3JAMQ

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
141
Chain Sequence
b'TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 33
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3jamQ00
2AJ4A 5LMUE 4DR6E 4JG4A 2OI2A 1XMOE 2UXDE 2HFSA 2HK3A 2GS8A 4YHHE 4DUZE 3OTOE 1DARA 5GMEA 4LF7E 2HKJA 1KVKA 4X62E 1ZM4A 1PKPA 1IBMI 4LF4I 1XNQE 2UU9I 1KKHA 2NPFA 2ZM6I 5IWAE 4JI4I 5LMNE 1H73A 3J7AM 4YY3E 3T1YE 2DEJA 4DPXA 2HK2A 1WUUA 1Z5CA 1IBKI 2VQFE 4JV5E 2X7IA 4FWHA 2E5LI 2A2DA 4ED4A 3ZKDA 1NHHA 4JI2E 1HNZI 4DV5E 4JI3E 1FKAE 1Z0EA 5BR8E 4Z7YA 1N33I 4GKJE 4DPTA 1B63A 1FNMA 4DV1E 4B3MI 4LF9E 4USMA 4OX9I 3JAMC 4LFBI 4USKA 5GMDA 2UUCI 4HACA 2V34A 5IT9Q 4WUCA 1HNXI 1MU5A 4URLA 5A2QQ 4DR4I 2Q2EB 4PU9A 3J7AG 1J5EI 3QT5A 1IBME 4JYAI 3ZKBA 4FWDA 3Q1QA 4LF4E 4JI7I 3B78A 3ZZ0A 3PYFA 2V2QA 1HR0I 1EA6A 4JI4E 1N32I 3B8HA 4DV2I 1ELOA 3J81C 1PIEA 2UUBI 3J80C 4DV3I 2DEIA 4HYMA 1NZ0A 4DR3I 1N36I 1Z59A 3V5RA 3QT7A 3WU6A 4DR2E 4AQYI 4X64I 1N33E 4Z7CA 4DU7A 4R1FA 4B3ME 1S16A 4JI5I 4JI1I 1B62A 4OX9E 4DV7I 4X66I 2UUCE 1IBLI 3LTOA 3WU5A 1HNXE 4JI0I 1HNWE 3B82A 4NXME 4DR4E 4UTGA 1J5EE 3WU4A 1Z0VA 4JYAE 1ZXMA 2F4VI 4GKKI 4JI7E 1FJGE 3ZM7A 1BKNA 4XTJA 4FW9A 5LL6R 1H72C 4DV2E 4DPYA 2UUBE 2HKEA 3CWVA 2WW4A 3ZZUA 1S4EA 4DR3E 3H4LA 2HHHI 4DR1E 4WUDA 4B3RI 4DR5I 4B3TI 4I3HA 4AQYE 2UXCE 4X64E 2LJPA 2R3VA 3PYGA 1A6FA 4JI5E 1K47A 1KTVA 5IT9C 2EFGA 4KQVA 1ZM9A 4LF6I 4DV7E 4X66E 4RPFA 1IBLE 4MYUA 4LF5I 1H74A 1QZRA 1Z0BA 2UUAI 1EI1A 4DU8A 1XMQI 4LFCI 4MYTA 1D6TA 4JI8I 5FLXQ 4GKKE 1PVGA 4DPWA 2HFUA 2V2VA 3F0NA 2UU9E 4LF8I 1N34I 2ZM6E 3QT8A 1NHIA 3T1HI 4NXNI 1KIJA 3PYEA 2HHHE 1IBKE 4B3RE 4DR5E 4B3TE 1ZM3A 4WUBA 4PRVA 2E5LE 3GONA 4LF7I 1ZM2A 2VQEI 2UXBI 2V2ZA 1HNZE 2ZITA 4LFAI 4DUYI 1MG7A 4ZVIA 3PYDA 4LF8E 5IWAI 2XEXA 2E1RA 2BV3A 4LFBE 4LF5E 4YY3I 2UUAE 4KHPI 4JV5I 1ZXNA 4LFCE 1RR9A 2ZBKB 3ZZTA 3J80Q 3V2UC 2X36A 4JI8E 4JI3I 4PRXA 1H7UA 4FWGA 3HULA 1Z0WA 2J7KA 3T1HE 1HR0E 1I94I 4NXNE 1N32E 4DPUA 4DV3E 1OJ4A 1N36E 4DXLA 4HXZA 3K17A 4JI6I 1UEKA 2VQEE 2UXBE 3D4JA 3LPSA 4FN5A 4M1KA 4DV0I 4LFAE 4DUYE 1Z0TA 4P52A 2VF3A 1XNRI 4JI1E 4X65I 4DV4I 1XHKA 1RREA 2BM1A 5A2QC 4KHPE 4K0KI 1U2RA 5FLXC 4DV6I 3K1JA 3LNUA 4JI0E 1N0UA 4DR2I 1FWKA 4B3SI 1Z5BA 2F4VE 3M6AA 2R42A 4HACB 4DR7I 1I94E 5LMUI 2BM0A 4DR6I 1Z0GA 1XMOI 2UXDI 1HNWI 4NXMI 4JI6E 3JAMQ 4YHHI 2CZ9A 4DUZI 3OTOI 4DV0E 4X62I 2A2CA 4UT4A 3WU3A 1FJGI 1H7SA 1Z5AA 1XNRE 1MX0A 1XNQI 1NHJA 5L3JA 4X65E 4DV4E 4LF6E 1VISA 4K0KE 4P7AA 4LF9I 5LMNI 2V8PA 4DV6E 4DR1I 3T1YI 1FI4A 1Z0CA 3QT6A 2VQFI 1XMQE 4HY1A 2UXCI 3J81Q 1FWLA 4B3SE 4JI2I 4DV5I 4EMDA 5BR8I 1N0VC 4GKJI 4DR7E 4DV1I 1N34E
chains in the Genus database with same CATH superfamily
