3JAMQ

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
141
Chain Sequence
TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 33
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3jamQ00
4X65I 1NHIA 4X64E 4DR2I 4LF8I 1IBLI 4X66I 1HNXE 1U2RA 4B3ME 2UUCI 1NHJA 1K47A 4MYTA 1PKPA 4Z7YA 2HKEA 4WUDA 4JV5E 4DV5E 3F0NA 4JI2E 2J7KA 5IWAI 4NXNI 1D6TA 4X62I 2EFGA 4DPYA 3K1JA 4JI7I 3B78A 1XMQE 4JI3E 1DARA 4DUYI 3QT5A 5FLXQ 3QT8A 4GKKE 1XMOE 3J7AM 4DR4E 5BR8I 4FWGA 3LPSA 1HNWI 4LFBE 4PU9A 2DEIA 4GKJE 4RPFA 4JI0E 4K0KE 2CZ9A 2Q2EB 2XEXA 1ZM2A 4X65E 3V5RA 1BKNA 3HULA 4URLA 3B8HA 3ZM7A 4UT4A 2UUBI 1I94I 2VQEE 4DV4I 4OX9E 2NPFA 3J80Q 1UEKA 3GONA 3ZZUA 2VQFI 3T1YI 5L3JA 3WU5A 4B3RE 4DV6E 1XNQI 2UXDE 1H7SA 1HNZI 1NZ0A 2V34A 4DR1I 4DR3E 4FN5A 4JI8I 4Z7CA 4LFAI 5BR8E 4UTGA 4P52A 2OI2A 1IBME 4XTJA 4P7AA 1ZM4A 3QT7A 3J7AG 4LFCI 2ZITA 3CWVA 4WUBA 1QZRA 2HHHI 5FLXC 1Z0TA 1FJGI 4DV3E 4DV2I 4DV7E 5LMNE 2E5LI 4JI6I 3LNUA 4LF4I 4ZVIA 3PYDA 4DR6I 1Z0WA 3H4LA 1MX0A 3PYGA 1XHKA 4DV1I 4LF6I 4B3TI 1S4EA 4DPXA 1ZM3A 4DPTA 1N36E 4KHPI 4DV0I 1H73A 2UUAE 4JYAE 3T1HE 1KKHA 4YHHI 4USMA 1Z59A 2HFSA 2UXCI 5GMDA 2UXBI 1Z5CA 2VF3A 4DR7E 3J80C 4JI4I 2BV3A 3PYFA 4PRVA 4LF9E 2R3VA 1HR0I 4JI1E 2F4VI 5LMUE 4DUZE 4EMDA 1FJGE 1N32E 4JG4A 4DR5I 4JI6E 1N33I 1IBKI 4LF5I 1Z5BA 1KIJA 1PVGA 4B3TE 4DR2E 4LF8E 1IBLE 4X66E 2ZM6I 4YY3I 4DXLA 1XNRI 4FW9A 2UUCE 4KHPE 4MYUA 4NXMI 5GMEA 2HFUA 2DEJA 3ZKBA 2UU9I 2A2CA 3OTOI 4LF7I 4B3SI 5IWAE 4HYMA 2R42A 4NXNE 5IT9Q 4X62E 1N34I 1J5EI 4JI7E 4DPWA 1WUUA 1NHHA 4DUYE 4X64I 2HKJA 1HNXI 3ZKDA 1Z0EA 1H7UA 4AQYI 4JV5I 4JI2I 1HNWE 4I3HA 4KQVA 1XMQI 1N33E 1FWKA 2A2DA 1Z5AA 4GKKI 1XMOI 4HY1A 3WU4A 2E1RA 3M6AA 2UUBE 1I94E 4LFBI 4DV4E 2HK3A 2BM1A 3PYEA 3D4JA 1ELOA 4GKJI 4JI0I 2VQFE 3T1YE 4K0KI 1N0UA 1S16A 1Z0BA 4USKA 1XNQE 1HNZE 4DR1E 3JAMQ 4JI8E 5A2QQ 4LFAE 1RR9A 2VQEI 5IT9C 4AQYE 4OX9I 1FKAE 2WW4A 2BM0A 4LFCE 2ZBKB 3WU3A 1ZM9A 4R1FA 2HHHE 4B3RI 4DV6I 3K17A 2UXDI 4DV2E 2E5LE 4LF4E 4FWDA 4DR3I 4DR6E 2GS8A 3B82A 4DV1E 4LF6E 3ZZ0A 1IBMI 1KTVA 4DU8A 1B62A 3J81Q 3Q1QA 4DV0E 1N0VC 1Z0VA 4FWHA 4DV3I 4HACA 4DV7I 5LMNI 4YHHE 2UXCE 2UXBE 2LJPA 4JI5I 3V2UC 1RREA 4PRXA 4JI4E 1FNMA 1H74A 1N36I 4B3MI 1ZXNA 1Z0CA 2UUAI 4JYAI 1A6FA 4ED4A 3T1HI 4M1KA 4DV5I 1HR0E 4DU7A 2F4VE 3JAMC 4DPUA 5A2QC 4DR5E 5LL6R 1B63A 1FWLA 3QT6A 1ZXMA 2V2ZA 4JI3I 1IBKE 4DR7I 4LF5E 3ZZTA 1H72C 1OJ4A 2X36A 4WUCA 4DR4I 4LF9I 3LTOA 3WU6A 1MU5A 1VISA 2ZM6E 4YY3E 1XNRE 1PIEA 4HACB 4JI1I 1EI1A 4NXME 1FI4A 1EA6A 1Z0GA 2AJ4A 5LMUI 4DUZI 1N32I 4HXZA 2V2VA 2UU9E 3OTOE 4LF7E 2V2QA 4B3SE 4JI5E 1N34E 1J5EE 1MG7A 2X7IA 1KVKA 2V8PA 3J81C 2HK2A
chains in the Genus database with same CATH superfamily
