMA 5K0LA 1N6IA 5GMDA 1VTKA 5EJFA 2VZ8A 3L3BA 4LYFA 5TF4A 4XGKA 2XSZA 2YRXA 3GJRA 3GFOA 1QHGA 1XEWY 1DO2A 2FEWB 3EJ6A 2HHHE 4HMPA 4MS1A 4LBZA 4X1KB 4DKXA 8LDHA 1GAEO 3HR8A 1P7YA 1Y6QA 3ESAA 2BMFA 4M9CA 2FHPA 3MXTA 1T15A 4MI3A 4HEA6 4R2XA 1WUIS 1DWOA 2HIGA 3H9GA 3J81C 1B1CA 1CTQA 1UQTA 3KPWA 4PPFA 1GQYA 1PZHA 3WIBA 4AECA 3U5TA 1ID1A 1HFJA 3H5TA 3LF2A 2CF6A 1GKUB 2QE7D 4PHFA 4OGWA 2DFPA 5AK6A 3ZE2B 4CKXA 3E2MA 3WGGA 5LU9A 1Q95A 1OE0A 4JV5E 4D5GA 4LZAA 3MT8A 3GIDA 3IAUA 3IELA 3W5VA 1GAXA 2AE8A 1A96A 1F0NA 3L8DA 3D6NB 2DX7A 2UYGA 2MTBA 3COVA 3HLTA 3N2GB 4JC0A 5F2OA 2YJ3A 4JL8A 2BL4A 2PXCA 4MW7A 2CK3D 1ZMTA 3VH1A 1W1UA 1BOOA 2Q5OA 3L8HA 4WJLA 2WFMA 3UENA 2BMJA 1TUBA 1YZKA 3GA7A 1E9SA 4LJLA 5JAMA 1N7JA 1VRCA 2B4AA 3WGLA 4M9UA 1F0PA 2P6PA 1DDOA 3OIUA 3UQZA 3IPCA 2XVMA 2QJOA 3OZFA 2O5VA 1YGPA 2CVHA 3NX4A 2HREA 4XD7D 3RNOA 3SIPA 5IT4A 4ARCA 1Y82A 3QXGA 3CUKA 2NSHA 2ZITA 1WCIA 1Q3HA 2CHEA 1AGNA 4NIMA 4I4NA 1PR9A 1DJLA 1FLAA 1TJ4A 2VBGA 4RTKA 1MO6A 4E4YA 3KVVA 3HYCA 3MJVA 1QFXA 1HMYA 2Q5QA 5H70A 3IUNA 4ZA2A 4ZQBA 4Z49A 3BMCA 1DARA 1ODLA 2WTNA 3D3NA 3DO8A 3VR1A 1V4BA 1H0RA 3TQRA 3UJ6A 3ZHYA 2B4QA 1VKRA 721PA 1Q20A 3ODGA 2ZRFA 2ZU6A 4LVNA 5T6MA 4J0CA 3QT8A 1RZUA 2GCOA 1N3YA 2XAUA 4UEQA 3UG6A 5JFGA 3ITNA 4IFDD 1SVIA 2WILA 1BE6A 1E7RA 2VBIA 3O7MA 3NHJA 5EJIA 4B40A 3HB1A 5ALFA 1N5JA 5FPPA 1XRNA 8ATCA 1W1WA 5JYCA 4GG1A 2GN8A 2I6TA 3ZBTA 5C1DA 3G23A 4FT4A 1AMOA 3CZAA 2AZXA 4EGAA 2VK8A 3HVUA 3C3PA 1BNCA 2YNMC 3A1SA 5HRAA 3ZH2A 1VLQA 2QR2A 3FNGA 5K2MA 1WUUA 5DLEA 2O3QA 1E77A 3TQTA 1QTQA 4YCAA 5IBRA 1U6IA 4LOJA 4ZZ2A 4UUAA 4LDJA 5FJJA 2R84A 3O8OA 2PZGA 1RWBA 4GMFA 1MMFB 4OUDB 2AC7A 4B4KA 4BFWA 2QGZA 3HKCB 2DFVA 3H9QA 5FLKA 5L45A 3H86A 4MZDA 4ZMSA 3CISA 2IS6A 1NJ2A 3P9IA 4GMXA 1LLCA 1O54A 4B4WA 2REQA 1KGDA 4QBTA 1U0OC 3V46A 4JJGA 1FNSA 3DEYX 5K7SA 4RD3A 1A9OA 3TNJA 2IY7A 1OI4A 1J24A 4K03A 3FJYA 2J3IA 3DVLA 3QVOA 4ETMA 3LRXA 1AB5A 1XRSB 1JHRA 2IV3A 1OVMA 3SX2A 3DEFA 1KK0A 3GIWA 4PNPA 2ERCA 1UK8A 4XWGA 3FYSA 5DOZA 3PPXA 1M6HA 3EVFA 4PSCA 2XDYA 3F6EX 3WGIA 3AVQA 1BKYA 2QRVB 1T0PA 3CIOA 5AKZA 1J39A 3NTOA 5SYMA 4C89A 3NVKI 2C4NA 3MOGA 2UU9E 1ZJJA 5C0XD 1H1LB 3E8XA 3I6YA 4NE2A 2B1RA 3IP1A 4UQLA 3EWIA 3IEPA 3MAJA 1CB0A 5EQTA 2V9ZA 2Y0CA 1XTVA 1JSRA 4LHWA 5U4XA 1L7RA 2XUJA 2LCQA 3OT1A 4YIHA 1TPYA 3GGSA 1Z83A 3M9XA 5DGHA 2XUZA 4UUMA 3MTQA 2XMBA 3SZOA 4L2IB 1T0UA 2X3FA 4IRUB 5F4BA 3AVTA 2QROA 3MQ2A 5T4EA 2HDHA 3EK2A 5FWNA 5K0JA 1KMIY 2JAOA 2MINA 2V2VA 1P0CA 4GPD1 3VJKA 3K9WA 3NBZC 1SXGA 4TLAA 5GIOE 1GVHA 3Q1LA 3E9MA 3ROQA 3UO8B 2J0VA 2P9CA 1I1HA 1QF9A 3DNFA 4FS3A 3HRHA 4HJRA 4UD2A 3OX3A 5IJ0B 3B6IA 1NR7A 3CUTA 4LSGA 2YHSA 1MFPA 1JA9A 4HNGA 1YI8A 2XNSA 4CIAA 4H60A 3ZWYA 3OBIA 4FONA 4DG5A 5BSFA 1PUIA 1NJSA 4DQLA 1G3UA 3PLNA 4WHMA 4ZCRA 4WKOA 3W9SA 4DYVA 1G8MA 4PHHA 4LFAE 4RTJA 4NBTA 5KTRA 1DQNA 4WLNA 3OBBA 3T1YI 1WSAA 4MV1A 4DUPA 5JY6A 1EB8A 1U04A 1BEZA 4EHKA 3CLKA 1AE1A 1CR0A 5C8DA 4GO1A 1P6XA 3OPMA 1CV2A 4GVXA 1XZEA 1NMEA 2LE0A 5CX4A 1YTLA 3DXXA 1M8PA 3HRKA 1IOWA 2OV3A 2P2SA 3K3PA 1CVLA 3PUYA 3RTDA 3HUDA 3EIXA 3IT3A 1R4AA 1QGAA 1L5YA 2AQHA 3JARB 4B3RE 4HC4A 4UE3S 5LZ5A 4OX9Y 3RS0A 5IVKA 3L7AA 1AN9A 2Q2NA 2YBDA 4OKSA 4AXXA 5CB4B 4K28A 2Q45A 1CDOA 2OP0A 5DIFA 4WDQA 3VTZA 1PZMA 1GPWB 2LGJA 1Y8QA 2QMZA 4GM4A 2Y1XA 2HGZA 3W5HA 5B55A 2RG7A 2V4UA 2O3TA 2WFLB 4JVOA 5T57A 4ENWA 3QX9A 5KYVA 1YRHA 2OV2A 5DLPA 3ROKA 5D3KA 3M7ND 1XQYA 1Y0BA 3N8DA 4K88A 4NAUA 5C5EA 5ELMA 1WDLA 2MSDB 4YP9A 4B7CA 1TNDA 3U37A 4M36A 2B2XA 3GLIB 2W2NA 1BS9A 3DJYA 4HWKA 4KGDA 1H0HA 2UUAB 4EY5A 5CBPB 4R5HA 4D45A 1G3QA 1QIDA 3C7KA 3OCYA 4HLCA 4U7GA 5BOSB 2WYWA 3GEIA 3DE1X 1DXYA 3EG9B 4B82A 4GKKE 2YWFA 3SF0A 3G13A 5AVTA 4XX0A 3QENA 1Y60A 1Y6ZA 4GLOA 3U39A 2PBFA 1PJSA 1COZA 3QUCA 1KDVA 2ECQA 2J0SA 3CF0A 5IJXA 3OZEA 2RGXA 3N07A 4NZOA 1BXGB 2M2IA 5LQKA 4M3NA 4Q00A 3M7NG 5KI6A 4YUYA 2OAP1 3H7IA 1YBHA 3MBOA 2EARA 4MDYA 2L42A 4YAOA 2XZOA 3C85A 1TCAA 3L6RA 4OG2A 2PZLA 4MVJH 1RIFA 4PRLA 2O1EA 4PQGA 1M2HA 2EZ9A 1OX4B 3TFWA 4B3FX 2QZSA 4EAAA 4F1KA 4ZGBA 1UXIA 4WK2B 2XXAB 4DDKA 1H9CA 4A8JC 1R7RA 1Z36A 1ZU5A 3C41J 5CXSA 5A7HA 2OFPA 2H4YA 3CU5A 4XTJA 1QZUA 3H65A 3HUEA 4FW7A 4R3NA 1O3YA 3OO0A 2HNKA 3LP8A 2WWIA 2W6JD 1XMSA 2H85A 1J22A 4QQRA 4UKDA 3REQB 4D0RA 4ZAYA 3MWDB 1HYGA 4XB2A 4QFBA 5I7HA 3EEOA 1QQBA 4KN9S 1W94A 1MXFA 4EY7A 3V2IA 1SOAA 4FUQA 2K2WA 4LF6E 3DQQA 5HBRA 4CQLA 1GFIA 2UV8A 5KOHB 1ZHHA 4BQRA 1MU5A 3AYXB 2VT2A 2H4JA 2VQEB 4OBBA 4AQ7A 1ULHA 2EYQA 2V3VA 2YXEA 3TI9A 5L6LB 2BHLA 4L1KA 3RRMA 2D5LA 2IYOA 3D8UA 4PTLA 2ISCA 3LCCA 4NZYA 3M49A 4MJ7A 2FUG1 1L7NA 4F5DA 2BEUA 4YYZA 4CIBA 5BR8B 3BCUA 4FHCA 3T5GA 4TV9B 2VQFE 1ZH2A 1CQIA 2QT1A 5JATA 1RLIA 1G8AA 5AOVA 1EEHA 1NV9A 1NYQA 