1HK7A

Middle domain of hsp90
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
248
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK PROTEIN HSP82
publication title Structural and Functional Analysis of the Middle Segment of Hsp90. Implications for ATP Hydrolysis and Client Protein and Cochaperone Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 75
structure length 248
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hk7A01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hk7A02
1USUA 1Y6ZA 1Y4SA 2O1TA 3PRYA 5FWKA 2O1VA 3HJCA 1HK7A 3Q6MA 3Q6NA 1USVA 2GQ0A 2IOPA 2O1UA 2CGEA 2IOQA 2CG9A 1Y4UA 2O1WA
chains in the Genus database with same CATH superfamily
1AGRA 1XA4A 1JRLA 2W6JA 5A9SA 4PS1A 4LZLA 3NG1A 1Y34E 3O31A 4HFNA 2VWPA 1E7YA 3ZGZA 1T3TA 2C2KA 1QHYA 2V74B 2E9SA 2QPLA 1AA9A 1E3TA 2E5FA 3DUFA 1RRFA 4O4HB 3MTGA 5CMLA 5E2BA 5F52A 3RIGA 2IW1A 1Z17A 2KW5A 4WWHA 4ZT6A 4ZC8A 4V1CA 4TWRA 3RODA 3AHCA 1Z7BA 1QZZA 1G8JA 3R40A 4N7MA 5KOHB 3B2QA 4MMZB 3V2GA 4WHMA 4I3FA 3F6RA 1U0OC 1JE1A 1SUSA 1EB8A 2OD7A 4REOA 4N03A 5DRTA 3DCYA 4JZKA 1YRBA 1GL7A 3FKQA 3LWBA 4G5GA 1EK6A 2HTEA 4XD7A 4F2DA 5KMGA 4CMCA 4KFCA 1A7JA 1X1EA 2QD4A 2KX7A 4P7FA 1I5EA 3PPXA 4ZU3A 3VM6A 3RS5A 1BXGB 2A3NA 4LI3X 3WIOA 4A8JC 5JNVA 3HVHA 3N0XA 3NCTA 3M6VA 3RJMA 3RANA 1GKLA 5FFFA 2PUBA 2DQYA 1TC1A 2AXNA 3B13B 4AJLA 1E58A 1RP1A 1T1EA 2HPHA 3UGTA 3WYNA 2PGAA 4K03A 5IK2A 2DF8A 4BVJA 2FW1A 3K9QO 4MUNA 3SCZA 3L05A 4FB4A 2NN6F 1F0NA 1SUWA 3M5DA 4RWZA 3V9AA 4BX3A 4C0JA 5ICMA 1Q21A 4WACA 3EZYA 1ND6A 1FE8A 4U9HS 3JY6A 2ZYGA 4LDRA 4J49A 1ZJ4A 3E84A 1MX3A 4HUQA 3TLKA 5DKFA 3I4CA 5L45A 4KE6A 1PNRA 4MS1B 5DX1A 1YJXA 3AT1A 4R41A 2ZWPA 5L3SB 1ZMBA 3CPJB 1SA0A 4JGBA 1CR4A 1EVJA 4WUDA 2YMLA 3HV2A 3VR6D 4AULA 1IZ7A 3O3CA 1VJGA 4DR3I 1BWQA 1NVVQ 2X36A 1SBQA 1JHOA 3NS7A 3FJOA 4DR4I 1COWD 3KVNA 3P19A 5JVDB 4YT2A 5K0CA 2P78A 4GYWA 4MICA 4V3BA 3CVWA 1U1DA 4JUCA 1FRNA 5DM2A 2X5OA 3ZW9A 3M1YA 1QKIA 4GSLA 1FTGA 2VG8A 1M6WA 1NZJA 1HE8B 4EHHA 3FFBA 1HZJA 3PDJA 3ZLTA 4FUTA 1EM6A 1Z26A 4K9MA 2BGJA 2P0EA 3JRXA 1Z7EA 1NV8A 4BCCA 3NRJA 1WVIA 3OSUA 3V1NA 4YXWD 2PUHA 1LI7A 5LPNA 1IJEA 1NJ8A 3NHZA 3FBWA 1ETUA 3JYQA 4UUAA 4WXRA 4ZT4A 5BSTA 2PD3A 3BK1A 2ABWA 1J33A 2LWIA 4BFXA 1ZDMA 3S1SA 4RVGA 5A03A 1ZH2A 5IMBA 4JOSA 2JGLA 2W6NA 4KB5A 4FSDA 3ND5A 4MAMA 4UMDA 4EZIA 3OCCA 5D3MA 3DCJA 3FMIA 1DJOA 2PCJA 2BMVA 4RBNA 4QUEA 1GUYA 3SMVA 1OC2A 2YWCA 4Z9YA 4KUHA 5EMNA 3L7KA 2HV9A 4N7JA 3AF6A 1TF2A 2VDJA 1E3EA 2RG1A 1CUZA 1LPAB 5I5EA 4TYYA 2FG7C 1MJGA 1T6BY 2GHTA 3G2LA 3QWIA 4P58A 3U37A 1ZJ6A 5JAIA 1ULSA 3QOXA 4N9WA 4FYMA 4U6SA 2J85A 2Y4NA 4E5MA 1OXMA 1XCMA 2XJ9A 2BC9A 3I73A 5KCZA 1JE0A 2OLKA 3DGEC 3KXIA 2CNLA 2QDXA 3FTDA 1XZIA 2Q2WA 4W1RA 5AO9A 2WWHA 3HCEA 4BB5A 2PX5A 3ZDAA 3TCNA 2HQBA 3KJNA 5C5CA 1HO3A 4BVLA 2FFAA 2XLCA 3AOEA 3JALB 4PX3A 3RVPA 1CY1A 4EM6A 2OR3A 1VE5A 3C8UA 4G1EB 5K0FA 4NFLA 1UBTS 5IKMA 5ITZB 2NO1A 1UBJS 4NFSA 3QENA 1N2JA 1ZA2A 2GZ2A 4DSOA 1QGUA 1PEYA 2CMHA 3IB3A 4RJIA 4H6PA 4TM7A 1P4SA 1HWYA 5LD2C 1JFFA 5A0VA 2OL4A 1L5QA 3LVFO 1V96A 2RSLA 3OEYA 4KRYA 5G1PA 5ADWA 3SYRA 2FI1A 2CMFA 1WNFA 3MLAA 4RTNA 2W6IA 4EPXA 4MJXA 2WWGA 4A0FA 2GESA 3DDCA 2VF5X 4UCXA 3ZS9A 1Z63A 5DDIP 4ABTA 4QOIA 2IPMA 3PHCA 4ER7A 4MDFA 5DK4A 4A73A 2D5CA 3P32A 1PDWA 2XWJI 3SS8A 1AO0A 4GHWA 3E9NA 4LRWA 4PC1A 2XYRA 4RIFA 3IP9A 1IATA 3K1YA 2I55A 4MDTA 3CKLA 1V5IA 4NHEA 2HDHA 2GYWA 3JWGA 1WW8A 1T6YA 1Z74A 2H17A 5REQB 1JLHA 1ZD4A 4I7EA 4P54A 2IBSA 3ETEA 3ORQA 1JVBA 3S1AA 3CGWA 3J80Q 1FNCA 1BGVA 1E6UA 1EINA 2PGJA 3PUXA 4K46A 3TM4A 4CMEC 1UR5A 1FMFA 3ZU3A 2JK0A 3T7DA 4ZALA 2RGRA 2BD0A 2R47A 4YRBA 4KN8A 3KSUA 1VKRA 3ABOB 2ZVDA 4GMDA 3U9TA 1K8RA 1JUDA 4DL9A 2VP6A 3ZTWA 4UFPA 1G8FA 4AUKA 1MMFB 4QOGA 4X85A 2DFDA 3D8UA 3OCYA 2I3AA 1GNQA 1TCVA 2B8JA 2WU3A 3HI6A 3W3AH 4FFBA 2ODQA 4H4EA 3UK0A 5EVJA 4UPEA 2REBA 3GEIA 1OT3A 2XTAA 5FBLB 4LF6B 1JJAA 1YB4A 1RMYA 1I2AA 3UUEA 1E0KA 4XB2A 1O0CA 3IODA 2AC4A 4B6PA 3FVTA 1F0KA 3UYLA 1HDGO 1KQOA 3IJ5A 4ZODA 3I9LA 4MYRA 4X1IB 4CWAA 4GXNA 4D6XA 4XFDA 1GQSA 4DY6A 2ZWOA 2FJUA 3DZHA 1KJQA 3HUUA 4CMGA 1A5AB 4IF6A 4P3NA 4RLSA 5FF9A 2J87A 1O0BA 4AS1A 1WWKA 1UDRA 1KKHA 2O3ZA 1CTQA 2ZRMA 1GPH1 1GKYA 2GEKA 4UFOA 4DC9A 2A67A 4IIEA 4BO4A 3UPUA 1YUNA 1CFJA 1VG8A 2P79A 2ZUBA 1EWQA 2QI9F 2RK4A 2BELA 2FN3A 4GBGA 1XL1A 3D7MA 2UXDE 3G59A 4RK6A 2F62A 3A4MA 2XSZD 1Z56C 1T5HX 2G0AA 1OFIA 4U2DA 1VPWA 2B4TO 1P0CA 3U44B 3CX7A 5D7NA 2QN8A 4LRXA 4WNAB 2Z3WA 2UZ0A 2H2GA 1ZLYA 5BR7A 3DL2A 4EJSA 5ADVA 4KC0A 4QU9A 3DQQA 1CEXA 1MT3A 3WB9A 4FKMA 4GOXA 4CTOA 3AK4A 1E63A 1J6UA 4ZCSA 1HKHA 4R2JA 1OE0A 1T2AA 4Y1RA 2QW8A 3WRWA 4EW1A 1B43A 5EWLA 3UGKA 4C04A 3OO0A 3SXJA 3V6MA 1D8AA 3LECA 3UWOA 4U7TB 1H0RA 1ZWLA 1OLXA 3A6LA 4KU4A 3ZI4A 2BI8A 4YRNA 4TRJA 2XUHA 2Z5CA 4RF3A 1PP4A 3IELA 4B43A 4E5YA 4EUSA 4GPIB 4NWIA 5GV7A 5JWHA 1OKKA 4LNHA 5K8UA 2XXAB 4RA6B 2EATA 1WMDA 3CRZA 1I1QB 2WUEA 1SU6A 3LX4A 4BGDA 5JNLA 2RGBA 3C8ZA 4B81A 5EYPA 1MJFA 1K8QA 3KV1A 2CNOA 2QRMA 4RD6A 2FHPA 1V3QE 2C5AA 3CRMA 5D3ZA 2CUTA 3QPWA 3WWEA 2P2NA 4JCCA 2N0SA 3GJTA 3GBPA 