4DV0I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv0I00
5GMEA 1VISA 4DV4E 1Z0EA 5A2QC 4B3SE 4JI2E 1ZM3A 2ZM6E 4DR1I 1KVKA 1IBLE 3ZKBA 4LFBE 3JAMQ 1Z0CA 1N34I 4AQYE 4JI4E 4UTGA 4DV3I 2AJ4A 3CWVA 3D4JA 2UUAE 4KHPE 2NPFA 4M1KA 1ZXNA 5L3JA 4K0KI 1N34E 2UXCE 3T1HI 4X62I 2F4VI 4WUCA 2HFSA 1N0UA 1Z5AA 3B82A 3WU3A 4DU8A 4HXZA 3T1HE 2F4VE 1NHHA 4OX9I 1H73A 1Z0WA 4NXNI 4GKKE 1DARA 4DV0I 4DPXA 4RPFA 4DR6E 4HACB 3PYEA 2ZBKB 1Z5CA 1ZM9A 4OX9E 4PU9A 1I94I 4JV5E 3QT8A 1XNQE 4DR3I 4DV0E 1FKAE 1Z5BA 1ELOA 4R1FA 3ZM7A 2V8PA 4DR5E 1I94E 2E5LI 4DR3E 4Z7YA 4JI1I 3QT5A 1BKNA 4MYUA 4YY3E 4MYTA 4JI8I 4DR2I 1B63A 2E5LE 3ZZTA 4JI1E 5LMNI 4LF7I 1QZRA 3J81Q 1N36E 4JI8E 2UXDE 5IT9C 4JI5I 1S4EA 5IWAI 4X66I 4GKJI 1HNXE 1NHJA 2UU9I 1WUUA 4WUBA 4LF5I 5LMNE 4LF7E 1H74A 4DV6I 2UUCI 4LFCI 4UT4A 3HULA 4ED4A 4DXLA 4DUYI 1FJGE 5IWAE 4DPUA 4X66E 4B3SI 2CZ9A 4PRXA 4GKJE 2ZM6I 1HNZE 2HKJA 4LF5E 1IBLI 2X36A 4B3TI 4DV6E 2UUCE 3LTOA 4LFCE 4DUYE 4AQYI 4JI4I 5FLXC 2UUAI 4DR7I 4B3TE 5LL6R 4KHPI 2UXCI 3B8HA 4LF9I 4DR7E 4DPWA 5A2QQ 1N0VC 3QT7A 4EMDA 1EI1A 1FI4A 1FWLA 4JYAI 4DV7E 4LF9E 1MX0A 2HHHI 4GKKI 2VQFI 2UXBI 4JYAE 4ZVIA 4DR6I 4P7AA 3H4LA 2V2ZA 1A6FA 2HHHE 4JV5I 2UXBE 2VQFE 1FNMA 3PYFA 1XNQI 4LF8E 3ZZUA 4XTJA 2HFUA 1N32I 4USKA 4FW9A 2V2VA 3OTOE 4DV1I 4FN5A 4DR5I 4JI0E 1XMOI 2A2DA 4DU7A 1N32E 4YY3I 4DV1E 1XMOE 1NZ0A 2J7KA 1N36I 2WW4A 1Z0BA 4JG4A 1H7UA 4LF4I 2UXDI 3K17A 1HR0E 1HNXI 4USMA 1Z0GA 4LF4E 3T1YE 1Z0VA 1IBKE 3QT6A 1FJGI 4WUDA 4HY1A 2XEXA 1HNZI 2VF3A 1HNWI 2ZITA 4X64E 3J7AM 3LNUA 2HKEA 2BM0A 3M6AA 3V2UC 2OI2A 3WU4A 5IT9Q 1ZM2A 3V5RA 1HNWE 1Z0TA 3Q1QA 2HK2A 2UUBE 4LF6I 1PVGA 4DPYA 4LFAE 4DV2I 4NXME 4DV5I 3JAMC 4LF6E 5BR8I 4DUZE 1PKPA 2Q2EB 2VQEI 3B78A 1RREA 4DV2E 4DV5E 4DV7I 4I3HA 2DEIA 3WU6A 1S16A 5FLXQ 1N33I 2V34A 5BR8E 1XMQE 2VQEE 4FWGA 3GONA 1U2RA 4B3RI 1N33E 1ZM4A 3WU5A 4DR1E 4LF8I 4P52A 3OTOI 4JI0I 5LMUI 4B3RE 4DV3E 4HACA 2V2QA 1H7SA 3ZKDA 4K0KE 2A2CA 2E1RA 4X62E 5LMUE 4DPTA 4YHHI 1PIEA 2R42A 1KIJA 1FWKA 3F0NA 2GS8A 4HYMA 2HK3A 4JI7I 1HR0I 4YHHE 4JI3I 1KTVA 4NXNE 2BV3A 4FWDA 4B3MI 3T1YI 1UEKA 1MG7A 1IBKI 4JI7E 4Z7CA 1XNRI 4JI3E 4X64I 4PRVA 3J81C 4B3ME 4JI6I 1IBMI 1RR9A 2X7IA 3J80C 1Z59A 1XNRE 1NHIA 4X65I 4JI6E 1IBME 2UUBI 1D6TA 5GMDA 1K47A 1B62A 4LFAI 2EFGA 4NXMI 4DR4I 3J80Q 1KKHA 3PYGA 4URLA 4DR2E 4X65E 3J7AG 2LJPA 1XHKA 3PYDA 2DEJA 3ZZ0A 4DUZI 1EA6A 4DR4E 1J5EI 3K1JA 1ZXMA 4DV4I 4JI5E 1OJ4A 4KQVA 1MU5A 2R3VA 2BM1A 2UU9E 1H72C 4JI2I 1XMQI 4FWHA 4LFBI 1J5EE 3LPSA
chains in the Genus database with same CATH superfamily
