4K0KE

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4k0kE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4k0kE02
5LL6R 4WUBA 3HULA 2UXDI 1MG7A 1KTVA 2MDRA 1WUUA 3T1YE 4DPYA 4HACA 1VISA 4GKKI 4KHPE 1Z0CA 4I3HA 2NPFA 4DUZI 2HFUA 1QZRA 4X66E 4P7AA 4LF8I 3LPSA 1HNXI 3B8HA 4B3RI 1I94E 1Z0GA 1ZBTA 4NXNI 4PRVA 1DI2A 2BM1A 2Q2EB 1N32I 4DPUA 4JI1E 1XNQE 4DR6I 4PU9A 1IBKE 4LF4E 1S4EA 4JI7I 3ADGA 4JI6I 1X49A 2V2VA 3PYDA 4FW9A 1XMOI 3ZZ0A 1ZM4A 4GKJE 2HKJA 3T1HI 3Q1QA 4DV0E 3OTOI 1Z0TA 2UXBE 4DV5E 4FWGA 3ADIA 4HYMA 4LF5I 1Z0VA 4LFCI 5IT9Q 2L3CA 1FJGE 4DV1I 2XEXA 3J7AG 1Z5AA 2HKEA 4JI0E 1J5EI 1X47A 2UU9E 2L2MA 2N3GA 4DU7A 2VQFI 2ZM6I 1ZXNA 1WHQA 1HNWE 4LFAI 1Z0WA 4X8WA 4HACB 5FLXC 4B3SI 4MYUA 4JV5E 3ZKBA 2UUBE 1N33E 1KVKA 1HNZE 1J26A 2LJPA 2WW4A 2RTXA 1T4LB 4B3ME 3J7AM 3J7Yp 4DUYE 4OOGC 2NA2A 1H7SA 4WUCA 4WYQB 5L3JA 2ZITA 4ED4A 4DV2E 4DR7E 2UUCI 1FI4A 2JY9A 2LTRA 1U2RA 2RSMA 1IBLE 4LF6E 1XNRE 2X36A 4YHHE 4DU8A 5BR8E 1IBME 1DARA 1PIEA 4JI5I 2L3JA 2VQFE 4B3TI 2ZM6E 4WUDA 2HK3A 4M2ZA 4X62E 4LFBE 1RQ0A 2HK2A 4DR5I 2UXCI 2L2NA 4JI2E 2DMYA 1FWKA 2L2KB 1N36I 4X64E 4DR1I 5CFFE 3ADJA 4YY3E 1XMQI 1YYKA 5IT9C 3VYYA 5IWAE 3JAMQ 2NUEA 2GS8A 1BKNA 3LLHA 2DIXA 2A2DA 5LMUI 1Z5BA 1PKPA 4XTJA 4AQYE 4P52A 2N3HA 4JI3E 4DR2I 1NHIA 1FKAE 4DV3I 2LUQA 1K47A 3K1JA 2LJHA 1NZ0A 4NXMI 1RREA 4UTGA 3PYEA 2E5LE 4ZVIA 4JI8E 2UUAE 4FN5A 4DV6I 1YYWA 4DR3I 4JYAI 4M1KA 2UXDE 4DR1E 3CWVA 4GKKE 1XHKA 2BM0A 2X7IA 2R3VA 4DUZE 1RR9A 2YT4A 4JI4I 4LF8E 1Z0EA 1HNXE 5A2QQ 4B3RE 4NXNE 4LF7I 1OJ4A 2HHHI 1KKHA 3K17A 3F0NA 1N32E 1N0UA 4DV4I 4X65I 1ZM3A 4DR6E 3LNUA 1B62A 4JI7E 1UHZA 2B7TA 1N0VC 4JI6E 4DKKA 3ZZUA 1H7UA 2HFSA 1XMOE 2F4VI 4JG4A 1EA6A 3D4JA 4LF9I 3T1HE 1YZ9A 3ADLA 3LTOA 3OTOE 1MX0A 1NHJA 1HR0I 3JAMC 4LF5E 4R1FA 5GMEA 4LFCE 2B3TB 4DV1E 4DR4I 3ZM7A 3M6AA 1ELOA 2OI2A 4DV7I 1J5EE 4LF7E 2R42A 2RS6A 5LMNI 1Z5CA 4LFAE 1A6FA 1H73A 3T1YI 2VF3A 3C4BA 4B3SE 4KHPI 4DPTA 1MU5A 4X66I 2A2CA 2B7VA 4KQVA 1EKZA 4K0KI 4FWHA 2LTSA 2LRSA 2VQEI 1H74A 3PYFA 1EI1A 1KIJA 2LBSB 4JI1I 2UUCE 2E1RA 2V8PA 1IBKI 4LF4I 4MYTA 1Z59A 5A2QC 4HXZA 3C4TA 4DPXA 4USKA 4JI5E 2J7KA 2L33A 3J80Q 1T4NA 5LMNE 2NUGA 3GONA 4GKJI 4B3TE 1NHHA 2V34A 2BV3A 3QT7A 4DV0I 3HTXA 1H72C 4DV5I 2UXBI 1ZXMA 1T4OA 4EMDA 4DR5E 5GMDA 1UILA 2UXCE 1FJGI 4K0KE 3ZKDA 2NUFA 4RPFA 2CZ9A 2JVAA 1FNMA 4JI0I 1N36E 3B82A 2VQEE 2UU9I 2DEJA 1XMQE 1WHNA 1GQEA 1HNWI 1Z0BA 1FWLA 5LMUE 3J81Q 4JV5I 2UUBI 1N33I 4URLA 1HNZI 2CPNA 4B3MI 4DUYI 4DR2E 4DV3E 4NXME 2LUPB 2KHXA 4DV2I 4DR7I 4FWDA 3P1XA 1STUA 4DXLA 4HY1A 1IBLI 3H4LA 4LF6I 4DV6E 1XNRI 3B78A 4YHHI 4DR3E 5BR8I 1IBMI 4JYAE 1B63A 2ZBKB 3WU4A 4USMA 4PRXA 4X62I 4LFBI 2AJ4A 4Z7CA 2IHR1 4JI4E 1QU6A 4OX9I 4JI2I 4Z7YA 3J80C 4WFTA 3QT8A 2HHHE 1N34I 4DV4E 4X65E 3QT5A 4X64I 1RC7A 4DPWA 1X48A 4YY3I 3WU3A 3PYGA 1UEKA 5IWAI 2EZ6A 4M30A 2V2QA 2F4VE 4AQYI 4LF9E 1ZM9A 1I94I 4JI3I 1YYOA 3VYXA 2EFGA 4UT4A 3WU5A 1S16A 1HR0E 2DB2A 2RS7A 1ZM2A 1XNQI 2DEIA 3J81C 2E5LI 4JI8I 3QT6A 4DR4E 1O0WA 2UUAI 5FLXQ 1D6TA 4OX9E 3V5RA 3WU6A 3ZZTA 4DV7E 1PVGA 2V2ZA 3V2UC 1N34E
chains in the Genus database with same CATH superfamily
2JEBA 2YTPA 5LL6R 2F1DA 4WUBA 4BA2A 2YZTA 3HULA 1GTKA 1MG7A 2Z5CA 1KTVA 2R1FA 2MDRA 5A69A 1YFHA 1WUUA 2V83A 3T1YE 3L7ZA 4BBYA 4DPYA 4HACA 1VISA 4GKKI 2EPAA 4KHPE 1Z0CA 2IOPA 2EMFA 5AASA 2NPFA 4I3HA 2EMCA 2YTFA 2IERA 1KYQA 2EPNA 2YSPA 4DUZI 3H09A 3PS1A 2ODRC 2HFUA 1QZRA 4X66E 4P7AA 2JOBA 3PS3A 4LF8I 3LPSA 1HNXI 4NHRA 2WNRB 3B8HA 4B3RI 2EPPA 4RHBB 4R2CA 2DLQA 1EH6A 4O43A 1I94E 1VI7A 1Z0GA 5ADZA 4NZVA 1ZBTA 4NXNI 4PRVA 2O1WA 1DI2A 2BA1D 3M7ND 2BM1A 1OYSA 1YUIA 2EMBA 3C6MA 2NABA 2Q2EB 4IFDD 3FIGA 1N32I 4M0VA 2EQ3A 4DPUA 4J8ZA 4JI1E 2YTQA 1XNQE 4DR6I 1WRJA 4PU9A 1IBKE 3BGHA 4LF4E 1S4EA 4OO1A 4BCAA 3B4TA 4JI7I 1YHCA 2YTGA 2C38B 2JE6A 5IV8B 3ADGA 1F2IG 2DSYA 4JI6I 1YUJA 5JEAE 4U3BA 2A25A 2EWLA 1X49A 2V2VA 2ELZA 3PYDA 4FW9A 4MU3A 3ZZ0A 1XMOI 5K36E 1ZM4A 1P47A 4GKJE 2EM0A 2HKJA 3T1HI 2EOJA 3Q1QA 4ZYGA 4DV0E 3OTOI 2JEAB 2YTNA 1Z0TA 4R2SA 2UXBE 4DV5E 4FWGA 4QNKA 3ADIA 4FW6A 4IS1C 4HYMA 1N3GA 1PJTA 2YPNA 4LF5I 2GLIA 2EPZA 1JK2A 1Z0VA 4LFCI 2PO0B 2V88A 2L3CA 5IT9Q 4IZKA 1FJGE 4DV1I 2EOMA 4IZJB 2CTDA 2J7JA 1PJSA 2EL5A 2O1TA 2XEXA 3J7AG 3KZYA 1Z5AA 2HKEA 5KL3A 4JI0E 1J5EI 4O24A 1X47A 