3JAMQ

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
141
Chain Sequence
TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 33
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3jamQ00
5BR8I 4DR1I 4B3TE 4JI8I 5IT9C 1H74A 2UUAE 4LFBE 1PIEA 4X64I 2VF3A 4WUDA 1ZM9A 4DUZI 2HHHE 2AJ4A 2V2QA 1U2RA 3J80C 3JAMQ 4DPXA 4URLA 3H4LA 1XNQI 4DV4I 4LF9I 2UUCE 3F0NA 4JI6E 4OX9I 4LF4I 2J7KA 1FJGI 5FLXQ 1KVKA 4X65I 5GMDA 1IBKI 5GMEA 1N36I 4DR2I 4JI2E 5LMUE 1ZM2A 4DPWA 3T1HI 2EFGA 4USMA 1ZXNA 4AQYI 4JI4E 1Z5AA 1IBMI 4JI5I 1KTVA 1HNXE 4DV0I 4UTGA 1XNRI 4DUYE 1VISA 2CZ9A 2UXCE 1N33I 1Z0WA 4KQVA 4LF5I 4B3SI 3J81Q 4LFAE 1FWLA 3ZZTA 2VQFI 3LPSA 2GS8A 1XMOE 1XMQE 2HK3A 1EA6A 2A2DA 4R1FA 4M1KA 4JI1I 4DR7I 1RREA 1KKHA 1NZ0A 3QT6A 4GKKE 1Z5BA 4JI7I 1Z0VA 5IT9Q 3WU4A 4DU7A 4DV2E 3QT5A 1HNZE 4I3HA 1NHIA 4JI3E 4DV1I 4WUBA 1H73A 1N32E 3OTOI 3WU5A 4JI0E 3QT7A 4LF6E 4JYAI 4X66E 2V2ZA 1HR0E 4DR5I 1FNMA 2UU9I 4LF7E 3J7AG 5IWAE 4B3ME 2HFSA 2VQEI 1I94E 3ZZUA 2V2VA 4FWHA 4B3RI 4NXNE 2HK2A 4MYUA 3WU3A 1MU5A 1H72C 2DEJA 4NXME 4DR4E 2HFUA 4DV5E 4ZVIA 4HACA 2UUCI 4JI6I 1J5EE 4DU8A 3V5RA 2ZBKB 1DARA 2V34A 5BR8E 4DR6E 4JI2I 5LMUI 5LL6R 1MX0A 1PVGA 3ZKBA 2UXDI 1ZM4A 1ELOA 4X64E 4YY3E 4DPUA 4JI4I 2V8PA 1BKNA 1HNXI 2X7IA 3PYDA 3ZKDA 1FWKA 3ZZ0A 2A2CA 3PYEA 1IBLE 1XNQE 4DUYI 4DV4E 2UUBE 4X62E 1NHHA 4LF4E 1FJGE 2BM0A 4LFAI 4X65E 1H7UA 5A2QC 1N36E 1XMOI 1N34I 4UT4A 4GKJE 5L3JA 1Z59A 2LJPA 4DR3I 2NPFA 4LF8E 4EMDA 1K47A 3J7AM 2XEXA 4GKKI 3T1YI 4RPFA 2X36A 2Q2EB 3D4JA 4DV2I 3LNUA 2UXBE 3ZM7A 1UEKA 4K0KI 4JI3I 4LF5E 1N32I 2E5LE 2VQFE 4DV7E 3HULA 4JI0I 4LF6I 1RR9A 1Z0CA 4X66I 4HY1A 1FKAE 4JI7E 4FW9A 1EI1A 3Q1QA 5IWAI 4B3MI 4DXLA 4DV3E 1OJ4A 4DV6I 4FWDA 1MG7A 4YHHE 1I94I 5LMNE 3LTOA 2DEIA 4B3TI 4JYAE 2UUAI 4LFBI 4FWGA 1KIJA 5A2QQ 2HHHI 4NXMI 4KHPE 4DPTA 3CWVA 4DR4I 2UU9E 4DV5I 4JV5E 2ZM6E 1XHKA 1HNWE 1J5EI 1Z0TA 2VQEE 1NHJA 4LFCE 4DR6I 1D6TA 2F4VE 4P52A 2OI2A 4DR1E 4ED4A 1A6FA 4B3RE 4JI8E 4YY3I 1QZRA 4HYMA 4DUZE 1PKPA 3PYGA 2E1RA 1IBLI 2UUBI 4X62I 3B82A 1N0VC 4XTJA 4P7AA 2BV3A 3QT8A 4LF9E 3V2UC 2UXCI 4OX9E 1S16A 1ZM3A 4GKJI 1IBKE 1FI4A 2UXDE 2HKJA 4DR2E 1XMQI 1B63A 4LF8I 1Z0BA 4Z7CA 3K17A 1Z5CA 3T1HE 2R42A 4AQYE 1IBME 4JI5E 1S4EA 2UXBI 2BM1A 4FN5A 1Z0EA 1N0UA 4DV0E 4PRVA 1XNRE 2E5LI 4HACB 1HNZI 1WUUA 1N33E 4DV7I 1N34E 1Z0GA 1H7SA 4B3SE 3B78A 4USKA 1B62A 2WW4A 4DR3E 3JAMC 3WU6A 3K1JA 4JI1E 3T1YE 4Z7YA 4DR7E 2R3VA 5FLXC 1HR0I 2ZITA 3PYFA 4LF7I 4DV3I 4HXZA 4K0KE 2HKEA 4JG4A 4YHHI 5LMNI 4DV1E 3J80Q 3OTOE 4WUCA 4PRXA 3M6AA 4NXNI 4KHPI 3J81C 4DR5E 4JV5I 2ZM6I 1HNWI 3GONA 4DV6E 3B8HA 4PU9A 4LFCI 2F4VI 4DPYA 4MYTA 1ZXMA
chains in the Genus database with same CATH superfamily