3THSA 5JNWA 5F1OA 4ENVA 1DKNA 3LC2O 1XXHB 2VJLA 3OOWA 4KQ2A 4XASA 4EEKA 1GG2A 5I4KA 4CLDA 4F1WA 1BHO1 1XNRE 2FMXA 3GHHA 4PAOA 1LRLA 3BH6A 4PF1A 1XKTA 2P1ZA 2O2JA 4US1R 3T34A 2F6RA 1DOZA 2EQAA 2HZ7A 2IVZA 1VIYA 1CD5A 4RELA 1G7SA 5AOBA 1R4AA 4Y6PA 1BQ3A 4JITA 2P5YA 4PPQA 2NVWA 4FINA 2CEAA 2R8YA 3A1WA 1THTA 2X40A 1O5IA 4JSYA 5HFAA 3UMSA 3KUDA 5BV0A 5GZ1A 2O5EA 5JH7F 2WQ7A 4PRYA 3CZQA 1XHKA 4QU8A 1U7WA 4UASA 1GGMA 3KQYA 4P36A 3B5EA 1URPA 2H7XA 4RZ2A 4R9VA 2YFHA 4OK3A 3DMNA 2XRFA 1SVMA 4Q1FA 1B15A 2A9FA 5JAUA 3MHTA 4BQIA 1AKRA 1CNEA 3GEEA 3U1YA 4A0QA 2VJYA 3FI9A 3INYA 3AVXA 3MUOA 2PSFA 3F90A 2Q1SA 3HA2A 3DXXA 2XNDD 1SOVA 4I5DA 1R5BA 5IBCA 4XUEA 3H2KA 2JGFA 1IE3A 1KC3A 4AG6A 4LJKA 1Z4NA 1E4OA 5AP9A 3LC1O 4D4JA 2BDEA 2IYWA 5H4HA 5A6SA 1R5JA 5JQGB 2P2LA 1BGWA 2ET6A 5TMPA 3G0IA 3H5RA 4HGQA 4OQQA 1RKVA 4D3SA 4UU1A 3B1ZA 3CDIA 1AUPA 1L7NA 2YJNA 4HNAA 5I3CA 2ATVA 2BM9A 5HZKA 2WJ6A 2DR3A 1HFKA 3VPHA 2Z6VA 2VQFB 4CLHA 3GC6A 1T4CA 2UXBE 4KGDA 4NR0A 4YJFB 5FI0B 3UAZA 4N76A 5ARBA 4U7JA 4I4CA 4G1MB 3GRYA 3CPHA 4FMBB 1TIPA 1BH2A 3R77A 2NU7B 1S16A 1QYIA 4W1QA 3TE6A 4HDNB 1N0VC 4KVGA 3QV2A 4ARZA 2A5FA 3NAMA 5HYVA 1RWNA 1ZA1A 4I6JA 5CX1B 2EBUA 5G4KA 4TZKA 5EZ5A 5I5GA 4DLWA 1F20A 3QQ5A 4J03A 4PNHA 3LLUA 1WMAA 4A0GA 4ZHQF 3GVPA 2CSUA 1P3JA 2RI1A 1V71A 1XU7A 4DLUA 1LY1A 1TL7C 2XVYA 3LA6A 2H65A 5GMOA 1H1LA 4IBOA 3AW9A 3GGCA 2I8AA 3AWDA 3HU1A 4FYYA 3QX7A 5CPFA 2JBHA 3SHOA 4AP5A 3INTA 3UCEA 5JCXA 1D9XA 2Z8XA 4YJ3A 2YOFA 3PGA1 3F5FA 4G23A 1ADFA 1UH5A 2HNAA 2IQ5A 2VDRB 3KVYA 4I50B 3LHDA 3MRVA 4I66A 4N0MA 3ZVLA 1XAIA 2FWJA 4O33A 2YW2A 2KS6A 2SECE 5HQJA 1DPFA 1KAQA 1G9TA 1R7RA 4EY7A 5C0XA 3CW9A 1O0SA 1G1AA 1W9HA 1MO2A 3PTLA 4FNMA 3DZJA 1V8BA 3MMPA 3RC3A 3TQHA 4NQZA 4CCYA 4G0NA 5C4IA 4OLAA 1KAOA 4LVOA 5A9TA 2R68A 1U7TA 4PHTA 4BQSA 1QCZA 2QVBA 2JL1A 3DDWA 3AP2A 2O2HA 1GEEA 3IUMA 4MRMA 4OGFA 5LLTA 3FPJA 3LTOA 3FWZA 1EVYA 4ZVNA 4CIXA 4L4UA 3MFQA 3A4IA 2PL9A 1PYDA 2WSLA 3K2BA 5JE8A 3UN1A 1EGQA 2INGX 5IF9A 1D6JA 3NTRA 1E3IA 4X6YA 1KMIY 2DPMA 3PFGA 1K9SA 1JALA 4PZEA 5KHLB 2IEGA 1PDOA 4HR7A 4P34A 3GMTA 3SPXA 4UXJA 3S2YA 4HNSA 3L0CA 3ZDCA 1ZVKA 2CHQA 1Q3HA 3BL5A 4KAJA 3U4QA 4YR7A 2W9XA 4B3JA 3K71B 1CYDA 1O94C 2B8NA 3EVZA 3CX8A 3JQ9C 1V37A 3E05A 4W7IA 2WZDA 4GO1A 4U7WA 3ANNA 4ODIA 5BSFA 5JJ5A 3T5BA 2J4DA 1OIWA 3BUSA 1NQTA 4MW4A 2ERXA 1YO6A 3BD9A 4FD3A 3TQIA 1BQ4A 5TE9A 1SUCA 4XEHA 4DNQA 4D7AA 3QY0A 3PCXA 4P5PA 2HK3A 3FLBA 3JWEA 3VA7A 3KALA 2QRKA 5I7OA 1PVOA 4IJMA 4DV5I 4QJIA 4UBOA 3ZU5A 3SDBA 3NOQA 4UZSA 3WY9A 4KSYA 4AZ3B 4HK4A 5FAXA 5T57A 3OJWA 1L7VC 1NW8A 1F1BA 4DMCA 2J9ZB 1UK6A 5IAJA 3EQ8A 3V4LA 3KCQA 1W8IA 2DKOA 3JARB 1UBOS 1IDOA 4M88A 4WZ6A 1XOIA 3LZDA 4IIUA 3UT6A 3K0SA 3VRHA 2E4UA 5BURA 4XTJA 4JIMA 5LC1A 4A8PA 2Z6UA 3HRIA 4L28A 2AEJA 4J2TA 5F21A 3WYAA 3AG6A 4KXNA 4MP3A 1KTIA 2YWHA 1YJCA 3P0RA 3QVLA 2W6MA 4Q7KA 4LCBA 5FADA 1YNOA 4PYKA 2KLHA 1E0JA 2ASVA 3V00A 1AF4A 1L7PA 2AFIA 5EE1A 3ZZNA 5IZ4A 3IB6A 2B4RO 2O3RA 4M7RA 5KSZA 3QSYA 3L1HA 5C0XE 4RKEA 3GRCA 1KO7A 2ZRBA 2C29D 4IJKA 4BFUA 1LS1A 2Q4OA 4LKRA 1SCUA 1X7XB 4CTJA 1AB6A 2BVNA 3FBGA 1ADJA 3PI7A 4PZAA 2AC2A 3SJUA 4A3SA 2FX5A 3K32A 3MD0A 3DMTA 3P9PA 1ZICA 2PBZA 4GNKA 2YWFA 4AVYA 2GBLA 3IKJA 2BMJA 1T5OA 4JB2A 5D6NA 3TSAA 4LTMA 3U3DA 3T06B 2H16A 3V8VA 4FS8A 1JQBA 1J42A 3E7FA 1N6RA 5GP1A 2EQBA 1KNXA 1ZN8A 2DECA 4JL6A 1K0UA 1SC4A 4O4JA 4QGHA 4BTEA 4DIKA 3QTTA 1CYEA 4TTVA 2DB3A 4E5VA 1T3ZA 1C0LA 2F48A 3OE7D 4DHEA 3PNYA 3G1UA 1LXCA 5JZ9A 1T9KA 1US8B 5JISA 4R40A 5DWQA 2VHXA 2X5NA 4RVUA 5BW8A 3A2KA 1T8UA 2Z1NA 5B58T 2W2XA 2VHEA 4UMVA 4AF6A 2WJWA 4HBZA 2HV8A 3AH8A 2W22A 1ZRSA 2F4VB 4F92B 5AI0A 1P8JA 2WJZB 1C1DA 4PINA 5DBHX 5BP7A 1BE1A 1CNFA 4D9NA 2NMVA 3RFCA 3TRIA 1TIBA 3K09C 4II7A 4S24A 3DOCA 5IG2A 8MHTA 3UBMA 4ADSG 3V42A 1CUJA 1FPMA 3NGLA 3A1SA 1B4DA 3RC1A 2ZUFA 1BCRB 5BN4A 4LXQA 3DHWC 4OXYA 4H6WA 1F2DA 3P0HA 3UAYA 5CB6A 1WB4A 3AI7A 5FLYA 5IUNC 2VNAA 5TQVA 1T2FA 2C77A 1J5EE 1O3YA 3BM5A 3I32A 4LE2A 4HFJA 2BONA 3SOZA 2GN1A 4TTTS 1PJLA 3FSEA 4FCVA 4MIKA 1JKFA 2PWYA 3GJRA 1B6TA 3T7RA 3U4GA 4J7CA 4BNNA 4D45A 4NJOA 2ZTSA 3F4LA 2I78A 4FJ1A 4I81A 4M0FA 3EDRA 5BSHA 2HA2A 2Q8NA 3ASYA 4MIEA 4ENTA 2DUWA 4G5XA 5ELWA 1H2ZA 2N47A 1NUQA 1E1CA 2R48A 3P9CA 1LA2A 3UJ7A 1GUDA 1GXSA 3HY3A 3NYQA 2QYHA 4HWSA 4JUAA 1Y81A 5GONA 3CX6A 2HIGA 4HHEA 4HH0A 4IINA 1JLKA 3TQRA 4ZMBA 4B85A 1X77A 3KWMA 4RESA 4Z53A 4AQYI 3C1OA 1WXFA 2NU6B 2P9EA 3LYLA 3Q10A 4BAGA 4WJLA 1XLTA 2FVYA 3GRUA 2YJ5A 2IOFA 2R6GA 2WPDD 3DO5A 2HLDD 3RDPA 5AOCA 2AOTB 1E4EB 3JVIA 3KDSE 5DNWA 2QU8A 4AO6A 3KEGA 1RWWA 2G71A 3EXHA 1S4EA 1B7GO 1JHXA 1Y4AE 2P6UA 3F98A 1E6EA 3M49A 3VI3B 4ZYTA 5LQMA 1L5ZA 4V0SA 2C8LA 1VYHA 2ZJ7A 4ILEA 5I8WA 3QYAA 3IDFA 2V2QA 4BTVA 3A70A 3ZJ5A 3Q1QA 1VYTA 2Q4DA 4AG5A 3NP7A 4Y2XA 1PLJA 1GJRA 4B4KA 5L4NA 3NH9A 3LY5A 2FEWB 3QEOA 1UK7A 2DHEA 3RASA 4TKVA 4HS9A 3TBHA 5I7EA 1R4NB 2UVQA 1M1ZA 5BYAA 1Q1NA 1QLJA 3ISTA 1HNXE 4OQYA 3T3IA 2W2PA 4URZR 1QZRA 3Q8LA 5BY2A 1HEIA 2IODA 4M9CA 1XD2A 2NN3C 1JQ5A 4HEQA 2WJGA 4MQ5A 4YT4A 3BJRA 4JLJA 4OZEA 1EQAA 1SXIA 5AVXA 3WDSA 1X0XA 3V46A 