4K0KE

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4k0kE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4k0kE02
4JI6E 4DR1E 1ELOA 4LFBI 1ZM4A 2NA2A 1Z0WA 3J7AM 2ZITA 1J5EI 4DR7I 1XMOI 1KKHA 2WW4A 4X65E 4HACA 4FWHA 2A2DA 1HNWI 2V34A 4DPTA 1N34E 1IBLE 4USMA 3ADIA 5IWAE 4JI2E 2UU9E 1UHZA 2A2CA 4WUBA 4B3SI 4LFAE 1ZXNA 1Z5AA 1B62A 2UXCI 3P1XA 4AQYI 2HKEA 1Z5BA 1ZM9A 2B7VA 2ZM6E 4LF9E 1MG7A 4DU8A 1KTVA 1FJGI 1YYOA 4M2ZA 4K0KI 2UUCE 1N33I 3ZZUA 2UXBI 1BKNA 4DPWA 2UUBI 2GS8A 3ZZTA 2VQEE 4B3MI 5CFFE 2BM1A 1HR0E 3VYXA 2JY9A 4RPFA 4KQVA 3J81C 2KHXA 3F0NA 4DUYI 3C4BA 4I3HA 2NPFA 2X36A 4WYQB 3T1YI 2R42A 3OTOI 3ZZ0A 1FNMA 3QT8A 1NHIA 5LL6R 5GMEA 4DV3E 4JI7E 4JI4I 1X48A 3J81Q 1EA6A 1N36E 1NHHA 1RC7A 4Z7CA 1QZRA 5LMUE 4DR3E 1XNRI 1QU6A 4DPXA 3ADLA 1O0WA 4HYMA 1T4NA 1N0VC 1XHKA 2JVAA 4DR2I 1IBMI 4FN5A 4MYTA 5FLXQ 1ZM2A 2UXDI 4JI1E 4JG4A 1ZM3A 2V2VA 1T4LB 3PYDA 1H73A 2DEJA 4LF7E 4M1KA 2DB2A 4JYAE 1PIEA 4DV7I 1YYKA 5LMNE 1YZ9A 1IBKI 4NXNI 1Z0GA 4LFBE 2E5LI 4DR6I 4NXME 1J5EE 4DR7E 4M30A 4LF5I 4LFCI 2NUEA 3WU6A 2VQFI 2F4VI 1X49A 2MDRA 2ZBKB 4PRVA 3T1HE 1B63A 1ZXMA 4FW9A 4X66I 1XNQI 2CPNA 4DV1E 1PKPA 2RS6A 3J80C 3JAMC 2N3GA 3GONA 4EMDA 5L3JA 4B3RI 4B3SE 2L3CA 3H4LA 1EKZA 3C4TA 2UXCE 4JI6I 4AQYE 3WU3A 4DXLA 4X62E 4JI0I 3HTXA 1I94I 1XMQI 2LUPB 2IHR1 2YT4A 1FJGE 3J80Q 1NHJA 3JAMQ 3PYFA 4K0KE 1N33E 1MX0A 4YHHI 3ZKBA 3WU4A 1S16A 4KHPI 2UXBE 2UUBE 5BR8E 2N3HA 4DV0E 2DMYA 4YY3I 4B3ME 4GKKI 4DR5I 2E1RA 2LJPA 1NZ0A 2B7TA 4JI2I 2UU9I 4X64I 2X7IA 3B82A 2HFUA 2L2KB 4JI8I 4DV5I 1A6FA 4DV4I 2V2QA 1GQEA 4DV6I 1Z0TA 3PYEA 2ZM6I 1FI4A 4DPUA 1Z0EA 2RS7A 4JV5E 3LPSA 3OTOE 3J7AG 2HHHI 4OX9I 2UUCI 5GMDA 4JI4E 2UUAI 2RSMA 5FLXC 3CWVA 4JI5I 1XNRE 4HY1A 2EFGA 5IT9C 2Q2EB 4DR2E 4LF6I 1S4EA 1IBME 1Z0VA 1Z5CA 4DV2E 2UXDE 4B3TE 4UTGA 4URLA 2HKJA 4DV7E 2V2ZA 1IBKE 4GKJI 4NXNE 2HK2A 1YYWA 4X8WA 5IT9Q 4JI3E 4PRXA 1X47A 4ED4A 2LUQA 1N36I 4LF5E 2CZ9A 3QT6A 2L3JA 4DUZI 2BM0A 4MYUA 1XMOE 1FWLA 2V8PA 4X66E 2HFSA 1ZBTA 1KIJA 2DEIA 1H7UA 4DR4I 1HNWE 4WUDA 3V2UC 4JI1I 1K47A 1HNZI 4LF4I 1HNXI 3K1JA 4B3RE 1N32I 2B3TB 2BV3A 4JYAI 3ZM7A 1EI1A 5LMNI 1N0UA 1STUA 4JI0E 4NXMI 2EZ6A 4LF8I 1I94E 2NUFA 1XMQE 4P52A 4DR1I 4ZVIA 2DIXA 2R3VA 4YHHE 1VISA 4DPYA 1WHQA 3T1HI 2HK3A 4KHPE 3LTOA 4X65I 1UEKA 4YY3E 4DV1I 4WUCA 1Z0BA 4GKKE 4DR5E 4XTJA 2L2MA 1KVKA 1DARA 1WUUA 1N34I 1IBLI 4X64E 3V5RA 2RTXA 4PU9A 5IWAI 4JI8E 4DU7A 3WU5A 3D4JA 4DV5E 4LFAI 4DV4E 3PYGA 4USKA 3HULA 4X62I 3VYYA 4DV6E 4P7AA 4DUYE 3K17A 2HHHE 4OX9E 2LTRA 4HXZA 4LF9I 3T1YE 1MU5A 2UUAE 5BR8I 4DV0I 1RR9A 1Z0CA 4OOGC 4JI5E 3B8HA 2VQEI 2VF3A 3QT5A 1H7SA 4HACB 2LBSB 4LF6E 1FKAE 1J26A 3B78A 2LJHA 1HR0I 2AJ4A 4WFTA 1RREA 1RQ0A 1PVGA 4JV5I 1WHNA 1H74A 3LLHA 4GKJE 1UILA 4R1FA 1OJ4A 4FWDA 5A2QC 2LTSA 3Q1QA 2LRSA 2OI2A 4Z7YA 4DKKA 2E5LE 4DUZE 4DR6E 4DV3I 4JI7I 1D6TA 3QT7A 1U2RA 2L2NA 4LFCE 2J7KA 5LMUI 2VQFE 3ZKDA 4DR3I 2F4VE 4UT4A 2NUGA 3J7Yp 4DR4E 4DV2I 1T4OA 2L33A 4B3TI 1XNQE 1HNZE 3M6AA 4LF4E 5A2QQ 1HNXE 3LNUA 1N32E 1FWKA 1Z59A 1DI2A 3ADJA 3ADGA 1H72C 4FWGA 4LF7I 4JI3I 2XEXA 4LF8E
chains in the Genus database with same CATH superfamily
2JT2A 3F6HA 5K36A 4JI6E 4DR1E 1ELOA 3P3EA 4LFBI 2MKDA 2NA2A 1Z0WA 1ZM4A 3J7AM 2ZITA 2VESA 1ZR9A 1J5EI 1EH7A 4DR7I 1XMOI 1YSAC 1KKHA 2IERA 2EN8A 2WW4A 1PJQA 4X65E 1G2FC 3PS1A 1KJKA 1KYQA 2EOIA 4F9CB 4HACA 2EMYA 4FWHA 1UN6B 2PO1A 2A2DA 4N4RB 2EMIA 2V34A 4DPTA 1HNWI 4L8NA 1N34E 2VRDA 2EQ3A 1IBLE 2BA1G 1A1IA 4USMA 3DF6A 3ADIA 2O1VA 5IWAE 4AM3A 2EPXA 2I9IA 2WNRA 2YTQA 1YFHA 4JI2E 2UU9E 2Z5CA 1UHZA 2A2CA 4WUBA 4B3SI 4LFAE 4RHBB 1ZXNA 3NZKA 2JEBB 1Z5AA 1B62A 2ODRD 3L00A 3Q6NA 2YU5A 2UXCI 3P1XA 2EPCA 4AQYI 3M7NG 2HKEA 3BIDA 1Z5BA 1ZM9A 3HPSA 4WXDA 2IOQA 4ZYGA 5KL3A 4OO1A 2B7VA 2ZM6E 1ZU1A 2F8BA 2YTFA 4LF9E 4AIMA 1MG7A 4DU8A 4NBQA 1KTVA 3EPJA 2EPNA 4BBYA 2ELYA 2WCC3 1YYOA 3KWRA 1FJGI 3ZOQB 4M2ZA 2C39B 2FTXB 2YWQA 4K0KI 2ENHA 2LCEA 2UUCE 1N33I 4NZVA 2NN6C 5KL6A 4IFDC 2LE2A 3ZZUA 3CDJA 4QNKA 2UXBI 1BKNA 4DPWA 2UUBI 2GS8A 3ZZTA 1UDQA 4BS9A 4R2PA 2VQEE 4B3MI 5CFFE 2BM1A 3THOB 3HJCA 2EOYA 1Y6ZA 2EP3A 4I8OA 1HR0E 1R6LA 2CG9A 4LTYA 3VYXA 2JY9A 2WP8B 5DROA 4RPFA 2EN1A 5JEAC 4KQVA 3J81C 4FW7A 2KHXA 3F0NA 4LPFA 4MU4A 4DUYI 1WJPA 3C4BA 3ECRA 4I3HA 2NPFA 1NCSA 2EMLA 2EMAA 1T39A 2EPZA 4WYQB 