5DROA 2AJ4A 2WNRB 5LMUE 4DR6E 4JG4A 3Q6MA 2BR2B 2OI2A 1XMOE 2UXDE 2HFSA 2HK3A 2GS8A 3GLLA 2PO2B 4YHHE 2O3ZA 4LCGA 4DUZE 3OTOE 1DARA 5GMEA 4BA1B 2O1VA 3L7ZA 2HKJA 4LF7E 1KVKA 4X62E 1ZM4A 1VI7A 1PKPA 1IBMI 2GO4A 4IZKB 4LF4I 1XNQE 2UU9I 1KKHA 3KRNA 2NPFA 2ZM6I 3GCMA 5IWAE 4JI4I 2CGEA 5LMNE 1H73A 3B4TA 4QNKA 3J7AM 3CDJA 4YY3E 3T1YE 2DEJA 4DPXA 2HK2A 1WUUA 1Z5CA 1IBKI 2VQFE 2JT2A 3U1YA 2PNMA 4JV5E 2X7IA 4FWHA 2E5LI 2A2DA 4ED4A 2C39B 4FW3A 3ZKDA 1NHHA 4JI2E 4MU1A 1HNZI 2GO3A 4DV5E 4JI3E 2Z5CB 1FKAE 2CG9A 5DNXA 4J3DA 1Z0EA 5C0XF 5BR8E 4Z7YA 1N33I 4GKJE 4DPTA 1B63A 1FNMA 3HKMA 4DV1E 4B3MI 4LF9E 4USMA 2JEAB 5FWKA 4OX9I 3Q6NA 3JAMC 4LFBI 4USKA 5GMDA 2UUCI 4FW7A 2BA0G 4HACA 2V34A 5IT9Q 4WUCA 1E3PA 4BA2A 1Y60A 1HNXI 1MU5A 4URLA 5JEAB 5A2QQ 4DR4I 2Q2EB 2PO0A 4PU9A 3J7AG 2JEBB 5DNLA 1J5EI 3QT5A 2IERA 1IBME 4JYAI 3ZKBA 4FWDA 3Q1QA 2Z5BB 4LF4E 1R6MA 4JI7I 2O1UA 3B78A 3ZZ0A 3PYFA 1OYPA 1R6LA 2V2QA 1HR0I 1EA6A 4JI4E 1N32I 2O1WA 3B8HA 5K36A 4DV2I 1ELOA 3P76A 1YH8A 3J81C 1PIEA 2PNZB 2UUBI 2CVEA 3J80C 4DV3I 2DEIA 4HYMA 1NZ0A 4DR3I 1P42A 1N36I 5JEAF 1Z59A 4U3DA 3QT7A 3V5RA 3DD6A 4AIDA 5JEAE 2JE6A 3WU6A 4DR2E 4AQYI 4X64I 3PRYA 1N33E 2VESA 4Z7CA 4DU7A 4R1FA 4B3ME 1S16A 4JI5I 4JI1I 1B62A 4OZEA 2NN6F 4OX9E 2C38B 3GMEA 3HJCA 4DV7I 4X66I 2UUCE 4OKGA 3CDIA 1IBLI 3LTOA 1XXEA 2WNRA 3WU5A 1HNXE 4JI0I 2BA0D 2PO1B 1HNWE 3B82A 2BR2A 4NXME 4DR4E 4IZJB 4OO1F 1E3HA 4UTGA 1J5EE 3WU4A 1OYRA 1Z0VA 5ELWA 4JYAE 1ZXMA 2PO2A 2F4VI 4GKKI 2IOPA 4IFDF 4JI7E 4BA1A 1FJGE 3ZM7A 4MQYA 1BKNA 4XTJA 5C0XB 4FW9A 5LL6R 1H72C 1RHYA 4DV2E 4DPYA 2UUBE 2HKEA 4IZKA 3CWVA 2C37B 2PNLA 2WW4A 3ZZUA 1S4EA 4U3BA 1Y6ZA 4DR3E 3H4LA 3P3GA 3P06A 2HHHI 4DR1E 4WUDA 4B3RI 4DR5I 4N3OA 2F1DA 4I3HA 4B3TI 4AQYE 2UXCE 4X64E 2LJPA 1Y4SA 4MDTA 2R3VA 4AM3A 3PYGA 2C39A 1A6FA 4JI5E 1K47A 1KTVA 5IT9C 2EFGA 2Z5CA 4LPFA 5C0XE 4KQVA 1ZM9A 4LF6I 4DV7E 4X66E 4RPFA 4NBQA 1IBLE 4MYUA 4LF5I 2JEAA 1H74A 1QZRA 1Z0BA 2UUAI 1EI1A 4DU8A 4MU0A 1XMQI 4LFCI 4MYTA 4IS9A 1D6TA 3M7NG 4JI8I 5FLXQ 4GKKE 5JEAA 1UDSA 2WP8B 1PVGA 4MU3A 4DPWA 2HFUA 2JEBA 2V2VA 3F0NA 2UU9E 4LF8I 3PS3A 1N34I 2ZM6E 2Z5BA 3QT8A 1NHIA 3T1HI 2NN6B 4NXNI 1KIJA 3PYEA 2HHHE 1IBKE 5K36D 2IOQA 4B3RE 4DR5E 4B3TE 1ZM3A 2PNZA 4WUBA 4PRVA 2E5LE 3GONA 4LF7I 1ZM2A 2VQEI 2UXBI 4OO1B 2V2ZA 4FW5A 1HNZE 2ZITA 4MU4A 5K36C 4QNJA 4LFAI 4DUYI 4IFDB 1MG7A 1Y5YA 4ZVIA 3PYDA 4LF8E 5IWAI 2XEXA 2E1RA 2BV3A 4LFBE 1USUA 4LF5E 1UDOA 4YY3I 2NN6E 2UUAE 4KHPI 3P3EA 2C38A 4JV5I 1ZXNA 4LFCE 1RR9A 2ZBKB 3ZZTA 3J80Q 3V2UC 2X36A 3U1KA 4JI8E 2PO1A 3M85G 4JI3I 4GQUA 4OO1E 3K85A 4IZJA 1HK7A 3M7ND 4PRXA 4IZJD 2Z5EA 1H7UA 4FWGA 3HULA 4AIMA 4IFDE 1Z0WA 2J7KA 3T1HE 1HR0E 1I94I 2J65A 4NXNE 1N32E 5C0XA 4DPUA 4DV3E 4FW4A 1OJ4A 5C0XD 3L7ZB 2C37A 1N36E 2O1TA 4DXLA 4HXZA 3K17A 4JI6I 1UEKA 3UHMA 2VQEE 2UXBE 3H1CA 3D4JA 3LPSA 4FN5A 4FW6A 4M1KA 4DV0I 5C0XC 4LFAE 4DUYE 1Z0TA 4P52A 1USVA 2VF3A 5DRRA 1XNRI 4JI1E 4X65I 