4DV0I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv0I00
3V2UC 2Q2EB 4XTJA 1FWKA 2V2QA 4USMA 4DV1E 4JI4E 1ZM4A 4YHHE 4HYMA 3D4JA 2UUAE 1I94E 3B78A 1Z0CA 1QZRA 2E5LE 1N34I 1DARA 2A2DA 2UU9I 4LF8I 4M1KA 2HHHE 1RR9A 1MU5A 4B3TE 4JI8I 4LF7E 1XNRI 3PYGA 3Q1QA 4DR7E 1RREA 5LMUE 2UUCE 5BR8I 4DV7I 4PU9A 2UXBE 4KHPI 2XEXA 3JAMQ 4JI0E 4JYAI 4USKA 1Z0EA 4DV5E 1KVKA 1H7UA 1Z0GA 4X66E 4LFBI 3J80C 1NHIA 3M6AA 1Z0VA 4DV0E 2BM0A 1HNZE 4DV3E 4AQYE 4JI1E 4KQVA 4DV2E 4LF5I 2BM1A 3OTOI 2GS8A 2V2VA 5IWAE 1XMQI 4JI5I 1Z5AA 4DPXA 4URLA 4JI6I 2BV3A 1IBKE 3V5RA 1KKHA 3ZZTA 4DR6I 2HK3A 2ZITA 4X64E 2HFUA 5FLXQ 4EMDA 2F4VI 2NPFA 1ZM2A 4JV5I 2R42A 1N0UA 4X65E 3K17A 2UUBI 1XMOI 3JAMC 4DR4I 4FWDA 1PIEA 1FJGI 4WUCA 3T1YE 4NXNE 4HY1A 3WU6A 5LMNE 4YY3E 3PYEA 4B3SE 4LF6I 4I3HA 1ZXNA 2ZM6I 1HR0E 1B63A 4JI1I 4FN5A 4DV6E 1MX0A 4JI7I 2HKEA 4DR5I 4B3MI 1N33I 1PKPA 1FKAE 1FWLA 1XNQI 4DPYA 4GKKE 4K0KI 2R3VA 3J7AM 1FNMA 3ZZUA 4ZVIA 1NHJA 4LFAI 2UXCI 5FLXC 1IBME 5A2QQ 4JI3E 3QT8A 3HULA 1ZXMA 4DV4E 4DUYE 3PYDA 2VQFE 4B3RI 4DR3E 1N36E 2X36A 4OX9I 4DR2E 4DXLA 1Z59A 4JI2I 3F0NA 4UT4A 1N32I 3GONA 2UXDE 4MYTA 4DUZI 4LFCE 4GKJE 4LF9I 4FWGA 3LPSA 4ED4A 4P7AA 4HACA 3ZZ0A 4DV1I 4JI4I 4YHHI 4LF4E 4Z7CA 1PVGA 2UUAI 1NHHA 1I94I 2V8PA 2E5LI 4FWHA 4X62E 2HHHI 3T1HE 3WU4A 4NXME 2LJPA 1S4EA 4B3TI 1H72C 1U2RA 1HNWE 2E1RA 2DEJA 4DPTA 4LF7I 2J7KA 1IBMI 4DR7I 3J81Q 5LMUI 4HACB 2UUCI 1EI1A 2UXBI 4JI0I 1N34E 1BKNA 5A2QC 4DV5I 2UU9E 4LF8E 1VISA 1D6TA 1Z0TA 1Z0BA 4X66I 1H73A 1B62A 2V34A 1FI4A 1N0VC 4JI8E 4DV0I 3LNUA 4DU8A 4LFCI 4RPFA 1HNZI 5GMDA 3QT5A 3LTOA 5BR8E 4DV3I 4AQYI 4DV7E 1H7SA 4KHPE 4JYAE 1WUUA 3B8HA 2A2CA 4DV2I 1OJ4A 4Z7YA 5IWAI 4LFBE 3H4LA 5LL6R 2OI2A 3PYFA 3B82A 1IBKI 4X64I 2V2ZA 1EA6A 4FW9A 4HXZA 4DPUA 1IBLE 4LF5E 4X65I 3OTOE 3J81C 1XMQE 4JI5E 5IT9Q 2HK2A 1Z0WA 4JI6E 2DEIA 4WUBA 3T1YI 4NXNI 2HFSA 2VQEE 4DR6E 1ZM3A 3ZKBA 2AJ4A 2F4VE 1HNXE 3WU5A 4DU7A 5LMNI 4YY3I 4JV5E 2WW4A 4R1FA 4B3SI 1NZ0A 4DR1E 1HR0I 2CZ9A 4MYUA 4JG4A 4DV6I 2UUBE 1A6FA 1XMOE 1J5EE 4DR4E 1FJGE 1H74A 2HKJA 1XHKA 4GKKI 1K47A 3WU3A 1ZM9A 4PRVA 3QT6A 4P52A 4LF6E 2ZM6E 5L3JA 2EFGA 1S16A 1IBLI 4JI7E 4DR5E 4JI3I 1ELOA 4B3ME 1N33E 4WUDA 4DV4I 4DUYI 5GMEA 2VQFI 4DR3I 1N36I 1XNQE 3CWVA 3K1JA 4DR2I 4K0KE 2VQEI 5IT9C 4PRXA 2VF3A 1HNXI 1XNRE 1UEKA 2UXDI 4GKJI 1MG7A 4LFAE 2UXCE 4DR1I 1Z5CA 2X7IA 4UTGA 4LF4I 1J5EI 1Z5BA 3J80Q 1KTVA 3QT7A 4B3RE 3J7AG 4OX9E 3ZM7A 4DPWA 4JI2E 4X62I 1N32E 3T1HI 3ZKDA 4NXMI 2ZBKB 4DUZE 1KIJA 1HNWI 4LF9E
chains in the Genus database with same CATH superfamily