4WK2B 3U4AA 4XTCS 2DQKA 1HEYA 2ECFA 4F71A 4RX1A 4BLRA 3H2YA 3CZCA 4OFXA 5JC8A 1AB5A 1ZN9A 3D7LA 4YC7A 2RH9B 2XUOA 3I9V1 3LX6A 4KO3S 4MQ4A 2IEDA 3REFA 1KMHA 3E8MA 5M7EA 1XX6A 3UPDA 3ICQB 3OTQA 1AS2A 4DPYA 2J3LA 5EIFA 1Q11A 3DFUA 2C4KA 4J0QA 4W5JA 4G07A 3TPFA 2ZQYA 1P1IA 2PEZA 2X9VA 3WV5A 4Y8VA 1WDWB 2VIIA 3CKMA 2A84A 1W1IA 2FLVA 5TJHA 1JT9A 3ECCA 4HLQB 4LWPA 4EX6A 5JSHA 2L17A 5DGCA 4YRTA 1U0JA 2GCIA 2X4LA 3Q3JB 3RYFA 2PO0B 1BZYA 5C8VA 2RHCA 2VZ0A 4UTNA 3WLTA 3N6XA 1A9QA 1P9NA 4MTLA 2CE2X 2C2OA 2DPXA 1Z0JA 3MCTA 3OIGA 4II2A 4AQDA 5A9SB 1ESCA 3A26A 4GBMA 4NQRA 3DHNA 2JBAB 3WLSA 3IE1A 4NNJA 3ADCA 1K27A 1YRLA 3H42B 1X1BA 4S0XA 1IBME 3ZE0B 2J65A 1GGEA 3ENKA 2VCEA 2JB9A 4NPAA 2YJ6A 2PMKA 4R54A 3RUAA 3ZGVA 3IS3A 3FPBA 3KT8A 2JEYA 1SR8A 1PJ4A 4IGFA 5TDHA 4DW8A 4MLDA 5ERYA 3NM5A 1JA1A 4V1CB 2V2ZA 1Y37A 3QTBA 3KHTA 1SXJE 1N75A 2IIQA 2QAGA 3L07A 4EHLA 5IVHA 1GTVA 3EZ2A 5AYVA 4EGJA 1GD1O 2JEBB 3MINA 2ORED 1C9NA 2FRVA 3DVSX 3FDIA 3K8OE 1DPGA 3K8YA 4LSWA 3IDAA 4MUGA 4ZOEA 3PDUA 4Q6BA 1ZGZA 1UBMS 5T4HA 1VLVA 1F6WA 1NNEA 4OU4A 3SX2A 2LW7A 5AKGA 2HFJA 3ZDEA 3ZWXA 3U1BA 1SKMA 5A2QQ 5H68A 1IXKA 1O6FA 1W4BA 1ZOLA 2FB9A 4BE7B 3IBYA 4NE9A 4EGSA 3BA1A 5E1DA 3MK31 4JC8A 1R6UA 1W5AA 3MJHA 5CFPA 3EPLA 1RXUA 4XWTA 3WWPA 4N65A 3TFQA 3B36A 3CY6A 3JQ7A 3CUTA 3U6BA 4BP9A 4J3NA 1V3TA 2WB2A 4R2WA 4HUQB 1JJBA 3SC6A 1SVSA 4U2EA 2I2WA 1G5RA 1Q12A 1MRZA 3HCFA 4I9UA 4PLZA 1OA1A 3AL0C 1TF5A 1N6IA 1QO0A 1SA0B 1TMOA 1NMYA 4K2AA 1CY8A 1PVDA 4JBGA 4XYLA 1OWMA 5B2EA 1ZOPA 4PRVA 4AJHA 1GGHA 3I0NA 3T5TA 3VSCA 3WISA 4Q5IA 5IKPA 1O6CA 4IS9A 3EUFA 2YXLA 3IALA 1ZK2A 5A3SA 1J9EA 5LLDA 5IWCA 1XMQI 3WL7A 3GFQA 3I6IA 3SNKA 4CMHA 1VE3A 3DFMA 3K0EA 3HJBA 1G2OA 3W3AA 4QNJA 4GVXA 4OYLA 5LXTA 3H5IA 1W5SA 4G4IA 1NC3A 1WNTA 1PSZA 3IUPA 1NSFA 2UUAE 1JLSA 5DX8A 4X66E 5ENDA 4RGQA 5TB5A 3DTTA 3CLHA 4I4TF 1JKJA 4BNYA 2GNPA 2EFGA 4BMYA 2C7BA 3WGVA 5HIKA 3WIUA 5K2MA 3PRHA 1E2HA 2DLCX 4WASA 1EBUA 3NBYC 2ZRHA 3BZBA 1XZ8A 1N77A 1KFEB 1Z6TA 2QEQA 5BR8E 2KWIA 1GNVA 3T7TA 1N9KA 1AQLA 2SHKA 4DR7I 5HCNA 3FMVA 3X1MA 1LWOA 4KR7A 1CEYA 1ZK1A 4BDTA 1FEZA 4DA8A 5I47A 4C7KA 3VVMA 4WCFA 1DXQA 3ORYA 4B8WA 5G53C 1FVXA 4K9OA 2A5JA 1ORRA 1I2ZA 1HETA 4KZPA 4LKOA 3ND7A 5AD1A 1CS4C 2X19A 4Q0MA 5B7QA 1JXOA 2GO1A 4PLGA 2VTBA 4N8DA 4DR2I 5EXDA 1TJNA 1WUHS 1GPJA 3D81A 5AUNB 4HGPA 4KXMA 2RIRA 3OCZA 5AH0A 4QUBA 3ADDA 4A0RA 4V0LA 3KT3A 4NBVA 2HPZA 3R9WA 4YO7A 2YZ7A 1Y8AA 1YULA 1NP6A 3IJRA 1TFUA 2X3UA 4ZVUA 4C3ZA 4JROA 3GD7A 1NBOA 1PYGA 4HAVA 4HXEB 4KLRA 3N2ZB 1CU1A 4J90A 1PX0A 4I8XA 3RBXA 4XLZA 4HRAA 3VZBA 1H8ED 2XR1A 3L7BA 4M9SA 3C3MA 1JG6A 2DKNA 3HGQA 4B3SE 2UXDB 1JFFB 2I6TA 4D44A 1Y7LA 3FVVA 3IMGA 5GMEA 2JAHA 3KOWA 3EZ9A 2QN3A 3DNPA 4IZHA 4NL4H 4YIHA 1NW7A 4K9SA 1D6MA 1BEUB 2EJTA 2HA6A 5C8DA 1UEKA 3CXUA 4RVSA 3KFLA 1ZUWA 1L2TA 2D2FA 4YQFA 3ANMA 4HJRA 4LJ8A 2HR1A 2Y71A 3PR1A 3FFTA 4IJ6A 1A50B 2Q5IA 4MKRA 2HOQA 4EKDA 4H08A 2P7HA 4KHZA 5FA5A 3Q9NA 3HU3A 4PYLA 3C16C 2C8JA 3PLAE 3K9HA 3DZIA 2YXPX 4H0CA 3EZ6A 1BHQ1 4UD6A 4AP6A 1GSAA 4ZZ1A 4IJUA 4PQFA 2GB4A 4JC0A 3LCJA 3S1AB 5H4GA 2XB6A 1QH1A 1CJCA 4RHXA 1A82A 4XGRA 4F2HA 3PGKA 4LDZA 3SFZA 3O9ZA 1WVGA 3IV7A 4K0RA 3ZZ1A 4FOPA 2R6R1 3O4RA 2ZKIA 3CFYA 2ORIA 4DV1I 3AERA 3KUKA 4MOWA 4RHCA 2C37A 1Z0GA 2B0CA 2DSTA 2ZUTA 1XELA 1ECFA 1R66A 3V4RA 1TVKA 4BNIA 1K6MA 3IQGX 1MAAA 4AMUA 2CXRA 4GOOD 3A04A 3IFSA 2DQ4A 4TS4A 4HACA 3K20A 3ZY3A 3EX7C 4YAGA 1V3UA 1SKYE 1SVNA 2ZDGA 3BIOA 3BA6A 3HBFA 4IGIA 5DCLA 3N6VA 5IULC 5EXEA 3ETJA 4JJKA 4ZJZA 4TYQA 4IDGA 1VB3A 1KJ9A 1ZAKA 1PBNA 1F6BA 3DVRX 4B3IA 1WXDA 2EW1A 3UYKA 4YHHB 4Y0NA 3II6X 3HCBA 3V9PA 3DZFA 4MGHA 3V3KA 1V25A 1G64A 3SDSA 5F3RA 5CCXA 3ECAA 4MRAA 1B2RA 1DRJA 1DUIA 2I3BA 1G3QA 2AMFA 5EJGA 2R6DA 4B7UA 5ALNA 2TSYB 3VJKA 3FKJA 1GPBA 1D1TA 4XWYA 5FQNA 4CMBA 3I04M 3UAXA 3M33A 2X4IA 2XOXA 3FPCA 2QOEA 2YZKA 3MGKA 4ZK2A 1Y4DE 4EJSB 3FETA 2J9FA 2IUFA 1D1QA 4O8ZA 4Q4JA 1G8KA 2PRJA 3NFYA 4FOSA 1LBTA 4X92A 2C42A 4DM7A 2RI0A 2B37A 2M6LA 4WKNA 3AXSA 4CDNA 1QIKA 1EM8A 5EWLB 4UZFA 3D2CA 4XUCA 4JWTA 2XGMA 1V43A 2K87A 3ZZMA 3AVUA 1OLXB 1Z2NX 4Q39A 3HA3A 2UXBB 1HNWE 2Z5CB 1EQUA 2IQIA 3LVBA 4YFYA 4KQGA 3LE8A 5TT1A 1SOUA 4A92A 3CC8A 5KTTA 1PEAA 3KP1A 4U7FA 3WFIA 1UPXA 3BHMA 1ZX1A 1AZWA 2Q2VA 5K3CA 3WC4A 1EK2A 3HCRA 3W4IA 4N5DA 4DCOA 5JHHB 4OF4A 3KU4A 2IS2A 1EEHA 5EYPB 4AM3A 1LTHR 4IZIA 4GLOA 3DOFA 2Z3ZA 1H7UA 4IJVA 2RB4A 3VBEA 5I7WA 3WGJA 3L8HA 4F6RA 1QX4A 4LNUA 2R97A 4P31A 2WM9B 4XW2A 2OT3B 2W2KA 4OPMA 2XODA 2PWPA 3RT7A 3SMQA 2ZVPX 1YBFA 3CZ5A 1PZEA 3IAXA 1HLDA 3ONEA 4BHTA 5D6OA 5JSQA 3H4TA 4BZWA 1E79D 1MJ5A 4E08A 1C9EA 1P5ZB 3I2FA 4FHDA 2Q4BA 1FB5A 1EYZA 4XPIA 2ZIUB 3EVFA 4FMDF 1EBBA 4JI7E 4PCUA 4QHYA 2KJQA 3OM9A 4LDNA 4YCLA 5AW5A 5HDQA 4ZI7F 1TX4B 5FUBA 3W2EA 2LBPA 2W98A 2VRBA 4EBBA 2FMUA 4KBYA 4DV4I 3NBUA 1N8SA 1ZLXA 2JIPA 4EUFA 1UKYA 1ZK3A 4BVKA 3UB4A 3BQMB 4G36A 4GQIA 2O8DA 4G09A 2ZWAA 3ZVKA 4QDUA 3OKCA 4M7WA 4YHBA 4U7GA 1K7EB 1XMSA 1YS6A 5EIAA 4YY3I 4AY6A 3BXXA 4QZVA 5EE0A 2Q49A 5LN1A 1WIWA 4H4CA 1VL6A 2R1TA 1NJ2A 3MXOA 1K6IA 1QDLB 4RY8A 1X39A 5KOYA 4JVSB 4RD2A 