1A1JA 2X36A 3T1YI 2R42A 3OTOI 3ZZ0A 5F3WA 1DGCA 3VK6A 1FNMA 2JE6B 3BF2A 3QT8A 2V87A 2EM6A 1NHIA 2K4VA 5LL6R 2NN6B 1Y5YA 5GMEA 5KL7A 4DV3E 4JI7E 1Y4SA 4JI4I 5ADZA 1X48A 5C0XE 3IWBA 1EA6A 2YPNA 4LOMA 3J81Q 2YTNA 1N36E 1X5WA 4QNJA 1NHHA 1RC7A 2IESA 4Z7CA 1QZRA 2J65A 5LMUE 1YUJA 1P42A 1GTKA 4DR3E 5K36E 4BA2A 1GZ6A 2PNMA 1XNRI 5AE3A 2V86A 1NEIA 1QU6A 1ZAAC 3ADLA 4DPXA 1O0WA 5KL2A 1E3PA 4HYMA 1T4NA 1N0VC 1XHKA 2JVAA 2C38A 2NN6F 4DR2I 1EH8A 2YTJA 2YTOA 1IBMI 2Z5BB 4RH8A 4FN5A 1HK7A 2JEBA 2BA1D 1ZM2A 2YTIA 1P47A 4MYTA 2JOBA 5FLXQ 4U3DA 2V8QB 2GHFA 2WBUA 2EPLX 4JI1E 3P76A 3M85G 4JG4A 2UXDI 1ZM3A 1X3CA 2V2VA 2RSIA 1T4LB 3PYDA 1OYRA 4Q35B 1A1FA 1H73A 2DEJA 4LF7E 4M1KA 4O4KA 2DB2A 1WXRA 4JYAE 1G2DC 4BC7A 1PIEA 3BBGA 4ISAA 4DV7I 1YYKA 1TF6A 5LMNE 4TUIA 2V83A 1YZ9A 1IBKI 5LLQA 2ELZA 4NXNI 1Z0GA 2EPOA 4O5GA 4LFBE 4LCHA 2E5LI 4DR6I 2M9AA 3THNA 4NXME 3M7ND 1J5EE 1X6FA 2EPMX 4DR7E 4IFDE 4M30A 4LF5I 3DD6A 5A6AA 4WSPA 4OZEA 2EOQA 4LFCI 2BA0G 1UDSA 1R6MA 2NUEA 2A25A 2G7HA 3WU6A 2VQFI 2F4VI 1UDNA 1X49A 2MDRA 5AC4A 2GLIA 2M4IA 2ZBKB 4PRVA 2PNZB 3T1HE 1B63A 1ZXMA 4OO1E 4TUGA 4FW9A 4IZJD 4X66I 1XNQI 2CPNA 4FW3A 4DV1E 1QNTA 2EMBA 4OKGA 1PKPA 2YSPA 2L8TA 2RS6A 2JXPA 2EOEA 3J80C 4U3BA 3JAMC 2N3GA 3EPKA 3HXLA 1IQOA 3GONA 4EMDA 5L3JA 4B3RI 1Z1BA 4B3SE 3P3GA 4FW6A 4ZYHA 2C37B 3EQ1A 2L3CA 4R03A 5A6BD 4R2AA 4KWYA 4O24A 1MGTA 3H4LA 2EL6A 1EKZA 3C4TA 4M0VA 3QG5C 2M7QA 2UXCE 4AQYE 2JE6A 5DRQA 3WU3A 2NN6A 2DGCA 4DXLA 5C0XD 4X62E 4IFDA 4FW5A 4JI0I 3HTXA 2EM2A 1I94I 1XMQI 3BGHA 5K36D 2LUPB 2IHR1 2YT4A 2YRMA 1FJGE 3J80Q 2MKNA 4WX9A 1NHJA 3JAMQ 2EPPA 5A6KA 3PYFA 4K0KE 4L5NC 2HGHA 2EOMA 4HEIA 1N33E 2PO0A 1MX0A 4YHHI 3ZKBA 3H09A 3WU4A 3L7ZB 1S16A 3HPZA 1LLMC 4MQYA 4KHPI 5TSEA 4BHCA 2UXBE 2R1FA 2UUBE 5BR8E 2GQ0A 2VE7C 1EH6A 2N3HA 4DV0E 5ELWA 5JEAA 4MU3A 2DMYA 4YY3I 4JI6I 4B3ME 3GMEA 2YTEA 5AE2A 1RHYA 2EOOA 2JWOA 4GKKI 4DR5I 2E1RA 2EE8A 4BMJA 2LJPA 1NZ0A 2VF1A 2Z5BA 2EMGA 2B7TA 2YTGA 1JK1A 4JI2I 2BR2B 2UU9I 4X64I 2X7IA 1BB8A 3B82A 2WBTA 2HFUA 2L2KB 4JI8I 1UBDC 2D9HA 2EM5A 2JR1A 2EMCA 4DV5I 1A6FA 4DV4I 1DQ3A 4F6MA 2V2QA 4GEQB 4IFDD 1GQEA 4DV6I 5FWKA 3M85D 1Z0TA 4WXCA 4BC9A 3PYEA 2ZM6I 3JU0A 2RQLA 1FI4A 1Z0EA 4DPUA 2RS7A 3MHSC 2E72A 4JV5E 3OTOE 4GZNC 3J7AG 3LPSA 5IXMB 5K36B 1IMUA 2HHHI 1L4SA 4OX9I 5AC5A 2PNLA 4OO1D 2UUCI 3AUZA 4HTGA 2LMZA 5GMDA 4JI4E 3PS2A 2PNZA 2DLKA 5DRRA 1YHCA 1USUA 2J7JA 2UUAI 2EL4A 2V88A 2RSMA 2JYAA 3HQ1A 4J8ZA 5FLXC 5AE1A 1XXEA 4ZYEA 4DV2I 3CWVA 2WBSA 3U1KA 2BA0D 2CVEA 4JI5I 1XNRE 2PO1B 1BBGA 2F1DA 3JTZA 4HY1A 4P7DA 2AE8A 2EFGA 5K36F 5IT9C 2Q2EB 2EJ4A 4DR2E 3H1CA 4LF6I 1S4EA 3RMPA 1IBME 4R2CA 1Z0VA 5EKWA 2EMXA 1Z5CA 2YRKA 1ZBQA 2O3ZA 4DV2E 3K6QA 5KL4A 2UXDE 4B3TE 2YRHA 1YPNA 4UTGA 2CSHA 2V85A 3Q6MA 2RPCA 2EOZA 2PO2B 2EMFA 1WRJA 4URLA 1IQSA 2HKJA 3OMLA 4DV7E 4NHRA 4R2EA 2V2ZA 4MU0A 4IJDA 3KZZA 4O43A 1IBKE 1B69A 4NXNE 2HK2A 2Z5EA 4GKJI 1YYWA 2YU8A 3F6GA 4X8WA 5IT9Q 4JI3E 1RMDA 4Q28A 2NABA 2V89A 1X47A 2EMZA 2LUQA 3C6KA 4PRXA 4ED4A 1N36I 1X6EA 3LMLA 4LF5E 1VI7A 2CZ9A 3QT6A 2C39A 2L3JA 1Y4UA 4DUZI 2DMIA 3TQMA 2BM0A 2DRPA 4LCGA 4MYUA 4MDTA 4KZSA 4ZYDA 2KONA 2NN6E 1XMOE 1FWLA 4BHBA 3U1YA 2V8PA 5A6JA 2ENCA 4X66E 2EOFA 2HFSA 1ZBTA 2O1UA 5KL5A 4FK5C 1KIJA 2DEIA 1AH5A 4J3DA 4M9VC 1H7UA 2LJUA 4DR4I 1HNWE 4WUDA 4IZKB 3V2UC 4JI1I 1AAYA 1K47A 3KRNA 1HNZI 4LF4I 1HNXI 2HC5A 3K1JA 2WP8A 4B3RE 1N32I 2B3TB 1PJSA 4F9AB 1T38A 1TN9A 2BV3A 5JEAE 4JYAI 2L6MA 3ZM7A 2FV4B 4BA1B 2M1SA 1EI1A 4LF8E 5LMNI 2K7IA 2ADRA 1N0UA 2EMHA 2EMKA 1STUA 2GPIA 1PDAA 1A1GA 4JI0E 2EZ6A 4NXMI 4LF8I 1I94E 2NUFA 1XMQE 2EPRA 4P52A 2IOPA 4DR1I 4ZVIA 2LO3A 2O1WA 2EM8A 2DIXA 1TF3A 2R3VA 5DNLA 3MHHC 2EMWA 2YTPA 5C0XC 1JK2A 2EN2A 2EPAA 4YHHE 1WHQA 1VISA 2HK3A 4DPYA 3T1HI 3GCMA 4KHPE 2ODRC 3IWDA 2BBGA 1Y60A 3LTOA 4X65I 5K36C 2EOHA 2FGGA 1UEKA 4YY3E 4DV1I 4WUCA 4LCFA 2YZTA 1Z0BA 4GKKE 4F54A 4DR5E 1UDOA 5DNXA 5EL9A 4BA2B 4XTJA 2L2MA 2L92A 4IZJB 1KVKA 1DARA 1WUUA 4N3OA 1N34I 2EQ1A 1IBLI 2JEAB 4X64E 3V5RA 5AASA 2RTXA 2HJJA 2C38B 1E3HA 4PU9A 5IWAI 4MU1A 2I13A 4WPYA 4JI8E 3VHTB 4DU7A 3WU5A 2PO2A 3GLLA 3UK3C 4IS9A 3D4JA 2EOSA 2EWLA 2R76A 1SFEA 2E1MA 2EM4A 4DV5E 4LFAI 4DV4E 3PYGA 4USKA 3B4TA 3HULA 3VYYA 1PJTA 4DV6E 3P06A 4X62I 2B9DA 4P7AA 2Q8UA 2GO3A 4DUYE 2LV2A 2DLQA 2KOUA 3K17A 