4DV0I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv0I00
2F4VI 2GS8A 1FJGI 1N34E 1HNWE 4NXME 1FKAE 3QT7A 2V34A 4DV2E 1XNQE 4LF4E 1BKNA 3PYFA 3M6AA 1XMQE 4JI3E 4K0KE 2E5LE 3J7AM 5BR8E 1HNXE 1N32E 1IBLE 2UUCE 4FWGA 4X65E 4X62E 1J5EE 2UXDI 3Q1QA 1XMQI 1IBME 1KKHA 4X62I 5GMDA 3B82A 3V2UC 2WW4A 1ZM3A 4DR7E 4LFCI 3J80Q 4P52A 4OX9I 4B3RI 4LFAE 4DPWA 4LFBI 4JG4A 4LF5E 4DR2I 2BM0A 1PVGA 1RREA 4WUCA 3ZZ0A 2NPFA 4DR4E 4JI3I 1H7UA 1N34I 4PRVA 4B3TE 4DUYI 4KQVA 2HFUA 1FWLA 5IT9C 4X64E 4DR5I 4HACB 1MX0A 1K47A 4JI2I 4JYAE 1N33I 1Z59A 3J80C 4ED4A 3J7AG 4DV3I 1MU5A 4LF6I 1Z5AA 1Z5BA 4JI8E 1H72C 1Z5CA 4JI5E 3QT8A 1WUUA 4M1KA 1XNRI 1IBKE 4KHPI 4X66I 1QZRA 1ZM9A 4DR1I 4Z7YA 3WU4A 4X65I 4DV0I 3WU5A 4DPYA 4GKJI 5IT9Q 1HNZE 3B8HA 1KTVA 2ZM6E 4JI4E 3H4LA 3WU6A 5LMUE 4DPUA 3CWVA 4HACA 2A2DA 5L3JA 1H74A 4P7AA 2UU9I 4JI6E 4B3RE 1ZM4A 4NXNE 2ZBKB 5GMEA 1H7SA 2ZITA 4MYUA 5FLXC 3OTOI 4DUZI 4DR1E 3QT5A 1Z0CA 1NHHA 3V5RA 2UXCI 4AQYE 2DEJA 4JI8I 4YHHE 1PIEA 3T1YI 3LTOA 5LMNE 2V2VA 3PYDA 4YY3I 2UXBE 4DU7A 4PU9A 1EA6A 2X36A 4ZVIA 4DV6I 4KHPE 4AQYI 1MG7A 4B3SI 2AJ4A 1Z0WA 4NXMI 2V2ZA 1UEKA 4DR6E 4DV3E 4DR4I 4DXLA 1ELOA 4FWHA 4DR2E 5LMNI 5BR8I 1N32I 2UUCI 2UUAE 4LFAI 1B62A 4DR5E 3QT6A 1Z0EA 2UXCE 4HY1A 1KVKA 2V2QA 4B3SE 4LF8I 1HR0I 2X7IA 5LL6R 1IBMI 4GKKI 4UT4A 1ZXNA 4YY3E 4FW9A 4FN5A 3HULA 5A2QQ 5LMUI 4DR7I 4USKA 1KIJA 2BM1A 4LF7I 4MYTA 5IWAE 4DV0E 5FLXQ 2Q2EB 1ZM2A 3ZKBA 1XMOI 4JV5E 2VQFI 4JI1E 4DV4E 4JI6I 1HR0E 4HXZA 3K1JA 4USMA 4YHHI 2R42A 3JAMC 4LF4I 2J7KA 2UUAI 4I3HA 1FI4A 1XMOE 1Z0GA 1N0UA 3GONA 2V8PA 4HYMA 1ZXMA 3PYEA 4DPTA 3PYGA 1IBKI 4B3ME 1Z0VA 5IWAI 2UU9E 1B63A 4JI0E 4LF7E 4LF5I 4DV5I 4LF6E 2UXBI 3D4JA 1VISA 4DV7I 1IBLI 1NZ0A 2VQFE 2XEXA 4DV1I 1S4EA 3ZZUA 4WUDA 3B78A 3ZKDA 4DR3E 4GKKE 4DUYE 4B3TI 1HNWI 2HK2A 4URLA 2BV3A 4DV1E 4EMDA 1N36I 2E5LI 1N36E 4DV4I 3ZM7A 2EFGA 1OJ4A 4JI7I 4WUBA 2OI2A 1DARA 4FWDA 1RR9A 1Z0BA 1EI1A 1D6TA 4LFCE 2VQEI 2UUBE 1FJGE 1FWKA 2HKEA 3LNUA 2VQEE 4DR3I 4DV6E 1XNRE 1N0VC 3WU3A 2HK3A 4DV7E 4R1FA 3T1HE 3T1YE 4K0KI 4JI0I 3JAMQ 1H73A 2VF3A 1XHKA 1Z0TA 2LJPA 2HFSA 4LF8E 4DUZE 4GKJE 2F4VE 2R3VA 4JV5I 3ZZTA 4NXNI 2HKJA 3F0NA 3OTOE 2E1RA 4XTJA 4LF9E 4DPXA 1A6FA 2CZ9A 1PKPA 4PRXA 1HNXI 4DU8A 3J81C 2ZM6I 4JI4I 4DR6I 1FNMA 1I94I 3J81Q 4DV2I 4RPFA 4LFBE 5A2QC 4B3MI 4LF9I 3LPSA 1N33E 1HNZI 4Z7CA 4X66E 1XNQI 4X64I 3K17A 2HHHI 4JI5I 2A2CA 1U2RA 1I94E 2UUBI 1NHIA 4DV5E 1NHJA 3T1HI 1J5EI 2UXDE 4JI2E 4JYAI 4JI7E 1S16A 2HHHE 4OX9E 4JI1I 2DEIA 4UTGA
chains in the Genus database with same CATH superfamily