3V2UC 2Q2EB 4NBQA 1OYRA 4XTJA 1FWKA 2V2QA 1Y4UA 4USMA 4DV1E 4JI4E 1ZM4A 4YHHE 4AIDA 4HYMA 3D4JA 2JEAA 2PNMA 2UUAE 2WP8B 1I94E 4ISAA 3B78A 1Z0CA 1QZRA 2E5LE 4IFDD 1N34I 1DARA 3P3CA 2A2DA 2UU9I 2Z5CB 2PO0B 4LF8I 4M1KA 3KRNA 2HHHE 1RR9A 1YH8A 1YHCA 4FW3A 2GO4A 1MU5A 4IZJD 4B3TE 1VI7A 4JI8I 4LF7E 1XNRI 3PYGA 2C37B 2JT2A 3Q1QA 4DR7E 1RREA 5C0XC 5JEAB 5LMUE 2UUCE 1UDSA 5DRPA 5BR8I 4DV7I 4PU9A 2UXBE 3L7ZB 4KHPI 2XEXA 3JAMQ 4JI0E 4N3OA 4JYAI 4USKA 1Z0EA 4DV5E 1KVKA 1H7UA 3UHMA 4OO1C 1Y5YA 1Z0GA 2F1DA 4X66E 2IESA 4LFBI 3J80C 2J65A 1NHIA 3M6AA 4BA1B 2NN6D 1Z0VA 4DV0E 2BM0A 1HNZE 3Q6NA 2CVEA 2NN6F 4DV3E 4AQYE 1USUA 4JI1E 4KQVA 5EKWA 4DV2E 4LF5I 2BM1A 4FW6A 3OTOI 2BR2A 2GS8A 2V2VA 5IWAE 3U1YA 1XMQI 4JI5I 1Z5AA 2O1UA 4DPXA 4URLA 4JI6I 2BV3A 3PRYA 1IBKE 3V5RA 1KKHA 3ZZTA 4MU0A 4DR6I 1Y6ZA 4IS9A 2GO3A 2HK3A 2ZITA 2HFUA 4X64E 4EMDA 5FLXQ 2NPFA 2F4VI 1ZM2A 4JV5I 2R42A 1N0UA 1UDOA 4X65E 3K17A 2C38A 2O1WA 2UUBI 5JEAD 1XMOI 3JAMC 4DR4I 1E3HA 4FWDA 1PIEA 1FJGI 4WUCA 5C0XE 3T1YE 4NXNE 2Z5BA 4HY1A 2VESA 5JEAF 3WU6A 5LMNE 2AE8A 2C39A 4YY3E 4OO1E 3PYEA 4B3SE 4LF6I 4I3HA 1ZXNA 2ZM6I 1HR0E 1B63A 4JI1I 4FN5A 3M7ND 2PNZA 2PO1A 4DV6E 5K36A 1MX0A 4JI7I 2HKEA 4DR5I 4GQUA 4B3MI 2C38B 1N33I 1PKPA 3P76A 3CDIA 1FKAE 1FWLA 1XNQI 4DPYA 4GKKE 2Z5BB 3PS2A 4K0KI 2R3VA 3J7AM 1FNMA 2IOQA 3ZZUA 4ZVIA 1NHJA 4IFDF 2JEBA 4LFAI 2UXCI 5FLXC 1IBME 3CDJA 5A2QQ 4JI3E 3QT8A 3HULA 2PNZB 2PO1B 5K36B 2IOPA 1ZXMA 2BA0D 4DV4E 4DUYE 3PYDA 2JEAB 2VQFE 4B3RI 4DR3E 1N36E 4IFDC 2X36A 4OX9I 4DR2E 4DXLA 5C0XA 1Z59A 1Y60A 4JI2I 3F0NA 2PO2A 4UT4A 1N32I 4J3DA 3GONA 4MU1A 2UXDE 4MYTA 4DUZI 4LFCE 4GKJE 4OO1A 4LF9I 2JEBB 4FWGA 2CG9A 3LPSA 4ED4A 4P7AA 4HACA 3ZZ0A 4DV1I 4JI4I 4YHHI 4LF4E 4IZJA 4FW7A 5K36E 4Z7CA 1PVGA 2UUAI 1NHHA 1I94I 2V8PA 4FWHA 2E5LI 4X62E 2HHHI 5C0XB 3T1HE 3WU4A 2NN6C 4NXME 2LJPA 1S4EA 4B3TI 1H72C 1U2RA 1HNWE 2E1RA 3P06A 3M85G 4U3BA 2DEJA 4DPTA 2PNLA 4LF7I 4OO1B 4MQYA 4FW4A 2J7KA 1IBMI 3NZKA 4DR7I 3J81Q 5LMUI 4HACB 3M85D 2UUCI 3GMEA 1EI1A 1Y4SA 2UXBI 4JI0I 1N34E 1BKNA 2CGEA 1R6LA 5A2QC 4DV5I 2UU9E 4LF8E 1VISA 1D6TA 1Z0TA 1Z0BA 2BR2B 3HKMA 4X66I 5K36D 1OYSA 1H73A 1USVA 4MU3A 1B62A 1UDQA 2V34A 1FI4A 1N0VC 4JI8E 4DV0I 3LNUA 4DU8A 4AIMA 4LFCI 4RPFA 4IZKA 1HNZI 5DRRA 3PS1A 4OZEA 1R6MA 3M7NG 5GMDA 3QT5A 3LTOA 5BR8E 4MU4A 2IERA 3Q6MA 4DV3I 2WP8A 1H7SA 4DV7E 4AQYI 2WNRA 4KHPE 4JYAE 1WUUA 3H1CA 3B8HA 2A2CA 4DV2I 1OJ4A 4Z7YA 5JEAC 5IWAI 4LFBE 4BA2A 3DD6A 3H4LA 5LL6R 2OI2A 3PYFA 3B82A 2C37A 1IBKI 4QNJA 5JEAA 4IZKB 4X64I 5C0XD 2C39B 2JE6A 2V2ZA 3B4TA 3U1KA 2O3ZA 1EA6A 3L7ZA 4FW9A 4MDTA 4HXZA 2BA0G 4LOMA 5DRQA 4DPUA 1IBLE 4X65I 4LF5E 2WNRB 3OTOE 2NN6E 3J81C 4OO1D 5C0XF 1XMQE 4JI5E 2BA1G 5IT9Q 2HK2A 3P3GA 4BA2B 4BA1A 4FW5A 1Z0WA 3P3EA 2DEIA 4JI6E 4WUBA 1OYPA 4NXNI 3T1YI 2HFSA 4OO1F 2VQEE 2BA1D 4DR6E 1ZM3A 3ZKBA 5ELWA 4LCFA 2AJ4A 4LCHA 2F4VE 1HNXE 3GLLA 3WU5A 4DU7A 5LMNI 4YY3I 4JV5E 2WW4A 4R1FA 4IFDA 4B3SI 2JE6B 1NZ0A 4DR1E 1HR0I 2CZ9A 4MYUA 4JG4A 4DV6I 1HK7A 2UUBE 1A6FA 1XMOE 1J5EE 4DR4E 1FJGE 1E3PA 