2LJUA 2UU9E 2L2MA 2N3GA 4BMJA 3PS2A 4DU7A 2VESA 2VQFI 5DRPA 2WZOA 2ZM6I 2JEBB 4BA2B 1ZXNA 1WXRA 1WHQA 4R2QA 1HNWE 2Z5CB 2RQLA 2L6MA 1X5WA 4MDTA 4LFAI 1HK7A 2LO3A 1Z0WA 5AC4A 2YTOA 3L7ZB 4X8WA 4LCHA 4HACB 2WBTA 5FLXC 4B3SI 2EN7A 2DLKA 2EMHA 2GO3A 3P06A 4IZJD 2AE8A 1USVA 4JV5E 4MYUA 3ZKBA 2UUBE 2WP8A 1N33E 2EOEA 2Z5EA 1KVKA 2JPAA 3ECRA 4FW3A 4R8OA 1HNZE 1YSAC 1J26A 1R6LA 2RTXA 2LJPA 2BB8A 2MKDA 1TF6A 1T4LB 4F6NA 4B3ME 3J7Yp 4DUYE 4MLVA 4OOGC 4R03A 1Y60A 3J7AM 2NA2A 1H7SA 4WUCA 4WYQB 1A1JA 5L3JA 3EPHA 2YRMA 4KZSA 2V86A 2HJJA 4HTGA 2ZITA 2C37A 3QG5C 4ED4A 4DV2E 4DR7E 2UUCI 4X9JA 2H36X 1WJPA 1FI4A 2J65A 2FGGA 2JY9A 2EE8A 2LTRA 1U2RA 1G2DC 2YRHA 4OO1B 2RSMA 1IBLE 4LF6E 2JE6B 1PJQA 4OO1F 4FK5C 1XNRE 3MHSC 1RMDA 2D9HA 2IOQA 2LV2A 4YHHE 2X36A 4LU9A 5BR8E 1EH7A 4DU8A 1IBME 5DNYA 1DARA 1PIEA 1JK1A 4JI5I 2L3JA 3HXLA 3ZOQB 4ISAA 2KONA 2IESA 2ENAA 2VQFE 4B3TI 2RSIA 2ZM6E 4WUDA 1QNTA 3THOB 2HK3A 2EM9A 2PNZA 4N3OA 2ENCA 2K4VA 4M2ZA 2LMZA 4X62E 1BBOA 4WXDA 4LFBE 1RQ0A 4WX9A 2HK2A 4DR5I 2RPCA 3BF2A 5LLQA 4F2JC 1A1KA 5JEAD 2UXCI 1E3PA 2L2NA 2ODRD 2JWOA 2DMYA 4JI2E 1FWKA 4IZKB 3IWBA 2EPLX 5K36D 2L2KB 2EP3A 2EJ4A 4IS9A 2YWQA 1N36I 2EPXA 2BBGA 4X64E 3UHMA 4DR1I 3Q6NA 5CFFE 3ADJA 4YY3E 5C0XA 2JT2A 2EN3A 1XMQI 1YYKA 5IT9C 4OO1C 1SR9A 3VYYA 5DROA 1EH8A 2E72A 5IWAE 3JAMQ 2NUEA 2GS8A 1BKNA 3LLHA 2DIXA 2A2DA 2LE2A 5LMUI 2O3ZA 3UK3C 2EM8A 1Z5BA 4MQYA 1PKPA 4LCFA 4XTJA 1Z1BA 4MLQA 2NN6C 3HPZA 4AQYE 4P52A 2WP8B 4BHCA 2DMIA 2CT1A 2EMYA 1ZR9A 4I8OA 2PNLA 3P3EA 2N3HA 2PO2A 4JI3E 4WPYA 4DR2I 2M7QA 1NHIA 1FKAE 4DV3I 2LUQA 1K47A 3K1JA 2LJHA 5DRQA 1NZ0A 4NXMI 5A6AA 1RREA 4UTGA 2M9AA 2C37B 3PYEA 3K6QA 2E5LE 4JI8E 4F9BB 2LT7A 2YTDA 4F6MA 2EOOA 4ZVIA 2EMWA 4BA1A 2JOXA 2M4IA 2ADRA 2EL4A 2UUAE 2BA1G 4O5GA 3M7NG 1DGCA 1Y4SA 4FN5A 1X3CA 4OZEA 2YTEA 2NN6A 2HC5A 4DV6I 1YYWA 4DR3I 2CGEA 5EL9A 1IMUA 4F9CB 4R2PA 1X6HA 4M1KA 5F3WA 4JYAI 2EOIA 2UXDE 1ZBQA 5KL4A 4DR1E 3CWVA 3DD6A 4AIMA 1A1LA 4P7DA 4MU4A 4NBQA 4GKKE 1XHKA 2VE7C 2BM0A 2X7IA 2R3VA 4J3DA 3MHHC 2PNZB 1UBDC 4FW5A 2EQ1A 4L8NA 4DUZE 2L8TA 1RR9A 2YT4A 4JI4I 4LF8E 1Z0EA 2EOZA 1HNXE 5A2QQ 4BC7A 4B3RE 2EOSA 2V8QB 4NXNE 4LF7I 1OJ4A 3EPJA 2JYAA 2HHHI 1KKHA 2EPKX 3F0NA 3GCMA 1N32E 2ENHA 3JTZA 1N0UA 2WW4A 3K17A 4DV4I 4X65I 2KOUA 1ZM3A 2E1MA 2F8BA 4DR6E 3LNUA 2EMXA 1B62A 4QNJA 2LVHA 4JI7E 5C0XB 1A1GA 4FW7A 1UHZA 2B7TA 1N0VC 5C0XF 1GZ6A 2EN2A 4JI6E 5AC5A 2YSOA 4DKKA 4L5NC 3ZZUA 2V89A 1H7UA 3HJCA 2HFSA 1XMOE 1OYPA 2CG9A 4AIDA 4LCGA 2F4VI 1T39A 1BBGA 3AV0A 5A6BD 3RMPA 1EA6A 1UDOA 4O4KA 4JG4A 1ZAAC 4WSPA 3T1HE 3D4JA 1YZ9A 3ADLA 4LF9I 1IQSA 2EN4A 3LTOA 3OTOE 5A6KA 4IFDA 2PO2B 1A1IA 5EKWA 4GQUA 2EN1A 1MX0A 1NHJA 2VF1A 4GZNC 1HR0I 2JR1A 3JAMC 1IQOA 3NZKA 1G2FC 4LF5E 2O1VA 4R1FA 5GMEA 4LFCE 2B3TB 1KJKA 4DV1E 5AE3A 4OKGA 2CVEA 3U1YA 4WSGA 3M85D 2VRDA 3ZM7A 2MKNA 1OYRA 3M6AA 4BA1B 4DR4I 2UXDI 2DGCA 2V85A 1ELOA 3F6GA 2OI2A 1SFEA 4DV7I 1J5EE 4LF7E 5TSEA 2NN6B 2RS6A 2R42A 2Z5BA 2YTJA 2NN6F 5LMNI 2YRKA 3HPSA 1Z5CA 2BA0D 1TF3A 5C0XC 4R2AA 3THNA 3K85A 4LFAE 1A6FA 1H73A 3T1YI 2VF3A 4AM3A 2YTIA 3C4BA 3TQMA 4B3SE 3F6HA 4KHPI 4OO1D 1E3HA 2EMAA 2N8XA 4DPTA 2PRTA 3GMEA 4F54A 1MU5A 4X66I 2A2CA 2B7VA 4KQVA 2EM3A 1EKZA 4K0KI 3L00A 3MSWA 2GO4A 1DQ3A 2NN6D 4FWHA 5ELWA 2LTSA 2BR2A 2C39A 2L92A 2LRSA 2VQEI 5DNLA 1H74A 3PYFA 1EI1A 4M9VC 1KIJA 2MC5A 3P3CA 2LBSB 4JI1I 2UUCE 5C0XE 2E1RA 2V8PA 2FTXB 4Q28A 1IBKI 4LF4I 1A1HA 4MYTA 1Z59A 1L4SA 5A2QC 1T38A 2EM5A 4HXZA 4BS9A 2I9IA 3C4TA 2EMLA 4DPXA 4USKA 4JI5E 2J7KA 1ZU1A 3H1CA 2L33A 4FW4A 3J80Q 1T4NA 5LMNE 2NUGA 1Y4UA 3GONA 3P76A 4B3TE 2DRPA 1NHHA 4U3DA 3IWCA 1RHYA 2BV3A 2V34A 1MEYC 3P3GA 3QT7A 1UN6B 3CDIA 4DV0I 3KWRA 3HTXA 4IFDB 3PRYA 3OMLA 4TUIA 1AAYA 2EM6A 2EOQA 2V2ZA 2PO1A 4IFDF 1Y6ZA 1H72C 4DV5I 2UXBI 2EN8A 2LCEA 1ZXMA 1T4OA 4EMDA 4DR5E 5GMDA 1UILA 4OO1E 5JEAC 5DNXA 2UXCE 2ELYA 1FJGI 5KL6A 2V87A 4K0KE 3ZKDA 2GHFA 5K36C 2YU8A 5KL2A 2NUFA 3BBGA 2EMZA 2NN6E 4RPFA 2CZ9A 4R2EA 2JVAA 1FNMA 4JI0I 1N36E 1NEIA 1B69A 3B82A 3AUZA 1BB8A 2VQEE 2Z5BB 2UU9I 2DEJA 2M1SA 1XMQE 1UDSA 2MDGA 1WHNA 3VK6A 1GQEA 1HNWI 1Z0BA 1FWLA 2K7IA 5LMUE 2G7HA 1LLMC 3J81Q 5JEAA 2EOHA 4TUGA 4JV5I 2UUBI 1Y5YA 1N33I 5DRRA 4URLA 5K36A 2FV4B 1HNZI 3M99B 2WBSA 2CPNA 2EM2A 4B3MI 4DUYI 4Q35B 4DR2E 4IFDC 4DV3E 2BR2B 2C39B 