4K0KE

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4k0kE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4k0kE02
2HK2A 4DR4I 2R42A 4USKA 4DUZE 1PKPA 1X48A 1I94E 2V2ZA 4WUCA 3ZM7A 2F4VI 4DV1E 2A2CA 2VQEE 2NUFA 4PRXA 1XHKA 4OX9I 3QT8A 2UU9I 4DV5I 1EI1A 4OOGC 3T1YI 4JYAI 2HKEA 4HXZA 2HHHE 1S16A 1IBKE 2V2VA 1Z0EA 1Z0BA 1NZ0A 4JI3I 1N34E 5GMDA 4DPXA 4I3HA 3V2UC 1N36I 4JV5E 1U2RA 1DARA 4ZVIA 1FWKA 3GONA 1S4EA 5FLXC 1NHJA 2LBSB 1T4OA 1O0WA 4FW9A 4MYTA 1J26A 4DV0I 1RREA 4X66E 4JI1I 4JI4I 4DU8A 1YZ9A 3WU4A 4DU7A 5IT9C 4DR5E 3ZZ0A 4DV7I 4DV6E 4UT4A 3VYXA 4JI8E 2V8PA 3JAMQ 1RQ0A 4YY3E 3K17A 2BV3A 5A2QC 3ADGA 2NUEA 3QT6A 2RSMA 1WHQA 4NXNE 3LPSA 2LUQA 5LMNI 4FWHA 2KHXA 2VQFI 4K0KI 4GKKE 5LL6R 3B82A 4B3TI 2L2MA 4LFCI 1Z5AA 3K1JA 4JI2E 3PYEA 2ZBKB 4FWDA 4DV3E 3QT5A 3QT7A 1OJ4A 1RR9A 2X7IA 2E1RA 4DR2I 1XNQI 4LF8I 2EFGA 1PIEA 4DR3I 4LF4I 1HNXE 4NXME 4X65E 4KQVA 4DR6E 1FKAE 4LF5E 4FN5A 2LJHA 4R1FA 1X49A 2DEJA 1HR0E 3P1XA 2LTRA 4DUZI 2GS8A 4Z7CA 3V5RA 1H7SA 1DI2A 3ZZTA 1I94I 5IT9Q 2DEIA 2RTXA 1FI4A 2UUCE 2BM0A 2NA2A 1FWLA 2VQEI 4DPUA 5LMUE 3CWVA 3PYFA 1XNRI 5IWAI 3J7AG 4AQYE 4X62I 3B8HA 1EKZA 4WYQB 2HHHI 2LJPA 4WUDA 1NHIA 2AJ4A 4DXLA 1N32I 1WHNA 4DUYE 4DR1E 1N34I 2UXDE 4X64I 1STUA 5BR8E 4RPFA 2ZM6E 3VYYA 1XMQE 3M6AA 2UXBE 2UUAE 2CZ9A 2MDRA 3LLHA 4WUBA 1Z0GA 2V34A 3LNUA 2E5LE 1X47A 3J7Yp 2R3VA 3OTOE 4DR5I 4DV6I 4JI5E 3WU3A 4YY3I 4B3RI 4DR7E 1B62A 1H72C 1FJGI 4JI7I 4B3ME 2V2QA 4HACB 1ZM9A 1ELOA 4LF9E 5CFFE 1T4NA 2LUPB 2CPNA 1QU6A 4JI6E 4LFBI 2DMYA 2JVAA 1Z5BA 4LFAE 2UXCI 1KKHA 1ZBTA 3T1HE 1HNWE 1N0UA 3C4TA 2UUBE 2F4VE 1HNXI 4DPYA 4NXMI 1WUUA 4LF7I 4DR6I 4JG4A 1HNZI 2RS7A 1YYKA 2UU9E 4DV5E 2Q2EB 3T1YE 1IBLI 3F0NA 3HTXA 1ZM4A 3C4BA 4JI3E 4DV2E 2N3HA 1N36E 4LF6E 1XMOI 4B3SI 2UUCI 1N33I 1BKNA 4XTJA 1RC7A 1B63A 4M2ZA 4AQYI 4URLA 2HFUA 2BM1A 4GKJE 1MG7A 2WW4A 4DR1I 2DB2A 2UXDI 2ZM6I 1XMQI 2UXBI 1N0VC 1EA6A 4HYMA 5LMNE 4DV1I 3PYDA 4M1KA 4K0KE 4EMDA 3J81C 3OTOI 2A2DA 1Z0TA 4JI5I 1IBKI 4X8WA 4DPTA 2J7KA 3ADIA 2HK3A 4FWGA 3D4JA 4PU9A 2YT4A 1ZM3A 4DR2E 1XNQE 4JV5I 4LF8E 4DR3E 4P52A 1K47A 4YHHE 1NHHA 1VISA 2L3JA 4DV4E 1PVGA 3HULA 3J80Q 4LF9I 4USMA 1J5EE 2B3TB 3PYGA 1IBME 4JI6I 4X66I 2VF3A 1MU5A 4JI8I 4LFAI 2X36A 1GQEA 4JI0E 1ZXNA 2JY9A 3T1HI 5GMEA 1HNWI 2L3CA 2N3GA 2UUBI 4NXNI 4WFTA 2L2KB 1H7UA 4KHPE 4MYUA 4GKKI 1XNRE 2B7VA 1Z0VA 5IWAE 1H73A 1YYWA 4X62E 2EZ6A 4DR4E 2DIXA 4JI2I 2LRSA 1N32E 3J81Q 4DV3I 4DV2I 4P7AA 3ADJA 4X64E 4LF6I 1QZRA 1T4LB 1ZM2A 1Z59A 2XEXA 2OI2A 4X65I 4LF5I 4OX9E 1FNMA 1HR0I 4GKJI 4JYAE 3ZKBA 1KVKA 4DKKA 4B3RE 2L33A 2IHR1 3WU5A 4ED4A 3ADLA 1FJGE 3J80C 4JI7E 1UEKA 3H4LA 4Z7YA 1Z5CA 1A6FA 3Q1QA 5LMUI 2RS6A 1H74A 1MX0A 4M30A 2HFSA 4DV0E 1KTVA 4LFBE 4JI4E 4JI1E 4HACA 1UILA 4DV7E 2NUGA 2UXCE 4DUYI 1ZXMA 5BR8I 1Z0CA 2B7TA 2UUAI 4YHHI 4DV4I 4LF7E 1J5EI 3J7AM 1KIJA 3ZKDA 2E5LI 2VQFE 2ZITA 1HNZE 4B3TE 2HKJA 4PRVA 4LFCE 1IBMI 1YYOA 5FLXQ 5L3JA 3ZZUA 1IBLE 2LTSA 1D6TA 4JI0I 2L2NA 4DPWA 4DR7I 2NPFA 4B3MI 1XMOE 4B3SE 3LTOA 1N33E 4UTGA 4LF4E 1UHZA 3B78A 4KHPI 4HY1A 1Z0WA 5A2QQ 3JAMC 3WU6A
chains in the Genus database with same CATH superfamily
2HK2A 3M99B 5AE1A 4DR4I 2R42A 4ZYHA 2PO2A 5A6JA 4USKA 5K36C 4DUZE 3BGHA 2HGHA 3LMLA 1PKPA 4OZEA 2EPOA 4F9CB 2ELYA 1X48A 2EOFA 2ODRC 1YUJA 2JEBA 1I94E 2V2ZA 4WUCA 3ZM7A 2F4VI 4DV1E 2A2CA 2VQEE 1A1IA 3MHHC 1PDAA 2NUFA 4PRXA 4WX9A 2EOOA 5C0XE 1XHKA 4OX9I 2LV2A 3GMEA 3QT8A 2YPNA 4AIDA 2UU9I 5DRRA 1P42A 4DV5I 1EI1A 4OOGC 2YU8A 2DGCA 2HKEA 3T1YI 4JYAI 2VRDA 2EOHA 2HHHE 2EMFA 2V85A 1S16A 4HXZA 4R2DA 1IBKE 2EMAA 2V2VA 1G2FC 5TSEA 5K36A 1Z0EA 1Z0BA 4IJDA 1NZ0A 3DJWA 4JI3I 1N34E 5GMDA 4DPXA 4I3HA 3V2UC 4Q28A 4JV5E 2MKDA 1U2RA 2CGEA 1N36I 1TN9A 1DARA 4ZVIA 1ZBQA 5AE2A 3P3EA 1FWKA 4ZYDA 2JE6B 3GONA 1S4EA 5FLXC 2EN8A 4L8NA 1NHJA 3EQ1A 2EOIA 4MQYA 1VI7A 2LBSB 1T4OA 1USUA 1O0WA 2YTFA 2Z5CA 3Q6NA 4FW9A 4MYTA 1J26A 5DNLA 3U1KA 1RREA 4DV0I 4X66E 4JI1I 4JI4I 4DU8A 1YZ9A 3WU4A 4MU3A 4DU7A 5IT9C 2O1UA 4DR5E 5A6KA 3RMPA 1A1HA 4DV6E 3ZZ0A 3VYXA 4JI8E 2V8PA 2F8BA 2GO4A 4MU0A 1RQ0A 2GLIA 2BB8A 3JAMQ 2PO1A 2C38B 4YY3E 2EM9A 3U1YA 3K17A 4FW3A 2EMGA 2JOBA 5A2QC 2EPPA 3ADGA 2NUEA 2BV3A 4LCGA 3M85D 3QT6A 2EMBA 2YU5A 2PNZB 1UN6B 2RSMA 4BA2A 1WHQA 4NXNE 1SR9A 3LPSA 2LUQA 5LMNI 5KL3A 1Y5YA 3QG5C 4FWHA 