5GMEA 1VISA 4NBQA 4DV4E 2Z5EA 1Z0EA 5A2QC 4B3SE 3M7NG 2JEBB 2Z5BB 4JI2E 1ZM3A 2ZM6E 4DR1I 1KVKA 1IBLE 3ZKBA 2NN6C 4LFBE 3JAMQ 1Z0CA 2PNZA 1OYPA 1N34I 1E3PA 4AQYE 4JI4E 4UTGA 3DD6A 2WP8A 4DV3I 2AJ4A 3CWVA 2PO2A 3D4JA 2UUAE 4KHPE 2BR2B 2NPFA 4M1KA 1ZXNA 3HJCA 5L3JA 4K0KI 1N34E 5DRRA 2UXCE 3P3CA 3T1HI 4X62I 2F4VI 4WUCA 2HFSA 1N0UA 1USVA 1Z5AA 3B82A 2C38A 3WU3A 4DU8A 4HXZA 3T1HE 2CVEA 2F4VE 3UHMA 1NHHA 4OX9I 3L7ZB 1H73A 1Z0WA 4NXNI 1VI7A 2VESA 4GKKE 1DARA 3HKMA 1OYRA 4DPXA 4DV0I 4RPFA 4DR6E 2BA1D 4HACB 1UDNA 4IFDE 3PYEA 2ZBKB 1Z5CA 4FW4A 1ZM9A 4OX9E 4PU9A 1I94I 4JV5E 3QT8A 5ELWA 1XNQE 1Y4SA 4DR3I 4DV0E 1FKAE 1Z5BA 4MU1A 1ELOA 3Q6MA 4R1FA 3ZM7A 2V8PA 4DR5E 5K36F 1I94E 4FW7A 2NN6E 2E5LI 4IFDA 4DR3E 4IZJA 4Z7YA 4JI1I 4OO1D 3QT5A 2IESA 1BKNA 4MYUA 4YY3E 4MYTA 4JI8I 2AE8A 4DR2I 1B63A 2C39A 1HK7A 2E5LE 3ZZTA 4JI1E 4LCGA 5LMNI 4LF7I 2C37B 1QZRA 2PNMA 3J81Q 1N36E 2JEAB 2WNRA 4JI8E 3NZKA 2UXDE 5IT9C 5JEAD 4JI5I 1S4EA 5IWAI 4X66I 4GKJI 1HNXE 5C0XA 1NHJA 2UU9I 1WUUA 2NN6F 2O3ZA 4WUBA 4LF5I 5LMNE 4LF7E 1H74A 4DV6I 4LCFA 2UUCI 4LFCI 4UT4A 3HULA 4ED4A 4DXLA 4DUYI 1FJGE 5IWAE 4DPUA 4X66E 4B3SI 2CZ9A 4PRXA 4GKJE 4LOMA 2PO0B 2ZM6I 2HKJA 1HNZE 4LF5E 1IBLI 2X36A 4B3TI 4DV6E 2UUCE 3LTOA 2O1VA 4LFCE 5DNLA 4DUYE 4AQYI 4OO1B 4JI4I 3P06A 5FLXC 4MQYA 2UUAI 3PS3A 4DR7I 4B3TE 5LL6R 5DRPA 4KHPI 2UXCI 1Y6ZA 3B8HA 3U1YA 4LF9I 2GO3A 4FW6A 4DR7E 5JEAB 4DPWA 5A2QQ 1N0VC 3QT7A 4EMDA 1EI1A 2GQ0A 1FI4A 4MU4A 1FWLA 4JYAI 4OKGA 4DV7E 4LF9E 4OO1C 1MX0A 2PNZB 2HHHI 4GKKI 2VQFI 2UXBI 2PNLA 4JYAE 1OYSA 2WP8B 4ZVIA 4DR6I 2PO2B 4P7AA 5EL9A 1USUA 3H4LA 5K36E 3KRNA 2V2ZA 2O1TA 3PRYA 1A6FA 3M85D 2HHHE 4JV5I 2UXBE 2VQFE 1FNMA 2O1UA 3PYFA 1XNQI 4LF8E 3ZZUA 4IFDD 5JEAC 4IZJD 4XTJA 4IZKA 2HFUA 2BA0D 1N32I 4USKA 4FW9A 2V2VA 3OTOE 2C38B 4FN5A 4GQUA 4DV1I 4DR5I 4JI0E 1XMOI 5DROA 2A2DA 4DU7A 3GMEA 5K36A 1N32E 4YY3I 2GO4A 1Y60A 3PS2A 4DV1E 4FW3A 1XMOE 1RHYA 1NZ0A 5C0XD 2J7KA 2JE6A 3M85G 1N36I 2WW4A 1Z0BA 4JG4A 5DRQA 1H7UA 4LF4I 2Z5CA 2UXDI 3K17A 2BA1G 2BA0G 1XXEA 1HR0E 3CDJA 3Q6NA 1HNXI 3H1CA 4USMA 1Z0GA 4LF4E 3T1YE 2NN6A 1Z0VA 4IFDB 1IBKE 3QT6A 2PO1A 4IZJB 4WUDA 1FJGI 4HY1A 2XEXA 1HNZI 2VF3A 1HNWI 2ZITA 5FWKA 5EKWA 4X64E 4BA2A 3J7AM 3LNUA 1Y5YA 2C39B 2HKEA 2BM0A 3M6AA 4BA1A 3V2UC 2OI2A 3WU4A 5IT9Q 1ZM2A 3V5RA 1HNWE 2WNRB 3P3EA 1YHCA 1R6LA 1Z0TA 3Q1QA 1UDQA 2HK2A 2UUBE 4LF6I 4MU0A 2JEBA 5C0XB 2Z5BA 1PVGA 4DPYA 1UDSA 4OZEA 4LFAE 4DV2I 4NXME 4OO1F 5C0XF 4DV5I 2F1DA 3P3GA 4IFDC 1Y4UA 3GLLA 4FW5A 3JAMC 4LF6E 3CDIA 4J3DA 5BR8I 4DUZE 1PKPA 2Q2EB 2VQEI 3B78A 1RREA 4DV2E 4DV5E 4DV7I 4MDTA 4I3HA 4LCHA 2BR2A 2DEIA 3WU6A 1S16A 2O1WA 5FLXQ 1N33I 5JEAF 2V34A 5BR8E 1XMQE 2VQEE 4MU3A 3B4TA 4FWGA 3P76A 5C0XC 4ISAA 2IOPA 3GONA 1U2RA 4LPFA 4AM3A 4B3RI 1N33E 2J65A 1UDOA 1ZM4A 3WU5A 4DR1E 4LF8I 4P52A 5K36D 3L7ZA 1YH8A 3OTOI 4JI0I 5LMUI 4B3RE 4AIDA 4QNKA 4DV3E 4HACA 2V2QA 2IOQA 3K85A 1H7SA 3ZKDA 4K0KE 2A2CA 2E1RA 4X62E 5LMUE 4DPTA 1E3HA 4YHHI 1PIEA 2R42A 2IERA 3GCMA 1KIJA 4U3BA 2CGEA 5DNXA 1FWKA 3F0NA 2GS8A 4HYMA 