4BA2A 5DRRA 2F4VI 2GS8A 1FJGI 1N34E 1HNWE 4NXME 1FKAE 3QT7A 2CVEA 2V34A 4DV2E 1XNQE 4LF4E 1BKNA 3PYFA 2NN6C 3M6AA 1XMQE 2NN6F 4JI3E 4K0KE 3P3GA 2E5LE 4MDTA 3J7AM 2PNZA 3UHMA 5BR8E 1HNXE 1N32E 2JEBA 1VI7A 5JEAA 1IBLE 2UUCE 3DD6A 4FWGA 4X65E 4X62E 1J5EE 2UXDI 3Q1QA 1XMQI 2C39B 2BA0D 2NN6E 4OO1F 1IBME 1KKHA 2PO1A 5DROA 2VESA 4X62I 5GMDA 3V2UC 3B82A 2WW4A 1ZM3A 4BA1B 4DR7E 5DNLA 4LFCI 3J80Q 4P52A 4BA2B 4OX9I 4LPFA 4B3RI 4LFAE 4DPWA 4LFBI 4JG4A 4LF5E 4DR2I 2BM0A 1PVGA 1RREA 4WUCA 3ZZ0A 5ELWA 2NPFA 4DR4E 1RHYA 4JI3I 5K36D 4IZJD 1H7UA 1N34I 2PO0A 4PRVA 4B3TE 4DUYI 4KQVA 2HFUA 1FWLA 2PNMA 5IT9C 4X64E 2C37B 4DR5I 4HACB 3CDJA 4UTGA 1MX0A 1E3PA 1K47A 4JI2I 4JYAE 1N33I 1Z59A 3J80C 4ED4A 2AE8A 3J7AG 4DV3I 1MU5A 4LF6I 1Z5AA 1Z5BA 4JI8E 1H72C 1Z5CA 4JI5E 3QT8A 4IFDA 1WUUA 4M1KA 1XNRI 1IBKE 4KHPI 5JEAC 4X66I 1QZRA 1ZM9A 4DR1I 4Z7YA 4IFDB 3WU4A 5JEAE 4X65I 4LOMA 2JEAA 4DV0I 3WU5A 4FW3A 4FW5A 4DPYA 3GLLA 4GKJI 5IT9Q 1HNZE 3Q6NA 3B8HA 2BA0G 4IZJB 1KTVA 5C0XE 2ZM6E 4JI4E 3H4LA 3WU6A 5LMUE 4DPUA 3CWVA 4HACA 2A2DA 5L3JA 1H74A 4P7AA 2UU9I 4BA1A 4JI6E 4B3RE 5C0XB 1ZM4A 5K36F 4NXNE 4NBQA 2ZBKB 5GMEA 1H7SA 2ZITA 2O3ZA 4MYUA 5FLXC 3OTOI 4DUZI 4DR1E 3QT5A 1Z0CA 1NHHA 3V5RA 5JEAB 2UXCI 5K36A 4AQYE 4IZKB 2DEJA 4U3DA 4JI8I 4YHHE 1PIEA 3T1YI 3LTOA 5LMNE 3PS1A 2V2VA 3PYDA 4YY3I 2UXBE 4DU7A 1UDQA 4PU9A 1EA6A 2X36A 4ZVIA 4DV6I 4KHPE 4AQYI 4LCHA 5DNXA 1MG7A 4B3SI 2AJ4A 1Z0WA 2BA1D 4NXMI 2V2ZA 5FWKA 1R6MA 1UEKA 3K85A 4DR6E 2JEBB 2C38B 4DV3E 4DR4I 4DXLA 1ELOA 2NN6D 4AM3A 4FWHA 4GQUA 5LMNI 4DR2E 2BR2B 4IS9A 5BR8I 1Y4UA 2UUCI 1N32I 2UUAE 4LFAI 1B62A 4DR5E 4MQYA 3QT6A 4MU0A 1Z0EA 1P42A 2UXCE 2BR2A 4HY1A 1KVKA 2V2QA 2PO0B 4B3SE 3U1KA 3H1CA 1XXEA 1HR0I 4LF8I 2X7IA 3M7NG 5LL6R 1IBMI 5DRQA 4GKKI 4UT4A 1OYPA 1ZXNA 4YY3E 4FW9A 4N3OA 4FN5A 3HULA 3M85D 2NN6B 5A2QQ 5LMUI 5C0XC 4DR7I 4USKA 1KIJA 1E3HA 2BM1A 4LF7I 4MYTA 4IFDE 5IWAE 3P06A 4DV0E 2F1DA 3Q6MA 5FLXQ 2Q2EB 4OO1B 4QNKA 1USVA 1ZM2A 3ZKBA 1XMOI 3PS3A 4JV5E 2VQFI 4OO1D 4JI1E 4DV4E 3GMEA 2PNZB 4JI6I 1HR0E 4HXZA 3NZKA 2O1TA 3K1JA 4USMA 3KRNA 4YHHI 2IOQA 2Z5BB 2IOPA 2WNRB 5EKWA 2R42A 4AIDA 3JAMC 2IERA 4LF4I 1Y60A 2J7KA 2UUAI 4I3HA 1FI4A 1XMOE 1Z0GA 2NN6A 2WP8A 2GO4A 3M85G 1N0UA 3GONA 3PRYA 2V8PA 4HYMA 1ZXMA 3PYEA 4DPTA 2PO2A 3PYGA 1IBKI 2PO1B 4B3ME 1Z0VA 5IWAI 2UU9E 1B63A 2Z5BA 5JEAF 4JI0E 4MU1A 4LF7E 4LF5I 4DV5I 4LF6E 4OZEA 4ISAA 2PNLA 2UXBI 3D4JA 1VISA 3CDIA 4DV7I 1IBLI 1NZ0A 2VQFE 2XEXA 4DV1I 1S4EA 3ZZUA 4WUDA 3B78A 2JE6A 3ZKDA 4DR3E 4FW4A 2BA1G 2C38A 4GKKE 4DUYE 4B3TI 2O1WA 1UDSA 2JEAB 2C37A 1HNWI 2HK2A 4URLA 3GCMA 4OKGA 2BV3A 4OO1C 4DV1E 1USUA 4EMDA 1N36I 4LCFA 2Z5CA 2E5LI 1N36E 4DV4I 3ZM7A 2EFGA 1OJ4A 1OYSA 4JI7I 4WUBA 2OI2A 1DARA 5K36C 4FWDA 1RR9A 1Z0BA 1EI1A 1D6TA 4LFCE 2VQEI 5DRPA 2JE6B 2J65A 5C0XF 3PS2A 2UUBE 3B4TA 1FJGE 2Z5EA 5K36B 3M7ND 1FWKA 3P3EA 2HKEA 3LNUA 4QNJA 2VQEE 4IFDC 3P3CA 5EL9A 4DR3I 4DV6E 1Y4SA 2WNRA 5K36E 2C39A 4MU4A 1XNRE 1N0VC 3WU3A 3L7ZB 2HK3A 4DV7E 4R1FA 2O1VA 3T1HE 3T1YE 2PO2B 4K0KI 4JI0I 4OO1A 3JAMQ 