2KHXA 1BBOA 2VQFI 2LT7A 5LL6R 4GKKE 2RQLA 3B82A 4K0KI 3KRNA 4B3TI 4AM3A 1EH8A 1YPNA 2L2MA 3UK3C 4LFCI 2EORA 3HQ1A 1Z5AA 4P7DA 1JK2A 3K1JA 4JI2E 3PYEA 3HXLA 4R2SA 3GCMA 2K7IA 3DF6A 1UDSA 5K36E 5K36D 2ZBKB 4FWDA 4DV3E 4ZYGA 3QT5A 3CDIA 2BR2B 3QT7A 1GZ6A 1PJTA 2ODRD 1DGCA 1OJ4A 1RR9A 2X7IA 3L7ZA 2EJ4A 5DNYA 2E1RA 4DR2I 1XNQI 3DD6A 4LF8I 2EFGA 1PIEA 4DR3I 4LF4I 2WBUA 1YSAC 5DRQA 1HNXE 1A1FA 4NXME 2PRTA 5JEAC 1E3PA 4X65E 4KQVA 1FKAE 4DR6E 2C37A 4O43A 4LF5E 2O1VA 2EQ3A 1B69A 4FN5A 2LJHA 4R1FA 1X49A 2DEJA 1HR0E 2L92A 3P1XA 4FW5A 2YRMA 3HKMA 2LTRA 4QNJA 2NN6B 4DUZI 2GS8A 2EMKA 3P06A 4Z7CA 3V5RA 1H7SA 3TQMA 5ELWA 2YRKA 5IV8B 3BF2A 2BA1G 5AC5A 2EMCA 4IFDB 2M4IA 1DI2A 2BA1D 4AIMA 4DMIA 2ENHA 4N4RB 3ZZTA 1I94I 5IT9Q 2DRPA 2DEIA 2RTXA 2EPXA 1FI4A 2EPLX 2UUCE 2BM0A 4NBQA 2NA2A 1FWLA 2VQEI 4DPUA 2NABA 2C38A 5LMUE 3CWVA 2EMZA 2PO0B 2YTEA 2EMXA 3PYFA 4DV7I 1XNRI 3J7AG 5IWAI 5JEAA 2O1WA 1BBGA 1N3GA 4AQYE 2EOJA 4X62I 4M0VA 3B8HA 3PRYA 2EL6A 4WYQB 1EKZA 1UDQA 2HHHI 5EL9A 2LJPA 4WUDA 5KL6A 3HPSA 5DROA 1ZR9A 2DSYA 1USVA 1NHIA 2AJ4A 4DXLA 1N32I 2MC5A 1WHNA 4DUYE 2F1DA 4DR1E 4I8OA 2VESA 1N34I 2V83A 2UXDE 1MGTA 3PS1A 4X64I 2IOQA 1STUA 5BR8E 4MU1A 4RPFA 2ZM6E 3VYYA 1XMQE 3M6AA 2UXBE 2EM7A 1R6LA 2UUAE 2CZ9A 2MDRA 2LMZA 3LLHA 5F3WA 4FW4A 4WUBA 1Z0GA 2V34A 3LNUA 2EL4A 2E5LE 2M1SA 4LU9A 1X47A 3J7Yp 2JT2A 2YTQA 2R3VA 3OTOE 4WSPA 2I9IA 3BBGA 2H36X 4DR5I 4DV6I 1TF6A 1UDOA 4JI5E 3WU3A 2R1FA 4YY3I 4B3RI 2Z5BB 4DR7E 2JEAB 1ZAAC 1B62A 4BA1A 2L8TA 1Z1BA 1H72C 3OMLA 1FJGI 2JP9A 4LTYA 4JI7I 4B3ME 1HK7A 2V2QA 5C0XB 1UBDC 4HACB 1ZM9A 1ELOA 2WNRB 4FK5C 2JWOA 2EQ0A 2EMHA 2D9HA 5JEAD 4LF9E 2V87A 5JEAE 2ADRA 3ECRA 5CFFE 4IZJA 1L4SA 1T4NA 4NHRA 2G7HA 2LUPB 2CPNA 1QU6A 4IZKB 2YWQA 3IWBA 4JI6E 4LFBI 2DMYA 2C39B 2YTJA 4IS9A 2HJJA 4R2PA 2LO3A 2JVAA 1Z5BA 2PNLA 4LFAE 4J8ZA 2UXCI 1KKHA 2AE8A 1ZBTA 3VK6A 3T1HE 1HNWE 1N0UA 2JPAA 3VHTB 4OO1F 2GPIA 1A1KA 4FW7A 5DNXA 2FV4B 3C4TA 2UUBE 1MEYC 2F4VE 1HNXI 2E1MA 4DPYA 4NXMI 4WSGA 2GQ0A 3BIDA 1WUUA 4LF7I 4F6MA 4DR6I 2EPNA 4JG4A 4OO1B 4IS1C 1HNZI 2RS7A 2BA0G 4QNKA 1YUIA 1YYKA 2UU9E 4LPFA 1QNTA 4DV5E 2Q2EB 3T1YE 4BS9A 2BA0D 4O5GA 4MDTA 3F6GA 1IBLI 3EPHA 5A6AA 2JXPA 5A6BA 3HTXA 1ZM4A 3F0NA 2MKNA 3C4BA 2O3ZA 4JI3E 2JYAA 4DV2E 4WXCA 2DMIA 4R03A 2N3HA 2CSHA 1N36E 4LF6E 2FTXB 1A1JA 1XMOI 4B3SI 2UUCI 2YSPA 2PO2B 3M7NG 1BKNA 1N33I 4XTJA 4IZJD 1RC7A 2YTPA 1B63A 3M7ND 2KONA 4U3DA 1X6EA 1PJQA 2J7JA 4BHCA 2NN6F 4WPYA 4OKGA 4M2ZA 2EN7A 2EWLA 4AQYI 4BBYA 4URLA 2HFUA 2I13A 4OO1C 2BM1A 4IFDF 4GKJE 3K85A 2JE6A 1MG7A 1WXRA 2WW4A 2EM2A 2DB2A 4DR1I 3PS3A 2UXDI 4LCHA 2GO3A 2O1TA 4IZKA 2LE2A 3ZOQB 2ZM6I 2K4VA 2M7QA 1XMQI 4BC7A 2UXBI 1N0VC 1EA6A 4HYMA 4BCAA 5LMNE 1SFEA 2EN1A 2WCC3 4DV1I 2RPCA 3PYDA 4M1KA 1RHYA 3MHSC 4K0KE 4FW6A 4EMDA 4F9AB 2EOXA 3J81C 4WXDA 3OTOI 1TF3A 2EN3A 1X3CA 3L00A 4J3DA 4BMJA 2PNZA 5A6BD 1DQ3A 3KWRA 2WP8B 4HEIA 2A2DA 2EOEA 2EN2A 1Z0TA 4JI5I 1UDNA 4R2RA 1IBKI 2JOXA 3UHMA 4X8WA 4OO1A 2J7KA 3IWCA 2VE7C 2EMYA 5ADZA 3ADIA 4MU4A 4DPTA 2HK3A 2N8XA 2EOQA 2NN6C 4FWGA 3D4JA 4PU9A 4KWYA 3HPZA 2YT4A 1ZM3A 4DR2E 1XNQE 4JV5I 2EM5A 2ENAA 2EPUA 2EQ1A 2YTNA 4F54A 4X9JA 4DR3E 4LF8E 3H1CA 4P52A 4IFDC 1K47A 4YHHE 1NHHA 1VISA 2L3JA 4DV4E 1PVGA 3HULA 3J80Q 4LF9I 3JU0A 5AE3A 4USMA 1J5EE 2BR2A 4ZYEA 3MSWA 1PJSA 1YFHA 2V8QB 2B3TB 3PYGA 2IOPA 2EM8A 2YTDA 1IBME 4JI6I 2RSIA 4X66I 1IQSA 1GTKA 4ISAA 2V89A 3EPJA 4BHBA 2VF3A 4BA2B 2IERA 1MU5A 4JI8I 4LFAI 2X36A 2JR1A 1GQEA 5C0XF 2LJUA 4JI0E 2PNMA 1ZXNA 2JY9A 3T1HI 5GMEA 5LLQA 1HNWI 1X6FA 1R6MA 2EPCA 1X6HA 2NN6A 1LLMC 2IESA 2L3CA 2N3GA 2WZOA 2CTDA 4NXNI 4WFTA 2UUBI 2L2KB 4RHBB 1H7UA 2HC5A 4KHPE 4MYUA 4IFDA 4GKKI 1XNRE 2B7VA 1Z0VA 3P3GA 5IWAE 1H73A 4LCFA 2EN6A 4NZVA 3KZYA 2EMWA 1YYWA 4X62E 2EZ6A 3L7ZB 4O24A 4DR4E 4OO1D 5IXMB 1P47A 2DIXA 3IWDA 4JI2I 4OO1E 1AH5A 2LRSA 2YZTA 2E72A 1N32E 2EL5A 3EPLA 2PO0A 3J81Q 4DV3I 3P3CA 4R2CA 2MDGA 5KL5A 3HJCA 2EM6A 1WRJA 2C37B 3F6HA 4GQUA 4DV2I 4P7AA 2EOYA 3ADJA 1X5WA 4X64E 1OYPA 4HTGA 3THNA 4LF6I 2EPMX 1QZRA 1EH7A 4O4KA 1T4LB 2B9DA 2WP8A 5FWKA 2BBGA 2WBSA 1ZM2A 2FGGA 2EP3A 2YSOA 2GHFA 1Z59A 2XEXA 2OI2A 2Z5EA 4MLQA 4F9BB 1IMUA 2CVEA 2EM4A 4KZSA 2WBTA 1Y60A 4X65I 2YTOA 5C0XC 2Q8UA 4LF5I 4BC9A 1Y4SA 4OX9E 1FNMA 1G2DC 4RH8A 1HR0I 2EN4A 4UT4A 2EOZA 4GKJI 4JYAE 