3PRYA 4LU9A 2NN6D 5C0XB 4B3TI 2EOJA 2HHHE 5T6JA 4OX9E 2LTRA 4HXZA 4LF9I 2EORA 3T1YE 1MU5A 2DSYA 2EM3A 2ENAA 2UUAE 5BR8I 3PS3A 3MSWA 4DV0I 2EOXA 1RR9A 1Z0CA 2BB8A 2H36X 3EPLA 4OO1C 4OOGC 2YSOA 2PRTA 3AV0A 4BCAA 4JI5E 1OYPA 3B8HA 2JPAA 2VQEI 1MEYC 5JEAD 4IZKA 4R2QA 2EPUA 2VF3A 3QT5A 2EN6A 1H7SA 4HACB 5C0XF 2LBSB 2JOXA 5DNYA 4LF6E 4F2JC 1FKAE 4FW4A 2EL5A 2EM0A 2CTDA 3C6MA 4BA1A 3HKMA 1J26A 4R2SA 1A1HA 2LJHA 2EM9A 1OYSA 2AJ4A 3B78A 1HR0I 2EPKX 2GO4A 4WFTA 1RREA 2C37A 1RQ0A 1PVGA 4MLQA 2WNRB 3K85A 3P3CA 4JV5I 1N3GA 1WHNA 1YUIA 2Z5CB 1H74A 4F9BB 2LVHA 2JP9A 3LLHA 4R2DA 4GKJE 4IFDB 3UHMA 2N8XA 4F6NA 1UILA 4R1FA 4AIDA 1OJ4A 4FWDA 5A2QC 2LTSA 5DRPA 3Q1QA 2LRSA 2OI2A 2O1TA 4Z7YA 4OO1B 4DKKA 2E5LE 4DUZE 1F2IG 4DR6E 4DV3I 4JI7I 1D6TA 4IS1C 3QT7A 2PO0B 1YH8A 2MDGA 1U2RA 1USVA 2EQ0A 3L7ZA 2EM7A 2MC6A 4GQUA 2L2NA 2EN7A 3KZYA 4IZJA 4LFCE 2JEAA 5JEAB 3FIGA 2WZOA 2J7KA 5LMUI 5A69A 2VQFE 3ZKDA 1X6HA 4DR3I 2F4VE 4UT4A 4IFDF 2NUGA 3J7Yp 1BBOA 2EN4A 4X9JA 2CT1A 4R2RA 3M99B 3DJWA 4P78A 3IWCA 1T4OA 2L33A 4DR4E 2MC5A 1XNQE 1A1KA 1HNZE 4LF4E 2BR2A 1HNXE 3M6AA 5A2QQ 5IV8B 3LNUA 1N32E 4OO1F 4MLVA 1FWKA 1Z59A 5A6BA 4R8OA 4WSGA 1DI2A 3ADJA 3ADGA 2LT7A 1H72C 2EN3A 1A1LA 3EPHA 2YTDA 2CGEA 4FWGA 5C0XA 4LF7I 5JEAF 1SR9A 3CDIA 4JI3I 2XEXA 4DMIA
chains in the Genus database with same CATH topology
3F6HA 4JI6E 4DR1E 1ELOA 4LFBI 1ZM4A 2NA2A 1Z0WA 3J7AM 2ZITA 1J5EI 4DR7I 1XMOI 1KKHA 2WW4A 4X65E 4F9CB 4HACA 4FWHA 2A2DA 1HNWI 2V34A 4DPTA 4L8NA 1N34E 1IBLE 4USMA 3DF6A 3ADIA 2O1VA 5IWAE 4JI2E 2UU9E 2Z5CA 1UHZA 2A2CA 4WUBA 4B3SI 4LFAE 1ZXNA 1Z5AA 1B62A 2ODRD 3Q6NA 2UXCI 3P1XA 4AQYI 2HKEA 1Z5BA 1ZM9A 3HPSA 2IOQA 2B7VA 2ZM6E 4LF9E 2F8BA 1MG7A 4DU8A 1KTVA 4BBYA 1FJGI 1YYOA 3KWRA 3ZOQB 4M2ZA 2FTXB 4K0KI 2UUCE 1N33I 2LE2A 3ZZUA 2UXBI 1BKNA 4DPWA 2UUBI 2GS8A 3ZZTA 4BS9A 2VQEE 4B3MI 5CFFE 2BM1A 3HJCA 1Y6ZA 4I8OA 1HR0E 2CG9A 4LTYA 3VYXA 2JY9A 4RPFA 4KQVA 3J81C 2KHXA 3F0NA 4DUYI 4DMIA 3C4BA 4I3HA 2NPFA 2X36A 4WYQB 3T1YI 2R42A 3OTOI 3ZZ0A 5F3WA 3VK6A 1FNMA 3QT8A 2V87A 1NHIA 2K4VA 5LL6R 5GMEA 4DV3E 4JI7E 1Y4SA 4JI4I 5ADZA 1X48A 3IWBA 1EA6A 3J81Q 1N36E 1NHHA 1RC7A 4Z7CA 1QZRA 5LMUE 4DR3E 1GZ6A 2PNMA 1XNRI 5AE3A 2V86A 1QU6A 4DPXA 3ADLA 1O0WA 4HYMA 1T4NA 1N0VC 1XHKA 2JVAA 4DR2I 1IBMI 2Z5BB 4FN5A 4MYTA 1HK7A 5FLXQ 1ZM2A 2JOBA 2V8QB 2UXDI 4JI1E 4JG4A 1ZM3A 2V2VA 1T4LB 3PYDA 1H73A 2DEJA 4LF7E 4M1KA 2DB2A 1WXRA 4JYAE 1PIEA 4BC7A 4DV7I 1YYKA 5LMNE 4TUIA 2V83A 1YZ9A 1IBKI 4NXNI 1Z0GA 4LFBE 2E5LI 4DR6I 4NXME 1J5EE 4DR7E 4M30A 4LF5I 4WSPA 4LFCI 2NUEA 3WU6A 2G7HA 2VQFI 2F4VI 1X49A 2MDRA 2ZBKB 2M4IA 4PRVA 3T1HE 1B63A 1ZXMA 4TUGA 4FW9A 4IZJD 4X66I 1XNQI 2CPNA 4DV1E 1PKPA 2L8TA 2RS6A 3J80C 3JAMC 2N3GA 3HXLA 3GONA 4EMDA 5L3JA 4B3RI 4B3SE 2L3CA 4R03A 3H4LA 1EKZA 3C4TA 4M0VA 2M7QA 2UXCE 4JI6I 4AQYE 3WU3A 4DXLA 4X62E 4JI0I 3HTXA 1I94I 1XMQI 2LUPB 2IHR1 2YT4A 1FJGE 3J80Q 1NHJA 3JAMQ 3PYFA 4K0KE 4L5NC 1N33E 1MX0A 4YHHI 3ZKBA 3H09A 3WU4A 1S16A 3HPZA 4KHPI 2UXBE 2UUBE 2GQ0A 5BR8E 2VE7C 2N3HA 4DV0E 2DMYA 4YY3I 4B3ME 5AE2A 2JWOA 4GKKI 4DR5I 2E1RA 4BMJA 2LJPA 1NZ0A 2VF1A 2Z5BA 2B7TA 4JI2I 2UU9I 4X64I 2X7IA 3B82A 2HFUA 2L2KB 4JI8I 2JR1A 4DV5I 1A6FA 4DV4I 1DQ3A 2V2QA 4GEQB 1GQEA 4DV6I 5FWKA 1Z0TA 4BC9A 3PYEA 2ZM6I 3JU0A 1FI4A 4DPUA 1Z0EA 2RS7A 4JV5E 3LPSA 3OTOE 3J7AG 2HHHI 4OX9I 2PNLA 2UUCI 3AUZA 2LMZA 5GMDA 4JI4E 1USUA 2UUAI 2V88A 2RSMA 3HQ1A 4J8ZA 5FLXC 5AE1A 3CWVA 4JI5I 1XNRE 3JTZA 4HY1A 4P7DA 2EFGA 5IT9C 2Q2EB 4DR2E 4LF6I 1S4EA 3RMPA 1IBME 1Z0VA 1Z5CA 1ZBQA 4DV2E 3K6QA 2UXDE 4B3TE 4UTGA 2V85A 3Q6MA 4URLA 2HKJA 3OMLA 4DV7E 2V2ZA 1IBKE 4GKJI 2Z5EA 4NXNE 2HK2A 1YYWA 3F6GA 4X8WA 5IT9Q 4JI3E 4Q28A 2V89A 1X47A 4PRXA 2LUQA 4ED4A 1N36I 3LMLA 4LF5E 2CZ9A 3QT6A 2L3JA 1Y4UA 4DUZI 2BM0A 4MYUA 4KZSA 2KONA 1XMOE 1FWLA 2V8PA 4X66E 2HFSA 1ZBTA 2O1UA 1KIJA 2DEIA 1H7UA 4DR4I 1HNWE 4WUDA 4IZKB 3V2UC 4JI1I 1K47A 1HNZI 4LF4I 1HNXI 3K1JA 4B3RE 1N32I 2B3TB 4F9AB 2BV3A 4JYAI 2L6MA 3ZM7A 2FV4B 2M1SA 1EI1A 5LMNI 1N0UA 1STUA 4JI0E 4NXMI 2EZ6A 4LF8I 1I94E 2NUFA 1XMQE 4P52A 2IOPA 4DR1I 4ZVIA 2O1WA 2DIXA 2R3VA 4YHHE 1VISA 4DPYA 1WHQA 3T1HI 2HK3A 4KHPE 2ODRC 3IWDA 3LTOA 4X65I 1UEKA 2FGGA 4YY3E 4DV1I 4WUCA 2YZTA 1Z0BA 4GKKE 4F54A 4DR5E 4XTJA 2L2MA 2L92A 4IZJB 1KVKA 1DARA 1WUUA 4N3OA 1N34I 1IBLI 4X64E 