1H73A 2VF3A 1XHKA 1Z0TA 2LJPA 2HFSA 4LF8E 4DUZE 4GKJE 2F4VE 1Y5YA 2R3VA 4JV5I 3ZZTA 4NXNI 2GO3A 2HKJA 3F0NA 3OTOE 2E1RA 4XTJA 4LF9E 2Z5CB 4IFDD 3P76A 4DPXA 1A6FA 2CZ9A 1Y6ZA 1YH8A 1OYRA 1PKPA 4PRXA 1HNXI 4J3DA 4DU8A 4IZKA 3J81C 2ZM6I 4JI4I 3HJCA 5JEAD 2GQ0A 4DR6I 1FNMA 2O1UA 1I94I 1R6LA 2CG9A 1UDNA 3J81Q 4DV2I 1YHCA 4RPFA 4LFBE 5A2QC 4B3MI 4LF9I 3L7ZA 3LPSA 1N33E 1UDOA 4IFDF 1HNZI 3U1YA 4Z7CA 4X66E 5C0XD 5C0XA 1XNQI 2IESA 4X64I 4MU3A 3K17A 2HHHI 4JI5I 2A2CA 1U2RA 1HK7A 1I94E 2JT2A 2UUBI 1NHIA 4DV5E 1NHJA 4IZJA 4U3BA 3T1HI 1J5EI 2CGEA 2UXDE 4JI2E 4JYAI 4FW6A 4JI7E 3HKMA 4AIMA 4FW7A 1S16A 2HHHE 4OX9E 4OO1E 4JI1I 2DEIA 4LCGA 2WP8B
chains in the Genus database with same CATH topology
2F4VI 2GS8A 1FJGI 1N34E 1HNWE 4NXME 1FKAE 3QT7A 2V34A 4DV2E 1XNQE 4LF4E 1BKNA 3PYFA 3M6AA 1XMQE 4JI3E 4K0KE 2E5LE 3J7AM 5BR8E 1HNXE 1N32E 1IBLE 2UUCE 4FWGA 4X65E 4X62E 1J5EE 2UXDI 3Q1QA 1XMQI 1IBME 1KKHA 4X62I 5GMDA 3B82A 3V2UC 2WW4A 1ZM3A 4DR7E 4LFCI 3J80Q 4P52A 4OX9I 4B3RI 4LFAE 4DPWA 4LFBI 4JG4A 4LF5E 4DR2I 2BM0A 1PVGA 1RREA 4WUCA 3ZZ0A 2NPFA 4DR4E 4JI3I 4IZJD 1H7UA 1N34I 4PRVA 4B3TE 4DUYI 4KQVA 2HFUA 1FWLA 2PNMA 5IT9C 4X64E 4DR5I 4HACB 1MX0A 1K47A 4JI2I 4JYAE 1N33I 1Z59A 3J80C 4ED4A 3J7AG 4DV3I 1MU5A 4LF6I 1Z5AA 1Z5BA 4JI8E 1H72C 1Z5CA 4JI5E 3QT8A 1WUUA 4M1KA 1XNRI 1IBKE 4KHPI 4X66I 1QZRA 1ZM9A 4DR1I 4Z7YA 3WU4A 4X65I 4DV0I 3WU5A 4DPYA 4GKJI 5IT9Q 1HNZE 3Q6NA 3B8HA 4IZJB 1KTVA 2ZM6E 4JI4E 3H4LA 3WU6A 5LMUE 4DPUA 3CWVA 4HACA 2A2DA 5L3JA 1H74A 4P7AA 2UU9I 4JI6E 4B3RE 1ZM4A 4NXNE 2ZBKB 5GMEA 1H7SA 2ZITA 4MYUA 5FLXC 3OTOI 4DUZI 4DR1E 3QT5A 1Z0CA 1NHHA 3V5RA 2UXCI 4AQYE 4IZKB 2DEJA 4JI8I 4YHHE 1PIEA 3T1YI 3LTOA 5LMNE 2V2VA 3PYDA 4YY3I 2UXBE 4DU7A 4PU9A 1EA6A 2X36A 4ZVIA 4DV6I 4KHPE 4AQYI 1MG7A 4B3SI 2AJ4A 1Z0WA 4NXMI 2V2ZA 5FWKA 1UEKA 3K85A 4DR6E 4DV3E 4DR4I 4DXLA 1ELOA 4FWHA 4DR2E 5LMNI 5BR8I 1Y4UA 2UUCI 1N32I 2UUAE 4LFAI 1B62A 4DR5E 3QT6A 1Z0EA 2UXCE 4HY1A 1KVKA 2V2QA 4B3SE 4LF8I 1HR0I 2X7IA 5LL6R 1IBMI 4GKKI 4UT4A 1ZXNA 4YY3E 4FW9A 4N3OA 4FN5A 3HULA 5A2QQ 5LMUI 4DR7I 4USKA 1KIJA 2BM1A 4LF7I 4MYTA 5IWAE 3P06A 4DV0E 3Q6MA 5FLXQ 2Q2EB 1USVA 1ZM2A 3ZKBA 1XMOI 4JV5E 2VQFI 4JI1E 4DV4E 4JI6I 1HR0E 4HXZA 2O1TA 3K1JA 4USMA 4YHHI 2IOQA 2Z5BB 2IOPA 2R42A 3JAMC 4LF4I 2J7KA 2UUAI 4I3HA 1FI4A 1XMOE 1Z0GA 1N0UA 3GONA 3PRYA 2V8PA 4HYMA 1ZXMA 3PYEA 4DPTA 3PYGA 1IBKI 4B3ME 1Z0VA 5IWAI 2UU9E 1B63A 2Z5BA 4JI0E 4LF7E 4LF5I 4DV5I 4LF6E 2PNLA 2UXBI 3D4JA 1VISA 4DV7I 1IBLI 1NZ0A 2VQFE 2XEXA 4DV1I 1S4EA 3ZZUA 4WUDA 3B78A 3ZKDA 4DR3E 4GKKE 4DUYE 4B3TI 2O1WA 1HNWI 2HK2A 4URLA 2BV3A 4DV1E 1USUA 4EMDA 1N36I 2Z5CA 2E5LI 1N36E 4DV4I 3ZM7A 2EFGA 1OJ4A 4JI7I 4WUBA 2OI2A 1DARA 4FWDA 1RR9A 1Z0BA 1EI1A 1D6TA 4LFCE 2VQEI 2UUBE 1FJGE 2Z5EA 1FWKA 2HKEA 3LNUA 2VQEE 4DR3I 4DV6E 