2AA3A 3B48A 3QNMA 3JQ8A 3H9JA 1ZP6A 2PGLA 4YJHA 2OZEA 3FCEA 3SU8A 2I9KA 3D5EA 1KOFA 2NV2B 1I1NA 3DV2A 4GVLA 1NXSA 4M46A 3RVMA 1L9XA 2IHBA 3KWJA 3TOZA 4EJ6A 5BMVF 1UFQA 4QVIA 3A05A 3EDMA 3EBPA 8ABPA 4JLWA 2OBLA 4GOMD 1XDUA 4JQZA 4HQKA 1TAGA 2FZWA 4MV1A 1W2WB 5F7XA 4D25A 3GROA 3C6XA 3VDXA 1W30A 4RGVA 1OI2A 3MS2A 5K0EA 4AS3A 4RS3A 1FQJA 1T4CB 4OVKA 1FFEA 3RM3A 3TJZA 1P29A 4PSKA 3EG9A 2YJ3A 2WW8A 2V1UA 3PVSA 1RP7A 2G08A 5F5XA 5EFZA 1HORA 3BZUA 5KU7A 4ARZB 4HN2A 5FNVF 5G4KB 3U3MA 2NZUG 3M82A 2B8WA 2EU8A 4DYVA 1H9CA 3LC0A 3ADKA 1DEXA 1KVSA 1Q14A 3DFIA 3GJ8A 3RD5A 2WUWE 2ZJ2A 3WKAA 2JS7A 2H9IA 3QKSA 3WGZA 1W29A 1AIPA 2DPGA 3QFRA 4DLVA 1QS0B 2I4RA 3K70B 2YH2A 1OJ4A 1IXSB 1HUQA 1VE9A 1H1LB 4K1LA 4MAFA 4PSDA 1FTYA 1MT0A 2HUNA 3DP7A 1AGXA 3LJKA 5B3LA 1NRJB 4YJ3B 5L9AA 1QZUA 4U63A 1IHOA 1IU9A 1DAKA 3NHLA 5D85A 4RDHA 2IYZA 4TRNA 1R8YA 5DGDA 1KSGA 1PG2A 1DAOA 1WE2A 1YVRA 2F3UA 3CLKA 3RF7A 1X7YA 5C0XB 3EXG2 3QE0A 3HDJA 1QHEA 2ES4A 4Q3OA 3BE4A 2W2NA 5CW2A 4CCYB 2HWYA 1FXWF 3V2HA 2E18A 4ZHSA 2PKQP 3G2MA 3TR5A 4OP2A 1EFDN 4K3UA 4E6EA 1UM8A 4MRMB 1K4MA 5B57C 1GRVA 3UM9A 3SZRA 2ISCA 3MCVA 4G1VA 1EG7A 2Y76A 2RARA 3N9IA 3SNHA 1KS9A 2NXNA 1UEJA 1ZD3A 2RHBA 3WYDA 2CBZA 3CKKA 3ZW7A 3W7AA 4YGXB 4L0QA 3F0TA 3CNEA 4OJYA 3NP9A 4LHYA 1RREA 3CB2A 5J4KA 3G9QA 3PV0A 3V4VB 2OBBA 3AJEA 1QFYA 4E70A 3P20A 1ZXLA 1J0BA 4XAQA 4HZUA 4CU5A 3PQ3A 1DDGA 1THMA 3AINA 3U7QA 3W8FA 3PXBA 3B6IA 4WNCA 2OHJA 1EXVA 5JAOA 2FQYA 3EODA 1AK9A 1Z4JA 3QFSA 1CJVC 1PUJA 2IK8A 4OAOA 2ZU6A 3KYCB 5A3QA 3N5CA 1NXQA 4JDUA 4OKNA 4M54A 5LM3A 1K7SN 1RLOA 3T0FA 2V7XA 4UHFA 1DJQA 1S1MA 3STTA 2XBUA 5DZSA 3VOBA 3E0XA 2HF9A 5FA6A 3UFXA 2TRSB 4DT1A 2YVKA 5AM2A 2CXSA 2PZGA 5IBQA 1DFGA 1XCOA 4EG1A 2YUIA 3B6MA 4F4HA 3SZ3A 3MAJA 3AF5A 2PUAA 4KREA 1R6AA 3PRJA 4JP3A 3SEAA 2YC4C 2FZEA 1F5SA 3OZ7A 4PRXA 4NAHA 4ENPA 1L3BA 3L8EA 3MUFA 1OX6A 5F9FA 1DBIA 1J5EB 1ZQ9A 1X1QA 1U9CA 2AT1A 1U9JA 2KPOA 3DTYA 1NUHA 1XK6A 2NACA 4TVBA 4V24A 2QA5A 3EGDA 3HR8A 3AUYA 4WBXC 2GMWA 3M7IA 3V4SA 3R9XA 2ZRLA 2J0EA 4P2GA 3OA2A 5JMTA 5LU8A 3F47A 4UDOA 5HKKA 1Z47A 2JIRA 3F5QA 1O96A 4B3RE 2H08A 4LRSB 2X0RA 4IXMA 4LRTB 1KFBB 4GMFA 1Z8FA 1GUFA 2BHNA 2YIJA 1S2DA 5K3DA 4FN5A 1G7TA 2AFIB 3CGGA 5H80A 4URXR 1O03A 4FW8A 1JQ3A 3KKPA 3IXMA 1EMDA 5CH8A 1FUEA 4CT5A 1DC7A 1M0SA 4K6FA 6REQA 1YE5A 1PG0A 1SCUB 2OG2A 4Y0AA 1DO8A 4QDXA 3DV0A 1UDOA 1NLZA 3P9ZA 4Z86A 1N1GA 1I94E 4JI3E 1JMKC 4KQXA 2GKOA 1Q22A 1POXA 1EGVB 5K8CA 2ZRKA 1VBFA 4EVRA 4MIOA 5JCJD 1RE0A 2IVFA 3P1JA 1FFSA 1T9AA 3ZDRA 2PLFA 1ZD5A 2LRHA 1ZMRA 2WILA 3H05A 4MQFA 5JDCC 3GA7A 3HADA 1IAQA 4JQOA 4LGYA 4O4JB 4AJKA 5LZ9A 2AR0A 2YNMD 1QIHA 3UY4A 5JDIC 1Z2DA 2CDRA 1HE2A 1BS1A 3BFPA 4E5SA 5C8YF 2ZIFA 5G3ZA 2WYHA 2MMGA 2ZYUX 5FA8A 4D8TA 2YINC 4KN6A 1KR5A 2CJPA 2HJSA 1WF3A 3R3YA 1HNXB 2BGUA 3IOYA 4BV8A 3AHHA 3HXPA 1HYEA 3PPVA 4K81B 1SXQA 4MZDA 3PT5A 5CM2Z 4GX2A 5C1BA 2HJWA 3LT4A 1C1DB 3AZPA 3OWHA 4BXOA 3AGQA 3U62A 1ULTA 2EAUA 1FYVA 1FJGB 5IC6A 4AYTA 1OH7A 1GOTA 5ADUS 5K6AA 3OLYA 3U7IA 2NN6E 3OEHD 4J0JA 4B40A 1POWA 4V0OA 4NULA 2VBIA 2H31A 5BN4B 3GQBA 3PDCA 3L7YA 3DOUA 4L1KA 2Q7OE 2RHOA 4CBVA 4KFSA 3PDIB 1E1NA 4GMHA 2ZIWB 2BA1D 1ND5A 3KNZA 1F0YA 4WY5A 5EGNA 4YRMA 5FNZA 1U0LA 3QLVA 4Q03A 3T99A 2ISSD 1JDTA 1XNGA 2RBKA 5KYUA 2IEAA 1XZQA 4YLEA 4Z9XA 1D5WA 3T3HA 3TIIA 3FTPA 1U4SA 1MUUA 2WD9A 5IASA 1PD1A 3U3ZA 4L8GA 4MU3A 2IYQA 2QUZA 3OEEA 4DIEA 4ZJUA 5J4LA 1THZA 4FZ3A 3BQ9A 4CEHA 4KXUA 1E1CB 3SHQA 4JSRA 1ISIA 3KQOA 1UC8A 1M1YA 4J0GA 4UT4A 1GXSB 4Q3BA 2R44A 3JWHA 2ZREA 3NZKA 3R0VA 5GONB 5HKBA 2EZTA 2PRSA 4L8YA 3GLUA 3CT4A 1RWMA 1PUIA 5THXA 2C00A 3DV9A 1RM5A 3GARA 3UHMA 1OFHA 2F2TA 1X70A 3M2PA 4MMXB 4MULA 4OX9I 4PNZA 3BFJA 1V11B 2C95A 2ZYRA 2I34A 3CCBA 4ZICA 3X1DA 5JYDA 3EXHB 3R5HA 1K2VN 1M1NA 1YU9A 1PS9A 1AHNA 2Q4EA 3GUYA 3I58A 2WUDA 4LOKA 4ZTBA 2JKVA 2ZZMA 2EHDA 4DUYI 2FFQA 1SXJB 1WMFA 2QRUA 3LDHA 3R8CA 3IUBA 4RH0A 2WJ4A 3FDZA 2BA0G 4PU0A 3ZS8A 2UVPB 1NW4A 4W9NC 3HY6A 2JFNA 1LPSA 2ZDHA 2VSOA 3KEOA 5DOVA 5H70A 3HMKA 5JFTA 5F12A 3SFTA 2I2BA 5A4AA 1D2RA 3RVBA 3KWLA 2HU8A 3ZLUA 3PS3A 1KDTA 4TKVB 5C4GB 4KNWA 2XCIA 2RJOA 5E9AA 2EZ9A 1ZGCA 2JHCA 1S0UA 2AR9A 1RHRA 3IGFA 4A4DA 3B3QA 2WLSA 1RHYA 3NWEA 1WSWA 3OQIB 3PFCA 1XD2B 3RRMA 2WYWA 4HSEA 5A62A 4A6EA 3OHMA 4MK4A 1NZDA 4EPTA 3OF2A 2QB5A 9ATCA 1U28C 1ECLA 1DBVO 3IVCA 3KPJA 1DC4A 1NBEA 1R6VA 3DHYA 4UREA 3S55A 4CKXA 1JR6A 4ALLA 2DGDA 4FFSA 3ZDFA 1GKKA 3HSKA 1PQWA 1W34A 1Z18A 1B0PA 1CS0A 2IXDA 2PA0A 2Q28A 2ZE6A 3B60A 4S1NA 4YRAA 2GYVA 1KMHB 1VBMA 2OO5C 4CKWA 1KQNA 4ZOAA 1DZ3A 3JR3A 2GRAA 4TKLA 1JHUA 1GYRA 2FSSA 4BZQA 2CE7A 5L3JA 4JJFA 5KKAA 2JGJA 2QK4A 4FDUA 4UNIA 1W2GA 4NYJR 1DOAA 2VNJA 4ECEA 1BE8A 1NVAA 4U02A 3ZLBA 3RPEA 1GGFA 5HJ5A 1MF7A 1ONPA 1QORA 4JYAE 4BMZA 3AJ9A 2OMEA 2UUAB 4MDHA 3IAAA 5JATA 1E9EA 2YMPA 4PYNA 2R96A 3KX2A 1FC0A 4RCVA 4UZEA 3M3PA 5LQJA 2JLSA 2MSEB 3DEIA 4QELA 3ZBUA 5EIXA 4LS3A 1F5NA 2B9EA 3KAPA 4F86A 1CUWA 2F3SA 5AKHA 3KOXA 4D9HA 5BR8B 4ZGWA 3ENQA 4FQ7A 4R8MA 5K36D 2ZIZA 3PQ7A 5D00A 1NN5A 2ZETA 3P9QA 4DCGA 3LWNA 4GOJA 1ZNYA 4EKNB 5JADA 3L4EA 2BBTA 