3U1KA 2HK3A 2NN6D 4JI7I 1HR0I 4IZKB 3PS1A 4YHHE 4JI3I 1KTVA 4NXNE 2BV3A 4FWDA 4B3MI 3T1YI 1R6MA 1UEKA 1MG7A 1IBKI 4JI7E 4Z7CA 4U3DA 5K36B 1XNRI 4JI3E 2C37A 2JEAA 4X64I 4PRVA 4N3OA 3J81C 4B3ME 4JI6I 1IBMI 2JT2A 1P42A 1RR9A 2X7IA 3J80C 4AIMA 4OO1E 1Z59A 5C0XE 2JE6B 4IFDF 1XNRE 1NHIA 2Z5CB 4X65I 4JI6E 1IBME 2UUBI 1D6TA 5GMDA 1K47A 2PO0A 1B62A 3M7ND 4LFAI 2EFGA 4NXMI 4DR4I 3J80Q 1KKHA 3PYGA 4URLA 4DR2E 4X65E 2NN6B 5JEAE 5K36C 3J7AG 4OO1A 2PO1B 2LJPA 1XHKA 3PYDA 2DEJA 3ZZ0A 4DUZI 1EA6A 4DR4E 1J5EI 4BA2B 4QNJA 3K1JA 1ZXMA 4DV4I 4JI5E 2CG9A 1OJ4A 4KQVA 1MU5A 2R3VA 2BM1A 2UU9E 1H72C 4JI2I 4IS9A 4BA1B 1XMQI 4FWHA 4LFBI 1J5EE 5JEAA 3LPSA
chains in the Genus database with same CATH topology
5GMEA 1VISA 4DV4E 2Z5EA 1Z0EA 5A2QC 4B3SE 2Z5BB 4JI2E 1ZM3A 2ZM6E 4DR1I 1KVKA 1IBLE 3ZKBA 4LFBE 3JAMQ 1Z0CA 1N34I 4AQYE 4JI4E 4UTGA 4DV3I 2AJ4A 3CWVA 3D4JA 2UUAE 4KHPE 2NPFA 4M1KA 1ZXNA 3HJCA 5L3JA 4K0KI 1N34E 2UXCE 3T1HI 4X62I 2F4VI 4WUCA 2HFSA 1N0UA 1USVA 1Z5AA 3B82A 3WU3A 4DU8A 4HXZA 3T1HE 2F4VE 1NHHA 4OX9I 1H73A 1Z0WA 4NXNI 4GKKE 1DARA 4DV0I 4DPXA 4RPFA 4DR6E 4HACB 3PYEA 2ZBKB 1Z5CA 1ZM9A 4OX9E 4PU9A 1I94I 4JV5E 3QT8A 1XNQE 1Y4SA 4DR3I 4DV0E 1FKAE 1Z5BA 3Q6MA 1ELOA 4R1FA 3ZM7A 2V8PA 4DR5E 1I94E 2E5LI 4DR3E 4IZJA 4Z7YA 4JI1I 3QT5A 1BKNA 4MYUA 4YY3E 4MYTA 4JI8I 4DR2I 1B63A 2E5LE 1HK7A 3ZZTA 4JI1E 5LMNI 4LF7I 1QZRA 2PNMA 3J81Q 1N36E 4JI8E 2UXDE 5IT9C 4JI5I 1S4EA 5IWAI 4X66I 4GKJI 1HNXE 1NHJA 2UU9I 1WUUA 4WUBA 4LF5I 5LMNE 4LF7E 1H74A 4DV6I 2UUCI 4LFCI 4UT4A 3HULA 4ED4A 4DXLA 4DUYI 1FJGE 5IWAE 4DPUA 4X66E 4B3SI 2CZ9A 4PRXA 4GKJE 2ZM6I 1HNZE 2HKJA 4LF5E 1IBLI 2X36A 4B3TI 4DV6E 2UUCE 3LTOA 2O1VA 4LFCE 4DUYE 4AQYI 4JI4I 3P06A 5FLXC 2UUAI 4DR7I 4B3TE 5LL6R 4KHPI 2UXCI 1Y6ZA 3B8HA 4LF9I 4DR7E 4DPWA 5A2QQ 1N0VC 3QT7A 4EMDA 1EI1A 2GQ0A 1FI4A 1FWLA 4JYAI 4DV7E 4LF9E 1MX0A 2HHHI 4GKKI 2VQFI 2UXBI 2PNLA 4JYAE 4ZVIA 4DR6I 1USUA 4P7AA 3H4LA 2V2ZA 2O1TA 3PRYA 1A6FA 2HHHE 4JV5I 2UXBE 2VQFE 1FNMA 2O1UA 3PYFA 1XNQI 4LF8E 3ZZUA 4IZJD 4XTJA 4IZKA 2HFUA 1N32I 4USKA 4FW9A 2V2VA 3OTOE 4DV1I 4FN5A 4DR5I 4JI0E 1XMOI 2A2DA 4DU7A 1N32E 4YY3I 4DV1E 1XMOE 1NZ0A 2J7KA 1N36I 2WW4A 1Z0BA 4JG4A 1H7UA 4LF4I 2Z5CA 2UXDI 3K17A 1HR0E 1HNXI 3Q6NA 4USMA 1Z0GA 4LF4E 3T1YE 1Z0VA 1IBKE 3QT6A 4IZJB 4WUDA 1FJGI 4HY1A 2XEXA 1HNZI 2VF3A 1HNWI 2ZITA 5FWKA 4X64E 3J7AM 3LNUA 2HKEA 2BM0A 3M6AA 3V2UC 2OI2A 3WU4A 5IT9Q 1ZM2A 3V5RA 1HNWE 1Z0TA 3Q1QA 2HK2A 2UUBE 4LF6I 2Z5BA 1PVGA 4DPYA 4LFAE 4DV2I 4NXME 4DV5I 1Y4UA 3JAMC 4LF6E 5BR8I 4DUZE 4DV7I 1PKPA 2Q2EB 3B78A 1RREA 2VQEI 4DV2E 4DV5E 4I3HA 2DEIA 3WU6A 1S16A 2O1WA 5FLXQ 1N33I 2V34A 5BR8E 1XMQE 2VQEE 4FWGA 2IOPA 3GONA 1U2RA 4B3RI 1N33E 1ZM4A 3WU5A 4DR1E 4LF8I 4P52A 3OTOI 4JI0I 5LMUI 4B3RE 4DV3E 4HACA 2V2QA 2IOQA 3K85A 1H7SA 3ZKDA 4K0KE 2A2CA 