1Y4SA 1XNRE 1N0VC 3WU3A 2HK3A 4DV7E 4R1FA 2O1VA 3T1HE 3T1YE 4K0KI 4JI0I 3JAMQ 1H73A 2VF3A 1XHKA 1Z0TA 2LJPA 2HFSA 4LF8E 4DUZE 4GKJE 2F4VE 2R3VA 4JV5I 3ZZTA 4NXNI 2HKJA 3F0NA 3OTOE 2E1RA 4XTJA 4LF9E 2Z5CB 4DPXA 1A6FA 2CZ9A 1Y6ZA 1PKPA 4PRXA 1HNXI 4DU8A 4IZKA 3J81C 2ZM6I 4JI4I 3HJCA 2GQ0A 4DR6I 1FNMA 2O1UA 1I94I 2CG9A 3J81Q 4DV2I 4RPFA 4LFBE 5A2QC 4B3MI 4LF9I 3LPSA 1N33E 1HNZI 4Z7CA 4X66E 1XNQI 4X64I 3K17A 2HHHI 4JI5I 2A2CA 1U2RA 1HK7A 1I94E 2UUBI 1NHIA 4DV5E 1NHJA 4IZJA 3T1HI 1J5EI 2CGEA 2UXDE 4JI2E 4JYAI 4JI7E 1S16A 2HHHE 4OX9E 4JI1I 2DEIA 4UTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V I;  2GS8 A;  1FJG I;  1N34 E;  1HNW E;  4NXM E;  1FKA E;  3QT7 A;  2V34 A;  4DV2 E;  1XNQ E;  4LF4 E;  1BKN A;  3PYF A;  3M6A A;  1XMQ E;  4JI3 E;  4K0K E;  2E5L E;  3J7A M;  5BR8 E;  1HNX E;  1N32 E;  1IBL E;  2UUC E;  4FWG A;  4X65 E;  4X62 E;  1J5E E;  2UXD I;  3Q1Q A;  1XMQ I;  1IBM E;  1KKH A;  4X62 I;  5GMD A;  3B82 A;  3V2U C;  2WW4 A;  1ZM3 A;  4DR7 E;  4LFC I;  3J80 Q;  4P52 A;  4OX9 I;  4B3R I;  4LFA E;  4DPW A;  4LFB I;  4JG4 A;  4LF5 E;  4DR2 I;  2BM0 A;  1PVG A;  1RRE A;  4WUC A;  3ZZ0 A;  2NPF A;  4DR4 E;  4JI3 I;  1H7U A;  1N34 I;  4PRV A;  4B3T E;  4DUY I;  4KQV A;  2HFU A;  1FWL A;  5IT9 C;  4X64 E;  4DR5 I;  4HAC B;  1MX0 A;  1K47 A;  4JI2 I;  4JYA E;  1N33 I;  1Z59 A;  3J80 C;  4ED4 A;  3J7A G;  4DV3 I;  1MU5 A;  4LF6 I;  1Z5A A;  1Z5B A;  4JI8 E;  1H72 C;  1Z5C A;  4JI5 E;  3QT8 A;  1WUU A;  4M1K A;  1XNR I;  1IBK E;  4KHP I;  4X66 I;  1QZR A;  1ZM9 A;  4DR1 I;  4Z7Y A;  3WU4 A;  4X65 I;  4DV0 I;  3WU5 A;  4DPY A;  4GKJ I;  5IT9 Q;  1HNZ E;  3B8H A;  1KTV A;  2ZM6 E;  4JI4 E;  3H4L A;  3WU6 A;  5LMU E;  4DPU A;  3CWV A;  4HAC A;  2A2D A;  5L3J A;  1H74 A;  4P7A A;  2UU9 I;  4JI6 E;  4B3R E;  1ZM4 A;  4NXN E;  2ZBK B;  5GME A;  1H7S A;  2ZIT A;  4MYU A;  5FLX C;  3OTO I;  4DUZ I;  4DR1 E;  3QT5 A;  1Z0C A;  1NHH A;  3V5R A;  2UXC I;  4AQY E;  2DEJ A;  4JI8 I;  4YHH E;  1PIE A;  3T1Y I;  3LTO A;  5LMN E;  2V2V A;  3PYD A;  4YY3 I;  2UXB E;  4DU7 A;  4PU9 A;  1EA6 A;  2X36 A;  4ZVI A;  4DV6 I;  4KHP E;  4AQY I;  1MG7 A;  4B3S I;  2AJ4 A;  1Z0W A;  4NXM I;  2V2Z A;  1UEK A;  4DR6 E;  4DV3 E;  4DR4 I;  4DXL A;  1ELO A;  4FWH A;  4DR2 E;  5LMN I;  5BR8 I;  1N32 I;  2UUC I;  2UUA E;  4LFA I;  1B62 A;  4DR5 E;  3QT6 A;  1Z0E A;  2UXC E;  4HY1 A;  1KVK A;  2V2Q A;  4B3S E;  4LF8 I;  1HR0 I;  2X7I A;  5LL6 R;  1IBM I;  4GKK I;  4UT4 A;  1ZXN A;  4YY3 E;  4FW9 A;  4FN5 A;  3HUL A;  5A2Q Q;  5LMU I;  4DR7 I;  4USK A;  1KIJ A;  2BM1 A;  4LF7 I;  4MYT A;  5IWA E;  4DV0 E;  5FLX Q;  2Q2E B;  1ZM2 A;  3ZKB A;  1XMO I;  4JV5 E;  2VQF I;  4JI1 E;  4DV4 E;  4JI6 I;  1HR0 E;  4HXZ A;  3K1J A;  4USM A;  4YHH I;  2R42 A;  