2DX7A 1DC5A 2QAGB 2X5KO 1OZHA 4QDKA 1Z75A 4B74A 3H19A 4W7HA 4ZCQA 2YY7A 5PNTA 6YASA 3MINB 3GDGA 2P35A 4JI4E 5KPDA 2BFDA 5JO9A 4AK9A 2J7PA 2PLRA 4HAXA 4AN1A 4IZKB 4B9AA 2VA9A 1NPYA 1H7SA 3PQ2A 3FCSB 2WQ6A 3ZLJA 5HNKA 3UMMA 1Y80A 5C35A 1PT5A 5KVCA 3TZCA 1TAUA 2CFOA 4YP1A 3KKEA 4W9RA 4RAQA 4Q1AA 2ZSUA 2O3SA 4IHJF 5FI5A 1CXZA 1OYSA 4R3WA 1Z4IA 1B23P 3GUHA 4INPA 3RGGA 1KH1A 1KP9A 3QY9A 2WG1A 4O29A 2PLWA 4O4IA 1QIEA 2IIBA 3IHWA 3JQ7B 2IYYA 1R12A 2YC2C 4RCYA 3KVVA 3AQIA 4FFDA 4YMLA 2HJ9A 2HGSA 5JDIA 5K2OA 3C6MA 1ECJA 4ITUA 3WK5A 1GGJA 1Z6ZA 4D9GA 4E4TA 3ADPA 3ZWDA 1I7PA 4Y1GA 2HJRA 3MAAC 4Q37A 4EW6A 1GA6A 4B3TI 4Q7MB 4NTZA 3SR3A 3KYBA 3EDOA 3VPFA 4P4UA 4D4HA 3B4TA 3SYNA 5H16A 2BEVB 4DLNA 5DGTA 3EAGA 4JFAA 5LDDC 4JSTA 4JHLA 1N32B 4P8RA 4ZPXA 4J2HA 4TOIA 4CEIA 1O94D 2DBYA 2I66A 3T0GA 3Q9LA 1F2VA 3GWZA 5LXTB 4GM1A 2GM9A 1KYTA 4DIUA 1CQJB 3PYDA 1JAXA 2VP3A 2CLFB 2FX3A 1T0BA 2A86A 3BKWA 3IPYA 1SM4A 1C29B 2JLAA 3WGNA 3BMCB 4EMBA 1QC5A 3ASUA 3NC4A 3N74A 3ROGA 3MGAA 4EJMA 1EWTA 1I33A 7YASA 1VC2A 3SQXA 4TL6A 1YU6A 3AGPA 3L0DA 2NTNA 4EK9A 4PRZA 3EY4A 4ENQA 821PA 2V8PA 3EF3A 1RZUA 3WLRA 3X1YA 5BR4A 2AYYA 1P7VA 2AW3A 4KTTE 4B6EA 1TA0A 3PKJA 1GSHA 4IFDA 2PBRA 4PV7A 4R8VA 2Z3VA 4BVFA 2VDMB 3JQDA 4HV4A 4WCFB 5C8XA 3WFZA 5JZSA 3FRIA 3T61A 3VU1A 9LDTA 1EVQA 4EZEA 1Z15A 1I4EB 2BZSA 2Q6VA 2WU0A 1U9IA 2HT1A 1C5KA 1FA9A 1IBSA 2QZSA 3OFND 3N8GA 1GITA 5JSZB 5M5BA 1LLDA 2I99A 2D06A 1GAXA 2ZBQA 4DV2E 1SKYB 3KDAA 4WZAE 4YCCA 1V8FA 4LMPA 2JEAB 3U1TA 1S3SA 2BZGA 1PGQA 3PXCX 1DCMA 3R8XA 1MV8A 5KS2A 3JZFA 4NBWA 4IQ4A 4URFA 2HCFA 4RKQA 3ZH9B 3JPWA 5KTRA 4RGYA 1XNQI 9LDBA 4CUZA 1QHSA 1BDJA 2JFWA 5CITA 4HDKA 5IVPA 3DMPA 5BMVB 2ZYVX 1TQDA 4KYUA 4TSFD 2BRUA 3QUSA 3NO4A 2CXPA 1FNBA 3F46A 1BVRA 1V9SA 2B61A 1C9KA 1C41A 1N8KA 3HYNA 3NVMB 5D01A 4P4GA 1EUYA 1RLUA 3C3JA 3DL0A 2XUKA 3IT2A 4I55B 3RVRA 3FTQA 1R0SA 5CVVA 2XDAA 4C21A 5GWXA 1M2VA 2B36A 2W2LD 5HQTA 4DVGA 2PWAA 4MA0A 4E1AA 4BYGA 4XWGA 2B2NA 3USCS 3GLFA 1WO8A 4F9EA 3K7EA 221PA 4RV4A 3QVTA 4BB9A 1XFAA 3EUWA 3WK6A 3X2EA 2J5KA 1QRRA 3UW3A 5FBQB 3H8SA 3Q5EA 3R3XA 1HNWB 4L5YA 2EL7A 2D13A 1MH1A 5IDYA 3HUTA 3WAKA 4DMMA 1QH1B 2J3JA 2WFAA 2Z4TA 5EQJB 4OHYA 1SCAA 1TW3A 3ZK9A 4OHRA 3QVGA 1BOFA 2Z4SA 4A8HA 3QU7A 2WTXA 1B93A 3ZWCA 3JZIA 2B7CA 2I80A 2WYUA 3DOIA 3OTOI 3GMEA 2CMKA 4CNQA 4ZIRA 4FUQA 3EOBI 3IDOA 4NZYA 3N07A 4PLHA 3AERB 3K0FA 2WSSA 5L3QA 1U1IA 2PQ0A 4MU4A 3PQ8A 4XZ3A 5GGYA 3GLIE 3LPLA 3DYIA 1SXGA 4JEUA 4FE7A 4UHEA 4R7GA 3VYWA 5CB4F 5KNBD 3F6SA 3PNVA 4J0FA 4NDNE 4B5LA 4LF4B 3P9XA 1TVKB 2C8KA 1LW7A 2OCPA 3QHAA 5KTSA 1JFSA 3AKCA 1DAGA 1DQSA 1RI3A 1A2KC 1YK1A 3PEUA 4ARUA 1U8CB 3USZA 1FFGA 3QYFA 3SSMA 5JMWA 2OENG 1GZ3A 1X7GA 4TT8A 5KVAA 3A11A 2QW1A 5G0UA 3F9IA 1USVA 4Q18A 1J2YA 4U3DA 2QSYA 2X8LA 3K9BA 4YWJA 1PJZA 4RIHA 3RFFA 5ALQA 4GYYA 4C0WA 3O0TA 5K0SA 3RSQA 3SZGA 2M1XA 5K5EA 1IH8A 2YIMA 2ZYTX 4UJ5A 5LZ7A 4KKVA 4L5IA 3EPJA 1J1UA 4OLFA 1NLYA 3O4IA 2V6BA 4JJAA 4X1KA 5HF6A 5LYJF 5FX2A 1Z5PA 2O5RA 1QAOA 4QECA 4U4AA 1XVUA 4JODA 4CV3A 4KFRA 4B84A 4FGUA 3DBLA 1X19A 4RTJA 1X8JA 2M2IA 4Z54A 1T2DA 2G5TA 1T4MA 3NHFA 4JEIA 5FD8A 4QM6A 1RWPA 1NJ5A 2P68A 4F2WA 1RZRD 1OB5A 2C96A 4LF8B 1OYWA 1GCAA 3E23A 5G0SA 4FBGA 3HFSA 3HRKA 5A5GA 3JD0A 2J9FB 5JC1A 3GEGA 2E4AA 4DIDA 4Q4JB 1DUVG 2B8EA 2R1UA 2YJGA 3DVAA 4Q34A 5CA0A 3UV6A 2BF4A 4JXKA 3EFHA 2PFSA 1EM8B 1OYYA 3G23A 5FQOA 3MJRA 3ROKA 5E9WA 1EHIA 1C8BA 1VMKA 3AB8A 3DW3X 5BNFA 2NW6A 1DARA 4BC0A 2O1WA 2C3UA 4N0DA 3CZRA 4OKGA 3KQMA 4R1MA 2QN2A 5MGBA 1FRVA 1KGSA 3BXFA 2JIOA 1P5HA 4LYDA 2UZIR 2VUTA 4PZUA 4RCZA 1IHDA 2XVZA 4DIMA 1QXSA 1J2UA 2MSDB 3F7OA 3CWQA 2JGKA 1SBZA 4ZCMA 4L0MA 2HXYA 3Q8MA 1KPGA 1SNYA 2O57A 3WLEA 1DE0A 4BUCA 2BFCA 3IAUA 4WRRA 3RRJA 3RO7A 1LBHA 1J24A 4LNUB 3H65A 3MN1A 1G20A 3G82C 2W93A 3HR7A 4BO1A 5L3VA 1BDIA 3TPZA 4E7PA 4EYGA 5B6JA 1SVIA 2ZI5A 2ZUSA 3O4JA 4AKTA 3ACBA 1GVNB 4U5XA 1UMDA 3S2ZA 1FS6A 2GZ1A 1HDIA 4G6ZA 1WXWA 5JJLA 5E7MA 3IA2A 4XPIB 3WU3A 1FSZA 5JY1A 5J3JA 1FQKA 3E18A 2OA0A 3IV9A 2VSNA 3ZCXA 2IOFK 3KRNA 4NC9A 2GS8A 4DV6E 1TVCA 2X0KA 4HO1X 3SYTA 3EXIB 5DM4A 1NIPA 7AT1A 3DB1A 3NUGA 2X76A 2DHCA 1SHTX 3QW2A 1S2LA 2PX4A 4HWKA 1UXHA 4PZLA 3S1LA 4DMRA 2ORVA 2QS9A 3SD7A 3E9MA 4PEVA 2CHUA 1CULC 4DPUA 2ZQZA 2Z57A 4FR2A 4KXWA 3RHTA 1EFHA 1FFBA 4BBJA 4HLUA 4JBLA 1P2TA 3VI4B 4CM1A 1XWWA 4LF5E 3BDAA 2EBFX 3GDOA 4HH4A 1F7VA 3BMQA 3PWTA 4TUYA 3H1EA 1RXEA 4FE4A 1H5NA 4WBSA 4BMVA 3P26A 5IANA 1PN3A 3O1HB 2D54A 4G1FA 3MQ4A 5HR5A 1VKNA 5K36F 2PN1A 1V1JA 4IO1A 5FTMA 4YVFA 5IABA 5MN5A 4D3XA 3IL2A 1GGKA 4WVFA 1WHTA 4NVRA 4FVTA 1A1SA 2DMRA 3N2LA 2WZQA 3IIJA 5K0GA 1PJQA 3DH0A 3ZHQA 2W6CX 1G8GA 16PKA 2DHQA 5JYBA 1VE1A 2TMGA 3BC1A 4L74A 4XYEA 5YASA 3SOPA 1NOIA 1E4YA 3A6ZA 4FWHA 3TLEA 2C4VA 3K15A 3DE4X 1HYBA 2I6FA 2YBDA 1PWEA 2LCIA 3AMVA 1CJUC 2Y1GA 2Z5LA 4YYZA 3EG9B 2PYDA 5I01A 4EY3A 3NT4A 2NG1A 2RGNC 3H5AA 2R87A 1ZAYA 3HZHA 5T6MA 2R8OA 4OGLA 2VWHA 4WUTA 4WLUA 3ZHUA 2R00C 1CY4A 1L7OA 1RXSA 4IVPA 5J59A 3OFKA 4GVPA 1VP9A 3T9AA 3H1CA 2Z9DA 5JEAA 2I6XA 2VRCA 4FYJA 4CVNA 1YNSA 1Q44A 3QKSB 4FEAA 2ZEJA 1QYDA 