3KRNA 5BR8I 4DR1I 4B3TE 4JI8I 5IT9C 1H74A 2UUAE 4IFDB 4LFBE 2O3ZA 1PIEA 4X64I 2VF3A 4WUDA 1ZM9A 4DUZI 2HHHE 2NN6D 2Z5EA 4FW7A 2AJ4A 2PNLA 2V2QA 1U2RA 3J80C 2PNZA 3JAMQ 4DPXA 2O1UA 4FW6A 4URLA 3H4LA 1XNQI 4DV4I 4LF9I 2UUCE 2J65A 3F0NA 4JI6E 4OX9I 4LF4I 2C38B 2J7KA 1FJGI 5FLXQ 1KVKA 4X65I 4OO1C 5GMDA 5GMEA 1N36I 1IBKI 4DR2I 4JI2E 5LMUE 1ZM2A 2WNRB 4DPWA 5JEAB 4IFDF 3M7NG 3H1CA 4LCFA 1P42A 2EFGA 2JEBA 2Z5CA 3T1HI 4USMA 2C39A 4MDTA 1ZXNA 4AQYI 4JI4E 1Z5AA 1IBMI 4JI5I 4OKGA 1KTVA 1HNXE 4DV0I 4LOMA 4UTGA 1XNRI 4DUYE 1VISA 2CZ9A 2UXCE 1N33I 1Z0WA 3P3GA 4KQVA 4LF5I 4B3SI 3J81Q 4LFAE 1FWLA 3ZZTA 2VQFI 3LPSA 2GS8A 1XMOE 1XMQE 2HK3A 5JEAF 1EA6A 2A2DA 2CVEA 4R1FA 3UHMA 4BA2A 4M1KA 1Y4SA 2CGEA 2VESA 4JI1I 4DR7I 1RREA 1KKHA 1NZ0A 3QT6A 4GKKE 1Z5BA 5K36B 4JI7I 4IZJA 1Z0VA 2PNZB 5IT9Q 4N3OA 3WU4A 4DU7A 4QNJA 4DV2E 2PO1B 1UDSA 3QT5A 1HNZE 4I3HA 1NHIA 5DROA 4JI3E 1R6LA 4WUBA 4DV1I 1H73A 1N32E 3P06A 3OTOI 4IFDC 3WU5A 1UDOA 4JI0E 3QT7A 4LF6E 1RHYA 2PNMA 4JYAI 2C37A 2JE6B 4X66E 2JEBB 2Z5CB 4IZJD 2V2ZA 1HR0E 4DR5I 5K36F 3M85G 1FNMA 2UU9I 4LF7E 1YHCA 3J7AG 5IWAE 4FW3A 4B3ME 4QNKA 5DRPA 2HFSA 2JT2A 5JEAC 2VQEI 1I94E 4MQYA 3P76A 3ZZUA 2V2VA 1Y60A 4FWHA 1UDQA 4B3RI 5ELWA 2HK2A 4NXNE 4MYUA 5C0XB 3WU3A 1MU5A 1H72C 5DRQA 2DEJA 3DD6A 2BA1G 4NXME 4DR4E 2HFUA 4DV5E 2BR2B 4ZVIA 4HACA 2UUCI 4JI6I 4MU1A 4LCHA 1J5EE 1OYSA 4DU8A 3V5RA 2BA0D 2ZBKB 1DARA 2V34A 3PS3A 5BR8E 4DR6E 1YH8A 2GO4A 2WP8A 5LMUI 4JI2I 5LL6R 1MX0A 1PVGA 3ZKBA 2UXDI 1Y5YA 4OO1E 1ZM4A 5K36C 1Y6ZA 1ELOA 5C0XF 4X64E 1E3HA 1Y4UA 2CG9A 4LPFA 2IESA 3B4TA 4YY3E 2IOPA 2PO0A 4DPUA 2O1VA 4JI4I 3HKMA 2V8PA 1BKNA 1HNXI 1XXEA 2X7IA 3PYDA 3ZKDA 1FWKA 3ZZ0A 2A2CA 3PYEA 4IZKB 1IBLE 2NN6B 1XNQE 4DUYI 4DV4E 2UUBE 3CDIA 4X62E 1NHHA 4LF4E 3U1YA 1FJGE 2BM0A 4OO1D 4LFAI 4X65E 1H7UA 5A2QC 1N36E 1XMOI 1N34I 4UT4A 4BA1B 4GKJE 5L3JA 1Z59A 2LJPA 3P3CA 4DR3I 2NPFA 4LF8E 4EMDA 1K47A 3J7AM 2XEXA 4GKKI 3T1YI 4RPFA 2X36A 2Q2EB 2NN6F 3D4JA 4DV2I 2GO3A 3LNUA 2UXBE 3ZM7A 1UEKA 4K0KI 4JI3I 3M7ND 4LF5E 1N32I 2E5LE 2VQFE 4DV7E 3HULA 4LCGA 4JI0I 5C0XC 4LF6I 1RR9A 2PO2A 4IFDA 4IFDE 1Z0CA 2O1WA 4X66I 3GLLA 4HY1A 1FKAE 3L7ZA 4JI7E 2C39B 4FW9A 1EI1A 3K85A 3Q1QA 5IWAI 1OYRA 4B3MI 2JEAA 4DXLA 5FWKA 4DV3E 1OJ4A 2C38A 4DV6I 2F1DA 4FWDA 1MG7A 4IS9A 4IFDD 2IERA 4YHHE 3GCMA 5LMNE 1I94I 3LTOA 2DEIA 2WNRA 5JEAA 5JEAE 4B3TI 4JYAE 4U3BA 2UUAI 4AM3A 4LFBI 4FWGA 1KIJA 1UDNA 4BA2B 5A2QQ 2HHHI 4NXMI 4KHPE 4DPTA 2NN6C 3CWVA 4DR4I 2UU9E 4DV5I 3U1KA 4JV5E 2ZM6E 1XHKA 4IZJB 1HNWE 1USUA 1J5EI 1Z0TA 5JEAD 2VQEE 1NHJA 4LFCE 4DR6I 1D6TA 2F4VE 4P52A 2OI2A 4MU3A 4DR1E 2PO2B 4ED4A 3M85D 1A6FA 4B3RE 4JI8E 4OO1A 3CDJA 4YY3I 1QZRA 4HYMA 2C37B 5K36A 4DUZE 5K36E 3L7ZB 5DNLA 1PKPA 3PYGA 2E1RA 2PO1A 1IBLI 2UUBI 2JEAB 4X62I 3B82A 1N0VC 4XTJA 4P7AA 3PS2A 4MU0A 2BV3A 2GQ0A 3QT8A 3V2UC 4LF9E 2UXCI 4OX9E 1USVA 2O1TA 1S16A 1ZM3A 4GKJI 1IBKE 2BA1D 1FI4A 2UXDE 2HKJA 4DR2E 1XMQI 5K36D 