3JAMQ

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
141
Chain Sequence
TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 33
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3jamQ00
4WUBA 1FKAE 2VF3A 4DPYA 4K0KE 2UU9I 1N36I 1ZM2A 2AJ4A 2WW4A 3B82A 4KQVA 1FNMA 4LF6I 2LJPA 4JI4E 3ZZ0A 4DV5I 4DV0I 1HR0E 4MYUA 1S4EA 3ZZUA 1UEKA 1N32I 4K0KI 3QT6A 4JI7I 4B3SE 1NHHA 1QZRA 2F4VE 3HULA 1Z0GA 5IT9C 1ZXMA 3ZM7A 2CZ9A 1N34E 1HNXE 4JI4I 4DV3I 4HACA 1HR0I 4JI8E 4UTGA 1HNZE 1NZ0A 1IBLE 2UUAE 5BR8E 2F4VI 4DPXA 2GS8A 4AQYI 4X62E 4NXNI 5GMEA 1WUUA 1XMQE 3J81C 1N34I 1HNXI 1H7UA 1XMOI 3PYFA 1XNQE 1PIEA 4DR5E 4DU7A 1S16A 1Z0BA 1Z0TA 4JI8I 4X64E 4DV7E 1Z59A 3GONA 1HNZI 3J7AG 3K17A 4DV4E 1IBLI 5BR8I 1RREA 2ZM6E 1KIJA 4X62I 4B3RE 4DR4E 1XMQI 1XNQI 3T1HE 4PRVA 4DR5I 4LF8E 2VQEE 4DV7I 2UXCE 1K47A 4FWGA 3LTOA 4DV4I 3J7AM 4P52A 3JAMQ 2ZM6I 4P7AA 1H72C 4LF9E 4B3RI 1DARA 4DR4I 4LF4I 2HFUA 3T1HI 2HHHE 4DV6E 4LF8I 3Q1QA 2UXCI 5FLXQ 5GMDA 2UXBE 4JI1E 4DUZE 3WU4A 3H4LA 2E1RA 2HFSA 4LF9I 2HHHI 4DV6I 3ZKDA 1Z0EA 1ZXNA 2BM1A 2HK3A 1Z0WA 4GKKI 4JI6E 2UXBI 4JI1I 2R42A 4DUZI 1PVGA 1I94I 1Z0VA 4USKA 4URLA 3OTOE 1OJ4A 1ZM9A 3T1YE 1PKPA 4DR2E 4I3HA 4JI6I 2V2VA 2V8PA 3WU5A 1ZM4A 3K1JA 3ZKBA 3OTOI 4EMDA 3J80Q 3T1YI 4LF7E 1VISA 4LF5E 4B3SI 1N0VC 4X66E 2DEIA 4DUYE 4XTJA 1KTVA 2UXDE 5IWAE 1MG7A 4DR1E 1IBKE 3WU3A 2DEJA 4LF7I 2UUAI 5A2QQ 1H7SA 4NXME 1MX0A 4X66I 4JYAE 2V34A 4DUYI 2UXDI 5IWAI 2A2DA 4X64I 4DR1I 2A2CA 1IBKI 3D4JA 4B3TE 1FJGE 4M1KA 4FW9A 4LFBE 2ZBKB 3V2UC 4DR7E 1BKNA 4NXMI 4LFAE 1FWLA 4JYAI 5LMNE 3PYEA 1ELOA 4WUDA 2NPFA 1N33E 3B78A 2VQEI 2UUBE 4B3TI 2V2QA 1FJGI 4ZVIA 1U2RA 4DPTA 5IT9Q 3LNUA 4LFBI 1KKHA 4DR7I 4Z7YA 1XHKA 1H74A 4LFAI 1Z5BA 3V5RA 4R1FA 5LMNI 4JG4A 3WU6A 1N33I 4LFCE 2UUBI 1B62A 2HK2A 4OX9E 2HKEA 4DPWA 3B8HA 4PU9A 4MYTA 2X7IA 4DR6E 4WUCA 2R3VA 4FWDA 4DV2E 4ED4A 1N32E 1KVKA 4LFCI 4JI7E 4DV1E 4OX9I 1EA6A 4KHPE 3JAMC 4HACB 1FI4A 3PYGA 4DV3E 2UUCE 4DR6I 1Z5CA 4YHHE 4HYMA 2HKJA 2OI2A 3LPSA 1IBME 3CWVA 4JV5E 1RR9A 1Z5AA 4DV2I 2ZITA 4DV1I 3F0NA 4AQYE 4NXNE 5FLXC 4DR2I 2Q2EB 4JI5E 4KHPI 4DPUA 4Z7CA 4JI2E 1XMOE 2V2ZA 3QT7A 2UUCI 3QT8A 4YHHI 1IBMI 2BV3A 1FWKA 4JV5I 4B3ME 1ZM3A 5LMUE 2J7KA 4LF5I 4JI0E 3M6AA 4DXLA 1J5EE 4JI3E 4JI5I 1D6TA 1B63A 4DR3E 4DU8A 4JI2I 3QT5A 1MU5A 3PYDA 2VQFE 4PRXA 1XNRE 4B3MI 1H73A 2X36A 5LMUI 4GKJE 1N0UA 1HNWE 4JI0I 4USMA 2E5LE 1J5EI 4JI3I 4X65E 4LF4E 1A6FA 4DR3I 4FN5A 2XEXA 4FWHA 2VQFI 4HY1A 1XNRI 2BM0A 3ZZTA 3J80C 5LL6R 4GKJI 1HNWI 4HXZA 2E5LI 4YY3E 1Z0CA 1NHJA 4UT4A 4X65I 1EI1A 4RPFA 2UU9E 1N36E 4GKKE 2EFGA 3J81Q 1NHIA 4LF6E 1I94E 4YY3I 5A2QC 4DV5E 5L3JA 4DV0E
chains in the Genus database with same CATH superfamily