1OYRA 2EOMA 3FIGA 4M9VC 1KVKA 2MC6A 4DKKA 1YHCA 4LOMA 3ZKBA 2R76A 5JEAF 1ZU1A 3C6MA 4B3RE 2L33A 3M85G 2EMIA 2IHR1 2YTIA 3K6QA 4P78A 3WU5A 2VF1A 4ED4A 2NN6D 3ADLA 1FJGE 4L5NC 2NN6E 2YTGA 3J80C 4JI7E 1UEKA 5AASA 5JEAB 1RMDA 2CG9A 3THOB 4IFDD 3H4LA 3P76A 4IFDE 4F6NA 1KJKA 4Z7YA 1IQOA 1A6FA 1A1GA 1Z5CA 5LMUI 3Q1QA 2Z5BA 2JEAA 2RS6A 5KL2A 1Y4UA 2ENCA 2YRHA 4GEQB 1H74A 4R2EA 1MX0A 2V88A 4U3BA 4M30A 2M9AA 2HFSA 5AC4A 3B4TA 5C0XA 4DV0E 1KTVA 3AUZA 2DLKA 4JI1E 4R8OA 1UILA 4JI4E 4LFBE 1E3HA 2JEBB 2EM3A 2L6MA 2WNRA 4HACA 2EE8A 4R2QA 4DV7E 5EKWA 4TUGA 2NUGA 2UXCE 4DUYI 4GZNC 3EPKA 1ZXMA 1T38A 4TUIA 3Q6MA 5BR8I 1NEIA 1Z0CA 1Y6ZA 2B7TA 2C39A 1WJPA 5K36F 2UUAI 1YH8A 1KYQA 4YHHI 2LCEA 1AAYA 5T6JA 4N3OA 4DV4I 1EH6A 2EPAA 4LF7E 1J5EI 3J7AM 1KIJA 3ZKDA 2EM0A 2E5LI 2VQFE 2ZITA 1HNZE 1OYSA 4BA1B 2J65A 1A1LA 1BB8A 5K36B 4B3TE 2HKJA 4PRVA 2EPKX 4LFCE 4MLVA 1IBMI 1YYOA 2EPZA 2CT1A 5A69A 5FLXQ 5L3JA 2LVHA 1JK1A 2EOSA 3ZZUA 1IBLE 2ELZA 1T39A 3GLLA 2LTSA 2KOUA 3AV0A 1D6TA 3CDJA 4JI0I 2EMLA 4R2AA 1NCSA 2L2NA 3H09A 4DPWA 4DR7I 5KL7A 4IZJB 3NZKA 3KZZA 2A25A 1XXEA 2Z5CB 2NPFA 3PS2A 4B3MI 1XMOE 2DLQA 4B3SE 3LTOA 5KL4A 4Q35B 1N33E 4UTGA 4LF4E 5DRPA 3JTZA 1UHZA 3B78A 4KHPI 2V86A 4F2JC 1F2IG 1Z0WA 4HY1A 5A2QQ 3C6KA 5C0XD 3JAMC 2PO1B 3WU6A 2EPRA
chains in the Genus database with same CATH topology
2HK2A 5AE1A 4DR4I 2R42A 4USKA 4DUZE 3LMLA 1PKPA 4F9CB 1X48A 2ODRC 1I94E 2V2ZA 4WUCA 3ZM7A 2F4VI 4DV1E 2A2CA 2VQEE 2NUFA 4PRXA 1XHKA 4OX9I 3QT8A 2UU9I 4DV5I 1EI1A 4OOGC 3T1YI 4JYAI 2HKEA 4HXZA 2HHHE 1S16A 2V85A 1IBKE 2V2VA 1Z0EA 1Z0BA 1NZ0A 3DJWA 4JI3I 1N34E 5GMDA 4DPXA 4I3HA 3V2UC 4Q28A 4JV5E 1U2RA 2CGEA 1N36I 1DARA 4ZVIA 1ZBQA 5AE2A 1FWKA 3GONA 1S4EA 5FLXC 4L8NA 1NHJA 2LBSB 1T4OA 1USUA 1O0WA 2Z5CA 3Q6NA 4FW9A 4MYTA 1J26A 4DV0I 1RREA 4X66E 4JI1I 4JI4I 4DU8A 1YZ9A 3WU4A 4DU7A 5IT9C 2O1UA 4DR5E 3RMPA 3ZZ0A 4DV7I 4DV6E 4UT4A 3VYXA 4JI8E 2V8PA 2F8BA 3JAMQ 1RQ0A 4YY3E 3K17A 2JOBA 2BV3A 5A2QC 3ADGA 2NUEA 3QT6A 2RSMA 1WHQA 4NXNE 1SR9A 3LPSA 2LUQA 5LMNI 4FWHA 2KHXA 2VQFI 4K0KI 5LL6R 4GKKE 3B82A 4B3TI 2L2MA 4LFCI 3HQ1A 1Z5AA 4P7DA 3K1JA 4JI2E 3PYEA 3HXLA 3DF6A 2ZBKB 4FWDA 4DV3E 3QT5A 3QT7A 1GZ6A 2ODRD 1OJ4A 1RR9A 2X7IA 5DNYA 2E1RA 4DR2I 1XNQI 4LF8I 2EFGA 1PIEA 4DR3I 4LF4I 1HNXE 4NXME 4X65E 4KQVA 4DR6E 1FKAE 4LF5E 2O1VA 4FN5A 2LJHA 4R1FA 1X49A 2DEJA 1HR0E 2L92A 3P1XA 2LTRA 4DUZI 2GS8A 3P06A 4Z7CA 3V5RA 1H7SA 2M4IA 1DI2A 4DMIA 3ZZTA 1I94I 5IT9Q 2DEIA 2RTXA 1FI4A 2UUCE 2BM0A 2NA2A 1FWLA 2VQEI 4DPUA 5LMUE 3CWVA 3PYFA 1XNRI 3J7AG 5IWAI 2O1WA 4AQYE 4X62I 4M0VA 3B8HA 3PRYA 1EKZA 4WYQB 2HHHI 2LJPA 4WUDA 3HPSA 1USVA 2DSYA 1NHIA 2AJ4A 4DXLA 1N32I 2MC5A 1WHNA 4DUYE 4DR1E 4I8OA 1N34I 2V83A 2UXDE 4X64I 2IOQA 1STUA 5BR8E 4RPFA 2ZM6E 3VYYA 1XMQE 3M6AA 2UXBE 2UUAE 2CZ9A 2MDRA 2LMZA 3LLHA 5F3WA 4WUBA 1Z0GA 2V34A 3LNUA 2E5LE 2M1SA 4LU9A 1X47A 3J7Yp 2R3VA 3OTOE 4WSPA 2H36X 4DR5I 4DV6I 4JI5E 3WU3A 4YY3I 4B3RI 2Z5BB 4DR7E 1B62A 2L8TA 1H72C 3OMLA 1FJGI 4LTYA 4JI7I 4B3ME 1HK7A 2V2QA 4HACB 1ZM9A 1ELOA 2JWOA 4LF9E 2V87A 5CFFE 4IZJA 1T4NA 2G7HA 2LUPB 2CPNA 1QU6A 4IZKB 3IWBA 4JI6E 4LFBI 2DMYA 2JVAA 1Z5BA 2PNLA 4LFAE 4J8ZA 2UXCI 1KKHA 1ZBTA 3VK6A 3T1HE 1HNWE 1N0UA 2FV4B 3C4TA 2UUBE 2F4VE 1HNXI 2E1MA 4DPYA 4NXMI 2GQ0A 1WUUA 4LF7I 4DR6I 4JG4A 1HNZI 2RS7A 1YYKA 2UU9E 4DV5E 2Q2EB 3T1YE 4BS9A 3F6GA 1IBLI 3F0NA 3HTXA 1ZM4A 3C4BA 4JI3E 4DV2E 4R03A 2N3HA 1N36E 4LF6E 2FTXB 1XMOI 4B3SI 2UUCI 1N33I 1BKNA 4XTJA 4IZJD 1RC7A 1B63A 2KONA 4WPYA 4M2ZA 2EWLA 4AQYI 4BBYA 4URLA 2HFUA 2BM1A 4GKJE 3K85A 1MG7A 1WXRA 2WW4A 4DR1I 2DB2A 2UXDI 2O1TA 4IZKA 2LE2A 3ZOQB 2ZM6I 2K4VA 2M7QA 1XMQI 4BC7A 2UXBI 1N0VC 1EA6A 4HYMA 4BCAA 5LMNE 4DV1I 3PYDA 4M1KA 4K0KE 4EMDA 4F9AB 3J81C 3OTOI 4BMJA 1DQ3A 3KWRA 2A2DA 1Z0TA 4JI5I 1IBKI 2JOXA 4X8WA 4DPTA 2J7KA 3IWCA 2VE7C 5ADZA 3ADIA 2HK3A 4FWGA 3D4JA 4PU9A 3HPZA 2YT4A 1ZM3A 4DR2E 1XNQE 4JV5I 4LF8E 4F54A 4DR3E 4P52A 1K47A 4YHHE 1NHHA 1VISA 2L3JA 4DV4E 1PVGA 3HULA 3J80Q 4LF9I 3JU0A 5AE3A 4USMA 1J5EE 3MSWA 2V8QB 2B3TB 3PYGA 2IOPA 1IBME 4JI6I 4X66I 2V89A 2VF3A 1MU5A 4JI8I 4LFAI 2X36A 2JR1A 1GQEA 4JI0E 2PNMA 1ZXNA 2JY9A 3T1HI 5GMEA 1HNWI 2L3CA 2N3GA 2WZOA 2UUBI 4NXNI 4WFTA 2L2KB 1H7UA 4KHPE 4MYUA 4GKKI 1XNRE 2B7VA 1Z0VA 5IWAE 1H73A 1YYWA 4X62E 2EZ6A 4DR4E 2DIXA 3IWDA 