4DV0I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv0I00
2UUCE 5IT9C 1HNWI 1EA6A 2BM0A 1KVKA 2OI2A 4X62I 5IWAE 3V5RA 4LF5E 2A2DA 4KHPI 1XMOI 4WUBA 2HFSA 4DR4I 4DR7E 4DR1I 2VQEI 3JAMQ 4YHHE 2UXCI 1PKPA 1XNQI 3Q1QA 4LF4I 4EMDA 1KIJA 4K0KI 1XMQE 4USKA 4HY1A 3T1HI 4DUZI 5LL6R 3QT7A 1NZ0A 3PYEA 4JI0I 1Z0BA 4LFAI 2E5LI 4DV1E 4PRXA 1U2RA 3PYFA 1ZM3A 5A2QQ 5IWAI 4LF5I 4URLA 1Z5AA 4M1KA 4DPXA 1D6TA 1H74A 2UU9E 1H73A 2ZM6E 1HNZE 4DR7I 1J5EE 2V2ZA 3LPSA 1IBME 1FWKA 4YHHI 1N0VC 3HULA 3ZZTA 4JV5E 1Z5CA 4B3RI 3B82A 1HNWE 2R3VA 4X62E 1XMQI 3JAMC 4RPFA 4DV0E 1KKHA 1IBKE 2V8PA 3K17A 1ZM4A 1VISA 3OTOE 2BV3A 3J81C 4DR1E 4DV1I 4JI6E 4FWDA 4GKKE 1FJGE 2CZ9A 1ZXNA 4LF8E 1Z0GA 1FKAE 1N34E 4X66E 2LJPA 4DV6E 3LNUA 1N33E 2UU9I 4PU9A 2DEJA 4FN5A 2ZITA 2ZM6I 1HNZI 2V2VA 2E5LE 1J5EI 3B78A 2GS8A 1IBMI 3GONA 4JV5I 4DU8A 3LTOA 1XHKA 1MU5A 4DR6E 3QT8A 2UUBE 2EFGA 1N0UA 4DV0I 1FI4A 1N32E 4DPYA 1IBKI 3WU3A 4DPWA 3ZM7A 3OTOI 4DUYE 2AJ4A 4JI6I 4JI1I 4GKKI 1FJGI 4NXNE 4LF8I 4B3RE 1DARA 4Z7CA 4I3HA 1WUUA 1Z0CA 1N34I 4X66I 1B62A 4DV6I 4GKJI 1N33I 3J80Q 4JI8E 1ELOA 3ZKBA 1PVGA 4DR2E 4LF6E 3PYDA 2UXDE 4DR3E 5GMDA 3ZZ0A 1H72C 4DR6I 3F0NA 2UUBI 4XTJA 1ZM2A 2HHHI 3ZZUA 3D4JA 3QT6A 1N32I 1Z59A 4DV7E 4WUCA 4HACA 4DUYI 3WU5A 4HACB 4NXNI 1UEKA 1H7SA 3WU4A 3QT5A 4DU7A 1Z5BA 3PYGA 1ZM9A 4DR5E 1RREA 1OJ4A 4JG4A 4NXME 1EI1A 4JI8I 4KQVA 3J7AM 1B63A 2HKEA 2NPFA 4JI1E 4DR2I 4LF6I 2UXDI 4DR3I 4Z7YA 2UXBE 4DV2E 1I94E 4LF9E 4LF7I 4GKJE 5BR8E 4MYTA 1QZRA 4DV7I 4ED4A 5A2QC 4DV3I 2F4VE 1ZXMA 4UTGA 1N36E 1K47A 2BM1A 4DXLA 4DV5I 4DV4E 5LMNE 2A2CA 5L3JA 2HHHE 4B3SE 2HK2A 4LFCE 4DR5I 4P7AA 1Z0VA 4JI5E 4NXMI 1PIEA 2UUAE 4FWGA 2E1RA 4DPUA 2HK3A 2UXBI 4YY3E 4B3ME 1H7UA 1XNRE 2HFUA 3V2UC 1S16A 4DV2I 1I94I 2Q2EB 4ZVIA 4LF9I 5FLXQ 4JYAI 1HNXE 3H4LA 4JI7E 4JI3E 2V34A 5BR8I 5GMEA 1S4EA 