3V5RA 5AASA 2RTXA 4PU9A 5IWAI 4WPYA 4JI8E 4DU7A 3WU5A 3D4JA 2EWLA 2E1MA 4DV5E 4LFAI 4DV4E 3PYGA 4USKA 3HULA 3P06A 3VYYA 4DV6E 4X62I 2B9DA 4P7AA 4DUYE 2KOUA 3K17A 3PRYA 4LU9A 2HHHE 5T6JA 4OX9E 2LTRA 4HXZA 4LF9I 3T1YE 1MU5A 2DSYA 2UUAE 5BR8I 3MSWA 4DV0I 1RR9A 1Z0CA 2H36X 4OOGC 3AV0A 4BCAA 4JI5E 3B8HA 2VQEI 4IZKA 2VF3A 3QT5A 1H7SA 4HACB 2LBSB 2JOXA 5DNYA 4LF6E 1FKAE 1J26A 3B78A 2LJHA 1HR0I 2AJ4A 4WFTA 1RREA 1RQ0A 1PVGA 3K85A 4JV5I 1WHNA 2Z5CB 1H74A 4F9BB 3LLHA 4GKJE 1UILA 4R1FA 1OJ4A 4FWDA 5A2QC 2LTSA 3Q1QA 2LRSA 2OI2A 2O1TA 4Z7YA 4DKKA 2E5LE 4DUZE 4DR6E 4DV3I 4JI7I 1D6TA 3QT7A 1U2RA 1USVA 2MC6A 2L2NA 4IZJA 4LFCE 3FIGA 2WZOA 2J7KA 5LMUI 2VQFE 3ZKDA 4DR3I 2F4VE 4UT4A 2NUGA 3J7Yp 4DR4E 4DV2I 3DJWA 4P78A 3IWCA 1T4OA 2L33A 4B3TI 2MC5A 1XNQE 1HNZE 3M6AA 4LF4E 5A2QQ 1HNXE 3LNUA 1N32E 1FWKA 1Z59A 4R8OA 1DI2A 3ADJA 3ADGA 1H72C 2CGEA 4FWGA 4LF7I 1SR9A 4JI3I 2XEXA 4LF8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 E;  4DR1 E;  1ELO A;  4LFB I;  1ZM4 A;  2NA2 A;  1Z0W A;  3J7A M;  2ZIT A;  1J5E I;  4DR7 I;  1XMO I;  1KKH A;  2WW4 A;  4X65 E;  4HAC A;  4FWH A;  2A2D A;  1HNW I;  2V34 A;  4DPT A;  1N34 E;  1IBL E;  4USM A;  3ADI A;  5IWA E;  4JI2 E;  2UU9 E;  1UHZ A;  2A2C A;  4WUB A;  4B3S I;  4LFA E;  1ZXN A;  1Z5A A;  1B62 A;  2UXC I;  3P1X A;  4AQY I;  2HKE A;  1Z5B A;  1ZM9 A;  2B7V A;  2ZM6 E;  4LF9 E;  1MG7 A;  4DU8 A;  1KTV A;  1FJG I;  1YYO A;  4M2Z A;  4K0K I;  2UUC E;  1N33 I;  3ZZU A;  2UXB I;  1BKN A;  4DPW A;  2UUB I;  2GS8 A;  3ZZT A;  2VQE E;  4B3M I;  5CFF E;  2BM1 A;  1HR0 E;  3VYX A;  2JY9 A;  4RPF A;  4KQV A;  3J81 C;  2KHX A;  3F0N A;  4DUY I;  3C4B A;  4I3H A;  2NPF A;  2X36 A;  4WYQ B;  3T1Y I;  2R42 A;  3OTO I;  3ZZ0 A;  1FNM A;  3QT8 A;  1NHI A;  5LL6 R;  5GME A;  4DV3 E;  4JI7 E;  4JI4 I;  1X48 A;  3J81 Q;  1EA6 A;  1N36 E;  1NHH A;  1RC7 A;  4Z7C A;  1QZR A;  5LMU E;  4DR3 E;  1XNR I;  1QU6 A;  4DPX A;  3ADL A;  1O0W A;  4HYM A;  1T4N A;  1N0V C;  1XHK A;  2JVA A;  4DR2 I;  1IBM I;  4FN5 A;  4MYT A;  5FLX Q;  1ZM2 A;  2UXD I;  4JI1 E;  4JG4 A;  1ZM3 A;  2V2V A;  1T4L B;  3PYD A;  1H73 A;  2DEJ A;  4LF7 E;  4M1K A;  2DB2 A;  4JYA E;  1PIE A;  4DV7 I;  1YYK A;  5LMN E;  1YZ9 A;  1IBK I;  4NXN I;  1Z0G A;  4LFB E;  2E5L I;  4DR6 I;  4NXM E;  1J5E E;  4DR7 E;  4M30 A;  4LF5 I;  4LFC I;  2NUE A;  3WU6 A;  2VQF I;  2F4V I;  1X49 A;  2MDR A;  2ZBK B;  4PRV A;  3T1H E;  1B63 A;  1ZXM A;  4FW9 A;  4X66 I;  1XNQ I;  2CPN A;  4DV1 E;  1PKP A;  2RS6 A;  3J80 C;  3JAM C;  2N3G A;  3GON A;  4EMD A;  5L3J A;  4B3R I;  4B3S E;  2L3C A;  3H4L A;  1EKZ A;  3C4T A;  2UXC E;  4JI6 I;  4AQY E;  3WU3 A;  4DXL A;  4X62 E;  4JI0 I;  3HTX A;  1I94 I;  1XMQ I;  2LUP B;  2IHR 1;  2YT4 A;  1FJG E;  3J80 Q;  1NHJ A;  3JAM Q;  3PYF A;  4K0K E;  1N33 E;  1MX0 A;  4YHH I;  3ZKB A;  3WU4 A;  1S16 A;  4KHP I;  2UXB E;  2UUB E;  5BR8 E;  2N3H A;  4DV0 E;  2DMY A;  4YY3 I;  4B3M E;  4GKK I;  4DR5 I;  2E1R A;  2LJP A;  1NZ0 A;  2B7T A;  4JI2 I;  2UU9 I;  4X64 I;  2X7I A;  3B82 A;  2HFU A;  2L2K B;  4JI8 I;  4DV5 I;  1A6F A;  4DV4 I;  2V2Q A;  1GQE A;  4DV6 I;  1Z0T A;  3PYE A;  2ZM6 I;  1FI4 A;  4DPU A;  1Z0E A;  2RS7 A;  4JV5 E;  3LPS A;  3OTO E;  3J7A G;  2HHH I;  4OX9 I;  2UUC I;  5GMD A;  4JI4 E;  2UUA I;  2RSM A;  5FLX C;  3CWV A;  4JI5 I;  1XNR E;  4HY1 A;  2EFG A;  5IT9 C;  2Q2E B;  4DR2 E;  4LF6 I;  1S4E A;  1IBM E;  1Z0V A;  1Z5C A;  4DV2 E;  2UXD E;  4B3T E;  4UTG A;  4URL A;  2HKJ A;  4DV7 E;  2V2Z A;  1IBK E;  4GKJ I;  4NXN E;  2HK2 A;  1YYW A;  4X8W A;  5IT9 Q;  4JI3 E;  4PRX A;  1X47 A;  4ED4 A;  2LUQ A;  1N36 I;  4LF5 E;  2CZ9 A;  3QT6 A;  2L3J A;  4DUZ I;  2BM0 A;  4MYU A;  1XMO E;  1FWL A;  2V8P A;  4X66 E;  2HFS A;  1ZBT A;  1KIJ A;  2DEI A;  1H7U A;  4DR4 I;  1HNW E;  4WUD A;  3V2U C;  4JI1 I;  1K47 A;  1HNZ I;  4LF4 I;  1HNX I;  3K1J A;  4B3R E;  1N32 I;  2B3T B;  2BV3 A;  4JYA I;  3ZM7 A;  1EI1 A;  5LMN I;  1N0U A;  1STU A;  4JI0 E;  4NXM I;  2EZ6 A;  4LF8 I;  1I94 E;  2NUF A;  1XMQ E;  4P52 A;  4DR1 I;  4ZVI A;  2DIX A;  2R3V A;  4YHH E;  1VIS A;  4DPY A;  1WHQ A;  3T1H I;  2HK3 A;  4KHP E;  3LTO A;  4X65 I;  1UEK A;  4YY3 E;  4DV1 I;  4WUC A;  1Z0B A;  4GKK E;  4DR5 E;  4XTJ A;  2L2M A;  