4DV0I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv0I00
4B3TI 4P52A 4MYTA 4LFBI 1Z0BA 2NPFA 4I3HA 4LF8E 4X65E 4UT4A 4NXME 1S16A 1NZ0A 4DR3I 5FLXC 2HK3A 1N33I 4DPYA 4KHPE 4JI6I 2BM1A 4JYAI 3WU6A 5LMNE 3V2UC 1HNWE 1KIJA 4LFCI 4FWDA 4JI7I 4X64E 1ELOA 2R42A 2DEIA 1PVGA 4B3TE 4LFBE 4P7AA 4DV1I 1H73A 1A6FA 4JI0E 3WU3A 4FWHA 4GKJI 3JAMC 5A2QC 1FKAE 4JI6E 3J7AM 4AQYI 1QZRA 4DPXA 1KKHA 1MG7A 1N36I 4MYUA 4JI7E 4YY3I 2F4VI 2VQEI 4DV7E 2UUAI 4HACA 4DU7A 1WUUA 4NXNE 4DV4I 1OJ4A 4DV2I 4DPUA 1FJGI 4USMA 4JI1I 1N0UA 4GKJE 5LL6R 4HACB 2HHHI 2LJPA 1Z59A 1Z5BA 3PYFA 1Z5AA 2X7IA 1XMQI 1FWLA 4AQYE 4X62I 3H4LA 4DXLA 1N36E 4GKKI 4X65I 4X66I 4LF6E 2EFGA 4YY3E 2WW4A 4JI8E 2F4VE 2VQEE 2UUAE 2Q2EB 1MX0A 3LTOA 4XTJA 5BR8I 3CWVA 4DV4E 5LMNI 5LMUE 4Z7CA 1Z0VA 4JI1E 1N34E 1U2RA 1XHKA 3ZZ0A 3LNUA 4LF4I 4WUDA 1XMOI 1EI1A 4DR5E 3M6AA 1XMQE 4JI2I 1FWKA 4JI0I 4X62E 4LFAI 4GKKE 4X66E 2AJ4A 4FWGA 3F0NA 1KVKA 1ZM9A 4DU8A 1IBME 3D4JA 5BR8E 2V34A 4FW9A 1IBKI 3PYEA 3QT7A 1HNZI 1D6TA 1PIEA 1Z0TA 4LF4E 1NHIA 3QT6A 4DV7I 2V2VA 1XMOE 4B3SI 4NXNI 2UXBI 5L3JA 4JI2E 4WUBA 4LFAE 1N0VC 3QT5A 2E5LE 1ZM4A 1MU5A 2HFSA 5GMEA 2R3VA 1UEKA 3ZKBA 4HY1A 3WU5A 1ZXMA 4JV5I 4DR6I 1EA6A 3LPSA 1IBKE 1HNZE 4LF6I 4JI8I 2ZM6I 4DV3I 4USKA 1BKNA 4B3SE 4YHHE 4B3MI 3J81Q 2A2DA 2UXBE 4LF5I 5LMUI 3B78A 1N34I 3ZZTA 2E1RA 3K17A 4DR5I 1VISA 2HKJA 2UXDI 4EMDA 1XNQI 4JV5E 1Z5CA 3GONA 4DR6E 2VQFI 1DARA 2OI2A 4JI3E 2HFUA 2ZBKB 2UXCE 2X36A 2ZM6E 4KQVA 4DV3E 1IBMI 4B3ME 4LF5E 4FN5A 4DV6E 1ZM2A 1HR0E 1K47A 2V2QA 4ED4A 1NHHA 4DR7E 1Z0CA 3J80Q 4OX9I 4DV5E 1Z0GA 2V8PA 2UUCI 2ZITA 4LF9I 2UXDE 1XNQE 3ZKDA 2E5LI 4JI4I 2VQFE 1I94I 4DUZE 2CZ9A 1S4EA 2A2CA 1IBLI 3T1HI 5IT9Q 1H74A 3K1JA 2BM0A 1H7SA 3ZZUA 4DPTA 4HXZA 3J81C 1FI4A 1NHJA 1PKPA 1HNXE 1Z0EA 4DR4I 1ZXNA 2UU9I 4OX9E 4YHHI 4DUYI 3QT8A 2UUCE 4URLA 4WUCA 4B3RE 4LF9E 3HULA 4DV0E 4JI4E 1I94E 1J5EE 1IBLE 3T1HE 3OTOE 2J7KA 1KTVA 4JI5I 3J7AG 1RR9A 4JI3I 4DR4E 1XNRI 2XEXA 4M1KA 4Z7YA 2UXCI 2UU9E 4ZVIA 4DR3E 3J80C 4DUYE 3B82A 4DPWA 1N33E 4DR1I 2UUBI 4DV6I 4JYAE 5IWAI 1HR0I 4DR7I 3ZM7A 4LFCE 5FLXQ 1ZM3A 4UTGA 4DV5I 2V2ZA 1N32I 3WU4A 3V5RA 1Z0WA 3B8HA 4K0KI 5IT9C 3Q1QA 4JI5E 4DV1E 1RREA 4DUZI 1XNRE 4JG4A 4DR2I 5GMDA 4LF7I 3T1YI 1B63A 2GS8A 4DR1E 4PU9A 3PYGA 2UUBE 1FNMA 1H72C 5IWAE 1HNXI 4LF8I 3JAMQ 4HYMA 2DEJA 2HKEA 5A2QQ 3PYDA 4NXMI 4PRXA 2VF3A 1N32E 4R1FA 4RPFA 4KHPI 4K0KE 4B3RI 4DV2E 2BV3A 4DV0I 1FJGE 4PRVA 1HNWI 1B62A 4X64I 1J5EI 4DR2E 1H7UA 2HK2A 2HHHE 4LF7E 3T1YE 3OTOI
chains in the Genus database with same CATH superfamily