4DV4I 1XHKA 1RREA 3PS2A 2BM1A 5A2QC 4KHPE 4K0KI 1U2RA 5FLXC 4DV6I 4LCFA 3K1JA 3LNUA 4JI0E 4LCHA 1UDNA 1N0UA 2AE8A 4DR2I 1FWKA 4ISAA 4B3SI 3M85D 1Z5BA 2F4VE 3M6AA 2BA1D 2R42A 2WP8A 4HACB 5JEAD 4DR7I 1I94E 3P3CA 4LOMA 4BA2B 2IESA 1UDQA 5LMUI 1OYSA 2BM0A 3NZKA 4DR6I 1Z0GA 1XMOI 2UXDI 2PO0B 1HNWI 2NN6A 4NXMI 4JI6E 5JEAC 5EKWA 3JAMQ 4YHHI 3PS1A 2CZ9A 2NN6D 4DUZI 3OTOI 4DV0E 1Y4UA 4X62I 2A2CA 4UT4A 5K36B 3WU3A 2GQ0A 5EL9A 1FJGI 4OO1A 1H7SA 1Z5AA 1XNRE 1MX0A 1XNQI 1NHJA 5L3JA 4X65E 4DV4E 2NN6C 4OO1D 4LF6E 1VISA 5DRPA 4K0KE 1YHCA 4P7AA 4LF9I 4IFDA 5LMNI 2V8PA 4DV6E 5DRQA 2JE6B 4DR1I 3T1YI 4IFDD 1FI4A 1Z0CA 3QT6A 2VQFI 1XMQE 4OO1C 4HY1A 2UXCI 3J81Q 1FWLA 4B3SE 4JI2I 4DV5I 4EMDA 5K36F 4IFDC 2BA1G 5BR8I 5K36E 1N0VC 4GKJI 4DR7E 4DV1I 1N34E
chains in the Genus database with same CATH topology
2AJ4A 5LMUE 4DR6E 4JG4A 3Q6MA 2OI2A 1XMOE 2UXDE 2HFSA 2HK3A 2GS8A 4YHHE 4DUZE 3OTOE 1DARA 5GMEA 2O1VA 4LF7E 2HKJA 1KVKA 4X62E 1ZM4A 1PKPA 1IBMI 4IZKB 4LF4I 1XNQE 2UU9I 1KKHA 2NPFA 2ZM6I 5IWAE 4JI4I 2CGEA 5LMNE 1H73A 3J7AM 4YY3E 3T1YE 2DEJA 4DPXA 2HK2A 1WUUA 1Z5CA 1IBKI 2VQFE 2PNMA 4JV5E 2X7IA 4FWHA 2E5LI 2A2DA 4ED4A 3ZKDA 1NHHA 4JI2E 1HNZI 4DV5E 4JI3E 2Z5CB 1FKAE 2CG9A 1Z0EA 5BR8E 4Z7YA 1N33I 4GKJE 4DPTA 1B63A 1FNMA 4DV1E 4B3MI 4LF9E 4USMA 5FWKA 4OX9I 3Q6NA 3JAMC 4LFBI 4USKA 5GMDA 2UUCI 4HACA 2V34A 5IT9Q 4WUCA 1HNXI 1MU5A 4URLA 5A2QQ 4DR4I 2Q2EB 4PU9A 3J7AG 1J5EI 3QT5A 1IBME 4JYAI 3ZKBA 4FWDA 3Q1QA 2Z5BB 4LF4E 4JI7I 2O1UA 3B78A 3ZZ0A 3PYFA 2V2QA 1HR0I 1EA6A 4JI4E 1N32I 2O1WA 3B8HA 4DV2I 1ELOA 3J81C 1PIEA 2UUBI 3J80C 4DV3I 2DEIA 4HYMA 1NZ0A 4DR3I 1N36I 1Z59A 3V5RA 3QT7A 3WU6A 4DR2E 4AQYI 4X64I 3PRYA 1N33E 4Z7CA 4DU7A 4R1FA 4B3ME 1S16A 4JI5I 4JI1I 1B62A 4OX9E 3HJCA 4DV7I 4X66I 2UUCE 1IBLI 3LTOA 3WU5A 1HNXE 4JI0I 1HNWE 3B82A 4NXME 4DR4E 4IZJB 4UTGA 1J5EE 3WU4A 1Z0VA 4JYAE 1ZXMA 2F4VI 4GKKI 2IOPA 4JI7E 1FJGE 3ZM7A 1BKNA 4XTJA 4FW9A 5LL6R 1H72C 4DV2E 4DPYA 2UUBE 2HKEA 4IZKA 3CWVA 2PNLA 2WW4A 3ZZUA 1S4EA 1Y6ZA 4DR3E 3H4LA 3P06A 2HHHI 4DR1E 4WUDA 4B3RI 4DR5I 4N3OA 4B3TI 4I3HA 4AQYE 2UXCE 4X64E 2LJPA 1Y4SA 2R3VA 3PYGA 1A6FA 4JI5E 1K47A 1KTVA 5IT9C 2EFGA 2Z5CA 4KQVA 1ZM9A 4LF6I 4DV7E 4X66E 4RPFA 1IBLE 4MYUA 4LF5I 1H74A 1QZRA 1Z0BA 2UUAI 1EI1A 4DU8A 1XMQI 4LFCI 4MYTA 1D6TA 4JI8I 5FLXQ 4GKKE 1PVGA 4DPWA 2HFUA 2V2VA 3F0NA 2UU9E 4LF8I 1N34I 2ZM6E 2Z5BA 3QT8A 1NHIA 3T1HI 4NXNI 1KIJA 3PYEA 2HHHE 1IBKE 2IOQA 4B3RE 4DR5E 4B3TE 1ZM3A 4WUBA 4PRVA 2E5LE 3GONA 4LF7I 1ZM2A 2VQEI 2UXBI 2V2ZA 1HNZE 2ZITA 4LFAI 4DUYI 1MG7A 4ZVIA 3PYDA 4LF8E 5IWAI 2XEXA 2E1RA 2BV3A 4LFBE 1USUA 4LF5E 4YY3I 2UUAE 4KHPI 4JV5I 1ZXNA 4LFCE 1RR9A 2ZBKB 3ZZTA 3J80Q 3V2UC 2X36A 4JI8E 4JI3I 3K85A 4IZJA 1HK7A 4PRXA 4IZJD 2Z5EA 1H7UA 4FWGA 3HULA 1Z0WA 2J7KA 3T1HE 1HR0E 1I94I 4NXNE 1N32E 4DPUA 4DV3E 1OJ4A 1N36E 