4LTYA 2EOXA 4RH8A 5A6JA 4NXME 2LUPB 1TN9A 2KHXA 4DV2I 2PNMA 4DR7I 4FWDA 3P1XA 4LPFA 3KRNA 1STUA 1YPNA 3JU0A 4DXLA 4HY1A 1IBLI 3H4LA 4LF6I 3C6KA 4DV6E 1XNRI 3B78A 4YHHI 4DR3E 5BR8I 2EPUA 1IBMI 4JYAE 3VHTB 4KWYA 4P78A 1A1FA 2R76A 3Q6MA 1B63A 3EPLA 4IFDE 3HQ1A 5IXMB 5AE2A 2ZBKB 3GLLA 3CDJA 2I13A 3WU4A 4USMA 5C0XD 2EM4A 4R2DA 2WBUA 3BIDA 1USUA 4PRXA 4X62I 4LFBI 2AJ4A 2PO1B 2JP9A 4LOMA 2EORA 3LMLA 2EMGA 1UDNA 2IHR1 2EPCA 4Z7CA 4GKJI 4JI4E 1QU6A 2EL6A 2WNRA 4MU1A 4HEIA 4N4RB 4BC9A 4OX9I 2MC6A 4JI2I 4Z7YA 3IWDA 3J80C 4WFTA 2EMIA 3EPKA 4DMIA 3QT8A 5T6JA 2HHHE 2EMKA 2B9DA 1N34I 4DV4E 1P42A 4X65E 3DJWA 3M85G 1X6EA 3QT5A 4X64I 2JXPA 1RC7A 2EOFA 4DPWA 1X48A 2YU5A 4YY3I 2O1UA 1XXEA 3U1KA 2C38A 3WU3A 3PYGA 1UEKA 5FWKA 2EM7A 5IWAI 2EPMX 2GQ0A 4IJDA 2EPOA 4M30A 2EZ6A 2BA0G 2V2QA 4GEQB 4ZYDA 3KZZA 5AE1A 2F4VE 5JEAB 4AQYI 5JEAF 4F9AB 1MGTA 2EQ0A 2WCC3 4LF9E 1X6FA 1UDQA 1ZM9A 1I94I 2JEAA 5K36B 2GPIA 2CSHA 4WXCA 4JI3I 5K36F 1YYOA 3VYXA 2EFGA 3HKMA 1NCSA 4UT4A 3WU5A 1S16A 4ZYHA 2DB2A 2RS7A 1HR0E 3EQ1A 3DF6A 1ZM2A 2EN6A 1XNQI 2PO0A 4MU0A 3J81C 1R6MA 2DEIA 5KL7A 2E5LI 4JI8I 4BHBA 3QT6A 2HGHA 4IZJA 4DR4E 2EPRA 1YH8A 1O0WA 2UUAI 5FLXQ 1D6TA 2EOYA 4OX9E 3V5RA 3WU6A 3ZZTA 1PDAA 1AH5A 5A6BA 4DV7E 4ZYEA 1PVGA 5KL5A 3V2UC 2Q8UA 4R2RA 1N34E
chains in the Genus database with same CATH topology
5LL6R 4WUBA 2YZTA 3HULA 1MG7A 2Z5CA 2UXDI 1KTVA 2MDRA 1WUUA 2V83A 3T1YE 4BBYA 4DPYA 4HACA 1VISA 4GKKI 4KHPE 1Z0CA 2IOPA 5AASA 2NPFA 4I3HA 4DUZI 3H09A 2ODRC 2HFUA 1QZRA 4X66E 4P7AA 2JOBA 4LF8I 3LPSA 1HNXI 3B8HA 4B3RI 1I94E 1Z0GA 5ADZA 1ZBTA 4NXNI 4PRVA 2O1WA 1DI2A 2BM1A 2Q2EB 3FIGA 1N32I 4M0VA 4DPUA 4J8ZA 4JI1E 1XNQE 4DR6I 4PU9A 1IBKE 4LF4E 1S4EA 4BCAA 4JI7I 3ADGA 2DSYA 4JI6I 2EWLA 1X49A 2V2VA 3PYDA 4FW9A 1XMOI 3ZZ0A 1ZM4A 4GKJE 2HKJA 3T1HI 3Q1QA 4DV0E 3OTOI 1Z0TA 2UXBE 4DV5E 4FWGA 3ADIA 4HYMA 4LF5I 1Z0VA 4LFCI 5IT9Q 2V88A 2L3CA 4IZKA 1FJGE 4DV1I 4IZJB 2O1TA 2XEXA 3J7AG 1Z5AA 2HKEA 4JI0E 1J5EI 1X47A 2UU9E 2L2MA 2N3GA 4BMJA 4DU7A 2VQFI 2WZOA 2ZM6I 1ZXNA 1WXRA 1WHQA 1HNWE 2Z5CB 2L6MA 4LFAI 1HK7A 1Z0WA 4X8WA 4HACB 5FLXC 4B3SI 3P06A 4MYUA 4IZJD 1USVA 4JV5E 3ZKBA 2UUBE 2Z5EA 1N33E 1KVKA 4R8OA 1HNZE 1J26A 2LJPA 2WW4A 2RTXA 1T4LB 4B3ME 3J7AM 3J7Yp 4DUYE 4OOGC 4R03A 2NA2A 1H7SA 4WUCA 4WYQB 5L3JA 4KZSA 2V86A 2ZITA 4ED4A 4DV2E 4DR7E 2UUCI 2H36X 1FI4A 2FGGA 2JY9A 2LTRA 1U2RA 2RSMA 1IBLE 4LF6E 1XNRE 2IOQA 2X36A 4YHHE 4DU8A 4LU9A 5BR8E 1IBME 5DNYA 1DARA 1PIEA 4JI5I 2L3JA 3HXLA 3ZOQB 2KONA 2VQFE 4B3TI 2ZM6E 4WUDA 2HK3A 4N3OA 2K4VA 4M2ZA 2LMZA 4X62E 4LFBE 1RQ0A 2HK2A 4DR5I 2UXCI 2L2NA 2ODRD 2JWOA 2DMYA 4JI2E 1FWKA 4IZKB 3IWBA 2L2KB 1N36I 4X64E 4DR1I 3Q6NA 5CFFE 3ADJA 4YY3E 1XMQI 1YYKA 5IT9C 1SR9A 3VYYA 5IWAE 3JAMQ 2NUEA 2GS8A 1BKNA 3LLHA 2DIXA 2A2DA 2LE2A 5LMUI 1Z5BA 1PKPA 4XTJA 3HPZA 4AQYE 4P52A 4I8OA 2PNLA 2N3HA 4JI3E 4WPYA 4DR2I 2M7QA 1NHIA 1FKAE 4DV3I 2LUQA 1K47A 3K1JA 2LJHA 1NZ0A 4NXMI 1RREA 4UTGA 3PYEA 3K6QA 2E5LE 4JI8E 4F9BB 4ZVIA 2JOXA 2M4IA 2UUAE 1Y4SA 4FN5A 4DV6I 1YYWA 4DR3I 2CGEA 4F9CB 4M1KA 4JYAI 5F3WA 2UXDE 1ZBQA 4DR1E 3CWVA 4P7DA 4GKKE 1XHKA 2VE7C 2BM0A 2X7IA 2R3VA 4L8NA 4DUZE 2L8TA 1RR9A 2YT4A 4JI4I 4LF8E 1Z0EA 1HNXE 5A2QQ 4BC7A 4B3RE 2V8QB 4NXNE 4LF7I 1OJ4A 2HHHI 1KKHA 3K17A 3F0NA 1N32E 3JTZA 1N0UA 4DV4I 4X65I 2KOUA 1ZM3A 2E1MA 2F8BA 4DR6E 3LNUA 1B62A 4JI7E 1UHZA 2B7TA 1N0VC 1GZ6A 4JI6E 4DKKA 4L5NC 3ZZUA 2V89A 1H7UA 3HJCA 2HFSA 1XMOE 2CG9A 2F4VI 4JG4A 3AV0A 3RMPA 1EA6A 3D4JA 4WSPA 3T1HE 4LF9I 1YZ9A 3ADLA 3LTOA 3OTOE 1MX0A 1NHJA 2VF1A 1HR0I 2JR1A 3JAMC 4LF5E 2O1VA 4R1FA 5GMEA 4LFCE 2B3TB 4DV1E 5AE3A 4DR4I 3ZM7A 3M6AA 2V85A 1ELOA 3F6GA 2OI2A 4DV7I 1J5EE 4LF7E 2R42A 2Z5BA 2RS6A 5LMNI 3HPSA 1Z5CA 3K85A 4LFAE 1A6FA 1H73A 3T1YI 2VF3A 3C4BA 4B3SE 3F6HA 4KHPI 4DPTA 4F54A 1MU5A 4X66I 2A2CA 2B7VA 4KQVA 1EKZA 4K0KI 3MSWA 4FWHA 1DQ3A 2LTSA 2L92A 2LRSA 2VQEI 1H74A 3PYFA 1EI1A 1KIJA 2MC5A 2LBSB 4JI1I 2UUCE 2E1RA 2V8PA 2FTXB 4Q28A 1IBKI 4LF4I 4MYTA 1Z59A 5A2QC 4HXZA 4BS9A 3C4TA 4DPXA 4USKA 4JI5E 2J7KA 2L33A 3J80Q 1T4NA 5LMNE 2NUGA 1Y4UA 3GONA 4GKJI 4B3TE 1NHHA 3IWCA 2V34A 2BV3A 3QT7A 4DV0I 3KWRA 3HTXA 3PRYA 3OMLA 4TUIA 1Y6ZA 1H72C 4DV5I 2UXBI 1ZXMA 1T4OA 4EMDA 4DR5E 5GMDA 1UILA 2UXCE 1FJGI 2V87A 4K0KE 3ZKDA 2NUFA 4RPFA 2CZ9A 2JVAA 1FNMA 4JI0I 1N36E 