4BU1A 1RZ3A 1MO3A 2E1PA 1KYXA 3GGOA 4HDNA 4XQ9A 4CDRA 2ZKLA 1TA9A 3KPJA 4JI5I 2P30A 5E1BA 3TGWA 2VQ6A 4N0QA 3A9TA 5LZ8A 2C5HA 1MHTA 1P2GA 3ZZ0A 5E1OA 5BV8A 1JT9A 4H31A 2NXWA 5PGMA 3I61A 4JP5A 1KAQA 3MC1A 1A2KC 1KSJA 5A5FA 2H2IA 7ABPA 1XWWA 4W82A 1SBZA 3HFJA 1NW5A 2R44A 2ZRLA 4TKLA 4W5JA 5CCBA 2JAUA 4X64I 4KAJA 2DXIA 1J5XA 5HIAA 4ZREA 5HIIA 5AVRA 2C77A 1BHSA 3QTLA 4MKGA 2DQKA 3SBXA 1EX6A 3I5YA 2OLJA 3GMSA 2VDWA 1QP4A 5I7SA 1X2EA 1EBFA 2X8AA 5TGZA 4URXR 1AMUA 5CB0A 5C46F 1ESDA 2H4ZA 4M9RA 1NJFA 4EG1A 5IFLA 1JHYA 4R1FA 3NH9A 2ZEJA 4YFYA 2BF4A 4EQZA 1XI2A 3OPVA 2FXVA 3U5ZB 2HQRA 1P81A 1AD2A 1Q92A 4JBGA 1GARA 3C87A 4ALNA 3P0HA 3K20A 4GP9A 4IDOA 1YR3A 5EWLA 1BN6A 3GWGA 2CC2A 2FMIA 2G5TA 2GJ9A 3ZD6A 2XCSB 4QAJA 4Z7QB 1A7JA 3K70C 1UZAA 1XPRA 2YYYA 5D7NA 3WL7A 1G18A 2R6FA 2V7VA 1SD5A 1BXZA 4F8EA 2CXNA 1UK6A 1VP3A 1J25A 1CR6A 2FG6C 3T7IA 4Q4DA 3EA4A 1T6XA 5KKCA 3C3KA 1OJ7A 2Q6LA 2CCJA 2QUIA 1HDZA 1E0AA 3RIHA 3EEBA 3U3RA 1ZONA 3QJYA 5HMLA 4CKBB 1CR2A 1EDOA 3MWKA 5KYXB 3TTVA 1E99A 3W79A 2Y1EA 3E9YA 3P9YA 3HXLA 2VHCA 4MCHA 4LI3X 3G7UA 3UPUA 3C7AA 5HQ3A 2V7GA 2DETA 2IYZA 1HQKA 3I1YA 1QTIA 3OEYA 3LQRA 3KQOA 3HULA 1ZI8A 1AS2A 2BP7B 3PBKA 5BRNA 4ZI7B 2B9VA 2PS0A 1CZNA 2RHBA 3GFRA 3MN1A 3N0RA 2ORYA 4EA8A 5IKPA 3IVAA 3B89A 3RRNA 4J1SA 4RY9A 3JAMC 1UEJA 5JD6A 3OFND 1TAGA 3A2NA 1M6NA 2CVEA 5A0TA 4ZRDA 2QN7A 1K6JA 5AK0A 4FN4A 4P1ZA 5AK3A 4E31A 4YJ2F 2XHEA 2G80A 4GGMX 2PUBA 5ITWA 2HK3A 3U56A 1B41A 3QF4B 1YH8A 2AI3A 3BWMA 3GPCA 4X62B 1G0OA 5A4AA 3CX3A 1YWGO 4U8GA 5BMOA 1P1IA 4PZEA 4ROSA 3U7RA 1BXRB 4R9UC 4V2IA 4PVCA 3MWFA 1P0QA 4MWGA 1XD8A 3UMSA 1ECFA 1GN9A 3QFSA 3KB6A 4I0WB 4RPKA 3R8XA 1Z7EA 3O91A 1KH2A 4GVPA 2QMEA 1Z4IA 4EHJA 2G3YA 5I51A 5K3BA 1MB2A 4I2NA 3L7ZA 1PGOA 2RGCA 3BHJA 1J5EE 3DLIA 4JI8I 3TW8A 2Q1XA 3E9RA 3FPEA 4XVCA 1SKUA 3LZDA 4GYYA 3ZHXA 1UKZA 4M1TA 5EI5A 1I4EB 1ZL0A 3VYVA 4M7RA 4MX8A 4P4NA 4CLXA 2V2QA 3OQ1A 1OKKD 4DUGA 2YMMA 5EE3A 3I0NA 4G9EA 4XTRA 4U6NA 3OM1A 1C1HA 2RK3A 3MUOA 5K0NA 3QY0A 5AW7A 5U9CA 1P61B 1JBQA 1WWKA 3VKWA 5GJWC 4DWVA 2XMPA 3F6SA 3AVXA 1ZUNA 3JXEA 5BSMA 3W7AA 4RGBA 1UFOA 4BX8A 3W5SA 1D03A 4BNTA 2IYUA 2IHTA 2VJLA 1ZISA 3OLYA 3KVYA 1JJ7A 3ZU4A 3A9RA 3NBXX 4HNHA 3KVNA 4FE3A 1YQWA 2EGHA 4Q7JB 3NWPA 2R96A 3DUFB 4N39A 4XCVA 5AXAA 5IDWA 2PUEA 4Z9FA 1Q84A 1G6Q1 3RUFA 7AT1A 3PXDA 1KO8A 3M9WA 4II3A 1L4FA 1TQ4A 4JH0A 1RWXA 1SIWA 4IFIA 4EDFA 1MV8A 4KPEC 2F4VE 1Q22A 1G55A 2F8MA 4H1UA 3TG2A 2GD0A 3VO9A 3GROA 2DECA 4AN1A 2ZIZA 4F5ZA 1IUOA 3ESBA 2GA9A 2GPTA 4XRGA 5JHHB 3R2JA 4J7UA 4Q3LA 2X19A 5I6DA 2GJKA 3MOIA 2NU8A 2JFXA 4G2NA 4C2AA 3UHFA 4DLBA 1OH6A 1JQBA 1VL1A 4LXTA 1PWYE 2Z2IA 1RYEA 5AVKA 3W2IA 2LKCA 4DA6A 1P62B 4DLYA 4ZEOA 2H0QA 1PWZA 4IIGA 1A4IA 3IGFA 5IDVA 2X42A 3U3JA 2PUFA 3P52A 3EPRA 1AKTA 1KS2A 5E6SB 2JGDB 1FBTA 4GWLA 3UM9A 1L4LA 2EIXA 2FUG6 3IV7A 3K1AB 3NORA 1WCXA 4WOBA 3AUSA 1L8XA 3BMOB 1AO0A 1O0CA 1BX3A 3F6CA 3CE6A 1PT8A 4IDAA 5HFJA 4AY4A 1UF9A 2GVNA 2IE0A 1V8DA 3V4FA 4YP1A 1JSCA 1CYEA 3BL6A 1KOJA 5C5DA 1Y9ZA 2D2FA 2F62A 5L4LA 4IR7A 1QYDA 1SC4A 4LJKA 2H5IA 4UEJA 1Q12A 1U28A 1JDJA 8ADHA 4REQA 2I0FA 4DCCA 1N7IA 2NVBA 1J5PA 1A04A 1ONOA 2FE1A 3X2EA 2P3LA 4D81A 3PP8A 4KW7A 2I9PA 1SC9A 3I6QA 2G9VA 4RACA 1AK2A 2X2PA 5DBOA 1MNQA 2A3RA 3WHIA 3J81Q 2QAJA 2OV8A 4OXQA 3W6OA 3B6KA 2CXSA 2R9VA 3NVMB 4IGAA 1CBUA 3MNFA 3HA5A 4NS4A 4KWCA 1VE7A 2AXQA 4URHA 2DUUA 2IKQA 4EB3A 4KRYA 1QHXA 1DHTA 2H1RA 2I2DA 2GZDA 4G8JA 2HIMA 3VZBA 4CM4B 1YS4A 1H3NA 2YWRA 5JJ5A 1PJLA 2HSZA 2Z2ZA 4YRAA 1OYSA 2QU8A 3G5MA 1K7EB 2ODBA 2J4FA 5C4GB 4QRHA 2VHXA 4YV0A 2PFSA 4O4JA 1ZL2A 1LDBA 2OI2A 1IEQA 2FU5C 3BE4A 3TOCA 2AOUB 1UDWA 3LIPA 1E1CA 3NKVA 5EUQB 2UXDI 2A4KA 3DHVA 4IG4A 5FV4A 3IAEA 1ODIA 2HK7A 1U8EA 2GZHA 3W9UA 1UZUA 2XTNA 4IMRA 3QH4A 4Q3DA 4J3NA 5C1PA 5B3JA 4EL5A 1J09A 4IKOA 4JENA 1B3RA 1LLQA 3PL1A 3Q72A 4M83A 4D2IA 3JAWA 3RU2A 3CZMA 3DMDA 2QXYA 3VVBA 2DEUA 4QBGB 4HDSA 3ZWBA 4UD6A 5DYTA 3GDFA 2HL6A 1B2RA 3BMNB 2C9MA 3W90A 5FWKA 2V0NA 3BMQB 1JILA 1DJQA 4XJTA 5DN6A 2WAXA 1HBJA 3BVPA 1H94A 4FHDA 4BMPB 4Q39A 4RJ2A 3MTGA 1T5IA 3MUEA 4LGMA 2I6SA 1OXBB 4Y2HA 2EBWA 1JQ5A 1LD3A 1SC3A 1H2RS 1S9DA 2G72A 2LCIA 3E22A 4C4RA 4D4HA 3U44B 1C1YA 1W35A 2P75A 1IIBA 3NONA 1U0JA 5EWMA 3WWEA 4H17A 1ADJA 1Z33A 2XT9A 1LZLA 4JY7A 3RVQA 1IUNA 3ZM7A 2B69A 3KHKA 4ZYVA 1URPA 2P0EA 5TQ2A 1DX4A 2QPTA 3C4VA 1T5OA 3HU3A 3LYLA 1Y42X 4M1SA 4BO1A 4CL0A 1DZ3A 5CVDA 4N4AA 1L4UA 4ZOLA 1T13A 4IIBA 1HYHA 3IX7A 3ZDRA 2VYCA 3DM9B 4NJMB 2JHGA 4DR6B 2RGDA 2Y67A 1D2AA 4Q3KA 1QOZA 4K3UA 3BZWA 1GHTA 3D1VA 4YQYA 1H8EA 1JDSA 2BMEA 3R7DA 4KMRA 2JJ1A 2JFWA 1YDFA 3F49S 3OU7A 4MB6A 1EVIA 2NNWB 3KUXA 4UM5A 1EFVB 1RLOA 2AJBA 4Y2PA 3DLBA 2BKEA 1I2AA 1PKPA 1GOTA 2LKDA 2BMVA 3IESA 