1H74A 2HKJA 3PS3A 1XHKA 4GKKI 1K47A 3WU3A 1ZM9A 4PRVA 2PO2B 3QT6A 4P52A 4LF6E 2ZM6E 5L3JA 5JEAE 2EFGA 4IFDB 1S16A 1IBLI 2O1TA 3GCMA 4JI7E 4DR5E 4JI3I 1ELOA 2NN6A 3HJCA 4B3ME 1N33E 2O1VA 5FWKA 4WUDA 4DV4I 4IZJB 4DUYI 4LPFA 5GMEA 1UDNA 2VQFI 4DR3I 1N36I 1XNQE 3CWVA 3K1JA 4U3DA 4DR2I 4K0KE 2GQ0A 3K85A 2VQEI 5IT9C 1RHYA 4PRXA 2VF3A 4QNKA 1HNXI 4AM3A 1XNRE 1UEKA 2UXDI 4GKJI 1MG7A 4LFAE 2UXCE 4DR1I 5K36F 4IFDE 1Z5CA 5DNXA 2X7IA 4UTGA 4LF4I 1J5EI 1Z5BA 3J80Q 1KTVA 2NN6B 3QT7A 4LCGA 4B3RE 2Z5CA 2PO0A 3J7AG 4OX9E 3ZM7A 4DPWA 5DNLA 1P42A 5DROA 4JI2E 5K36C 4X62I 1N32E 1XXEA 3T1HI 3ZKDA 4NXMI 2ZBKB 4DUZE 1KIJA 1HNWI 2Z5EA 4LF9E 5EL9A 4OKGA
chains in the Genus database with same CATH topology
3V2UC 2Q2EB 4XTJA 1FWKA 2V2QA 1Y4UA 4USMA 4DV1E 4JI4E 1ZM4A 4YHHE 4HYMA 3D4JA 2PNMA 2UUAE 1I94E 3B78A 1Z0CA 1QZRA 2E5LE 1N34I 1DARA 2A2DA 2UU9I 2Z5CB 4LF8I 4M1KA 2HHHE 1RR9A 1MU5A 4IZJD 4B3TE 4JI8I 4LF7E 1XNRI 3PYGA 3Q1QA 4DR7E 1RREA 5LMUE 2UUCE 5BR8I 4DV7I 4PU9A 2UXBE 4KHPI 2XEXA 3JAMQ 4JI0E 4N3OA 4JYAI 4USKA 1Z0EA 4DV5E 1KVKA 1H7UA 1Z0GA 4X66E 4LFBI 3J80C 1NHIA 3M6AA 1Z0VA 4DV0E 2BM0A 1HNZE 3Q6NA 4DV3E 4AQYE 1USUA 4JI1E 4KQVA 4DV2E 4LF5I 2BM1A 3OTOI 2GS8A 2V2VA 5IWAE 1XMQI 4JI5I 1Z5AA 2O1UA 4DPXA 4URLA 4JI6I 2BV3A 3PRYA 1IBKE 3V5RA 1KKHA 3ZZTA 4DR6I 1Y6ZA 2HK3A 2ZITA 4X64E 2HFUA 5FLXQ 4EMDA 2F4VI 2NPFA 1ZM2A 4JV5I 2R42A 1N0UA 4X65E 3K17A 2O1WA 2UUBI 1XMOI 3JAMC 4DR4I 4FWDA 1PIEA 1FJGI 4WUCA 3T1YE 4NXNE 2Z5BA 4HY1A 3WU6A 5LMNE 4YY3E 3PYEA 4B3SE 4LF6I 4I3HA 1ZXNA 2ZM6I 1HR0E 1B63A 4JI1I 4FN5A 4DV6E 1MX0A 4JI7I 2HKEA 4DR5I 4B3MI 1N33I 1PKPA 1FKAE 1FWLA 1XNQI 4DPYA 4GKKE 2Z5BB 4K0KI 2R3VA 3J7AM 1FNMA 2IOQA 3ZZUA 4ZVIA 1NHJA 4LFAI 2UXCI 5FLXC 1IBME 5A2QQ 4JI3E 3QT8A 3HULA 2IOPA 1ZXMA 4DV4E 4DUYE 3PYDA 2VQFE 4B3RI 4DR3E 1N36E 2X36A 4OX9I 4DR2E 4DXLA 1Z59A 4JI2I 3F0NA 4UT4A 1N32I 3GONA 2UXDE 4MYTA 4DUZI 4LFCE 4GKJE 4LF9I 4FWGA 2CG9A 3LPSA 4ED4A 4P7AA 4HACA 3ZZ0A 4DV1I 4JI4I 4YHHI 4LF4E 4IZJA 4Z7CA 1PVGA 2UUAI 1NHHA 1I94I 2V8PA 4FWHA 2E5LI 4X62E 2HHHI 3T1HE 3WU4A 4NXME 2LJPA 1S4EA 4B3TI 1H72C 1U2RA 1HNWE 2E1RA 3P06A 2DEJA 4DPTA 2PNLA 4LF7I 2J7KA 1IBMI 4DR7I 3J81Q 5LMUI 4HACB 2UUCI 1EI1A 1Y4SA 2UXBI 4JI0I 1N34E 1BKNA 2CGEA 5A2QC 4DV5I 2UU9E 4LF8E 1VISA 1D6TA 1Z0TA 1Z0BA 4X66I 1H73A 1USVA 1B62A 2V34A 1FI4A 1N0VC 4JI8E 4DV0I 3LNUA 4DU8A 4LFCI 4RPFA 4IZKA 1HNZI 5GMDA 3QT5A 3LTOA 5BR8E 3Q6MA 4DV3I 4AQYI 4DV7E 1H7SA 4KHPE 4JYAE 1WUUA 3B8HA 2A2CA 4DV2I 1OJ4A 4Z7YA 5IWAI 4LFBE 3H4LA 5LL6R 2OI2A 3PYFA 3B82A 1IBKI 4IZKB 4X64I 2V2ZA 1EA6A 4FW9A 4HXZA 4DPUA 1IBLE 4LF5E 4X65I 3OTOE 3J81C 1XMQE 4JI5E 5IT9Q 2HK2A 1Z0WA 4JI6E 2DEIA 4WUBA 3T1YI 4NXNI 2HFSA 2VQEE 4DR6E 1ZM3A 3ZKBA 2AJ4A 2F4VE 1HNXE 3WU5A 4DU7A 5LMNI 4YY3I 4JV5E 2WW4A 4R1FA 4B3SI 1NZ0A 4DR1E 1HR0I 