1HMYA 3VYRB 3M6MD 2JI7A 3TO5A 1S1CA 3PYMA 1Y3IA 3E22A 4HADA 1P18A 5LB4A 4IQFA 4RJTA 3CN9A 1JHAA 1JHPA 4AN4A 1JVSA 4GUDA 5H9WA 3HQ4O 5LL6R 3NORA 2G1UA 3TOCA 4ED4A 1JQLB 4JX9A 3QOFA 3UMFA 1HDCA 4EIWA 4LFCI 5KJ1A 3E6AA 1MQAA 3GLSA 4HP8A 5SY4A 1W0KA 2VK1A 4BPRA 2J9GA 5E1OA 4E13A 2QBYA 3GYBA 4R01A 5IAEA 4ZT7A 4AL4A 1R8QA 2AH5A 2JFFA 2WF9A 2AD5A 1JU9A 5EZYA 3GLGA 1TCCA 2D0PB 4RFLA 1O87A 3OX1A 1N7IA 3EGVA 2V3VA 5KTOA 1TKBA 1FMLA 1ORTA 2OFWA 3MOSA 3ET5A 3Q15C 4M6WA 1I94B 1JDJA 2JI4A 4JI3B 1VG9B 2BP7A 2H54A 3M5WA 3Q7PA 4IOMA 3PJDA 4N6OA 4PHFA 4DJDC 3BCHA 3MERA 3BT7A 1Y8CA 4PFQA 2GM4A 2PTGA 2GN8A 3Q72A 3IDZA 2QSJA 4QRIA 1VKOA 3PLRA 4B9EA 1BKDR 2WVGA 2FXIA 3U3KA 2F1RA 2UUBE 1SPBS 4DLLA 2NQTA 3K8QA 3PHHA 3EOZA 1ZZGA 3KOMA 4GE3A 3U7QB 1R8XA 2QJFA 5CHEA 3OO1A 4POOA 2VT7A 3GA5A 3HCAA 5DU2A 3TJRA 4M1EA 2I7DA 2R6ZA 2VH1A 4ZYXA 4X65E 4C2BA 4XCXA 1MXHA 4IRXA 4UCQA 5IHPA 1ZOSA 5LIRA 2WT9A 2C39A 2RB5A 3A28A 4H59A 4HNQA 1ONNA 4OP3A 1JBQA 1LPNA 2Q6OA 3UFXB 2ZM6B 5DXFA 3D7SA 3GJ3A 3N59A 1UDXA 4ERNA 4F4JA 1KDPA 1KY4A 1S8OA 2OXFA 1KO8A 4GH5A 3ASZA 1VGQA 4P3PA 2PGDA 3VR2A 3O03A 3ML1A 2AF3C 2NN6B 3IV6A 3WICA 5JO0A 1SUPA 3CKYA 3PUVA 5GJCA 2JAWA 1D4FA 2ZSEA 3HB1A 2MCFA 2NO0A 5EKXA 4LJ6A 1VBNA 3FB4A 1WJGA 3FROA 1CUBA 5JEAE 1FMJA 1JDBB 1W8DA 2W48A 5B53A 4NAVA 1VP3A 4JI2E 3FVRA 2O2ZA 2X4DA 3EGDB 1ZBQA 4PZDA 2WP8A 3R9XB 4UKDA 2C94A 4JKIA 3C43A 3IOBA 1FNDA 3P4YA 1N5IA 1YJ5A 4LAFA 2PM8A 1O96B 1JXAA 4GP7A 2HPVA 4UAVA 4CFSA 3GP5A 1UBGA 3TEFA 4MUFA 1EP9A 2QP9X 1UM9A 1UZUA 4UJ3A 3ZCRA 4C03A 1OA0A 3AVOA 1RMQA 3G9XA 1ATZA 1QHFA 4ROTA 1UQRA 2EFCB 3D6UA 2QLJA 4UHKA 2G9RA 3HC7A 3OZEA 5F7OA 1V1MB 3KB6A 3VU0A 1X3SA 6REQB 1QKKA 4WPGA 1AOXA 4ACAA 5B7PA 2O2CA 2RHDA 3DV0B 2MWMA 4FLEA 5KVVA 1KI1A 4F1JA 1KRWA 4RMNA 1F2TA 2BHTA 1Q0HA 1XQXA 2C1XA 3IO3A 4KN9S 4O4HF 4B32A 1RPNA 2ODEA 4RSGA 1CVLA 1TB4A 4GG1A 1MO4A 1A8HA 3I4FA 5DISB 3UA3A 3W2IA 3ZDDA 3H9UA 4JQCA 2GHQA 2A7QA 2JFUA 4OBXA 4L50A 4MQFB 1IY2A 4CF3A 5JS7A 1G9XA 2WJPA 4RORA 1T0PA 2QNRA 2UZ1A 3NTLA 5IJ0A 5AKZA 2Q45A 5AI8A 2R7KA 2ODTX 4MQYA 3ZI0A 1Y9AA 4OGGA 4DLPA 2ZWVA 4DR5I 5KWIA 2QTAA 4WFKA 2V03A 1LUAA 1LPMA 2GO7A 5HM6A 1GCGA 1ZUNA 3IMCA 3EQ2A 3FHJA 4OBWA 4OI4A 3ZWAA 3GT7A 5EWJA 1WEKA 1YE8A 3KZOA 1GPAA 1NKVA 2C3OA 1J8VA 1KSJA 3GCWA 3W6NA 4YRFA 4BXOB 1ZM3A 4B7ZA 3MBOA 3ZWWA 1O57A 1AO3A 3DQZA 3JYOA 2I1VB 1JR2A 1ACMA 2P2YA 3SE7A 4Z6KA 3QT6A 3D4JA 4LG1A 3QPAA 4NZMA 4X94A 3R7BA 1IHXA 4IYRA 4ZGGA 1XQ1A 2I33A 3I9FA 1HTTA 1MRNA 1BA2A 5GZ6A 4U2GA 1N2SA 2FRXA 4NMLA 3ZE8A 1ZXNA 4LFAE 2HI0A 2ONCA 4PRKA 2XX3A 5LB2A 3W77A 3OE5A 4UHHA 1H2YA 4X7PA 5ELLA 4GWKA 2E4XA 2CYBA 5U9CA 1TM7E 5LMNI 1XPOA 3U4CA 3MYYA 1TFRA 2V65A 3OCJA 2GK6A 4NOKA 1NUUA 2WIGA 3AR7A 4ZDJA 3TW8A 1L4EA 3IEVA 1XWFA 1SQFA 1WHSA 2C9BA 3CH5A 5AW0A 1Z38A 2IHJA 4C3UA 3CLTC 4DSAA 2QUAA 5EUBA 3PJRA 1DJNA 1MQ8B 4JYAB 3IE2A 1M1YB 5FL7A 2VQ6A 1FL9A 5MDHA 2IXFA 3D9QX 2F3PA 3ER8A 1UFKA 2GKSA 2DCMA 1F4VA 1ZD1A 5JAQA 1WPGA 3TD2A 4F0JA 3W6OA 6LDHA 1UUFA 2HX1A 3TZ6A 3ZW8A 1EX7A 1YZHA 2FK8A 2NPOA 3COYA 1YRAA 3L7MA 1TTQB 4FOTA 3CRVA 3L04A 5JCOC 1E99A 3WU5A 3H11A 4WN3A 1SUIA 4EVQA 4N7RA 4QT0A 4H7FA 4YO8A 4B4OA 2QNBA 1R0KA 1QVVA 3CR3C 3F7MA 4RETA 2D5AA 4X84A 1PFKA 3J81k 5DRPA 3TTTA 3JAMC 1M1UA 3HKBB 3VC1A 2GPBA 3FDZB 4YFVA 2WJAA 5AK5A 1L7QA 1N5LA 1S8NA 4FW4A 5ALWA 4IF4A 1FYEA 1KYZA 1T0UA 2J0SA 5A2GA 2AKYA 1AGNA 2B5WA 4WINA 3SEQA 2NUPA 3I9V6 4B7CA 2Y1FA 3OURA 1F9AA 4KOAA 4N49A 3X1KA 4TTSA 1CJSA 4H0FA 1T1IA 4MTCA 4XXHA 1JF8A 3MFYA 4MGZR 4FYXA 4U9UA 2YN0A 3GEHA 1E64A 2VDKB 5P8WA 1MC1A 2VSFA 3BL6A 2XAAA 3MD9A 4M0EA 4XKJA 2AZTA 1AF7A 3ZDQA 3A6FA 1TQHA 2K4MA 2WD8A 4OLJA 1JWAB 1HF3A 4LOMA 4GIBA 1I36A 1RYYA 1QH9A 1SIOA 1KSHA 1E2QA 4FKBA 2ZJ4A 3ZNQA 4LZOA 5DB4A 2CHGA 4CFYA 4OFZA 4L7QA 1WABA 2VP0A 1W87A 5E4TA 4CKBA 5JD3A 4P52A 4EA9A 3C24A 1CS0B 4OSEA 2QRPA 5G1OA 1Z6XA 2C9CA 5JNUA 3R0XA 1V39A 3C8HA 3G5MA 4PONA 5DFAA 3WGQA 3ZD7A 1YSCA 4CKWB 3H6GA 1MAHA 5EJ8A 4QHSA 5LFAA 4R2LA 4EVIA 3WLAA 1DBPA 3CXRA 1U3UA 5I8ZA 2I62A 3O93A 1F12A 2YWGA 3ZD8A 5TQJA 3OPXA 3V34A 4EG7A 3QWAA 3R4VA 1KDOA 1JZSA 1DX6A 2CUNA 3DEHA 2BGMA 4P2BA 1MW8X 2GWHA 5CT8A 2H1LA 3E5RA 3ROPA 2EGHA 1K6XA 1OIXA 3BRWA 2PU5A 2XNHA 1U3TA 2CZGA 2OZLA 4W5WA 5FCDA 5K0BA 3C3PA 3DZ8A 1CUSA 1GCUA 4FWBA 1Y48E 2C1EA 2JIZA 2WNIA 4JVMA 1U2ZA 1WB5A 2J5QA 2R9VA 4WECA 4KHPI 1UP6A 4D4MA 2D4AA 2FUCA 2PX8A 4YWHA 5AW8A 1NIJA 5E7IA 4WD3A 3ESYA 4R5MA 1LSSA 4FONA 3BH7A 4QPDA 3TBKA 1KYWA 3LD9A 1AMUA 4ER0A 2BKLA 1PEDA 3AOGA 3LHKA 4FI3F 2ACWA 4CM9A 2P2CA 3VNUA 2VAMA 1T5BA 2ILVA 2RC5A 1GZUA 3DPUA 1IYZA 3IAS1 1CK4A 2ODAA 2ZB7A 2I8CA 2XAUA 5BWOA 3WMWA 3OX3A 5IC4A 1UJCA 3ZVRA 4WW0A 5IW8A 1IZYA 3I6MA 3B1FA 3OPQA 2WZCA 4D8XA 1E9SA 3QXHA 5JJCA 2BFDB 2DFLA 2IZ0A 1SCIA 2JA1A 4ZEXA 1AURA 1NYRA 1SQ5A 3OY7A 1SKUA 1I4LD 3UO8B 4B5KA 4DV2B 2A3RA 4ZZ0A 4JR1A 2YIDA 1OQAA 1UBUS 1M72A 1I5RA 2JI9A 3OI7A 3U3XA 3LUHA 2MSNA 3F73A 1XA3A 2UU9E 1E20A 2HK8A 2KM1A 3CRW1 3F74A 2X22A 3BGOS 3CO0S 1P77A 4RPLA 4S1VA 2ZG6A 5JIBA 4U39A 1H1DA 2VF7A 2JJ2A 3GEMA 1UXOA 1TE2A 4TWJA 2OM6A 2XYQA 5DTQA 4O4IB 3T1QA 2HSJA 