2O1TA 4DXLA 4HXZA 3K17A 4JI6I 1UEKA 2VQEE 2UXBE 3D4JA 3LPSA 4FN5A 4M1KA 4DV0I 4LFAE 4DUYE 1Z0TA 4P52A 1USVA 2VF3A 1XNRI 4JI1E 4X65I 4DV4I 1XHKA 1RREA 2BM1A 5A2QC 4KHPE 4K0KI 1U2RA 5FLXC 4DV6I 3K1JA 3LNUA 4JI0E 1N0UA 4DR2I 1FWKA 4B3SI 1Z5BA 2F4VE 3M6AA 2R42A 4HACB 4DR7I 1I94E 5LMUI 2BM0A 4DR6I 1Z0GA 1XMOI 2UXDI 1HNWI 4NXMI 4JI6E 3JAMQ 4YHHI 2CZ9A 4DUZI 3OTOI 4DV0E 1Y4UA 4X62I 2A2CA 4UT4A 3WU3A 2GQ0A 1FJGI 1H7SA 1Z5AA 1XNRE 1MX0A 1XNQI 1NHJA 5L3JA 4X65E 4DV4E 4LF6E 1VISA 4K0KE 4P7AA 4LF9I 5LMNI 2V8PA 4DV6E 4DR1I 3T1YI 1FI4A 1Z0CA 3QT6A 2VQFI 1XMQE 4HY1A 2UXCI 3J81Q 1FWLA 4B3SE 4JI2I 4DV5I 4EMDA 5BR8I 1N0VC 4GKJI 4DR7E 4DV1I 1N34E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AJ4 A;  5LMU E;  4DR6 E;  4JG4 A;  2OI2 A;  1XMO E;  2UXD E;  2HFS A;  2HK3 A;  2GS8 A;  4YHH E;  4DUZ E;  3OTO E;  1DAR A;  5GME A;  4LF7 E;  2HKJ A;  1KVK A;  4X62 E;  1ZM4 A;  1PKP A;  1IBM I;  4LF4 I;  1XNQ E;  2UU9 I;  1KKH A;  2NPF A;  2ZM6 I;  5IWA E;  4JI4 I;  5LMN E;  1H73 A;  3J7A M;  4YY3 E;  3T1Y E;  2DEJ A;  4DPX A;  2HK2 A;  1WUU A;  1Z5C A;  1IBK I;  2VQF E;  4JV5 E;  2X7I A;  4FWH A;  2E5L I;  2A2D A;  4ED4 A;  3ZKD A;  1NHH A;  4JI2 E;  1HNZ I;  4DV5 E;  4JI3 E;  1FKA E;  1Z0E A;  5BR8 E;  4Z7Y A;  1N33 I;  4GKJ E;  4DPT A;  1B63 A;  1FNM A;  4DV1 E;  4B3M I;  4LF9 E;  4USM A;  4OX9 I;  3JAM C;  4LFB I;  4USK A;  5GMD A;  2UUC I;  4HAC A;  2V34 A;  5IT9 Q;  4WUC A;  1HNX I;  1MU5 A;  4URL A;  5A2Q Q;  4DR4 I;  2Q2E B;  4PU9 A;  3J7A G;  1J5E I;  3QT5 A;  1IBM E;  4JYA I;  3ZKB A;  4FWD A;  3Q1Q A;  4LF4 E;  4JI7 I;  3B78 A;  3ZZ0 A;  3PYF A;  2V2Q A;  1HR0 I;  1EA6 A;  4JI4 E;  1N32 I;  3B8H A;  4DV2 I;  1ELO A;  3J81 C;  1PIE A;  2UUB I;  3J80 C;  4DV3 I;  2DEI A;  4HYM A;  1NZ0 A;  4DR3 I;  1N36 I;  1Z59 A;  3V5R A;  3QT7 A;  3WU6 A;  4DR2 E;  4AQY I;  4X64 I;  1N33 E;  4Z7C A;  4DU7 A;  4R1F A;  4B3M E;  1S16 A;  4JI5 I;  4JI1 I;  1B62 A;  4OX9 E;  4DV7 I;  4X66 I;  2UUC E;  1IBL I;  3LTO A;  3WU5 A;  1HNX E;  4JI0 I;  1HNW E;  3B82 A;  4NXM E;  4DR4 E;  4UTG A;  1J5E E;  3WU4 A;  1Z0V A;  4JYA E;  1ZXM A;  2F4V I;  4GKK I;  4JI7 E;  1FJG E;  3ZM7 A;  1BKN A;  4XTJ A;  4FW9 A;  5LL6 R;  1H72 C;  4DV2 E;  4DPY A;  2UUB E;  2HKE A;  3CWV A;  2WW4 A;  3ZZU A;  1S4E A;  4DR3 E;  3H4L A;  2HHH I;  4DR1 E;  4WUD A;  4B3R I;  4DR5 I;  4B3T I;  4I3H A;  4AQY E;  2UXC E;  4X64 E;  2LJP A;  2R3V A;  3PYG A;  1A6F A;  4JI5 E;  1K47 A;  1KTV A;  5IT9 C;  2EFG A;  4KQV A;  1ZM9 A;  4LF6 I;  4DV7 E;  4X66 E;  4RPF A;  1IBL E;  4MYU A;  4LF5 I;  1H74 A;  1QZR A;  1Z0B A;  2UUA I;  1EI1 A;  4DU8 A;  1XMQ I;  4LFC I;  4MYT A;  1D6T A;  4JI8 I;  5FLX Q;  4GKK E;  1PVG A;  4DPW A;  2HFU A;  2V2V A;  3F0N A;  2UU9 E;  4LF8 I;  1N34 I;  2ZM6 E;  3QT8 A;  