4B3TI 4P52A 2WNRA 4MYTA 4LFBI 2IESA 1R6MA 1Z0BA 2NPFA 3P3EA 2PO2A 4I3HA 4LF8E 2JEAB 5C0XB 4IZJA 4X65E 1Y60A 5ELWA 2O1TA 4UT4A 1S16A 4NXME 1NZ0A 2Z5EA 4DR3I 5FLXC 2HK3A 1N33I 4LCFA 4DPYA 4KHPE 4JI6I 2BM1A 4BA2A 4JYAI 3HJCA 3WU6A 5LMNE 3V2UC 1HNWE 1KIJA 3K85A 4LFCI 4FWDA 4JI7I 4X64E 3CDJA 1P42A 1ELOA 2R42A 4N3OA 5DRRA 5JEAF 2DEIA 4IFDC 2C37A 2CGEA 1PVGA 4B3TE 4LFBE 3H1CA 4P7AA 4DV1I 1H73A 2BA1G 1A6FA 5FWKA 5K36A 5DNXA 4JI0E 3WU3A 4FWHA 4MU1A 4GKJI 3JAMC 5A2QC 4OO1E 2O1WA 3P3CA 1FKAE 3B4TA 4JI6E 3J7AM 4AQYI 2GO3A 4ISAA 3PS3A 1QZRA 4DPXA 1KKHA 1MG7A 1N36I 4MYUA 4IFDE 4JI7E 1XXEA 2PO1B 4QNJA 4YY3I 2IERA 2F4VI 2VQEI 3M7NG 4DV7E 2BA1D 2UUAI 4HACA 2C38A 4DU7A 1WUUA 2Z5CB 4NXNE 2PNLA 4DV4I 1OJ4A 4DV2I 4DPUA 1FJGI 3GMEA 4USMA 4JI1I 1N0UA 4GKJE 5LL6R 4HACB 2HHHI 2C39B 2F1DA 2LJPA 1Z59A 1Z5BA 3PYFA 1Z5AA 2X7IA 1XMQI 1FWLA 4AQYE 3M7ND 3H4LA 4X62I 4DXLA 1N36E 4GKKI 4X65I 4X66I 4IFDB 4LF6E 2EFGA 4YY3E 2WW4A 4MU4A 4JI8E 2F4VE 2VQEE 2UUAE 4MDTA 2Q2EB 1MX0A 2BR2A 3LTOA 4XTJA 5BR8I 3CWVA 4DV4E 5LMNI 4OO1F 5DROA 5LMUE 5K36C 4Z7CA 1Z0VA 4JI1E 1N34E 3GCMA 1U2RA 2AE8A 2J65A 1XHKA 3ZZ0A 3LNUA 4LF4I 3L7ZA 4WUDA 1XMOI 5K36D 1EI1A 4DR5E 3M6AA 4IFDF 1UDQA 1XMQE 4JI2I 1FWKA 4JI0I 3L7ZB 4X62E 4LFAI 1USVA 4IZKA 4GKKE 2O3ZA 4X66E 2WNRB 2AJ4A 2CVEA 4FWGA 3F0NA 5JEAA 1KVKA 1ZM9A 4DU8A 2PO2B 1IBME 5DRQA 3D4JA 1E3HA 2JE6A 5BR8E 4IZJB 4FW7A 2V34A 4FW9A 3CDIA 1IBKI 3PYEA 3QT7A 1HNZI 1D6TA 1PIEA 1Z0TA 4AM3A 4LF4E 1NHIA 3QT6A 4DV7I 4BA2B 2V2VA 5C0XF 1XMOE 4B3SI 4NXNI 3M85D 1Y4UA 2UXBI 4LCGA 5DNLA 5L3JA 4JI2E 2PNMA 4WUBA 4LFAE 1N0VC 2NN6C 3QT5A 2E5LE 2C37B 1ZM4A 4MQYA 1MU5A 2HFSA 5GMEA 3Q6NA 2R3VA 1UEKA 3ZKBA 1OYSA 4HY1A 5K36B 2NN6D 2CG9A 1HK7A 3WU5A 1ZXMA 4JV5I 4DR6I 1EA6A 3LPSA 1IBKE 3P3GA 1HNZE 4LF6I 2WP8A 4FW5A 4IS9A 4JI8I 2ZM6I 1UDOA 4DV3I 4USKA 1BKNA 4B3SE 4YHHE 4B3MI 3J81Q 2A2DA 2UXBE 4LF5I 2PNZA 5LMUI 3B78A 1N34I 3ZZTA 1R6LA 2JEBA 2E1RA 1RHYA 1OYPA 3HKMA 2C38B 3K17A 5JEAC 4DR5I 2GO4A 2PNZB 4LOMA 1VISA 2VESA 1UDNA 2HKJA 4LCHA 2UXDI 4OO1A 4EMDA 1XNQI 4JV5E 1Z5CA 3GONA 5JEAD 4DR6E 5C0XD 2VQFI 2NN6A 1DARA 1E3PA 2OI2A 4JI3E 2PO0A 4U3DA 2HFUA 2ZBKB 2UXCE 2X36A 2ZM6E 4KQVA 4DV3E 1IBMI 4FW3A 4B3ME 2NN6B 4LF5E 4FN5A 4DV6E 1USUA 1ZM2A 5JEAE 1HR0E 1K47A 2V2QA 4ED4A 2Z5BA 1NHHA 4DR7E 1Z0CA 2BR2B 3J80Q 3NZKA 4OX9I 4DV5E 1Z0GA 1YH8A 2V8PA 4LPFA 2UUCI 2ZITA 4LF9I 2UXDE 1XNQE 3ZKDA 1VI7A 2E5LI 3M85G 4JI4I 2VQFE 3DD6A 1I94I 4DUZE 2CZ9A 1S4EA 2A2CA 1IBLI 5C0XA 2JEAA 3T1HI 5K36E 5IT9Q 1H74A 3K1JA 2BM0A 4IZKB 1H7SA 2O1VA 3ZZUA 4DPTA 4HXZA 3J81C 1FI4A 1NHJA 1PKPA 2JT2A 1Y6ZA 1YHCA 1Z0EA 5JEAB 1HNXE 4DR4I 1ZXNA 4GQUA 2UU9I 4FW4A 2JE6B 4MU3A 4OX9E 3UHMA 4YHHI 4DUYI 3QT8A 2UUCE 4URLA 4WUCA 4AIMA 4B3RE 4OO1C 4QNKA 4LF9E 3HULA 4DV0E 4JI4E 1I94E 5EKWA 4J3DA 1J5EE 2GQ0A 4OO1D 1IBLE 3T1HE 3OTOE 2J7KA 1KTVA 3P76A 4JI5I 3J7AG 1RR9A 3U1KA 3GLLA 4IFDD 4JI3I 4DR4E 1XNRI 2XEXA 4M1KA 4MU0A 4Z7YA 2UXCI 2UU9E 4BA1A 4ZVIA 4DR3E 3J80C 2O1UA 3B82A 2IOQA 4DPWA 4DUYE 2PO1A 1N33E 2NN6E 4DR1I 2UUBI 4DV6I 2WP8B 