2CZ9A 4MYUA 4JG4A 4DV6I 1HK7A 2UUBE 1A6FA 1XMOE 1J5EE 4DR4E 1FJGE 1H74A 2HKJA 1XHKA 4GKKI 1K47A 3WU3A 1ZM9A 4PRVA 3QT6A 4P52A 4LF6E 2ZM6E 5L3JA 2EFGA 1S16A 1IBLI 2O1TA 4JI7E 4DR5E 4JI3I 1ELOA 4B3ME 3HJCA 1N33E 2O1VA 5FWKA 4WUDA 4DV4I 4IZJB 4DUYI 5GMEA 2VQFI 4DR3I 1N36I 1XNQE 3CWVA 3K1JA 4DR2I 4K0KE 2GQ0A 3K85A 2VQEI 5IT9C 4PRXA 2VF3A 1HNXI 1XNRE 1UEKA 2UXDI 4GKJI 1MG7A 4LFAE 2UXCE 4DR1I 1Z5CA 2X7IA 4UTGA 4LF4I 1J5EI 1Z5BA 3J80Q 1KTVA 3QT7A 4B3RE 2Z5CA 3J7AG 4OX9E 3ZM7A 4DPWA 4JI2E 4X62I 1N32E 3T1HI 3ZKDA 4NXMI 2ZBKB 4DUZE 1KIJA 1HNWI 2Z5EA 4LF9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2U C;  2Q2E B;  4XTJ A;  1FWK A;  2V2Q A;  4USM A;  4DV1 E;  4JI4 E;  1ZM4 A;  4YHH E;  4HYM A;  3D4J A;  2UUA E;  1I94 E;  3B78 A;  1Z0C A;  1QZR A;  2E5L E;  1N34 I;  1DAR A;  2A2D A;  2UU9 I;  4LF8 I;  4M1K A;  2HHH E;  1RR9 A;  1MU5 A;  4B3T E;  4JI8 I;  4LF7 E;  1XNR I;  3PYG A;  3Q1Q A;  4DR7 E;  1RRE A;  5LMU E;  2UUC E;  5BR8 I;  4DV7 I;  4PU9 A;  2UXB E;  4KHP I;  2XEX A;  3JAM Q;  4JI0 E;  4JYA I;  4USK A;  1Z0E A;  4DV5 E;  1KVK A;  1H7U A;  1Z0G A;  4X66 E;  4LFB I;  3J80 C;  1NHI A;  3M6A A;  1Z0V A;  4DV0 E;  2BM0 A;  1HNZ E;  4DV3 E;  4AQY E;  4JI1 E;  4KQV A;  4DV2 E;  4LF5 I;  2BM1 A;  3OTO I;  2GS8 A;  2V2V A;  5IWA E;  1XMQ I;  4JI5 I;  1Z5A A;  4DPX A;  4URL A;  4JI6 I;  2BV3 A;  1IBK E;  3V5R A;  1KKH A;  3ZZT A;  4DR6 I;  2HK3 A;  2ZIT A;  4X64 E;  2HFU A;  5FLX Q;  4EMD A;  2F4V I;  2NPF A;  1ZM2 A;  4JV5 I;  2R42 A;  1N0U A;  4X65 E;  3K17 A;  2UUB I;  1XMO I;  3JAM C;  4DR4 I;  4FWD A;  1PIE A;  1FJG I;  4WUC A;  3T1Y E;  4NXN E;  4HY1 A;  3WU6 A;  5LMN E;  4YY3 E;  3PYE A;  4B3S E;  4LF6 I;  4I3H A;  1ZXN A;  2ZM6 I;  1HR0 E;  1B63 A;  4JI1 I;  4FN5 A;  4DV6 E;  1MX0 A;  4JI7 I;  2HKE A;  4DR5 I;  4B3M I;  1N33 I;  1PKP A;  1FKA E;  1FWL A;  1XNQ I;  4DPY A;  4GKK E;  4K0K I;  2R3V A;  3J7A M;  1FNM A;  3ZZU A;  4ZVI A;  1NHJ A;  4LFA I;  2UXC I;  5FLX C;  1IBM E;  5A2Q Q;  4JI3 E;  3QT8 A;  3HUL A;  1ZXM A;  4DV4 E;  4DUY E;  3PYD A;  2VQF E;  4B3R I;  4DR3 E;  1N36 E;  2X36 A;  4OX9 I;  4DR2 E;  4DXL A;  1Z59 A;  4JI2 I;  3F0N A;  4UT4 A;  1N32 I;  3GON A;  2UXD E;  4MYT A;  4DUZ I;  4LFC E;  4GKJ E;  4LF9 I;  4FWG A;  3LPS A;  4ED4 A;  4P7A A;  4HAC A;  3ZZ0 A;  4DV1 I;  4JI4 I;  4YHH I;  4LF4 E;  4Z7C A;  1PVG A;  2UUA I;  1NHH A;  1I94 I;  2V8P A;  2E5L I;  4FWH A;  4X62 E;  2HHH I;  3T1H E;  3WU4 A;  4NXM E;  2LJP A;  1S4E A;  4B3T I;  1H72 C;  1U2R A;  1HNW E;  2E1R A;  2DEJ A;  4DPT A;  4LF7 I;  2J7K A;  1IBM I;  4DR7 I;  3J81 Q;  5LMU I;  4HAC B;  2UUC I;  1EI1 A;  2UXB I;  4JI0 I;  1N34 E;  1BKN A;  5A2Q C;  4DV5 I;  2UU9 E;  4LF8 E;  1VIS A;  1D6T A;  1Z0T A;  1Z0B A;  4X66 I;  1H73 A;  