1NHI A;  3T1H I;  4NXN I;  1KIJ A;  3PYE A;  2HHH E;  1IBK E;  4B3R E;  4DR5 E;  4B3T E;  1ZM3 A;  4WUB A;  4PRV A;  2E5L E;  3GON A;  4LF7 I;  1ZM2 A;  2VQE I;  2UXB I;  2V2Z A;  1HNZ E;  2ZIT A;  4LFA I;  4DUY I;  1MG7 A;  4ZVI A;  3PYD A;  4LF8 E;  5IWA I;  2XEX A;  2E1R A;  2BV3 A;  4LFB E;  4LF5 E;  4YY3 I;  2UUA E;  4KHP I;  4JV5 I;  1ZXN A;  4LFC E;  1RR9 A;  2ZBK B;  3ZZT A;  3J80 Q;  3V2U C;  2X36 A;  4JI8 E;  4JI3 I;  4PRX A;  1H7U A;  4FWG A;  3HUL A;  1Z0W A;  2J7K A;  3T1H E;  1HR0 E;  1I94 I;  4NXN E;  1N32 E;  4DPU A;  4DV3 E;  1OJ4 A;  1N36 E;  4DXL A;  4HXZ A;  3K17 A;  4JI6 I;  1UEK A;  2VQE E;  2UXB E;  3D4J A;  3LPS A;  4FN5 A;  4M1K A;  4DV0 I;  4LFA E;  4DUY E;  1Z0T A;  4P52 A;  2VF3 A;  1XNR I;  4JI1 E;  4X65 I;  4DV4 I;  1XHK A;  1RRE A;  2BM1 A;  5A2Q C;  4KHP E;  4K0K I;  1U2R A;  5FLX C;  4DV6 I;  3K1J A;  3LNU A;  4JI0 E;  1N0U A;  4DR2 I;  1FWK A;  4B3S I;  1Z5B A;  2F4V E;  3M6A A;  2R42 A;  4HAC B;  4DR7 I;  1I94 E;  5LMU I;  2BM0 A;  4DR6 I;  1Z0G A;  1XMO I;  2UXD I;  1HNW I;  4NXM I;  4JI6 E;  3JAM Q;  4YHH I;  2CZ9 A;  4DUZ I;  3OTO I;  4DV0 E;  4X62 I;  2A2C A;  4UT4 A;  3WU3 A;  1FJG I;  1H7S A;  1Z5A A;  1XNR E;  1MX0 A;  1XNQ I;  1NHJ A;  5L3J A;  4X65 E;  4DV4 E;  4LF6 E;  1VIS A;  4K0K E;  4P7A A;  4LF9 I;  5LMN I;  2V8P A;  4DV6 E;  4DR1 I;  3T1Y I;  1FI4 A;  1Z0C A;  3QT6 A;  2VQF I;  1XMQ E;  4HY1 A;  2UXC I;  3J81 Q;  1FWL A;  4B3S E;  4JI2 I;  4DV5 I;  4EMD A;  5BR8 I;  1N0V C;  4GKJ I;  4DR7 E;  4DV1 I;  1N34 E; 
#chains in the Genus database with same CATH topology
 5DRO A;  2AJ4 A;  2WNR B;  5LMU E;  4DR6 E;  4JG4 A;  3Q6M A;  2BR2 B;  2OI2 A;  1XMO E;  2UXD E;  2HFS A;  2HK3 A;  2GS8 A;  3GLL A;  2PO2 B;  4YHH E;  2O3Z A;  4LCG A;  4DUZ E;  3OTO E;  1DAR A;  5GME A;  4BA1 B;  2O1V A;  3L7Z A;  2HKJ A;  4LF7 E;  1KVK A;  4X62 E;  1ZM4 A;  1VI7 A;  1PKP A;  1IBM I;  2GO4 A;  4IZK B;  4LF4 I;  1XNQ E;  2UU9 I;  1KKH A;  3KRN A;  2NPF A;  2ZM6 I;  3GCM A;  5IWA E;  4JI4 I;  2CGE A;  5LMN E;  1H73 A;  3B4T A;  4QNK A;  3J7A M;  3CDJ A;  4YY3 E;  3T1Y E;  2DEJ A;  4DPX A;  2HK2 A;  1WUU A;  1Z5C A;  1IBK I;  2VQF E;  2JT2 A;  3U1Y A;  2PNM A;  4JV5 E;  2X7I A;  4FWH A;  2E5L I;  2A2D A;  4ED4 A;  2C39 B;  4FW3 A;  3ZKD A;  1NHH A;  4JI2 E;  4MU1 A;  1HNZ I;  2GO3 A;  4DV5 E;  4JI3 E;  2Z5C B;  1FKA E;  2CG9 A;  5DNX A;  4J3D A;  1Z0E A;  5C0X F;  5BR8 E;  4Z7Y A;  1N33 I;  4GKJ E;  4DPT A;  1B63 A;  1FNM A;  3HKM A;  4DV1 E;  4B3M I;  4LF9 E;  4USM A;  2JEA B;  5FWK A;  4OX9 I;  3Q6N A;  3JAM C;  4LFB I;  4USK A;  5GMD A;  2UUC I;  4FW7 A;  2BA0 G;  4HAC A;  2V34 A;  5IT9 Q;  4WUC A;  1E3P A;  4BA2 A;  1Y60 A;  1HNX I;  1MU5 A;  4URL A;  5JEA B;  5A2Q Q;  4DR4 I;  2Q2E B;  2PO0 A;  4PU9 A;  