4JYAE 5IWAI 1HR0I 4OZEA 5K36F 3PRYA 4BA1B 4AIDA 4DR7I 2Z5CA 3ZM7A 4LFCE 5FLXQ 1ZM3A 2BA0G 3U1YA 4UTGA 4DV5I 5C0XC 2V2ZA 1N32I 3WU4A 1UDSA 5DRPA 3V5RA 1Z0WA 3B8HA 4K0KI 2JEBB 2C39A 5IT9C 3P06A 3PS1A 3Q1QA 4JI5E 4DV1E 1RREA 4DUZI 1XNRE 4JG4A 2IOPA 4DR2I 5GMDA 3Q6MA 1OYRA 4LF7I 3T1YI 4U3BA 1B63A 4OO1B 4NBQA 4IFDA 2GS8A 4DR1E 4IZJD 4PU9A 3PYGA 2BA0D 4OKGA 1Y5YA 3PS2A 1FNMA 2UUBE 1H72C 2PO0B 5IWAE 1HNXI 4LF8I 5EL9A 3JAMQ 4HYMA 2DEJA 4FW6A 5C0XE 2HKEA 5A2QQ 3PYDA 4NXMI 3KRNA 4PRXA 2VF3A 1N32E 4R1FA 4RPFA 4KHPI 4K0KE 4B3RI 2Z5BB 4DV2E 2BV3A 4DV0I 1FJGE 4PRVA 1HNWI 1B62A 2NN6F 4X64I 1J5EI 1Y4SA 4DR2E 1H7UA 2HK2A 2HHHE 4LF7E 3T1YE 3OTOI
chains in the Genus database with same CATH topology
4B3TI 4P52A 4MYTA 4LFBI 1Z0BA 2NPFA 4I3HA 4LF8E 4IZJA 4X65E 4UT4A 2O1TA 4NXME 1S16A 1NZ0A 2Z5EA 4DR3I 5FLXC 2HK3A 1N33I 4DPYA 4KHPE 4JI6I 2BM1A 4JYAI 3HJCA 3WU6A 5LMNE 3V2UC 1HNWE 1KIJA 3K85A 4LFCI 4FWDA 4JI7I 4X64E 1ELOA 2R42A 4N3OA 2DEIA 2CGEA 1PVGA 4B3TE 4LFBE 4P7AA 4DV1I 1H73A 5FWKA 1A6FA 4JI0E 3WU3A 4FWHA 4GKJI 3JAMC 5A2QC 2O1WA 1FKAE 4JI6E 3J7AM 4AQYI 1QZRA 4DPXA 1KKHA 1MG7A 1N36I 4MYUA 4JI7E 4YY3I 2F4VI 2VQEI 4DV7E 2UUAI 4HACA 4DU7A 1WUUA 2Z5CB 4NXNE 2PNLA 4DV4I 1OJ4A 4DV2I 4DPUA 1FJGI 4USMA 4JI1I 1N0UA 4GKJE 5LL6R 4HACB 2HHHI 2LJPA 1Z59A 1Z5BA 3PYFA 1Z5AA 2X7IA 1XMQI 1FWLA 4AQYE 4X62I 3H4LA 4DXLA 1N36E 4GKKI 4X65I 4X66I 4LF6E 2EFGA 4YY3E 2WW4A 4JI8E 2F4VE 2VQEE 2UUAE 2Q2EB 1MX0A 3LTOA 4XTJA 5BR8I 3CWVA 4DV4E 5LMNI 5LMUE 4Z7CA 1Z0VA 4JI1E 1N34E 1U2RA 1XHKA 3ZZ0A 3LNUA 4LF4I 4WUDA 1XMOI 1EI1A 4DR5E 3M6AA 1XMQE 4JI2I 1FWKA 4JI0I 4X62E 4LFAI 1USVA 4IZKA 4GKKE 4X66E 2AJ4A 4FWGA 3F0NA 1KVKA 1ZM9A 4DU8A 1IBME 3D4JA 5BR8E 4IZJB 2V34A 4FW9A 1IBKI 3PYEA 3QT7A 1HNZI 1D6TA 1PIEA 1Z0TA 4LF4E 1NHIA 3QT6A 4DV7I 2V2VA 1XMOE 4B3SI 4NXNI 1Y4UA 2UXBI 5L3JA 4JI2E 2PNMA 4WUBA 4LFAE 1N0VC 3QT5A 2E5LE 1ZM4A 1MU5A 2HFSA 5GMEA 3Q6NA 2R3VA 1UEKA 3ZKBA 4HY1A 2CG9A 1HK7A 3WU5A 1ZXMA 4JV5I 4DR6I 1EA6A 3LPSA 1IBKE 1HNZE 4LF6I 4JI8I 2ZM6I 4DV3I 4USKA 1BKNA 4B3SE 4YHHE 4B3MI 3J81Q 2A2DA 2UXBE 4LF5I 5LMUI 3B78A 1N34I 3ZZTA 2E1RA 3K17A 4DR5I 1VISA 2HKJA 2UXDI 4EMDA 1XNQI 4JV5E 1Z5CA 3GONA 4DR6E 2VQFI 1DARA 2OI2A 4JI3E 2HFUA 2ZBKB 2UXCE 2X36A 2ZM6E 4KQVA 4DV3E 1IBMI 4B3ME 4LF5E 4FN5A 4DV6E 1USUA 1ZM2A 1HR0E 1K47A 2V2QA 4ED4A 2Z5BA 1NHHA 4DR7E 1Z0CA 3J80Q 4OX9I 4DV5E 1Z0GA 2V8PA 2UUCI 2ZITA 4LF9I 2UXDE 1XNQE 3ZKDA 2E5LI 4JI4I 2VQFE 1I94I 4DUZE 2CZ9A 1S4EA 2A2CA 1IBLI 3T1HI 5IT9Q 1H74A 3K1JA 2BM0A 4IZKB 1H7SA 2O1VA 3ZZUA 4DPTA 4HXZA 3J81C 1FI4A 1NHJA 1PKPA 1Y6ZA 1HNXE 1Z0EA 4DR4I 1ZXNA 2UU9I 4OX9E 4YHHI 4DUYI 3QT8A 2UUCE 4URLA 4WUCA 4B3RE 4LF9E 3HULA 4DV0E 4JI4E 1I94E 1J5EE 2GQ0A 1IBLE 3T1HE 3OTOE 2J7KA 1KTVA 4JI5I 3J7AG 1RR9A 4JI3I 4DR4E 1XNRI 2XEXA 4M1KA 4Z7YA 2UXCI 