1KTVA 2HKJA 4HYMA 2F4VI 2R42A 4USMA 1IBLE 1N36I 3J81Q 1HR0E 4DV4I 5LMNI 4AQYE 4JI2E 1Z0WA 4B3TI 4B3SI 2WW4A 2ZBKB 1MX0A 4LFCI 1NHIA 4LF7E 4DPTA 4JI5I 4OX9I 1FNMA 4X65E 4FWHA 2UUAI 4FW9A 2J7KA 4DV3E 2UUCI 3K1JA 4JI4E 4PRVA 4YY3I 1MG7A 4B3MI 4LFBE 3M6AA 4DV5E 1XNRI 4X64E 5IT9Q 4MYUA 2XEXA 3T1YE 1HNXI 3ZKDA 4R1FA 2X36A 4JI7I 4JI3I 1BKNA 4WUDA 1RR9A 2VQFE 5LMUE 1NHHA 5FLXC 1IBLI 1FWLA 2V2QA 1HR0I 3J80C 4JYAE 2X7IA 4AQYI 3WU6A 4KHPE 1XMOE 3CWVA 4JI2I 4DR4E 4X65I 3J7AG 2VQEE 2UXCE 4JI4I 4UT4A 1XNQE 1NHJA 4LFBI 4LF4E 3B8HA 4P52A 4X64I 4K0KE 1Z0EA 3T1YI 4HXZA 2VF3A 1A6FA 2DEIA 4B3TE 3T1HE 4DUZE 4JI0E 4LFAE 4OX9E 2VQFI 1Z0TA 5LMUI
chains in the Genus database with same CATH superfamily
4U3BA 2UUCE 2CGEA 5IT9C 4QNKA 1HNWI 1EA6A 2BR2A 4FW4A 2BM0A 1KVKA 2CVEA 2OI2A 5IWAE 4X62I 1OYRA 3V5RA 4LF5E 3KRNA 4IFDD 2A2DA 4KHPI 1XMOI 4OZEA 4WUBA 2HFSA 4DR4I 2AE8A 4DR7E 4DR1I 2VQEI 3JAMQ 4YHHE 2UXCI 1PKPA 2GO4A 3M85G 4OKGA 1XNQI 2IESA 3Q1QA 4LF4I 4EMDA 1KIJA 4K0KI 1XMQE 4USKA 1E3HA 1UDOA 3K85A 4HY1A 3T1HI 3CDIA 5LL6R 3QT7A 1NZ0A 3PYEA 5C0XB 3B4TA 4DUZI 4JI0I 1Z0BA 3P3GA 4LFAI 2E5LI 4DV1E 1USUA 4PRXA 1U2RA 3PYFA 1ZM3A 5A2QQ 4MU4A 1Y4UA 5IWAI 4LF5I 3GLLA 1Z5AA 4M1KA 4DPXA 4URLA 2PO1A 1D6TA 1H74A 2PO1B 2UU9E 2JE6A 1H73A 4IFDA 3P76A 2ZM6E 1HNZE 2JE6B 4DR7I 1J5EE 2V2ZA 4IFDB 3LPSA 1IBME 1FWKA 4YHHI 1N0VC 3HULA 3ZZTA 3PS2A 5EL9A 4JV5E 1Z5CA 3P3EA 2VESA 4B3RI 3B82A 1HNWE 2R3VA 2GO3A 4X62E 2C38A 1XMQI 1E3PA 1P42A 3JAMC 5DRRA 4RPFA 2C38B 4DV0E 1KKHA 1IBKE 2V8PA 3K17A 4AM3A 1ZM4A 1VISA 3DD6A 3OTOE 2BV3A 3J81C 4FW5A 2PO2A 4DV1I 4DR1E 4JI6E 4FWDA 4FW6A 1USVA 4ISAA 4GKKE 4LCFA 1FJGE 2BA1D 1ZXNA 2CZ9A 2PO2B 4LF8E 3Q6NA 1Z0GA 2BA0G 4GQUA 1FKAE 4IZJA 1N34E 4X66E 2LJPA 4DV6E 3LNUA 3U1KA 4IZJB 1N33E 2UU9I 4PU9A 3M7NG 2DEJA 4FN5A 5FWKA 2ZITA 4LCGA 2ZM6I 1HNZI 4NBQA 