2JE6A 1B63A 4GQUA 4LF8I 1Z0BA 2Z5BA 2AE8A 4Z7CA 3K17A 1Z5CA 3T1HE 4J3DA 2IOQA 1R6MA 2R42A 4AQYE 1IBME 4JI5E 1S4EA 1VI7A 3NZKA 2UXBI 2BM1A 4FN5A 1Z0EA 1N0UA 4DV0E 3HJCA 4PRVA 1XNRE 2E5LI 4HACB 1HNZI 1WUUA 1N33E 4DV7I 1N34E 1OYPA 1Z0GA 4U3DA 1H7SA 3P3EA 4B3SE 3B78A 4USKA 1B62A 2WW4A 2WP8B 4DR3E 5C0XA 3JAMC 3WU6A 5C0XE 4OO1B 3PS1A 3K1JA 1HK7A 4JI1E 3T1YE 3PRYA 4Z7YA 4DR7E 2R3VA 5FLXC 2BR2A 1HR0I 2ZITA 3Q6NA 2PO0B 3PYFA 4LF7I 4OZEA 4AIMA 4HXZA 4DV3I 4K0KE 5EL9A 4AIDA 2HKEA 4JG4A 4YHHI 5LMNI 4DV1E 3J80Q 5C0XD 3OTOE 4MU4A 5DRRA 4WUCA 3Q6MA 4PRXA 4OO1F 2Z5BB 2BA0G 3M6AA 4NXNI 4KHPI 4NBQA 3J81C 3GMEA 4DR5E 4JV5I 2ZM6I 4IZKA 2NN6A 2NN6E 1HNWI 3GONA 4FW4A 1E3PA 5EKWA 4DV6E 4ISAA 3B8HA 4PU9A 4LFCI 4FW5A 2F4VI 4DPYA 4MYTA 4BA1A 5DNXA 1ZXMA
chains in the Genus database with same CATH topology
5BR8I 4DR1I 4B3TE 4JI8I 5IT9C 1H74A 2UUAE 4LFBE 1PIEA 4X64I 2VF3A 4WUDA 1ZM9A 4DUZI 2HHHE 2Z5EA 2AJ4A 2PNLA 2V2QA 1U2RA 3J80C 3JAMQ 4DPXA 2O1UA 4URLA 3H4LA 1XNQI 4DV4I 4LF9I 2UUCE 3F0NA 4JI6E 4OX9I 4LF4I 2J7KA 1FJGI 5FLXQ 1KVKA 4X65I 5GMDA 5GMEA 1N36I 1IBKI 4DR2I 4JI2E 5LMUE 1ZM2A 4DPWA 3T1HI 2EFGA 2Z5CA 4USMA 1ZXNA 4AQYI 4JI4E 1Z5AA 1IBMI 4JI5I 1KTVA 1HNXE 4DV0I 4UTGA 1XNRI 4DUYE 1VISA 2CZ9A 2UXCE 1N33I 1Z0WA 4KQVA 4LF5I 4B3SI 3J81Q 4LFAE 1FWLA 3ZZTA 2VQFI 3LPSA 2GS8A 1XMOE 1XMQE 2HK3A 1EA6A 2A2DA 4R1FA 4M1KA 1Y4SA 2CGEA 4JI1I 4DR7I 1RREA 1KKHA 1NZ0A 3QT6A 4GKKE 1Z5BA 4JI7I 4IZJA 1Z0VA 5IT9Q 4N3OA 3WU4A 4DU7A 4DV2E 3QT5A 1HNZE 4I3HA 1NHIA 4JI3E 4DV1I 4WUBA 1H73A 1N32E 3P06A 3OTOI 3WU5A 4JI0E 3QT7A 4LF6E 2PNMA 4JYAI 4X66E 2Z5CB 4IZJD 2V2ZA 1HR0E 4DR5I 1FNMA 2UU9I 4LF7E 3J7AG 5IWAE 4B3ME 2HFSA 2VQEI 1I94E 3ZZUA 2V2VA 4FWHA 4B3RI 4NXNE 2HK2A 4MYUA 3WU3A 1MU5A 1H72C 2DEJA 4NXME 4DR4E 2HFUA 4DV5E 4ZVIA 4HACA 2UUCI 4JI6I 1J5EE 4DU8A 3V5RA 2ZBKB 1DARA 2V34A 5BR8E 4DR6E 4JI2I 5LMUI 5LL6R 1MX0A 1PVGA 3ZKBA 2UXDI 1ZM4A 1Y6ZA 1ELOA 4X64E 1Y4UA 2CG9A 4YY3E 2IOPA 4DPUA 4JI4I 2O1VA 2V8PA 1BKNA 1HNXI 2X7IA 3PYDA 3ZKDA 1FWKA 3ZZ0A 2A2CA 3PYEA 4IZKB 1IBLE 1XNQE 4DUYI 4DV4E 2UUBE 4X62E 1NHHA 4LF4E 1FJGE 2BM0A 4LFAI 4X65E 1H7UA 5A2QC 1N36E 1XMOI 1N34I 4UT4A 4GKJE 5L3JA 1Z59A 2LJPA 4DR3I 2NPFA 4LF8E 4EMDA 1K47A 3J7AM 2XEXA 4GKKI 3T1YI 4RPFA 2X36A 2Q2EB 3D4JA 4DV2I 3LNUA 2UXBE 3ZM7A 1UEKA 4K0KI 4JI3I 4LF5E 1N32I 2E5LE 2VQFE 4DV7E 3HULA 4JI0I 4LF6I 1RR9A 1Z0CA 2O1WA 4X66I 4HY1A 1FKAE 4JI7E 4FW9A 1EI1A 3K85A 3Q1QA 5IWAI 4B3MI 4DXLA 5FWKA 4DV3E 1OJ4A 4DV6I 4FWDA 1MG7A 4YHHE 5LMNE 1I94I 3LTOA 2DEIA 4B3TI 4JYAE 2UUAI 4LFBI 4FWGA 1KIJA 5A2QQ 2HHHI 4NXMI 4KHPE 4DPTA 3CWVA 4DR4I 2UU9E 4DV5I 4JV5E 2ZM6E 1XHKA 4IZJB 1HNWE 1USUA 1J5EI 1Z0TA 2VQEE 1NHJA 4LFCE 4DR6I 1D6TA 2F4VE 4P52A 2OI2A 4DR1E 4ED4A 1A6FA 4B3RE 4JI8E 4YY3I 1QZRA 4HYMA 4DUZE 1PKPA 3PYGA 2E1RA 1IBLI 2UUBI 4X62I 3B82A 1N0VC 