2UU9E 4ZVIA 4DR3E 3J80C 2O1UA 3B82A 2IOQA 4DPWA 4DUYE 1N33E 4DR1I 2UUBI 4DV6I 4JYAE 5IWAI 1HR0I 3PRYA 4DR7I 2Z5CA 3ZM7A 4LFCE 5FLXQ 1ZM3A 4UTGA 4DV5I 2V2ZA 1N32I 3WU4A 3V5RA 1Z0WA 3B8HA 4K0KI 5IT9C 3P06A 3Q1QA 4JI5E 4DV1E 1RREA 4DUZI 1XNRE 4JG4A 2IOPA 4DR2I 5GMDA 3Q6MA 4LF7I 3T1YI 1B63A 2GS8A 4DR1E 4IZJD 4PU9A 3PYGA 2UUBE 1FNMA 1H72C 5IWAE 1HNXI 4LF8I 3JAMQ 4HYMA 2DEJA 2HKEA 5A2QQ 3PYDA 4NXMI 4PRXA 2VF3A 1N32E 4R1FA 4RPFA 4KHPI 4K0KE 4B3RI 2Z5BB 4DV2E 2BV3A 4DV0I 1FJGE 4PRVA 1HNWI 1B62A 4X64I 1J5EI 1Y4SA 4DR2E 1H7UA 2HK2A 2HHHE 4LF7E 3T1YE 3OTOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T I;  4P52 A;  4MYT A;  4LFB I;  1Z0B A;  2NPF A;  4I3H A;  4LF8 E;  4X65 E;  4UT4 A;  4NXM E;  1S16 A;  1NZ0 A;  4DR3 I;  5FLX C;  2HK3 A;  1N33 I;  4DPY A;  4KHP E;  4JI6 I;  2BM1 A;  4JYA I;  3WU6 A;  5LMN E;  3V2U C;  1HNW E;  1KIJ A;  4LFC I;  4FWD A;  4JI7 I;  4X64 E;  1ELO A;  2R42 A;  2DEI A;  1PVG A;  4B3T E;  4LFB E;  4P7A A;  4DV1 I;  1H73 A;  1A6F A;  4JI0 E;  3WU3 A;  4FWH A;  4GKJ I;  3JAM C;  5A2Q C;  1FKA E;  4JI6 E;  3J7A M;  4AQY I;  1QZR A;  4DPX A;  1KKH A;  1MG7 A;  1N36 I;  4MYU A;  4JI7 E;  4YY3 I;  2F4V I;  2VQE I;  4DV7 E;  2UUA I;  4HAC A;  4DU7 A;  1WUU A;  4NXN E;  4DV4 I;  1OJ4 A;  4DV2 I;  4DPU A;  1FJG I;  4USM A;  4JI1 I;  1N0U A;  4GKJ E;  5LL6 R;  4HAC B;  2HHH I;  2LJP A;  1Z59 A;  1Z5B A;  3PYF A;  1Z5A A;  2X7I A;  1XMQ I;  1FWL A;  4AQY E;  4X62 I;  3H4L A;  4DXL A;  1N36 E;  4GKK I;  4X65 I;  4X66 I;  4LF6 E;  2EFG A;  4YY3 E;  2WW4 A;  4JI8 E;  2F4V E;  2VQE E;  2UUA E;  2Q2E B;  1MX0 A;  3LTO A;  4XTJ A;  5BR8 I;  3CWV A;  4DV4 E;  5LMN I;  5LMU E;  4Z7C A;  1Z0V A;  4JI1 E;  1N34 E;  1U2R A;  1XHK A;  3ZZ0 A;  3LNU A;  4LF4 I;  4WUD A;  1XMO I;  1EI1 A;  4DR5 E;  3M6A A;  1XMQ E;  4JI2 I;  1FWK A;  4JI0 I;  4X62 E;  4LFA I;  4GKK E;  4X66 E;  2AJ4 A;  4FWG A;  3F0N A;  1KVK A;  1ZM9 A;  4DU8 A;  1IBM E;  3D4J A;  5BR8 E;  2V34 A;  4FW9 A;  1IBK I;  3PYE A;  3QT7 A;  1HNZ I;  1D6T A;  1PIE A;  1Z0T A;  4LF4 E;  1NHI A;  3QT6 A;  4DV7 I;  2V2V A;  1XMO E;  4B3S I;  4NXN I;  2UXB I;  5L3J A;  4JI2 E;  4WUB A;  4LFA E;  1N0V C;  3QT5 A;  2E5L E;  1ZM4 A;  1MU5 A;  2HFS A;  5GME A;  2R3V A;  1UEK A;  3ZKB A;  4HY1 A;  3WU5 A;  1ZXM A;  4JV5 I;  4DR6 I;  1EA6 A;  3LPS A;  1IBK E;  1HNZ E;  4LF6 I;  4JI8 I;  2ZM6 I;  4DV3 I;  4USK A;  1BKN A;  4B3S E;  4YHH E;  4B3M I;  3J81 Q;  2A2D A;  2UXB E;  4LF5 I;  5LMU I;  3B78 A;  1N34 I;  3ZZT A;  2E1R A;  3K17 A;  4DR5 I;  1VIS A;  2HKJ A;  2UXD I;  4EMD A;  1XNQ I;  4JV5 E;  1Z5C A;  3GON A;  4DR6 E;  2VQF I;  1DAR A;  2OI2 A;  4JI3 E;  2HFU A;  2ZBK B;  2UXC E;  2X36 A;  2ZM6 E;  4KQV A;  4DV3 E;  1IBM I;  4B3M E;  4LF5 E;  4FN5 A;  4DV6 E;  