2V2VA 2E5LE 1J5EI 3B78A 2GS8A 1IBMI 1UDSA 1XXEA 3GONA 2IOQA 4JV5I 2WNRA 2CG9A 4DU8A 3LTOA 1XHKA 3NZKA 5K36F 1MU5A 2JEBA 4DR6E 5K36C 1VI7A 3QT8A 2WNRB 2UUBE 5ELWA 2EFGA 2BR2B 3HJCA 3Q6MA 5DRPA 1N0UA 2F1DA 4DV0I 1FI4A 5DRQA 1N32E 4DPYA 1IBKI 3WU3A 4DPWA 3ZM7A 3OTOI 4DUYE 1OYSA 2AJ4A 4JI6I 4JI1I 4GKKI 1R6MA 1FJGI 4NXNE 4LF8I 2O1TA 4B3RE 1DARA 4Z7CA 4I3HA 1WUUA 1Z0CA 1N34I 4X66I 1B62A 2PNMA 4DV6I 4GKJI 1N33I 3U1YA 3J80Q 4JI8E 1ELOA 5K36D 3ZKBA 3PS3A 1PVGA 3M85D 4DR2E 4LF6E 3PYDA 2UXDE 4DR3E 5GMDA 3ZZ0A 4AIMA 2WP8A 1H72C 4DR6I 3F0NA 2UUBI 4LCHA 4XTJA 1ZM2A 2HHHI 3ZZUA 3D4JA 3QT6A 1N32I 1Z59A 4DV7E 4WUCA 4HACA 4DUYI 3WU5A 4HACB 5JEAF 4NXNI 5JEAC 1UEKA 2PNLA 1H7SA 3WU4A 3QT5A 4DU7A 1Z5BA 3PYGA 4FW3A 1ZM9A 4DR5E 1RREA 5C0XF 1OJ4A 4JG4A 4NXME 1EI1A 4JI8I 5K36E 3UHMA 4KQVA 3J7AM 1B63A 4BA2A 2HKEA 2J65A 2NPFA 3CDJA 4DR2I 4JI1E 4LF6I 4BA2B 2UXDI 5K36A 4DR3I 2JT2A 4Z7YA 2UXBE 4OO1F 4OO1C 5K36B 4DV2E 1I94E 4LF9E 5EKWA 4N3OA 4LF7I 4GKJE 2O1WA 5BR8E 5JEAD 1HK7A 4IFDF 4MYTA 1QZRA 4DV7I 4ED4A 5A2QC 3GMEA 4DV3I 2F4VE 4IZKA 2JEAA 4QNJA 1ZXMA 4UTGA 1N36E 1K47A 5C0XD 2BM1A 4IZKB 4DXLA 2JEAB 4DV5I 2C37A 4DV4E 1RHYA 5LMNE 2A2CA 2JEBB 5L3JA 2HHHE 4B3SE 2HK2A 4LFCE 4DR5I 4P7AA 1Z0VA 2PO0A 4JI5E 4NXMI 1PIEA 2UUAE 4OO1D 4FWGA 4MQYA 2NN6F 2NN6C 2E1RA 4DPUA 1R6LA 2HK3A 4IS9A 4MDTA 4J3DA 4YY3E 2UXBI 4B3ME 1H7UA 1XNRE 2HFUA 3V2UC 1S16A 2Z5EA 4DV2I 1I94I 2Q2EB 4ZVIA 4LF9I 5FLXQ 4JYAI 1HNXE 3H4LA 1YHCA 3H1CA 5JEAE 4JI7E 4JI3E 2V34A 5BR8I 5GMEA 1S4EA 1Y6ZA 1UDNA 1KTVA 5JEAA 2HKJA 4HYMA 2F4VI 2R42A 1UDQA 1OYPA 4USMA 1IBLE 5JEAB 5C0XE 1N36I 3J81Q 1HR0E 5DNXA 4DV4I 5C0XA 5LMNI 4U3DA 4AQYE 1Y4SA 2NN6D 2WP8B 4JI2E 1Z0WA 4B3TI 2WW4A 2ZBKB 4B3SI 1MX0A 4LFCI 1NHIA 4LF7E 4DPTA 3PS1A 4OO1E 4JI5I 4OX9I 2PNZA 1FNMA 4LPFA 4X65E 4FWHA 2UUAI 4FW9A 4MU3A 2J7KA 2PNZB 4DV3E 