4X65I 1NHIA 4X64E 4DR2I 4ISAA 4LF8I 4LPFA 1IBLI 4X66I 1HNXE 1U2RA 4B3ME 2UUCI 1NHJA 1K47A 4MYTA 1PKPA 1P42A 4Z7YA 2HKEA 4WUDA 4JV5E 1HK7A 4DV5E 3F0NA 4JI2E 5JEAB 4MQYA 2J7KA 5IWAI 4NXNI 3Q6NA 1D6TA 4X62I 2EFGA 5DRPA 4DPYA 2JE6B 3K1JA 4JI7I 3B78A 4OKGA 4AIMA 1XMQE 2PO1B 4JI3E 1DARA 4DUYI 3QT5A 1R6MA 1Y5YA 4NBQA 5FLXQ 3QT8A 4GKKE 1XMOE 3J7AM 4U3BA 4DR4E 4U3DA 1USUA 5BR8I 1E3PA 4FWGA 3LPSA 5DNLA 1HNWI 4LFBE 4PU9A 1Y60A 2DEIA 4OZEA 4IFDE 4GKJE 4RPFA 4JI0E 3H1CA 4K0KE 2GQ0A 2CZ9A 2Q2EB 2XEXA 5JEAF 2NN6A 1ZM2A 2C38A 4X65E 2JT2A 4IZJB 3V5RA 1BKNA 3HULA 2C39A 4OO1D 4URLA 3B8HA 3ZM7A 4UT4A 2JEBB 2UUBI 1I94I 2VQEE 4DV4I 3P06A 4OX9E 2NPFA 3J80Q 1UEKA 3GONA 3U1KA 3ZZUA 2VQFI 3T1YI 5L3JA 3WU5A 4B3RE 4DV6E 2AE8A 3P3GA 1XNQI 2UXDE 1H7SA 3K85A 1HNZI 4MU1A 1NZ0A 2V34A 4DR1I 4DR3E 4FN5A 2O1UA 5DNXA 4JI8I 2JE6A 4Z7CA 2PO1A 4LFAI 1YHCA 5BR8E 4UTGA 4P52A 2OI2A 1IBME 4XTJA 4P7AA 1ZM4A 3QT7A 3J7AG 4LFCI 2ZITA 3CWVA 4MU0A 3P3EA 4WUBA 1QZRA 2HHHI 5FLXC 1Z0TA 2NN6B 4DV3E 1FJGI 4DV2I 4DV7E 5LMNE 2E5LI 4JI6I 4GQUA 2BA1D 3LNUA 2C38B 3HKMA 4LF4I 5K36D 4ZVIA 5ELWA 3PYDA 3CDIA 4DR6I 1Z0WA 1OYRA 3H4LA 1MX0A 2PO2A 3PYGA 2BR2B 1XHKA 4FW3A 4DV1I 4LF6I 4FW4A 4AIDA 4B3TI 1S4EA 2IESA 1OYPA 1ZM3A 4DPXA 4DPTA 1N36E 4OO1C 2WP8A 4KHPI 4DV0I 4IZJA 1H73A 2WNRA 2UUAE 4JYAE 3T1HE 2JEBA 1KKHA 4YHHI 4USMA 1Z59A 2HFSA 2UXCI 1E3HA 5GMDA 4OO1E 2UXBI 1Z5CA 4QNJA 2Z5EA 1UDNA 2NN6F 1VI7A 2VF3A 4DR7E 4J3DA 3J80C 4JI4I 5C0XC 3PS3A 2BV3A 2CG9A 3PYFA 4PRVA 3KRNA 3DD6A 4LF9E 4IFDC 2R3VA 1HR0I 4JI1E 5C0XE 2F4VI 5C0XB 2CGEA 5LMUE 4DUZE 4EMDA 1FJGE 4MU3A 1N32E 4JG4A 4DR5I 3M85D 4JI6E 3PS2A 3P76A 1N33I 2PO2B 2VESA 4IFDB 1IBKI 2IOQA 4LF5I 2O3ZA 2BA0D 1Z5BA 1USVA 1KIJA 1PVGA 4B3TE 2WP8B 4DR2E 4LF8E 1IBLE 4X66E 2ZM6I 2WNRB 4YY3I 4DXLA 1XNRI 4FW9A 2UUCE 5K36E 4KHPE 2BR2A 3U1YA 4MYUA 4NXMI 5GMEA 3M85G 2HFUA 2DEJA 3ZKBA 2UU9I 2A2CA 3OTOI 4LF7I 4B3SI 2BA0G 2C37A 3UHMA 5IWAE 4HYMA 2R42A 4NXNE 5IT9Q 4X62E 1N34I 1J5EI 3NZKA 4JI7E 4DPWA 1WUUA 5JEAD 1NHHA 3B4TA 4DUYE 4X64I 4OO1A 2HKJA 1HNXI 3ZKDA 1Z0EA 4IFDF 1H7UA 3PS1A 4AQYI 4JV5I 5DROA 4JI2I 2PNZB 3GMEA 1HNWE 4I3HA 4KQVA 2O1TA 1RHYA 1XMQI 1N33E 1FWKA 2A2DA 4N3OA 5C0XA 1Z5AA 3Q6MA 4GKKI 1XMOI 4HY1A 4IFDA 3WU4A 2O1WA 1Y6ZA 2E1RA 4IS9A 1YH8A 3M6AA 2UUBE 2C37B 1I94E 4LFBI 4IZJD 4DV4E 2HK3A 2PNLA 2BM1A 3PYEA 3D4JA 1ELOA 2BA1G 4GKJI 4JI0I 5K36A 2VQFE 3T1YE 4K0KI 1N0UA 1S16A 1Z0BA 4OO1B 3HJCA 4USKA 1XNQE 1UDQA 1HNZE 5JEAC 2F1DA 4DR1E 2Z5CA 3JAMQ 4JI8E 5A2QQ 4IZKA 4LFAE 1RR9A 2VQEI 3CDJA 5IT9C 2J65A 4AQYE 4OX9I 4FW6A 1Y4UA 4BA1B 2WW4A 5JEAE 1FKAE 4BA2B 2BM0A 4LFCE 2ZBKB 3GCMA 3WU3A 1ZM9A 4R1FA 2HHHE 3P3CA 4DV6I 4B3RI 3K17A 2UXDI 4DV2E 2E5LE 5FWKA 2PNZA 2Z5BA 4LF4E 4FWDA 4DR3I 4LCFA 5K36C 4DR6E 2NN6D 2GS8A 3B82A 4DV1E 4LF6E 4OO1F 3ZZ0A 1IBMI 1KTVA 4DU8A 1B62A 3J81Q 3Q1QA 2PO0B 4DV0E 5K36B 5DRRA 1N0VC 1Z0VA 2JEAB 4FWHA 4DV3I 5DRQA 4HACA 4DV7I 5LMNI 4YHHE 2UXCE 2UXBE 