4XTJA 4P7AA 2BV3A 2GQ0A 3QT8A 3V2UC 4LF9E 2UXCI 4OX9E 1USVA 2O1TA 1S16A 1ZM3A 4GKJI 1IBKE 1FI4A 2UXDE 2HKJA 4DR2E 1XMQI 1B63A 4LF8I 1Z0BA 2Z5BA 4Z7CA 3K17A 1Z5CA 3T1HE 2IOQA 2R42A 4AQYE 1IBME 4JI5E 1S4EA 2UXBI 2BM1A 4FN5A 1Z0EA 1N0UA 4DV0E 3HJCA 4PRVA 1XNRE 2E5LI 4HACB 1HNZI 1WUUA 1N33E 4DV7I 1N34E 1Z0GA 1H7SA 4B3SE 3B78A 4USKA 1B62A 2WW4A 4DR3E 3JAMC 3WU6A 3K1JA 1HK7A 4JI1E 3T1YE 3PRYA 4Z7YA 4DR7E 2R3VA 5FLXC 1HR0I 2ZITA 3Q6NA 3PYFA 4LF7I 4DV3I 4HXZA 4K0KE 2HKEA 4JG4A 4YHHI 5LMNI 4DV1E 3J80Q 3OTOE 4WUCA 3Q6MA 4PRXA 2Z5BB 3M6AA 4NXNI 4KHPI 3J81C 4DR5E 4JV5I 2ZM6I 4IZKA 1HNWI 3GONA 4DV6E 3B8HA 4PU9A 4LFCI 2F4VI 4DPYA 4MYTA 1ZXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 I;  4DR1 I;  4B3T E;  4JI8 I;  5IT9 C;  1H74 A;  2UUA E;  4LFB E;  1PIE A;  4X64 I;  2VF3 A;  4WUD A;  1ZM9 A;  4DUZ I;  2HHH E;  2AJ4 A;  2V2Q A;  1U2R A;  3J80 C;  3JAM Q;  4DPX A;  4URL A;  3H4L A;  1XNQ I;  4DV4 I;  4LF9 I;  2UUC E;  3F0N A;  4JI6 E;  4OX9 I;  4LF4 I;  2J7K A;  1FJG I;  5FLX Q;  1KVK A;  4X65 I;  5GMD A;  1IBK I;  5GME A;  1N36 I;  4DR2 I;  4JI2 E;  5LMU E;  1ZM2 A;  4DPW A;  3T1H I;  2EFG A;  4USM A;  1ZXN A;  4AQY I;  4JI4 E;  1Z5A A;  1IBM I;  4JI5 I;  1KTV A;  1HNX E;  4DV0 I;  4UTG A;  1XNR I;  4DUY E;  1VIS A;  2CZ9 A;  2UXC E;  1N33 I;  1Z0W A;  4KQV A;  4LF5 I;  4B3S I;  3J81 Q;  4LFA E;  1FWL A;  3ZZT A;  2VQF I;  3LPS A;  2GS8 A;  1XMO E;  1XMQ E;  2HK3 A;  1EA6 A;  2A2D A;  4R1F A;  4M1K A;  4JI1 I;  4DR7 I;  1RRE A;  1KKH A;  1NZ0 A;  3QT6 A;  4GKK E;  1Z5B A;  4JI7 I;  1Z0V A;  5IT9 Q;  3WU4 A;  4DU7 A;  4DV2 E;  3QT5 A;  1HNZ E;  4I3H A;  1NHI A;  4JI3 E;  4DV1 I;  4WUB A;  1H73 A;  1N32 E;  3OTO I;  3WU5 A;  4JI0 E;  3QT7 A;  4LF6 E;  4JYA I;  4X66 E;  2V2Z A;  1HR0 E;  4DR5 I;  1FNM A;  2UU9 I;  4LF7 E;  3J7A G;  5IWA E;  4B3M E;  2HFS A;  2VQE I;  1I94 E;  3ZZU A;  2V2V A;  4FWH A;  4B3R I;  4NXN E;  2HK2 A;  4MYU A;  3WU3 A;  1MU5 A;  1H72 C;  2DEJ A;  4NXM E;  4DR4 E;  2HFU A;  4DV5 E;  4ZVI A;  4HAC A;  2UUC I;  4JI6 I;  1J5E E;  4DU8 A;  3V5R A;  2ZBK B;  1DAR A;  2V34 A;  5BR8 E;  4DR6 E;  4JI2 I;  5LMU I;  5LL6 R;  1MX0 A;  1PVG A;  3ZKB A;  2UXD I;  1ZM4 A;  1ELO A;  4X64 E;  4YY3 E;  4DPU A;  4JI4 I;  2V8P A;  1BKN A;  1HNX I;  2X7I A;  3PYD A;  3ZKD A;  1FWK A;  3ZZ0 A;  2A2C A;  3PYE A;  1IBL E;  1XNQ E;  4DUY I;  4DV4 E;  2UUB E;  4X62 E;  1NHH A;  4LF4 E;  1FJG E;  2BM0 A;  4LFA I;  4X65 E;  1H7U A;  5A2Q C;  1N36 E;  1XMO I;  1N34 I;  4UT4 A;  4GKJ E;  5L3J A;  1Z59 A;  2LJP A;  4DR3 I;  2NPF A;  4LF8 E;  4EMD A;  1K47 A;  3J7A M;  2XEX A;  4GKK I;  3T1Y I;  4RPF A;  2X36 A;  2Q2E B;  3D4J A;  4DV2 I;  3LNU A;  2UXB E;  3ZM7 A;  1UEK A;  4K0K I;  4JI3 I;  4LF5 E;  1N32 I;  2E5L E;  2VQF E;  4DV7 E;  3HUL