2E1RA 4X62E 5LMUE 4DPTA 4YHHI 1PIEA 2R42A 1KIJA 2CGEA 1FWKA 3F0NA 2GS8A 4HYMA 2HK3A 4JI7I 1HR0I 4IZKB 4YHHE 4JI3I 1KTVA 4NXNE 2BV3A 4FWDA 4B3MI 3T1YI 1UEKA 1MG7A 1IBKI 4JI7E 4Z7CA 1XNRI 4JI3E 4X64I 4PRVA 4N3OA 3J81C 4B3ME 4JI6I 1IBMI 1RR9A 2X7IA 3J80C 1Z59A 1XNRE 1NHIA 2Z5CB 4X65I 4JI6E 1IBME 2UUBI 1D6TA 5GMDA 1K47A 1B62A 4LFAI 2EFGA 4NXMI 4DR4I 3J80Q 1KKHA 3PYGA 4URLA 4DR2E 4X65E 3J7AG 2LJPA 1XHKA 3PYDA 2DEJA 3ZZ0A 4DUZI 1EA6A 4DR4E 1J5EI 3K1JA 1ZXMA 4DV4I 4JI5E 2CG9A 1OJ4A 4KQVA 1MU5A 2R3VA 2BM1A 2UU9E 1H72C 4JI2I 1XMQI 4FWHA 4LFBI 1J5EE 3LPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GME A;  1VIS A;  4DV4 E;  1Z0E A;  5A2Q C;  4B3S E;  4JI2 E;  1ZM3 A;  2ZM6 E;  4DR1 I;  1KVK A;  1IBL E;  3ZKB A;  4LFB E;  3JAM Q;  1Z0C A;  1N34 I;  4AQY E;  4JI4 E;  4UTG A;  4DV3 I;  2AJ4 A;  3CWV A;  3D4J A;  2UUA E;  4KHP E;  2NPF A;  4M1K A;  1ZXN A;  5L3J A;  4K0K I;  1N34 E;  2UXC E;  3T1H I;  4X62 I;  2F4V I;  4WUC A;  2HFS A;  1N0U A;  1Z5A A;  3B82 A;  3WU3 A;  4DU8 A;  4HXZ A;  3T1H E;  2F4V E;  1NHH A;  4OX9 I;  1H73 A;  1Z0W A;  4NXN I;  4GKK E;  1DAR A;  4DV0 I;  4DPX A;  4RPF A;  4DR6 E;  4HAC B;  3PYE A;  2ZBK B;  1Z5C A;  1ZM9 A;  4OX9 E;  4PU9 A;  1I94 I;  4JV5 E;  3QT8 A;  1XNQ E;  4DR3 I;  4DV0 E;  1FKA E;  1Z5B A;  1ELO A;  4R1F A;  3ZM7 A;  2V8P A;  4DR5 E;  1I94 E;  2E5L I;  4DR3 E;  4Z7Y A;  4JI1 I;  3QT5 A;  1BKN A;  4MYU A;  4YY3 E;  4MYT A;  4JI8 I;  4DR2 I;  1B63 A;  2E5L E;  3ZZT A;  4JI1 E;  5LMN I;  4LF7 I;  1QZR A;  3J81 Q;  1N36 E;  4JI8 E;  2UXD E;  5IT9 C;  4JI5 I;  1S4E A;  5IWA I;  4X66 I;  4GKJ I;  1HNX E;  1NHJ A;  2UU9 I;  1WUU A;  4WUB A;  4LF5 I;  5LMN E;  4LF7 E;  1H74 A;  4DV6 I;  2UUC I;  4LFC I;  4UT4 A;  3HUL A;  4ED4 A;  4DXL A;  4DUY I;  1FJG E;  5IWA E;  4DPU A;  4X66 E;  4B3S I;  2CZ9 A;  4PRX A;  4GKJ E;  2ZM6 I;  1HNZ E;  2HKJ A;  4LF5 E;  1IBL I;  2X36 A;  4B3T I;  4DV6 E;  2UUC E;  3LTO A;  4LFC E;  4DUY E;  4AQY I;  4JI4 I;  5FLX C;  2UUA I;  4DR7 I;  4B3T E;  5LL6 R;  4KHP I;  2UXC I;  3B8H A;  4LF9 I;  4DR7 E;  4DPW A;  5A2Q Q;  1N0V C;  3QT7 A;  4EMD A;  1EI1 A;  1FI4 A;  1FWL A;  4JYA I;  4DV7 E;  4LF9 E;  1MX0 A;  2HHH I;  4GKK I;  2VQF I;  2UXB I;  4JYA E;  4ZVI A;  4DR6 I;  4P7A A;  3H4L A;  2V2Z A;  1A6F A;  2HHH E;  4JV5 I;  2UXB E;  2VQF E;  1FNM A;  3PYF A;  1XNQ I;  4LF8 E;  3ZZU A;  4XTJ A;  2HFU A;  1N32 I;  4USK A;  4FW9 A;  2V2V A;  3OTO E;  4DV1 I;  4FN5 A;  4DR5 I;  4JI0 E;  1XMO I;  2A2D A;  4DU7 A;  1N32 E;  4YY3 I;  4DV1 E;  1XMO E;  1NZ0 A;  2J7K A;  1N36 I;  2WW4 A;  1Z0B A;  4JG4 A;  1H7U A;  4LF4 I;  2UXD I;  3K17 A;  1HR0 E;  1HNX I;  4USM A;  1Z0G A;  4LF4 E;  3T1Y E;  1Z0V A;  1IBK E;  3QT6 A;  1FJG I;  4WUD A;  4HY1 A;  2XEX A;  1HNZ I;  