1R6LA 2LJPA 4JI5I 2Z5CB 3V2UC 1RREA 4IZKB 1UDSA 4LOMA 2CVEA 1UDOA 5C0XF 3L7ZA 4PRXA 5EKWA 3PRYA 4JI4E 4MU4A 1FNMA 1H74A 1N36I 4B3MI 2PNMA 4FW7A 1XXEA 1ZXNA 4FW5A 1Z0CA 2UUAI 4JYAI 1A6FA 4ED4A 2GO3A 3T1HI 4M1KA 4DV5I 3M7ND 1HR0E 4DU7A 2F4VE 1OYSA 2Z5BB 3GLLA 4BA1A 3JAMC 4DPUA 2IERA 4QNKA 5A2QC 4BA2A 4DR5E 5LL6R 1B63A 5JEAA 1FWLA 5K36F 3QT6A 2O1VA 1ZXMA 2V2ZA 4JI3I 5C0XD 1IBKE 4LCGA 5EL9A 4DR7I 4LF5E 2IOPA 3ZZTA 1H72C 1OJ4A 1Y4SA 4AM3A 2X36A 2NN6C 4WUCA 4DR4I 4IFDD 4LF9I 3LTOA 3M7NG 3WU6A 1MU5A 1VISA 2ZM6E 4YY3E 1XNRE 1PIEA 4HACB 4JI1I 1EI1A 4NXME 1FI4A 1EA6A 1Z0GA 2AJ4A 5LMUI 2NN6E 4DUZI 1N32I 4HXZA 2V2VA 4MDTA 2UU9E 2GO4A 3OTOE 4LF7E 2V2QA 4B3SE 2PO0A 4JI5E 1N34E 1J5EE 3L7ZB 1MG7A 2C39B 2X7IA 2JEAA 1KVKA 2V8PA 4LCHA 3J81C 2HK2A
chains in the Genus database with same CATH topology
4X65I 1NHIA 4X64E 4DR2I 4LF8I 1IBLI 4X66I 1HNXE 1U2RA 4B3ME 2UUCI 1NHJA 1K47A 4MYTA 1PKPA 4Z7YA 2HKEA 4WUDA 4JV5E 1HK7A 4DV5E 3F0NA 4JI2E 2J7KA 5IWAI 4NXNI 3Q6NA 1D6TA 4X62I 2EFGA 4DPYA 3K1JA 4JI7I 3B78A 1XMQE 4JI3E 1DARA 4DUYI 3QT5A 5FLXQ 3QT8A 4GKKE 1XMOE 3J7AM 4DR4E 1USUA 5BR8I 4FWGA 3LPSA 1HNWI 4LFBE 4PU9A 2DEIA 4GKJE 4RPFA 4JI0E 4K0KE 2GQ0A 2CZ9A 2Q2EB 2XEXA 1ZM2A 4X65E 4IZJB 3V5RA 1BKNA 3HULA 4URLA 3B8HA 3ZM7A 4UT4A 2UUBI 1I94I 2VQEE 4DV4I 3P06A 4OX9E 2NPFA 3J80Q 1UEKA 3GONA 3ZZUA 2VQFI 3T1YI 5L3JA 3WU5A 4B3RE 4DV6E 1XNQI 2UXDE 1H7SA 3K85A 1HNZI 1NZ0A 2V34A 4DR1I 4DR3E 4FN5A 2O1UA 4JI8I 4Z7CA 4LFAI 5BR8E 4UTGA 4P52A 2OI2A 1IBME 4XTJA 4P7AA 1ZM4A 3QT7A 3J7AG 4LFCI 2ZITA 3CWVA 4WUBA 1QZRA 2HHHI 5FLXC 1Z0TA 1FJGI 4DV3E 4DV2I 4DV7E 5LMNE 2E5LI 4JI6I 3LNUA 4LF4I 4ZVIA 3PYDA 4DR6I 1Z0WA 3H4LA 1MX0A 3PYGA 1XHKA 4DV1I 4LF6I 4B3TI 1S4EA 4DPXA 1ZM3A 4DPTA 1N36E 4KHPI 4DV0I 4IZJA 1H73A 2UUAE 4JYAE 3T1HE 1KKHA 4YHHI 4USMA 1Z59A 2HFSA 2UXCI 5GMDA 2UXBI 1Z5CA 2Z5EA 2VF3A 4DR7E 3J80C 4JI4I 2BV3A 2CG9A 3PYFA 4PRVA 4LF9E 2R3VA 1HR0I 4JI1E 2F4VI 2CGEA 5LMUE 4DUZE 4EMDA 1FJGE 1N32E 4JG4A 4DR5I 4JI6E 1N33I 1IBKI 2IOQA 4LF5I 1Z5BA 1USVA 1KIJA 1PVGA 4B3TE 4DR2E 4LF8E 1IBLE 4X66E 2ZM6I 4YY3I 4DXLA 1XNRI 4FW9A 2UUCE 4KHPE 4MYUA 4NXMI 5GMEA 2HFUA 2DEJA 3ZKBA 2UU9I 2A2CA 3OTOI 4LF7I 4B3SI 5IWAE 4HYMA 2R42A 4NXNE 5IT9Q 4X62E 1N34I 1J5EI 4JI7E 4DPWA 1WUUA 1NHHA 4DUYE 4X64I 2HKJA 1HNXI 3ZKDA 1Z0EA 1H7UA 4AQYI 4JV5I 4JI2I 1HNWE 4I3HA 4KQVA 2O1TA 1XMQI 1N33E 1FWKA 2A2DA 4N3OA 1Z5AA 3Q6MA 4GKKI 1XMOI 4HY1A 3WU4A 2O1WA 1Y6ZA 2E1RA 3M6AA 2UUBE 1I94E 4LFBI 4IZJD 4DV4E 2HK3A 2PNLA 2BM1A 3PYEA 3D4JA 1ELOA 4GKJI 4JI0I 2VQFE 3T1YE 4K0KI 1N0UA 1S16A 1Z0BA 4USKA 1XNQE 1HNZE 4DR1E 2Z5CA 3JAMQ 4JI8E 5A2QQ 4IZKA 4LFAE 1RR9A 2VQEI 5IT9C 4AQYE 4OX9I 1Y4UA 1FKAE 2WW4A 2BM0A 4LFCE 2ZBKB 3WU3A 1ZM9A 4R1FA 2HHHE 4B3RI 4DV6I 3K17A 2UXDI 4DV2E 2E5LE 5FWKA 2Z5BA 4LF4E 4FWDA 4DR3I 4DR6E 2GS8A 3B82A 4DV1E 