2ZULA 3ZUPA 4QECA 1SA0B 1KK3A 1I8TA 2AL7A 2P8JA 4BO4A 4DV0B 1P29A 3IH5A 5E3JA 4MCAA 4OHOA 5LMCA 2LJPA 4BFLA 4JQZA 3STTA 2Y8EA 4N48A 4MRVA 4Y7CA 3BICA 5E38A 4AKEA 4BNMA 5I8PA 2O4UX 3SC4A 3DLHA 4J7XA 4B6RA 4DA4A 1H1DA 2PNZB 1XYGA 2PZKA 4MEBA 2JLQA 4CM6A 4KNYA 4NFYA 4UDOA 1SUWA 4MKFA 1PT6A 2FWAA 1YA6A 2F43B 4FDMA 1GG5A 1M2VA 3SZRA 1T2EA 2XCQA 3OWHA 1AURA 5FUQA 1XPJA 3WHPA 4HDCA 4IIYA 3ZDCA 2FFBA 5HKAA 1P7ZA 3NAMA 1UC4B 5FT9A 1XRLA 1TADA 1XNQB 2XRFA 1SKBA 4QYSA 4CMJA 5BURA 5DO9A 1PR3A 1E2UA 3DTVA 3JWHA 2RIRA 4D92A 1Z0AA 1Z0CA 1UMBA 3K5WA 3LP6A 4YHHB 1NFRA 1LZKA 1WXDA 1ODSA 2XR1A 1P60A 2K6GA 4UQOA 3MF4A 3KB8A 1Z56C 4UBLA 4JGGA 4DV2B 4RVOA 1QQAA 5DRRA 2IIQA 1W85B 1T9GS 5LB4A 3K0AA 4KVGA 4RHXA 3R4CA 5JBQA 1N77A 3VX4A 3I04A 3COZA 4UFPA 1PQ4A 4QJIA 1ILWA 4L4ZA 2DSTA 3PS3A 1POXA 4D7AA 3E61A 3WU3A 6YASA 4Y6GB 1N57A 5FLXC 8MHTA 2REXB 5MFPA 2QX4A 1TO2E 1LI7A 4DF3A 4P7AA 1E62A 2WG1A 3R3UA 4YCSA 5MHTA 2QMOA 3GN1A 4V0KA 4H0CA 4WCFB 3QOFA 4MMYB 2PLNA 3KTOA 1CXZA 4DARA 1RVDA 4X7MA 3BA1A 3WYDA 1VJ1A 2FX5A 5AHXA 2PO2B 1W44A 1D6SA 1E5QA 3V97A 4EG7A 4RPJA 3DYIA 3TCXB 3J80C 4G41A 4KRGA 4O5OA 3FB1A 3HMKA 3G5UA 4DMRA 4ZYTA 2AMLA 3ENWA 2WWWA 1JIUA 2IL1A 1X7ZB 1FTQA 1D9ZA 5A4IS 2O3UA 5ALLA 1NNEA 1D2HA 3WYGA 1R6MA 4OMUA 3S1AA 2ZQYA 1NF2A 2CZGA 2WWXA 4NBWA 5LDHA 3OU2A 4IZKA 1ML4A 1JQKA 2B4RO 2FGKA 1P1FA 1MB3A 1KJWA 3R5HA 3U4DA 3DOUA 3LDGA 2NYUA 1ZDMA 3MJFA 3NKLA 3FMOB 5A4KA 3O7WA 3LD9A 4RCYA 1EVQA 3O94A 3PVZA 2GGSA 3ZDAA 1B93A 4NYJQ 4PGMA 1V7QA 4FYXA 3IEIA 2VHJA 3BXPA 3K4HA 3FY4A 3MRVA 1E2PA 4HNTA 1ZU4A 1QBKC 4EZIA 5B37A 3HJFA 1BEEA 4YRDA 1XNJA 3A6JA 4UUOA 5BSWA 5GWXA 5AI8A 2UXBI 1GVNB 2YC4C 4D9BA 2Z09A 3V1MA 5BWNA 5GOTA 4OL0A 1YU6A 2G4CA 3D6VA 3IERA 1U9IC 2XOKD 3IUYA 2OGWA 4KDEA 4CUKA 1DGQA 2Y1KA 2GILA 1KP3A 2V7EA 3ER6A 1HM5A 3H2KA 5LD2C 3PWZA 4UM7A 2EX1A 3AKEA 2AA3A 3OZVA 2P2NA 1R9NA 3OCCA 3P4YA 2WJVA 4ITUA 2VR1A 4KN8A 3TMKA 4BEJA 4CJXA 1ONBA 3WY9A 4MHSA 3G8BA 2HHAA 3GRUA 3Q87B 4QOHA 1CCWA 4QTXA 4JU9A 3KR2A 3B2NA 3CRVA 3NNNA 2NO4A 2F3PA 3NYIA 1T5TA 4RQAA 3SLGA 3DP7A 5F23A 4QNMA 2ZVJA 1L4MA 3L1UA 2B6HA 3OJEA 4FGZA 2DG2A 5K36B 5BSHA 3K71B 1XP5A 3U1YA 2ZT7A 1MF7A 1Z5NA 4XR9A 1K3TA 3EOBI 4D57A 5HCNA 3HU2A 5CYFA 3KQLA 5CH5A 2FMFA 3MMZA 4NBLA 4EYOA 1Z73A 2YQ5A 3OQMA 1G8SA 2OMKA 1C9KA 1EUQA 1T2DA 1TL7C 4NTZA 5B57C 3SM3A 2XMDA 1BCSB 3ND9A 4QU0A 5IT0A 1WW3A 5GONA 3RK4A 3T9AA 1JYFA 1SCUA 3OQIA 5AVZA 2OC4A 3RFTA 1TZ2A 1XF1A 1IVYA 2BKVA 3GQVA 4HEHA 4DR5E 2JCBA 4DRXA 5KQRA 2RE8A 1ISFA 3PNMA 2ZUFA 1QU3A 3H1CA 5B12A 2X6TA 4C2TA 4QYTA 3WLFA 5CLGA 3WJ2A 3NWJA 4PNZA 2OGUA 3F67A 1QHNA 2R4UA 2NYRA 5A2QC 4JR2A 3UWMA 1L5LA 5B6JA 1NU6A 1JU9A 3D6TB 3H97A 1S02A 3CLUC 2ID9A 1C1XA 2ZP1A 3GV0A 5G0VA 5JE8A 3HK2A 4OPMA 4WUVA 4FWBA 1L5SA 2H1SA 3TQCA 2HDNB 4X7PA 4X6UA 3O84A 4I4TF 1V1RB 2V59A 5AH0A 4CKEA 4AY3A 1E79A 3JU3A 5I7OA 3O2QB 4N3GA 2RHCA 1OYRA 3AEUA 3QITA 4FSXA 4NQRA 3KB2A 4R2HA 5BUQA 5A6SA 1FFHA 5LMUI 1MX3A 3DMHA 4HT3B 5JADA 3NIWA 3SC3A 1DINA 1JPVA 1W47A 1L5NA 1L7DA 4C76A 2A9OA 1PP4A 2PQ0A 3C8ZA 5L3QB 2H0AA 1QKJA 5B7PA 1FF9A 1T25A 1JKJA 2XH8A 5G0SA 5I9TA 3T1HB 3V8RA 1TYBE 2PRJA 2NUTB 6ADHA 1QYCA 2YZGA 3G02A 3F7OA 1AF7A 4U9IS 4WH0A 4KUGA 4GYWA 2QRMA 1BDJA 2JIBA 3NHYA 5B1IA 1PV2A 4IXWA 3EFBA 4D0NA 2X0DA 3SE0A 5TS2A 2XWQA 3EGDB 4CKCA 3PFBA 1P33A 2OL4A 3INRA 1CEXA 5I4BA 4MV6A 1FU8A 3Q88A 4U00A 3FM9A 1T8RA 3N5CA 1RHMA 1SPBS 5EZYB 3TL3A 1KMHA 4RTMA 2O1VA 3P0JA 2VF7A 1R6TA 2BGUA 3EJWA 3JYPA 1B23P 3B12A 4HLUA 5DNDA 3I2IA 3TOXA 3UCEA 4MAFA 2VF5X 4N7BA 1VPVA 2FFJA 4QDOA 3HWRA 1MV5A 4HDRB 3OPYB 3FIJA 2R0QC 2VYVD 4V0MA 3O9VA 4H6XA 1DV1A 4IWXA 4L0MA 4NPAA 4RIFA 4BAGA 4BMZA 2BMWA 1XZHA 3DWEX 3I9OA 1CUSA 2BY4A 2IU3A 4D6PA 1RBZA 4E03A 1LSSA 4QYWA 1QNLA 3UV7A 2QL9A 3QX7A 4JJ8A 3WAKA 4F2HA 4FKZA 4DNOA 5ECYA 5AESA 4J3DA 1KYWA 4BV2A 1GG9A 4LJRA 1Y3HA 3V7UA 2JFYA 4KOEC 3JAMQ 1ZGZA 4RANA 3R9IA 4P92A 3R7WB 4N40A 4AYTA 1ZK3A 2W48A 1N34B 3FJ1A 3OWXA 2VQDA 5JS6A 5FFFA 3LQ4A 4ROTA 2JFPA 4ZHQA 3DF9A 4PRYA 4MI9A 1UXKA 2YJ4A 4HZUB 1X9HA 4UUPA 5F7JA 1N0WA 3LFUA 1P0IA 2H1OA 3TM4A 3THRA 2YMQA 3RM3A 1G20E 1FVXA 5E4JA 3IV9A 2VRCA 1GNPA 2HHHB 2ZUBA 5TR9A 2IQ5A 4I9HA 5DOVA 4TMTA 3C3WA 2GBGA 3MRXA 3NCHA 1SIUA 3P3CA 3CLHA 1G4UR 1TZMA 4BECA 1L4YA 2V9PA 2JEAA 4EO7A 3DOFA 3RHSA 3EVDA 3OZ7A 5HIJA 5TLSA 1E3PA 2Y4OA 2OHXA 2JBWA 3L4BC 4PICA 2BBSA 4X60A 2EWWA 5AKXA 5E4FA 4PX3A 4LCFA 5JAIA 4KK3A 4EK9A 3RYHA 5LYJA 1INLA 1UKAA 1C5KA 1JFLA 2PIAA 4JP3A 4O2AA 3ZOZA 2VP0A 2WLSA 3BCSA 5IXYA 5JLJA 1NHGA 4Z1MA 3GLGB 3QIVA 3OTHA 4C7JA 3FVWA 3GRPA 3RFUA 1E9VA 3SU8A 1EFPB 4M4SA 3LOQA 3PNYA 1OHHA 1KQPA 1SXJA 3I83A 5ER6A 1P5HA 5FI1B 5ALKA 4DV7E 1RC1A 1JEDA 3EMDA 3GHYA 3EASA 3IUQA 3R8CA 5A02A 4WTOA 3PKIA 1CB7A 