A;  4JI0 I;  4LF6 I;  1RR9 A;  1Z0C A;  4X66 I;  4HY1 A;  1FKA E;  4JI7 E;  4FW9 A;  1EI1 A;  3Q1Q A;  5IWA I;  4B3M I;  4DXL A;  4DV3 E;  1OJ4 A;  4DV6 I;  4FWD A;  1MG7 A;  4YHH E;  1I94 I;  5LMN E;  3LTO A;  2DEI A;  4B3T I;  4JYA E;  2UUA I;  4LFB I;  4FWG A;  1KIJ A;  5A2Q Q;  2HHH I;  4NXM I;  4KHP E;  4DPT A;  3CWV A;  4DR4 I;  2UU9 E;  4DV5 I;  4JV5 E;  2ZM6 E;  1XHK A;  1HNW E;  1J5E I;  1Z0T A;  2VQE E;  1NHJ A;  4LFC E;  4DR6 I;  1D6T A;  2F4V E;  4P52 A;  2OI2 A;  4DR1 E;  4ED4 A;  1A6F A;  4B3R E;  4JI8 E;  4YY3 I;  1QZR A;  4HYM A;  4DUZ E;  1PKP A;  3PYG A;  2E1R A;  1IBL I;  2UUB I;  4X62 I;  3B82 A;  1N0V C;  4XTJ A;  4P7A A;  2BV3 A;  3QT8 A;  4LF9 E;  3V2U C;  2UXC I;  4OX9 E;  1S16 A;  1ZM3 A;  4GKJ I;  1IBK E;  1FI4 A;  2UXD E;  2HKJ A;  4DR2 E;  1XMQ I;  1B63 A;  4LF8 I;  1Z0B A;  4Z7C A;  3K17 A;  1Z5C A;  3T1H E;  2R42 A;  4AQY E;  1IBM E;  4JI5 E;  1S4E A;  2UXB I;  2BM1 A;  4FN5 A;  1Z0E A;  1N0U A;  4DV0 E;  4PRV A;  1XNR E;  2E5L I;  4HAC B;  1HNZ I;  1WUU A;  1N33 E;  4DV7 I;  1N34 E;  1Z0G A;  1H7S A;  4B3S E;  3B78 A;  4USK A;  1B62 A;  2WW4 A;  4DR3 E;  3JAM C;  3WU6 A;  3K1J A;  4JI1 E;  3T1Y E;  4Z7Y A;  4DR7 E;  2R3V A;  5FLX C;  1HR0 I;  2ZIT A;  3PYF A;  4LF7 I;  4DV3 I;  4HXZ A;  4K0K E;  2HKE A;  4JG4 A;  4YHH I;  5LMN I;  4DV1 E;  3J80 Q;  3OTO E;  4WUC A;  4PRX A;  3M6A A;  4NXN I;  4KHP I;  3J81 C;  4DR5 E;  4JV5 I;  2ZM6 I;  1HNW I;  3GON A;  4DV6 E;  3B8H A;  4PU9 A;  4LFC I;  2F4V I;  4DPY A;  4MYT A;  1ZXM A; 
#chains in the Genus database with same CATH topology
 3KRN A;  5BR8 I;  4DR1 I;  4B3T E;  4JI8 I;  5IT9 C;  1H74 A;  2UUA E;  4IFD B;  4LFB E;  2O3Z A;  1PIE A;  4X64 I;  2VF3 A;  4WUD A;  1ZM9 A;  4DUZ I;  2HHH E;  2NN6 D;  2Z5E A;  4FW7 A;  2AJ4 A;  2PNL A;  2V2Q A;  1U2R A;  3J80 C;  2PNZ A;  3JAM Q;  4DPX A;  2O1U A;  4FW6 A;  4URL A;  3H4L A;  1XNQ I;  4DV4 I;  4LF9 I;  2UUC E;  2J65 A;  3F0N A;  4JI6 E;  4OX9 I;  4LF4 I;  2C38 B;  2J7K A;  1FJG I;  5FLX Q;  1KVK A;  4X65 I;  4OO1 C;  5GMD A;  5GME A;  1N36 I;  1IBK I;  4DR2 I;  4JI2 E;  5LMU E;  1ZM2 A;  2WNR B;  4DPW A;  5JEA B;  4IFD F;  3M7N G;  3H1C A;  4LCF A;  1P42 A;  2EFG A;  2JEB A;  2Z5C A;  3T1H I;  4USM A;  2C39 A;  4MDT A;  1ZXN A;  4AQY I;  4JI4 E;  1Z5A A;  1IBM I;  4JI5 I;  4OKG A;  1KTV A;  1HNX E;  4DV0 I;  4LOM A;  4UTG A;  1XNR I;  4DUY E;  1VIS A;  2CZ9 A;  2UXC E;  1N33 I;  1Z0W A;  3P3G A;  4KQV A;  4LF5 I;  4B3S I;  3J81 Q;  4LFA E;  1FWL A;  3ZZT A;  2VQF I;  3LPS A;  2GS8 A;  1XMO E;  1XMQ E;  2HK3 A;  5JEA F;  1EA6 A;  2A2D A;  2CVE A;  4R1F A;  3UHM A;  4BA2 A;  4M1K A;  1Y4S A;  2CGE A;  2VES A;  4JI1 I;  4DR7 I;  1RRE A;  1KKH A;  1NZ0 A;  3QT6 A;  4GKK E;  1Z5B A;  5K36 B;  4JI7 I;  4IZJ A;  