4WUBA 2PO0B 1FKAE 2VF3A 4DPYA 2JE6A 4K0KE 2UU9I 1N36I 4MQYA 3P3GA 4MU4A 1ZM2A 2AJ4A 2WW4A 4IFDB 1Y4SA 5JEAE 3B82A 4KQVA 3B4TA 5JEAF 4LCFA 1FNMA 4LF6I 2LJPA 4JI4E 3ZZ0A 2NN6A 3UHMA 4DV5I 4DV0I 5C0XE 1OYRA 1HR0E 4MYUA 1S4EA 2PO1B 3ZZUA 3HJCA 1UEKA 3L7ZB 5JEAC 2CGEA 3DD6A 3M85D 4K0KI 1N32I 3QT6A 4FW7A 2C39A 4JI7I 4MU3A 4FW3A 4B3SE 1NHHA 1QZRA 2F4VE 3HULA 4LOMA 1Z0GA 2Z5CA 5IT9C 1ZXMA 3ZM7A 2CZ9A 1N34E 2PO2A 1HNXE 2O3ZA 3HKMA 4JI4I 2CVEA 4DV3I 4HACA 1HR0I 4JI8E 2O1UA 4UTGA 2PO1A 1HNZE 1NZ0A 1IBLE 3PS2A 5BR8E 2UUAE 1Y60A 2F4VI 4DPXA 2GS8A 2O1TA 4AQYI 4X62E 4NXNI 4OO1D 5GMEA 1WUUA 1XMQE 3PRYA 3J81C 1N34I 1OYPA 1HNXI 1H7UA 1XMOI 2IOQA 3PYFA 1XNQE 1PIEA 2PNMA 4DR5E 4DU7A 3U1KA 1S16A 1Z0BA 1Z0TA 3P76A 4JI8I 5C0XB 4X64E 4DV7E 5K36E 5DRQA 1Z59A 3GONA 5K36F 1HNZI 3J7AG 3K17A 4DV4E 1IBLI 5BR8I 1RREA 2VESA 3M85G 2BA1D 5DROA 2ZM6E 1KIJA 4X62I 4IZKB 4B3RE 4MU0A 1XMQI 4DR4E 4OO1E 5K36C 1XNQI 3T1HE 4PRVA 4DR5I 4LF8E 3GMEA 2VQEE 4GQUA 4DV7I 4AIMA 2UXCE 3P06A 1K47A 4FWGA 3LTOA 4DV4I 4IZJD 3J7AM 4P52A 2C38A 2NN6F 3JAMQ 2ZM6I 2WP8B 3CDIA 3H1CA 4P7AA 1H72C 4LF9E 4B3RI 1DARA 2Z5EA 3PS3A 4IZKA 4LF4I 4DR4I 2HFUA 4OKGA 3T1HI 2HHHE 4DV6E 1OYSA 4LF8I 3Q1QA 4NBQA 2NN6C 5DNLA 2F1DA 4QNKA 5DRPA 2UXCI 5JEAD 2IESA 5FLXQ 5GMDA 2UXBE 4JI1E 4DUZE 5DRRA 3WU4A 3H4LA 1USVA 2E1RA 2HFSA 2BA0D 2GO3A 4LF9I 2BA1G 4OO1B 2HHHI 4DV6I 3ZKDA 1Z0EA 1E3PA 1ZXNA 2C37B 2BM1A 2HK3A 1Z0WA 4GKKI 4JI6E 2UXBI 4JI1I 2R42A 4DUZI 1PVGA 1I94I 2WNRB 1Z0VA 4USKA 2IOPA 4QNJA 4URLA 3OTOE 1OJ4A 2PO0A 1ZM9A 1YH8A 2GO4A 5EKWA 3T1YE 3K85A 1PKPA 4DR2E 4IFDA 4FW4A 4I3HA 4JI6I 2JEBB 4LPFA 2V2VA 2J65A 2V8PA 2O1VA 4IZJB 3WU5A 2WNRA 5K36D 1ZM4A 2BA0G 3K1JA 3ZKBA 3OTOI 4EMDA 3J80Q 3L7ZA 3T1YI 4LF7E 1VISA 4LF5E 4B3SI 1N0VC 5JEAB 2JEBA 4X66E 2DEIA 4DUYE 4XTJA 1KTVA 4IZJA 2UXDE 5IWAE 1MG7A 4DR1E 1IBKE 3WU3A 2DEJA 2NN6D 4LCGA 4LF7I 2UUAI 3GCMA 5A2QQ 1H7SA 4AM3A 4NXME 1MX0A 4X66I 4JYAE 1R6LA 2V34A 4DUYI 4BA1B 2UXDI 5IWAI 2A2DA 4X64I 4N3OA 4DR1I 2A2CA 2Z5BB 3D4JA 1IBKI 5C0XA 4B3TE 1FJGE 3NZKA 4M1KA 2NN6E 4FW9A 4LFBE 1RHYA 2ZBKB 1UDQA 3V2UC 4BA2B 4DR7E 1BKNA 4NXMI 1UDSA 4LFAE 2CG9A 1FWLA 4JYAI 5LMNE 3PYEA 1ELOA 4WUDA 2NPFA 1N33E 3B78A 2VQEI 2UUBE 4B3TI 2BR2B 2JT2A 2V2QA 1FJGI 2AE8A 4ZVIA 5K36B 1U2RA 4DPTA 5IT9Q 3LNUA 4LFBI 1KKHA 4BA2A 4DR7I 4Z7YA 2WP8A 1XHKA 1H74A 4IFDC 4LFAI 1Z5BA 2PNLA 1HK7A 3V5RA 2JE6B 4R1FA 5LMNI 4IS9A 1UDNA 2GQ0A 4JG4A 3WU6A 1N33I 4LFCE 2UUBI 1B62A 2HK2A 4FW5A 2BR2A 2HKEA 4OX9E 4DPWA 3P3EA 3M7ND 3B8HA 2NN6B 4PU9A 4MYTA 5EL9A 2X7IA 4DR6E 4WUCA 4ISAA 2R3VA 4FWDA 5DNXA 4DV2E 4ED4A 1N32E 2C39B 4OO1A 1KVKA 4LFCI 4JI7E 4DV1E 2C37A 2Z5CB 4OX9I 4U3DA 1EA6A 3PS1A 2PO2B 4KHPE 3CDJA 3JAMC 4HACB 1FI4A 3PYGA 4DV3E 1XXEA 2UUCE 4DR6I 1Z5CA 4YHHE 4HYMA 5C0XF 2HKJA 2OI2A 3LPSA 1E3HA 1IBME 3CWVA 1YHCA 4JV5E 1RR9A 1Z5AA 4DV2I 1P42A 2ZITA 1Y5YA 4DV1I 3F0NA 4AQYE 4NXNE 5FWKA 5C0XC 5FLXC 4DR2I 2Q2EB 4JI5E 1Y4UA 4KHPI 