2IYVA 4G4JA 4MVJD 4D9FA 4FS8A 4L22A 3B70A 2JDIA 1DLJA 1NXPA 2OBXA 2PK3A 5C7OO 3QLVA 1O96B 4DLSA 4FFBB 4JB8A 5EA2A 5FA5A 4J0JA 4QJBA 5CDYA 1E1MA 1TDJA 3L92A 4B3CA 5L9AA 2XSZD 1JQLB 4XCQA 2FSIA 3AV3A 3AGPA 4Y9SA 3IJ5A 2BSAA 4RIIA 2IDMA 1KYTA 4BMYA 4CKWA 2GTHA 1N2CA 2RC5A 2VJPA 5JG7A 2HYIC 1X7XA 2GNOA 2XIJA 3QWHA 5JXJA 1YUNA 3KAJA 4AF7A 1OPXA 1KJZA 2YFHA 3WYEA 4A2WA 4ENQA 2AJCA 4UMEA 2ZBPA 4MVJG 3WGKA 3T0FA 3LPLA 3C3EA 1OZ0A 3L0DA 1QCCA 3T7TA 1XGKA 4AWBA 4YMTA 3QVVA 4ESVA 4U3DA 1GPH1 5C1OA 4O2LA 1LDYA 1HC7A 2H9AA 3NIBA 2BFWA 1WHTB 2XOEA 3LECA 1QFZA 2VAVA 3CV3A 3NDIA 4LXXA 4NJEB 1QGUA 2D5BA 5EIOA 1KPIA 5IYZA 5M2QA 4C22A 4I55A 3DEIA 3BH0A 1PGNA 2CDNA 3H2IA 4HRYA 3TSOA 4E88A 2Q21A 2O1UA 1HSOA 2ASEA 2VF2A 4DHWA 2V7XA 3WKBA 3WK8A 1XNRI 3AHHA 1AUQA 4BO2A 3ZW9A 2ZQ5A 3AU9A 3FSJX 1FQJA 3M3HA 1ST3A 3GR6A 4GP7A 4YFVA 4EQ6A 1LTQA 5AVUA 4Z53A 3BD6A 3CB4A 3RFCA 3F7MA 5JMOA 4BMOB 4YQZA 3GLLA 1WMDA 1P7VA 4IS3A 3H05A 3CZCA 4GZ6A 2VP6A 5KOJB 1EM8A 2JFOA 1ZRNA 3KR0A 1J4AA 1D7AA 2VOJA 2G5PA 5F1PA 5JEDA 4ZU6X 4K6MA 5C31A 3S2GA 4DR4I 1PL8A 2R87A 3ORFA 1RT9A 3DA8A 5DWQA 3B82A 3EH2A 3RABA 1AGPA 1YULA 4CCWA 4DR2I 1VB5A 4B8ZA 4YO7A 2O14A 4AJJA 1E2FA 4KPGA 2F4NA 4BJ6A 2X8JA 2R00C 2H5JA 1AV7A 2CCKA 1VI2A 3CKKA 3K09C 1AJEA 1YS7A 4K86A 2D06A 3R7NA 1KPHA 4Q9IA 3G1WA 2A5YB 4ZYWA 4MLZA 1OREA 3GG2A 3O95A 2HF8A 1BW9A 3DV0A 3QX8A 4UPEA 1JDBB 3IIJA 3GMEA 1LEHA 4GQBA 4NENA 1KQNA 3LUJA 1VKZA 2NXEA 5H9WA 3QE3A 4MVJE 2A0KA 3GY0A 1P1HA 1JE1A 3B13B 4MVJP 4Z0HO 1CQPA 5LOVA 1MIHA 1NUQA 1RR6A 3UJCA 2AR9A 2UU9B 1DXHA 2OCIA 2WTBA 5F77A 1XQ9A 4JS0A 3QLUC 4Y2XA 2AIRA 2XYQA 2Z98A 3PX2A 4PLTA 4TT3A 3WGTA 3BBLA 2W8BA 2PE5A 3EPPA 1UDRA 1JWBB 4TMXA 1ZBQA 2ZE8A 4WXRA 1YZLA 4OBEA 2AR7A 4QGFA 2BSXA 4IJQA 2R6AA 2EBUA 3WL6A 5DYGA 1GV0A 3QVGB 3F73A 1O8CA 1RKQA 2GF9A 2VNIA 1M2GA 3EZYA 3TUIC 1JG7A 2Q3FA 4UVHA 1NGSA 2PGIA 3B51X 1ARZA 3S5JA 5K8TA 3NXKA 1ORHA 4REMA 3V8VA 2WP0A 3W3ZB 4IFDB 2YDYA 4KBGA 5CLIA 5A3RA 1ZMXA 1NW3A 3W34A 3KJQA 4BVGA 2A5GA 2OZKA 1YXMA 2RHLA 3EXIA 1WPGA 4WVLA 1SIBE 4UVGA 4YI5A 3SIWA 4B2YA 1KMCA 4F97A 2AXPA 4MQEB 2YJZA 5DLQC 5AW1A 2A9FA 1RYHA 1T0JB 1W5EA 3D3QA 1N78A 3S99A 1E5LA 3D7SA 1JWLA 3LBNA 4KIJA 5AKHA 5G4LA 3W4IA 4LFAB 1E7QA 2C3PA 4IO0A 4XFJA 4BRUA 1BHJA 3H4IA 4A2CA 4C08A 1IXYA 3HCOA 1PTKA 1D4AA 3L9WA 1J8FA 4YAKA 5HK8A 3QJ5A 3GMIA 1IPFA 2XA2A 4X97A 4D5EA 2AT1A 3AVYA 1ISSA 1TU3A 2JIMA 3QEKA 4HVAA 4BLSA 4EENA 2XD4A 3C8UA 3FSGA 4IZOA 5YASA 4AIIA 3VNQA 4K9PA 3K9LA 5EJ2A 4C03A 4CF3A 4YMVA 2Q3MA 4PQYA 4B3RB 4FYPA 1C9MA 4ENTA 1IRIA 1Z4OA 2G0TA 1OGIA 1TGVA 4I6GA 5DI3A 5KTTA 2ETVA 2AOWA 1G5QA 3Q6MA 1BHO1 1ZOOA 4PPGA 1KO4A 5ALSA 3ZXXA 3WJ7A 3L5OA 5CM9C 2RGEA 4DYDA 2G36A 1YMVA 2G63A 2R4QA 4RCVA 5JS2A 4HAIA 2NU7B 3UMRA 2BGTA 1QC5A 2XNHA 4JB0A 3D7RA 2ZOSA 3JQ8A 2JH8A 2NO6A 4BTVA 2L17A 1PQWA 4FNOA 1L5WA 3QKUA 4KIUA 2NZVG 1YC5A 4HWSA 4XDGA 4HPWA 4NI5A 4O1IA 3UJ8A 4F9FA 3PQ8A 2CDBA 5IASA 5LQSA 2PNJA 4MS3A 2ZB8A 4B76A 2YWHA 3H6HA 4DANA 5C0XB 2ZWAA 1T35A 1BX0A 4FCVA 5HJ7A 4GKKB 3HSYA 5I7AA 1R6LA 1E6UA 2B1QA 1M1UA 2V03A 2Y05A 3L7JA 4FOSA 4ZCPA 3KEFA 1GDTA 4USKA 1NP7A 3KXPA 4MIKA 1DQYA 4G0XA 1FRVA 5BWMA 3KWFA 3PR3A 4OQ4A 2ZIVB 2G82A 2YWDA 3IUEA 5DHSA 1QYIA 5FTJA 1KI3A 3L49A 3FKSD 1G6KA 5E8JA 5SZKB 3PC2A 4OLJA 2YYSA 1L1RA 4YT4A 4FHGA 4QTYA 1HWYA 3GZJA 1J1ZA 4B3TE 3EDCA 1T0BA 1YAJA 3Q98A 4PLYA 1GL6A 4E5KA 1Y8ZA 4B35A 4B3HA 1FEZA 1FRFS 5LBUA 3V8MA 3LWZA 4MWSA 1F2TA 4EJ0A 1ULBA 2EVWX 4R2KA 3ZKBA 2Y92A 1G21A 1DC4A 3BUSA 2AB0A 3CVVA 1WMAA 1KR5A 2TS1A 2E5FA 1HDCA 5IHXA 2R48A 2HADA 5DEIA 2WF8A 4LCGA 5EGNA 3VGPA 2FVXA 5FLXQ 1F4VA 3LAWA 2EZ4A 1QPGA 4OKIA 4TTTS 4XWKA 3CC8A 4BMVA 2OXIA 4ZCLA 5IX8A 1Z28A 1H74A 1P1KA 2GKOA 4IILA 4MLCA 3ZKWB 2VDQB 2C7QA 5JQGA 2LDBA 3EVGA 1UAGA 4N0PA 2X41A 3VV2A 3OP4A 1ZXNA 4LTNA 4JYCA 1XTUA 4WJKB 2BJWA 1B7GO 1KKMA 4OHKA 2ORED 1XJ5A 1IDN1 3LVQE 4RQBA 3URMA 4EX6A 4UW9A 3QIAA 4GEGA 5JBIA 3AVWA 3SX0A 1T2FA 3WOVA 4YT8A 2ZJAA 3H9JA 4PGFA 4BTEA 3KT6A 3TZ6A 1Z8DA 3IP6A 3JRNA 4W9NA 1K5DA 2OCAA 3ROEA 4E2XA 3GLFB 2QL5A 1OVGA 3R7BA 4Z7NB 2IBSA 2REBA 1DRWA 2ZRBA 4I6JA 1B8UA 4KXNA 3WLKX 1FUUA 1X1RA 4B75A 1E66A 5CIQA 4BNZA 5DNYB 1E0KA 2VPZA 3FUTA 2WT9A 1DQPA 2IGBA 4RVFA 1MAUA 4MITA 2YS7A 3RT9A 4ALMA 5C2JB 4DE5A 1A97A 1MAAA 4PU0A 1XMOI 4BA1A 4K6GA 4MWBA 2QTVB 1Q14A 3BGIA 3PI7A 4CEIA 2WHRA 4DLPA 5TVGA 5ECWA 3GFSA 2QVZX 3C15C 3KJZA 4P36A 2YV3A 2NV2B 2IPNA 1E3SA 2HSJA 3KKQA 4WPGA 4LJSA 1MIOB 1VIMA 5AUNB 1XU4A 2UZIR 4LGCA 2PQ2A 4AUKA 4B0PA 1GZSA 3T94A 5JWOA 2QTLA 3FZGA 3GVHA 1PJAA 4FMPA 1HSZA 2E6UX 1J2JA 2FDRA 4KKXB 2ZE5A 3ZDQA 1U1DA 5JAHA 1SY7A 4QYIB 3IDOA 5GZ6A 1ZK4A 3MINB 2G09A 1M1ZA 3N3AC 3ESYA 4LYGA 2CXPA 5K45A 2C2HA 2BV3A 1P2DA 1JA1A 1JDNA 2B7CA 