1KVK A;  1DAR A;  1WUU A;  1N34 I;  1IBL I;  4X64 E;  3V5R A;  2RTX A;  4PU9 A;  5IWA I;  4JI8 E;  4DU7 A;  3WU5 A;  3D4J A;  4DV5 E;  4LFA I;  4DV4 E;  3PYG A;  4USK A;  3HUL A;  4X62 I;  3VYY A;  4DV6 E;  4P7A A;  4DUY E;  3K17 A;  2HHH E;  4OX9 E;  2LTR A;  4HXZ A;  4LF9 I;  3T1Y E;  1MU5 A;  2UUA E;  5BR8 I;  4DV0 I;  1RR9 A;  1Z0C A;  4OOG C;  4JI5 E;  3B8H A;  2VQE I;  2VF3 A;  3QT5 A;  1H7S A;  4HAC B;  2LBS B;  4LF6 E;  1FKA E;  1J26 A;  3B78 A;  2LJH A;  1HR0 I;  2AJ4 A;  4WFT A;  1RRE A;  1RQ0 A;  1PVG A;  4JV5 I;  1WHN A;  1H74 A;  3LLH A;  4GKJ E;  1UIL A;  4R1F A;  1OJ4 A;  4FWD A;  5A2Q C;  2LTS A;  3Q1Q A;  2LRS A;  2OI2 A;  4Z7Y A;  4DKK A;  2E5L E;  4DUZ E;  4DR6 E;  4DV3 I;  4JI7 I;  1D6T A;  3QT7 A;  1U2R A;  2L2N A;  4LFC E;  2J7K A;  5LMU I;  2VQF E;  3ZKD A;  4DR3 I;  2F4V E;  4UT4 A;  2NUG A;  3J7Y p;  4DR4 E;  4DV2 I;  1T4O A;  2L33 A;  4B3T I;  1XNQ E;  1HNZ E;  3M6A A;  4LF4 E;  5A2Q Q;  1HNX E;  3LNU A;  1N32 E;  1FWK A;  1Z59 A;  1DI2 A;  3ADJ A;  3ADG A;  1H72 C;  4FWG A;  4LF7 I;  4JI3 I;  2XEX A;  4LF8 E; 
#chains in the Genus database with same CATH topology
 2JT2 A;  3F6H A;  5K36 A;  4JI6 E;  4DR1 E;  1ELO A;  3P3E A;  4LFB I;  2MKD A;  2NA2 A;  1Z0W A;  1ZM4 A;  3J7A M;  2ZIT A;  2VES A;  1ZR9 A;  1J5E I;  1EH7 A;  4DR7 I;  1XMO I;  1YSA C;  1KKH A;  2IER A;  2EN8 A;  2WW4 A;  1PJQ A;  4X65 E;  1G2F C;  3PS1 A;  1KJK A;  1KYQ A;  2EOI A;  4F9C B;  4HAC A;  2EMY A;  4FWH A;  1UN6 B;  2PO1 A;  2A2D A;  4N4R B;  2EMI A;  2V34 A;  4DPT A;  1HNW I;  4L8N A;  1N34 E;  2VRD A;  2EQ3 A;  1IBL E;  2BA1 G;  1A1I A;  4USM A;  3DF6 A;  3ADI A;  2O1V A;  5IWA E;  4AM3 A;  2EPX A;  2I9I A;  2WNR A;  2YTQ A;  1YFH A;  4JI2 E;  2UU9 E;  2Z5C A;  1UHZ A;  2A2C A;  4WUB A;  4B3S I;  4LFA E;  4RHB B;  1ZXN A;  3NZK A;  2JEB B;  1Z5A A;  1B62 A;  2ODR D;  3L00 A;  3Q6N A;  2YU5 A;  2UXC I;  3P1X A;  2EPC A;  4AQY I;  3M7N G;  2HKE A;  3BID A;  1Z5B A;  1ZM9 A;  3HPS A;  4WXD A;  2IOQ A;  4ZYG A;  5KL3 A;  4OO1 A;  2B7V A;  2ZM6 E;  1ZU1 A;  2F8B A;  2YTF A;  4LF9 E;  4AIM A;  1MG7 A;  4DU8 A;  4NBQ A;  1KTV A;  3EPJ A;  2EPN A;  4BBY A;  2ELY A;  2WCC 3;  1YYO A;  3KWR A;  1FJG I;  3ZOQ B;  4M2Z A;  2C39 B;  2FTX B;  2YWQ A;  4K0K I;  2ENH A;  2LCE A;  2UUC E;  1N33 I;  4NZV A;  2NN6 C;  5KL6 A;  4IFD C;  2LE2 A;  3ZZU A;  3CDJ A;  4QNK A;  2UXB I;  1BKN A;  4DPW A;  2UUB I;  2GS8 A;  3ZZT A;  1UDQ A;  4BS9 A;  4R2P A;  2VQE E;  4B3M I;  5CFF E;  2BM1 A;  3THO B;  3HJC A;  2EOY A;  1Y6Z A;  2EP3 A;  4I8O A;  1HR0 E;  1R6L A;  2CG9 A;  4LTY A;  3VYX A;  2JY9 A;  2WP8 B;  5DRO A;  4RPF A;  2EN1 A;  5JEA C;  4KQV A;  3J81 C;  4FW7 A;  2KHX A;  3F0N A;  4LPF A;  4MU4 A;  4DUY I;  1WJP A;  3C4B A;  3ECR A;  4I3H A;  2NPF A;  1NCS A;  2EML A;  2EMA A;  1T39 A;  2EPZ A;  4WYQ B;  1A1J A;  2X36 A;  3T1Y I;  2R42 A;  3OTO I;  3ZZ0 A;  5F3W A;  1DGC A;  3VK6 A;  1FNM A;  2JE6 B;  3BF2 A;  3QT8 A;  2V87 A;  2EM6 A;  1NHI A;  2K4V A;  5LL6 R;  2NN6 B;  1Y5Y A;  5GME A;  5KL7 A;  4DV3 E;  4JI7 E;  1Y4S A;  4JI4 I;  5ADZ A;  1X48 A;  5C0X E;  3IWB A;  1EA6 A;  2YPN A;  4LOM A;  3J81 Q;  2YTN A;  1N36 E;  1X5W A;  4QNJ A;  1NHH A;  1RC7 A;  2IES A;  4Z7C A;  1QZR A;  2J65 A;  5LMU E;  1YUJ A;  1P42 A;  1GTK A;  4DR3 E;  5K36 E;  4BA2 A;  1GZ6 A;  2PNM A;  1XNR I;  5AE3 A;  2V86 A;  1NEI A;  1QU6 A;  1ZAA C;  3ADL A;  4DPX A;  1O0W A;  5KL2 A;  1E3P A;  4HYM A;  1T4N A;  1N0V C;  1XHK A;  2JVA A;  2C38 A;  2NN6 F;  4DR2 I;  1EH8 A;  2YTJ A;  2YTO A;  1IBM I;  2Z5B B;  4RH8 A;  4FN5 A;  1HK7 A;  2JEB A;  2BA1 D;  1ZM2 A;  2YTI A;  1P47 A;  4MYT A;  2JOB A;  5FLX Q;  4U3D A;  2V8Q B;  2GHF A;  2WBU A;  2EPL X;  4JI1 E;  3P76 A;  3M85 G;  4JG4 A;  2UXD I;  1ZM3 A;  1X3C A;  2V2V A;  2RSI A;  1T4L B;  3PYD A;  1OYR A;  4Q35 B;  1A1F A;  1H73 A;  2DEJ A;  4LF7 E;  4M1K A;  4O4K A;  2DB2 A;  1WXR A;  4JYA E;  1G2D C;  4BC7 A;  1PIE A;  3BBG A;  4ISA A;  4DV7 I;  1YYK A;  1TF6 A;  5LMN E;  4TUI A;  2V83 A;  1YZ9 A;  1IBK I;  5LLQ A;  2ELZ A;  4NXN I;  1Z0G A;  2EPO A;  4O5G A;  4LFB E;  4LCH A;  2E5L I;  4DR6 I;  2M9A A;  3THN A;  4NXM E;  3M7N D;  1J5E E;  1X6F A;  2EPM X;  4DR7 E;  4IFD E;  4M30 A;  