4DPUA 4Z7CA 2IERA 4JI2E 1XMOE 3M7NG 3KRNA 2V2ZA 5ELWA 3QT7A 2UUCI 3QT8A 4YHHI 1IBMI 2BV3A 2PNZB 1FWKA 4JV5I 4U3BA 4B3ME 1ZM3A 5LMUE 2J7KA 1Y6ZA 4JI0E 3M6AA 4LF5I 4DXLA 1J5EE 4JI3E 4JI5I 1D6TA 1B63A 4DR3E 4DU8A 4JI2I 3QT5A 1MU5A 5JEAA 3PYDA 2VQFE 4IFDD 4AIDA 4MU1A 4PRXA 1R6MA 1XNRE 4B3MI 2PNZA 1H73A 2X36A 5LMUI 4GKJE 2C38B 1N0UA 1HNWE 4JI0I 4USMA 2E5LE 1J5EI 4OZEA 4JI3I 4X65E 4LF4E 2O1WA 1A6FA 4DR3I 4FN5A 4OO1F 4LCHA 2XEXA 4FWHA 2VQFI 4J3DA 4HY1A 4BA1A 4IFDE 2JEAB 1UDOA 1XNRI 2BM0A 4IFDF 2Z5BA 3Q6MA 3ZZTA 3P3CA 3J80C 5LL6R 4GKJI 4OO1C 4FW6A 1HNWI 4HXZA 4MDTA 2E5LI 4YY3E 1Z0CA 1NHJA 4UT4A 3Q6NA 4X65I 1EI1A 4RPFA 2UU9E 1N36E 2JEAA 3U1YA 3GLLA 4GKKE 2EFGA 4DV0E 5K36A 3J81Q 1NHIA 1VI7A 4LF6E 5C0XD 1I94E 4YY3I 5A2QC 4DV5E 5L3JA 1USUA
chains in the Genus database with same CATH topology
4WUBA 1FKAE 2VF3A 4DPYA 4K0KE 2UU9I 1N36I 1ZM2A 2AJ4A 2WW4A 1Y4SA 3B82A 4KQVA 1FNMA 4LF6I 2LJPA 4JI4E 3ZZ0A 4DV5I 4DV0I 1HR0E 4MYUA 1S4EA 3ZZUA 3HJCA 1UEKA 2CGEA 4K0KI 1N32I 3QT6A 4JI7I 4B3SE 1NHHA 1QZRA 2F4VE 3HULA 1Z0GA 2Z5CA 5IT9C 1ZXMA 3ZM7A 2CZ9A 1N34E 1HNXE 4JI4I 4DV3I 4HACA 1HR0I 4JI8E 2O1UA 4UTGA 1HNZE 1NZ0A 1IBLE 2UUAE 5BR8E 2F4VI 4DPXA 4AQYI 2GS8A 2O1TA 4X62E 4NXNI 5GMEA 1WUUA 1XMQE 3PRYA 3J81C 1N34I 1HNXI 1H7UA 1XMOI 2IOQA 3PYFA 1XNQE 1PIEA 2PNMA 4DR5E 4DU7A 1S16A 1Z0BA 1Z0TA 4JI8I 4X64E 4DV7E 1Z59A 3GONA 1HNZI 3J7AG 3K17A 4DV4E 1IBLI 5BR8I 1RREA 2ZM6E 1KIJA 4X62I 4IZKB 4B3RE 4DR4E 1XMQI 1XNQI 3T1HE 4PRVA 4DR5I 4LF8E 2VQEE 4DV7I 2UXCE 3P06A 1K47A 4FWGA 3LTOA 4DV4I 4IZJD 3J7AM 4P52A 3JAMQ 2ZM6I 4P7AA 1H72C 4LF9E 4B3RI 1DARA 2Z5EA 4IZKA 4LF4I 4DR4I 2HFUA 3T1HI 2HHHE 4DV6E 4LF8I 3Q1QA 2UXCI 5FLXQ 5GMDA 2UXBE 4JI1E 4DUZE 3WU4A 3H4LA 1USVA 2E1RA 2HFSA 4LF9I 2HHHI 4DV6I 3ZKDA 1Z0EA 1ZXNA 2BM1A 2HK3A 1Z0WA 4GKKI 4JI6E 2UXBI 4JI1I 2R42A 4DUZI 1PVGA 1I94I 1Z0VA 4USKA 2IOPA 4URLA 3OTOE 1OJ4A 1ZM9A 3T1YE 3K85A 1PKPA 4DR2E 4I3HA 4JI6I 2V2VA 2V8PA 2O1VA 4IZJB 3WU5A 1ZM4A 3K1JA 3ZKBA 3OTOI 4EMDA 3J80Q 3T1YI 4LF7E 1VISA 4LF5E 4B3SI 1N0VC 4X66E 2DEIA 4DUYE 4XTJA 1KTVA 4IZJA 2UXDE 5IWAE 1MG7A 4DR1E 1IBKE 3WU3A 2DEJA 4LF7I 2UUAI 5A2QQ 1H7SA 4NXME 1MX0A 4X66I 4JYAE 2V34A 4DUYI 2UXDI 5IWAI 2A2DA 4X64I 4N3OA 4DR1I 2A2CA 2Z5BB 3D4JA 1IBKI 4B3TE 1FJGE 4M1KA 4FW9A 4LFBE 2ZBKB 3V2UC 4DR7E 1BKNA 4NXMI 4LFAE 2CG9A 1FWLA 4JYAI 5LMNE 3PYEA 1ELOA 4WUDA 2NPFA 1N33E 3B78A 2VQEI 2UUBE 4B3TI 2V2QA 1FJGI 4ZVIA 1U2RA 4DPTA 5IT9Q 3LNUA 4LFBI 1KKHA 4DR7I 4Z7YA 1XHKA 1H74A 4LFAI 1Z5BA 2PNLA 1HK7A 3V5RA 4R1FA 5LMNI 2GQ0A 4JG4A 3WU6A 1N33I 4LFCE 2UUBI 1B62A 2HK2A 4OX9E 2HKEA 4DPWA 3B8HA 4PU9A 4MYTA 2X7IA 4DR6E 4WUCA 2R3VA 4FWDA 4DV2E 4ED4A 1N32E 1KVKA 4LFCI 4JI7E 4DV1E 2Z5CB 4OX9I 1EA6A 4KHPE 3JAMC 4HACB 1FI4A 3PYGA 4DV3E 2UUCE 4DR6I 1Z5CA 4YHHE 4HYMA 2HKJA 2OI2A 3LPSA 1IBME 3CWVA 4JV5E 