3G8DA 1FVHA 3NT5A 3PSHA 3W4JA 1FMFA 4JC5A 2B61A 5LU8A 3NZKA 4JI0I 1SQ6A 4K6HA 3TZEA 2GERA 4AG5A 1UOOA 2QTNA 3LG2A 4RJJA 4D4LA 5A9SA 4PIMA 1HE2A 3UA3A 1C2YA 5AVWA 1YS6A 1XG5A 1N36E 3N5KA 4U63A 4NYJR 2JFHA 4RXMA 4V0NA 5HJEA 3IQXA 4C5BA 2VESA 5C3MA 5KJ1A 1KK2A 4AVYA 3KJFA 4OOFA 2EGUA 4NOJA 1RWMA 2G4VA 5FA6A 1SCNE 4R1PA 4R2LA 3TIGA 1XFAA 4NH4A 3KLMX 3IUJA 4Q4AA 4NJOA 4WBNB 1FDOA 4PTZA 3YASA 4KQ6A 1M1YA 4LOIA 3D6HA 4RIEA 1UJ6A 4R05A 1L9XA 4OREX 1E3HA 1VGQA 1JEQB 2PWYA 4QXMA 3A9SA 1TEXA 3OJXA 2GASA 3BWXA 3EXFB 4HNSA 2YZMA 3HJRA 5I4CA 4DR7B 4HUJA 1GRVA 1GUDA 4NXMI 1T6NA 2XVXA 5C3UA 5ICGA 1JEAA 2I65A 2F48A 2Z5VA 4JLPA 2IHYA 3L6BA 1RXEA 3TLXA 2X13A 1OYOA 5EJGA 4UM8B 4S1NA 5H02A 2W6ZA 1ORIA 3U9LA 3ZWQA 2ZIXB 1UBFA 3ZWAA 4XXHA 4OQFA 3ISJA 1D9XA 4I81A 1PSDA 4Q3AA 3PRKE 4AS2A 1BA2A 1DPFA 2IU4A 4Z9BA 1J0CA 4H0FA 4P2GA 4KREA 3THWA 4HDAA 3LV8A 5KNBH 4LRTB 2HD4A 3P76A 1Y1RA 1KVQA 1E61A 5ENDA 4DZTA 2CLCX 2V4ZA 2BCGY 3KFLA 4FYIA 4RSRA 4D9GA 4AKIA 2X0EA 4P5DA 1TZKA 1THTA 2XIQA 3KBOA 5KYUB 4XWWA 1A5TA 1Z35A 1WZNA 2Z58A 1P0PA 3E15A 2BSQA 4QLAA 1RI4A 4A8JB 1GL7A 1XTKA 3GZ4A 1SXIA 2ODQA 4PPQA 1SVKA 1XZJA 2C39B 9LDTA 2AI2A 3AWDA 4N8DA 4URUR 1XD9A 2WF6A 3VHLB 3CHYA 4E5DA 3PFGA 1T8TA 4UVIA 2I99A 2O6LA 3AIOA 3M9LA 1GQOA 1OWLA 1CUFA 2J5XA 3L7YA 4DGQA 2XB4A 3IIKA 1YIOA 2AKYA 3C5HA 3QWBA 4BXOB 3EMBA 4D8WA 5AJWA 1IUKA 2CJWA 5EYPA 5LMNI 5CDFA 1SRQA 3VMMA 1FTWA 5JSKA 1T9GR 1J8QA 3A1UA 3SDZA 4DMHA 3LUGA 2LXNA 3GWZA 3JQ7A 4J3JA 2AN4A 5CYPA 3FLBA 2EC5A 5TV2A 5CT6A 3WMFA 3RAGA 5FKJA 1W25A 3QFRA 4JUDX 3H5LA 4N7JA 1X3SA 2PBRA 3V7NA 1VMAA 1MD9A 3ZDBA 2VJQA 4FILA 4ZICA 4IVQA 4DADA 2NUPB 1HDYA 5F98A 1P3DA 1VMEA 5HR5A 4LF9E 2J9YB 3ZKDA 1J7JA 3F9IA 3GFQA 3O2SB 3A4MA 5GADl 5D3ZA 1D04A 3HFSA 3DVQX 3PFNA 4QU5A 2B83A 1GU7A 2GXUA 2W8ZA 3HY6A 1THMA 4RL6A 4CLDA 1QRTA 1W2HA 2F4VB 4L07A 2YIVX 4J90A 2ID8A 4Q02A 4XLTA 1EQ2A 4HYQA 4XUGB 1Z08A 1EINA 3ZHVA 4U0JA 5K05A 2ZCJA 5TX7A 4NAHA 2VSFA 3SF8A 1KFKB 2R8ZA 2HA4A 4II2A 2P1RA 3CT4A 1KEUA 3ZJ5A 1YR2A 1XRQA 4JI2E 2BTQA 2QLNA 4MSUA 3R77A 5JSZA 1TKAA 4HFMA 2P35A 4G5GA 1OBHA 1E4VA 2J3EA 3CDJA 2VHVA 4ZVTA 3VQTA 1FS5A 4WA7A 4BE7B 5EWJA 1LSJA 3A1CA 1R15A 1C0IA 5JYBA 4QTTB 5FV7A 4ZEXA 4GECA 1XRMA 4PS1A 3UN1A 3Q0EA 3LXRA 1TT5A 4YLEA 2XDQA 3V7WA 5JXWA 3TTXA 5ALRA 1SU4A 5IFKA 4DWJA 4FMDB 4FW8A 4LKOA 4NAVA 4G9BA 2AFIA 3ZPXA 4B6PA 1N5IA 3PTLA 2ZJ0A 2FPSA 1Y1KE 2ADOA 4UFOA 3B4TA 1M9NA 1XMQE 3AEZA 3K6RA 4KQWA 1GZ6A 1N2XA 2H11A 2WHXA 1STOA 3CGWA 3NCTA 4LAFA 4C3ZA 4F6RB 2CEAA 2A0FA 3S8EA 1AHNA 2Q0XA 3H8WA 3KSMA 4Q16A 1NBWB 4QPNA 3SZLA 1RC0A 4QBKA 4KV7A 3OIVA 2JD2A 2E48A 2I22A 2PT6A 3COWA 3ZJUA 3NDRA 1YZ3A 4CNQA 2VBFA 2II6A 4M7PA 2PQMA 4RWZA 3WC4A 1W0JA 5DX1A 1KI9A 1UZMA 3DDSA 3EVBA 3ZZNA 5JC1A 5JISA 2O1TA 2VQSA 1P9RA 4IIEA 1XAJA 1QH0A 4HUTA 3VHQA 1MX9A 4L4RA 3TRHA 3KKZA 1H66A 2L19A 4OQDA 5G2OA 2JJ2D 5KAMA 2HWWA 2C57A 2OFFA 3ABQB 3A9VA 3OQBA 5IAJA 5EN4A 1E0SA 1VZ3A 3EIOA 1E1LA 1K8XB 3AR2A 1R88A 1MA0A 4WUCA 4KAFA 1G17A 4FZ5A 4PGAA 4QEZA 1V47A 1XA3A 2FZVA 4ZVUA 1NRWA 1XXHA 1GV1A 1A5AB 2IXAA 3F8WA 2XMSA 3EQ8A 3UHPA 1U8FO 5IJ9B 5KMGA 1I2DA 1EP9A 3DMTA 3GCXA 3CZ5A 3Q9NA 7YASA 5BXYA 3UAYA 2Z5GA 1S8FA 2P2LA 4NDAA 3TCNA 2X9GA 1DAFA 2PH5A 1DP4A 2FA9A 2W2PA 2CL5A 6Q21A 1HRDA 1KEZA 2IUUA 4R2WA 1NTRA 4U7DA 1VLVA 3L06A 4B6GA 2QZ9A 2NMVA 5AUQA 2FPGA 1QRAA 4LOKA 3TLKA 2GF2A 1HNWB 4R1OA 3FR8A 4KRFA 4GQAA 1IIRA 1E2IA 3UPTA 5JCJA 4CHTA 1XWIA 3MS7A 2I6XA 621PA 4XAQA 1CFJA 2ICAA 1H1TA 2NV6A 1J07A 2AYZA 4X65E 2B3TA 3CPJB 2G0AA 3M4JA 3OCZA 4JJEA 4KK4A 3E05A 3K9QO 4TTQA 3W3AH 3N58A 3BWVA 1PYGA 2WIDA 3A4TA 3PX3A 5FUBA 1QIIA 1XCPA 2BGLA 2PVSA 4LRYA 3N2IA 1V7PC 2PIDA 1PR4A 3QKRB 4TYPA 4B2PA 2K87A 3S28A 5FD8A 3B5JA 1GGJA 2IVFA 1N2BA 2K7ZA 2XUHA 3BOSA 1D6NA 1EUDB 4HJXA 3RO7A 2OC9A 4BMXA 2HN9A 1I0IA 4UNRA 4CTJA 3QBJA 1GPNA 4R71A 3GEGA 3H1FA 1EKXA 1X80B 1M10A 2AS0A 5FEUA 2ZI5A 3IOMA 3AB8A 4DUZI 1NULA 4TTIA 3E8SA 4WXMA 4C78A 1EPUA 3RKUA 3TSWA 3OLXA 2PSDA 3O2JA 4WNYA 5BVGA 1I3NA 3WK6A 2NOAA 5KPJA 1E3MA 1DCMA 1TQ6A 3QQ5A 2JANA 4Z4CA 1SFRA 4AZSA 5E0KB 3U61B 2OBNA 1U8XX 1AHHA 1OIWA 2H4XA 4EMUA 4EA7A 1JN0A 3M34A 1VMKA 2P2YA 5C1BA 2ZSAA 4ZMRA 3W1EA 1GFZA 5DN6D 3FHCB 2M32A 5DP1A 5JAZA 1GPKA 5DNEA 4B3SB 3OUUA 3LWDA 4ENSA 4TKUA 3QKTA 3ZW7A 5F9FA 4C4SA 4Q4LA 1WD7A 3KETA 1OYVA 3N2GA 2CMGA 3ENNA 2QD5A 1EVYA 1O77A 2EKZA 1B2LA 1OLSB 1P4RA 2ZSBA 4O4IB 2ESRA 1LNZA 1OGYA 3RS2A 3ZV6A 1HDGO 4Q4CA 1W30A 3QOWA 4FYHA 2E5WA 1EA5A 3HFRA 3LOPA 3GFVA 4YASA 5D6OA 1IONA 1XZPA 4PLFA 3P2OA 2FRDA 4R1TA 2VTBB 2FJUA 1Q7RA 4UASA 5F3RA 1H8ED 2TSYB 2VJKA 3PG5A 2IZ6A 3G0CA 4K1XA 4MI6A 1A98A 3KWJA 4NV3A 3QUQA 1F2UB 4JLWA 1US8B 1RZVA 2FEMA 2GO7A 2RKOA 2NU6B 2VJAA 2QTRA 4NECA 2HW8A 1NUSA 2GS8A 