2UUCI 3K1JA 3P3CA 4OO1A 3HKMA 4JI4E 4IZJD 4PRVA 5DROA 4YY3I 1MG7A 4B3MI 4LFBE 4OO1B 3M6AA 4DV5E 4IFDE 1XNRI 4BA1A 4X64E 5IT9Q 4MYUA 2XEXA 3T1YE 4LOMA 1HNXI 3ZKDA 4BA1B 4R1FA 2X36A 2O1VA 4JI7I 4JI3I 5C0XC 1BKNA 4WUDA 2Z5CA 2GQ0A 1RR9A 2VQFE 2IOPA 5LMUE 2Z5CB 4FW7A 1NHHA 5FLXC 1Y60A 1IBLI 2BA1G 1FWLA 3GCMA 2V2QA 1HR0I 2O3ZA 3J80C 2NN6E 4JYAE 2X7IA 4AQYI 3WU6A 4KHPE 1XMOE 2Z5BA 3CWVA 4JI2I 4DR4E 2NN6A 1YH8A 2Z5BB 2O1UA 4X65I 5DNLA 3P06A 3J7AG 4IFDC 2VQEE 2NN6B 2UXCE 4JI4I 4AIDA 4UT4A 2BA0D 1XNQE 1NHJA 4LFBI 4LF4E 3B8HA 4P52A 3L7ZA 4X64I 4K0KE 1Z0EA 1Y5YA 3T1YI 4HXZA 4MU0A 2VF3A 3L7ZB 3M7ND 1A6FA 2C37B 2DEIA 4MU1A 4B3TE 3T1HE 2C39A 4DUZE 2IERA 4JI0E 4LFAE 3PRYA 4OX9E 2C39B 2VQFI 1Z0TA 5LMUI 2PO0B
chains in the Genus database with same CATH topology
2UUCE 2CGEA 5IT9C 1HNWI 1EA6A 2BM0A 1KVKA 2OI2A 4X62I 5IWAE 3V5RA 4LF5E 2A2DA 4KHPI 1XMOI 4WUBA 2HFSA 4DR4I 4DR7E 4DR1I 2VQEI 3JAMQ 4YHHE 2UXCI 1PKPA 1XNQI 3Q1QA 4LF4I 4EMDA 1KIJA 4K0KI 1XMQE 4USKA 3K85A 4HY1A 3T1HI 4DUZI 5LL6R 3QT7A 1NZ0A 3PYEA 4JI0I 1Z0BA 4LFAI 2E5LI 4DV1E 1USUA 4PRXA 1U2RA 3PYFA 1ZM3A 5A2QQ 1Y4UA 5IWAI 4LF5I 4URLA 1Z5AA 4M1KA 4DPXA 1D6TA 1H74A 2UU9E 1H73A 2ZM6E 1HNZE 4DR7I 1J5EE 2V2ZA 3LPSA 1IBME 1FWKA 4YHHI 1N0VC 3HULA 3ZZTA 4JV5E 1Z5CA 4B3RI 3B82A 1HNWE 2R3VA 4X62E 1XMQI 3JAMC 4RPFA 4DV0E 1KKHA 1IBKE 2V8PA 3K17A 1ZM4A 1VISA 3OTOE 2BV3A 3J81C 4DR1E 4DV1I 4JI6E 4FWDA 1USVA 4GKKE 1FJGE 2CZ9A 1ZXNA 4LF8E 3Q6NA 1Z0GA 1FKAE 4IZJA 1N34E 4X66E 2LJPA 4DV6E 3LNUA 4IZJB 1N33E 2UU9I 4PU9A 2DEJA 4FN5A 5FWKA 2ZITA 2ZM6I 1HNZI 2V2VA 2E5LE 1J5EI 3B78A 2GS8A 1IBMI 3GONA 2IOQA 4JV5I 2CG9A 4DU8A 3LTOA 1XHKA 1MU5A 4DR6E 3QT8A 2UUBE 2EFGA 3HJCA 3Q6MA 1N0UA 4DV0I 1FI4A 1N32E 4DPYA 1IBKI 3WU3A 4DPWA 3ZM7A 3OTOI 4DUYE 2AJ4A 4JI6I 4JI1I 4GKKI 1FJGI 4NXNE 4LF8I 2O1TA 4B3RE 1DARA 4Z7CA 