2VF3 A;  1HNW I;  2ZIT A;  4X64 E;  3J7A M;  3LNU A;  2HKE A;  2BM0 A;  3M6A A;  3V2U C;  2OI2 A;  3WU4 A;  5IT9 Q;  1ZM2 A;  3V5R A;  1HNW E;  1Z0T A;  3Q1Q A;  2HK2 A;  2UUB E;  4LF6 I;  1PVG A;  4DPY A;  4LFA E;  4DV2 I;  4NXM E;  4DV5 I;  3JAM C;  4LF6 E;  5BR8 I;  4DUZ E;  1PKP A;  2Q2E B;  2VQE I;  3B78 A;  1RRE A;  4DV2 E;  4DV5 E;  4DV7 I;  4I3H A;  2DEI A;  3WU6 A;  1S16 A;  5FLX Q;  1N33 I;  2V34 A;  5BR8 E;  1XMQ E;  2VQE E;  4FWG A;  3GON A;  1U2R A;  4B3R I;  1N33 E;  1ZM4 A;  3WU5 A;  4DR1 E;  4LF8 I;  4P52 A;  3OTO I;  4JI0 I;  5LMU I;  4B3R E;  4DV3 E;  4HAC A;  2V2Q A;  1H7S A;  3ZKD A;  4K0K E;  2A2C A;  2E1R A;  4X62 E;  5LMU E;  4DPT A;  4YHH I;  1PIE A;  2R42 A;  1KIJ A;  1FWK A;  3F0N A;  2GS8 A;  4HYM A;  2HK3 A;  4JI7 I;  1HR0 I;  4YHH E;  4JI3 I;  1KTV A;  4NXN E;  2BV3 A;  4FWD A;  4B3M I;  3T1Y I;  1UEK A;  1MG7 A;  1IBK I;  4JI7 E;  4Z7C A;  1XNR I;  4JI3 E;  4X64 I;  4PRV A;  3J81 C;  4B3M E;  4JI6 I;  1IBM I;  1RR9 A;  2X7I A;  3J80 C;  1Z59 A;  1XNR E;  1NHI A;  4X65 I;  4JI6 E;  1IBM E;  2UUB I;  1D6T A;  5GMD A;  1K47 A;  1B62 A;  4LFA I;  2EFG A;  4NXM I;  4DR4 I;  3J80 Q;  1KKH A;  3PYG A;  4URL A;  4DR2 E;  4X65 E;  3J7A G;  2LJP A;  1XHK A;  3PYD A;  2DEJ A;  3ZZ0 A;  4DUZ I;  1EA6 A;  4DR4 E;  1J5E I;  3K1J A;  1ZXM A;  4DV4 I;  4JI5 E;  1OJ4 A;  4KQV A;  1MU5 A;  2R3V A;  2BM1 A;  2UU9 E;  1H72 C;  4JI2 I;  1XMQ I;  4FWH A;  4LFB I;  1J5E E;  3LPS A; 
#chains in the Genus database with same CATH topology
 5GME A;  1VIS A;  4NBQ A;  4DV4 E;  2Z5E A;  1Z0E A;  5A2Q C;  4B3S E;  3M7N G;  2JEB B;  2Z5B B;  4JI2 E;  1ZM3 A;  2ZM6 E;  4DR1 I;  1KVK A;  1IBL E;  3ZKB A;  2NN6 C;  4LFB E;  3JAM Q;  1Z0C A;  2PNZ A;  1OYP A;  1N34 I;  1E3P A;  4AQY E;  4JI4 E;  4UTG A;  3DD6 A;  2WP8 A;  4DV3 I;  2AJ4 A;  3CWV A;  2PO2 A;  3D4J A;  2UUA E;  4KHP E;  2BR2 B;  2NPF A;  4M1K A;  1ZXN A;  3HJC A;  5L3J A;  4K0K I;  1N34 E;  5DRR A;  2UXC E;  3P3C A;  3T1H I;  4X62 I;  2F4V I;  4WUC A;  2HFS A;  1N0U A;  1USV A;  1Z5A A;  3B82 A;  2C38 A;  3WU3 A;  4DU8 A;  4HXZ A;  3T1H E;  2CVE A;  2F4V E;  3UHM A;  1NHH A;  4OX9 I;  3L7Z B;  1H73 A;  1Z0W A;  4NXN I;  1VI7 A;  2VES A;  4GKK E;  1DAR A;  3HKM A;  1OYR A;  4DPX A;  4DV0 I;  4RPF A;  4DR6 E;  2BA1 D;  4HAC B;  1UDN A;  4IFD E;  3PYE A;  2ZBK B;  1Z5C A;  4FW4 A;  1ZM9 A;  4OX9 E;  4PU9 A;  1I94 I;  4JV5 E;  3QT8 A;  5ELW A;  1XNQ E;  1Y4S A;  4DR3 I;  4DV0 E;  1FKA E;  1Z5B A;  4MU1 A;  1ELO A;  3Q6M A;  4R1F A;  3ZM7 A;  2V8P A;  4DR5 E;  5K36 F;  1I94 E;  4FW7 A;  2NN6 E;  2E5L I;  4IFD A;  4DR3 E;  4IZJ A;  4Z7Y A;  4JI1 I;  4OO1 D;  3QT5 A;  2IES A;  1BKN A;  4MYU A;  4YY3 E;  4MYT A;  4JI8 I;  2AE8 A;  4DR2 I;  1B63 A;  2C39 A;  1HK7 