4LF6E 3ZZ0A 1IBMI 1KTVA 4DU8A 1B62A 3J81Q 3Q1QA 4DV0E 1N0VC 1Z0VA 4FWHA 4DV3I 4HACA 4DV7I 5LMNI 4YHHE 2UXCE 2UXBE 2LJPA 4JI5I 2Z5CB 3V2UC 1RREA 4IZKB 4PRXA 3PRYA 4JI4E 1FNMA 1H74A 1N36I 4B3MI 2PNMA 1ZXNA 1Z0CA 2UUAI 4JYAI 1A6FA 4ED4A 3T1HI 4M1KA 4DV5I 1HR0E 4DU7A 2F4VE 2Z5BB 3JAMC 4DPUA 5A2QC 4DR5E 5LL6R 1B63A 1FWLA 3QT6A 2O1VA 1ZXMA 2V2ZA 4JI3I 1IBKE 4DR7I 4LF5E 2IOPA 3ZZTA 1H72C 1OJ4A 1Y4SA 2X36A 4WUCA 4DR4I 4LF9I 3LTOA 3WU6A 1MU5A 1VISA 2ZM6E 4YY3E 1XNRE 1PIEA 4HACB 4JI1I 1EI1A 4NXME 1FI4A 1EA6A 1Z0GA 2AJ4A 5LMUI 4DUZI 1N32I 4HXZA 2V2VA 2UU9E 3OTOE 4LF7E 2V2QA 4B3SE 4JI5E 1N34E 1J5EE 1MG7A 2X7IA 1KVKA 2V8PA 3HJCA 3J81C 2HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 I;  1NHI A;  4X64 E;  4DR2 I;  4LF8 I;  1IBL I;  4X66 I;  1HNX E;  1U2R A;  4B3M E;  2UUC I;  1NHJ A;  1K47 A;  4MYT A;  1PKP A;  4Z7Y A;  2HKE A;  4WUD A;  4JV5 E;  4DV5 E;  3F0N A;  4JI2 E;  2J7K A;  5IWA I;  4NXN I;  1D6T A;  4X62 I;  2EFG A;  4DPY A;  3K1J A;  4JI7 I;  3B78 A;  1XMQ E;  4JI3 E;  1DAR A;  4DUY I;  3QT5 A;  5FLX Q;  3QT8 A;  4GKK E;  1XMO E;  3J7A M;  4DR4 E;  5BR8 I;  4FWG A;  3LPS A;  1HNW I;  4LFB E;  4PU9 A;  2DEI A;  4GKJ E;  4RPF A;  4JI0 E;  4K0K E;  2CZ9 A;  2Q2E B;  2XEX A;  1ZM2 A;  4X65 E;  3V5R A;  1BKN A;  3HUL A;  4URL A;  3B8H A;  3ZM7 A;  4UT4 A;  2UUB I;  1I94 I;  2VQE E;  4DV4 I;  4OX9 E;  2NPF A;  3J80 Q;  1UEK A;  3GON A;  3ZZU A;  2VQF I;  3T1Y I;  5L3J A;  3WU5 A;  4B3R E;  4DV6 E;  1XNQ I;  2UXD E;  1H7S A;  1HNZ I;  1NZ0 A;  2V34 A;  4DR1 I;  4DR3 E;  4FN5 A;  4JI8 I;  4Z7C A;  4LFA I;  5BR8 E;  4UTG A;  4P52 A;  2OI2 A;  1IBM E;  4XTJ A;  4P7A A;  1ZM4 A;  3QT7 A;  3J7A G;  4LFC I;  2ZIT A;  3CWV A;  4WUB A;  1QZR A;  2HHH I;  5FLX C;  1Z0T A;  1FJG I;  4DV3 E;  4DV2 I;  4DV7 E;  5LMN E;  2E5L I;  4JI6 I;  3LNU A;  4LF4 I;  4ZVI A;  3PYD A;  4DR6 I;  1Z0W A;  3H4L A;  1MX0 A;  3PYG A;  1XHK A;  4DV1 I;  4LF6 I;  4B3T I;  1S4E A;  4DPX A;  1ZM3 A;  4DPT A;  1N36 E;  4KHP I;  4DV0 I;  1H73 A;  2UUA E;  4JYA E;  3T1H E;  1KKH A;  4YHH I;  4USM A;  1Z59 A;  2HFS A;  2UXC I;  5GMD A;  2UXB I;  1Z5C A;  2VF3 A;  4DR7 E;  3J80 C;  4JI4 I;  2BV3 A;  3PYF A;  4PRV A;  4LF9 E;  2R3V A;  1HR0 I;  4JI1 E;  2F4V I;  5LMU E;  4DUZ E;  4EMD A;  1FJG E;  1N32 E;  4JG4 A;  4DR5 I;  4JI6 E;  1N33 I;  1IBK I;  4LF5 I;  1Z5B A;  1KIJ A;  1PVG A;  4B3T E;  4DR2 E;  4LF8 E;  1IBL E;  4X66 E;  2ZM6 I;  4YY3 I;  4DXL A;  1XNR I;  4FW9 A;  2UUC E;  4KHP E;  4MYU A;  4NXM I;  5GME A;  2HFU A;  2DEJ A;  3ZKB A;  2UU9 I;  2A2C A;  3OTO I;  4LF7 I;  4B3S I;  5IWA E;  4HYM A;  2R42 A;  4NXN E;  5IT9 Q;  4X62 E;  1N34 I;  1J5E I;  4JI7 E;  4DPW A;  1WUU A;  1NHH A;  4DUY E;  4X64 I;  2HKJ A;  1HNX I;  3ZKD A;  1Z0E A;  1H7U A;  4AQY I;  4JV5 