1ZM2 A;  1HR0 E;  1K47 A;  2V2Q A;  4ED4 A;  1NHH A;  4DR7 E;  1Z0C A;  3J80 Q;  4OX9 I;  4DV5 E;  1Z0G A;  2V8P A;  2UUC I;  2ZIT A;  4LF9 I;  2UXD E;  1XNQ E;  3ZKD A;  2E5L I;  4JI4 I;  2VQF E;  1I94 I;  4DUZ E;  2CZ9 A;  1S4E A;  2A2C A;  1IBL I;  3T1H I;  5IT9 Q;  1H74 A;  3K1J A;  2BM0 A;  1H7S A;  3ZZU A;  4DPT A;  4HXZ A;  3J81 C;  1FI4 A;  1NHJ A;  1PKP A;  1HNX E;  1Z0E A;  4DR4 I;  1ZXN A;  2UU9 I;  4OX9 E;  4YHH I;  4DUY I;  3QT8 A;  2UUC E;  4URL A;  4WUC A;  4B3R E;  4LF9 E;  3HUL A;  4DV0 E;  4JI4 E;  1I94 E;  1J5E E;  1IBL E;  3T1H E;  3OTO E;  2J7K A;  1KTV A;  4JI5 I;  3J7A G;  1RR9 A;  4JI3 I;  4DR4 E;  1XNR I;  2XEX A;  4M1K A;  4Z7Y A;  2UXC I;  2UU9 E;  4ZVI A;  4DR3 E;  3J80 C;  4DUY E;  3B82 A;  4DPW A;  1N33 E;  4DR1 I;  2UUB I;  4DV6 I;  4JYA E;  5IWA I;  1HR0 I;  4DR7 I;  3ZM7 A;  4LFC E;  5FLX Q;  1ZM3 A;  4UTG A;  4DV5 I;  2V2Z A;  1N32 I;  3WU4 A;  3V5R A;  1Z0W A;  3B8H A;  4K0K I;  5IT9 C;  3Q1Q A;  4JI5 E;  4DV1 E;  1RRE A;  4DUZ I;  1XNR E;  4JG4 A;  4DR2 I;  5GMD A;  4LF7 I;  3T1Y I;  1B63 A;  2GS8 A;  4DR1 E;  4PU9 A;  3PYG A;  2UUB E;  1FNM A;  1H72 C;  5IWA E;  1HNX I;  4LF8 I;  3JAM Q;  4HYM A;  2DEJ A;  2HKE A;  5A2Q Q;  3PYD A;  4NXM I;  4PRX A;  2VF3 A;  1N32 E;  4R1F A;  4RPF A;  4KHP I;  4K0K E;  4B3R I;  4DV2 E;  2BV3 A;  4DV0 I;  1FJG E;  4PRV A;  1HNW I;  1B62 A;  4X64 I;  1J5E I;  4DR2 E;  1H7U A;  2HK2 A;  2HHH E;  4LF7 E;  3T1Y E;  3OTO I; 
#chains in the Genus database with same CATH topology
 4B3T I;  4P52 A;  2WNR A;  4MYT A;  4LFB I;  2IES A;  1R6M A;  1Z0B A;  2NPF A;  3P3E A;  2PO2 A;  4I3H A;  4LF8 E;  2JEA B;  5C0X B;  4IZJ A;  4X65 E;  1Y60 A;  5ELW A;  2O1T A;  4UT4 A;  1S16 A;  4NXM E;  1NZ0 A;  2Z5E A;  4DR3 I;  5FLX C;  2HK3 A;  1N33 I;  4LCF A;  4DPY A;  4KHP E;  4JI6 I;  2BM1 A;  4BA2 A;  4JYA I;  3HJC A;  3WU6 A;  5LMN E;  3V2U C;  1HNW E;  1KIJ A;  3K85 A;  4LFC I;  4FWD A;  4JI7 I;  4X64 E;  3CDJ A;  1P42 A;  1ELO A;  2R42 A;  4N3O A;  5DRR A;  5JEA F;  2DEI A;  4IFD C;  2C37 A;  2CGE A;  1PVG A;  4B3T E;  4LFB E;  3H1C A;  4P7A A;  4DV1 I;  1H73 A;  2BA1 G;  1A6F A;  5FWK A;  5K36 A;  5DNX A;  4JI0 E;  3WU3 A;  4FWH A;  4MU1 A;  4GKJ I;  3JAM C;  5A2Q C;  4OO1 E;  2O1W A;  3P3C A;  1FKA E;  3B4T A;  4JI6 E;  3J7A M;  4AQY I;  2GO3 A;  4ISA A;  3PS3 A;  1QZR A;  4DPX A;  1KKH A;  1MG7 A;  1N36 I;  4MYU A;  4IFD E;  4JI7 E;  1XXE A;  2PO1 B;  4QNJ A;  4YY3 I;  2IER A;  2F4V I;  2VQE I;  3M7N G;  4DV7 E;  2BA1 D;  2UUA I;  4HAC A;  2C38 A;  4DU7 A;  1WUU A;  2Z5C B;  4NXN E;  2PNL A;  4DV4 I;  1OJ4 A;  4DV2 I;  4DPU A;  1FJG I;  3GME A;  4USM A;  4JI1 I;  1N0U A;  4GKJ E;  5LL6 R;  4HAC B;  2HHH I;  2C39 B;  2F1D A;  2LJP A;  1Z59 A;  1Z5B A;  3PYF