3JAM C;  4LF4 I;  2J7K A;  2UUA I;  4I3H A;  1FI4 A;  1XMO E;  1Z0G A;  1N0U A;  3GON A;  2V8P A;  4HYM A;  1ZXM A;  3PYE A;  4DPT A;  3PYG A;  1IBK I;  4B3M E;  1Z0V A;  5IWA I;  2UU9 E;  1B63 A;  4JI0 E;  4LF7 E;  4LF5 I;  4DV5 I;  4LF6 E;  2UXB I;  3D4J A;  1VIS A;  4DV7 I;  1IBL I;  1NZ0 A;  2VQF E;  2XEX A;  4DV1 I;  1S4E A;  3ZZU A;  4WUD A;  3B78 A;  3ZKD A;  4DR3 E;  4GKK E;  4DUY E;  4B3T I;  1HNW I;  2HK2 A;  4URL A;  2BV3 A;  4DV1 E;  4EMD A;  1N36 I;  2E5L I;  1N36 E;  4DV4 I;  3ZM7 A;  2EFG A;  1OJ4 A;  4JI7 I;  4WUB A;  2OI2 A;  1DAR A;  4FWD A;  1RR9 A;  1Z0B A;  1EI1 A;  1D6T A;  4LFC E;  2VQE I;  2UUB E;  1FJG E;  1FWK A;  2HKE A;  3LNU A;  2VQE E;  4DR3 I;  4DV6 E;  1XNR E;  1N0V C;  3WU3 A;  2HK3 A;  4DV7 E;  4R1F A;  3T1H E;  3T1Y E;  4K0K I;  4JI0 I;  3JAM Q;  1H73 A;  2VF3 A;  1XHK A;  1Z0T A;  2LJP A;  2HFS A;  4LF8 E;  4DUZ E;  4GKJ E;  2F4V E;  2R3V A;  4JV5 I;  3ZZT A;  4NXN I;  2HKJ A;  3F0N A;  3OTO E;  2E1R A;  4XTJ A;  4LF9 E;  4DPX A;  1A6F A;  2CZ9 A;  1PKP A;  4PRX A;  1HNX I;  4DU8 A;  3J81 C;  2ZM6 I;  4JI4 I;  4DR6 I;  1FNM A;  1I94 I;  3J81 Q;  4DV2 I;  4RPF A;  4LFB E;  5A2Q C;  4B3M I;  4LF9 I;  3LPS A;  1N33 E;  1HNZ I;  4Z7C A;  4X66 E;  1XNQ I;  4X64 I;  3K17 A;  2HHH I;  4JI5 I;  2A2C A;  1U2R A;  1I94 E;  2UUB I;  1NHI A;  4DV5 E;  1NHJ A;  3T1H I;  1J5E I;  2UXD E;  4JI2 E;  4JYA I;  4JI7 E;  1S16 A;  2HHH E;  4OX9 E;  4JI1 I;  2DEI A;  4UTG A; 
#chains in the Genus database with same CATH topology
 4BA2 A;  5DRR A;  2F4V I;  2GS8 A;  1FJG I;  1N34 E;  1HNW E;  4NXM E;  1FKA E;  3QT7 A;  2CVE A;  2V34 A;  4DV2 E;  1XNQ E;  4LF4 E;  1BKN A;  3PYF A;  2NN6 C;  3M6A A;  1XMQ E;  2NN6 F;  4JI3 E;  4K0K E;  3P3G A;  2E5L E;  4MDT A;  3J7A M;  2PNZ A;  3UHM A;  5BR8 E;  1HNX E;  1N32 E;  2JEB A;  1VI7 A;  5JEA A;  1IBL E;  2UUC E;  3DD6 A;  4FWG A;  4X65 E;  4X62 E;  1J5E E;  2UXD I;  3Q1Q A;  1XMQ I;  2C39 B;  2BA0 D;  2NN6 E;  4OO1 F;  1IBM E;  1KKH A;  2PO1 A;  5DRO A;  2VES A;  4X62 I;  5GMD A;  3V2U C;  3B82 A;  2WW4 A;  1ZM3 A;  4BA1 B;  4DR7 E;  5DNL A;  4LFC I;  3J80 Q;  4P52 A;  4BA2 B;  4OX9 I;  4LPF A;  4B3R I;  4LFA E;  4DPW A;  4LFB I;  4JG4 A;  4LF5 E;  4DR2 I;  2BM0 A;  1PVG A;  1RRE A;  4WUC A;  3ZZ0 A;  5ELW A;  2NPF A;  4DR4 E;  1RHY A;  4JI3 I;  5K36 D;  4IZJ D;  1H7U A;  1N34 I;  2PO0 A;  4PRV A;  4B3T E;  4DUY I;  4KQV A;  2HFU A;  1FWL A;  2PNM A;  5IT9 C;  4X64 E;  2C37 B;  4DR5 I;  4HAC B;  3CDJ A;  4UTG A;  1MX0 A;  1E3P A;  1K47 A;  4JI2 I;  4JYA E;  1N33 I;  1Z59 A;  3J80 C;  4ED4 A;  2AE8 A;  3J7A G;  4DV3 I;  1MU5 A;  4LF6 I;  1Z5A A;  1Z5B A;  4JI8 E;  1H72 C;  1Z5C A;  4JI5 E;  3QT8 A;  4IFD A;  1WUU A;  4M1K A;  1XNR I;  1IBK E;  4KHP I;  5JEA