3B82A 3AUZA 2VQEE 2Z5BB 2UU9I 2DEJA 2M1SA 1XMQE 1WHNA 3VK6A 1GQEA 1HNWI 1Z0BA 1FWLA 5LMUE 2G7HA 3J81Q 4TUGA 4JV5I 2UUBI 1N33I 4URLA 2FV4B 1HNZI 2CPNA 4B3MI 4DUYI 4DR2E 4DV3E 4LTYA 4NXME 2LUPB 2KHXA 4DV2I 2PNMA 4DR7I 4FWDA 3P1XA 1STUA 3JU0A 4DXLA 4HY1A 1IBLI 3H4LA 4LF6I 4DV6E 1XNRI 3B78A 4YHHI 4DR3E 5BR8I 1IBMI 4JYAE 4P78A 3Q6MA 1B63A 3HQ1A 5AE2A 2ZBKB 3WU4A 4USMA 1USUA 4PRXA 4X62I 4LFBI 2AJ4A 3LMLA 4Z7CA 2IHR1 4JI4E 1QU6A 4BC9A 4OX9I 2MC6A 4JI2I 4Z7YA 3IWDA 3J80C 4WFTA 3QT8A 4DMIA 5T6JA 2HHHE 2B9DA 1N34I 4DV4E 4X65E 3DJWA 3QT5A 4X64I 1RC7A 4DPWA 1X48A 4YY3I 2O1UA 3WU3A 3PYGA 1UEKA 5FWKA 5IWAI 2GQ0A 2EZ6A 4M30A 2V2QA 4GEQB 5AE1A 2F4VE 4AQYI 4F9AB 4LF9E 1ZM9A 1I94I 4JI3I 1YYOA 3VYXA 2EFGA 4UT4A 3WU5A 1S16A 1HR0E 2DB2A 2RS7A 3DF6A 1ZM2A 1XNQI 3J81C 2DEIA 2E5LI 4JI8I 3QT6A 4IZJA 4DR4E 1O0WA 2UUAI 5FLXQ 1D6TA 4OX9E 3V5RA 3WU6A 3ZZTA 4DV7E 1PVGA 2V2ZA 3V2UC 1N34E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 R;  4WUB A;  3HUL A;  2UXD I;  1MG7 A;  1KTV A;  2MDR A;  1WUU A;  3T1Y E;  4DPY A;  4HAC A;  1VIS A;  4GKK I;  4KHP E;  1Z0C A;  4I3H A;  2NPF A;  4DUZ I;  2HFU A;  1QZR A;  4X66 E;  4P7A A;  4LF8 I;  3LPS A;  1HNX I;  3B8H A;  4B3R I;  1I94 E;  1Z0G A;  1ZBT A;  4NXN I;  4PRV A;  1DI2 A;  2BM1 A;  2Q2E B;  1N32 I;  4DPU A;  4JI1 E;  1XNQ E;  4DR6 I;  4PU9 A;  1IBK E;  4LF4 E;  1S4E A;  4JI7 I;  3ADG A;  4JI6 I;  1X49 A;  2V2V A;  3PYD A;  4FW9 A;  1XMO I;  3ZZ0 A;  1ZM4 A;  4GKJ E;  2HKJ A;  3T1H I;  3Q1Q A;  4DV0 E;  3OTO I;  1Z0T A;  2UXB E;  4DV5 E;  4FWG A;  3ADI A;  4HYM A;  4LF5 I;  1Z0V A;  4LFC I;  5IT9 Q;  2L3C A;  1FJG E;  4DV1 I;  2XEX A;  3J7A G;  1Z5A A;  2HKE A;  4JI0 E;  1J5E I;  1X47 A;  2UU9 E;  2L2M A;  2N3G A;  4DU7 A;  2VQF I;  2ZM6 I;  1ZXN A;  1WHQ A;  1HNW E;  4LFA I;  1Z0W A;  4X8W A;  4HAC B;  5FLX C;  4B3S I;  4MYU A;  4JV5 E;  3ZKB A;  2UUB E;  1N33 E;  1KVK A;  1HNZ E;  1J26 A;  2LJP A;  2WW4 A;  2RTX A;  1T4L B;  4B3M E;  3J7A M;  3J7Y p;  4DUY E;  4OOG C;  2NA2 A;  1H7S A;  4WUC A;  4WYQ B;  5L3J A;  2ZIT A;  4ED4 A;  4DV2 E;  4DR7 E;  2UUC I;  1FI4 A;  2JY9 A;  2LTR A;  1U2R A;  2RSM A;  1IBL E;  4LF6 E;  1XNR E;  2X36 A;  4YHH E;  4DU8 A;  5BR8 E;  1IBM E;  1DAR A;  1PIE A;  4JI5 I;  2L3J A;  2VQF E;  4B3T I;  2ZM6 E;  4WUD A;  2HK3 A;  4M2Z A;  4X62 E;  4LFB E;  1RQ0 A;  2HK2 A;  4DR5 I;  2UXC I;  2L2N A;  4JI2 E;  2DMY A;  1FWK A;  2L2K B;  1N36 I;  4X64 E;  4DR1 I;  5CFF E;  3ADJ A;  4YY3 E;  1XMQ I;  1YYK A;  5IT9 C;  3VYY A;  5IWA E;  3JAM Q;  2NUE A;  2GS8 A;  1BKN A;  3LLH A;  2DIX A;  2A2D A;  5LMU I;  1Z5B A;  1PKP A;  4XTJ A;  4AQY E;  4P52 A;  2N3H A;  4JI3 E;  4DR2 I;  1NHI A;  1FKA E;  4DV3 I;  2LUQ A;  1K47 A;  3K1J A;  2LJH A;  1NZ0 A;  4NXM I;  1RRE A;  4UTG A;  3PYE A;  2E5L E;  4ZVI A;  4JI8 E;  2UUA E;  4FN5 A;  4DV6 I;  1YYW A;  4DR3 I;  4JYA I;  4M1K A;  2UXD E;  4DR1 E;  3CWV A;  4GKK E;  1XHK A;  2BM0 A;  2X7I A;  2R3V A;  4DUZ E;  1RR9 A;  2YT4 A;  4JI4 I;  4LF8 E;  1Z0E A;  1HNX E;  5A2Q Q;  4B3R E;  4NXN E;  4LF7 I;  1OJ4 A;  2HHH I;  1KKH A;  3K17 A;  3F0N A;  1N32 E;  1N0U A;  4DV4 I;  4X65 I;  1ZM3 A;  4DR6 E;  3LNU A;  1B62 A;  4JI7 E;  1UHZ A;  2B7T A;  1N0V C;  4JI6 E;  4DKK A;  3ZZU A;  1H7U A;  2HFS A;  1XMO E;  2F4V I;  4JG4 A;  1EA6 A;  3D4J A;  4LF9 I;  3T1H E;  1YZ9 A;  3ADL A;  3LTO A;  3OTO E;  1MX0 A;  1NHJ A;  1HR0 I;  3JAM C;  4LF5 E;  4R1F A;  5GME A;  4LFC E;  2B3T B;  4DV1 E;  4DR4 I;  3ZM7 A;  3M6A A;  1ELO A;  2OI2 A;  4DV7 I;  1J5E E;  4LF7 E;  2R42 A;  2RS6 A;  5LMN I;  1Z5C A;  4LFA E;  1A6F A;  1H73 A;  3T1Y I;  2VF3 A;  3C4B A;  4B3S E;  4KHP I;  4DPT A;  1MU5 A;  4X66 I;  2A2C A;  2B7V A;  4KQV A;  1EKZ A;  4K0K I;  4FWH A;  2LTS A;  2LRS A;  2VQE I;  1H74 A;  3PYF A;  1EI1 A;  1KIJ A;  2LBS B;  4JI1 I;  2UUC E;  2E1R A;  2V8P A;  1IBK I;  4LF4 I;  4MYT A;  1Z59 A;  5A2Q C;  4HXZ A;  3C4T A;  4DPX A;  4USK A;  4JI5 E;  2J7K A;  2L33 A;  3J80 Q;  1T4N A;  5LMN E;  2NUG A;  3GON A;  4GKJ I;  4B3T E;  1NHH A;  2V34 A;  2BV3 A;  3QT7 A;  4DV0 I;  3HTX A;  1H72 C;  4DV5 I;  2UXB I;  1ZXM A;  1T4O A;  4EMD A;  4DR5 E;  5GMD A;  1UIL A;  2UXC E;  1FJG I;  4K0K E;  3ZKD A;  2NUF A;  4RPF A;  2CZ9 A;  2JVA A;  