A;  1Z5A A;  2X7I A;  1XMQ I;  1FWL A;  4AQY E;  3M7N D;  3H4L A;  4X62 I;  4DXL A;  1N36 E;  4GKK I;  4X65 I;  4X66 I;  4IFD B;  4LF6 E;  2EFG A;  4YY3 E;  2WW4 A;  4MU4 A;  4JI8 E;  2F4V E;  2VQE E;  2UUA E;  4MDT A;  2Q2E B;  1MX0 A;  2BR2 A;  3LTO A;  4XTJ A;  5BR8 I;  3CWV A;  4DV4 E;  5LMN I;  4OO1 F;  5DRO A;  5LMU E;  5K36 C;  4Z7C A;  1Z0V A;  4JI1 E;  1N34 E;  3GCM A;  1U2R A;  2AE8 A;  2J65 A;  1XHK A;  3ZZ0 A;  3LNU A;  4LF4 I;  3L7Z A;  4WUD A;  1XMO I;  5K36 D;  1EI1 A;  4DR5 E;  3M6A A;  4IFD F;  1UDQ A;  1XMQ E;  4JI2 I;  1FWK A;  4JI0 I;  3L7Z B;  4X62 E;  4LFA I;  1USV A;  4IZK A;  4GKK E;  2O3Z A;  4X66 E;  2WNR B;  2AJ4 A;  2CVE A;  4FWG A;  3F0N A;  5JEA A;  1KVK A;  1ZM9 A;  4DU8 A;  2PO2 B;  1IBM E;  5DRQ A;  3D4J A;  1E3H A;  2JE6 A;  5BR8 E;  4IZJ B;  4FW7 A;  2V34 A;  4FW9 A;  3CDI A;  1IBK I;  3PYE A;  3QT7 A;  1HNZ I;  1D6T A;  1PIE A;  1Z0T A;  4AM3 A;  4LF4 E;  1NHI A;  3QT6 A;  4DV7 I;  4BA2 B;  2V2V A;  5C0X F;  1XMO E;  4B3S I;  4NXN I;  3M85 D;  1Y4U A;  2UXB I;  4LCG A;  5DNL A;  5L3J A;  4JI2 E;  2PNM A;  4WUB A;  4LFA E;  1N0V C;  2NN6 C;  3QT5 A;  2E5L E;  2C37 B;  1ZM4 A;  4MQY A;  1MU5 A;  2HFS A;  5GME A;  3Q6N A;  2R3V A;  1UEK A;  3ZKB A;  1OYS A;  4HY1 A;  5K36 B;  2NN6 D;  2CG9 A;  1HK7 A;  3WU5 A;  1ZXM A;  4JV5 I;  4DR6 I;  1EA6 A;  3LPS A;  1IBK E;  3P3G A;  1HNZ E;  4LF6 I;  2WP8 A;  4FW5 A;  4IS9 A;  4JI8 I;  2ZM6 I;  1UDO A;  4DV3 I;  4USK A;  1BKN A;  4B3S E;  4YHH E;  4B3M I;  3J81 Q;  2A2D A;  2UXB E;  4LF5 I;  2PNZ A;  5LMU I;  3B78 A;  1N34 I;  3ZZT A;  1R6L A;  2JEB A;  2E1R A;  1RHY A;  1OYP A;  3HKM A;  2C38 B;  3K17 A;  5JEA C;  4DR5 I;  2GO4 A;  2PNZ B;  4LOM A;  1VIS A;  2VES A;  1UDN A;  2HKJ A;  4LCH A;  2UXD I;  4OO1 A;  4EMD A;  1XNQ I;  4JV5 E;  1Z5C A;  3GON A;  5JEA D;  4DR6 E;  5C0X D;  2VQF I;  2NN6 A;  1DAR A;  1E3P A;  2OI2 A;  4JI3 E;  2PO0 A;  4U3D A;  2HFU A;  2ZBK B;  2UXC E;  2X36 A;  2ZM6 E;  4KQV A;  4DV3 E;  1IBM I;  4FW3 A;  4B3M E;  2NN6 B;  4LF5 E;  4FN5 A;  4DV6 E;  1USU A;  1ZM2 A;  5JEA E;  1HR0 E;  1K47 A;  2V2Q A;  4ED4 A;  2Z5B A;  1NHH A;  4DR7 E;  1Z0C A;  2BR2 B;  3J80 Q;  3NZK A;  4OX9 I;  4DV5 E;  1Z0G A;  1YH8 A;  2V8P A;  4LPF A;  2UUC I;  2ZIT A;  4LF9 I;  2UXD E;  1XNQ E;  3ZKD A;  1VI7 A;  2E5L I;  3M85 G;  4JI4 I;  2VQF E;  3DD6 A;  1I94 I;  4DUZ E;  2CZ9 A;  1S4E A;  2A2C A;  1IBL I;  5C0X A;  2JEA A;  3T1H I;  5K36 E;  5IT9 Q;  1H74 A;  3K1J A;  2BM0 A;  4IZK B;  1H7S A;  2O1V A;  3ZZU A;  4DPT A;  4HXZ A;  3J81 C;  1FI4 A;  1NHJ A;  1PKP A;  2JT2 A;  1Y6Z A;  1YHC A;  1Z0E A;  5JEA B;  1HNX E;  4DR4 I;  1ZXN A;  4GQU A;  2UU9 I;  4FW4 A;  2JE6 B;  4MU3 A;  4OX9 E;  3UHM A;  4YHH I;  4DUY I;  3QT8 A;  2UUC E;  4URL