4JI2I 2LRSA 2YZTA 1N32E 3J81Q 4DV3I 3HJCA 4DV2I 3F6HA 4P7AA 3ADJA 4X64E 4LF6I 1QZRA 1T4LB 2B9DA 5FWKA 1ZM2A 2FGGA 1Z59A 2XEXA 2OI2A 2Z5EA 4F9BB 4KZSA 4X65I 4LF5I 4BC9A 1Y4SA 4OX9E 1FNMA 1HR0I 4GKJI 4JYAE 3FIGA 3ZKBA 1KVKA 2MC6A 4DKKA 4B3RE 2L33A 2IHR1 3WU5A 3K6QA 4P78A 2VF1A 4ED4A 3ADLA 1FJGE 4L5NC 3J80C 4JI7E 1UEKA 5AASA 2CG9A 3H4LA 4Z7YA 1Z5CA 1A6FA 3Q1QA 5LMUI 2Z5BA 2RS6A 1Y4UA 4GEQB 1H74A 1MX0A 2V88A 4M30A 2HFSA 4DV0E 1KTVA 4LFBE 3AUZA 4JI1E 4R8OA 1UILA 4JI4E 4HACA 2L6MA 4DV7E 4TUGA 2NUGA 2UXCE 4DUYI 1ZXMA 4TUIA 3Q6MA 5BR8I 1Z0CA 1Y6ZA 2B7TA 2UUAI 4YHHI 4DV4I 5T6JA 4N3OA 4LF7E 1J5EI 3J7AM 1KIJA 3ZKDA 2E5LI 2VQFE 2ZITA 1HNZE 4B3TE 2HKJA 4PRVA 4LFCE 1IBMI 1YYOA 5FLXQ 5L3JA 3ZZUA 1IBLE 2LTSA 2KOUA 3AV0A 1D6TA 4JI0I 3H09A 2L2NA 4DPWA 4DR7I 4IZJB 2Z5CB 2NPFA 4B3MI 1XMOE 4B3SE 3LTOA 1N33E 4UTGA 4LF4E 3JTZA 1UHZA 3B78A 4KHPI 2V86A 4HY1A 1Z0WA 5A2QQ 3JAMC 3WU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK2 A;  4DR4 I;  2R42 A;  4USK A;  4DUZ E;  1PKP A;  1X48 A;  1I94 E;  2V2Z A;  4WUC A;  3ZM7 A;  2F4V I;  4DV1 E;  2A2C A;  2VQE E;  2NUF A;  4PRX A;  1XHK A;  4OX9 I;  3QT8 A;  2UU9 I;  4DV5 I;  1EI1 A;  4OOG C;  3T1Y I;  4JYA I;  2HKE A;  4HXZ A;  2HHH E;  1S16 A;  1IBK E;  2V2V A;  1Z0E A;  1Z0B A;  1NZ0 A;  4JI3 I;  1N34 E;  5GMD A;  4DPX A;  4I3H A;  3V2U C;  1N36 I;  4JV5 E;  1U2R A;  1DAR A;  4ZVI A;  1FWK A;  3GON A;  1S4E A;  5FLX C;  1NHJ A;  2LBS B;  1T4O A;  1O0W A;  4FW9 A;  4MYT A;  1J26 A;  4DV0 I;  1RRE A;  4X66 E;  4JI1 I;  4JI4 I;  4DU8 A;  1YZ9 A;  3WU4 A;  4DU7 A;  5IT9 C;  4DR5 E;  3ZZ0 A;  4DV7 I;  4DV6 E;  4UT4 A;  3VYX A;  4JI8 E;  2V8P A;  3JAM Q;  1RQ0 A;  4YY3 E;  3K17 A;  2BV3 A;  5A2Q C;  3ADG A;  2NUE A;  3QT6 A;  2RSM A;  1WHQ A;  4NXN E;  3LPS A;  2LUQ A;  5LMN I;  4FWH A;  2KHX A;  2VQF I;  4K0K I;  4GKK E;  5LL6 R;  3B82 A;  4B3T I;  2L2M A;  4LFC I;  1Z5A A;  3K1J A;  4JI2 E;  3PYE A;  2ZBK B;  4FWD A;  4DV3 E;  3QT5 A;  3QT7 A;  1OJ4 A;  1RR9 A;  2X7I A;  2E1R A;  4DR2 I;  1XNQ I;  4LF8 I;  2EFG A;  1PIE A;  4DR3 I;  4LF4 I;  1HNX E;  4NXM E;  4X65 E;  4KQV A;  4DR6 E;  1FKA E;  4LF5 E;  4FN5 A;  2LJH A;  4R1F A;  1X49 A;  2DEJ A;  1HR0 E;  3P1X A;  2LTR A;  4DUZ I;  2GS8 A;  4Z7C A;  3V5R A;  1H7S A;  1DI2 A;  3ZZT A;  1I94 I;  5IT9 Q;  2DEI A;  2RTX A;  1FI4 A;  2UUC E;  2BM0 A;  2NA2 A;  1FWL A;  2VQE I;  4DPU A;  5LMU E;  3CWV A;  3PYF A;  1XNR I;  5IWA I;  3J7A G;  4AQY E;  4X62 I;  3B8H A;  1EKZ A;  4WYQ B;  2HHH I;  2LJP A;  4WUD A;  1NHI A;  2AJ4 A;  4DXL A;  1N32 I;  1WHN A;  4DUY E;  4DR1 E;  1N34 I;  2UXD E;  4X64 I;  1STU A;  5BR8 E;  4RPF A;  2ZM6 E;  3VYY A;  1XMQ E;  3M6A A;  2UXB E;  2UUA E;  2CZ9 A;  2MDR A;  3LLH A;  4WUB A;  1Z0G A;  2V34 A;  3LNU A;  2E5L E;  1X47 A;  3J7Y p;  2R3V A;  3OTO E;  4DR5 I;  4DV6 I;  4JI5 E;  3WU3 A;  4YY3 I;  4B3R I;  4DR7 E;  1B62 A;  1H72 C;  1FJG I;  4JI7 I;  4B3M E;  2V2Q A;  4HAC B;  1ZM9 A;  1ELO A;  4LF9 E;  5CFF E;  1T4N A;  2LUP B;  2CPN A;  1QU6 A;  4JI6 E;  4LFB I;  2DMY A;  2JVA A;  1Z5B A;  4LFA E;  2UXC I;  1KKH A;  1ZBT A;  3T1H E;  1HNW E;  1N0U A;  3C4T A;  2UUB E;  2F4V E;  1HNX I;  4DPY A;  4NXM I;  1WUU A;  4LF7 I;  4DR6 I;  4JG4 A;  1HNZ I;  2RS7 A;  1YYK A;  2UU9 E;  4DV5 E;  2Q2E B;  3T1Y E;  1IBL I;  3F0N A;  3HTX A;  1ZM4 A;  3C4B A;  4JI3 E;  4DV2 E;  2N3H A;  1N36 E;  4LF6 E;  1XMO I;  4B3S I;  2UUC I;  1N33 I;  1BKN A;  4XTJ A;  1RC7 A;  1B63 A;  4M2Z A;  4AQY I;  4URL A;  2HFU A;  2BM1 A;  4GKJ E;  1MG7 A;  2WW4 A;  4DR1 I;  2DB2 A;  2UXD I;  2ZM6 I;  1XMQ I;  2UXB I;  1N0V C;  1EA6 A;  4HYM A;  5LMN E;  4DV1 I;  3PYD A;  4M1K A;  4K0K E;  4EMD A;  3J81 C;  3OTO I;  2A2D A;  1Z0T A;  4JI5 I;  1IBK I;  4X8W A;  4DPT A;  2J7K A;  3ADI A;  2HK3 A;  4FWG A;  3D4J A;  4PU9 A;  2YT4 A;  1ZM3 A;  4DR2 E;  1XNQ E;  4JV5 I;  4LF8 E;  4DR3 E;  4P52 A;  1K47 A;  4YHH E;  1NHH A;  1VIS A;  2L3J A;  4DV4 E;  1PVG A;  3HUL A;  3J80 Q;  4LF9 I;  4USM A;  1J5E E;  2B3T B;  3PYG A;  1IBM E;  4JI6 I;  4X66 I;  2VF3 A;  1MU5 A;  4JI8 I;  4LFA I;  2X36 A;  1GQE A;  4JI0 E;  1ZXN A;  2JY9 A;  3T1H I;  5GME A;  1HNW I;  2L3C A;  2N3G A;  2UUB I;  4NXN I;  4WFT A;  2L2K B;  1H7U A;  4KHP E;  4MYU A;  