4LF5 I;  3DD6 A;  5A6A A;  4WSP A;  4OZE A;  2EOQ A;  4LFC I;  2BA0 G;  1UDS A;  1R6M A;  2NUE A;  2A25 A;  2G7H A;  3WU6 A;  2VQF I;  2F4V I;  1UDN A;  1X49 A;  2MDR A;  5AC4 A;  2GLI A;  2M4I A;  2ZBK B;  4PRV A;  2PNZ B;  3T1H E;  1B63 A;  1ZXM A;  4OO1 E;  4TUG A;  4FW9 A;  4IZJ D;  4X66 I;  1XNQ I;  2CPN A;  4FW3 A;  4DV1 E;  1QNT A;  2EMB A;  4OKG A;  1PKP A;  2YSP A;  2L8T A;  2RS6 A;  2JXP A;  2EOE A;  3J80 C;  4U3B A;  3JAM C;  2N3G A;  3EPK A;  3HXL A;  1IQO A;  3GON A;  4EMD A;  5L3J A;  4B3R I;  1Z1B A;  4B3S E;  3P3G A;  4FW6 A;  4ZYH A;  2C37 B;  3EQ1 A;  2L3C A;  4R03 A;  5A6B D;  4R2A A;  4KWY A;  4O24 A;  1MGT A;  3H4L A;  2EL6 A;  1EKZ A;  3C4T A;  4M0V A;  3QG5 C;  2M7Q A;  2UXC E;  4AQY E;  2JE6 A;  5DRQ A;  3WU3 A;  2NN6 A;  2DGC A;  4DXL A;  5C0X D;  4X62 E;  4IFD A;  4FW5 A;  4JI0 I;  3HTX A;  2EM2 A;  1I94 I;  1XMQ I;  3BGH A;  5K36 D;  2LUP B;  2IHR 1;  2YT4 A;  2YRM A;  1FJG E;  3J80 Q;  2MKN A;  4WX9 A;  1NHJ A;  3JAM Q;  2EPP A;  5A6K A;  3PYF A;  4K0K E;  4L5N C;  2HGH A;  2EOM A;  4HEI A;  1N33 E;  2PO0 A;  1MX0 A;  4YHH I;  3ZKB A;  3H09 A;  3WU4 A;  3L7Z B;  1S16 A;  3HPZ A;  1LLM C;  4MQY A;  4KHP I;  5TSE A;  4BHC A;  2UXB E;  2R1F A;  2UUB E;  5BR8 E;  2GQ0 A;  2VE7 C;  1EH6 A;  2N3H A;  4DV0 E;  5ELW A;  5JEA A;  4MU3 A;  2DMY A;  4YY3 I;  4JI6 I;  4B3M E;  3GME A;  2YTE A;  5AE2 A;  1RHY A;  2EOO A;  2JWO A;  4GKK I;  4DR5 I;  2E1R A;  2EE8 A;  4BMJ A;  2LJP A;  1NZ0 A;  2VF1 A;  2Z5B A;  2EMG A;  2B7T A;  2YTG A;  1JK1 A;  4JI2 I;  2BR2 B;  2UU9 I;  4X64 I;  2X7I A;  1BB8 A;  3B82 A;  2WBT A;  2HFU A;  2L2K B;  4JI8 I;  1UBD C;  2D9H A;  2EM5 A;  2JR1 A;  2EMC A;  4DV5 I;  1A6F A;  4DV4 I;  1DQ3 A;  4F6M A;  2V2Q A;  4GEQ B;  4IFD D;  1GQE A;  4DV6 I;  5FWK A;  3M85 D;  1Z0T A;  4WXC A;  4BC9 A;  3PYE A;  2ZM6 I;  3JU0 A;  2RQL A;  1FI4 A;  1Z0E A;  4DPU A;  2RS7 A;  3MHS C;  2E72 A;  4JV5 E;  3OTO E;  4GZN C;  3J7A G;  3LPS A;  5IXM B;  5K36 B;  1IMU A;  2HHH I;  1L4S A;  4OX9 I;  5AC5 A;  2PNL A;  4OO1 D;  2UUC I;  3AUZ A;  4HTG A;  2LMZ A;  5GMD A;  4JI4 E;  3PS2 A;  2PNZ A;  2DLK A;  5DRR A;  1YHC A;  1USU A;  2J7J A;  2UUA I;  2EL4 A;  2V88 A;  2RSM A;  2JYA A;  3HQ1 A;  4J8Z A;  5FLX C;  5AE1 A;  1XXE A;  4ZYE A;  4DV2 I;  3CWV A;  2WBS A;  3U1K A;  2BA0 D;  2CVE A;  4JI5 I;  1XNR E;  2PO1 B;  1BBG A;  2F1D A;  3JTZ A;  4HY1 A;  4P7D A;  2AE8 A;  2EFG A;  5K36 F;  5IT9 C;  2Q2E B;  2EJ4 A;  4DR2 E;  3H1C A;  4LF6 I;  1S4E A;  3RMP A;  1IBM E;  4R2C A;  1Z0V A;  5EKW A;  2EMX A;  1Z5C A;  2YRK A;  1ZBQ A;  2O3Z A;  4DV2 E;  3K6Q A;  5KL4 A;  2UXD E;  4B3T E;  2YRH A;  1YPN A;  4UTG A;  2CSH A;  2V85 A;  3Q6M A;  2RPC A;  2EOZ A;  2PO2 B;  2EMF A;  1WRJ A;  4URL A;  1IQS A;  2HKJ A;  3OML A;  4DV7 E;  4NHR A;  4R2E A;  2V2Z A;  4MU0 A;  4IJD A;  3KZZ A;  4O43 A;  1IBK E;  1B69 A;  4NXN E;  2HK2 A;  2Z5E A;  4GKJ I;  1YYW A;  2YU8 A;  3F6G A;  4X8W A;  5IT9 Q;  4JI3 E;  1RMD A;  4Q28 A;  2NAB A;  2V89 A;  1X47 A;  2EMZ A;  2LUQ A;  3C6K A;  4PRX A;  4ED4 A;  1N36 I;  1X6E A;  3LML A;  4LF5 E;  1VI7 A;  2CZ9 A;  3QT6 A;  2C39 A;  2L3J A;  1Y4U A;  4DUZ I;  2DMI A;  3TQM A;  2BM0 A;  2DRP A;  4LCG A;  4MYU A;  4MDT A;  4KZS A;  4ZYD A;  2KON A;  2NN6 E;  1XMO E;  1FWL A;  4BHB A;  3U1Y A;  2V8P A;  5A6J A;  2ENC A;  4X66 E;  2EOF A;  2HFS A;  1ZBT A;  2O1U A;  5KL5 A;  4FK5 C;  1KIJ A;  2DEI A;  1AH5 A;  4J3D A;  4M9V C;  1H7U A;  2LJU A;  4DR4 I;  1HNW E;  4WUD A;  4IZK B;  3V2U C;  4JI1 I;  1AAY A;  1K47 A;  3KRN A;  1HNZ I;  4LF4 I;  1HNX I;  2HC5 A;  3K1J A;  2WP8 A;  4B3R E;  1N32 I;  2B3T B;  1PJS A;  4F9A B;  1T38 A;  1TN9 A;  2BV3 A;  5JEA E;  4JYA I;  2L6M A;  3ZM7 A;  2FV4 B;  4BA1 B;  2M1S A;  1EI1 A;  4LF8 E;  5LMN I;  2K7I A;  2ADR A;  1N0U A;  2EMH A;  2EMK A;  1STU A;  2GPI A;  1PDA A;  1A1G A;  4JI0 E;  2EZ6 A;  4NXM I;  4LF8 I;  1I94 E;  2NUF A;  1XMQ E;  2EPR A;  4P52 A;  2IOP A;  4DR1 I;  4ZVI A;  2LO3 A;  2O1W A;  2EM8 A;  2DIX A;  1TF3 A;  2R3V A;  5DNL A;  3MHH C;  2EMW A;  2YTP A;  5C0X C;  1JK2 A;  2EN2 A;  2EPA A;  4YHH E;  1WHQ A;  1VIS A;  2HK3 A;  4DPY A;  3T1H I;  3GCM A;  4KHP E;  2ODR C;  3IWD A;  2BBG A;  1Y60 A;  3LTO A;  