1Z0V A;  2PNZ B;  5IT9 Q;  4N3O A;  3WU4 A;  4DU7 A;  4QNJ A;  4DV2 E;  2PO1 B;  1UDS A;  3QT5 A;  1HNZ E;  4I3H A;  1NHI A;  5DRO A;  4JI3 E;  1R6L A;  4WUB A;  4DV1 I;  1H73 A;  1N32 E;  3P06 A;  3OTO I;  4IFD C;  3WU5 A;  1UDO A;  4JI0 E;  3QT7 A;  4LF6 E;  1RHY A;  2PNM A;  4JYA I;  2C37 A;  2JE6 B;  4X66 E;  2JEB B;  2Z5C B;  4IZJ D;  2V2Z A;  1HR0 E;  4DR5 I;  5K36 F;  3M85 G;  1FNM A;  2UU9 I;  4LF7 E;  1YHC A;  3J7A G;  5IWA E;  4FW3 A;  4B3M E;  4QNK A;  5DRP A;  2HFS A;  2JT2 A;  5JEA C;  2VQE I;  1I94 E;  4MQY A;  3P76 A;  3ZZU A;  2V2V A;  1Y60 A;  4FWH A;  1UDQ A;  4B3R I;  5ELW A;  2HK2 A;  4NXN E;  4MYU A;  5C0X B;  3WU3 A;  1MU5 A;  1H72 C;  5DRQ A;  2DEJ A;  3DD6 A;  2BA1 G;  4NXM E;  4DR4 E;  2HFU A;  4DV5 E;  2BR2 B;  4ZVI A;  4HAC A;  2UUC I;  4JI6 I;  4MU1 A;  4LCH A;  1J5E E;  1OYS A;  4DU8 A;  3V5R A;  2BA0 D;  2ZBK B;  1DAR A;  2V34 A;  3PS3 A;  5BR8 E;  4DR6 E;  1YH8 A;  2GO4 A;  2WP8 A;  5LMU I;  4JI2 I;  5LL6 R;  1MX0 A;  1PVG A;  3ZKB A;  2UXD I;  1Y5Y A;  4OO1 E;  1ZM4 A;  5K36 C;  1Y6Z A;  1ELO A;  5C0X F;  4X64 E;  1E3H A;  1Y4U A;  2CG9 A;  4LPF A;  2IES A;  3B4T A;  4YY3 E;  2IOP A;  2PO0 A;  4DPU A;  2O1V A;  4JI4 I;  3HKM A;  2V8P A;  1BKN A;  1HNX I;  1XXE A;  2X7I A;  3PYD A;  3ZKD A;  1FWK A;  3ZZ0 A;  2A2C A;  3PYE A;  4IZK B;  1IBL E;  2NN6 B;  1XNQ E;  4DUY I;  4DV4 E;  2UUB E;  3CDI A;  4X62 E;  1NHH A;  4LF4 E;  3U1Y A;  1FJG E;  2BM0 A;  4OO1 D;  4LFA I;  4X65 E;  1H7U A;  5A2Q C;  1N36 E;  1XMO I;  1N34 I;  4UT4 A;  4BA1 B;  4GKJ E;  5L3J A;  1Z59 A;  2LJP A;  3P3C A;  4DR3 I;  2NPF A;  4LF8 E;  4EMD A;  1K47 A;  3J7A M;  2XEX A;  4GKK I;  3T1Y I;  4RPF A;  2X36 A;  2Q2E B;  2NN6 F;  3D4J A;  4DV2 I;  2GO3 A;  3LNU A;  2UXB E;  3ZM7 A;  1UEK A;  4K0K I;  4JI3 I;  3M7N D;  4LF5 E;  1N32 I;  2E5L E;  2VQF E;  4DV7 E;  3HUL A;  4LCG A;  4JI0 I;  5C0X C;  4LF6 I;  1RR9 A;  2PO2 A;  4IFD A;  4IFD E;  1Z0C A;  2O1W A;  4X66 I;  3GLL A;  4HY1 A;  1FKA E;  3L7Z A;  4JI7 E;  2C39 B;  4FW9 A;  1EI1 A;  3K85 A;  3Q1Q A;  5IWA I;  1OYR A;  4B3M I;  2JEA A;  4DXL A;  5FWK A;  4DV3 E;  1OJ4 A;  2C38 A;  4DV6 I;  2F1D A;  4FWD A;  1MG7 A;  4IS9 A;  4IFD D;  2IER A;  4YHH E;  3GCM A;  5LMN E;  1I94 I;  3LTO A;  2DEI A;  2WNR A;  5JEA A;  5JEA E;  4B3T I;  4JYA E;  4U3B A;  2UUA I;  4AM3 A;  4LFB I;  4FWG A;  1KIJ A;  1UDN A;  4BA2 B;  5A2Q Q;  2HHH I;  4NXM I;  4KHP E;  4DPT A;  2NN6 C;  3CWV A;  4DR4 I;  2UU9 E;  4DV5 I;  3U1K A;  4JV5 E;  2ZM6 E;  1XHK A;  4IZJ B;  1HNW E;  1USU A;  1J5E I;  1Z0T A;  5JEA D;  2VQE E;  1NHJ A;  4LFC E;  4DR6 I;  1D6T A;  2F4V E;  4P52 A;  2OI2 A;  4MU3 A;  4DR1 E;  2PO2 B;  4ED4 A;  3M85 D;  1A6F A;  4B3R E;  4JI8 E;  4OO1 A;  3CDJ A;  4YY3 I;  1QZR A;  4HYM A;  2C37 