A;  4WUC A;  4AIM A;  4B3R E;  4OO1 C;  4QNK A;  4LF9 E;  3HUL A;  4DV0 E;  4JI4 E;  1I94 E;  5EKW A;  4J3D A;  1J5E E;  2GQ0 A;  4OO1 D;  1IBL E;  3T1H E;  3OTO E;  2J7K A;  1KTV A;  3P76 A;  4JI5 I;  3J7A G;  1RR9 A;  3U1K A;  3GLL A;  4IFD D;  4JI3 I;  4DR4 E;  1XNR I;  2XEX A;  4M1K A;  4MU0 A;  4Z7Y A;  2UXC I;  2UU9 E;  4BA1 A;  4ZVI A;  4DR3 E;  3J80 C;  2O1U A;  3B82 A;  2IOQ A;  4DPW A;  4DUY E;  2PO1 A;  1N33 E;  2NN6 E;  4DR1 I;  2UUB I;  4DV6 I;  2WP8 B;  4JYA E;  5IWA I;  1HR0 I;  4OZE A;  5K36 F;  3PRY A;  4BA1 B;  4AID A;  4DR7 I;  2Z5C A;  3ZM7 A;  4LFC E;  5FLX Q;  1ZM3 A;  2BA0 G;  3U1Y A;  4UTG A;  4DV5 I;  5C0X C;  2V2Z A;  1N32 I;  3WU4 A;  1UDS A;  5DRP A;  3V5R A;  1Z0W A;  3B8H A;  4K0K I;  2JEB B;  2C39 A;  5IT9 C;  3P06 A;  3PS1 A;  3Q1Q A;  4JI5 E;  4DV1 E;  1RRE A;  4DUZ I;  1XNR E;  4JG4 A;  2IOP A;  4DR2 I;  5GMD A;  3Q6M A;  1OYR A;  4LF7 I;  3T1Y I;  4U3B A;  1B63 A;  4OO1 B;  4NBQ A;  4IFD A;  2GS8 A;  4DR1 E;  4IZJ D;  4PU9 A;  3PYG A;  2BA0 D;  4OKG A;  1Y5Y A;  3PS2 A;  1FNM A;  2UUB E;  1H72 C;  2PO0 B;  5IWA E;  1HNX I;  4LF8 I;  5EL9 A;  3JAM Q;  4HYM A;  2DEJ A;  4FW6 A;  5C0X E;  2HKE A;  5A2Q Q;  3PYD A;  4NXM I;  3KRN A;  4PRX A;  2VF3 A;  1N32 E;  4R1F A;  4RPF A;  4KHP I;  4K0K E;  4B3R I;  2Z5B B;  4DV2 E;  2BV3 A;  4DV0 I;  1FJG E;  4PRV A;  1HNW I;  1B62 A;  2NN6 F;  4X64 I;  1J5E I;  1Y4S A;  4DR2 E;  1H7U A;  2HK2 A;  2HHH E;  4LF7 E;  3T1Y E;  3OTO I; 
#chains in the Genus database with same CATH homology
 4B3T I;  4P52 A;  4MYT A;  4LFB I;  1Z0B A;  2NPF A;  4I3H A;  4LF8 E;  4IZJ A;  4X65 E;  4UT4 A;  2O1T A;  4NXM E;  1S16 A;  1NZ0 A;  2Z5E A;  4DR3 I;  5FLX C;  2HK3 A;  1N33 I;  4DPY A;  4KHP E;  4JI6 I;  2BM1 A;  4JYA I;  3HJC A;  3WU6 A;  5LMN E;  3V2U C;  1HNW E;  1KIJ A;  3K85 A;  4LFC I;  4FWD A;  4JI7 I;  4X64 E;  1ELO A;  2R42 A;  4N3O A;  2DEI A;  2CGE A;  1PVG A;  4B3T E;  4LFB E;  4P7A A;  4DV1 I;  1H73 A;  5FWK A;  1A6F A;  4JI0 E;  3WU3 A;  4FWH A;  4GKJ I;  3JAM C;  5A2Q C;  2O1W A;  1FKA E;  4JI6 E;  3J7A M;  4AQY I;  1QZR A;  4DPX A;  1KKH A;  1MG7 A;  1N36 I;  4MYU A;  4JI7 E;  4YY3 I;  2F4V I;  2VQE I;  4DV7 E;  2UUA I;  4HAC A;  4DU7 A;  1WUU A;  2Z5C B;  4NXN E;  2PNL A;  4DV4 I;  1OJ4 A;  4DV2 I;  4DPU A;  1FJG I;  4USM A;  4JI1 I;  1N0U A;  4GKJ E;  5LL6 R;  4HAC B;  2HHH I;  2LJP A;  1Z59 A;  1Z5B A;  3PYF A;  1Z5A A;  2X7I A;  1XMQ I;  1FWL A;  4AQY E;  4X62 I;  3H4L A;  4DXL A;  1N36 E;  4GKK I;  4X65 I;  4X66 I;  4LF6 E;  2EFG A;  4YY3 E;  2WW4 A;  4JI8 E;  2F4V E;  2VQE E;  2UUA E;  2Q2E B;  1MX0 A;  3LTO A;  4XTJ A;  5BR8 I;  3CWV A;  4DV4 E;  5LMN I;  5LMU E;  4Z7C A;  1Z0V A;  4JI1 E;  1N34 E;  1U2R A;  1XHK A;  3ZZ0 A;  3LNU A;  