4X65 I;  5K36 C;  2EOH A;  2FGG A;  1UEK A;  4YY3 E;  4DV1 I;  4WUC A;  4LCF A;  2YZT A;  1Z0B A;  4GKK E;  4F54 A;  4DR5 E;  1UDO A;  5DNX A;  5EL9 A;  4BA2 B;  4XTJ A;  2L2M A;  2L92 A;  4IZJ B;  1KVK A;  1DAR A;  1WUU A;  4N3O A;  1N34 I;  2EQ1 A;  1IBL I;  2JEA B;  4X64 E;  3V5R A;  5AAS A;  2RTX A;  2HJJ A;  2C38 B;  1E3H A;  4PU9 A;  5IWA I;  4MU1 A;  2I13 A;  4WPY A;  4JI8 E;  3VHT B;  4DU7 A;  3WU5 A;  2PO2 A;  3GLL A;  3UK3 C;  4IS9 A;  3D4J A;  2EOS A;  2EWL A;  2R76 A;  1SFE A;  2E1M A;  2EM4 A;  4DV5 E;  4LFA I;  4DV4 E;  3PYG A;  4USK A;  3B4T A;  3HUL A;  3VYY A;  1PJT A;  4DV6 E;  3P06 A;  4X62 I;  2B9D A;  4P7A A;  2Q8U A;  2GO3 A;  4DUY E;  2LV2 A;  2DLQ A;  2KOU A;  3K17 A;  3PRY A;  4LU9 A;  2NN6 D;  5C0X B;  4B3T I;  2EOJ A;  2HHH E;  5T6J A;  4OX9 E;  2LTR A;  4HXZ A;  4LF9 I;  2EOR A;  3T1Y E;  1MU5 A;  2DSY A;  2EM3 A;  2ENA A;  2UUA E;  5BR8 I;  3PS3 A;  3MSW A;  4DV0 I;  2EOX A;  1RR9 A;  1Z0C A;  2BB8 A;  2H36 X;  3EPL A;  4OO1 C;  4OOG C;  2YSO A;  2PRT A;  3AV0 A;  4BCA A;  4JI5 E;  1OYP A;  3B8H A;  2JPA A;  2VQE I;  1MEY C;  5JEA D;  4IZK A;  4R2Q A;  2EPU A;  2VF3 A;  3QT5 A;  2EN6 A;  1H7S A;  4HAC B;  5C0X F;  2LBS B;  2JOX A;  5DNY A;  4LF6 E;  4F2J C;  1FKA E;  4FW4 A;  2EL5 A;  2EM0 A;  2CTD A;  3C6M A;  4BA1 A;  3HKM A;  1J26 A;  4R2S A;  1A1H A;  2LJH A;  2EM9 A;  1OYS A;  2AJ4 A;  3B78 A;  1HR0 I;  2EPK X;  2GO4 A;  4WFT A;  1RRE A;  2C37 A;  1RQ0 A;  1PVG A;  4MLQ A;  2WNR B;  3K85 A;  3P3C A;  4JV5 I;  1N3G A;  1WHN A;  1YUI A;  2Z5C B;  1H74 A;  4F9B B;  2LVH A;  2JP9 A;  3LLH A;  4R2D A;  4GKJ E;  4IFD B;  3UHM A;  2N8X A;  4F6N A;  1UIL A;  4R1F A;  4AID A;  1OJ4 A;  4FWD A;  5A2Q C;  2LTS A;  5DRP A;  3Q1Q A;  2LRS A;  2OI2 A;  2O1T A;  4Z7Y A;  4OO1 B;  4DKK A;  2E5L E;  4DUZ E;  1F2I G;  4DR6 E;  4DV3 I;  4JI7 I;  1D6T A;  4IS1 C;  3QT7 A;  2PO0 B;  1YH8 A;  2MDG A;  1U2R A;  1USV A;  2EQ0 A;  3L7Z A;  2EM7 A;  2MC6 A;  4GQU A;  2L2N A;  2EN7 A;  3KZY A;  4IZJ A;  4LFC E;  2JEA A;  5JEA B;  3FIG A;  2WZO A;  2J7K A;  5LMU I;  5A69 A;  2VQF E;  3ZKD A;  1X6H A;  4DR3 I;  2F4V E;  4UT4 A;  4IFD F;  2NUG A;  3J7Y p;  1BBO A;  2EN4 A;  4X9J A;  2CT1 A;  4R2R A;  3M99 B;  3DJW A;  4P78 A;  3IWC A;  1T4O A;  2L33 A;  4DR4 E;  2MC5 A;  1XNQ E;  1A1K A;  1HNZ E;  4LF4 E;  2BR2 A;  1HNX E;  3M6A A;  5A2Q Q;  5IV8 B;  3LNU A;  1N32 E;  4OO1 F;  4MLV A;  1FWK A;  1Z59 A;  5A6B A;  4R8O A;  4WSG A;  1DI2 A;  3ADJ A;  3ADG A;  2LT7 A;  1H72 C;  2EN3 A;  1A1L A;  3EPH A;  2YTD A;  2CGE A;  4FWG A;  5C0X A;  4LF7 I;  5JEA F;  1SR9 A;  3CDI A;  4JI3 I;  2XEX A;  4DMI A; 
#chains in the Genus database with same CATH homology
 3F6H A;  4JI6 E;  4DR1 E;  1ELO A;  4LFB I;  1ZM4 A;  2NA2 A;  1Z0W A;  3J7A M;  2ZIT A;  1J5E I;  4DR7 I;  1XMO I;  1KKH A;  2WW4 A;  4X65 E;  4F9C B;  4HAC A;  4FWH A;  2A2D A;  1HNW I;  2V34 A;  4DPT A;  4L8N A;  1N34 E;  1IBL E;  4USM A;  3DF6 A;  3ADI A;  2O1V A;  5IWA E;  4JI2 E;  2UU9 E;  2Z5C A;  1UHZ A;  2A2C A;  4WUB A;  4B3S I;  4LFA E;  1ZXN A;  1Z5A A;  1B62 A;  2ODR D;  3Q6N A;  2UXC I;  3P1X A;  4AQY I;  2HKE A;  1Z5B A;  1ZM9 A;  3HPS A;  2IOQ A;  2B7V A;  2ZM6 E;  4LF9 E;  2F8B A;  1MG7 A;  4DU8 A;  1KTV A;  4BBY A;  1FJG I;  1YYO A;  3KWR A;  3ZOQ B;  4M2Z A;  2FTX B;  4K0K I;  2UUC E;  1N33 I;  2LE2 A;  3ZZU A;  2UXB I;  1BKN A;  4DPW A;  2UUB I;  2GS8 A;  3ZZT A;  4BS9 A;  2VQE E;  4B3M I;  5CFF E;  2BM1 A;  3HJC A;  1Y6Z A;  4I8O A;  1HR0 E;  2CG9 A;  4LTY A;  3VYX A;  2JY9 A;  4RPF A;  4KQV A;  3J81 C;  2KHX A;  3F0N A;  4DUY I;  4DMI A;  3C4B A;  4I3H A;  2NPF A;  2X36 A;  4WYQ B;  3T1Y I;  2R42 A;  3OTO I;  3ZZ0 A;  5F3W A;  3VK6 A;  1FNM A;  3QT8 A;  2V87 A;  1NHI A;  2K4V A;  5LL6 R;  5GME A;  4DV3 E;  4JI7 E;  1Y4S A;  4JI4 I;  5ADZ A;  1X48 A;  3IWB A;  1EA6 A;  3J81 Q;  1N36 E;  1NHH A;  1RC7 A;  4Z7C A;  1QZR A;  5LMU E;  4DR3 E;  1GZ6 A;  2PNM A;  1XNR I;  5AE3 A;  2V86 A;  1QU6 A;  4DPX A;  3ADL A;  1O0W A;  4HYM A;  1T4N A;  1N0V C;  1XHK A;  2JVA A;  4DR2 I;  1IBM I;  2Z5B B;  4FN5 A;  4MYT A;  1HK7 A;  5FLX Q;  1ZM2 A;  2JOB A;  2V8Q B;  2UXD I;  4JI1 E;  4JG4 A;  1ZM3 A;  2V2V A;  1T4L B;  3PYD A;  1H73 