4I3HA 1WUUA 1Z0CA 1N34I 4X66I 1B62A 2PNMA 4DV6I 4GKJI 1N33I 3J80Q 4JI8E 1ELOA 3ZKBA 1PVGA 4DR2E 4LF6E 3PYDA 2UXDE 4DR3E 5GMDA 3ZZ0A 1H72C 4DR6I 3F0NA 2UUBI 4XTJA 1ZM2A 2HHHI 3ZZUA 3D4JA 3QT6A 1N32I 1Z59A 4DV7E 4WUCA 4HACA 4DUYI 3WU5A 4HACB 4NXNI 1UEKA 2PNLA 1H7SA 3WU4A 3QT5A 4DU7A 1Z5BA 3PYGA 1ZM9A 4DR5E 1RREA 1OJ4A 4JG4A 4NXME 1EI1A 4JI8I 4KQVA 3J7AM 1B63A 2HKEA 2NPFA 4JI1E 4DR2I 4LF6I 2UXDI 4DR3I 4Z7YA 2UXBE 4DV2E 1I94E 4LF9E 4N3OA 4LF7I 4GKJE 2O1WA 5BR8E 1HK7A 4MYTA 1QZRA 4DV7I 4ED4A 5A2QC 4DV3I 2F4VE 4IZKA 1ZXMA 4UTGA 1N36E 1K47A 2BM1A 4IZKB 4DXLA 4DV5I 4DV4E 5LMNE 2A2CA 5L3JA 2HHHE 4B3SE 2HK2A 4LFCE 4DR5I 4P7AA 1Z0VA 4JI5E 4NXMI 1PIEA 2UUAE 4FWGA 2E1RA 4DPUA 2HK3A 2UXBI 4YY3E 4B3ME 1H7UA 1XNRE 2HFUA 3V2UC 1S16A 2Z5EA 4DV2I 1I94I 2Q2EB 4ZVIA 4LF9I 5FLXQ 4JYAI 1HNXE 3H4LA 4JI7E 4JI3E 2V34A 5BR8I 5GMEA 1S4EA 1Y6ZA 1KTVA 2HKJA 4HYMA 2F4VI 2R42A 4USMA 1IBLE 1N36I 3J81Q 1HR0E 4DV4I 5LMNI 4AQYE 1Y4SA 4JI2E 1Z0WA 4B3TI 2WW4A 2ZBKB 4B3SI 1MX0A 4LFCI 1NHIA 4LF7E 4DPTA 4JI5I 4OX9I 1FNMA 4X65E 4FWHA 2UUAI 4FW9A 2J7KA 4DV3E 2UUCI 3K1JA 4JI4E 4IZJD 4PRVA 4YY3I 1MG7A 4B3MI 4LFBE 3M6AA 4DV5E 1XNRI 4X64E 5IT9Q 4MYUA 2XEXA 3T1YE 1HNXI 3ZKDA 4R1FA 2X36A 2O1VA 4JI7I 4JI3I 1BKNA 4WUDA 2Z5CA 2GQ0A 1RR9A 2VQFE 2IOPA 5LMUE 2Z5CB 1NHHA 5FLXC 1IBLI 1FWLA 2V2QA 1HR0I 3J80C 4JYAE 2X7IA 4AQYI 3WU6A 4KHPE 1XMOE 2Z5BA 3CWVA 4JI2I 4DR4E 2Z5BB 2O1UA 4X65I 3P06A 3J7AG 2VQEE 2UXCE 4JI4I 4UT4A 1XNQE 1NHJA 4LFBI 4LF4E 3B8HA 4P52A 4X64I 4K0KE 1Z0EA 3T1YI 4HXZA 2VF3A 1A6FA 2DEIA 4B3TE 3T1HE 4DUZE 4JI0E 4LFAE 3PRYA 4OX9E 2VQFI 1Z0TA 5LMUI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC E;  5IT9 C;  1HNW I;  1EA6 A;  2BM0 A;  1KVK A;  2OI2 A;  4X62 I;  5IWA E;  3V5R A;  4LF5 E;  2A2D A;  4KHP I;  1XMO I;  4WUB A;  2HFS A;  4DR4 I;  4DR7 E;  4DR1 I;  2VQE