I;  4JI2 I;  1HNW E;  4I3H A;  4KQV A;  1XMQ I;  1N33 E;  1FWK A;  2A2D A;  1Z5A A;  4GKK I;  1XMO I;  4HY1 A;  3WU4 A;  2E1R A;  3M6A A;  2UUB E;  1I94 E;  4LFB I;  4DV4 E;  2HK3 A;  2BM1 A;  3PYE A;  3D4J A;  1ELO A;  4GKJ I;  4JI0 I;  2VQF E;  3T1Y E;  4K0K I;  1N0U A;  1S16 A;  1Z0B A;  4USK A;  1XNQ E;  1HNZ E;  4DR1 E;  3JAM Q;  4JI8 E;  5A2Q Q;  4LFA E;  1RR9 A;  2VQE I;  5IT9 C;  4AQY E;  4OX9 I;  1FKA E;  2WW4 A;  2BM0 A;  4LFC E;  2ZBK B;  3WU3 A;  1ZM9 A;  4R1F A;  2HHH E;  4B3R I;  4DV6 I;  3K17 A;  2UXD I;  4DV2 E;  2E5L E;  4LF4 E;  4FWD A;  4DR3 I;  4DR6 E;  2GS8 A;  3B82 A;  4DV1 E;  4LF6 E;  3ZZ0 A;  1IBM I;  1KTV A;  4DU8 A;  1B62 A;  3J81 Q;  3Q1Q A;  4DV0 E;  1N0V C;  1Z0V A;  4FWH A;  4DV3 I;  4HAC A;  4DV7 I;  5LMN I;  4YHH E;  2UXC E;  2UXB E;  2LJP A;  4JI5 I;  3V2U C;  1RRE A;  4PRX A;  4JI4 E;  1FNM A;  1H74 A;  1N36 I;  4B3M I;  1ZXN A;  1Z0C A;  2UUA I;  4JYA I;  1A6F A;  4ED4 A;  3T1H I;  4M1K A;  4DV5 I;  1HR0 E;  4DU7 A;  2F4V E;  3JAM C;  4DPU A;  5A2Q C;  4DR5 E;  5LL6 R;  1B63 A;  1FWL A;  3QT6 A;  1ZXM A;  2V2Z A;  4JI3 I;  1IBK E;  4DR7 I;  4LF5 E;  3ZZT A;  1H72 C;  1OJ4 A;  2X36 A;  4WUC A;  4DR4 I;  4LF9 I;  3LTO A;  3WU6 A;  1MU5 A;  1VIS A;  2ZM6 E;  4YY3 E;  1XNR E;  1PIE A;  4HAC B;  4JI1 I;  1EI1 A;  4NXM E;  1FI4 A;  1EA6 A;  1Z0G A;  2AJ4 A;  5LMU I;  4DUZ I;  1N32 I;  4HXZ A;  2V2V A;  2UU9 E;  3OTO E;  4LF7 E;  2V2Q A;  4B3S E;  4JI5 E;  1N34 E;  1J5E E;  1MG7 A;  2X7I A;  1KVK A;  2V8P A;  3J81 C;  2HK2 A; 
#chains in the Genus database with same CATH topology
 4X65 I;  1NHI A;  4X64 E;  4DR2 I;  4ISA A;  4LF8 I;  4LPF A;  1IBL I;  4X66 I;  1HNX E;  1U2R A;  4B3M E;  2UUC I;  1NHJ A;  1K47 A;  4MYT A;  1PKP A;  1P42 A;  4Z7Y A;  2HKE A;  4WUD A;  4JV5 E;  1HK7 A;  4DV5 E;  3F0N A;  4JI2 E;  5JEA B;  4MQY A;  2J7K A;  5IWA I;  4NXN I;  3Q6N A;  1D6T A;  4X62 I;  2EFG A;  5DRP A;  4DPY A;  2JE6 B;  3K1J A;  4JI7 I;  3B78 A;  4OKG A;  4AIM A;  1XMQ E;  2PO1 B;  4JI3 E;  1DAR A;  4DUY I;  3QT5 A;  1R6M A;  1Y5Y A;  4NBQ A;  5FLX Q;  3QT8 A;  4GKK E;  1XMO E;  3J7A M;  4U3B A;  4DR4 E;  4U3D A;  1USU A;  5BR8 I;  1E3P A;  4FWG A;  3LPS A;  5DNL A;  1HNW I;  4LFB E;  4PU9 A;  1Y60 A;  2DEI A;  4OZE A;  4IFD E;  4GKJ E;  4RPF A;  4JI0 E;  3H1C A;  4K0K E;  2GQ0 A;  2CZ9 A;  2Q2E B;  2XEX A;  5JEA F;  2NN6 A;  1ZM2 A;  2C38 A;  4X65 E;  2JT2 A;  4IZJ B;  3V5R A;  1BKN A;  3HUL A;  2C39 A;  4OO1 D;  4URL A;  3B8H A;  3ZM7 A;  4UT4 A;  2JEB B;  2UUB I;  1I94 I;  2VQE E;  4DV4 I;  3P06 A;  4OX9 E;  2NPF A;  3J80 Q;  1UEK A;  3GON A;  3U1K A;  3ZZU A;  2VQF I;  3T1Y I;  5L3J A;  3WU5 A;  4B3R E;  4DV6 E;  2AE8 A;  3P3G A;  1XNQ I;  2UXD E;  1H7S A;  3K85 A;  1HNZ I;  4MU1 A;  1NZ0 A;  2V34 A;  