A;  2DEJ A;  4LF7 E;  4M1K A;  2DB2 A;  1WXR A;  4JYA E;  1PIE A;  4BC7 A;  4DV7 I;  1YYK A;  5LMN E;  4TUI A;  2V83 A;  1YZ9 A;  1IBK I;  4NXN I;  1Z0G A;  4LFB E;  2E5L I;  4DR6 I;  4NXM E;  1J5E E;  4DR7 E;  4M30 A;  4LF5 I;  4WSP A;  4LFC I;  2NUE A;  3WU6 A;  2G7H A;  2VQF I;  2F4V I;  1X49 A;  2MDR A;  2ZBK B;  2M4I A;  4PRV A;  3T1H E;  1B63 A;  1ZXM A;  4TUG A;  4FW9 A;  4IZJ D;  4X66 I;  1XNQ I;  2CPN A;  4DV1 E;  1PKP A;  2L8T A;  2RS6 A;  3J80 C;  3JAM C;  2N3G A;  3HXL A;  3GON A;  4EMD A;  5L3J A;  4B3R I;  4B3S E;  2L3C A;  4R03 A;  3H4L A;  1EKZ A;  3C4T A;  4M0V A;  2M7Q A;  2UXC E;  4JI6 I;  4AQY E;  3WU3 A;  4DXL A;  4X62 E;  4JI0 I;  3HTX A;  1I94 I;  1XMQ I;  2LUP B;  2IHR 1;  2YT4 A;  1FJG E;  3J80 Q;  1NHJ A;  3JAM Q;  3PYF A;  4K0K E;  4L5N C;  1N33 E;  1MX0 A;  4YHH I;  3ZKB A;  3H09 A;  3WU4 A;  1S16 A;  3HPZ A;  4KHP I;  2UXB E;  2UUB E;  2GQ0 A;  5BR8 E;  2VE7 C;  2N3H A;  4DV0 E;  2DMY A;  4YY3 I;  4B3M E;  5AE2 A;  2JWO A;  4GKK I;  4DR5 I;  2E1R A;  4BMJ A;  2LJP A;  1NZ0 A;  2VF1 A;  2Z5B A;  2B7T A;  4JI2 I;  2UU9 I;  4X64 I;  2X7I A;  3B82 A;  2HFU A;  2L2K B;  4JI8 I;  2JR1 A;  4DV5 I;  1A6F A;  4DV4 I;  1DQ3 A;  2V2Q A;  4GEQ B;  1GQE A;  4DV6 I;  5FWK A;  1Z0T A;  4BC9 A;  3PYE A;  2ZM6 I;  3JU0 A;  1FI4 A;  4DPU A;  1Z0E A;  2RS7 A;  4JV5 E;  3LPS A;  3OTO E;  3J7A G;  2HHH I;  4OX9 I;  2PNL A;  2UUC I;  3AUZ A;  2LMZ A;  5GMD A;  4JI4 E;  1USU A;  2UUA I;  2V88 A;  2RSM A;  3HQ1 A;  4J8Z A;  5FLX C;  5AE1 A;  3CWV A;  4JI5 I;  1XNR E;  3JTZ A;  4HY1 A;  4P7D A;  2EFG A;  5IT9 C;  2Q2E B;  4DR2 E;  4LF6 I;  1S4E A;  3RMP A;  1IBM E;  1Z0V A;  1Z5C A;  1ZBQ A;  4DV2 E;  3K6Q A;  2UXD E;  4B3T E;  4UTG A;  2V85 A;  3Q6M A;  4URL A;  2HKJ A;  3OML A;  4DV7 E;  2V2Z A;  1IBK E;  4GKJ I;  2Z5E A;  4NXN E;  2HK2 A;  1YYW A;  3F6G A;  4X8W A;  5IT9 Q;  4JI3 E;  4Q28 A;  2V89 A;  1X47 A;  4PRX A;  2LUQ A;  4ED4 A;  1N36 I;  3LML A;  4LF5 E;  2CZ9 A;  3QT6 A;  2L3J A;  1Y4U A;  4DUZ I;  2BM0 A;  4MYU A;  4KZS A;  2KON A;  1XMO E;  1FWL A;  2V8P A;  4X66 E;  2HFS A;  1ZBT A;  2O1U A;  1KIJ A;  2DEI A;  1H7U A;  4DR4 I;  1HNW E;  4WUD A;  4IZK B;  3V2U C;  4JI1 I;  1K47 A;  1HNZ I;  4LF4 I;  1HNX I;  3K1J A;  4B3R E;  1N32 I;  2B3T B;  4F9A B;  2BV3 A;  4JYA I;  2L6M A;  3ZM7 A;  2FV4 B;  2M1S A;  1EI1 A;  5LMN I;  1N0U A;  1STU A;  4JI0 E;  4NXM I;  2EZ6 A;  4LF8 I;  1I94 E;  2NUF A;  1XMQ E;  4P52 A;  2IOP A;  4DR1 I;  4ZVI A;  2O1W A;  2DIX A;  2R3V A;  4YHH E;  1VIS A;  4DPY A;  1WHQ A;  3T1H I;  2HK3 A;  4KHP E;  2ODR C;  3IWD A;  3LTO A;  4X65 I;  1UEK A;  2FGG A;  4YY3 E;  4DV1 I;  4WUC A;  2YZT A;  1Z0B A;  4GKK E;  4F54 A;  4DR5 E;  4XTJ A;  2L2M A;  2L92 A;  4IZJ B;  1KVK A;  1DAR A;  1WUU A;  4N3O A;  1N34 I;  1IBL I;  4X64 E;  3V5R A;  5AAS A;  2RTX A;  4PU9 A;  5IWA I;  4WPY A;  4JI8 E;  4DU7 A;  3WU5 A;  3D4J A;  2EWL A;  2E1M A;  4DV5 E;  4LFA I;  4DV4 E;  3PYG A;  4USK A;  3HUL A;  3P06 A;  3VYY A;  4DV6 E;  4X62 I;  2B9D A;  4P7A A;  4DUY E;  2KOU A;  3K17 A;  3PRY A;  4LU9 A;  2HHH E;  5T6J A;  4OX9 E;  2LTR A;  4HXZ A;  4LF9 I;  3T1Y E;  1MU5 A;  2DSY A;  2UUA E;  5BR8 I;  3MSW A;  4DV0 I;  1RR9 A;  1Z0C A;  2H36 X;  4OOG C;  3AV0 A;  4BCA A;  4JI5 E;  3B8H A;  2VQE I;  4IZK A;  2VF3 A;  3QT5 A;  1H7S A;  4HAC B;  2LBS B;  2JOX A;  5DNY A;  4LF6 E;  1FKA E;  1J26 A;  3B78 A;  2LJH A;  1HR0 I;  2AJ4 A;  4WFT A;  1RRE A;  1RQ0 A;  1PVG A;  3K85 A;  4JV5 I;  1WHN A;  2Z5C B;  1H74 A;  4F9B B;  3LLH A;  4GKJ E;  1UIL A;  4R1F A;  1OJ4 A;  4FWD A;  5A2Q C;  2LTS A;  3Q1Q A;  2LRS A;  2OI2 A;  2O1T A;  4Z7Y A;  4DKK A;  2E5L E;  4DUZ E;  4DR6 E;  4DV3 I;  4JI7 I;  1D6T A;  3QT7 A;  1U2R A;  1USV A;  2MC6 A;  2L2N A;  4IZJ A;  4LFC E;  3FIG A;  2WZO A;  2J7K A;  5LMU I;  2VQF E;  3ZKD A;  4DR3 I;  2F4V E;  4UT4 A;  2NUG A;  3J7Y p;  4DR4 E;  4DV2 I;  3DJW A;  4P78 A;  3IWC A;  1T4O A;  2L33 A;  4B3T I;  2MC5 A;  1XNQ E;  1HNZ E;  3M6A A;  4LF4 E;  5A2Q Q;  1HNX E;  3LNU A;  1N32 E;  1FWK A;  1Z59 A;  4R8O A;  1DI2 A;  3ADJ A;  3ADG A;  1H72 C;  2CGE A;  4FWG A;  4LF7 I;  1SR9 A;  4JI3 I;  2XEX A;  4LF8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...