3LPSA 1Z4MA 3K5HA 3EE6A 3EUAA 1W4CA 5JRJA 1EAMA 3QMPA 3RSZA 1FJGE 2IGTA 1G8FA 4LHYA 2BGGA 4A03A 2AXNA 4GMDA 3HN6A 5CTJA 4TRRA 4DJDC 2QM7A 1SN7A 2R1TB 3GJ7A 3KSDO 3LX4A 2WIFA 2R2GA 2YJ6A 3CLVA 3BMXA 3KSZO 1P77A 2JI8A 3R5XA 1P2FA 1JG3A 2OHOA 3FPCA 1CSEE 2G1KA 4QFMA 2O1SA 3M6XA 1YAHA 1Z25A 2BBTA 2ZYTX 3A1NA 2VSXA 3LZCA 2RH5A 4GQUA 4PYQA 3SR0A 3U3ZA 5DSZA 3N8KA 2N0SA 5HXAA 1SOUA 1X7DA 5JVDF 1KOFA 3TPCA 3O74A 2W71A 4JT2A 4DZRA 4XGIA 2IHUA 4INJA 3O4GA 4ZP1A 2V1UA 4BV3A 1CEYA 3X2SA 1CZRA 4H27A 4C21A 4Y3UA 4LI0A 4PM4A 3AFOA 3DTVD 5AXCA 1XXLA 2X0IA 5BMVA 1CFZA 4G89A 4YMLA 3D2LA 3DT9A 2ZBFA 3VPXA 1Z2EA 2L0XA 2WE8A 2AHOA 4OUDA 3K17A 1Z13A 4LV6A 4BN0A 2GWHA 4F45A 3HKCA 4LJ8A 1VKNA 1KY2A 4BJHB 5LQMA 3EVTA 5ESWA 3N8NA 1G4AE 1MFZA 2P9JA 4BLOA 3IKTA 5HG0A 4IKEA 1KDYA 3OQOA 1H4SA 2ZZNA 1Q50A 4QELA 3NRCA 2I3ZA 2VH2A 3O73A 3DEJA 4YV2A 3EZGA 2Q46A 4PC3A 1BU5A 1M72A 2CJYA 4P0TA 1VJTA 2Z30A 1IFXA 4I3HA 4KO4S 4AKSA 3STHA 5C35A 4JWTA 3UYLA 3ENZA 3ILYA 3ZCUA 4EPTA 4TT8A 2C7RA 1CS0A 4HXEB 1ZKMA 4PZZA 2NT4A 5JCOC 3CRRA 2HSWA 3GEMA 3GUCA 3BDVA 3ECSA 3QA9A 1Y8RB 1UJNA 3NHLA 1YL5A 3ZQUA 3ZTTA 1JTVA 1JLMA 4FMCF 4GE3A 3IAXA 3HP7A 2I6FA 4ZAXA 4TVKA 3TH5A 1H1LA 2CCGA 2V8OA 2PVPA 3A27A 3ZY3A 2ZTSA 1ZWLA 1GZ7A 1M6YA 1N8NA 4HUQB 2Q5IA 3BE6A 5DASA 3KAPA 2B99A 3TGPA 4RV5A 5BR4A 4LN1A 4LXIA 2WYHA 3HB7A 3R6TA 4HVTA 3MTJA 2BHNA 3PYFA 4QARA 5CG2A 1DTWA 1JPJA 1M2OA 2B92A 3BIFA 5AHRA 4IHJF 1LWNA 3TIXB 2XE8A 4K81B 5E4TA 5CDUA 2P6UA 3IFSA 2XEXA 2OCPA 1ZVJA 3H11B 3HHPA 3QGMA 4TYQA 4M8IA 5ELXA 3ECCA 3FWKA 5F9MA 3N0VA 2H31A 4XYMA 3TLGB 5HFAA 1FC0A 3TTUA 4DILA 2VJMA 1EZ4A 1RLMA 1JWAB 3D1JA 4B48A 4CFYA 4DR5B 4BBPA 2IZ7A 2JRCA 3WVNA 3MGBA 3NRBA 3T7CA 2C84A 4KYUA 2XYVA 3EUFA 4G1EB 3U3DA 2NG1A 4QUHA 3G2QA 1TK9A 4GL4A 2HUNA 4I9NA 4GKVA 3H8JA 1RM4A 4B3MB 1VI5A 2J31A 3LJKA 4X66B 3DBOB 3N05A 1PSZA 1A9QA 2C59A 4LF5B 1SHKA 4MDEA 2F3TA 3V42A 1S0UA 2GYVA 3CPHA 3NWEA 5SZIA 2NVWA 1JHXA 1ZJ6A 5EMJA 2PGDA 1VQ1A 1EP3B 3AKZA 3VYTB 2CDAA 5B2ZA 1RBYA 2AHRA 3O8LA 4RPGA 4E2ZA 3SJ7A 3E7DA 1Y81A 3DVSX 5BW6B 3CONA 4EVIA 5K6AC 1S5PA 2QKYA 2A2ZA 1CE8A 5CDGA 1XZDA 2CHUA 2GKGA 3NO4A 3P2IA 4RHYA 4OJYA 1K68A 4DJFC 4CUZA 1TW2A 5D3QA 1Y7LA 5HQJA 3ZHTA 2CVPA 4GGOA 1OBVA 2GEFA 3EIFA 3K9HA 3VZQA 1DQSA 4N41A 1TJNA 3B3JA 4I7EA 3EDQA 3LQ2A 4H4CA 4M8LA 4JA2A 3NUQA 4QAQA 4RF2A 2CUNA 1RWQA 4OD0A 2PMCA 4P4UA 1VLMA 4QNRA 4IOKA 5K0BA 1W6RA 4U2BA 2AKEA 1FS4A 4WBXC 3CW8X 3EPKA 3IE2A 5I45A 4P4SB 5K3EA 3I6MA 1J2TA 2R85A 5KX5B 3ZCTA 5J63A 5JPIA 1W5AA 1FB5A 2WUWE 2CNNA 5BYAA 4C0XA 4YY3E 1XZ8A 4YAEA 5HW0A 3QU7A 5IVHA 3CH4B 2GFQA 3UAZA 1NN1A 1KAGA 1PFWA 4MGHA 4EFDA 4UATA 2R1VB 4N03A 4R2JA 4YAGA 5LZ4A 2P41A 2O8EA 2B25A 2C9ZA 3NT4A 1EJ0A 1SC6A 2L82A 1FQOA 1DUVG 1KDOA 1DVRA 3DXFA 4Q1EA 4QD3A 2WHPB 3B2QA 2YJNA 1OX4A 3ZV7A 3DZKA 4AMZA 4BKRA 2F1IA 2V4MA 1LW6E 2I5PO 3OC0A 2XXAA 1DKPA 1WTCA 1E79D 1A8UA 1GADO 2QGFA 4QUIA 4Z4IA 4UOZA 3N7TA 2Q2WA 4MPJA 3C6KA 3PS1A 4BPRA 1DU4A 2DBVO 3KAQA 1E9FA 1SVWA 2WA2A 3JPWA 4W63A 5TS3A 4PAWA 2IYNA 3ZZTA 4IJMA 1VL8A 5TEWA 1CUEA 4B3IA 2IBTA 1HF3A 4LJ5A 4EHBA 3IE0A 2O3ZA 4E5MA 4MDHA 5DTEA 1F3OA 2VP2A 5DXJA 3U81A 3VPFA 3GA5A 4OXXA 3WU5A 4YRJA 1V11A 3B1XA 1QFYA 1VJCA 2V1XA 3EGWA 1B0AA 5FNZA 4EWLA 4OYHA 1N32I 1DBVO 1TC2A 1LSOA 2YVKA 2P1ZA 1G20B 3SJAA 4I1PA 3COJA 2K7FA 2I8CA 5LD2B 5TEVA 1Q21A 2WICA 3IV6A 3NOOA 5CDSA 2JBAB 2R3VA 1JR3A 3NV9A 3QLEA 2NU9A 4MU3A 3F7TA 3VKGA 2X76A 1XVIA 4AO8A 1AMNA 2CNOA 3DKKA 3ZGZA 3ER8A 4MRPA 3AEQB 3IAAA 1KYQA 2M6SA 1ZMOA 3BD8A 5HS4A 3TTWA 1XN1A 2NSDA 5EFOA 3LLCA 3IPAA 5FTLA 1NQTA 1YZNA 2WSLA 3BTVA 2X8WA 3H0KA 2CV2A 4US2R 4HGNA 1VCOA 3S29A 5TC4A 4PXYA 2ZANA 3P96A 3MWEB 4F93B 1MRSA 1K2VN 3M6UA 2D3TA 4AY5A 2GCIA 3ZU6A 1PS0A 4FDVA 4DPLA 1ZIPA 2C0QA 3EISA 5HDQA 2UUCE 4YCLA 3DF7A 3IP7A 5EXSA 3FBTA 4PEVA 2EJBA 4IJKA 4BKMA 2UUAI 4J2OA 1D8TA 1Y63A 2QV0A 1VE6A 3FKQA 3H1PA 4QJ4A 2O7RA 2PANA 3R3SA 1I4OA 4L3VA 4R84A 3UF0A 5LUAA 2P9GA 4DUYB 4DV7B 3JCZA 3KOOA 4BEVA 3PYDA 1GPBA 1U6KA 2QY6A 4NVRA 1Y1LA 2J07A 3CB2A 4JJ4A 4JUAA 3PB3A 2DUWA 1RQ2A 2YHBA 3DD1A 2HPAA 3LFHA 4FDUA 4TRMA 1NQXA 2E6KA 3B2EA 1LXCA 3WRYA 4MOWA 3KU1A 5KVAA 3BE8A 3OP1A 3CLTC 5TPWA 4KITB 2CSUA 4EKYA 2BGMA 3KQVA 3QSYA 2N46A 2CWDA 1J0EA 1EZZA 1GNLA 2OESA 3BD7A 2E55A 2VRCD 3GQBB 1IM8A 1RJFA 1YU9A 1Z88A 4G07A 4ZU1X 4DM3A 4TYWA 3WIVA 1BROA 1HG0A 4AK9A 5C37A 3AC0A 3H1AA 3C3BA 3GUYA 3HKDA 4OXNA 2O06A 4H1VA 1YIAA 2R1UA 3RRXA 3AUFA 2PZEA 3DCNA 4RTNA 3R3JA 3SG0A 3GAFA 4QQFA 4Y0VA 1C0KA 1QFJA 2MYUA 4YJ3B 4FI3F 1TM7E 2LPMA 1ZXMA 4AMUA 4CKBA 2O8CB 4AF6A 1C4WA 5C5IA 2X9NA 2XCLA 3AETB 4RH3A 1GNSA 3FZNA 4C9BA 4X62E 5A3JA 4FR5A 2Z9BA 5LQAA 1PGQA 2VQEI 1NVAA 3HY4A 2WU8A 4AG3A 1KY3A 4EEXA 1R0SA 4EVQA 2BTOA 2JGJA 