3E3NA 3GMDA 3V3TA 3ZE2B 2YY5A 3EIWA 4E3WA 3FWYA 1BU5A 1R37A 4N5HX 4BU0A 2JRLA 2A0YA 5SZIA 2ZSBA 1NRWA 4MI1A 1OBFO 4S1PA 2Q6LA 5AHWA 1IVNA 4BWGA 4UC0A 4DCVA 1BRTA 2XNSA 1USUA 2TMDA 4PRLA 4IKOA 1JG4A 1N8NA 4IRUB 2TYSB 2XWSA 4RFVA 5B12A 4ACBA 4NEHB 1N9GB 2O06A 3D02A 3TQCA 3FF4A 5BW6B 1J1IA 2WSMA 1IZZA 2SCUA 3PNQA 4JKYA 1MNQA 3PD0A 4P32A 4CEIB 1OF1A 2CXNA 3JSAA 2ZBEA 2X1LA 3JQEA 4M3NA 1SMKA 4MVJG 4F3CA 4ZGBA 4OJTA 5EHZA 2BH2A 5IAAA 3CVVA 3GLRA 2XIQA 1RFGE 5CLIA 2HSEA 1HPLA 2QV7A 3EULA 3AM4A 4DCMA 5C1DA 4OQLA 3LS2A 2IHTA 4CF5A 1YR7A 3TZKA 3QLUC 4LNAA 4GXTA 4R1PA 1M8KA 1YRQA 1G291 3T9FA 2CJFA 5FL3A 4ER3A 1O95D 1YVEI 3KLBA 1GKIA 1M1XB 3LY8A 3EC2A 1N5RA 4KO4S 4MUMA 4IFDB 1QCDA 3RJ9A 4YPFA 1T8RA 3HXLA 1O7JA 2AF4C 3HBNA 3VKVA 1FS4A 4DJFC 2J6BA 1RW4A 1N1EA 4FCCA 1G5FA 3OCWA 2FH5B 3KEMA 2VJPA 4HXGA 4TRMA 3SFVA 3ULKA 5F51A 4D74A 5JOQA 1ZL0A 3BRQA 3VKWA 4BNVA 2P6RA 2Q6KA 3KD2A 1M9NA 3S3TA 2MINA 4AJ4A 5CDUA 5DE3A 1P0FA 2PUTA 3ZXUB 4YRRA 4R16A 2DFTA 1XKXA 3KG2A 1OZFA 3DVQX 3O7MA 2W11A 5F7ZA 4R84A 5ALOA 1NL3A 3FRJA 1JH9A 4FFRA 3ZTYA 2PS3A 3GCXA 4DDTA 5LQRA 2BSQA 4G26A 3BJMA 4UQOA 3K35A 4ND5A 3MSXA 3BK2A 3F1KA 3LIPA 4AKIA 1OI7A 2Y2UA 1KJZA 2ADFA 3A0UA 4FKZA 3SR4A 3ECSA 4QPJC 1KFCB 5FLXA 2JVJA 2QDKA 4HDRA 2PL3A 2C5BA 3F96A 2HA7A 2VHYA 2D2IA 2Y1KA 3I2YX 1NXOA 3N0VA 3NWJA 1C3VA 2H85A 4HDKB 4ZO8A 4PTZA 3ZIAA 2IYVA 2R25B 5ARDA 4FZVA 4RZHA 4IXTA 4UE6A 3SZOA 1BMFD 1YDWA 2OM2A 3AG5A 2LDBA 3QNWA 4LVNA 4MRPA 5C3UA 3A2MA 4WKCA 5AVJA 5EP3A 4OMUA 1Z0ZA 3AY3A 1LVHA 1E7MA 1SVKA 3DMRA 3LQ4A 2C0CA 3CB4A 3GH1A 2AOUA 3HEAA 4QEKA 4QUJA 5KPJA 4AJ1A 4NXME 2XGJA 3FOEC 2XUGA 4AQYE 1UJMA 5J2UA 4D92A 2FW9A 1M2VB 5DCWA 4QYXA 3WU4A 3CUYA 3L84A 4I9GA 1X7DA 1M2KA 5KOJA 1W48A 2Z98A 4R1UA 4KQJA 5JFOA 1DCFA 1U3FA 4CM8A 1DX9A 1SG9A 4D79A 4DMFA 5JQGF 3GLFB 3RREA 4CM6A 1NJFA 4C78A 3DBOB 3U39A 5C5EA 2PQMA 5JQWA 4WAUA 4RD4A 4DDVA 2GUGA 5GJBA 3UJDA 2O8EA 1N6LA 1TZ2A 2W6JD 4W6ZA 3UATA 3ZUGA 2FUNB 4NXNE 1JPUA 4BJ1A 2ZJ6A 4C7OB 1OI3A 1U8AA 1I2DA 4W99A 2DRIA 1ULZA 2JLBA 2QAJA 1HT3A 2X4GA 1U3VA 3GY0A 3QVGB 4IM7A 3F8TA 1E1RA 1RWOA 4J4HA 5K0LA 1UDCA 4GGPA 3HDYA 2LP4Y 2PMBA 4Z8XA 3CUKA 4ZIRB 2H48A 1TVMA 1WD5A 3O2NA 3K0FB 1GDHA 2PRKA 5LUAA 1B42A 4WLFA 4WY2A 2O2DA 4TXMA 5J23A 2XA2A 1S3GA 3EW9A 3WTCA 2ZXUA 3IESA 3C6QA 4N01A 3CIOA 4Z51A 3T1OA 3KDPA 2OD9A 3LYHA 1HT1E 4RF4A 1M33A 1RLMA 3K3PA 1OV6A 4G56A 3KLMX 1ZGBA 5CVCA 1PT9A 2P9HA 1ZVJA 1CERA 4LPFA 4BA2A 1MU0A 5JJBA 3HEBA 1U7PA 2RBEA 3R3VA 5D86A 5IN5A 4BQRA 5IKEA 5HW0A 3GLHE 4DV6B 1PKEA 4I50F 3OUZA 3JX9A 5HXAA 2X7IA 1ZRNA 3GJ0A 4I3GA 1L8QA 2HU7A 3E1SA 2YRWA 1XU9A 1WOYA 1KAEA 1RYBA 1EVEA 5IT0A 2BFEA 4BFZA 2V2VA 5IWAI 2ZIXB 4X1KB 3IAHA 3INGA 4OHZA 1LKZA 3HDHA 4MJ7A 5DBGA 3CRQA 4LF5B 2NXJA 1N6OA 3HL0A 4KE9A 5BSMA 4E1BA 1NBIA 3PQEA 4L75A 2BTOA 1GUBA 3FM9A 1H4SA 3DTNA 3L3BA 2OO3A 4OXQA 4YRPA 3G02A 2PL1A 4ESHA 4TTPA 1KAMA 1YRYE 2QTRA 4DBVO 3CDJA 1GZDA 1BCSA 2QGFA 3WHIA 5HILA 3AR2A 4XH9B 1D4ZA 3RBVA 1GV0A 1U6KA 5IAKA 1Z0UA 1EHCA 4FTWA 4ER5A 2ECPA 5BVHA 5JR3A 3DVAB 4ZJYA 3N6RA 2G9VA 1R0XA 4LE0A 5CA0B 4PX9A 2WB4A 2XD4A 1HYQA 3Q5DA 3T1YI 2ZAIA 1E7QA 3E9DA 2CG9A 5BV2P 1P72A 1LLQA 5EMLA 1R4ZA 2GEJA 1IBKI 3EVEA 3IE0A 1O77A 2P6PA 2O1SA 4RDIA 3RC7A 3FIJA 3SHVA 5TGDA 3W5BA 1Y6ZA 2HLHA 4WOBA 2J67A 2WWFA 2FSVC 1II9A 5HFNA 1YB2A 1GU0A 1AV6A 3D7KA 4RZXA 5BMOA 5DMHA 5ILOA 1R4MB 3PPIA 5ER6A 5B36A 3KXKA 2BFCB 2R0QC 3OY2A 3L7ZA 3RCBA 1G8SA 3LIIA 4ND7A 4O5AA 3AY6A 5I9BA 4CM4A 2AYXA 2WD7B 1YQGA 2R5NA 4KE7A 4NBTA 5KSYA 1BA3A 2PNLA 4KR0A 4AUNA 4MW2A 4EI7A 1UAYA 2ALJA 3DO6A 4HOYA 5CAEA 2HBYA 5ICGA 2JBWA 3AFNA 3FBTA 1MGPA 4KO1S 5EMJA 1DIHA 3H8VA 4EY5A 1OWOA 3SAJA 1JYFA 2D1YA 4RSMA 4IDEA 1GG5A 3L01A 3V8NA 4AZSA 3WLQA 4BLUA 5I9LA 1QUEA 4E11A 3NM6B 4EL0A 1VXRA 4X62I 3IR6A 2P30A 4QNNA 5KVQA 4CL8A 1CUEA 2DR2A 3VR6H 4YJGB 4BGEA 1UINA 2C7QA 5ESXA 2CL7X 2HQOA 4FSHA 2H4HA 3LQYA 3MBKA 4Q01A 4HYMA 5CIWA 1YFKA 2O7RA 1SC6A 3AVQA 2BWJA 2GA9A 1Z5CA 3H6KA 3SQLA 3J7AM 4JI1I 4P86A 1KC1A 2J3HA 3ANLA 1U5BB 1CETA 3EMBA 3I34X 2B34A 4M0PA 3BMQB 1GPYA 3G6WA 4G9EA 4TUYB 1MTZA 5KC8A 2OCDA 4AD8A 3FGPA 4V2IA 2CD9A 2R79A 4DLYA 1E9AA 1XVLA 5KC9A 1OH5A 2Y6UA 2PZJA 1S2OA 3HNOA 2J0UA 1MEOA 4YBRA 1KETA 3R5FA 4FGZA 1RWVA 1WHTB 4AJEA 4DRZA 3CX4A 1QIFA 4NOJA 3V1KA 2XITA 3ZK8A 2ZCVA 5A05A 4XX1A 4RHTA 2UUBB 4RKFA 4B82A 1ISSA 1ORVA 4M9RA 1ST2A 2PNJA 1A8QA 1LU9A 1UMBA 2GF0A 2AS0A 1Y5LA 2WFMA 2ZPUA 2A9KA 4HH1A 4WXPA 3FJYA 2QR3A 2YWJA 3MLEA 2RDMA 4GMXA 3GJXC 5EHQA 4X65B 2RI6A 1Q7GA 3IUNA 3KPWA 1YXMA 4W5TA 2GT1A 3VAZA 2X77A 4M0UA 4PN3A 4MVJF 5GPBA 4NZOA 4DEVA 2Y1CA 4KNVA 1AV7A 2G5PA 4LF9I 1EX6A 4I1RA 1GRQA 4Y2UA 1GFIA 5C80A 4C6SA 1WV0A 5F98A 5IAGA 2COKA 4JB8A 1TPYA 2XYHA 3PT9A 1B76A 3TGLA 2X86A 3HGMA 3ELYA 1H2AS 2VHJA 4ZAWA 3SVLA 4LQCA 4EW3A 3AEUA 1TQ8A 2ZRPA 3ORHA 4RA9A 4RLQA 1FJHA 3ND9A 3QSGA 4MUBA 1YV9A 2YZ2A 3PSHA 4NICA 4TMVA 4K9KA 4FQ8A 1L1RA 3L7OA 4UXIA 1IM2A 3LCMA 3C6YA 3PFKA 3ZEAA 5JEAB 5C46F 4CYMA 1MH9A 4JXJA 1YWGO 3D8RA 1GZVA 3SVTA 1OWPA 1DOHA 2ZI6A 2ZS9A 3GG9A 3P9SA 3E22B 3LP5A 3ABIA 1Z6AA 2A1IA 2WAOA 4U3JA 5ENZA 