4DR1 I;  4DR3 E;  4FN5 A;  2O1U A;  5DNX A;  4JI8 I;  2JE6 A;  4Z7C A;  2PO1 A;  4LFA I;  1YHC A;  5BR8 E;  4UTG A;  4P52 A;  2OI2 A;  1IBM E;  4XTJ A;  4P7A A;  1ZM4 A;  3QT7 A;  3J7A G;  4LFC I;  2ZIT A;  3CWV A;  4MU0 A;  3P3E A;  4WUB A;  1QZR A;  2HHH I;  5FLX C;  1Z0T A;  2NN6 B;  4DV3 E;  1FJG I;  4DV2 I;  4DV7 E;  5LMN E;  2E5L I;  4JI6 I;  4GQU A;  2BA1 D;  3LNU A;  2C38 B;  3HKM A;  4LF4 I;  5K36 D;  4ZVI A;  5ELW A;  3PYD A;  3CDI A;  4DR6 I;  1Z0W A;  1OYR A;  3H4L A;  1MX0 A;  2PO2 A;  3PYG A;  2BR2 B;  1XHK A;  4FW3 A;  4DV1 I;  4LF6 I;  4FW4 A;  4AID A;  4B3T I;  1S4E A;  2IES A;  1OYP A;  1ZM3 A;  4DPX A;  4DPT A;  1N36 E;  4OO1 C;  2WP8 A;  4KHP I;  4DV0 I;  4IZJ A;  1H73 A;  2WNR A;  2UUA E;  4JYA E;  3T1H E;  2JEB A;  1KKH A;  4YHH I;  4USM A;  1Z59 A;  2HFS A;  2UXC I;  1E3H A;  5GMD A;  4OO1 E;  2UXB I;  1Z5C A;  4QNJ A;  2Z5E A;  1UDN A;  2NN6 F;  1VI7 A;  2VF3 A;  4DR7 E;  4J3D A;  3J80 C;  4JI4 I;  5C0X C;  3PS3 A;  2BV3 A;  2CG9 A;  3PYF A;  4PRV A;  3KRN A;  3DD6 A;  4LF9 E;  4IFD C;  2R3V A;  1HR0 I;  4JI1 E;  5C0X E;  2F4V I;  5C0X B;  2CGE A;  5LMU E;  4DUZ E;  4EMD A;  1FJG E;  4MU3 A;  1N32 E;  4JG4 A;  4DR5 I;  3M85 D;  4JI6 E;  3PS2 A;  3P76 A;  1N33 I;  2PO2 B;  2VES A;  4IFD B;  1IBK I;  2IOQ A;  4LF5 I;  2O3Z A;  2BA0 D;  1Z5B A;  1USV A;  1KIJ A;  1PVG A;  4B3T E;  2WP8 B;  4DR2 E;  4LF8 E;  1IBL E;  4X66 E;  2ZM6 I;  2WNR B;  4YY3 I;  4DXL A;  1XNR I;  4FW9 A;  2UUC E;  5K36 E;  4KHP E;  2BR2 A;  3U1Y A;  4MYU A;  4NXM I;  5GME A;  3M85 G;  2HFU A;  2DEJ A;  3ZKB A;  2UU9 I;  2A2C A;  3OTO I;  4LF7 I;  4B3S I;  2BA0 G;  2C37 A;  3UHM A;  5IWA E;  4HYM A;  2R42 A;  4NXN E;  5IT9 Q;  4X62 E;  1N34 I;  1J5E I;  3NZK A;  4JI7 E;  4DPW A;  1WUU A;  5JEA D;  1NHH A;  3B4T A;  4DUY E;  4X64 I;  4OO1 A;  2HKJ A;  1HNX I;  3ZKD A;  1Z0E A;  4IFD F;  1H7U A;  3PS1 A;  4AQY I;  4JV5 I;  5DRO A;  4JI2 I;  2PNZ B;  3GME A;  1HNW E;  4I3H A;  4KQV A;  2O1T A;  1RHY A;  1XMQ I;  1N33 E;  1FWK A;  2A2D A;  4N3O A;  5C0X A;  1Z5A A;  3Q6M A;  4GKK I;  1XMO I;  4HY1 A;  4IFD A;  3WU4 A;  2O1W A;  1Y6Z A;  2E1R A;  4IS9 A;  1YH8 A;  3M6A A;  2UUB E;  2C37 B;  1I94 E;  4LFB I;  4IZJ D;  4DV4 E;  2HK3 A;  2PNL A;  2BM1 A;  3PYE A;  3D4J A;  1ELO A;  2BA1 G;  4GKJ I;  4JI0 I;  5K36 A;  2VQF E;  3T1Y E;  4K0K I;  1N0U A;  1S16 A;  1Z0B A;  4OO1 B;  3HJC A;  4USK A;  1XNQ E;  1UDQ A;  1HNZ E;  5JEA C;  2F1D A;  4DR1 E;  2Z5C A;  3JAM Q;  4JI8 E;  5A2Q Q;  4IZK A;  4LFA E;  1RR9 A;  2VQE I;  3CDJ A;  5IT9 C;  2J65 A;  4AQY E;  4OX9 I;  4FW6 A;  1Y4U A;  4BA1 B;  2WW4 A;  5JEA E;  1FKA E;  4BA2 B;  2BM0 A;  4LFC E;  2ZBK B;  3GCM A;  3WU3 A;  1ZM9 A;  4R1F A;  2HHH E;  3P3C A;  4DV6 I;  4B3R I;  3K17 A;  2UXD I;  4DV2 