4GKK I;  1XNR E;  2B7V A;  1Z0V A;  5IWA E;  1H73 A;  1YYW A;  4X62 E;  2EZ6 A;  4DR4 E;  2DIX A;  4JI2 I;  2LRS A;  1N32 E;  3J81 Q;  4DV3 I;  4DV2 I;  4P7A A;  3ADJ A;  4X64 E;  4LF6 I;  1QZR A;  1T4L B;  1ZM2 A;  1Z59 A;  2XEX A;  2OI2 A;  4X65 I;  4LF5 I;  4OX9 E;  1FNM A;  1HR0 I;  4GKJ I;  4JYA E;  3ZKB A;  1KVK A;  4DKK A;  4B3R E;  2L33 A;  2IHR 1;  3WU5 A;  4ED4 A;  3ADL A;  1FJG E;  3J80 C;  4JI7 E;  1UEK A;  3H4L A;  4Z7Y A;  1Z5C A;  1A6F A;  3Q1Q A;  5LMU I;  2RS6 A;  1H74 A;  1MX0 A;  4M30 A;  2HFS A;  4DV0 E;  1KTV A;  4LFB E;  4JI4 E;  4JI1 E;  4HAC A;  1UIL A;  4DV7 E;  2NUG A;  2UXC E;  4DUY I;  1ZXM A;  5BR8 I;  1Z0C A;  2B7T A;  2UUA I;  4YHH I;  4DV4 I;  4LF7 E;  1J5E I;  3J7A M;  1KIJ A;  3ZKD A;  2E5L I;  2VQF E;  2ZIT A;  1HNZ E;  4B3T E;  2HKJ A;  4PRV A;  4LFC E;  1IBM I;  1YYO A;  5FLX Q;  5L3J A;  3ZZU A;  1IBL E;  2LTS A;  1D6T A;  4JI0 I;  2L2N A;  4DPW A;  4DR7 I;  2NPF A;  4B3M I;  1XMO E;  4B3S E;  3LTO A;  1N33 E;  4UTG A;  4LF4 E;  1UHZ A;  3B78 A;  4KHP I;  4HY1 A;  1Z0W A;  5A2Q Q;  3JAM C;  3WU6 A; 
#chains in the Genus database with same CATH topology
 2HK2 A;  3M99 B;  5AE1 A;  4DR4 I;  2R42 A;  4ZYH A;  2PO2 A;  5A6J A;  4USK A;  5K36 C;  4DUZ E;  3BGH A;  2HGH A;  3LML A;  1PKP A;  4OZE A;  2EPO A;  4F9C B;  2ELY A;  1X48 A;  2EOF A;  2ODR C;  1YUJ A;  2JEB A;  1I94 E;  2V2Z A;  4WUC A;  3ZM7 A;  2F4V I;  4DV1 E;  2A2C A;  2VQE E;  1A1I A;  3MHH C;  1PDA A;  2NUF A;  4PRX A;  4WX9 A;  2EOO A;  5C0X E;  1XHK A;  4OX9 I;  2LV2 A;  3GME A;  3QT8 A;  2YPN A;  4AID A;  2UU9 I;  5DRR A;  1P42 A;  4DV5 I;  1EI1 A;  4OOG C;  2YU8 A;  2DGC A;  2HKE A;  3T1Y I;  4JYA I;  2VRD A;  2EOH A;  2HHH E;  2EMF A;  2V85 A;  1S16 A;  4HXZ A;  4R2D A;  1IBK E;  2EMA A;  2V2V A;  1G2F C;  5TSE A;  5K36 A;  1Z0E A;  1Z0B A;  4IJD A;  1NZ0 A;  3DJW A;  4JI3 I;  1N34 E;  5GMD A;  4DPX A;  4I3H A;  3V2U C;  4Q28 A;  4JV5 E;  2MKD A;  1U2R A;  2CGE A;  1N36 I;  1TN9 A;  1DAR A;  4ZVI A;  1ZBQ A;  5AE2 A;  3P3E A;  1FWK A;  4ZYD A;  2JE6 B;  3GON A;  1S4E A;  5FLX C;  2EN8 A;  4L8N A;  1NHJ A;  3EQ1 A;  2EOI A;  4MQY A;  1VI7 A;  2LBS B;  1T4O A;  1USU A;  1O0W A;  2YTF A;  2Z5C A;  3Q6N A;  4FW9 A;  4MYT A;  1J26 A;  5DNL A;  3U1K A;  1RRE A;  4DV0 I;  4X66 E;  4JI1 I;  4JI4 I;  4DU8 A;  1YZ9 A;  3WU4 A;  4MU3 A;  4DU7 A;  5IT9 C;  2O1U A;  4DR5 E;  5A6K A;  3RMP A;  1A1H A;  4DV6 E;  3ZZ0 A;  3VYX A;  4JI8 E;  2V8P A;  2F8B A;  2GO4 A;  4MU0 A;  1RQ0 A;  2GLI A;  2BB8 A;  3JAM Q;  2PO1 A;  2C38 B;  4YY3 E;  2EM9 A;  3U1Y A;  3K17 A;  4FW3 A;  2EMG A;  2JOB A;  5A2Q C;  2EPP A;  3ADG A;  2NUE A;  2BV3 A;  4LCG A;  3M85 D;  3QT6 A;  2EMB A;  2YU5 A;  2PNZ B;  1UN6 B;  2RSM A;  4BA2 A;  1WHQ A;  4NXN E;  1SR9 A;  3LPS A;  2LUQ A;  5LMN I;  5KL3 A;  1Y5Y A;  3QG5 C;  4FWH A;  2KHX A;  1BBO A;  2VQF I;  2LT7 A;  5LL6 R;  4GKK E;  2RQL A;  3B82 A;  4K0K I;  3KRN A;  4B3T I;  4AM3 A;  1EH8 A;  1YPN A;  2L2M A;  3UK3 C;  4LFC I;  2EOR A;  3HQ1 A;  1Z5A A;  4P7D A;  1JK2 A;  3K1J A;  4JI2 E;  3PYE A;  3HXL A;  4R2S A;  3GCM A;  2K7I A;  3DF6 A;  1UDS A;  5K36 E;  5K36 D;  2ZBK B;  4FWD A;  4DV3 E;  4ZYG A;  3QT5 A;  3CDI A;  2BR2 B;  3QT7 A;  1GZ6 A;  1PJT A;  2ODR D;  1DGC A;  1OJ4 A;  1RR9 A;  2X7I A;  3L7Z A;  2EJ4 A;  5DNY A;  2E1R A;  4DR2 I;  1XNQ I;  3DD6 A;  4LF8 I;  2EFG A;  1PIE A;  4DR3 I;  4LF4 I;  2WBU A;  1YSA C;  5DRQ A;  1HNX E;  1A1F A;  4NXM E;  2PRT A;  5JEA C;  1E3P A;  4X65 E;  4KQV A;  1FKA E;  4DR6 E;  2C37 A;  4O43 A;  4LF5 E;  2O1V A;  2EQ3 A;  1B69 A;  4FN5 A;  2LJH A;  4R1F A;  1X49 A;  2DEJ A;  1HR0 E;  2L92 A;  3P1X A;  4FW5 A;  2YRM A;  3HKM A;  2LTR A;  4QNJ A;  2NN6 B;  4DUZ I;  2GS8 A;  2EMK A;  3P06 A;  4Z7C A;  3V5R A;  1H7S A;  3TQM A;  5ELW A;  2YRK A;  5IV8 B;  3BF2 A;  2BA1 G;  5AC5 A;  2EMC A;  4IFD B;  2M4I A;  1DI2 A;  2BA1 D;  4AIM A;  4DMI A;  2ENH A;  4N4R B;  3ZZT A;  1I94 I;  5IT9 Q;  2DRP A;  2DEI A;  2RTX A;  2EPX A;  1FI4 A;  2EPL X;  2UUC E;  2BM0 A;  4NBQ A;  2NA2 A;  1FWL A;  2VQE I;  4DPU A;  2NAB A;  2C38 A;  5LMU E;  3CWV A;  2EMZ A;  2PO0 B;  2YTE A;  2EMX A;  3PYF A;  4DV7 I;  1XNR I;  3J7A G;  5IWA I;  5JEA A;  2O1W A;  1BBG