3SJAA 2PKQO 3V1UA 4S05A 2J0VA 5BSRA 2XE7A 3E2IA 3PHIA 1DINA 3C48A 5I9TA 4MS3A 4JKOA 2C38A 1J9ZA 2C2XA 2L2QA 1NE7A 4P98A 2CDNA 4JI8I 2DTDA 3BWYA 1ID1A 3ZN2A 4DCUA 1JWLA 1A8SA 4JJ4A 1N36I 2G1JA 2PY6A 1S8AA 1B14A 3WP1B 2QBYB 1PJSA 1Y5RA 1KO4A 2FPKA 2GAOA 4RUKA 4UM8B 4ZOLA 3TVTA 3FNGA 4EHJA 1GTL1 1TU4A 4R8LA 3ACDA 2FW6A 4NG4A 1JYEA 4DJTA 2OILA 5B55A 4C43A 3TR6A 3T12A 1HKUA 3B1VA 2QVGA 4ISBA 3NKLA 1XO1A 3RQIA 4E22A 3DBHB 3VVBA 1QLHA 4JYCA 5DN6D 2BP7B 4RNCA 2VH5R 4DWJA 1BROA 6GPBA 1FBTA 4RXMA 3F7TA 4JP5A 1LI5A 1FFCA 1NUPA 1RQ7A 1V7CA 2YYAA 3TNJA 4XTRA 2C58A 4DADA 1A7AA 3KSRA 3DLIA 3K5WA 4Q4AA 3N70A 4GMKA 3SC2A 1SOAA 4B80A 2Q41A 2XB8A 4RKRA 2JJMA 2C4UA 3JPYA 2ICAA 3JW8A 4OFWA 1U1EA 2V7QA 1M0TA 4DCSA 4G8BA 3H1PA 2L0XA 3HP7A 4P3OA 3ESZA 5E3IA 5ALVA 1EU1A 3KQTA 3PNLA 1IEQA 3A4NA 2IYUA 2LD4A 1J21A 3V55A 4DBZA 4O3MA 2C39B 2XECA 3P0JA 2UZ3A 1OKKD 4R2HA 3F3SA 2CXTA 3MWDA 1XMOI 3MA0A 2VJOA 2QSUA 5SZHB 4D3ZA 1P1KA 1EJ6A 4L22A 4OXXA 1XEAA 4ON9A 4L15A 2HDNB 3LVQE 2QN6A 2JJQA 3FJ1A 1MO3A 5JANA 3WA6A 3FTFA 3IQEA 3DF9A 1Q0RA 4LOJA 3KQKA 1V9LA 4FOLA 4LFAB 4IIJA 1A9TA 5BNIA 2ZBUA 3V97A 1F0PA 2WP8B 3VNAA 3DAOA 3C3WA 5H5JA 4AKGA 5FWKA 1V5GA 1X9IA 4P1ZA 4PGFA 3OM0A 4JUIA 2J09A 5DTRA 3FNHA 2NX2A 3ZV6A 4ED9A 5B4UA 1SRQA 1UM9B 4E03A 1GTSA 3OP4A 2W71A 3ZKWA 2VJMA 5E2IA 1IBRA 3DLCA 4ND3A 1C80A 3CONA 4K28A 4X63A 3OWOA 4D80A 4Z1MD 3TTVA 1ZNQO 2HMTA 3KR1A 2NVBA 3SY8A 4CG2A 2QM3A 3LDFA 4I4TB 4OQXA 3MWYW 3I61A 5CUQA 1DB3A 1EG2A 3UW1A 2OCYC 2ECKA 3A2NA 3NJ8A 1WUUA 3A4VA 4G37A 4BVEA 1HA3A 1Q0LA 5C7LO 3FIUA 3EIEA 3WDLA 4NMHA 2QTNA 1J7JA 5T4EA 5JARA 1KK1A 1U8UA 2UUCE 2O8CA 4P9NA 4O1IA 4BZXA 4B3DA 4WZBE 2X8AA 5JW6A 2OAQ1 1Y6FA 1PSWA 1U7OA 3BAZA 2AMJA 2XOEA 4C6TB 3FOZA 2HY7A 4PS0A 3U7EB 1WKVA 3V5RA 1BNCA 4Y1EA 5C1OA 3T5CA 5L53A 4OFBA 4LDPA 1ENOA 4NPHA 1NYTA 3SYKA 1B8VA 2UZ1B 3CH4B 5CYGA 3HLYA 5IJ0B 3C6BA 5KZMB 3OQPA 4ZWNA 3PC2A 4WOCA 3H2HA 2GA8A 4BMDA 1KIJA 4M1OA 5DNDA 2CD7A 4C4AA 4JI5I 3WLJA 1ZUNB 1HX7A 2C84A 1L4BA 1EEXB 2ZBRA 2W5UA 4F5ZA 2ZTHA 4Y2SA 2COEA 5EWJB 1QRTA 4KWIA 1Y8RA 1NUAA 1HTWA 1X94A 2BZ0A 2AJDA 1P9OA 3KOUA 4BX2A 4L57A 2VHTA 1NOJA 3SLGA 5EJ5A 1Q95A 2JASA 4F91B 1V47A 5DHUA 1WSDA 4D6YA 2BCGY 4KQ6A 3VHRA 1A5TA 3QMWA 4COOA 2Z5BA 1WZNA 4G8CA 4Y2TA 3IEUA 1IQ0A 1UZAA 1XU4A 3NTQA 4R9SA 5EESA 4MW9A 1GFSA 2GVZC 3QXXA 4DV4E 4X45A 4F3RA 1R0LA 2AX4A 1E1DA 4LPKA 4P7JA 3MTEA 2GPSA 3SM9A 2H1CA 4KEAA 5B7GA 4R1TA 2EHJA 3D1JA 1ZKDA 1E2KA 3IO5A 4QPNA 5FOXA 3QELA 2QORA 1KXJA 3H18A 2AXQA 4PZ0A 4CN8A 1QUFA 3NHKA 3B8EA 3IT3A 5C1PA 1U98A 3HUDA 2H63A 2VXOA 2CF5A 2XMPA 1GVHA 2B0JA 1Z5VA 3I2KA 2PR2A 2YVQA 4BC1A 2WNRB 1XMPA 2ISQA 3NBZC 1EZ4A 1Z4QA 3DE0X 2QVZX 5H1YA 4JT4A 1EWKA 3S8EA 1FK8A 1FX0B 4HWOA 4D1YA 3TLMA 2Q8QA 4XVQA 4DR6E 5C0XD 4MYUA 1NAIA 2QQ5A 2ZCUA 3AX6A 5E1BA 4ZTZB 3I4LA 2MSCB 1RNLA 1UOQA 2GXQA 4M49A 2FF5A 3TTYA 1KVRA 2ANBA 1M6VB 3ZNPA 1KJIA 2QY9A 3T5DA 1DGQA 1ADGA 5CX4A 3CT6A 2CNKA 1L4HA 3ZVMA 4AJOA 1AUOA 3VU3A 2NQ8A 4RMGA 1KTVA 4WIAA 4TN1A 3OJLA 2IP1A 1V2GA 4YAFA 4YDRA 5TGTA 3IEMA 4Z4IA 1GCIA 1MZPA 1HNNA 3D6MA 4NH4A 2F8TA 4DNPA 4LV8B 1JN0A 1NZFA 2XW6A 3J80C 2E37A 3UHJA 2GXAA 4G0UA 4YP9A 4P4NA 3NJRA 4F4IA 1VJ0A 3U60B 3R5TA 4HBGA 4HVCA 4GKJI 1G5TA 2QQEA 2RGAA 4OOEA 1JILA 4R9UC 1OPXA 4DV5B 2ASEA 3KAJA 1NN0A 3IR5A 4F4FA 3UH1A 5DRYA 4Z7JA 5U1PA 2NUPB 3Q6NA 2N1BA 1XK7A 1IEXA 5EWMA 4BNMA 3E82A 2P4EA 2D62A 5KTKA 4ER6A 4LY3A 5AIBA 1U63A 4DNOA 3NMUF 4BAUA 4EI9A 5BV7A 2UU9B 3DDOA 4TWZA 5BWLA 3M85D 4DOMA 3GL9A 3PIDA 2GK4A 1V16A 1Z5WA 2ZSIA 1M7HA 3P06A 3SYMA 3LBNA 3UAGA 4FZJA 5CB8A 2C3YA 2XWPA 2DT8A 1IPEA 2AFHA 2PKEA 4JBWA 2GRJA 4LA4A 4XRRA 1L5HA 2XTNA 1QDUA 2OBXA 3E2MA 3PUIA 3FUVA 2A88A 2BFOA 4Q82A 1H5UA 4CKBB 3ZC3A 1VLZA 2ENUA 3B89A 4LQDA 5ICEA 1BDHA 2AJ4A 2Z8YA 4KAFA 3VSAA 4ZK6A 3TTUA 2A59A 1J0EA 3C7CB 5E7JA 1JMVA 1T8TA 2QLFA 3EDQA 5JLAA 1JEJA 1G60A 3GA0A 4FIDA 4IS3A 3CYFA 2CLHB 5EJ7A 4IGKA 4X3CA 1YB5A 1Z29A 2MT9A 1E7SA 3BOSA 3ESXA 3OLWA 4R4JA 3CUVA 1TYBE 5CLQA 5ALDA 4EB3A 2HIMA 3CPEA 4GFDA 4K9QA 3Q88A 1OAKA 1QV7A 4LIPD 2OZLB 4G25A 3TKLA 5HZMA 3D0OA 1S02A 5EPOA 3VR4D 3FAZA 5BSGA 1JJIA 1N3BA 1U3DA 1K66A 1JFRA 1QG0A 3GRRA 4KWEA 4LWOA 3P4XA 1BE0A 3SHTA 3WYCA 1PJTA 4J2OA 1NKSA 3QG1A 5H81A 1L8AA 1D03A 2GPWA 4DUZI 2YXEA 4M83A 2OBMA 4EHFA 1JB9A 3PUHA 4LRYA 3UHAA 4E2XA 1X7ZA 3T54A 4GSYA 5KNLA 3AHEA 3MTIA 4ALMA 3M9LA 1KEZA 3FDFA 1RAAA 1Z33A 1U7UA 2HBQA 1XEXA 4ECAA 3GPIA 3SHWA 4V02A 5KJ6A 3BG5A 3GJ6A 1FSPA 1U2TA 3UWSA 1EP3B 2BEKA 2PYIA 3QZUA 1SRRA 1QQTA 2FW8A 2X3YA 3AZOA 5DJ5A 4M38A 1VECA 4GM0A 1Y1SA 1E0SA 4PQYA 5H3LA 5K0ZA 2FPPA 3HU2A 4NZZA 1H2EA 4ILKA 2WM8A 2AV6A 4NPCA 4EF5A 1YC5A 4IUDS 1FVFA 2R8RA 2Z95A 2H4YA 4ZI7B 4ZQHA 4MCHA 2Z8ZA 4C20A 1GSOA 1Y3CE 1W35A 2O7NA 4HRVA 1N6KA 1XCJA 2F55A 1PFWA 1XRQA 5MFPA 3PEWA 5ITWA 1RM3A 4DWOA 1IWPB 2ZZKA 1II0A 2R7AA 3HP4A 1QRSA 3OTHA 1KO1A 4JLVA 1J39A 2QE7A 2RHLA 2R6FA 4YAOA 1MX9A 2WWWA 3E3OA 2QP3A 3G2IA 4L85A 1ETHA 4Z0NA 1P62B 4X41A 3K4PA 1RHMA 5JEEA 3CLRD 2SKDA 2NZ8A 3A6KA 3I6QA 4A2WA 1ILEA 1YQUA 3IPRA 3E4CA 1SHJA 2HFKA 2E49A 2Q0QA 3HYCA 1U0TA 2VFAA 4NXMB