C;  4X66 I;  1QZR A;  1ZM9 A;  4DR1 I;  4Z7Y A;  4IFD B;  3WU4 A;  5JEA E;  4X65 I;  4LOM A;  2JEA A;  4DV0 I;  3WU5 A;  4FW3 A;  4FW5 A;  4DPY A;  3GLL A;  4GKJ I;  5IT9 Q;  1HNZ E;  3Q6N A;  3B8H A;  2BA0 G;  4IZJ B;  1KTV A;  5C0X E;  2ZM6 E;  4JI4 E;  3H4L A;  3WU6 A;  5LMU E;  4DPU A;  3CWV A;  4HAC A;  2A2D A;  5L3J A;  1H74 A;  4P7A A;  2UU9 I;  4BA1 A;  4JI6 E;  4B3R E;  5C0X B;  1ZM4 A;  5K36 F;  4NXN E;  4NBQ A;  2ZBK B;  5GME A;  1H7S A;  2ZIT A;  2O3Z A;  4MYU A;  5FLX C;  3OTO I;  4DUZ I;  4DR1 E;  3QT5 A;  1Z0C A;  1NHH A;  3V5R A;  5JEA B;  2UXC I;  5K36 A;  4AQY E;  4IZK B;  2DEJ A;  4U3D A;  4JI8 I;  4YHH E;  1PIE A;  3T1Y I;  3LTO A;  5LMN E;  3PS1 A;  2V2V A;  3PYD A;  4YY3 I;  2UXB E;  4DU7 A;  1UDQ A;  4PU9 A;  1EA6 A;  2X36 A;  4ZVI A;  4DV6 I;  4KHP E;  4AQY I;  4LCH A;  5DNX A;  1MG7 A;  4B3S I;  2AJ4 A;  1Z0W A;  2BA1 D;  4NXM I;  2V2Z A;  5FWK A;  1R6M A;  1UEK A;  3K85 A;  4DR6 E;  2JEB B;  2C38 B;  4DV3 E;  4DR4 I;  4DXL A;  1ELO A;  2NN6 D;  4AM3 A;  4FWH A;  4GQU A;  5LMN I;  4DR2 E;  2BR2 B;  4IS9 A;  5BR8 I;  1Y4U A;  2UUC I;  1N32 I;  2UUA E;  4LFA I;  1B62 A;  4DR5 E;  4MQY A;  3QT6 A;  4MU0 A;  1Z0E A;  1P42 A;  2UXC E;  2BR2 A;  4HY1 A;  1KVK A;  2V2Q A;  2PO0 B;  4B3S E;  3U1K A;  3H1C A;  1XXE A;  1HR0 I;  4LF8 I;  2X7I A;  3M7N G;  5LL6 R;  1IBM I;  5DRQ A;  4GKK I;  4UT4 A;  1OYP A;  1ZXN A;  4YY3 E;  4FW9 A;  4N3O A;  4FN5 A;  3HUL A;  3M85 D;  2NN6 B;  5A2Q Q;  5LMU I;  5C0X C;  4DR7 I;  4USK A;  1KIJ A;  1E3H A;  2BM1 A;  4LF7 I;  4MYT A;  4IFD E;  5IWA E;  3P06 A;  4DV0 E;  2F1D A;  3Q6M A;  5FLX Q;  2Q2E B;  4OO1 B;  4QNK A;  1USV A;  1ZM2 A;  3ZKB A;  1XMO I;  3PS3 A;  4JV5 E;  2VQF I;  4OO1 D;  4JI1 E;  4DV4 E;  3GME A;  2PNZ B;  4JI6 I;  1HR0 E;  4HXZ A;  3NZK A;  2O1T A;  3K1J A;  4USM A;  3KRN A;  4YHH I;  2IOQ A;  2Z5B B;  2IOP A;  2WNR B;  5EKW A;  2R42 A;  4AID A;  3JAM C;  2IER A;  4LF4 I;  1Y60 A;  2J7K A;  2UUA I;  4I3H A;  1FI4 A;  1XMO E;  1Z0G A;  2NN6 A;  2WP8 A;  2GO4 A;  3M85 G;  1N0U A;  3GON A;  3PRY A;  2V8P A;  4HYM A;  1ZXM A;  3PYE A;  4DPT A;  2PO2 A;  3PYG A;  1IBK I;  2PO1 B;  4B3M E;  1Z0V A;  5IWA I;  2UU9 E;  1B63 A;  2Z5B A;  5JEA F;  4JI0 E;  4MU1 A;  4LF7 E;  4LF5 I;  4DV5 I;  4LF6 E;  4OZE A;  4ISA A;  2PNL A;  2UXB I;  3D4J A;  1VIS A;  3CDI A;  4DV7 I;  1IBL I;  1NZ0 A;  2VQF E;  2XEX A;  4DV1 I;  1S4E A;  3ZZU A;  4WUD A;  3B78 A;  2JE6 A;  3ZKD A;  4DR3 E;  4FW4 A;  2BA1 G;  2C38 A;  4GKK E;  4DUY E;  4B3T I;  2O1W A;  1UDS A;  2JEA B;  2C37 A;  1HNW I;  2HK2 A;  4URL A;  3GCM A;  4OKG A;  2BV3 A;  4OO1 C;  4DV1 E;  1USU A;  4EMD A;  1N36 I;  4LCF A;  2Z5C A;  2E5L I;  1N36 E;  4DV4 I;  3ZM7 A;  2EFG A;  1OJ4 A;  1OYS A;  4JI7 I;  