A;  1N3G A;  4AQY E;  2EOJ A;  4X62 I;  4M0V A;  3B8H A;  3PRY A;  2EL6 A;  4WYQ B;  1EKZ A;  1UDQ A;  2HHH I;  5EL9 A;  2LJP A;  4WUD A;  5KL6 A;  3HPS A;  5DRO A;  1ZR9 A;  2DSY A;  1USV A;  1NHI A;  2AJ4 A;  4DXL A;  1N32 I;  2MC5 A;  1WHN A;  4DUY E;  2F1D A;  4DR1 E;  4I8O A;  2VES A;  1N34 I;  2V83 A;  2UXD E;  1MGT A;  3PS1 A;  4X64 I;  2IOQ A;  1STU A;  5BR8 E;  4MU1 A;  4RPF A;  2ZM6 E;  3VYY A;  1XMQ E;  3M6A A;  2UXB E;  2EM7 A;  1R6L A;  2UUA E;  2CZ9 A;  2MDR A;  2LMZ A;  3LLH A;  5F3W A;  4FW4 A;  4WUB A;  1Z0G A;  2V34 A;  3LNU A;  2EL4 A;  2E5L E;  2M1S A;  4LU9 A;  1X47 A;  3J7Y p;  2JT2 A;  2YTQ A;  2R3V A;  3OTO E;  4WSP A;  2I9I A;  3BBG A;  2H36 X;  4DR5 I;  4DV6 I;  1TF6 A;  1UDO A;  4JI5 E;  3WU3 A;  2R1F A;  4YY3 I;  4B3R I;  2Z5B B;  4DR7 E;  2JEA B;  1ZAA C;  1B62 A;  4BA1 A;  2L8T A;  1Z1B A;  1H72 C;  3OML A;  1FJG I;  2JP9 A;  4LTY A;  4JI7 I;  4B3M E;  1HK7 A;  2V2Q A;  5C0X B;  1UBD C;  4HAC B;  1ZM9 A;  1ELO A;  2WNR B;  4FK5 C;  2JWO A;  2EQ0 A;  2EMH A;  2D9H A;  5JEA D;  4LF9 E;  2V87 A;  5JEA E;  2ADR A;  3ECR A;  5CFF E;  4IZJ A;  1L4S A;  1T4N A;  4NHR A;  2G7H A;  2LUP B;  2CPN A;  1QU6 A;  4IZK B;  2YWQ A;  3IWB A;  4JI6 E;  4LFB I;  2DMY A;  2C39 B;  2YTJ A;  4IS9 A;  2HJJ A;  4R2P A;  2LO3 A;  2JVA A;  1Z5B A;  2PNL A;  4LFA E;  4J8Z A;  2UXC I;  1KKH A;  2AE8 A;  1ZBT A;  3VK6 A;  3T1H E;  1HNW E;  1N0U A;  2JPA A;  3VHT B;  4OO1 F;  2GPI A;  1A1K A;  4FW7 A;  5DNX A;  2FV4 B;  3C4T A;  2UUB E;  1MEY C;  2F4V E;  1HNX I;  2E1M A;  4DPY A;  4NXM I;  4WSG A;  2GQ0 A;  3BID A;  1WUU A;  4LF7 I;  4F6M A;  4DR6 I;  2EPN A;  4JG4 A;  4OO1 B;  4IS1 C;  1HNZ I;  2RS7 A;  2BA0 G;  4QNK A;  1YUI A;  1YYK A;  2UU9 E;  4LPF A;  1QNT A;  4DV5 E;  2Q2E B;  3T1Y E;  4BS9 A;  2BA0 D;  4O5G A;  4MDT A;  3F6G A;  1IBL I;  3EPH A;  5A6A A;  2JXP A;  5A6B A;  3HTX A;  1ZM4 A;  3F0N A;  2MKN A;  3C4B A;  2O3Z A;  4JI3 E;  2JYA A;  4DV2 E;  4WXC A;  2DMI A;  4R03 A;  2N3H A;  2CSH A;  1N36 E;  4LF6 E;  2FTX B;  1A1J A;  1XMO I;  4B3S I;  2UUC I;  2YSP A;  2PO2 B;  3M7N G;  1BKN A;  1N33 I;  4XTJ A;  4IZJ D;  1RC7 A;  2YTP A;  1B63 A;  3M7N D;  2KON A;  4U3D A;  1X6E A;  1PJQ A;  2J7J A;  4BHC A;  2NN6 F;  4WPY A;  4OKG A;  4M2Z A;  2EN7 A;  2EWL A;  4AQY I;  4BBY A;  4URL A;  2HFU A;  2I13 A;  4OO1 C;  2BM1 A;  4IFD F;  4GKJ E;  3K85 A;  2JE6 A;  1MG7 A;  1WXR A;  2WW4 A;  2EM2 A;  2DB2 A;  4DR1 I;  3PS3 A;  2UXD I;  4LCH A;  2GO3 A;  2O1T A;  4IZK A;  2LE2 A;  3ZOQ B;  2ZM6 I;  2K4V A;  2M7Q A;  1XMQ I;  4BC7 A;  2UXB I;  1N0V C;  1EA6 A;  4HYM A;  4BCA A;  5LMN E;  1SFE A;  2EN1 A;  2WCC 3;  4DV1 I;  2RPC A;  3PYD A;  4M1K A;  1RHY A;  3MHS C;  4K0K E;  4FW6 A;  4EMD A;  4F9A B;  2EOX A;  3J81 C;  4WXD A;  3OTO I;  1TF3 A;  2EN3 A;  1X3C A;  3L00 A;  4J3D A;  4BMJ A;  2PNZ A;  5A6B D;  1DQ3 A;  3KWR A;  2WP8 B;  4HEI A;  2A2D A;  2EOE A;  2EN2 A;  1Z0T A;  4JI5 I;  1UDN A;  4R2R A;  1IBK I;  2JOX A;  3UHM A;  4X8W A;  4OO1 A;  2J7K A;  3IWC A;  2VE7 C;  2EMY A;  5ADZ A;  3ADI A;  4MU4 A;  4DPT A;  2HK3 A;  2N8X A;  2EOQ A;  2NN6 C;  4FWG A;  3D4J A;  4PU9 A;  4KWY A;  3HPZ A;  2YT4 A;  1ZM3 A;  4DR2 E;  1XNQ E;  4JV5 I;  2EM5 A;  2ENA A;  2EPU A;  2EQ1 A;  2YTN A;  4F54 A;  4X9J A;  4DR3 E;  4LF8 E;  3H1C A;  4P52 A;  4IFD C;  1K47 A;  4YHH E;  1NHH A;  1VIS A;  2L3J A;  4DV4 E;  1PVG A;  3HUL A;  3J80 Q;  4LF9 I;  3JU0 A;  5AE3 A;  4USM A;  1J5E E;  2BR2 A;  4ZYE A;  3MSW A;  1PJS A;  1YFH A;  2V8Q B;  2B3T B;  3PYG A;  2IOP A;  2EM8 A;  2YTD A;  1IBM E;  4JI6 I;  2RSI A;  4X66 I;  1IQS A;  1GTK A;  4ISA A;  2V89 A;  3EPJ A;  4BHB A;  2VF3 A;  4BA2 B;  2IER A;  1MU5 A;  4JI8 I;  4LFA I;  2X36 A;  2JR1 A;  1GQE A;  5C0X F;  2LJU A;  4JI0 E;  2PNM A;  1ZXN A;  2JY9 A;  3T1H I;  5GME A;  5LLQ A;  1HNW I;  1X6F A;  1R6M A;  2EPC A;  1X6H A;  2NN6 A;  1LLM C;  2IES A;  2L3C A;  2N3G A;  2WZO A;  2CTD A;  4NXN I;  4WFT A;  2UUB I;  2L2K B;  4RHB B;  1H7U A;  2HC5 A;  4KHP E;  4MYU A;  4IFD A;  4GKK I;  1XNR E;  2B7V A;  1Z0V A;  3P3G A;  5IWA E;  1H73 A;  4LCF A;  2EN6 A;  4NZV A;  3KZY A;  2EMW A;  1YYW A;  4X62 E;  2EZ6 A;  3L7Z B;  4O24 A;  4DR4 E;  4OO1 D;  5IXM B;  1P47 