1RR9A 1Z5AA 4DV2I 2ZITA 4DV1I 3F0NA 4AQYE 4NXNE 5FWKA 5FLXC 4DR2I 2Q2EB 4JI5E 1Y4UA 4KHPI 4DPUA 4Z7CA 4JI2E 1XMOE 2V2ZA 3QT7A 2UUCI 3QT8A 4YHHI 1IBMI 2BV3A 1FWKA 4JV5I 4B3ME 1ZM3A 5LMUE 2J7KA 1Y6ZA 4JI0E 3M6AA 4LF5I 4DXLA 1J5EE 4JI3E 4JI5I 1D6TA 1B63A 4DR3E 4DU8A 4JI2I 3QT5A 1MU5A 3PYDA 2VQFE 4PRXA 1XNRE 4B3MI 1H73A 2X36A 5LMUI 4GKJE 1N0UA 1HNWE 4JI0I 4USMA 2E5LE 1J5EI 4JI3I 4X65E 1USUA 4LF4E 2O1WA 1A6FA 4DR3I 4FN5A 2XEXA 4FWHA 2VQFI 4HY1A 1XNRI 2BM0A 2Z5BA 3Q6MA 3ZZTA 3J80C 5LL6R 4GKJI 1HNWI 4HXZA 2E5LI 4YY3E 1Z0CA 1NHJA 4UT4A 3Q6NA 4X65I 1EI1A 4RPFA 2UU9E 1N36E 4GKKE 2EFGA 3J81Q 1NHIA 4LF6E 1I94E 4YY3I 5A2QC 4DV5E 5L3JA 4DV0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUB A;  1FKA E;  2VF3 A;  4DPY A;  4K0K E;  2UU9 I;  1N36 I;  1ZM2 A;  2AJ4 A;  2WW4 A;  3B82 A;  4KQV A;  1FNM A;  4LF6 I;  2LJP A;  4JI4 E;  3ZZ0 A;  4DV5 I;  4DV0 I;  1HR0 E;  4MYU A;  1S4E A;  3ZZU A;  1UEK A;  1N32 I;  4K0K I;  3QT6 A;  4JI7 I;  4B3S E;  1NHH A;  1QZR A;  2F4V E;  3HUL A;  1Z0G A;  5IT9 C;  1ZXM A;  3ZM7 A;  2CZ9 A;  1N34 E;  1HNX E;  4JI4 I;  4DV3 I;  4HAC A;  1HR0 I;  4JI8 E;  4UTG A;  1HNZ E;  1NZ0 A;  1IBL E;  2UUA E;  5BR8 E;  2F4V I;  4DPX A;  2GS8 A;  4AQY I;  4X62 E;  4NXN I;  5GME A;  1WUU A;  1XMQ E;  3J81 C;  1N34 I;  1HNX I;  1H7U A;  1XMO I;  3PYF A;  1XNQ E;  1PIE A;  4DR5 E;  4DU7 A;  1S16 A;  1Z0B A;  1Z0T A;  4JI8 I;  4X64 E;  4DV7 E;  1Z59 A;  3GON A;  1HNZ I;  3J7A G;  3K17 A;  4DV4 E;  1IBL I;  5BR8 I;  1RRE A;  2ZM6 E;  1KIJ A;  4X62 I;  4B3R E;  4DR4 E;  1XMQ I;  1XNQ I;  3T1H E;  4PRV A;  4DR5 I;  4LF8 E;  2VQE E;  4DV7 I;  2UXC E;  1K47 A;  4FWG A;  3LTO A;  4DV4 I;  3J7A M;  4P52 A;  3JAM Q;  2ZM6 I;  4P7A A;  1H72 C;  4LF9 E;  4B3R I;  1DAR A;  4DR4 I;  4LF4 I;  2HFU A;  3T1H I;  2HHH E;  4DV6 E;  4LF8 I;  3Q1Q A;  2UXC I;  5FLX Q;  5GMD A;  2UXB E;  4JI1 E;  4DUZ E;  3WU4 A;  3H4L A;  2E1R A;  2HFS A;  4LF9 I;  2HHH I;  4DV6 I;  3ZKD A;  1Z0E A;  1ZXN A;  2BM1 A;  2HK3 A;  1Z0W A;  4GKK I;  4JI6 E;  2UXB I;  4JI1 I;  2R42 A;  4DUZ I;  1PVG A;  1I94 I;  1Z0V A;  4USK A;  4URL A;  3OTO E;  1OJ4 A;  1ZM9 A;  3T1Y E;  1PKP A;  4DR2 E;  4I3H A;  4JI6 I;  2V2V A;  2V8P A;  3WU5 A;  1ZM4 A;  3K1J A;  3ZKB A;  3OTO I;  4EMD A;  3J80 Q;  3T1Y I;  4LF7 E;  1VIS A;  4LF5 E;  4B3S I;  1N0V C;  4X66 E;  2DEI A;  4DUY E;  4XTJ A;  1KTV A;  2UXD E;  5IWA E;  1MG7 A;  4DR1 E;  1IBK E;  3WU3 A;  2DEJ A;  4LF7 I;  2UUA I;  5A2Q Q;  1H7S A;  4NXM E;  1MX0 A;  4X66 I;  4JYA E;  2V34 A;  4DUY I;  2UXD I;  5IWA I;  2A2D A;  4X64 I;  4DR1 I;  2A2C A;  1IBK I;  3D4J A;  4B3T E;  1FJG E;  4M1K A;  4FW9 A;  4LFB E;  2ZBK B;  3V2U C;  4DR7 E;  1BKN A;  4NXM I;  4LFA E;  1FWL A;  4JYA I;  5LMN E;  3PYE A;  1ELO A;  4WUD A;  2NPF A;  1N33 