1B62 A;  2V34 A;  1FI4 A;  1N0V C;  4JI8 E;  4DV0 I;  3LNU A;  4DU8 A;  4LFC I;  4RPF A;  1HNZ I;  5GMD A;  3QT5 A;  3LTO A;  5BR8 E;  4DV3 I;  4AQY I;  4DV7 E;  1H7S A;  4KHP E;  4JYA E;  1WUU A;  3B8H A;  2A2C A;  4DV2 I;  1OJ4 A;  4Z7Y A;  5IWA I;  4LFB E;  3H4L A;  5LL6 R;  2OI2 A;  3PYF A;  3B82 A;  1IBK I;  4X64 I;  2V2Z A;  1EA6 A;  4FW9 A;  4HXZ A;  4DPU A;  1IBL E;  4LF5 E;  4X65 I;  3OTO E;  3J81 C;  1XMQ E;  4JI5 E;  5IT9 Q;  2HK2 A;  1Z0W A;  4JI6 E;  2DEI A;  4WUB A;  3T1Y I;  4NXN I;  2HFS A;  2VQE E;  4DR6 E;  1ZM3 A;  3ZKB A;  2AJ4 A;  2F4V E;  1HNX E;  3WU5 A;  4DU7 A;  5LMN I;  4YY3 I;  4JV5 E;  2WW4 A;  4R1F A;  4B3S I;  1NZ0 A;  4DR1 E;  1HR0 I;  2CZ9 A;  4MYU A;  4JG4 A;  4DV6 I;  2UUB E;  1A6F A;  1XMO E;  1J5E E;  4DR4 E;  1FJG E;  1H74 A;  2HKJ A;  1XHK A;  4GKK I;  1K47 A;  3WU3 A;  1ZM9 A;  4PRV A;  3QT6 A;  4P52 A;  4LF6 E;  2ZM6 E;  5L3J A;  2EFG A;  1S16 A;  1IBL I;  4JI7 E;  4DR5 E;  4JI3 I;  1ELO A;  4B3M E;  1N33 E;  4WUD A;  4DV4 I;  4DUY I;  5GME A;  2VQF I;  4DR3 I;  1N36 I;  1XNQ E;  3CWV A;  3K1J A;  4DR2 I;  4K0K E;  2VQE I;  5IT9 C;  4PRX A;  2VF3 A;  1HNX I;  1XNR E;  1UEK A;  2UXD I;  4GKJ I;  1MG7 A;  4LFA E;  2UXC E;  4DR1 I;  1Z5C A;  2X7I A;  4UTG A;  4LF4 I;  1J5E I;  1Z5B A;  3J80 Q;  1KTV A;  3QT7 A;  4B3R E;  3J7A G;  4OX9 E;  3ZM7 A;  4DPW A;  4JI2 E;  4X62 I;  1N32 E;  3T1H I;  3ZKD A;  4NXM I;  2ZBK B;  4DUZ E;  1KIJ A;  1HNW I;  4LF9 E; 
#chains in the Genus database with same CATH topology
 3V2U C;  2Q2E B;  4NBQ A;  1OYR A;  4XTJ A;  1FWK A;  2V2Q A;  1Y4U A;  4USM A;  4DV1 E;  4JI4 E;  1ZM4 A;  4YHH E;  4AID A;  4HYM A;  3D4J A;  2JEA A;  2PNM A;  2UUA E;  2WP8 B;  1I94 E;  4ISA A;  3B78 A;  1Z0C A;  1QZR A;  2E5L E;  4IFD D;  1N34 I;  1DAR A;  3P3C A;  2A2D A;  2UU9 I;  2Z5C B;  2PO0 B;  4LF8 I;  4M1K A;  3KRN A;  2HHH E;  1RR9 A;  1YH8 A;  1YHC A;  4FW3 A;  2GO4 A;  1MU5 A;  4IZJ D;  4B3T E;  1VI7 A;  4JI8 I;  4LF7 E;  1XNR I;  3PYG A;  2C37 B;  2JT2 A;  3Q1Q A;  4DR7 E;  1RRE A;  5C0X C;  5JEA B;  5LMU E;  2UUC E;  1UDS A;  5DRP A;  5BR8 I;  4DV7 I;  4PU9 A;  2UXB E;  3L7Z B;  4KHP I;  2XEX A;  3JAM Q;  4JI0 E;  4N3O A;  4JYA I;  4USK A;  1Z0E A;  4DV5 E;  1KVK A;  1H7U A;  3UHM A;  4OO1 C;  1Y5Y A;  1Z0G A;  2F1D A;  4X66 E;  2IES A;  4LFB I;  3J80 C;  2J65 A;  1NHI A;  3M6A A;  4BA1 B;  2NN6 D;  1Z0V A;  4DV0 E;  2BM0 A;  1HNZ E;  3Q6N A;  2CVE A;  2NN6 F;  4DV3 E;  4AQY E;  1USU A;  4JI1 E;  4KQV A;  5EKW A;  4DV2 E;  4LF5 I;  2BM1 A;  4FW6 A;  3OTO I;  2BR2 A;  2GS8 A;  2V2V A;  5IWA E;  3U1Y A;  1XMQ I;  4JI5 I;  1Z5A A;  2O1U A;  4DPX A;  4URL A;  4JI6 I;  2BV3 A;  3PRY A;  1IBK E;  3V5R A;  1KKH A;  3ZZT A;  4MU0 A;  4DR6 I;  1Y6Z A;  4IS9 A;  2GO3 