4WUB A;  2OI2 A;  1DAR A;  5K36 C;  4FWD A;  1RR9 A;  1Z0B A;  1EI1 A;  1D6T A;  4LFC E;  2VQE I;  5DRP A;  2JE6 B;  2J65 A;  5C0X F;  3PS2 A;  2UUB E;  3B4T A;  1FJG E;  2Z5E A;  5K36 B;  3M7N D;  1FWK A;  3P3E A;  2HKE A;  3LNU A;  4QNJ A;  2VQE E;  4IFD C;  3P3C A;  5EL9 A;  4DR3 I;  4DV6 E;  1Y4S A;  2WNR A;  5K36 E;  2C39 A;  4MU4 A;  1XNR E;  1N0V C;  3WU3 A;  3L7Z B;  2HK3 A;  4DV7 E;  4R1F A;  2O1V A;  3T1H E;  3T1Y E;  2PO2 B;  4K0K I;  4JI0 I;  4OO1 A;  3JAM Q;  1H73 A;  2VF3 A;  1XHK A;  1Z0T A;  2LJP A;  2HFS A;  4LF8 E;  4DUZ E;  4GKJ E;  2F4V E;  1Y5Y A;  2R3V A;  4JV5 I;  3ZZT A;  4NXN I;  2GO3 A;  2HKJ A;  3F0N A;  3OTO E;  2E1R A;  4XTJ A;  4LF9 E;  2Z5C B;  4IFD D;  3P76 A;  4DPX A;  1A6F A;  2CZ9 A;  1Y6Z A;  1YH8 A;  1OYR A;  1PKP A;  4PRX A;  1HNX I;  4J3D A;  4DU8 A;  4IZK A;  3J81 C;  2ZM6 I;  4JI4 I;  3HJC A;  5JEA D;  2GQ0 A;  4DR6 I;  1FNM A;  2O1U A;  1I94 I;  1R6L A;  2CG9 A;  1UDN A;  3J81 Q;  4DV2 I;  1YHC A;  4RPF A;  4LFB E;  5A2Q C;  4B3M I;  4LF9 I;  3L7Z A;  3LPS A;  1N33 E;  1UDO A;  4IFD F;  1HNZ I;  3U1Y A;  4Z7C A;  4X66 E;  5C0X D;  5C0X A;  1XNQ I;  2IES A;  4X64 I;  4MU3 A;  3K17 A;  2HHH I;  4JI5 I;  2A2C A;  1U2R A;  1HK7 A;  1I94 E;  2JT2 A;  2UUB I;  1NHI A;  4DV5 E;  1NHJ A;  4IZJ A;  4U3B A;  3T1H I;  1J5E I;  2CGE A;  2UXD E;  4JI2 E;  4JYA I;  4FW6 A;  4JI7 E;  3HKM A;  4AIM A;  4FW7 A;  1S16 A;  2HHH E;  4OX9 E;  4OO1 E;  4JI1 I;  2DEI A;  4LCG A;  2WP8 B; 
#chains in the Genus database with same CATH homology
 2F4V I;  2GS8 A;  1FJG I;  1N34 E;  1HNW E;  4NXM E;  1FKA E;  3QT7 A;  2V34 A;  4DV2 E;  1XNQ E;  4LF4 E;  1BKN A;  3PYF A;  3M6A A;  1XMQ E;  4JI3 E;  4K0K E;  2E5L E;  3J7A M;  5BR8 E;  1HNX E;  1N32 E;  1IBL E;  2UUC E;  4FWG A;  4X65 E;  4X62 E;  1J5E E;  2UXD I;  3Q1Q A;  1XMQ I;  1IBM E;  1KKH A;  4X62 I;  5GMD A;  3B82 A;  3V2U C;  2WW4 A;  1ZM3 A;  4DR7 E;  4LFC I;  3J80 Q;  4P52 A;  4OX9 I;  4B3R I;  4LFA E;  4DPW A;  4LFB I;  4JG4 A;  4LF5 E;  4DR2 I;  2BM0 A;  1PVG A;  1RRE A;  4WUC A;  3ZZ0 A;  2NPF A;  4DR4 E;  4JI3 I;  4IZJ D;  1H7U A;  1N34 I;  4PRV A;  4B3T E;  4DUY I;  4KQV A;  2HFU A;  1FWL A;  2PNM A;  5IT9 C;  4X64 E;  4DR5 I;  4HAC B;  1MX0 A;  1K47 A;  4JI2 I;  4JYA E;  1N33 I;  1Z59 A;  3J80 C;  4ED4 A;  3J7A G;  4DV3 I;  1MU5 A;  4LF6 I;  1Z5A A;  1Z5B A;  4JI8 E;  1H72 C;  1Z5C A;  4JI5 E;  3QT8 A;  1WUU A;  4M1K A;  1XNR I;  1IBK E;  4KHP I;  4X66 I;  1QZR A;  1ZM9 A;  4DR1 I;  4Z7Y A;  3WU4 A;  4X65 I;  4DV0 I;  3WU5 A;  4DPY A;  4GKJ I;  5IT9 Q;  1HNZ E;  3Q6N A;  3B8H A;  4IZJ B;  1KTV A;  2ZM6 E;  4JI4 E;  3H4L A;  3WU6 A;  5LMU E;  4DPU A;  3CWV A;  4HAC A;  2A2D A;  5L3J A;  1H74 A;  4P7A A;  2UU9 I;  4JI6 E;  4B3R E;  1ZM4 A;  