3J7A G;  2JEB B;  5DNL A;  1J5E I;  3QT5 A;  2IER A;  1IBM E;  4JYA I;  3ZKB A;  4FWD A;  3Q1Q A;  2Z5B B;  4LF4 E;  1R6M A;  4JI7 I;  2O1U A;  3B78 A;  3ZZ0 A;  3PYF A;  1OYP A;  1R6L A;  2V2Q A;  1HR0 I;  1EA6 A;  4JI4 E;  1N32 I;  2O1W A;  3B8H A;  5K36 A;  4DV2 I;  1ELO A;  3P76 A;  1YH8 A;  3J81 C;  1PIE A;  2PNZ B;  2UUB I;  2CVE A;  3J80 C;  4DV3 I;  2DEI A;  4HYM A;  1NZ0 A;  4DR3 I;  1P42 A;  1N36 I;  5JEA F;  1Z59 A;  4U3D A;  3QT7 A;  3V5R A;  3DD6 A;  4AID A;  5JEA E;  2JE6 A;  3WU6 A;  4DR2 E;  4AQY I;  4X64 I;  3PRY A;  1N33 E;  2VES A;  4Z7C A;  4DU7 A;  4R1F A;  4B3M E;  1S16 A;  4JI5 I;  4JI1 I;  1B62 A;  4OZE A;  2NN6 F;  4OX9 E;  2C38 B;  3GME A;  3HJC A;  4DV7 I;  4X66 I;  2UUC E;  4OKG A;  3CDI A;  1IBL I;  3LTO A;  1XXE A;  2WNR A;  3WU5 A;  1HNX E;  4JI0 I;  2BA0 D;  2PO1 B;  1HNW E;  3B82 A;  2BR2 A;  4NXM E;  4DR4 E;  4IZJ B;  4OO1 F;  1E3H A;  4UTG A;  1J5E E;  3WU4 A;  1OYR A;  1Z0V A;  5ELW A;  4JYA E;  1ZXM A;  2PO2 A;  2F4V I;  4GKK I;  2IOP A;  4IFD F;  4JI7 E;  4BA1 A;  1FJG E;  3ZM7 A;  4MQY A;  1BKN A;  4XTJ A;  5C0X B;  4FW9 A;  5LL6 R;  1H72 C;  1RHY A;  4DV2 E;  4DPY A;  2UUB E;  2HKE A;  4IZK A;  3CWV A;  2C37 B;  2PNL A;  2WW4 A;  3ZZU A;  1S4E A;  4U3B A;  1Y6Z A;  4DR3 E;  3H4L A;  3P3G A;  3P06 A;  2HHH I;  4DR1 E;  4WUD A;  4B3R I;  4DR5 I;  4N3O A;  2F1D A;  4I3H A;  4B3T I;  4AQY E;  2UXC E;  4X64 E;  2LJP A;  1Y4S A;  4MDT A;  2R3V A;  4AM3 A;  3PYG A;  2C39 A;  1A6F A;  4JI5 E;  1K47 A;  1KTV A;  5IT9 C;  2EFG A;  2Z5C A;  4LPF A;  5C0X E;  4KQV A;  1ZM9 A;  4LF6 I;  4DV7 E;  4X66 E;  4RPF A;  4NBQ A;  1IBL E;  4MYU A;  4LF5 I;  2JEA A;  1H74 A;  1QZR A;  1Z0B A;  2UUA I;  1EI1 A;  4DU8 A;  4MU0 A;  1XMQ I;  4LFC I;  4MYT A;  4IS9 A;  1D6T A;  3M7N G;  4JI8 I;  5FLX Q;  4GKK E;  5JEA A;  1UDS A;  2WP8 B;  1PVG A;  4MU3 A;  4DPW A;  2HFU A;  2JEB A;  2V2V A;  3F0N A;  2UU9 E;  4LF8 I;  3PS3 A;  1N34 I;  2ZM6 E;  2Z5B A;  3QT8 A;  1NHI A;  3T1H I;  2NN6 B;  4NXN I;  1KIJ A;  3PYE A;  2HHH E;  1IBK E;  5K36 D;  2IOQ A;  4B3R E;  4DR5 E;  4B3T E;  1ZM3 A;  2PNZ A;  4WUB A;  4PRV A;  2E5L E;  3GON A;  4LF7 I;  1ZM2 A;  2VQE I;  2UXB I;  4OO1 B;  2V2Z A;  4FW5 A;  1HNZ E;  2ZIT A;  4MU4 A;  5K36 C;  4QNJ A;  4LFA I;  4DUY I;  4IFD B;  1MG7 A;  1Y5Y A;  4ZVI A;  3PYD A;  4LF8 E;  5IWA I;  2XEX A;  2E1R A;  2BV3 A;  4LFB E;  1USU A;  4LF5 E;  1UDO A;  4YY3 I;  2NN6 E;  2UUA E;  4KHP I;  3P3E A;  2C38 A;  4JV5 I;  1ZXN A;  4LFC E;  1RR9 A;  2ZBK B;  3ZZT A;  3J80 Q;  3V2U C;  2X36 A;  3U1K A;  4JI8 E;  2PO1 A;  3M85 G;  4JI3 I;  4GQU A;  4OO1 E;  3K85 A;  4IZJ A;  1HK7 A;  3M7N D;  4PRX A;  4IZJ D;  2Z5E A;  1H7U A;  4FWG A;  3HUL A;  4AIM A;  4IFD E;  1Z0W A;  2J7K A;  3T1H E;  1HR0 E;  1I94 