A;  2HK3 A;  2ZIT A;  2HFU A;  4X64 E;  4EMD A;  5FLX Q;  2NPF A;  2F4V I;  1ZM2 A;  4JV5 I;  2R42 A;  1N0U A;  1UDO A;  4X65 E;  3K17 A;  2C38 A;  2O1W A;  2UUB I;  5JEA D;  1XMO I;  3JAM C;  4DR4 I;  1E3H A;  4FWD A;  1PIE A;  1FJG I;  4WUC A;  5C0X E;  3T1Y E;  4NXN E;  2Z5B A;  4HY1 A;  2VES A;  5JEA F;  3WU6 A;  5LMN E;  2AE8 A;  2C39 A;  4YY3 E;  4OO1 E;  3PYE A;  4B3S E;  4LF6 I;  4I3H A;  1ZXN A;  2ZM6 I;  1HR0 E;  1B63 A;  4JI1 I;  4FN5 A;  3M7N D;  2PNZ A;  2PO1 A;  4DV6 E;  5K36 A;  1MX0 A;  4JI7 I;  2HKE A;  4DR5 I;  4GQU A;  4B3M I;  2C38 B;  1N33 I;  1PKP A;  3P76 A;  3CDI A;  1FKA E;  1FWL A;  1XNQ I;  4DPY A;  4GKK E;  2Z5B B;  3PS2 A;  4K0K I;  2R3V A;  3J7A M;  1FNM A;  2IOQ A;  3ZZU A;  4ZVI A;  1NHJ A;  4IFD F;  2JEB A;  4LFA I;  2UXC I;  5FLX C;  1IBM E;  3CDJ A;  5A2Q Q;  4JI3 E;  3QT8 A;  3HUL A;  2PNZ B;  2PO1 B;  5K36 B;  2IOP A;  1ZXM A;  2BA0 D;  4DV4 E;  4DUY E;  3PYD A;  2JEA B;  2VQF E;  4B3R I;  4DR3 E;  1N36 E;  4IFD C;  2X36 A;  4OX9 I;  4DR2 E;  4DXL A;  5C0X A;  1Z59 A;  1Y60 A;  4JI2 I;  3F0N A;  2PO2 A;  4UT4 A;  1N32 I;  4J3D A;  3GON A;  4MU1 A;  2UXD E;  4MYT A;  4DUZ I;  4LFC E;  4GKJ E;  4OO1 A;  4LF9 I;  2JEB B;  4FWG A;  2CG9 A;  3LPS A;  4ED4 A;  4P7A A;  4HAC A;  3ZZ0 A;  4DV1 I;  4JI4 I;  4YHH I;  4LF4 E;  4IZJ A;  4FW7 A;  5K36 E;  4Z7C A;  1PVG A;  2UUA I;  1NHH A;  1I94 I;  2V8P A;  4FWH A;  2E5L I;  4X62 E;  2HHH I;  5C0X B;  3T1H E;  3WU4 A;  2NN6 C;  4NXM E;  2LJP A;  1S4E A;  4B3T I;  1H72 C;  1U2R A;  1HNW E;  2E1R A;  3P06 A;  3M85 G;  4U3B A;  2DEJ A;  4DPT A;  2PNL A;  4LF7 I;  4OO1 B;  4MQY A;  4FW4 A;  2J7K A;  1IBM I;  3NZK A;  4DR7 I;  3J81 Q;  5LMU I;  4HAC B;  3M85 D;  2UUC I;  3GME A;  1EI1 A;  1Y4S A;  2UXB I;  4JI0 I;  1N34 E;  1BKN A;  2CGE A;  1R6L A;  5A2Q C;  4DV5 I;  2UU9 E;  4LF8 E;  1VIS A;  1D6T A;  1Z0T A;  1Z0B A;  2BR2 B;  3HKM A;  4X66 I;  5K36 D;  1OYS A;  1H73 A;  1USV A;  4MU3 A;  1B62 A;  1UDQ A;  2V34 A;  1FI4 A;  1N0V C;  4JI8 E;  4DV0 I;  3LNU A;  4DU8 A;  4AIM A;  4LFC I;  4RPF A;  4IZK A;  1HNZ I;  5DRR A;  3PS1 A;  4OZE A;  1R6M A;  3M7N G;  5GMD A;  3QT5 A;  3LTO A;  5BR8 E;  4MU4 A;  2IER A;  3Q6M A;  4DV3 I;  2WP8 A;  1H7S A;  4DV7 E;  4AQY I;  2WNR A;  4KHP E;  4JYA E;  1WUU A;  3H1C A;  3B8H A;  2A2C A;  4DV2 I;  1OJ4 A;  4Z7Y A;  5JEA C;  5IWA I;  4LFB E;  4BA2 A;  3DD6 A;  3H4L A;  5LL6 R;  2OI2 A;  3PYF A;  3B82 A;  2C37 A;  1IBK I;  4QNJ A;  5JEA A;  4IZK B;  4X64 I;  5C0X D;  2C39 B;  2JE6 A;  2V2Z A;  3B4T A;  3U1K A;  2O3Z A;  1EA6 A;  3L7Z A;  4FW9 A;  4MDT A;  4HXZ A;  2BA0 G;  4LOM A;  5DRQ A;  4DPU A;  1IBL E;  4X65 I;  4LF5 E;  2WNR B;  3OTO E;  2NN6 E;  3J81 C;  4OO1 D;  5C0X F;  1XMQ E;  4JI5 E;  2BA1 G;  5IT9 