4LF4 I;  4WUD A;  1XMO I;  1EI1 A;  4DR5 E;  3M6A A;  1XMQ E;  4JI2 I;  1FWK A;  4JI0 I;  4X62 E;  4LFA I;  1USV A;  4IZK A;  4GKK E;  4X66 E;  2AJ4 A;  4FWG A;  3F0N A;  1KVK A;  1ZM9 A;  4DU8 A;  1IBM E;  3D4J A;  5BR8 E;  4IZJ B;  2V34 A;  4FW9 A;  1IBK I;  3PYE A;  3QT7 A;  1HNZ I;  1D6T A;  1PIE A;  1Z0T A;  4LF4 E;  1NHI A;  3QT6 A;  4DV7 I;  2V2V A;  1XMO E;  4B3S I;  4NXN I;  1Y4U A;  2UXB I;  5L3J A;  4JI2 E;  2PNM A;  4WUB A;  4LFA E;  1N0V C;  3QT5 A;  2E5L E;  1ZM4 A;  1MU5 A;  2HFS A;  5GME A;  3Q6N A;  2R3V A;  1UEK A;  3ZKB A;  4HY1 A;  2CG9 A;  1HK7 A;  3WU5 A;  1ZXM A;  4JV5 I;  4DR6 I;  1EA6 A;  3LPS A;  1IBK E;  1HNZ E;  4LF6 I;  4JI8 I;  2ZM6 I;  4DV3 I;  4USK A;  1BKN A;  4B3S E;  4YHH E;  4B3M I;  3J81 Q;  2A2D A;  2UXB E;  4LF5 I;  5LMU I;  3B78 A;  1N34 I;  3ZZT A;  2E1R A;  3K17 A;  4DR5 I;  1VIS A;  2HKJ A;  2UXD I;  4EMD A;  1XNQ I;  4JV5 E;  1Z5C A;  3GON A;  4DR6 E;  2VQF I;  1DAR A;  2OI2 A;  4JI3 E;  2HFU A;  2ZBK B;  2UXC E;  2X36 A;  2ZM6 E;  4KQV A;  4DV3 E;  1IBM I;  4B3M E;  4LF5 E;  4FN5 A;  4DV6 E;  1USU A;  1ZM2 A;  1HR0 E;  1K47 A;  2V2Q A;  4ED4 A;  2Z5B A;  1NHH A;  4DR7 E;  1Z0C A;  3J80 Q;  4OX9 I;  4DV5 E;  1Z0G A;  2V8P A;  2UUC I;  2ZIT A;  4LF9 I;  2UXD E;  1XNQ E;  3ZKD A;  2E5L I;  4JI4 I;  2VQF E;  1I94 I;  4DUZ E;  2CZ9 A;  1S4E A;  2A2C A;  1IBL I;  3T1H I;  5IT9 Q;  1H74 A;  3K1J A;  2BM0 A;  4IZK B;  1H7S A;  2O1V A;  3ZZU A;  4DPT A;  4HXZ A;  3J81 C;  1FI4 A;  1NHJ A;  1PKP A;  1Y6Z A;  1HNX E;  1Z0E A;  4DR4 I;  1ZXN A;  2UU9 I;  4OX9 E;  4YHH I;  4DUY I;  3QT8 A;  2UUC E;  4URL A;  4WUC A;  4B3R E;  4LF9 E;  3HUL A;  4DV0 E;  4JI4 E;  1I94 E;  1J5E E;  2GQ0 A;  1IBL E;  3T1H E;  3OTO E;  2J7K A;  1KTV A;  4JI5 I;  3J7A G;  1RR9 A;  4JI3 I;  4DR4 E;  1XNR I;  2XEX A;  4M1K A;  4Z7Y A;  2UXC I;  2UU9 E;  4ZVI A;  4DR3 E;  3J80 C;  2O1U A;  3B82 A;  2IOQ A;  4DPW A;  4DUY E;  1N33 E;  4DR1 I;  2UUB I;  4DV6 I;  4JYA E;  5IWA I;  1HR0 I;  3PRY A;  4DR7 I;  2Z5C A;  3ZM7 A;  4LFC E;  5FLX Q;  1ZM3 A;  4UTG A;  4DV5 I;  2V2Z A;  1N32 I;  3WU4 A;  3V5R A;  1Z0W A;  3B8H A;  4K0K I;  5IT9 C;  3P06 A;  3Q1Q A;  4JI5 E;  4DV1 E;  1RRE A;  4DUZ I;  1XNR E;  4JG4 A;  2IOP A;  4DR2 I;  5GMD A;  3Q6M A;  4LF7 I;  3T1Y I;  1B63 A;  2GS8 A;  4DR1 E;  4IZJ D;  4PU9 A;  3PYG A;  2UUB E;  1FNM A;  1H72 C;  5IWA E;  1HNX I;  4LF8 I;  3JAM Q;  4HYM A;  2DEJ A;  2HKE A;  5A2Q Q;  3PYD A;  4NXM I;  4PRX A;  2VF3 A;  1N32 E;  4R1F A;  4RPF A;  4KHP I;  4K0K E;  4B3R I;  2Z5B B;  4DV2 E;  2BV3 A;  4DV0 I;  1FJG E;  4PRV A;  1HNW I;  1B62 A;  4X64 I;  1J5E I;  1Y4S A;  4DR2 E;  1H7U A;  2HK2 A;  2HHH E;  4LF7 E;  3T1Y E;  3OTO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...