A;  2E5L E;  3ZZT A;  4JI1 E;  4LCG A;  5LMN I;  4LF7 I;  2C37 B;  1QZR A;  2PNM A;  3J81 Q;  1N36 E;  2JEA B;  2WNR A;  4JI8 E;  3NZK A;  2UXD E;  5IT9 C;  5JEA D;  4JI5 I;  1S4E A;  5IWA I;  4X66 I;  4GKJ I;  1HNX E;  5C0X A;  1NHJ A;  2UU9 I;  1WUU A;  2NN6 F;  2O3Z A;  4WUB A;  4LF5 I;  5LMN E;  4LF7 E;  1H74 A;  4DV6 I;  4LCF A;  2UUC I;  4LFC I;  4UT4 A;  3HUL A;  4ED4 A;  4DXL A;  4DUY I;  1FJG E;  5IWA E;  4DPU A;  4X66 E;  4B3S I;  2CZ9 A;  4PRX A;  4GKJ E;  4LOM A;  2PO0 B;  2ZM6 I;  2HKJ A;  1HNZ E;  4LF5 E;  1IBL I;  2X36 A;  4B3T I;  4DV6 E;  2UUC E;  3LTO A;  2O1V A;  4LFC E;  5DNL A;  4DUY E;  4AQY I;  4OO1 B;  4JI4 I;  3P06 A;  5FLX C;  4MQY A;  2UUA I;  3PS3 A;  4DR7 I;  4B3T E;  5LL6 R;  5DRP A;  4KHP I;  2UXC I;  1Y6Z A;  3B8H A;  3U1Y A;  4LF9 I;  2GO3 A;  4FW6 A;  4DR7 E;  5JEA B;  4DPW A;  5A2Q Q;  1N0V C;  3QT7 A;  4EMD A;  1EI1 A;  2GQ0 A;  1FI4 A;  4MU4 A;  1FWL A;  4JYA I;  4OKG A;  4DV7 E;  4LF9 E;  4OO1 C;  1MX0 A;  2PNZ B;  2HHH I;  4GKK I;  2VQF I;  2UXB I;  2PNL A;  4JYA E;  1OYS A;  2WP8 B;  4ZVI A;  4DR6 I;  2PO2 B;  4P7A A;  5EL9 A;  1USU A;  3H4L A;  5K36 E;  3KRN A;  2V2Z A;  2O1T A;  3PRY A;  1A6F A;  3M85 D;  2HHH E;  4JV5 I;  2UXB E;  2VQF E;  1FNM A;  2O1U A;  3PYF A;  1XNQ I;  4LF8 E;  3ZZU A;  4IFD D;  5JEA C;  4IZJ D;  4XTJ A;  4IZK A;  2HFU A;  2BA0 D;  1N32 I;  4USK A;  4FW9 A;  2V2V A;  3OTO E;  2C38 B;  4FN5 A;  4GQU A;  4DV1 I;  4DR5 I;  4JI0 E;  1XMO I;  5DRO A;  2A2D A;  4DU7 A;  3GME A;  5K36 A;  1N32 E;  4YY3 I;  2GO4 A;  1Y60 A;  3PS2 A;  4DV1 E;  4FW3 A;  1XMO E;  1RHY A;  1NZ0 A;  5C0X D;  2J7K A;  2JE6 A;  3M85 G;  1N36 I;  2WW4 A;  1Z0B A;  4JG4 A;  5DRQ A;  1H7U A;  4LF4 I;  2Z5C A;  2UXD I;  3K17 A;  2BA1 G;  2BA0 G;  1XXE A;  1HR0 E;  3CDJ A;  3Q6N A;  1HNX I;  3H1C A;  4USM A;  1Z0G A;  4LF4 E;  3T1Y E;  2NN6 A;  1Z0V A;  4IFD B;  1IBK E;  3QT6 A;  2PO1 A;  4IZJ B;  4WUD A;  1FJG I;  4HY1 A;  2XEX A;  1HNZ I;  2VF3 A;  1HNW I;  2ZIT A;  5FWK A;  5EKW A;  4X64 E;  4BA2 A;  3J7A M;  3LNU A;  1Y5Y A;  2C39 B;  2HKE A;  2BM0 A;  3M6A A;  4BA1 A;  3V2U C;  2OI2 A;  3WU4 A;  5IT9 Q;  1ZM2 A;  3V5R A;  1HNW E;  2WNR B;  3P3E A;  1YHC A;  1R6L A;  1Z0T A;  3Q1Q A;  1UDQ A;  2HK2 A;  2UUB E;  4LF6 I;  4MU0 A;  2JEB A;  5C0X B;  2Z5B A;  1PVG A;  4DPY A;  1UDS A;  4OZE A;  4LFA E;  4DV2 I;  4NXM E;  4OO1 F;  5C0X F;  4DV5 I;  2F1D A;  3P3G A;  4IFD C;  1Y4U A;  3GLL A;  4FW5 A;  3JAM C;  4LF6 E;  3CDI A;  4J3D A;  5BR8 I;  4DUZ E;  1PKP A;  2Q2E B;  2VQE I;  3B78 A;  1RRE A;  4DV2 E;  4DV5 E;  4DV7 I;  4MDT A;  4I3H A;  4LCH A;  2BR2 A;  2DEI A;  3WU6 A;  1S16 A;  2O1W A;  5FLX Q;  1N33 I;  5JEA F;  2V34 A;  5BR8 E;  1XMQ E;  2VQE E;  4MU3 A;  3B4T A;  4FWG A;  