4NXN E;  2ZBK B;  5GME A;  1H7S A;  2ZIT A;  4MYU A;  5FLX C;  3OTO I;  4DUZ I;  4DR1 E;  3QT5 A;  1Z0C A;  1NHH A;  3V5R A;  2UXC I;  4AQY E;  4IZK B;  2DEJ A;  4JI8 I;  4YHH E;  1PIE A;  3T1Y I;  3LTO A;  5LMN E;  2V2V A;  3PYD A;  4YY3 I;  2UXB E;  4DU7 A;  4PU9 A;  1EA6 A;  2X36 A;  4ZVI A;  4DV6 I;  4KHP E;  4AQY I;  1MG7 A;  4B3S I;  2AJ4 A;  1Z0W A;  4NXM I;  2V2Z A;  5FWK A;  1UEK A;  3K85 A;  4DR6 E;  4DV3 E;  4DR4 I;  4DXL A;  1ELO A;  4FWH A;  4DR2 E;  5LMN I;  5BR8 I;  1Y4U A;  2UUC I;  1N32 I;  2UUA E;  4LFA I;  1B62 A;  4DR5 E;  3QT6 A;  1Z0E A;  2UXC E;  4HY1 A;  1KVK A;  2V2Q A;  4B3S E;  4LF8 I;  1HR0 I;  2X7I A;  5LL6 R;  1IBM I;  4GKK I;  4UT4 A;  1ZXN A;  4YY3 E;  4FW9 A;  4N3O A;  4FN5 A;  3HUL A;  5A2Q Q;  5LMU I;  4DR7 I;  4USK A;  1KIJ A;  2BM1 A;  4LF7 I;  4MYT A;  5IWA E;  3P06 A;  4DV0 E;  3Q6M A;  5FLX Q;  2Q2E B;  1USV A;  1ZM2 A;  3ZKB A;  1XMO I;  4JV5 E;  2VQF I;  4JI1 E;  4DV4 E;  4JI6 I;  1HR0 E;  4HXZ A;  2O1T A;  3K1J A;  4USM A;  4YHH I;  2IOQ A;  2Z5B B;  2IOP A;  2R42 A;  3JAM C;  4LF4 I;  2J7K A;  2UUA I;  4I3H A;  1FI4 A;  1XMO E;  1Z0G A;  1N0U A;  3GON A;  3PRY A;  2V8P A;  4HYM A;  1ZXM A;  3PYE A;  4DPT A;  3PYG A;  1IBK I;  4B3M E;  1Z0V A;  5IWA I;  2UU9 E;  1B63 A;  2Z5B A;  4JI0 E;  4LF7 E;  4LF5 I;  4DV5 I;  4LF6 E;  2PNL A;  2UXB I;  3D4J A;  1VIS A;  4DV7 I;  1IBL I;  1NZ0 A;  2VQF E;  2XEX A;  4DV1 I;  1S4E A;  3ZZU A;  4WUD A;  3B78 A;  3ZKD A;  4DR3 E;  4GKK E;  4DUY E;  4B3T I;  2O1W A;  1HNW I;  2HK2 A;  4URL A;  2BV3 A;  4DV1 E;  1USU A;  4EMD A;  1N36 I;  2Z5C A;  2E5L I;  1N36 E;  4DV4 I;  3ZM7 A;  2EFG A;  1OJ4 A;  4JI7 I;  4WUB A;  2OI2 A;  1DAR A;  4FWD A;  1RR9 A;  1Z0B A;  1EI1 A;  1D6T A;  4LFC E;  2VQE I;  2UUB E;  1FJG E;  2Z5E A;  1FWK A;  2HKE A;  3LNU A;  2VQE E;  4DR3 I;  4DV6 E;  1Y4S A;  1XNR E;  1N0V C;  3WU3 A;  2HK3 A;  4DV7 E;  4R1F A;  2O1V A;  3T1H E;  3T1Y E;  4K0K I;  4JI0 I;  3JAM Q;  1H73 A;  2VF3 A;  1XHK A;  1Z0T A;  2LJP A;  2HFS A;  4LF8 E;  4DUZ E;  4GKJ E;  2F4V E;  2R3V A;  4JV5 I;  3ZZT A;  4NXN I;  2HKJ A;  3F0N A;  3OTO E;  2E1R A;  4XTJ A;  4LF9 E;  2Z5C B;  4DPX A;  1A6F A;  2CZ9 A;  1Y6Z A;  1PKP A;  4PRX A;  1HNX I;  4DU8 A;  4IZK A;  3J81 C;  2ZM6 I;  4JI4 I;  3HJC A;  2GQ0 A;  4DR6 I;  1FNM A;  2O1U A;  1I94 I;  2CG9 A;  3J81 Q;  4DV2 I;  4RPF A;  4LFB E;  5A2Q C;  4B3M I;  4LF9 I;  3LPS A;  1N33 E;  1HNZ I;  4Z7C A;  4X66 E;  1XNQ I;  4X64 I;  3K17 A;  2HHH I;  4JI5 I;  2A2C A;  1U2R A;  1HK7 A;  1I94 E;  2UUB I;  1NHI A;  4DV5 E;  1NHJ A;  4IZJ A;  3T1H I;  1J5E I;  2CGE A;  2UXD E;  4JI2 E;  4JYA I;  4JI7 E;  1S16 A;  2HHH E;  4OX9 E;  4JI1 I;  2DEI A;  4UTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...