B;  5K36 A;  4DUZ E;  5K36 E;  3L7Z B;  5DNL A;  1PKP A;  3PYG A;  2E1R A;  2PO1 A;  1IBL I;  2UUB I;  2JEA B;  4X62 I;  3B82 A;  1N0V C;  4XTJ A;  4P7A A;  3PS2 A;  4MU0 A;  2BV3 A;  2GQ0 A;  3QT8 A;  3V2U C;  4LF9 E;  2UXC I;  4OX9 E;  1USV A;  2O1T A;  1S16 A;  1ZM3 A;  4GKJ I;  1IBK E;  2BA1 D;  1FI4 A;  2UXD E;  2HKJ A;  4DR2 E;  1XMQ I;  5K36 D;  2JE6 A;  1B63 A;  4GQU A;  4LF8 I;  1Z0B A;  2Z5B A;  2AE8 A;  4Z7C A;  3K17 A;  1Z5C A;  3T1H E;  4J3D A;  2IOQ A;  1R6M A;  2R42 A;  4AQY E;  1IBM E;  4JI5 E;  1S4E A;  1VI7 A;  3NZK A;  2UXB I;  2BM1 A;  4FN5 A;  1Z0E A;  1N0U A;  4DV0 E;  3HJC A;  4PRV A;  1XNR E;  2E5L I;  4HAC B;  1HNZ I;  1WUU A;  1N33 E;  4DV7 I;  1N34 E;  1OYP A;  1Z0G A;  4U3D A;  1H7S A;  3P3E A;  4B3S E;  3B78 A;  4USK A;  1B62 A;  2WW4 A;  2WP8 B;  4DR3 E;  5C0X A;  3JAM C;  3WU6 A;  5C0X E;  4OO1 B;  3PS1 A;  3K1J A;  1HK7 A;  4JI1 E;  3T1Y E;  3PRY A;  4Z7Y A;  4DR7 E;  2R3V A;  5FLX C;  2BR2 A;  1HR0 I;  2ZIT A;  3Q6N A;  2PO0 B;  3PYF A;  4LF7 I;  4OZE A;  4AIM A;  4HXZ A;  4DV3 I;  4K0K E;  5EL9 A;  4AID A;  2HKE A;  4JG4 A;  4YHH I;  5LMN I;  4DV1 E;  3J80 Q;  5C0X D;  3OTO E;  4MU4 A;  5DRR A;  4WUC A;  3Q6M A;  4PRX A;  4OO1 F;  2Z5B B;  2BA0 G;  3M6A A;  4NXN I;  4KHP I;  4NBQ A;  3J81 C;  3GME A;  4DR5 E;  4JV5 I;  2ZM6 I;  4IZK A;  2NN6 A;  2NN6 E;  1HNW I;  3GON A;  4FW4 A;  1E3P A;  5EKW A;  4DV6 E;  4ISA A;  3B8H A;  4PU9 A;  4LFC I;  4FW5 A;  2F4V I;  4DPY A;  4MYT A;  4BA1 A;  5DNX A;  1ZXM A; 
#chains in the Genus database with same CATH homology
 5BR8 I;  4DR1 I;  4B3T E;  4JI8 I;  5IT9 C;  1H74 A;  2UUA E;  4LFB E;  1PIE A;  4X64 I;  2VF3 A;  4WUD A;  1ZM9 A;  4DUZ I;  2HHH E;  2Z5E A;  2AJ4 A;  2PNL A;  2V2Q A;  1U2R A;  3J80 C;  3JAM Q;  4DPX A;  2O1U A;  4URL A;  3H4L A;  1XNQ I;  4DV4 I;  4LF9 I;  2UUC E;  3F0N A;  4JI6 E;  4OX9 I;  4LF4 I;  2J7K A;  1FJG I;  5FLX Q;  1KVK A;  4X65 I;  5GMD A;  5GME A;  1N36 I;  1IBK I;  4DR2 I;  4JI2 E;  5LMU E;  1ZM2 A;  4DPW A;  3T1H I;  2EFG A;  2Z5C A;  4USM A;  1ZXN A;  4AQY I;  4JI4 E;  1Z5A A;  1IBM I;  4JI5 I;  1KTV A;  1HNX E;  4DV0 I;  4UTG A;  1XNR I;  4DUY E;  1VIS A;  2CZ9 A;  2UXC E;  1N33 I;  1Z0W A;  4KQV A;  4LF5 I;  4B3S I;  3J81 Q;  4LFA E;  1FWL A;  3ZZT A;  2VQF I;  3LPS A;  2GS8 A;  1XMO E;  1XMQ E;  2HK3 A;  1EA6 A;  2A2D A;  4R1F A;  4M1K A;  1Y4S A;  2CGE A;  4JI1 I;  4DR7 I;  1RRE A;  1KKH A;  1NZ0 A;  3QT6 A;  4GKK E;  1Z5B A;  4JI7 I;  4IZJ A;  1Z0V A;  5IT9 Q;  4N3O A;  3WU4 A;  4DU7 A;  4DV2 E;  3QT5 A;  1HNZ E;  4I3H A;  1NHI A;  4JI3 E;  4DV1 I;  4WUB A;  1H73 A;  1N32 E;  3P06 A;  3OTO I;  3WU5 A;  4JI0 E;  3QT7 A;  4LF6 E;  2PNM A;  4JYA I;  4X66 E;  2Z5C B;  4IZJ D;  2V2Z A;  1HR0 E;  4DR5 I;  1FNM A;  2UU9 I;  