E;  2E5L E;  5FWK A;  2PNZ A;  2Z5B A;  4LF4 E;  4FWD A;  4DR3 I;  4LCF A;  5K36 C;  4DR6 E;  2NN6 D;  2GS8 A;  3B82 A;  4DV1 E;  4LF6 E;  4OO1 F;  3ZZ0 A;  1IBM I;  1KTV A;  4DU8 A;  1B62 A;  3J81 Q;  3Q1Q A;  2PO0 B;  4DV0 E;  5K36 B;  5DRR A;  1N0V C;  1Z0V A;  2JEA B;  4FWH A;  4DV3 I;  5DRQ A;  4HAC A;  4DV7 I;  5LMN I;  4YHH E;  2UXC E;  2UXB E;  1R6L A;  2LJP A;  4JI5 I;  2Z5C B;  3V2U C;  1RRE A;  4IZK B;  1UDS A;  4LOM A;  2CVE A;  1UDO A;  5C0X F;  3L7Z A;  4PRX A;  5EKW A;  3PRY A;  4JI4 E;  4MU4 A;  1FNM A;  1H74 A;  1N36 I;  4B3M I;  2PNM A;  4FW7 A;  1XXE A;  1ZXN A;  4FW5 A;  1Z0C A;  2UUA I;  4JYA I;  1A6F A;  4ED4 A;  2GO3 A;  3T1H I;  4M1K A;  4DV5 I;  3M7N D;  1HR0 E;  4DU7 A;  2F4V E;  1OYS A;  2Z5B B;  3GLL A;  4BA1 A;  3JAM C;  4DPU A;  2IER A;  4QNK A;  5A2Q C;  4BA2 A;  4DR5 E;  5LL6 R;  1B63 A;  5JEA A;  1FWL A;  5K36 F;  3QT6 A;  2O1V A;  1ZXM A;  2V2Z A;  4JI3 I;  5C0X D;  1IBK E;  4LCG A;  5EL9 A;  4DR7 I;  4LF5 E;  2IOP A;  3ZZT A;  1H72 C;  1OJ4 A;  1Y4S A;  4AM3 A;  2X36 A;  2NN6 C;  4WUC A;  4DR4 I;  4IFD D;  4LF9 I;  3LTO A;  3M7N G;  3WU6 A;  1MU5 A;  1VIS A;  2ZM6 E;  4YY3 E;  1XNR E;  1PIE A;  4HAC B;  4JI1 I;  1EI1 A;  4NXM E;  1FI4 A;  1EA6 A;  1Z0G A;  2AJ4 A;  5LMU I;  2NN6 E;  4DUZ I;  1N32 I;  4HXZ A;  2V2V A;  4MDT A;  2UU9 E;  2GO4 A;  3OTO E;  4LF7 E;  2V2Q A;  4B3S E;  2PO0 A;  4JI5 E;  1N34 E;  1J5E E;  3L7Z B;  1MG7 A;  2C39 B;  2X7I A;  2JEA A;  1KVK A;  2V8P A;  4LCH A;  3J81 C;  2HK2 A; 
#chains in the Genus database with same CATH homology
 4X65 I;  1NHI A;  4X64 E;  4DR2 I;  4LF8 I;  1IBL I;  4X66 I;  1HNX E;  1U2R A;  4B3M E;  2UUC I;  1NHJ A;  1K47 A;  4MYT A;  1PKP A;  4Z7Y A;  2HKE A;  4WUD A;  4JV5 E;  1HK7 A;  4DV5 E;  3F0N A;  4JI2 E;  2J7K A;  5IWA I;  4NXN I;  3Q6N A;  1D6T A;  4X62 I;  2EFG A;  4DPY A;  3K1J A;  4JI7 I;  3B78 A;  1XMQ E;  4JI3 E;  1DAR A;  4DUY I;  3QT5 A;  5FLX Q;  3QT8 A;  4GKK E;  1XMO E;  3J7A M;  4DR4 E;  1USU A;  5BR8 I;  4FWG A;  3LPS A;  1HNW I;  4LFB E;  4PU9 A;  2DEI A;  4GKJ E;  4RPF A;  4JI0 E;  4K0K E;  2GQ0 A;  2CZ9 A;  2Q2E B;  2XEX A;  1ZM2 A;  4X65 E;  4IZJ B;  3V5R A;  1BKN A;  3HUL A;  4URL A;  3B8H A;  3ZM7 A;  4UT4 A;  2UUB I;  1I94 I;  2VQE E;  4DV4 I;  3P06 A;  4OX9 E;  2NPF A;  3J80 Q;  1UEK A;  3GON A;  3ZZU A;  2VQF I;  3T1Y I;  5L3J A;  3WU5 A;  4B3R E;  4DV6 E;  1XNQ I;  2UXD E;  1H7S A;  3K85 A;  1HNZ I;  1NZ0 A;  2V34 A;  4DR1 I;  4DR3 E;  4FN5 A;  2O1U A;  4JI8 I;  4Z7C A;  4LFA I;  5BR8 E;  4UTG A;  4P52 A;  2OI2 A;  1IBM E;  4XTJ A;  4P7A A;  1ZM4 A;  3QT7 A;  3J7A G;  4LFC I;  2ZIT A;  3CWV A;  4WUB A;  1QZR A;  2HHH I;  5FLX C;  1Z0T A;  1FJG I;  4DV3 E;  4DV2 I;  4DV7 E;  5LMN E;  2E5L I;  4JI6 I;  3LNU A;  4LF4 I;  