E;  3B78 A;  2VQE I;  2UUB E;  4B3T I;  2V2Q A;  1FJG I;  4ZVI A;  1U2R A;  4DPT A;  5IT9 Q;  3LNU A;  4LFB I;  1KKH A;  4DR7 I;  4Z7Y A;  1XHK A;  1H74 A;  4LFA I;  1Z5B A;  3V5R A;  4R1F A;  5LMN I;  4JG4 A;  3WU6 A;  1N33 I;  4LFC E;  2UUB I;  1B62 A;  2HK2 A;  4OX9 E;  2HKE A;  4DPW A;  3B8H A;  4PU9 A;  4MYT A;  2X7I A;  4DR6 E;  4WUC A;  2R3V A;  4FWD A;  4DV2 E;  4ED4 A;  1N32 E;  1KVK A;  4LFC I;  4JI7 E;  4DV1 E;  4OX9 I;  1EA6 A;  4KHP E;  3JAM C;  4HAC B;  1FI4 A;  3PYG A;  4DV3 E;  2UUC E;  4DR6 I;  1Z5C A;  4YHH E;  4HYM A;  2HKJ A;  2OI2 A;  3LPS A;  1IBM E;  3CWV A;  4JV5 E;  1RR9 A;  1Z5A A;  4DV2 I;  2ZIT A;  4DV1 I;  3F0N A;  4AQY E;  4NXN E;  5FLX C;  4DR2 I;  2Q2E B;  4JI5 E;  4KHP I;  4DPU A;  4Z7C A;  4JI2 E;  1XMO E;  2V2Z A;  3QT7 A;  2UUC I;  3QT8 A;  4YHH I;  1IBM I;  2BV3 A;  1FWK A;  4JV5 I;  4B3M E;  1ZM3 A;  5LMU E;  2J7K A;  4LF5 I;  4JI0 E;  3M6A A;  4DXL A;  1J5E E;  4JI3 E;  4JI5 I;  1D6T A;  1B63 A;  4DR3 E;  4DU8 A;  4JI2 I;  3QT5 A;  1MU5 A;  3PYD A;  2VQF E;  4PRX A;  1XNR E;  4B3M I;  1H73 A;  2X36 A;  5LMU I;  4GKJ E;  1N0U A;  1HNW E;  4JI0 I;  4USM A;  2E5L E;  1J5E I;  4JI3 I;  4X65 E;  4LF4 E;  1A6F A;  4DR3 I;  4FN5 A;  2XEX A;  4FWH A;  2VQF I;  4HY1 A;  1XNR I;  2BM0 A;  3ZZT A;  3J80 C;  5LL6 R;  4GKJ I;  1HNW I;  4HXZ A;  2E5L I;  4YY3 E;  1Z0C A;  1NHJ A;  4UT4 A;  4X65 I;  1EI1 A;  4RPF A;  2UU9 E;  1N36 E;  4GKK E;  2EFG A;  3J81 Q;  1NHI A;  4LF6 E;  1I94 E;  4YY3 I;  5A2Q C;  4DV5 E;  5L3J A;  4DV0 E; 
#chains in the Genus database with same CATH topology
 4WUB A;  2PO0 B;  1FKA E;  2VF3 A;  4DPY A;  2JE6 A;  4K0K E;  2UU9 I;  1N36 I;  4MQY A;  3P3G A;  4MU4 A;  1ZM2 A;  2AJ4 A;  2WW4 A;  4IFD B;  1Y4S A;  5JEA E;  3B82 A;  4KQV A;  3B4T A;  5JEA F;  4LCF A;  1FNM A;  4LF6 I;  2LJP A;  4JI4 E;  3ZZ0 A;  2NN6 A;  3UHM A;  4DV5 I;  4DV0 I;  5C0X E;  1OYR A;  1HR0 E;  4MYU A;  1S4E A;  2PO1 B;  3ZZU A;  3HJC A;  1UEK A;  3L7Z B;  5JEA C;  2CGE A;  3DD6 A;  3M85 D;  4K0K I;  1N32 I;  3QT6 A;  4FW7 A;  2C39 A;  4JI7 I;  4MU3 A;  4FW3 A;  4B3S E;  1NHH A;  1QZR A;  2F4V E;  3HUL A;  4LOM A;  1Z0G A;  2Z5C A;  5IT9 C;  1ZXM A;  3ZM7 A;  2CZ9 A;  1N34 E;  2PO2 A;  1HNX E;  2O3Z A;  3HKM A;  4JI4 I;  2CVE A;  4DV3 I;  4HAC A;  1HR0 I;  4JI8 E;  2O1U A;  4UTG A;  2PO1 A;  1HNZ E;  1NZ0 A;  1IBL E;  3PS2 A;  5BR8 E;  2UUA E;  1Y60 A;  2F4V I;  4DPX A;  2GS8 A;  2O1T A;  4AQY I;  4X62 E;  4NXN I;  4OO1 D;  5GME A;  1WUU A;  1XMQ E;  3PRY A;  3J81 C;  1N34 I;  1OYP A;  1HNX I;  1H7U A;  1XMO I;  2IOQ A;  3PYF A;  1XNQ E;  1PIE A;  2PNM A;  4DR5 E;  4DU7 A;  3U1K A;  1S16 A;  1Z0B A;  1Z0T A;  3P76 A;  4JI8 I;  5C0X B;  4X64 E;  4DV7 E;  5K36 E;  5DRQ A;  1Z59 A;  3GON A;  5K36 F;  1HNZ I;  