3P76 A;  5C0X C;  4ISA A;  2IOP A;  3GON A;  1U2R A;  4LPF A;  4AM3 A;  4B3R I;  1N33 E;  2J65 A;  1UDO A;  1ZM4 A;  3WU5 A;  4DR1 E;  4LF8 I;  4P52 A;  5K36 D;  3L7Z A;  1YH8 A;  3OTO I;  4JI0 I;  5LMU I;  4B3R E;  4AID A;  4QNK A;  4DV3 E;  4HAC A;  2V2Q A;  2IOQ A;  3K85 A;  1H7S A;  3ZKD A;  4K0K E;  2A2C A;  2E1R A;  4X62 E;  5LMU E;  4DPT A;  1E3H A;  4YHH I;  1PIE A;  2R42 A;  2IER A;  3GCM A;  1KIJ A;  4U3B A;  2CGE A;  5DNX A;  1FWK A;  3F0N A;  2GS8 A;  4HYM A;  3U1K A;  2HK3 A;  2NN6 D;  4JI7 I;  1HR0 I;  4IZK B;  3PS1 A;  4YHH E;  4JI3 I;  1KTV A;  4NXN E;  2BV3 A;  4FWD A;  4B3M I;  3T1Y I;  1R6M A;  1UEK A;  1MG7 A;  1IBK I;  4JI7 E;  4Z7C A;  4U3D A;  5K36 B;  1XNR I;  4JI3 E;  2C37 A;  2JEA A;  4X64 I;  4PRV A;  4N3O A;  3J81 C;  4B3M E;  4JI6 I;  1IBM I;  2JT2 A;  1P42 A;  1RR9 A;  2X7I A;  3J80 C;  4AIM A;  4OO1 E;  1Z59 A;  5C0X E;  2JE6 B;  4IFD F;  1XNR E;  1NHI A;  2Z5C B;  4X65 I;  4JI6 E;  1IBM E;  2UUB I;  1D6T A;  5GMD A;  1K47 A;  2PO0 A;  1B62 A;  3M7N D;  4LFA I;  2EFG A;  4NXM I;  4DR4 I;  3J80 Q;  1KKH A;  3PYG A;  4URL A;  4DR2 E;  4X65 E;  2NN6 B;  5JEA E;  5K36 C;  3J7A G;  4OO1 A;  2PO1 B;  2LJP A;  1XHK A;  3PYD A;  2DEJ A;  3ZZ0 A;  4DUZ I;  1EA6 A;  4DR4 E;  1J5E I;  4BA2 B;  4QNJ A;  3K1J A;  1ZXM A;  4DV4 I;  4JI5 E;  2CG9 A;  1OJ4 A;  4KQV A;  1MU5 A;  2R3V A;  2BM1 A;  2UU9 E;  1H72 C;  4JI2 I;  4IS9 A;  4BA1 B;  1XMQ I;  4FWH A;  4LFB I;  1J5E E;  5JEA A;  3LPS A; 
#chains in the Genus database with same CATH homology
 5GME A;  1VIS A;  4DV4 E;  2Z5E A;  1Z0E A;  5A2Q C;  4B3S E;  2Z5B B;  4JI2 E;  1ZM3 A;  2ZM6 E;  4DR1 I;  1KVK A;  1IBL E;  3ZKB A;  4LFB E;  3JAM Q;  1Z0C A;  1N34 I;  4AQY E;  4JI4 E;  4UTG A;  4DV3 I;  2AJ4 A;  3CWV A;  3D4J A;  2UUA E;  4KHP E;  2NPF A;  4M1K A;  1ZXN A;  3HJC A;  5L3J A;  4K0K I;  1N34 E;  2UXC E;  3T1H I;  4X62 I;  2F4V I;  4WUC A;  2HFS A;  1N0U A;  1USV A;  1Z5A A;  3B82 A;  3WU3 A;  4DU8 A;  4HXZ A;  3T1H E;  2F4V E;  1NHH A;  4OX9 I;  1H73 A;  1Z0W A;  4NXN I;  4GKK E;  1DAR A;  4DV0 I;  4DPX A;  4RPF A;  4DR6 E;  4HAC B;  3PYE A;  2ZBK B;  1Z5C A;  1ZM9 A;  4OX9 E;  4PU9 A;  1I94 I;  4JV5 E;  3QT8 A;  1XNQ E;  1Y4S A;  4DR3 I;  4DV0 E;  1FKA E;  1Z5B A;  3Q6M A;  1ELO A;  4R1F A;  3ZM7 A;  2V8P A;  4DR5 E;  1I94 E;  2E5L I;  4DR3 E;  4IZJ A;  4Z7Y A;  4JI1 I;  3QT5 A;  1BKN A;  4MYU A;  4YY3 E;  4MYT A;  4JI8 I;  4DR2 I;  1B63 A;  2E5L E;  1HK7 A;  3ZZT A;  4JI1 E;  5LMN I;  4LF7 I;  1QZR A;  2PNM A;  3J81 Q;  1N36 E;  4JI8 E;  2UXD E;  5IT9 C;  4JI5 I;  1S4E A;  5IWA I;  4X66 I;  4GKJ I;  1HNX E;  1NHJ A;  2UU9 I;  1WUU A;  4WUB A;  4LF5 I;  5LMN E;  4LF7 E;  1H74 A;  4DV6 I;  2UUC I;  4LFC I;  4UT4 A;  3HUL A;  4ED4 A;  4DXL A;  