1FNM A;  4JI0 I;  1N36 E;  3B82 A;  2VQE E;  2UU9 I;  2DEJ A;  1XMQ E;  1WHN A;  1GQE A;  1HNW I;  1Z0B A;  1FWL A;  5LMU E;  3J81 Q;  4JV5 I;  2UUB I;  1N33 I;  4URL A;  1HNZ I;  2CPN A;  4B3M I;  4DUY I;  4DR2 E;  4DV3 E;  4NXM E;  2LUP B;  2KHX A;  4DV2 I;  4DR7 I;  4FWD A;  3P1X A;  1STU A;  4DXL A;  4HY1 A;  1IBL I;  3H4L A;  4LF6 I;  4DV6 E;  1XNR I;  3B78 A;  4YHH I;  4DR3 E;  5BR8 I;  1IBM I;  4JYA E;  1B63 A;  2ZBK B;  3WU4 A;  4USM A;  4PRX A;  4X62 I;  4LFB I;  2AJ4 A;  4Z7C A;  2IHR 1;  4JI4 E;  1QU6 A;  4OX9 I;  4JI2 I;  4Z7Y A;  3J80 C;  4WFT A;  3QT8 A;  2HHH E;  1N34 I;  4DV4 E;  4X65 E;  3QT5 A;  4X64 I;  1RC7 A;  4DPW A;  1X48 A;  4YY3 I;  3WU3 A;  3PYG A;  1UEK A;  5IWA I;  2EZ6 A;  4M30 A;  2V2Q A;  2F4V E;  4AQY I;  4LF9 E;  1ZM9 A;  1I94 I;  4JI3 I;  1YYO A;  3VYX A;  2EFG A;  4UT4 A;  3WU5 A;  1S16 A;  1HR0 E;  2DB2 A;  2RS7 A;  1ZM2 A;  1XNQ I;  2DEI A;  3J81 C;  2E5L I;  4JI8 I;  3QT6 A;  4DR4 E;  1O0W A;  2UUA I;  5FLX Q;  1D6T A;  4OX9 E;  3V5R A;  3WU6 A;  3ZZT A;  4DV7 E;  1PVG A;  2V2Z A;  3V2U C;  1N34 E; 
#chains in the Genus database with same CATH topology
 2JEB A;  2YTP A;  5LL6 R;  2F1D A;  4WUB A;  4BA2 A;  2YZT A;  3HUL A;  1GTK A;  1MG7 A;  2Z5C A;  1KTV A;  2R1F A;  2MDR A;  5A69 A;  1YFH A;  1WUU A;  2V83 A;  3T1Y E;  3L7Z A;  4BBY A;  4DPY A;  4HAC A;  1VIS A;  4GKK I;  2EPA A;  4KHP E;  1Z0C A;  2IOP A;  2EMF A;  5AAS A;  2NPF A;  4I3H A;  2EMC A;  2YTF A;  2IER A;  1KYQ A;  2EPN A;  2YSP A;  4DUZ I;  3H09 A;  3PS1 A;  2ODR C;  2HFU A;  1QZR A;  4X66 E;  4P7A A;  2JOB A;  3PS3 A;  4LF8 I;  3LPS A;  1HNX I;  4NHR A;  2WNR B;  3B8H A;  4B3R I;  2EPP A;  4RHB B;  4R2C A;  2DLQ A;  1EH6 A;  4O43 A;  1I94 E;  1VI7 A;  1Z0G A;  5ADZ A;  4NZV A;  1ZBT A;  4NXN I;  4PRV A;  2O1W A;  1DI2 A;  2BA1 D;  3M7N D;  2BM1 A;  1OYS A;  1YUI A;  2EMB A;  3C6M A;  2NAB A;  2Q2E B;  4IFD D;  3FIG A;  1N32 I;  4M0V A;  2EQ3 A;  4DPU A;  4J8Z A;  4JI1 E;  2YTQ A;  1XNQ E;  4DR6 I;  1WRJ A;  4PU9 A;  1IBK E;  3BGH A;  4LF4 E;  1S4E A;  4OO1 A;  4BCA A;  3B4T A;  4JI7 I;  1YHC A;  2YTG A;  2C38 B;  2JE6 A;  5IV8 B;  3ADG A;  1F2I G;  2DSY A;  4JI6 I;  1YUJ A;  5JEA E;  4U3B A;  2A25 A;  2EWL A;  1X49 A;  2V2V A;  2ELZ A;  3PYD A;  4FW9 A;  4MU3 A;  3ZZ0 A;  1XMO I;  5K36 E;  1ZM4 A;  1P47 A;  4GKJ E;  2EM0 A;  2HKJ A;  3T1H I;  2EOJ A;  3Q1Q A;  4ZYG A;  4DV0 E;  3OTO I;  2JEA B;  2YTN A;  1Z0T A;  4R2S A;  2UXB E;  4DV5 E;  4FWG A;  4QNK A;  3ADI A;  4FW6 A;  4IS1 C;  4HYM A;  1N3G A;  1PJT A;  2YPN A;  4LF5 I;  2GLI A;  2EPZ A;  1JK2 A;  1Z0V A;  4LFC I;  2PO0 B;  2V88 A;  2L3C A;  5IT9 Q;  4IZK A;  1FJG E;  4DV1 I;  2EOM A;  4IZJ B;  2CTD A;  2J7J A;  1PJS A;  2EL5 A;  2O1T A;  2XEX A;  3J7A G;  3KZY A;  1Z5A A;  2HKE A;  5KL3 A;  4JI0 E;  1J5E I;  4O24 A;  1X47 A;  2LJU A;  2UU9 E;  2L2M A;  2N3G A;  4BMJ A;  3PS2 A;  4DU7 A;  2VES A;  2VQF I;  5DRP A;  2WZO A;  2ZM6 I;  2JEB B;  4BA2 B;  1ZXN A;  1WXR A;  1WHQ A;  4R2Q A;  1HNW E;  2Z5C B;  2RQL A;  2L6M A;  1X5W A;  4MDT A;  4LFA I;  1HK7 A;  2LO3 A;  1Z0W A;  5AC4 A;  2YTO A;  3L7Z B;  4X8W A;  4LCH A;  4HAC B;  2WBT A;  5FLX C;  4B3S I;  2EN7 A;  2DLK A;  2EMH A;  2GO3 A;  3P06 A;  4IZJ D;  2AE8 A;  1USV A;  4JV5 E;  4MYU A;  3ZKB A;  2UUB E;  2WP8 A;  1N33 E;  2EOE A;  2Z5E A;  1KVK A;  2JPA A;  3ECR A;  4FW3 A;  4R8O A;  1HNZ E;  1YSA C;  1J26 A;  1R6L A;  2RTX A;  2LJP A;  2BB8 A;  2MKD A;  1TF6 A;  1T4L B;  4F6N A;  4B3M E;  3J7Y p;  4DUY E;  4MLV A;  4OOG C;  4R03 A;  1Y60 A;  3J7A M;  2NA2 A;  1H7S A;  4WUC A;  4WYQ B;  1A1J A;  5L3J A;  3EPH A;  2YRM A;  4KZS A;  2V86 A;  2HJJ A;  4HTG A;  2ZIT A;  2C37 A;  3QG5 C;  4ED4 A;  4DV2 E;  4DR7 E;  2UUC I;  4X9J A;  2H36 X;  1WJP A;  1FI4 A;  2J65 A;  2FGG A;  2JY9 A;  2EE8 A;  2LTR A;  1U2R A;  1G2D C;  2YRH A;  4OO1 B;  2RSM A;  1IBL E;  4LF6 E;  2JE6 B;  1PJQ A;  4OO1 F;  4FK5 C;  1XNR E;  3MHS C;  1RMD A;  2D9H A;  2IOQ A;  2LV2 A;  4YHH E;  2X36 A;  4LU9 A;  5BR8 E;  1EH7 A;  4DU8 A;  1IBM E;  5DNY A;  1DAR A;  1PIE A;  1JK1 A;  4JI5 I;  2L3J A;  3HXL A;  3ZOQ B;  4ISA A;  2KON A;  2IES A;  2ENA A;  2VQF E;  4B3T I;  2RSI A;  2ZM6 E;  4WUD A;  1QNT A;  3THO B;  