3J7A G;  3K17 A;  4DV4 E;  1IBL I;  5BR8 I;  1RRE A;  2VES A;  3M85 G;  2BA1 D;  5DRO A;  2ZM6 E;  1KIJ A;  4X62 I;  4IZK B;  4B3R E;  4MU0 A;  1XMQ I;  4DR4 E;  4OO1 E;  5K36 C;  1XNQ I;  3T1H E;  4PRV A;  4DR5 I;  4LF8 E;  3GME A;  2VQE E;  4GQU A;  4DV7 I;  4AIM A;  2UXC E;  3P06 A;  1K47 A;  4FWG A;  3LTO A;  4DV4 I;  4IZJ D;  3J7A M;  4P52 A;  2C38 A;  2NN6 F;  3JAM Q;  2ZM6 I;  2WP8 B;  3CDI A;  3H1C A;  4P7A A;  1H72 C;  4LF9 E;  4B3R I;  1DAR A;  2Z5E A;  3PS3 A;  4IZK A;  4LF4 I;  4DR4 I;  2HFU A;  4OKG A;  3T1H I;  2HHH E;  4DV6 E;  1OYS A;  4LF8 I;  3Q1Q A;  4NBQ A;  2NN6 C;  5DNL A;  2F1D A;  4QNK A;  5DRP A;  2UXC I;  5JEA D;  2IES A;  5FLX Q;  5GMD A;  2UXB E;  4JI1 E;  4DUZ E;  5DRR A;  3WU4 A;  3H4L A;  1USV A;  2E1R A;  2HFS A;  2BA0 D;  2GO3 A;  4LF9 I;  2BA1 G;  4OO1 B;  2HHH I;  4DV6 I;  3ZKD A;  1Z0E A;  1E3P A;  1ZXN A;  2C37 B;  2BM1 A;  2HK3 A;  1Z0W A;  4GKK I;  4JI6 E;  2UXB I;  4JI1 I;  2R42 A;  4DUZ I;  1PVG A;  1I94 I;  2WNR B;  1Z0V A;  4USK A;  2IOP A;  4QNJ A;  4URL A;  3OTO E;  1OJ4 A;  2PO0 A;  1ZM9 A;  1YH8 A;  2GO4 A;  5EKW A;  3T1Y E;  3K85 A;  1PKP A;  4DR2 E;  4IFD A;  4FW4 A;  4I3H A;  4JI6 I;  2JEB B;  4LPF A;  2V2V A;  2J65 A;  2V8P A;  2O1V A;  4IZJ B;  3WU5 A;  2WNR A;  5K36 D;  1ZM4 A;  2BA0 G;  3K1J A;  3ZKB A;  3OTO I;  4EMD A;  3J80 Q;  3L7Z A;  3T1Y I;  4LF7 E;  1VIS A;  4LF5 E;  4B3S I;  1N0V C;  5JEA B;  2JEB A;  4X66 E;  2DEI A;  4DUY E;  4XTJ A;  1KTV A;  4IZJ A;  2UXD E;  5IWA E;  1MG7 A;  4DR1 E;  1IBK E;  3WU3 A;  2DEJ A;  2NN6 D;  4LCG A;  4LF7 I;  2UUA I;  3GCM A;  5A2Q Q;  1H7S A;  4AM3 A;  4NXM E;  1MX0 A;  4X66 I;  4JYA E;  1R6L A;  2V34 A;  4DUY I;  4BA1 B;  2UXD I;  5IWA I;  2A2D A;  4X64 I;  4N3O A;  4DR1 I;  2A2C A;  2Z5B B;  3D4J A;  1IBK I;  5C0X A;  4B3T E;  1FJG E;  3NZK A;  4M1K A;  2NN6 E;  4FW9 A;  4LFB E;  1RHY A;  2ZBK B;  1UDQ A;  3V2U C;  4BA2 B;  4DR7 E;  1BKN A;  4NXM I;  1UDS A;  4LFA E;  2CG9 A;  1FWL A;  4JYA I;  5LMN E;  3PYE A;  1ELO A;  4WUD A;  2NPF A;  1N33 E;  3B78 A;  2VQE I;  2UUB E;  4B3T I;  2BR2 B;  2JT2 A;  2V2Q A;  1FJG I;  2AE8 A;  4ZVI A;  5K36 B;  1U2R A;  4DPT A;  5IT9 Q;  3LNU A;  4LFB I;  1KKH A;  4BA2 A;  4DR7 I;  4Z7Y A;  2WP8 A;  1XHK A;  1H74 A;  4IFD C;  4LFA I;  1Z5B A;  2PNL A;  1HK7 A;  3V5R A;  2JE6 B;  4R1F A;  5LMN I;  4IS9 A;  1UDN A;  2GQ0 A;  4JG4 A;  3WU6 A;  1N33 I;  4LFC E;  2UUB I;  1B62 A;  2HK2 A;  4FW5 A;  2BR2 A;  2HKE A;  4OX9 E;  4DPW A;  3P3E A;  3M7N D;  3B8H A;  2NN6 B;  4PU9 A;  4MYT A;  5EL9 A;  2X7I A;  4DR6 E;  4WUC A;  4ISA A;  2R3V A;  4FWD A;  5DNX A;  4DV2 E;  4ED4 A;  1N32 E;  2C39 B;  4OO1 A;  1KVK A;  4LFC I;  4JI7 E;  4DV1 E;  2C37 A;  2Z5C B;  4OX9 I;  4U3D A;  1EA6 A;  3PS1 A;  2PO2 B;  4KHP