1PJ2A 4P31A 4XM2A 1NKSA 2QZ4A 2H48A 5M29A 1HNNA 1CX9B 3CCBA 1ZCJA 1MOQA 1P80A 3LQYA 3OZIA 5BR8I 3G2PA 4MQFA 5L51A 4XWAA 2V5AA 5MN4A 2W42A 1LQTA 1U2DA 3OA0A 1XU7A 2O5EA 4OQEA 5FWAA 1OTXA 5JNRA 2DWOA 3Q9SA 5CT4A 2YUIA 1ZITA 1CQZA 3OZTA 4O59O 3GEDA 1LFAA 1KZ1A 3JQEA 1ETHA 3EYWA 4QBIA 4RGVA 4K0KE 2IEYA 2GZ1A 2X4IA 2Z9DA 3Q7EA 2WWVD 2Z5BA 3DE2X 1HOXA 5E6UB 1X7YA 2I3AA 3VU9B 1Z0TA 1A72A 1KSFX 2OT3B 4IVPA 2FQ1A 3VHXB 1T3SA 2J0UB 2XADA 4RHTA 3VSEA 3W0LB 3ZCQA 1FE8A 1BGXT 3ANMA 3S2ZA 2RGNC 5AFSA 4RKEA 4CR7A 1Z3CA 2OWDA 4O4LF 2BGKA 2O0KA 2FJ0A 3IAHA 2J0EA 2ZUUA 1BOFA 3WICA 3ZYZA 3DQZA 3TAXA 2AH5A 3STUA 5FAKA 2YWXA 4FOLA 3E8MA 1Y7IA 2FK7A 4LDZA 1U7OA 2NWQA 1NRXA 4OKNA 1DAEA 4PXSA 4O2BB 4CIVA 1JU4A 3TQQA 3M1LA 1I1OA 1RXVA 1M0TA 2IXEA 2IF2A 2ZIWB 2J3MA 3OKPA 4G0OA 4RDIA 3SYRA 3UANA 1TQHA 3HM9A 2EFYA 1CHNA 4BWVA 2HMYB 2YXBA 2Y4NA 3ONEA 6NULA 4AJ9A 1F8GA 4W5OA 4Q66C 4RC9A 3M6WA 1M2FA 1WXWA 4MS1B 2XTJA 3VYRB 3ZG6A 2V6BA 4BQOA 4E6EA 3EPHA 4JHXA 4IVRA 1GO2A 1RYNA 5CEJA 2JIQA 5B1SA 1E5XA 2O8DA 2VI5A 4FGJA 4OJNA 5CLLA 1A27A 3WHKA 1Q74A 2HV9A 1C30A 2JCXA 3RVJA 4WV3A 4ZK6A 4ENUA 2P27A 3M3PA 2FFRA 4YX9A 4CEJA 2I7DA 3IIMA 2E37A 3OT4A 4IZ6A 4MWTA 4DLZA 1UXJA 1GA4A 2YXPX 1YFZA 3NB0A 1CF2O 3ASZA 3GX1A 4KNVA 1MOPA 4R1SA 4YACA 1G66A 3CVOA 4ED9A 5EZQA 1YUBA 1GUBA 3KZCA 3MTBA 1RS0A 3PNBA 1WMEA 4FBMA 2IZ5A 4D8UA 2AEFA 2QQFA 3PT5A 4IP0A 1J8DA 1TUBB 3L1JA 4EA6A 1S4MA 4TVBA 1LLDA 3E9DA 4ZQCB 4Q19A 4RXTA 3STWA 3RC8A 1UM9A 3A6HA 2DUNA 2WTXA 1FMJA 4YDRA 4DDVA 5A0FA 4I8DA 3DZDA 1P7CA 2P6OA 5CDTA 5JWRA 5E6SA 3WA7A 4A91A 1QLJA 2JGDA 1M1XB 1XU9A 1K75A 1LX7A 3PUWA 3IKVA 1RTTA 3BMOA 1VC2A 5LQDA 5BWCA 4C6RA 2QM3A 2GF0A 4TT3D 1PTJA 4UUNA 4BJ3A 1AGXA 1RC8A 2F7SA 1M2KA 5EKTA 2QRLA 1QRSA 3A6ZA 3QXCA 4ARBA 4J43A 4RF3A 3X1YA 4FCWA 5LN1A 3HACA 3BJEA 2VAPA 1T1RA 4OXRA 4WFJA 3TOZA 5IMSA 3AG5A 1GYPA 5TPZA 1DQRA 5K8UA 4FR0A 1X77A 4AG6A 3EDYA 4HATA 1MXHA 5IKMA 1HFKA 1XPUA 2PKWA 5MN6A 3DFKA 2GCOB 3PIRA 5ESRA 4PCVA 5CM2Z 3PCXA 3BF7A 2W2XA 1YRLA 2OZEA 2TMDA 3KV3O 3G8AA 4QXQA 2YV5A 5AOCA 5K99A 1YQUA 2I1VB 1VZ2A 2OBLA 4GLFA 4LYYA 1PYOA 4PHCA 3VYWA 1MRNA 3ZI7A 2UZ4A 5F9HA 1CJVC 2UXCE 2Q4RA 2R86A 2N3ZA 4MEJA 4MPTA 1F06A 4RENA 3D4JA 2EX0A 1JTFA 3AL0C 1AQIA 2R68A 3CMMA 3G9ZA 3H1EA 3B60A 3PS9A 4MKXA 3OJLA 3FCXA 4R0NA 2KW5A 4OXYA 5JHGB 3HL0A 3OX4A 4MQ4A 5C32A 2JH3A 3TD9A 3PPYA 1OZGA 2C4HA 3QV2A 4B3TB 2PX3A 3VKFA 1NVBA 1PV1A 4G5HA 4P5EA 5CVUA 3M3DA 1QX3A 2B4TO 3AM3A 3I05A 4AT1A 4YDQA 2QL7A 3FMIA 2FWMX 2CZ9A 2PPVA 1YQTA 3NYRA 3FF1A 3PHBE 4FFRA 3TZKA 3BE5A 4A1FA 1U5CA 3SZGA 3T9FA 2DVMA 4W7HA 1E63A 3BDIA 4Z0NA 4BS9A 3ZD9A 3SQLA 3S40A 1CP3A 2ZT5A 1FQWA 4XWOA 1FW8A 2I8LA 1JF8A 2DMRA 5EJ4A 1B62A 1NSTA 1SEVA 2RBGA 2VDMB 2ZIUB 2ZJ4A 1CDDA 3BMNA 3K8YA 3TYXA 4C4TA 2X1HA 2HWYA 3JD4A 1EFRA 3V4LA 4KWHA 4YH1A 2BDEA 4PBTA 2PBZA 1UWKA 3F2VA 1FNCA 1DAGA 1KAOA 4WLFA 1FSZA 1XA0A 5G4KA 3BS4A 2GXAA 2G17A 1PD1A 2ZRAA 5AVVA 4IINA 3SVLA 1RABA 4MVCA 3EN0A 3JWIA 1DKUA 1X1TA 2PEYA 3LFTA 3M82A 4GWKA 3ZI4A 1Z6YA 1BC5A 2EQAA 2VHYA 2X1VA 4JCCA 2PNLA 1U7UA 4R9NA 2ZUWA 2XCOA 5BN5B 1OGJA 4H08A 1R3UA 3OETA 3SLRA 2P4HX 2CZQA 2QXUA 2FPKA 4MTCA 4DV3B 1EVEA 1ZS9A 2DR0A 4MRSA 4F3TA 2WIKA 1EHCA 5A04A 1K4KA 3TIVA 1LV8A 1FFDA 1PCXA 2ZTUA 4GD3Q 2IYWA 3DFFA 3F96A 3GBVA 2MINB 3WSVA 1JDUA 1BFUA 1NLZA 1AKRA 1UBNA 2QK4A 1HRKA 4LSMA 3ESCA 3BB3A 4IZJD 1YV9A 1RLUA 3U9TA 4S2EA 4C3VA 3MA0A 1KFEB 3LT1A 1R5JA 1FZQA 1CEEA 3WRXA 2XB2A 3DC7A 2DHEA 2DOKA 2O50A 4TXMA 2I80A 2PH7A 4DNXA 2RGBA 5BPFA 4TYNA 1B42A 4IIJF 2DWQA 1ZCBA 2RI0A 1K27A 3P3GA 1GZVA 3C8MA 3M6MD 2WJHA 4OO1A 3KZMA 3L40A 4L5CA 4NZMA 4D4JA 4FW3A 1FRQA 3B6EA 3ONVA 4TYMA 2F55A 1WRBA 2RHDA 3GVXA 3CLRD 2D6FA 3AHFA 5FDFA 2YOHA 3Q10A 3F74A 2ZYDA 1R6BX 1AC5A 5TARA 1MX5A 1U5BB 3DCIA 4MVWA 1KA9H 1NA5A 2ZK7A 1N5MA 3NALA 4DPXA 4BB6A 1RHYA 4HH1A 1E64A 4UBJA 5FLEX 4GL2A 2G67A 2A59A 1DC6A 2FEAA 1W5SA 5A2GA 1AZLA 2PO0B 1K7XB 1T5DX 3FA2A 4DRZA 1COWA 2IPMA 2JA1A 1Y8QB 5ALOA 5B4TA 1F17A 13PKA 1LJ8A 2ZIAA 1D2NA 5FBVB 4NBKA 3ME5A 4QOFA 1S2LA 4MEAA 5KQGA 1W85A 1IJFA 4FCCA 1CLUA 1T43A 3KR1A 4IIXA 2GNPA 4WBSA 3W3AD 4NBSA 4EB0A 4M0CA 4KLAA 2YXDA 4D6XA 2VZ0A 1C7ZA 1E69A 4J0EA 3RUDA 3KSBC 1QR2A 3MGKA 4GOJA 4BVJA 4ND4A 1Y9EA 2CE7A 3H0CA 2OY0A 3ICVA 3PWTA 3T5PA 2BTEA 3I28A 5HGJA 3NBQA 2RC6A 4F4CA 4NYMQ 1ADFA 1G1AA 3PDCA 4EYGA 2EP5A 2LRHA 1OMOA 4MW9A 4A36A 1NU8A 1QYVA 1S7GA 5IEBA 5ICCA 3S81A 4RVSA 2OPBA 1V71A 3IAM1 4KWIA 4MUKA 4WXYB 2DLNA 2FPXA 3C39A 1E2EA 4GZ5A 5CFMA 1TF2A 3HO6A 2WWYA 4NWIA 2ZXUA 4GX1A 1R5BA 3LCJA 4XEUA 3RSSA 5KSOA 4DR6I 1H2YA 3DQPA 3DDHA 4JBNA 1TXGA 3B7WA 1UOQA 1OU0A 3VPGA 4OYLA 4FW9A 3HI4A 3HJCA 3AM1A 5EMHA 4TTAA 2VAMA 5P8WA 5ADVA 4GF5A 4DCPA 4YXFA 3QKWA 2A58A 5GP1A 