2HK3 A;  2EM9 A;  2PNZ A;  4N3O A;  2ENC A;  2K4V A;  4M2Z A;  2LMZ A;  4X62 E;  1BBO A;  4WXD A;  4LFB E;  1RQ0 A;  4WX9 A;  2HK2 A;  4DR5 I;  2RPC A;  3BF2 A;  5LLQ A;  4F2J C;  1A1K A;  5JEA D;  2UXC I;  1E3P A;  2L2N A;  2ODR D;  2JWO A;  2DMY A;  4JI2 E;  1FWK A;  4IZK B;  3IWB A;  2EPL X;  5K36 D;  2L2K B;  2EP3 A;  2EJ4 A;  4IS9 A;  2YWQ A;  1N36 I;  2EPX A;  2BBG A;  4X64 E;  3UHM A;  4DR1 I;  3Q6N A;  5CFF E;  3ADJ A;  4YY3 E;  5C0X A;  2JT2 A;  2EN3 A;  1XMQ I;  1YYK A;  5IT9 C;  4OO1 C;  1SR9 A;  3VYY A;  5DRO A;  1EH8 A;  2E72 A;  5IWA E;  3JAM Q;  2NUE A;  2GS8 A;  1BKN A;  3LLH A;  2DIX A;  2A2D A;  2LE2 A;  5LMU I;  2O3Z A;  3UK3 C;  2EM8 A;  1Z5B A;  4MQY A;  1PKP A;  4LCF A;  4XTJ A;  1Z1B A;  4MLQ A;  2NN6 C;  3HPZ A;  4AQY E;  4P52 A;  2WP8 B;  4BHC A;  2DMI A;  2CT1 A;  2EMY A;  1ZR9 A;  4I8O A;  2PNL A;  3P3E A;  2N3H A;  2PO2 A;  4JI3 E;  4WPY A;  4DR2 I;  2M7Q A;  1NHI A;  1FKA E;  4DV3 I;  2LUQ A;  1K47 A;  3K1J A;  2LJH A;  5DRQ A;  1NZ0 A;  4NXM I;  5A6A A;  1RRE A;  4UTG A;  2M9A A;  2C37 B;  3PYE A;  3K6Q A;  2E5L E;  4JI8 E;  4F9B B;  2LT7 A;  2YTD A;  4F6M A;  2EOO A;  4ZVI A;  2EMW A;  4BA1 A;  2JOX A;  2M4I A;  2ADR A;  2EL4 A;  2UUA E;  2BA1 G;  4O5G A;  3M7N G;  1DGC A;  1Y4S A;  4FN5 A;  1X3C A;  4OZE A;  2YTE A;  2NN6 A;  2HC5 A;  4DV6 I;  1YYW A;  4DR3 I;  2CGE A;  5EL9 A;  1IMU A;  4F9C B;  4R2P A;  1X6H A;  4M1K A;  5F3W A;  4JYA I;  2EOI A;  2UXD E;  1ZBQ A;  5KL4 A;  4DR1 E;  3CWV A;  3DD6 A;  4AIM A;  1A1L A;  4P7D A;  4MU4 A;  4NBQ A;  4GKK E;  1XHK A;  2VE7 C;  2BM0 A;  2X7I A;  2R3V A;  4J3D A;  3MHH C;  2PNZ B;  1UBD C;  4FW5 A;  2EQ1 A;  4L8N A;  4DUZ E;  2L8T A;  1RR9 A;  2YT4 A;  4JI4 I;  4LF8 E;  1Z0E A;  2EOZ A;  1HNX E;  5A2Q Q;  4BC7 A;  4B3R E;  2EOS A;  2V8Q B;  4NXN E;  4LF7 I;  1OJ4 A;  3EPJ A;  2JYA A;  2HHH I;  1KKH A;  2EPK X;  3F0N A;  3GCM A;  1N32 E;  2ENH A;  3JTZ A;  1N0U A;  2WW4 A;  3K17 A;  4DV4 I;  4X65 I;  2KOU A;  1ZM3 A;  2E1M A;  2F8B A;  4DR6 E;  3LNU A;  2EMX A;  1B62 A;  4QNJ A;  2LVH A;  4JI7 E;  5C0X B;  1A1G A;  4FW7 A;  1UHZ A;  2B7T A;  1N0V C;  5C0X F;  1GZ6 A;  2EN2 A;  4JI6 E;  5AC5 A;  2YSO A;  4DKK A;  4L5N C;  3ZZU A;  2V89 A;  1H7U A;  3HJC A;  2HFS A;  1XMO E;  1OYP A;  2CG9 A;  4AID A;  4LCG A;  2F4V I;  1T39 A;  1BBG A;  3AV0 A;  5A6B D;  3RMP A;  1EA6 A;  1UDO A;  4O4K A;  4JG4 A;  1ZAA C;  4WSP A;  3T1H E;  3D4J A;  1YZ9 A;  3ADL A;  4LF9 I;  1IQS A;  2EN4 A;  3LTO A;  3OTO E;  5A6K A;  4IFD A;  2PO2 B;  1A1I A;  5EKW A;  4GQU A;  2EN1 A;  1MX0 A;  1NHJ A;  2VF1 A;  4GZN C;  1HR0 I;  2JR1 A;  3JAM C;  1IQO A;  3NZK A;  1G2F C;  4LF5 E;  2O1V A;  4R1F A;  5GME A;  4LFC E;  2B3T B;  1KJK A;  4DV1 E;  5AE3 A;  4OKG A;  2CVE A;  3U1Y A;  4WSG A;  3M85 D;  2VRD A;  3ZM7 A;  2MKN A;  1OYR A;  3M6A A;  4BA1 B;  4DR4 I;  2UXD I;  2DGC A;  2V85 A;  1ELO A;  3F6G A;  2OI2 A;  1SFE A;  4DV7 I;  1J5E E;  4LF7 E;  5TSE A;  2NN6 B;  2RS6 A;  2R42 A;  2Z5B A;  2YTJ A;  2NN6 F;  5LMN I;  2YRK A;  3HPS A;  1Z5C A;  2BA0 D;  1TF3 A;  5C0X C;  4R2A A;  3THN A;  3K85 A;  4LFA E;  1A6F A;  1H73 A;  3T1Y I;  2VF3 A;  4AM3 A;  2YTI A;  3C4B A;  3TQM A;  4B3S E;  3F6H A;  4KHP I;  4OO1 D;  1E3H A;  2EMA A;  2N8X A;  4DPT A;  2PRT A;  3GME A;  4F54 A;  1MU5 A;  4X66 I;  2A2C A;  2B7V A;  4KQV A;  2EM3 A;  1EKZ A;  4K0K I;  3L00 A;  3MSW A;  2GO4 A;  1DQ3 A;  2NN6 D;  4FWH A;  5ELW A;  2LTS A;  2BR2 A;  2C39 A;  2L92 A;  2LRS A;  2VQE I;  5DNL A;  1H74 A;  3PYF A;  1EI1 A;  4M9V C;  1KIJ A;  2MC5 A;  3P3C A;  2LBS B;  4JI1 I;  2UUC E;  5C0X E;  2E1R A;  2V8P A;  2FTX B;  4Q28 A;  1IBK I;  4LF4 I;  1A1H A;  4MYT A;  1Z59 A;  1L4S A;  5A2Q C;  1T38 A;  2EM5 A;  4HXZ A;  4BS9 A;  2I9I A;  3C4T A;  2EML A;  4DPX A;  4USK A;  4JI5 E;  2J7K A;  1ZU1 A;  3H1C A;  2L33 A;  4FW4 A;  3J80 Q;  1T4N A;  5LMN E;  2NUG A;  1Y4U A;  3GON A;  3P76 A;  4B3T E;  2DRP A;  1NHH A;  4U3D A;  3IWC A;  1RHY A;  2BV3 A;  2V34 A;  1MEY C;  3P3G A;  3QT7 A;  1UN6 B;  3CDI A;  4DV0 I;  3KWR A;  3HTX A;  4IFD B;  3PRY A;  3OML A;  4TUI A;  1AAY A;  2EM6 A;  2EOQ A;  2V2Z A;  2PO1 A;  4IFD F;  1Y6Z A;  1H72 C;  4DV5 I;  2UXB I;  2EN8 A;  2LCE A;  1ZXM A;  