E;  3CDJ A;  3JAM C;  4HAC B;  1FI4 A;  3PYG A;  4DV3 E;  1XXE A;  2UUC E;  4DR6 I;  1Z5C A;  4YHH E;  4HYM A;  5C0X F;  2HKJ A;  2OI2 A;  3LPS A;  1E3H A;  1IBM E;  3CWV A;  1YHC A;  4JV5 E;  1RR9 A;  1Z5A A;  4DV2 I;  1P42 A;  2ZIT A;  1Y5Y A;  4DV1 I;  3F0N A;  4AQY E;  4NXN E;  5FWK A;  5C0X C;  5FLX C;  4DR2 I;  2Q2E B;  4JI5 E;  1Y4U A;  4KHP I;  4DPU A;  4Z7C A;  2IER A;  4JI2 E;  1XMO E;  3M7N G;  3KRN A;  2V2Z A;  5ELW A;  3QT7 A;  2UUC I;  3QT8 A;  4YHH I;  1IBM I;  2BV3 A;  2PNZ B;  1FWK A;  4JV5 I;  4U3B A;  4B3M E;  1ZM3 A;  5LMU E;  2J7K A;  1Y6Z A;  4JI0 E;  3M6A A;  4LF5 I;  4DXL A;  1J5E E;  4JI3 E;  4JI5 I;  1D6T A;  1B63 A;  4DR3 E;  4DU8 A;  4JI2 I;  3QT5 A;  1MU5 A;  5JEA A;  3PYD A;  2VQF E;  4IFD D;  4AID A;  4MU1 A;  4PRX A;  1R6M A;  1XNR E;  4B3M I;  2PNZ A;  1H73 A;  2X36 A;  5LMU I;  4GKJ E;  2C38 B;  1N0U A;  1HNW E;  4JI0 I;  4USM A;  2E5L E;  1J5E I;  4OZE A;  4JI3 I;  4X65 E;  4LF4 E;  2O1W A;  1A6F A;  4DR3 I;  4FN5 A;  4OO1 F;  4LCH A;  2XEX A;  4FWH A;  2VQF I;  4J3D A;  4HY1 A;  4BA1 A;  4IFD E;  2JEA B;  1UDO A;  1XNR I;  2BM0 A;  4IFD F;  2Z5B A;  3Q6M A;  3ZZT A;  3P3C A;  3J80 C;  5LL6 R;  4GKJ I;  4OO1 C;  4FW6 A;  1HNW I;  4HXZ A;  4MDT A;  2E5L I;  4YY3 E;  1Z0C A;  1NHJ A;  4UT4 A;  3Q6N A;  4X65 I;  1EI1 A;  4RPF A;  2UU9 E;  1N36 E;  2JEA A;  3U1Y A;  3GLL A;  4GKK E;  2EFG A;  4DV0 E;  5K36 A;  3J81 Q;  1NHI A;  1VI7 A;  4LF6 E;  5C0X D;  1I94 E;  4YY3 I;  5A2Q C;  4DV5 E;  5L3J A;  1USU A; 
#chains in the Genus database with same CATH homology
 4WUB A;  1FKA E;  2VF3 A;  4DPY A;  4K0K E;  2UU9 I;  1N36 I;  1ZM2 A;  2AJ4 A;  2WW4 A;  1Y4S A;  3B82 A;  4KQV A;  1FNM A;  4LF6 I;  2LJP A;  4JI4 E;  3ZZ0 A;  4DV5 I;  4DV0 I;  1HR0 E;  4MYU A;  1S4E A;  3ZZU A;  3HJC A;  1UEK A;  2CGE A;  4K0K I;  1N32 I;  3QT6 A;  4JI7 I;  4B3S E;  1NHH A;  1QZR A;  2F4V E;  3HUL A;  1Z0G A;  2Z5C A;  5IT9 C;  1ZXM A;  3ZM7 A;  2CZ9 A;  1N34 E;  1HNX E;  4JI4 I;  4DV3 I;  4HAC A;  1HR0 I;  4JI8 E;  2O1U A;  4UTG A;  1HNZ E;  1NZ0 A;  1IBL E;  2UUA E;  5BR8 E;  2F4V I;  4DPX A;  4AQY I;  2GS8 A;  2O1T A;  4X62 E;  4NXN I;  5GME A;  1WUU A;  1XMQ E;  3PRY A;  3J81 C;  1N34 I;  1HNX I;  1H7U A;  1XMO I;  2IOQ A;  3PYF A;  1XNQ E;  1PIE A;  2PNM A;  4DR5 E;  4DU7 A;  1S16 A;  1Z0B A;  1Z0T A;  4JI8 I;  4X64 E;  4DV7 E;  1Z59 A;  3GON A;  1HNZ I;  3J7A G;  3K17 A;  4DV4 E;  1IBL I;  5BR8 I;  1RRE A;  2ZM6 E;  1KIJ A;  4X62 I;  4IZK B;  4B3R E;  4DR4 E;  1XMQ I;  1XNQ I;  3T1H E;  4PRV A;  4DR5 I;  4LF8 E;  2VQE E;  4DV7 I;  2UXC E;  3P06 A;  1K47 A;  4FWG A;  3LTO A;  4DV4 I;  4IZJ D;  3J7A M;  4P52 A;  3JAM Q;  2ZM6 I;  4P7A A;  1H72 C;  4LF9 E;  4B3R I;  1DAR A;  2Z5E A;  4IZK A;  4LF4 I;  4DR4 I;  2HFU A;  