I;  2J65 A;  4NXN E;  1N32 E;  5C0X A;  4DPU A;  4DV3 E;  4FW4 A;  1OJ4 A;  5C0X D;  3L7Z B;  2C37 A;  1N36 E;  2O1T A;  4DXL A;  4HXZ A;  3K17 A;  4JI6 I;  1UEK A;  3UHM A;  2VQE E;  2UXB E;  3H1C A;  3D4J A;  3LPS A;  4FN5 A;  4FW6 A;  4M1K A;  4DV0 I;  5C0X C;  4LFA E;  4DUY E;  1Z0T A;  4P52 A;  1USV A;  2VF3 A;  5DRR A;  1XNR I;  4JI1 E;  4X65 I;  4DV4 I;  1XHK A;  1RRE A;  3PS2 A;  2BM1 A;  5A2Q C;  4KHP E;  4K0K I;  1U2R A;  5FLX C;  4DV6 I;  4LCF A;  3K1J A;  3LNU A;  4JI0 E;  4LCH A;  1UDN A;  1N0U A;  2AE8 A;  4DR2 I;  1FWK A;  4ISA A;  4B3S I;  3M85 D;  1Z5B A;  2F4V E;  3M6A A;  2BA1 D;  2R42 A;  2WP8 A;  4HAC B;  5JEA D;  4DR7 I;  1I94 E;  3P3C A;  4LOM A;  4BA2 B;  2IES A;  1UDQ A;  5LMU I;  1OYS A;  2BM0 A;  3NZK A;  4DR6 I;  1Z0G A;  1XMO I;  2UXD I;  2PO0 B;  1HNW I;  2NN6 A;  4NXM I;  4JI6 E;  5JEA C;  5EKW A;  3JAM Q;  4YHH I;  3PS1 A;  2CZ9 A;  2NN6 D;  4DUZ I;  3OTO I;  4DV0 E;  1Y4U A;  4X62 I;  2A2C A;  4UT4 A;  5K36 B;  3WU3 A;  2GQ0 A;  5EL9 A;  1FJG I;  4OO1 A;  1H7S A;  1Z5A A;  1XNR E;  1MX0 A;  1XNQ I;  1NHJ A;  5L3J A;  4X65 E;  4DV4 E;  2NN6 C;  4OO1 D;  4LF6 E;  1VIS A;  5DRP A;  4K0K E;  1YHC A;  4P7A A;  4LF9 I;  4IFD A;  5LMN I;  2V8P A;  4DV6 E;  5DRQ A;  2JE6 B;  4DR1 I;  3T1Y I;  4IFD D;  1FI4 A;  1Z0C A;  3QT6 A;  2VQF I;  1XMQ E;  4OO1 C;  4HY1 A;  2UXC I;  3J81 Q;  1FWL A;  4B3S E;  4JI2 I;  4DV5 I;  4EMD A;  5K36 F;  4IFD C;  2BA1 G;  5BR8 I;  5K36 E;  1N0V C;  4GKJ I;  4DR7 E;  4DV1 I;  1N34 E; 
#chains in the Genus database with same CATH homology
 2AJ4 A;  5LMU E;  4DR6 E;  4JG4 A;  3Q6M A;  2OI2 A;  1XMO E;  2UXD E;  2HFS A;  2HK3 A;  2GS8 A;  4YHH E;  4DUZ E;  3OTO E;  1DAR A;  5GME A;  2O1V A;  4LF7 E;  2HKJ A;  1KVK A;  4X62 E;  1ZM4 A;  1PKP A;  1IBM I;  4IZK B;  4LF4 I;  1XNQ E;  2UU9 I;  1KKH A;  2NPF A;  2ZM6 I;  5IWA E;  4JI4 I;  2CGE A;  5LMN E;  1H73 A;  3J7A M;  4YY3 E;  3T1Y E;  2DEJ A;  4DPX A;  2HK2 A;  1WUU A;  1Z5C A;  1IBK I;  2VQF E;  2PNM A;  4JV5 E;  2X7I A;  4FWH A;  2E5L I;  2A2D A;  4ED4 A;  3ZKD A;  1NHH A;  4JI2 E;  1HNZ I;  4DV5 E;  4JI3 E;  2Z5C B;  1FKA E;  2CG9 A;  1Z0E A;  5BR8 E;  4Z7Y A;  1N33 I;  4GKJ E;  4DPT A;  1B63 A;  1FNM A;  4DV1 E;  4B3M I;  4LF9 E;  4USM A;  5FWK A;  4OX9 I;  3Q6N A;  3JAM C;  4LFB I;  4USK A;  5GMD A;  2UUC I;  4HAC A;  2V34 A;  5IT9 Q;  4WUC A;  1HNX I;  1MU5 A;  4URL A;  5A2Q Q;  4DR4 I;  2Q2E B;  4PU9 A;  3J7A G;  1J5E I;  3QT5 A;  1IBM E;  4JYA I;  3ZKB A;  4FWD A;  3Q1Q A;  2Z5B B;  4LF4 E;  4JI7 I;  2O1U A;  3B78 A;  3ZZ0 A;  3PYF A;  2V2Q A;  1HR0 I;  1EA6 A;  4JI4 E;  1N32 I;  2O1W A;  3B8H A;  4DV2 I;  1ELO A;  3J81 C;  1PIE A;  2UUB I;  3J80 C;  4DV3 I;  2DEI A;  4HYM A;  1NZ0 A;  4DR3 I;  1N36 I;  1Z59 A;  3V5R A;  