1T4O A;  4EMD A;  4DR5 E;  5GMD A;  1UIL A;  4OO1 E;  5JEA C;  5DNX A;  2UXC E;  2ELY A;  1FJG I;  5KL6 A;  2V87 A;  4K0K E;  3ZKD A;  2GHF A;  5K36 C;  2YU8 A;  5KL2 A;  2NUF A;  3BBG A;  2EMZ A;  2NN6 E;  4RPF A;  2CZ9 A;  4R2E A;  2JVA A;  1FNM A;  4JI0 I;  1N36 E;  1NEI A;  1B69 A;  3B82 A;  3AUZ A;  1BB8 A;  2VQE E;  2Z5B B;  2UU9 I;  2DEJ A;  2M1S A;  1XMQ E;  1UDS A;  2MDG A;  1WHN A;  3VK6 A;  1GQE A;  1HNW I;  1Z0B A;  1FWL A;  2K7I A;  5LMU E;  2G7H A;  1LLM C;  3J81 Q;  5JEA A;  2EOH A;  4TUG A;  4JV5 I;  2UUB I;  1Y5Y A;  1N33 I;  5DRR A;  4URL A;  5K36 A;  2FV4 B;  1HNZ I;  3M99 B;  2WBS A;  2CPN A;  2EM2 A;  4B3M I;  4DUY I;  4Q35 B;  4DR2 E;  4IFD C;  4DV3 E;  2BR2 B;  2C39 B;  4LTY A;  2EOX A;  4RH8 A;  5A6J A;  4NXM E;  2LUP B;  1TN9 A;  2KHX A;  4DV2 I;  2PNM A;  4DR7 I;  4FWD A;  3P1X A;  4LPF A;  3KRN A;  1STU A;  1YPN A;  3JU0 A;  4DXL A;  4HY1 A;  1IBL I;  3H4L A;  4LF6 I;  3C6K A;  4DV6 E;  1XNR I;  3B78 A;  4YHH I;  4DR3 E;  5BR8 I;  2EPU A;  1IBM I;  4JYA E;  3VHT B;  4KWY A;  4P78 A;  1A1F A;  2R76 A;  3Q6M A;  1B63 A;  3EPL A;  4IFD E;  3HQ1 A;  5IXM B;  5AE2 A;  2ZBK B;  3GLL A;  3CDJ A;  2I13 A;  3WU4 A;  4USM A;  5C0X D;  2EM4 A;  4R2D A;  2WBU A;  3BID A;  1USU A;  4PRX A;  4X62 I;  4LFB I;  2AJ4 A;  2PO1 B;  2JP9 A;  4LOM A;  2EOR A;  3LML A;  2EMG A;  1UDN A;  2IHR 1;  2EPC A;  4Z7C A;  4GKJ I;  4JI4 E;  1QU6 A;  2EL6 A;  2WNR A;  4MU1 A;  4HEI A;  4N4R B;  4BC9 A;  4OX9 I;  2MC6 A;  4JI2 I;  4Z7Y A;  3IWD A;  3J80 C;  4WFT A;  2EMI A;  3EPK A;  4DMI A;  3QT8 A;  5T6J A;  2HHH E;  2EMK A;  2B9D A;  1N34 I;  4DV4 E;  1P42 A;  4X65 E;  3DJW A;  3M85 G;  1X6E A;  3QT5 A;  4X64 I;  2JXP A;  1RC7 A;  2EOF A;  4DPW A;  1X48 A;  2YU5 A;  4YY3 I;  2O1U A;  1XXE A;  3U1K A;  2C38 A;  3WU3 A;  3PYG A;  1UEK A;  5FWK A;  2EM7 A;  5IWA I;  2EPM X;  2GQ0 A;  4IJD A;  2EPO A;  4M30 A;  2EZ6 A;  2BA0 G;  2V2Q A;  4GEQ B;  4ZYD A;  3KZZ A;  5AE1 A;  2F4V E;  5JEA B;  4AQY I;  5JEA F;  4F9A B;  1MGT A;  2EQ0 A;  2WCC 3;  4LF9 E;  1X6F A;  1UDQ A;  1ZM9 A;  1I94 I;  2JEA A;  5K36 B;  2GPI A;  2CSH A;  4WXC A;  4JI3 I;  5K36 F;  1YYO A;  3VYX A;  2EFG A;  3HKM A;  1NCS A;  4UT4 A;  3WU5 A;  1S16 A;  4ZYH A;  2DB2 A;  2RS7 A;  1HR0 E;  3EQ1 A;  3DF6 A;  1ZM2 A;  2EN6 A;  1XNQ I;  2PO0 A;  4MU0 A;  3J81 C;  1R6M A;  2DEI A;  5KL7 A;  2E5L I;  4JI8 I;  4BHB A;  3QT6 A;  2HGH A;  4IZJ A;  4DR4 E;  2EPR A;  1YH8 A;  1O0W A;  2UUA I;  5FLX Q;  1D6T A;  2EOY A;  4OX9 E;  3V5R A;  3WU6 A;  3ZZT A;  1PDA A;  1AH5 A;  5A6B A;  4DV7 E;  4ZYE A;  1PVG A;  5KL5 A;  3V2U C;  2Q8U A;  4R2R A;  1N34 E; 
#chains in the Genus database with same CATH homology
 5LL6 R;  4WUB A;  2YZT A;  3HUL A;  1MG7 A;  2Z5C A;  2UXD I;  1KTV A;  2MDR A;  1WUU A;  2V83 A;  3T1Y E;  4BBY A;  4DPY A;  4HAC A;  1VIS A;  4GKK I;  4KHP E;  1Z0C A;  2IOP A;  5AAS A;  2NPF A;  4I3H A;  4DUZ I;  3H09 A;  2ODR C;  2HFU A;  1QZR A;  4X66 E;  4P7A A;  2JOB A;  4LF8 I;  3LPS A;  1HNX I;  3B8H A;  4B3R I;  1I94 E;  1Z0G A;  5ADZ A;  1ZBT A;  4NXN I;  4PRV A;  2O1W A;  1DI2 A;  2BM1 A;  2Q2E B;  3FIG A;  1N32 I;  4M0V A;  4DPU A;  4J8Z A;  4JI1 E;  1XNQ E;  4DR6 I;  4PU9 A;  1IBK E;  4LF4 E;  1S4E A;  4BCA A;  4JI7 I;  3ADG A;  2DSY A;  4JI6 I;  2EWL A;  1X49 A;  2V2V A;  3PYD A;  4FW9 A;  1XMO I;  3ZZ0 A;  1ZM4 A;  4GKJ E;  2HKJ A;  3T1H I;  3Q1Q A;  4DV0 E;  3OTO I;  1Z0T A;  2UXB E;  4DV5 E;  4FWG A;  3ADI A;  4HYM A;  4LF5 I;  1Z0V A;  4LFC I;  5IT9 Q;  2V88 A;  2L3C A;  4IZK A;  1FJG E;  4DV1 I;  4IZJ B;  2O1T A;  2XEX A;  3J7A G;  1Z5A A;  2HKE A;  4JI0 E;  1J5E I;  1X47 A;  2UU9 E;  2L2M A;  2N3G A;  4BMJ A;  4DU7 A;  2VQF I;  2WZO A;  2ZM6 I;  1ZXN A;  1WXR A;  1WHQ A;  1HNW E;  2Z5C B;  2L6M A;  4LFA I;  1HK7 A;  1Z0W A;  4X8W A;  4HAC B;  5FLX C;  4B3S I;  3P06 A;  4MYU A;  4IZJ D;  1USV A;  4JV5 E;  3ZKB A;  2UUB E;  2Z5E A;  1N33 E;  1KVK A;  4R8O A;  1HNZ E;  1J26 A;  2LJP A;  2WW4 A;  2RTX A;  1T4L B;  4B3M E;  3J7A M;  3J7Y p;  4DUY E;  4OOG C;  4R03 A;  2NA2 A;  1H7S A;  4WUC A;  4WYQ B;  5L3J A;  4KZS A;  2V86 A;  2ZIT A;  4ED4 A;  4DV2 E;  4DR7 E;  2UUC I;  2H36 X;  1FI4 A;  2FGG A;  2JY9 A;  2LTR A;  1U2R