3T1H I;  2HHH E;  4DV6 E;  4LF8 I;  3Q1Q A;  2UXC I;  5FLX Q;  5GMD A;  2UXB E;  4JI1 E;  4DUZ E;  3WU4 A;  3H4L A;  1USV A;  2E1R A;  2HFS A;  4LF9 I;  2HHH I;  4DV6 I;  3ZKD A;  1Z0E A;  1ZXN A;  2BM1 A;  2HK3 A;  1Z0W A;  4GKK I;  4JI6 E;  2UXB I;  4JI1 I;  2R42 A;  4DUZ I;  1PVG A;  1I94 I;  1Z0V A;  4USK A;  2IOP A;  4URL A;  3OTO E;  1OJ4 A;  1ZM9 A;  3T1Y E;  3K85 A;  1PKP A;  4DR2 E;  4I3H A;  4JI6 I;  2V2V A;  2V8P A;  2O1V A;  4IZJ B;  3WU5 A;  1ZM4 A;  3K1J A;  3ZKB A;  3OTO I;  4EMD A;  3J80 Q;  3T1Y I;  4LF7 E;  1VIS A;  4LF5 E;  4B3S I;  1N0V C;  4X66 E;  2DEI A;  4DUY E;  4XTJ A;  1KTV A;  4IZJ A;  2UXD E;  5IWA E;  1MG7 A;  4DR1 E;  1IBK E;  3WU3 A;  2DEJ A;  4LF7 I;  2UUA I;  5A2Q Q;  1H7S A;  4NXM E;  1MX0 A;  4X66 I;  4JYA E;  2V34 A;  4DUY I;  2UXD I;  5IWA I;  2A2D A;  4X64 I;  4N3O A;  4DR1 I;  2A2C A;  2Z5B B;  3D4J A;  1IBK I;  4B3T E;  1FJG E;  4M1K A;  4FW9 A;  4LFB E;  2ZBK B;  3V2U C;  4DR7 E;  1BKN A;  4NXM I;  4LFA E;  2CG9 A;  1FWL A;  4JYA I;  5LMN E;  3PYE A;  1ELO A;  4WUD A;  2NPF A;  1N33 E;  3B78 A;  2VQE I;  2UUB E;  4B3T I;  2V2Q A;  1FJG I;  4ZVI A;  1U2R A;  4DPT A;  5IT9 Q;  3LNU A;  4LFB I;  1KKH A;  4DR7 I;  4Z7Y A;  1XHK A;  1H74 A;  4LFA I;  1Z5B A;  2PNL A;  1HK7 A;  3V5R A;  4R1F A;  5LMN I;  2GQ0 A;  4JG4 A;  3WU6 A;  1N33 I;  4LFC E;  2UUB I;  1B62 A;  2HK2 A;  4OX9 E;  2HKE A;  4DPW A;  3B8H A;  4PU9 A;  4MYT A;  2X7I A;  4DR6 E;  4WUC A;  2R3V A;  4FWD A;  4DV2 E;  4ED4 A;  1N32 E;  1KVK A;  4LFC I;  4JI7 E;  4DV1 E;  2Z5C B;  4OX9 I;  1EA6 A;  4KHP E;  3JAM C;  4HAC B;  1FI4 A;  3PYG A;  4DV3 E;  2UUC E;  4DR6 I;  1Z5C A;  4YHH E;  4HYM A;  2HKJ A;  2OI2 A;  3LPS A;  1IBM E;  3CWV A;  4JV5 E;  1RR9 A;  1Z5A A;  4DV2 I;  2ZIT A;  4DV1 I;  3F0N A;  4AQY E;  4NXN E;  5FWK A;  5FLX C;  4DR2 I;  2Q2E B;  4JI5 E;  1Y4U A;  4KHP I;  4DPU A;  4Z7C A;  4JI2 E;  1XMO E;  2V2Z A;  3QT7 A;  2UUC I;  3QT8 A;  4YHH I;  1IBM I;  2BV3 A;  1FWK A;  4JV5 I;  4B3M E;  1ZM3 A;  5LMU E;  2J7K A;  1Y6Z A;  4JI0 E;  3M6A A;  4LF5 I;  4DXL A;  1J5E E;  4JI3 E;  4JI5 I;  1D6T A;  1B63 A;  4DR3 E;  4DU8 A;  4JI2 I;  3QT5 A;  1MU5 A;  3PYD A;  2VQF E;  4PRX A;  1XNR E;  4B3M I;  1H73 A;  2X36 A;  5LMU I;  4GKJ E;  1N0U A;  1HNW E;  4JI0 I;  4USM A;  2E5L E;  1J5E I;  4JI3 I;  4X65 E;  1USU A;  4LF4 E;  2O1W A;  1A6F A;  4DR3 I;  4FN5 A;  2XEX A;  4FWH A;  2VQF I;  4HY1 A;  1XNR I;  2BM0 A;  2Z5B A;  3Q6M A;  3ZZT A;  3J80 C;  5LL6 R;  4GKJ I;  1HNW I;  4HXZ A;  2E5L I;  4YY3 E;  1Z0C A;  1NHJ A;  4UT4 A;  3Q6N A;  4X65 I;  1EI1 A;  4RPF A;  2UU9 E;  1N36 E;  4GKK E;  2EFG A;  3J81 Q;  1NHI A;  4LF6 E;  1I94 E;  4YY3 I;  5A2Q C;  4DV5 E;  5L3J A;  4DV0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...