3QT7 A;  3WU6 A;  4DR2 E;  4AQY I;  4X64 I;  3PRY A;  1N33 E;  4Z7C A;  4DU7 A;  4R1F A;  4B3M E;  1S16 A;  4JI5 I;  4JI1 I;  1B62 A;  4OX9 E;  3HJC A;  4DV7 I;  4X66 I;  2UUC E;  1IBL I;  3LTO A;  3WU5 A;  1HNX E;  4JI0 I;  1HNW E;  3B82 A;  4NXM E;  4DR4 E;  4IZJ B;  4UTG A;  1J5E E;  3WU4 A;  1Z0V A;  4JYA E;  1ZXM A;  2F4V I;  4GKK I;  2IOP A;  4JI7 E;  1FJG E;  3ZM7 A;  1BKN A;  4XTJ A;  4FW9 A;  5LL6 R;  1H72 C;  4DV2 E;  4DPY A;  2UUB E;  2HKE A;  4IZK A;  3CWV A;  2PNL A;  2WW4 A;  3ZZU A;  1S4E A;  1Y6Z A;  4DR3 E;  3H4L A;  3P06 A;  2HHH I;  4DR1 E;  4WUD A;  4B3R I;  4DR5 I;  4N3O A;  4B3T I;  4I3H A;  4AQY E;  2UXC E;  4X64 E;  2LJP A;  1Y4S A;  2R3V A;  3PYG A;  1A6F A;  4JI5 E;  1K47 A;  1KTV A;  5IT9 C;  2EFG A;  2Z5C A;  4KQV A;  1ZM9 A;  4LF6 I;  4DV7 E;  4X66 E;  4RPF A;  1IBL E;  4MYU A;  4LF5 I;  1H74 A;  1QZR A;  1Z0B A;  2UUA I;  1EI1 A;  4DU8 A;  1XMQ I;  4LFC I;  4MYT A;  1D6T A;  4JI8 I;  5FLX Q;  4GKK E;  1PVG A;  4DPW A;  2HFU A;  2V2V A;  3F0N A;  2UU9 E;  4LF8 I;  1N34 I;  2ZM6 E;  2Z5B A;  3QT8 A;  1NHI A;  3T1H I;  4NXN I;  1KIJ A;  3PYE A;  2HHH E;  1IBK E;  2IOQ A;  4B3R E;  4DR5 E;  4B3T E;  1ZM3 A;  4WUB A;  4PRV A;  2E5L E;  3GON A;  4LF7 I;  1ZM2 A;  2VQE I;  2UXB I;  2V2Z A;  1HNZ E;  2ZIT A;  4LFA I;  4DUY I;  1MG7 A;  4ZVI A;  3PYD A;  4LF8 E;  5IWA I;  2XEX A;  2E1R A;  2BV3 A;  4LFB E;  1USU A;  4LF5 E;  4YY3 I;  2UUA E;  4KHP I;  4JV5 I;  1ZXN A;  4LFC E;  1RR9 A;  2ZBK B;  3ZZT A;  3J80 Q;  3V2U C;  2X36 A;  4JI8 E;  4JI3 I;  3K85 A;  4IZJ A;  1HK7 A;  4PRX A;  4IZJ D;  2Z5E A;  1H7U A;  4FWG A;  3HUL A;  1Z0W A;  2J7K A;  3T1H E;  1HR0 E;  1I94 I;  4NXN E;  1N32 E;  4DPU A;  4DV3 E;  1OJ4 A;  1N36 E;  2O1T A;  4DXL A;  4HXZ A;  3K17 A;  4JI6 I;  1UEK A;  2VQE E;  2UXB E;  3D4J A;  3LPS A;  4FN5 A;  4M1K A;  4DV0 I;  4LFA E;  4DUY E;  1Z0T A;  4P52 A;  1USV A;  2VF3 A;  1XNR I;  4JI1 E;  4X65 I;  4DV4 I;  1XHK A;  1RRE A;  2BM1 A;  5A2Q C;  4KHP E;  4K0K I;  1U2R A;  5FLX C;  4DV6 I;  3K1J A;  3LNU A;  4JI0 E;  1N0U A;  4DR2 I;  1FWK A;  4B3S I;  1Z5B A;  2F4V E;  3M6A A;  2R42 A;  4HAC B;  4DR7 I;  1I94 E;  5LMU I;  2BM0 A;  4DR6 I;  1Z0G A;  1XMO I;  2UXD I;  1HNW I;  4NXM I;  4JI6 E;  3JAM Q;  4YHH I;  2CZ9 A;  4DUZ I;  3OTO I;  4DV0 E;  1Y4U A;  4X62 I;  2A2C A;  4UT4 A;  3WU3 A;  2GQ0 A;  1FJG I;  1H7S A;  1Z5A A;  1XNR E;  1MX0 A;  1XNQ I;  1NHJ A;  5L3J A;  4X65 E;  4DV4 E;  4LF6 E;  1VIS A;  4K0K E;  4P7A A;  4LF9 I;  5LMN I;  2V8P A;  4DV6 E;  4DR1 I;  3T1Y I;  1FI4 A;  1Z0C A;  3QT6 A;  2VQF I;  1XMQ E;  4HY1 A;  2UXC I;  3J81 Q;  1FWL A;  4B3S E;  4JI2 I;  4DV5 I;  4EMD A;  5BR8 I;  1N0V C;  4GKJ I;  4DR7 E;  4DV1 I;  1N34 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...