4ZVI A;  3PYD A;  4DR6 I;  1Z0W A;  3H4L A;  1MX0 A;  3PYG A;  1XHK A;  4DV1 I;  4LF6 I;  4B3T I;  1S4E A;  4DPX A;  1ZM3 A;  4DPT A;  1N36 E;  4KHP I;  4DV0 I;  4IZJ A;  1H73 A;  2UUA E;  4JYA E;  3T1H E;  1KKH A;  4YHH I;  4USM A;  1Z59 A;  2HFS A;  2UXC I;  5GMD A;  2UXB I;  1Z5C A;  2Z5E A;  2VF3 A;  4DR7 E;  3J80 C;  4JI4 I;  2BV3 A;  2CG9 A;  3PYF A;  4PRV A;  4LF9 E;  2R3V A;  1HR0 I;  4JI1 E;  2F4V I;  2CGE A;  5LMU E;  4DUZ E;  4EMD A;  1FJG E;  1N32 E;  4JG4 A;  4DR5 I;  4JI6 E;  1N33 I;  1IBK I;  2IOQ A;  4LF5 I;  1Z5B A;  1USV A;  1KIJ A;  1PVG A;  4B3T E;  4DR2 E;  4LF8 E;  1IBL E;  4X66 E;  2ZM6 I;  4YY3 I;  4DXL A;  1XNR I;  4FW9 A;  2UUC E;  4KHP E;  4MYU A;  4NXM I;  5GME A;  2HFU A;  2DEJ A;  3ZKB A;  2UU9 I;  2A2C A;  3OTO I;  4LF7 I;  4B3S I;  5IWA E;  4HYM A;  2R42 A;  4NXN E;  5IT9 Q;  4X62 E;  1N34 I;  1J5E I;  4JI7 E;  4DPW A;  1WUU A;  1NHH A;  4DUY E;  4X64 I;  2HKJ A;  1HNX I;  3ZKD A;  1Z0E A;  1H7U A;  4AQY I;  4JV5 I;  4JI2 I;  1HNW E;  4I3H A;  4KQV A;  2O1T A;  1XMQ I;  1N33 E;  1FWK A;  2A2D A;  4N3O A;  1Z5A A;  3Q6M A;  4GKK I;  1XMO I;  4HY1 A;  3WU4 A;  2O1W A;  1Y6Z A;  2E1R A;  3M6A A;  2UUB E;  1I94 E;  4LFB I;  4IZJ D;  4DV4 E;  2HK3 A;  2PNL A;  2BM1 A;  3PYE A;  3D4J A;  1ELO A;  4GKJ I;  4JI0 I;  2VQF E;  3T1Y E;  4K0K I;  1N0U A;  1S16 A;  1Z0B A;  4USK A;  1XNQ E;  1HNZ E;  4DR1 E;  2Z5C A;  3JAM Q;  4JI8 E;  5A2Q Q;  4IZK A;  4LFA E;  1RR9 A;  2VQE I;  5IT9 C;  4AQY E;  4OX9 I;  1Y4U A;  1FKA E;  2WW4 A;  2BM0 A;  4LFC E;  2ZBK B;  3WU3 A;  1ZM9 A;  4R1F A;  2HHH E;  4B3R I;  4DV6 I;  3K17 A;  2UXD I;  4DV2 E;  2E5L E;  5FWK A;  2Z5B A;  4LF4 E;  4FWD A;  4DR3 I;  4DR6 E;  2GS8 A;  3B82 A;  4DV1 E;  4LF6 E;  3ZZ0 A;  1IBM I;  1KTV A;  4DU8 A;  1B62 A;  3J81 Q;  3Q1Q A;  4DV0 E;  1N0V C;  1Z0V A;  4FWH A;  4DV3 I;  4HAC A;  4DV7 I;  5LMN I;  4YHH E;  2UXC E;  2UXB E;  2LJP A;  4JI5 I;  2Z5C B;  3V2U C;  1RRE A;  4IZK B;  4PRX A;  3PRY A;  4JI4 E;  1FNM A;  1H74 A;  1N36 I;  4B3M I;  2PNM A;  1ZXN A;  1Z0C A;  2UUA I;  4JYA I;  1A6F A;  4ED4 A;  3T1H I;  4M1K A;  4DV5 I;  1HR0 E;  4DU7 A;  2F4V E;  2Z5B B;  3JAM C;  4DPU A;  5A2Q C;  4DR5 E;  5LL6 R;  1B63 A;  1FWL A;  3QT6 A;  2O1V A;  1ZXM A;  2V2Z A;  4JI3 I;  1IBK E;  4DR7 I;  4LF5 E;  2IOP A;  3ZZT A;  1H72 C;  1OJ4 A;  1Y4S A;  2X36 A;  4WUC A;  4DR4 I;  4LF9 I;  3LTO A;  3WU6 A;  1MU5 A;  1VIS A;  2ZM6 E;  4YY3 E;  1XNR E;  1PIE A;  4HAC B;  4JI1 I;  1EI1 A;  4NXM E;  1FI4 A;  1EA6 A;  1Z0G A;  2AJ4 A;  5LMU I;  4DUZ I;  1N32 I;  4HXZ A;  2V2V A;  2UU9 E;  3OTO E;  4LF7 E;  2V2Q A;  4B3S E;  4JI5 E;  1N34 E;  1J5E E;  1MG7 A;  2X7I A;  1KVK A;  2V8P A;  3HJC A;  3J81 C;  2HK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...