A;  2DIX A;  3IWD A;  4JI2 I;  4OO1 E;  1AH5 A;  2LRS A;  2YZT A;  2E72 A;  1N32 E;  2EL5 A;  3EPL A;  2PO0 A;  3J81 Q;  4DV3 I;  3P3C A;  4R2C A;  2MDG A;  5KL5 A;  3HJC A;  2EM6 A;  1WRJ A;  2C37 B;  3F6H A;  4GQU A;  4DV2 I;  4P7A A;  2EOY A;  3ADJ A;  1X5W A;  4X64 E;  1OYP A;  4HTG A;  3THN A;  4LF6 I;  2EPM X;  1QZR A;  1EH7 A;  4O4K A;  1T4L B;  2B9D A;  2WP8 A;  5FWK A;  2BBG A;  2WBS A;  1ZM2 A;  2FGG A;  2EP3 A;  2YSO A;  2GHF A;  1Z59 A;  2XEX A;  2OI2 A;  2Z5E A;  4MLQ A;  4F9B B;  1IMU A;  2CVE A;  2EM4 A;  4KZS A;  2WBT A;  1Y60 A;  4X65 I;  2YTO A;  5C0X C;  2Q8U A;  4LF5 I;  4BC9 A;  1Y4S A;  4OX9 E;  1FNM A;  1G2D C;  4RH8 A;  1HR0 I;  2EN4 A;  4UT4 A;  2EOZ A;  4GKJ I;  4JYA E;  1OYR A;  2EOM A;  3FIG A;  4M9V C;  1KVK A;  2MC6 A;  4DKK A;  1YHC A;  4LOM A;  3ZKB A;  2R76 A;  5JEA F;  1ZU1 A;  3C6M A;  4B3R E;  2L33 A;  3M85 G;  2EMI A;  2IHR 1;  2YTI A;  3K6Q A;  4P78 A;  3WU5 A;  2VF1 A;  4ED4 A;  2NN6 D;  3ADL A;  1FJG E;  4L5N C;  2NN6 E;  2YTG A;  3J80 C;  4JI7 E;  1UEK A;  5AAS A;  5JEA B;  1RMD A;  2CG9 A;  3THO B;  4IFD D;  3H4L A;  3P76 A;  4IFD E;  4F6N A;  1KJK A;  4Z7Y A;  1IQO A;  1A6F A;  1A1G A;  1Z5C A;  5LMU I;  3Q1Q A;  2Z5B A;  2JEA A;  2RS6 A;  5KL2 A;  1Y4U A;  2ENC A;  2YRH A;  4GEQ B;  1H74 A;  4R2E A;  1MX0 A;  2V88 A;  4U3B A;  4M30 A;  2M9A A;  2HFS A;  5AC4 A;  3B4T A;  5C0X A;  4DV0 E;  1KTV A;  3AUZ A;  2DLK A;  4JI1 E;  4R8O A;  1UIL A;  4JI4 E;  4LFB E;  1E3H A;  2JEB B;  2EM3 A;  2L6M A;  2WNR A;  4HAC A;  2EE8 A;  4R2Q A;  4DV7 E;  5EKW A;  4TUG A;  2NUG A;  2UXC E;  4DUY I;  4GZN C;  3EPK A;  1ZXM A;  1T38 A;  4TUI A;  3Q6M A;  5BR8 I;  1NEI A;  1Z0C A;  1Y6Z A;  2B7T A;  2C39 A;  1WJP A;  5K36 F;  2UUA I;  1YH8 A;  1KYQ A;  4YHH I;  2LCE A;  1AAY A;  5T6J A;  4N3O A;  4DV4 I;  1EH6 A;  2EPA A;  4LF7 E;  1J5E I;  3J7A M;  1KIJ A;  3ZKD A;  2EM0 A;  2E5L I;  2VQF E;  2ZIT A;  1HNZ E;  1OYS A;  4BA1 B;  2J65 A;  1A1L A;  1BB8 A;  5K36 B;  4B3T E;  2HKJ A;  4PRV A;  2EPK X;  4LFC E;  4MLV A;  1IBM I;  1YYO A;  2EPZ A;  2CT1 A;  5A69 A;  5FLX Q;  5L3J A;  2LVH A;  1JK1 A;  2EOS A;  3ZZU A;  1IBL E;  2ELZ A;  1T39 A;  3GLL A;  2LTS A;  2KOU A;  3AV0 A;  1D6T A;  3CDJ A;  4JI0 I;  2EML A;  4R2A A;  1NCS A;  2L2N A;  3H09 A;  4DPW A;  4DR7 I;  5KL7 A;  4IZJ B;  3NZK A;  3KZZ A;  2A25 A;  1XXE A;  2Z5C B;  2NPF A;  3PS2 A;  4B3M I;  1XMO E;  2DLQ A;  4B3S E;  3LTO A;  5KL4 A;  4Q35 B;  1N33 E;  4UTG A;  4LF4 E;  5DRP A;  3JTZ A;  1UHZ A;  3B78 A;  4KHP I;  2V86 A;  4F2J C;  1F2I G;  1Z0W A;  4HY1 A;  5A2Q Q;  3C6K A;  5C0X D;  3JAM C;  2PO1 B;  3WU6 A;  2EPR A; 
#chains in the Genus database with same CATH homology
 2HK2 A;  5AE1 A;  4DR4 I;  2R42 A;  4USK A;  4DUZ E;  3LML A;  1PKP A;  4F9C B;  1X48 A;  2ODR C;  1I94 E;  2V2Z A;  4WUC A;  3ZM7 A;  2F4V I;  4DV1 E;  2A2C A;  2VQE E;  2NUF A;  4PRX A;  1XHK A;  4OX9 I;  3QT8 A;  2UU9 I;  4DV5 I;  1EI1 A;  4OOG C;  3T1Y I;  4JYA I;  2HKE A;  4HXZ A;  2HHH E;  1S16 A;  2V85 A;  1IBK E;  2V2V A;  1Z0E A;  1Z0B A;  1NZ0 A;  3DJW A;  4JI3 I;  1N34 E;  5GMD A;  4DPX A;  4I3H A;  3V2U C;  4Q28 A;  4JV5 E;  1U2R A;  2CGE A;  1N36 I;  1DAR A;  4ZVI A;  1ZBQ A;  5AE2 A;  1FWK A;  3GON A;  1S4E A;  5FLX C;  4L8N A;  1NHJ A;  2LBS B;  1T4O A;  1USU A;  1O0W A;  2Z5C A;  3Q6N A;  4FW9 A;  4MYT A;  1J26 A;  4DV0 I;  1RRE A;  4X66 E;  4JI1 I;  4JI4 I;  4DU8 A;  1YZ9 A;  3WU4 A;  4DU7 A;  5IT9 C;  2O1U A;  4DR5 E;  3RMP A;  3ZZ0 A;  4DV7 I;  4DV6 E;  4UT4 A;  3VYX A;  4JI8 E;  2V8P A;  2F8B A;  3JAM Q;  1RQ0 A;  4YY3 E;  3K17 A;  2JOB A;  2BV3 A;  5A2Q C;  3ADG A;  2NUE A;  3QT6 A;  2RSM A;  1WHQ A;  4NXN E;  1SR9 A;  3LPS A;  2LUQ A;  5LMN I;  4FWH A;  2KHX A;  2VQF I;  4K0K I;  5LL6 R;  4GKK E;  3B82 A;  4B3T I;  2L2M A;  4LFC I;  3HQ1 A;  1Z5A A;  4P7D A;  3K1J A;  4JI2 E;  3PYE A;  3HXL A;  3DF6 A;  2ZBK B;  4FWD A;  4DV3 E;  3QT5 A;  3QT7 A;  1GZ6 A;  2ODR D;  1OJ4 A;  1RR9 A;  2X7I A;  5DNY A;  2E1R A;  4DR2 I;  1XNQ I;  4LF8 I;  2EFG A;  1PIE A;  4DR3 I;  4LF4 I;  1HNX E;  4NXM E;  4X65 E;  4KQV A;  4DR6 E;  1FKA E;  4LF5 E;  2O1V A;  4FN5 A;  2LJH A;  4R1F A;  1X49 A;  2DEJ A;  1HR0 E;  2L92 A;  3P1X A;  2LTR