4DUY I;  1FJG E;  5IWA E;  4DPU A;  4X66 E;  4B3S I;  2CZ9 A;  4PRX A;  4GKJ E;  2ZM6 I;  1HNZ E;  2HKJ A;  4LF5 E;  1IBL I;  2X36 A;  4B3T I;  4DV6 E;  2UUC E;  3LTO A;  2O1V A;  4LFC E;  4DUY E;  4AQY I;  4JI4 I;  3P06 A;  5FLX C;  2UUA I;  4DR7 I;  4B3T E;  5LL6 R;  4KHP I;  2UXC I;  1Y6Z A;  3B8H A;  4LF9 I;  4DR7 E;  4DPW A;  5A2Q Q;  1N0V C;  3QT7 A;  4EMD A;  1EI1 A;  2GQ0 A;  1FI4 A;  1FWL A;  4JYA I;  4DV7 E;  4LF9 E;  1MX0 A;  2HHH I;  4GKK I;  2VQF I;  2UXB I;  2PNL A;  4JYA E;  4ZVI A;  4DR6 I;  1USU A;  4P7A A;  3H4L A;  2V2Z A;  2O1T A;  3PRY A;  1A6F A;  2HHH E;  4JV5 I;  2UXB E;  2VQF E;  1FNM A;  2O1U A;  3PYF A;  1XNQ I;  4LF8 E;  3ZZU A;  4IZJ D;  4XTJ A;  4IZK A;  2HFU A;  1N32 I;  4USK A;  4FW9 A;  2V2V A;  3OTO E;  4DV1 I;  4FN5 A;  4DR5 I;  4JI0 E;  1XMO I;  2A2D A;  4DU7 A;  1N32 E;  4YY3 I;  4DV1 E;  1XMO E;  1NZ0 A;  2J7K A;  1N36 I;  2WW4 A;  1Z0B A;  4JG4 A;  1H7U A;  4LF4 I;  2Z5C A;  2UXD I;  3K17 A;  1HR0 E;  1HNX I;  3Q6N A;  4USM A;  1Z0G A;  4LF4 E;  3T1Y E;  1Z0V A;  1IBK E;  3QT6 A;  4IZJ B;  4WUD A;  1FJG I;  4HY1 A;  2XEX A;  1HNZ I;  2VF3 A;  1HNW I;  2ZIT A;  5FWK A;  4X64 E;  3J7A M;  3LNU A;  2HKE A;  2BM0 A;  3M6A A;  3V2U C;  2OI2 A;  3WU4 A;  5IT9 Q;  1ZM2 A;  3V5R A;  1HNW E;  1Z0T A;  3Q1Q A;  2HK2 A;  2UUB E;  4LF6 I;  2Z5B A;  1PVG A;  4DPY A;  4LFA E;  4DV2 I;  4NXM E;  4DV5 I;  1Y4U A;  3JAM C;  4LF6 E;  5BR8 I;  4DUZ E;  4DV7 I;  1PKP A;  2Q2E B;  3B78 A;  1RRE A;  2VQE I;  4DV2 E;  4DV5 E;  4I3H A;  2DEI A;  3WU6 A;  1S16 A;  2O1W A;  5FLX Q;  1N33 I;  2V34 A;  5BR8 E;  1XMQ E;  2VQE E;  4FWG A;  2IOP A;  3GON A;  1U2R A;  4B3R I;  1N33 E;  1ZM4 A;  3WU5 A;  4DR1 E;  4LF8 I;  4P52 A;  3OTO I;  4JI0 I;  5LMU I;  4B3R E;  4DV3 E;  4HAC A;  2V2Q A;  2IOQ A;  3K85 A;  1H7S A;  3ZKD A;  4K0K E;  2A2C A;  2E1R A;  4X62 E;  5LMU E;  4DPT A;  4YHH I;  1PIE A;  2R42 A;  1KIJ A;  2CGE A;  1FWK A;  3F0N A;  2GS8 A;  4HYM A;  2HK3 A;  4JI7 I;  1HR0 I;  4IZK B;  4YHH E;  4JI3 I;  1KTV A;  4NXN E;  2BV3 A;  4FWD A;  4B3M I;  3T1Y I;  1UEK A;  1MG7 A;  1IBK I;  4JI7 E;  4Z7C A;  1XNR I;  4JI3 E;  4X64 I;  4PRV A;  4N3O A;  3J81 C;  4B3M E;  4JI6 I;  1IBM I;  1RR9 A;  2X7I A;  3J80 C;  1Z59 A;  1XNR E;  1NHI A;  2Z5C B;  4X65 I;  4JI6 E;  1IBM E;  2UUB I;  1D6T A;  5GMD A;  1K47 A;  1B62 A;  4LFA I;  2EFG A;  4NXM I;  4DR4 I;  3J80 Q;  1KKH A;  3PYG A;  4URL A;  4DR2 E;  4X65 E;  3J7A G;  2LJP A;  1XHK A;  3PYD A;  2DEJ A;  3ZZ0 A;  4DUZ I;  1EA6 A;  4DR4 E;  1J5E I;  3K1J A;  1ZXM A;  4DV4 I;  4JI5 E;  2CG9 A;  1OJ4 A;  4KQV A;  1MU5 A;  2R3V A;  2BM1 A;  2UU9 E;  1H72 C;  4JI2 I;  1XMQ I;  4FWH A;  4LFB I;  1J5E E;  3LPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...