Q;  2HK2 A;  3P3G A;  4BA2 B;  4BA1 A;  4FW5 A;  1Z0W A;  3P3E A;  2DEI A;  4JI6 E;  4WUB A;  1OYP A;  4NXN I;  3T1Y I;  2HFS A;  4OO1 F;  2VQE E;  2BA1 D;  4DR6 E;  1ZM3 A;  3ZKB A;  5ELW A;  4LCF A;  2AJ4 A;  4LCH A;  2F4V E;  1HNX E;  3GLL A;  3WU5 A;  4DU7 A;  5LMN I;  4YY3 I;  4JV5 E;  2WW4 A;  4R1F A;  4IFD A;  4B3S I;  2JE6 B;  1NZ0 A;  4DR1 E;  1HR0 I;  2CZ9 A;  4MYU A;  4JG4 A;  4DV6 I;  1HK7 A;  2UUB E;  1A6F A;  1XMO E;  1J5E E;  4DR4 E;  1FJG E;  1E3P A;  1H74 A;  2HKJ A;  3PS3 A;  1XHK A;  4GKK I;  1K47 A;  3WU3 A;  1ZM9 A;  4PRV A;  2PO2 B;  3QT6 A;  4P52 A;  4LF6 E;  2ZM6 E;  5L3J A;  5JEA E;  2EFG A;  4IFD B;  1S16 A;  1IBL I;  2O1T A;  3GCM A;  4JI7 E;  4DR5 E;  4JI3 I;  1ELO A;  2NN6 A;  3HJC A;  4B3M E;  1N33 E;  2O1V A;  5FWK A;  4WUD A;  4DV4 I;  4IZJ B;  4DUY I;  4LPF A;  5GME A;  1UDN A;  2VQF I;  4DR3 I;  1N36 I;  1XNQ E;  3CWV A;  3K1J A;  4U3D A;  4DR2 I;  4K0K E;  2GQ0 A;  3K85 A;  2VQE I;  5IT9 C;  1RHY A;  4PRX A;  2VF3 A;  4QNK A;  1HNX I;  4AM3 A;  1XNR E;  1UEK A;  2UXD I;  4GKJ I;  1MG7 A;  4LFA E;  2UXC E;  4DR1 I;  5K36 F;  4IFD E;  1Z5C A;  5DNX A;  2X7I A;  4UTG A;  4LF4 I;  1J5E I;  1Z5B A;  3J80 Q;  1KTV A;  2NN6 B;  3QT7 A;  4LCG A;  4B3R E;  2Z5C A;  2PO0 A;  3J7A G;  4OX9 E;  3ZM7 A;  4DPW A;  5DNL A;  1P42 A;  5DRO A;  4JI2 E;  5K36 C;  4X62 I;  1N32 E;  1XXE A;  3T1H I;  3ZKD A;  4NXM I;  2ZBK B;  4DUZ E;  1KIJ A;  1HNW I;  2Z5E A;  4LF9 E;  5EL9 A;  4OKG A; 
#chains in the Genus database with same CATH homology
 3V2U C;  2Q2E B;  4XTJ A;  1FWK A;  2V2Q A;  1Y4U A;  4USM A;  4DV1 E;  4JI4 E;  1ZM4 A;  4YHH E;  4HYM A;  3D4J A;  2PNM A;  2UUA E;  1I94 E;  3B78 A;  1Z0C A;  1QZR A;  2E5L E;  1N34 I;  1DAR A;  2A2D A;  2UU9 I;  2Z5C B;  4LF8 I;  4M1K A;  2HHH E;  1RR9 A;  1MU5 A;  4IZJ D;  4B3T E;  4JI8 I;  4LF7 E;  1XNR I;  3PYG A;  3Q1Q A;  4DR7 E;  1RRE A;  5LMU E;  2UUC E;  5BR8 I;  4DV7 I;  4PU9 A;  2UXB E;  4KHP I;  2XEX A;  3JAM Q;  4JI0 E;  4N3O A;  4JYA I;  4USK A;  1Z0E A;  4DV5 E;  1KVK A;  1H7U A;  1Z0G A;  4X66 E;  4LFB I;  3J80 C;  1NHI A;  3M6A A;  1Z0V A;  4DV0 E;  2BM0 A;  1HNZ E;  3Q6N A;  4DV3 E;  4AQY E;  1USU A;  4JI1 E;  4KQV A;  4DV2 E;  4LF5 I;  2BM1 A;  3OTO I;  2GS8 A;  2V2V A;  5IWA E;  1XMQ I;  4JI5 I;  1Z5A A;  2O1U A;  4DPX A;  4URL A;  4JI6 I;  2BV3 A;  3PRY A;  1IBK E;  3V5R A;  1KKH A;  3ZZT A;  4DR6 I;  1Y6Z A;  2HK3 A;  2ZIT A;  4X64 E;  2HFU A;  5FLX Q;  4EMD A;  2F4V I;  2NPF A;  1ZM2 A;  4JV5 I;  2R42 A;  1N0U A;  4X65 E;  3K17 A;  2O1W A;  2UUB I;  1XMO I;  3JAM C;  4DR4 I;  4FWD A;  1PIE A;  1FJG I;  4WUC A;  3T1Y E;  4NXN E;  2Z5B A;  4HY1 A;  3WU6 A;  5LMN E;  4YY3 E;  3PYE A;  4B3S E;  4LF6 I;  4I3H A;  1ZXN A;  2ZM6 I;  1HR0 E;  