4LF7 E;  3J7A G;  5IWA E;  4B3M E;  2HFS A;  2VQE I;  1I94 E;  3ZZU A;  2V2V A;  4FWH A;  4B3R I;  4NXN E;  2HK2 A;  4MYU A;  3WU3 A;  1MU5 A;  1H72 C;  2DEJ A;  4NXM E;  4DR4 E;  2HFU A;  4DV5 E;  4ZVI A;  4HAC A;  2UUC I;  4JI6 I;  1J5E E;  4DU8 A;  3V5R A;  2ZBK B;  1DAR A;  2V34 A;  5BR8 E;  4DR6 E;  4JI2 I;  5LMU I;  5LL6 R;  1MX0 A;  1PVG A;  3ZKB A;  2UXD I;  1ZM4 A;  1Y6Z A;  1ELO A;  4X64 E;  1Y4U A;  2CG9 A;  4YY3 E;  2IOP A;  4DPU A;  4JI4 I;  2O1V A;  2V8P A;  1BKN A;  1HNX I;  2X7I A;  3PYD A;  3ZKD A;  1FWK A;  3ZZ0 A;  2A2C A;  3PYE A;  4IZK B;  1IBL E;  1XNQ E;  4DUY I;  4DV4 E;  2UUB E;  4X62 E;  1NHH A;  4LF4 E;  1FJG E;  2BM0 A;  4LFA I;  4X65 E;  1H7U A;  5A2Q C;  1N36 E;  1XMO I;  1N34 I;  4UT4 A;  4GKJ E;  5L3J A;  1Z59 A;  2LJP A;  4DR3 I;  2NPF A;  4LF8 E;  4EMD A;  1K47 A;  3J7A M;  2XEX A;  4GKK I;  3T1Y I;  4RPF A;  2X36 A;  2Q2E B;  3D4J A;  4DV2 I;  3LNU A;  2UXB E;  3ZM7 A;  1UEK A;  4K0K I;  4JI3 I;  4LF5 E;  1N32 I;  2E5L E;  2VQF E;  4DV7 E;  3HUL A;  4JI0 I;  4LF6 I;  1RR9 A;  1Z0C A;  2O1W A;  4X66 I;  4HY1 A;  1FKA E;  4JI7 E;  4FW9 A;  1EI1 A;  3K85 A;  3Q1Q A;  5IWA I;  4B3M I;  4DXL A;  5FWK A;  4DV3 E;  1OJ4 A;  4DV6 I;  4FWD A;  1MG7 A;  4YHH E;  5LMN E;  1I94 I;  3LTO A;  2DEI A;  4B3T I;  4JYA E;  2UUA I;  4LFB I;  4FWG A;  1KIJ A;  5A2Q Q;  2HHH I;  4NXM I;  4KHP E;  4DPT A;  3CWV A;  4DR4 I;  2UU9 E;  4DV5 I;  4JV5 E;  2ZM6 E;  1XHK A;  4IZJ B;  1HNW E;  1USU A;  1J5E I;  1Z0T A;  2VQE E;  1NHJ A;  4LFC E;  4DR6 I;  1D6T A;  2F4V E;  4P52 A;  2OI2 A;  4DR1 E;  4ED4 A;  1A6F A;  4B3R E;  4JI8 E;  4YY3 I;  1QZR A;  4HYM A;  4DUZ E;  1PKP A;  3PYG A;  2E1R A;  1IBL I;  2UUB I;  4X62 I;  3B82 A;  1N0V C;  4XTJ A;  4P7A A;  2BV3 A;  2GQ0 A;  3QT8 A;  3V2U C;  4LF9 E;  2UXC I;  4OX9 E;  1USV A;  2O1T A;  1S16 A;  1ZM3 A;  4GKJ I;  1IBK E;  1FI4 A;  2UXD E;  2HKJ A;  4DR2 E;  1XMQ I;  1B63 A;  4LF8 I;  1Z0B A;  2Z5B A;  4Z7C A;  3K17 A;  1Z5C A;  3T1H E;  2IOQ A;  2R42 A;  4AQY E;  1IBM E;  4JI5 E;  1S4E A;  2UXB I;  2BM1 A;  4FN5 A;  1Z0E A;  1N0U A;  4DV0 E;  3HJC A;  4PRV A;  1XNR E;  2E5L I;  4HAC B;  1HNZ I;  1WUU A;  1N33 E;  4DV7 I;  1N34 E;  1Z0G A;  1H7S A;  4B3S E;  3B78 A;  4USK A;  1B62 A;  2WW4 A;  4DR3 E;  3JAM C;  3WU6 A;  3K1J A;  1HK7 A;  4JI1 E;  3T1Y E;  3PRY A;  4Z7Y A;  4DR7 E;  2R3V A;  5FLX C;  1HR0 I;  2ZIT A;  3Q6N A;  3PYF A;  4LF7 I;  4DV3 I;  4HXZ A;  4K0K E;  2HKE A;  4JG4 A;  4YHH I;  5LMN I;  4DV1 E;  3J80 Q;  3OTO E;  4WUC A;  3Q6M A;  4PRX A;  2Z5B B;  3M6A A;  4NXN I;  4KHP I;  3J81 C;  4DR5 E;  4JV5 I;  2ZM6 I;  4IZK A;  1HNW I;  3GON A;  4DV6 E;  3B8H A;  4PU9 A;  4LFC I;  2F4V I;  4DPY A;  4MYT A;  1ZXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...