A;  4DUZ I;  2GS8 A;  3P06 A;  4Z7C A;  3V5R A;  1H7S A;  2M4I A;  1DI2 A;  4DMI A;  3ZZT A;  1I94 I;  5IT9 Q;  2DEI A;  2RTX A;  1FI4 A;  2UUC E;  2BM0 A;  2NA2 A;  1FWL A;  2VQE I;  4DPU A;  5LMU E;  3CWV A;  3PYF A;  1XNR I;  3J7A G;  5IWA I;  2O1W A;  4AQY E;  4X62 I;  4M0V A;  3B8H A;  3PRY A;  1EKZ A;  4WYQ B;  2HHH I;  2LJP A;  4WUD A;  3HPS A;  1USV A;  2DSY A;  1NHI A;  2AJ4 A;  4DXL A;  1N32 I;  2MC5 A;  1WHN A;  4DUY E;  4DR1 E;  4I8O A;  1N34 I;  2V83 A;  2UXD E;  4X64 I;  2IOQ A;  1STU A;  5BR8 E;  4RPF A;  2ZM6 E;  3VYY A;  1XMQ E;  3M6A A;  2UXB E;  2UUA E;  2CZ9 A;  2MDR A;  2LMZ A;  3LLH A;  5F3W A;  4WUB A;  1Z0G A;  2V34 A;  3LNU A;  2E5L E;  2M1S A;  4LU9 A;  1X47 A;  3J7Y p;  2R3V A;  3OTO E;  4WSP A;  2H36 X;  4DR5 I;  4DV6 I;  4JI5 E;  3WU3 A;  4YY3 I;  4B3R I;  2Z5B B;  4DR7 E;  1B62 A;  2L8T A;  1H72 C;  3OML A;  1FJG I;  4LTY A;  4JI7 I;  4B3M E;  1HK7 A;  2V2Q A;  4HAC B;  1ZM9 A;  1ELO A;  2JWO A;  4LF9 E;  2V87 A;  5CFF E;  4IZJ A;  1T4N A;  2G7H A;  2LUP B;  2CPN A;  1QU6 A;  4IZK B;  3IWB A;  4JI6 E;  4LFB I;  2DMY A;  2JVA A;  1Z5B A;  2PNL A;  4LFA E;  4J8Z A;  2UXC I;  1KKH A;  1ZBT A;  3VK6 A;  3T1H E;  1HNW E;  1N0U A;  2FV4 B;  3C4T A;  2UUB E;  2F4V E;  1HNX I;  2E1M A;  4DPY A;  4NXM I;  2GQ0 A;  1WUU A;  4LF7 I;  4DR6 I;  4JG4 A;  1HNZ I;  2RS7 A;  1YYK A;  2UU9 E;  4DV5 E;  2Q2E B;  3T1Y E;  4BS9 A;  3F6G A;  1IBL I;  3F0N A;  3HTX A;  1ZM4 A;  3C4B A;  4JI3 E;  4DV2 E;  4R03 A;  2N3H A;  1N36 E;  4LF6 E;  2FTX B;  1XMO I;  4B3S I;  2UUC I;  1N33 I;  1BKN A;  4XTJ A;  4IZJ D;  1RC7 A;  1B63 A;  2KON A;  4WPY A;  4M2Z A;  2EWL A;  4AQY I;  4BBY A;  4URL A;  2HFU A;  2BM1 A;  4GKJ E;  3K85 A;  1MG7 A;  1WXR A;  2WW4 A;  4DR1 I;  2DB2 A;  2UXD I;  2O1T A;  4IZK A;  2LE2 A;  3ZOQ B;  2ZM6 I;  2K4V A;  2M7Q A;  1XMQ I;  4BC7 A;  2UXB I;  1N0V C;  1EA6 A;  4HYM A;  4BCA A;  5LMN E;  4DV1 I;  3PYD A;  4M1K A;  4K0K E;  4EMD A;  4F9A B;  3J81 C;  3OTO I;  4BMJ A;  1DQ3 A;  3KWR A;  2A2D A;  1Z0T A;  4JI5 I;  1IBK I;  2JOX A;  4X8W A;  4DPT A;  2J7K A;  3IWC A;  2VE7 C;  5ADZ A;  3ADI A;  2HK3 A;  4FWG A;  3D4J A;  4PU9 A;  3HPZ A;  2YT4 A;  1ZM3 A;  4DR2 E;  1XNQ E;  4JV5 I;  4LF8 E;  4F54 A;  4DR3 E;  4P52 A;  1K47 A;  4YHH E;  1NHH A;  1VIS A;  2L3J A;  4DV4 E;  1PVG A;  3HUL A;  3J80 Q;  4LF9 I;  3JU0 A;  5AE3 A;  4USM A;  1J5E E;  3MSW A;  2V8Q B;  2B3T B;  3PYG A;  2IOP A;  1IBM E;  4JI6 I;  4X66 I;  2V89 A;  2VF3 A;  1MU5 A;  4JI8 I;  4LFA I;  2X36 A;  2JR1 A;  1GQE A;  4JI0 E;  2PNM A;  1ZXN A;  2JY9 A;  3T1H I;  5GME A;  1HNW I;  2L3C A;  2N3G A;  2WZO A;  2UUB I;  4NXN I;  4WFT A;  2L2K B;  1H7U A;  4KHP E;  4MYU A;  4GKK I;  1XNR E;  2B7V A;  1Z0V A;  5IWA E;  1H73 A;  1YYW A;  4X62 E;  2EZ6 A;  4DR4 E;  2DIX A;  3IWD A;  4JI2 I;  2LRS A;  2YZT A;  1N32 E;  3J81 Q;  4DV3 I;  3HJC A;  4DV2 I;  3F6H A;  4P7A A;  3ADJ A;  4X64 E;  4LF6 I;  1QZR A;  1T4L B;  2B9D A;  5FWK A;  1ZM2 A;  2FGG A;  1Z59 A;  2XEX A;  2OI2 A;  2Z5E A;  4F9B B;  4KZS A;  4X65 I;  4LF5 I;  4BC9 A;  1Y4S A;  4OX9 E;  1FNM A;  1HR0 I;  4GKJ I;  4JYA E;  3FIG A;  3ZKB A;  1KVK A;  2MC6 A;  4DKK A;  4B3R E;  2L33 A;  2IHR 1;  3WU5 A;  3K6Q A;  4P78 A;  2VF1 A;  4ED4 A;  3ADL A;  1FJG E;  4L5N C;  3J80 C;  4JI7 E;  1UEK A;  5AAS A;  2CG9 A;  3H4L A;  4Z7Y A;  1Z5C A;  1A6F A;  3Q1Q A;  5LMU I;  2Z5B A;  2RS6 A;  1Y4U A;  4GEQ B;  1H74 A;  1MX0 A;  2V88 A;  4M30 A;  2HFS A;  4DV0 E;  1KTV A;  4LFB E;  3AUZ A;  4JI1 E;  4R8O A;  1UIL A;  4JI4 E;  4HAC A;  2L6M A;  4DV7 E;  4TUG A;  2NUG A;  2UXC E;  4DUY I;  1ZXM A;  4TUI A;  3Q6M A;  5BR8 I;  1Z0C A;  1Y6Z A;  2B7T A;  2UUA I;  4YHH I;  4DV4 I;  5T6J A;  4N3O A;  4LF7 E;  1J5E I;  3J7A M;  1KIJ A;  3ZKD A;  2E5L I;  2VQF E;  2ZIT A;  1HNZ E;  4B3T E;  2HKJ A;  4PRV A;  4LFC E;  1IBM I;  1YYO A;  5FLX Q;  5L3J A;  3ZZU A;  1IBL E;  2LTS A;  2KOU A;  3AV0 A;  1D6T A;  4JI0 I;  3H09 A;  2L2N A;  4DPW A;  4DR7 I;  4IZJ B;  2Z5C B;  2NPF A;  4B3M I;  1XMO E;  4B3S E;  3LTO A;  1N33 E;  4UTG A;  4LF4 E;  3JTZ A;  1UHZ A;  3B78 A;  4KHP I;  2V86 A;  4HY1 A;  1Z0W A;  5A2Q Q;  3JAM C;  3WU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...