1B63 A;  4JI1 I;  4FN5 A;  4DV6 E;  1MX0 A;  4JI7 I;  2HKE A;  4DR5 I;  4B3M I;  1N33 I;  1PKP A;  1FKA E;  1FWL A;  1XNQ I;  4DPY A;  4GKK E;  2Z5B B;  4K0K I;  2R3V A;  3J7A M;  1FNM A;  2IOQ A;  3ZZU A;  4ZVI A;  1NHJ A;  4LFA I;  2UXC I;  5FLX C;  1IBM E;  5A2Q Q;  4JI3 E;  3QT8 A;  3HUL A;  2IOP A;  1ZXM A;  4DV4 E;  4DUY E;  3PYD A;  2VQF E;  4B3R I;  4DR3 E;  1N36 E;  2X36 A;  4OX9 I;  4DR2 E;  4DXL A;  1Z59 A;  4JI2 I;  3F0N A;  4UT4 A;  1N32 I;  3GON A;  2UXD E;  4MYT A;  4DUZ I;  4LFC E;  4GKJ E;  4LF9 I;  4FWG A;  2CG9 A;  3LPS A;  4ED4 A;  4P7A A;  4HAC A;  3ZZ0 A;  4DV1 I;  4JI4 I;  4YHH I;  4LF4 E;  4IZJ A;  4Z7C A;  1PVG A;  2UUA I;  1NHH A;  1I94 I;  2V8P A;  4FWH A;  2E5L I;  4X62 E;  2HHH I;  3T1H E;  3WU4 A;  4NXM E;  2LJP A;  1S4E A;  4B3T I;  1H72 C;  1U2R A;  1HNW E;  2E1R A;  3P06 A;  2DEJ A;  4DPT A;  2PNL A;  4LF7 I;  2J7K A;  1IBM I;  4DR7 I;  3J81 Q;  5LMU I;  4HAC B;  2UUC I;  1EI1 A;  1Y4S A;  2UXB I;  4JI0 I;  1N34 E;  1BKN A;  2CGE A;  5A2Q C;  4DV5 I;  2UU9 E;  4LF8 E;  1VIS A;  1D6T A;  1Z0T A;  1Z0B A;  4X66 I;  1H73 A;  1USV A;  1B62 A;  2V34 A;  1FI4 A;  1N0V C;  4JI8 E;  4DV0 I;  3LNU A;  4DU8 A;  4LFC I;  4RPF A;  4IZK A;  1HNZ I;  5GMD A;  3QT5 A;  3LTO A;  5BR8 E;  3Q6M A;  4DV3 I;  4AQY I;  4DV7 E;  1H7S A;  4KHP E;  4JYA E;  1WUU A;  3B8H A;  2A2C A;  4DV2 I;  1OJ4 A;  4Z7Y A;  5IWA I;  4LFB E;  3H4L A;  5LL6 R;  2OI2 A;  3PYF A;  3B82 A;  1IBK I;  4IZK B;  4X64 I;  2V2Z A;  1EA6 A;  4FW9 A;  4HXZ A;  4DPU A;  1IBL E;  4LF5 E;  4X65 I;  3OTO E;  3J81 C;  1XMQ E;  4JI5 E;  5IT9 Q;  2HK2 A;  1Z0W A;  4JI6 E;  2DEI A;  4WUB A;  3T1Y I;  4NXN I;  2HFS A;  2VQE E;  4DR6 E;  1ZM3 A;  3ZKB A;  2AJ4 A;  2F4V E;  1HNX E;  3WU5 A;  4DU7 A;  5LMN I;  4YY3 I;  4JV5 E;  2WW4 A;  4R1F A;  4B3S I;  1NZ0 A;  4DR1 E;  1HR0 I;  2CZ9 A;  4MYU A;  4JG4 A;  4DV6 I;  1HK7 A;  2UUB E;  1A6F A;  1XMO E;  1J5E E;  4DR4 E;  1FJG E;  1H74 A;  2HKJ A;  1XHK A;  4GKK I;  1K47 A;  3WU3 A;  1ZM9 A;  4PRV A;  3QT6 A;  4P52 A;  4LF6 E;  2ZM6 E;  5L3J A;  2EFG A;  1S16 A;  1IBL I;  2O1T A;  4JI7 E;  4DR5 E;  4JI3 I;  1ELO A;  4B3M E;  3HJC A;  1N33 E;  2O1V A;  5FWK A;  4WUD A;  4DV4 I;  4IZJ B;  4DUY I;  5GME A;  2VQF I;  4DR3 I;  1N36 I;  1XNQ E;  3CWV A;  3K1J A;  4DR2 I;  4K0K E;  2GQ0 A;  3K85 A;  2VQE I;  5IT9 C;  4PRX A;  2VF3 A;  1HNX I;  1XNR E;  1UEK A;  2UXD I;  4GKJ I;  1MG7 A;  4LFA E;  2UXC E;  4DR1 I;  1Z5C A;  2X7I A;  4UTG A;  4LF4 I;  1J5E I;  1Z5B A;  3J80 Q;  1KTV A;  3QT7 A;  4B3R E;  2Z5C A;  3J7A G;  4OX9 E;  3ZM7 A;  4DPW A;  4JI2 E;  4X62 I;  1N32 E;  3T1H I;  3ZKD A;  4NXM I;  2ZBK B;  4DUZ E;  1KIJ A;  1HNW I;  2Z5E A;  4LF9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...