3BXFA 3NTLA 4EDHA 2FHSA 4ND8B 2R7MA 4JIMA 2W7TA 9GPBA 2ZROA 2AZMA 1RWVA 4QWWA 1X7ZA 3BF8A 3GMDA 1CK4A 4DV0I 2OO5C 4MR7A 5EIXA 4JITA 2CFTA 1NBOA 2Y2VA 2WAMA 2QRUA 1KKHA 1U3UA 3V6MA 3I2YX 2H4FA 4FX5A 2WY2D 4CQLB 1Z18A 2HMVA 4EB6A 4NK5A 4TRNA 1UAAA 1KRHA 4MR9B 2E49A 1HX7A 3DZ8A 5KDDA 1E3IA 2NADA 1MC8A 4M86A 4ZKEA 2QIPA 3DDZX 4DCJA 1YS9A 3H84A 3LLUA 5IANA 4M6WA 3E9NA 1B8OA 5T8KC 4RA6A 2DT8A 4UBNA 4YUWA 2DFLA 1WULS 2DPXA 2AX3A 4N7RA 3WGJA 4C2BA 2BEUB 2BCEA 1LBEA 4URFA 4DIUA 1MEJA 1NJGA 3D43A 1VJ5A 1XNQI 3RIMA 3WDLA 1QE0A 3WLLA 4RH1A 2HK6A 2IHZA 5THQA 3V4OA 4C01A 4LF9B 4YHHI 1VL6A 5FO0A 3KSUA 5A0VA 3KIPA 3GZTB 3G9TA 4ANFA 2BKUA 4OB7A 3T38A 4OA5A 1A0OA 1WKCA 4WKBA 3M2PA 5ENZA 4ZXPA 4DV2I 1PW5A 5T4FA 2VPQA 4JLSA 3SZMA 3VNRA 2B98A 2I54A 3FTCA 4JXXA 3E9QA 4HSEA 1FDTA 1W48A 4YO8A 3X44A 4X3OA 3BA6A 5TT1A 2GUWA 1UDNA 1FX0A 2GK3A 3BSYA 1B14A 4QSHA 3MGGA 2EKBA 3W2FA 1U9YA 5D1HA 5DGCA 4BLVA 4I4CA 3WLPA 1ENPA 1MAHA 1RHKA 2VDWB 5K36A 1A2BA 3U1VA 2ZWPA 1P39A 5LKRA 3W04A 1ITZA 1H42A 1ZD9A 2BM9A 4N0EA 1KZ7B 2V8PA 1SHZA 3DPUA 4MUIA 5ALPA 2ZSJA 3SEFA 4DMCA 4KXYA 5JDIC 1ZUD1 2QG9A 3K0FB 1JVBA 4NF2A 2JLVA 1IZ9A 5I7UA 1JV2B 1VBNA 4UE6A 1PN3A 2NTEA 2V0GA 1V1JA 2FR8A 3BH6A 3NOVA 1PJZA 2R6HA 1YQDA 2WRZA 3B9BA 3JW8A 2JARA 5F21A 4CTNA 5IT5A 4FFNA 4LWOA 3T3MB 1E9BA 4BCDA 2AUMA 3GJ6A 1NFQA 2V6IA 3V4RA 4G5OA 4WOCA 2NUBA 2B3DA 3I9JA 2GETA 3KJEA 1M7HA 1U7ZA 1Z5BA 4TS9A 4YEDA 3UMFA 1MORA 2DY1A 5FFMA 2H9IA 1PFKA 4PNHA 4DC9A 4R8SA 1YR6A 4RMNA 4DLLA 5LC1A 1VL0A 4IIDA 1SXPA 4F06A 4QVGA 5AM1A 1WQ3A 5A3VA 2G88A 2IYRA 3AF0A 3PNLA 5LJIA 2O19A 3F47A 3PRJA 1VA5A 3L0PA 4GX0A 4HGPA 1DKQA 4IIVA 3R9KA 5KQMA 4LFBE 4F2WA 4K6CA 5LSAA 3LDFA 1YQQA 1UOEA 5EL0A 3TSCA 2P4QA 4P34A 3ZZUA 3TLAA 4O6VA 3THYA 5CU7A 1SCJA 2AC4A 2F9MA 3G85A 4YUVA 2IEDA 3ECAA 4M21A 5FUWA 2CJXA 1RM0A 2YJTD 3PGVA 2WV9A 3RJ9A 4CZ2A 4ENVA 1Q1AA 5LFAA 1S96A 3ST7A 4CG1A 3H0EA 4IDQA 4XGQA 3UK0A 1BN7A 1W1IA 1CNMA 5K0ZA 2FN8A 5H81A 2Z5FA 5AM2A 3ZN2A 1PK9A 1N0VC 1I0LA 4LTDA 4Y6QA 5JUWA 1PFYA 1ISPA 1W4LA 1EUYA 2B94A 2NUTA 4YPOA 3ET4A 1I94B 2DKNA 4XVQA 3TQIA 4JSTA 2NPOA 1D1PA 3QPCA 5C4IA 2HOQA 2GH1A 3OTOE 2X9VA 4UTXA 5CURA 1IXRC 1GJRA 1RI2A 1X0XA 1YSCA 2FPLA 2WI8A 4FXPA 1WD5A 5DCLA 5JO9A 3SDSA 3KG2A 3VDRA 4OP3A 1CW2B 3BRQA 3GG9A 1PR5A 1DMSA 4NNJA 4YMGA 3ZKAA 4TZ0A 3BJMA 3NLLA 3WU4A 2J9GA 5TDHA 3S55A 2WDZA 4IXMA 4YR9A 3LGXA 2PUVA 3E53A 1RQXA 4OU5A 1WOYA 3L7ZB 1S3FA 2ZJYA 3O82A 4I4LA 5EZYA 4E15A 2H52A 8OHMA 3TW8B 1G4HA 3ZGNA 2LNDA 3KSRA 2J9FA 2JLAA 1GZ4A 2IV2X 1AKUA 1EJ2A 3GU3A 5SZJA 1ND6A 3DXZA 2X0JA 2NX2A 4L9SA 1N8SA 4HDRA 2FSUA 3NPAA 1RXWA 1D5CA 2ZRMA 4I5IA 4NG5A 3UAVA 3WDKA 3BFPA 1BKDR 1YOBA 1W0JD 4V03A 2PMFA 3IUBA 2ZYHA 4I08A 3ZWCA 2JGKA 4QUKA 5EG5A 3EIEA 2NSJA 1OXVA 1ZUNB 2FI1A 1TLFA 1UWVA 3ICCA 3L6OO 3B5EA 4TTSA 1BWPA 1E3LA 2C82A 1V5EA 1OY1A 1WMBA 4TQ9A 4OJQA 3FVQA 3R7WA 3RE1A 5I4IA 5LP6A 1RYZA 1YT5A 5BNIA 4C0JA 3L7MA 5KB3A 1R8JA 3NEYA 3KYDA 3R41A 1IN8A 2OILA 4LBVA 3M5PA 2F6RA 3B1YA 1E2NA 2JLRA 3PNQA 4R7GA 1OA0A 3BKWA 3GLQA 4P3XA 2ZUTA 4QGGA 3DR5A 1WV0A 4U7JA 3DZIA 4QVKA 1KARA 3NMUF 1G5IA 2XZDA 2DPMA 2Y9MB 3ENVA 1W9MA 3MQ4A 3BEOA 3OKAA 3QOXA 4E3ZA 1Q7GA 1KIFA 1R5OA 2XQGA 1P8JA 3E3MA 4KI7A 4M0LA 3ZK8A 1GP2A 3G2OA 3NATA 3Q1QA 3OQJA 2P2GA 4MQMA 4C3UA 5EE1A 2C1EA 2WAOA 1DC8A 1KNQA 3T7EA 5BWLA 2FOLA 1DAPA 4G5QA 3D4PA 1JHDA 2JHPA 3IRVA 3JQBC 5FOTA 1PFGA 5SY6A 3GCMA 2HK8A 4O63O 2C38B 4CN8A 3NHUA 1ZJWA 3T1HI 1N4DA 1T91A 1VKOA 3QYJA 1RQPA 2GBFA 5BN4B 1AH2A 2QT9A 3Q1KA 5ALTA 2FPIA 1GLNA 1OAOA 2E4VA 2PSEA 4I50A 3VAAA 3HEAA 1G6HA 3VKVA 2UVDA 2Q5FA 4LJ9A 1VISA 1ESCA 2ACVA 2DFNA 3PDHA 5CVEA 3LU1A 4D8YA 3I4CA 2AFIE 1Z7YA 5CW1A 2AVNA 5ICEA 1FX1A 5K01A 5JJKA 4IBOA 2I78A 1OFUX 1U81A 3JYOA 3QEOA 1UXOA 2OLEA 3T3GA 4AUNA 2GXQA 3A31A 4O08A 5ULLA 2MR5A 4OL9A 4Y67A 3G2MA 4Q9LA 3GGDA 3AIIA 2DTDA 4D25A 3A06A 1S8OA 1HE8B 3CX7A 1JJAA 4X3PA 3HCWA 5F2NA 4LCHA 3ZDXB 2GAOA 5A3SA 3B1KA 4J0DA 3S70A 5CA0F 5LVAA 5LZ9A 1EJ6A 1O96A 2GFIA 3WGMA 3N86A 4L6CA 3VR2A 1U2GA 3OPYI 4ME6A 4EY6A 2QE6A 2VXCA 1NHHA 2B82A 2VJBA 2HZ7A 4H1WA 4OAPA 3B9QA 1CC1S 1FJGB 5BT9A 2ERXA 1WVIA 2A67A 1UT5A 1IUPA 1YBMA 1FUEA 2RBEA 3JASA 4XIIA 3W2EA 4INOA 2EL7A 1ZUWA 4M88A 3CN9A 4X44A 2EDCA 3MLEA 1GCIA 1P42A 2OUIA 1N34I 1O97C 1OW3B 2X77A 2WWGA 2KLHA 3GCGA 2X58A 3IBTA 4ZK2A 4AJNA 4UBMA 3NM6B 2YCLA 1ZEJA 2UUBE 1Y3IA 4PSDA 2QF7A 3Q5GA 3BWYA 2GHIA 1C80A 3P9XA 4AP9A 2XNKA 2Y66A 3ZCVA 1L7VC 1QPBA 2WNIA 4LXGA 3D8TA 4K9NA 4FGUA 4KODA 1XXHE 2C97A 3ZWXA 4YJ2B 2FSVA 5LPNA 1E3WA 1ZW6A 3C14C 2HHHI 1NXTA 2IFTA 3AHCA 3GVCA 4GNRA 4XQGA 3WDMA 3JAWB 4TKVB 1R37A 1UM8A 4HDSB 3I5AA 5KTNA 4UNPA 2ZTHA 3TKYA 5JARA 4MGKR 1E8DA 1JBKA 1TZJA 2B37A 2FEPA 1W46A 2VNSA 2A57A 3A58B 3EWN<