A;  2RSM A;  1IBL E;  4LF6 E;  1XNR E;  2IOQ A;  2X36 A;  4YHH E;  4DU8 A;  4LU9 A;  5BR8 E;  1IBM E;  5DNY A;  1DAR A;  1PIE A;  4JI5 I;  2L3J A;  3HXL A;  3ZOQ B;  2KON A;  2VQF E;  4B3T I;  2ZM6 E;  4WUD A;  2HK3 A;  4N3O A;  2K4V A;  4M2Z A;  2LMZ A;  4X62 E;  4LFB E;  1RQ0 A;  2HK2 A;  4DR5 I;  2UXC I;  2L2N A;  2ODR D;  2JWO A;  2DMY A;  4JI2 E;  1FWK A;  4IZK B;  3IWB A;  2L2K B;  1N36 I;  4X64 E;  4DR1 I;  3Q6N A;  5CFF E;  3ADJ A;  4YY3 E;  1XMQ I;  1YYK A;  5IT9 C;  1SR9 A;  3VYY A;  5IWA E;  3JAM Q;  2NUE A;  2GS8 A;  1BKN A;  3LLH A;  2DIX A;  2A2D A;  2LE2 A;  5LMU I;  1Z5B A;  1PKP A;  4XTJ A;  3HPZ A;  4AQY E;  4P52 A;  4I8O A;  2PNL A;  2N3H A;  4JI3 E;  4WPY A;  4DR2 I;  2M7Q A;  1NHI A;  1FKA E;  4DV3 I;  2LUQ A;  1K47 A;  3K1J A;  2LJH A;  1NZ0 A;  4NXM I;  1RRE A;  4UTG A;  3PYE A;  3K6Q A;  2E5L E;  4JI8 E;  4F9B B;  4ZVI A;  2JOX A;  2M4I A;  2UUA E;  1Y4S A;  4FN5 A;  4DV6 I;  1YYW A;  4DR3 I;  2CGE A;  4F9C B;  4M1K A;  4JYA I;  5F3W A;  2UXD E;  1ZBQ A;  4DR1 E;  3CWV A;  4P7D A;  4GKK E;  1XHK A;  2VE7 C;  2BM0 A;  2X7I A;  2R3V A;  4L8N A;  4DUZ E;  2L8T A;  1RR9 A;  2YT4 A;  4JI4 I;  4LF8 E;  1Z0E A;  1HNX E;  5A2Q Q;  4BC7 A;  4B3R E;  2V8Q B;  4NXN E;  4LF7 I;  1OJ4 A;  2HHH I;  1KKH A;  3K17 A;  3F0N A;  1N32 E;  3JTZ A;  1N0U A;  4DV4 I;  4X65 I;  2KOU A;  1ZM3 A;  2E1M A;  2F8B A;  4DR6 E;  3LNU A;  1B62 A;  4JI7 E;  1UHZ A;  2B7T A;  1N0V C;  1GZ6 A;  4JI6 E;  4DKK A;  4L5N C;  3ZZU A;  2V89 A;  1H7U A;  3HJC A;  2HFS A;  1XMO E;  2CG9 A;  2F4V I;  4JG4 A;  3AV0 A;  3RMP A;  1EA6 A;  3D4J A;  4WSP A;  3T1H E;  4LF9 I;  1YZ9 A;  3ADL A;  3LTO A;  3OTO E;  1MX0 A;  1NHJ A;  2VF1 A;  1HR0 I;  2JR1 A;  3JAM C;  4LF5 E;  2O1V A;  4R1F A;  5GME A;  4LFC E;  2B3T B;  4DV1 E;  5AE3 A;  4DR4 I;  3ZM7 A;  3M6A A;  2V85 A;  1ELO A;  3F6G A;  2OI2 A;  4DV7 I;  1J5E E;  4LF7 E;  2R42 A;  2Z5B A;  2RS6 A;  5LMN I;  3HPS A;  1Z5C A;  3K85 A;  4LFA E;  1A6F A;  1H73 A;  3T1Y I;  2VF3 A;  3C4B A;  4B3S E;  3F6H A;  4KHP I;  4DPT A;  4F54 A;  1MU5 A;  4X66 I;  2A2C A;  2B7V A;  4KQV A;  1EKZ A;  4K0K I;  3MSW A;  4FWH A;  1DQ3 A;  2LTS A;  2L92 A;  2LRS A;  2VQE I;  1H74 A;  3PYF A;  1EI1 A;  1KIJ A;  2MC5 A;  2LBS B;  4JI1 I;  2UUC E;  2E1R A;  2V8P A;  2FTX B;  4Q28 A;  1IBK I;  4LF4 I;  4MYT A;  1Z59 A;  5A2Q C;  4HXZ A;  4BS9 A;  3C4T A;  4DPX A;  4USK A;  4JI5 E;  2J7K A;  2L33 A;  3J80 Q;  1T4N A;  5LMN E;  2NUG A;  1Y4U A;  3GON A;  4GKJ I;  4B3T E;  1NHH A;  3IWC A;  2V34 A;  2BV3 A;  3QT7 A;  4DV0 I;  3KWR A;  3HTX A;  3PRY A;  3OML A;  4TUI A;  1Y6Z A;  1H72 C;  4DV5 I;  2UXB I;  1ZXM A;  1T4O A;  4EMD A;  4DR5 E;  5GMD A;  1UIL A;  2UXC E;  1FJG I;  2V87 A;  4K0K E;  3ZKD A;  2NUF A;  4RPF A;  2CZ9 A;  2JVA A;  1FNM A;  4JI0 I;  1N36 E;  3B82 A;  3AUZ A;  2VQE E;  2Z5B B;  2UU9 I;  2DEJ A;  2M1S A;  1XMQ E;  1WHN A;  3VK6 A;  1GQE A;  1HNW I;  1Z0B A;  1FWL A;  5LMU E;  2G7H A;  3J81 Q;  4TUG A;  4JV5 I;  2UUB I;  1N33 I;  4URL A;  2FV4 B;  1HNZ I;  2CPN A;  4B3M I;  4DUY I;  4DR2 E;  4DV3 E;  4LTY A;  4NXM E;  2LUP B;  2KHX A;  4DV2 I;  2PNM A;  4DR7 I;  4FWD A;  3P1X A;  1STU A;  3JU0 A;  4DXL A;  4HY1 A;  1IBL I;  3H4L A;  4LF6 I;  4DV6 E;  1XNR I;  3B78 A;  4YHH I;  4DR3 E;  5BR8 I;  1IBM I;  4JYA E;  4P78 A;  3Q6M A;  1B63 A;  3HQ1 A;  5AE2 A;  2ZBK B;  3WU4 A;  4USM A;  1USU A;  4PRX A;  4X62 I;  4LFB I;  2AJ4 A;  3LML A;  4Z7C A;  2IHR 1;  4JI4 E;  1QU6 A;  4BC9 A;  4OX9 I;  2MC6 A;  4JI2 I;  4Z7Y A;  3IWD A;  3J80 C;  4WFT A;  3QT8 A;  4DMI A;  5T6J A;  2HHH E;  2B9D A;  1N34 I;  4DV4 E;  4X65 E;  3DJW A;  3QT5 A;  4X64 I;  1RC7 A;  4DPW A;  1X48 A;  4YY3 I;  2O1U A;  3WU3 A;  3PYG A;  1UEK A;  5FWK A;  5IWA I;  2GQ0 A;  2EZ6 A;  4M30 A;  2V2Q A;  4GEQ B;  5AE1 A;  2F4V E;  4AQY I;  4F9A B;  4LF9 E;  1ZM9 A;  1I94 I;  4JI3 I;  1YYO A;  3VYX A;  2EFG A;  4UT4 A;  3WU5 A;  1S16 A;  1HR0 E;  2DB2 A;  2RS7 A;  3DF6 A;  1ZM2 A;  1XNQ I;  3J81 C;  2DEI A;  2E5L I;  4JI8 I;  3QT6 A;  4IZJ A;  4DR4 E;  1O0W A;  2UUA I;  5FLX Q;  1D6T A;  4OX9 E;  3V5R A;  3WU6 A;  3ZZT A;  4DV7 E;  1PVG A;  2V2Z A;  3V2U C;  1N34 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...