I;  3JAM Q;  4YHH E;  2UXC I;  1PKP A;  1XNQ I;  3Q1Q A;  4LF4 I;  4EMD A;  1KIJ A;  4K0K I;  1XMQ E;  4USK A;  4HY1 A;  3T1H I;  4DUZ I;  5LL6 R;  3QT7 A;  1NZ0 A;  3PYE A;  4JI0 I;  1Z0B A;  4LFA I;  2E5L I;  4DV1 E;  4PRX A;  1U2R A;  3PYF A;  1ZM3 A;  5A2Q Q;  5IWA I;  4LF5 I;  4URL A;  1Z5A A;  4M1K A;  4DPX A;  1D6T A;  1H74 A;  2UU9 E;  1H73 A;  2ZM6 E;  1HNZ E;  4DR7 I;  1J5E E;  2V2Z A;  3LPS A;  1IBM E;  1FWK A;  4YHH I;  1N0V C;  3HUL A;  3ZZT A;  4JV5 E;  1Z5C A;  4B3R I;  3B82 A;  1HNW E;  2R3V A;  4X62 E;  1XMQ I;  3JAM C;  4RPF A;  4DV0 E;  1KKH A;  1IBK E;  2V8P A;  3K17 A;  1ZM4 A;  1VIS A;  3OTO E;  2BV3 A;  3J81 C;  4DR1 E;  4DV1 I;  4JI6 E;  4FWD A;  4GKK E;  1FJG E;  2CZ9 A;  1ZXN A;  4LF8 E;  1Z0G A;  1FKA E;  1N34 E;  4X66 E;  2LJP A;  4DV6 E;  3LNU A;  1N33 E;  2UU9 I;  4PU9 A;  2DEJ A;  4FN5 A;  2ZIT A;  2ZM6 I;  1HNZ I;  2V2V A;  2E5L E;  1J5E I;  3B78 A;  2GS8 A;  1IBM I;  3GON A;  4JV5 I;  4DU8 A;  3LTO A;  1XHK A;  1MU5 A;  4DR6 E;  3QT8 A;  2UUB E;  2EFG A;  1N0U A;  4DV0 I;  1FI4 A;  1N32 E;  4DPY A;  1IBK I;  3WU3 A;  4DPW A;  3ZM7 A;  3OTO I;  4DUY E;  2AJ4 A;  4JI6 I;  4JI1 I;  4GKK I;  1FJG I;  4NXN E;  4LF8 I;  4B3R E;  1DAR A;  4Z7C A;  4I3H A;  1WUU A;  1Z0C A;  1N34 I;  4X66 I;  1B62 A;  4DV6 I;  4GKJ I;  1N33 I;  3J80 Q;  4JI8 E;  1ELO A;  3ZKB A;  1PVG A;  4DR2 E;  4LF6 E;  3PYD A;  2UXD E;  4DR3 E;  5GMD A;  3ZZ0 A;  1H72 C;  4DR6 I;  3F0N A;  2UUB I;  4XTJ A;  1ZM2 A;  2HHH I;  3ZZU A;  3D4J A;  3QT6 A;  1N32 I;  1Z59 A;  4DV7 E;  4WUC A;  4HAC A;  4DUY I;  3WU5 A;  4HAC B;  4NXN I;  1UEK A;  1H7S A;  3WU4 A;  3QT5 A;  4DU7 A;  1Z5B A;  3PYG A;  1ZM9 A;  4DR5 E;  1RRE A;  1OJ4 A;  4JG4 A;  4NXM E;  1EI1 A;  4JI8 I;  4KQV A;  3J7A M;  1B63 A;  2HKE A;  2NPF A;  4JI1 E;  4DR2 I;  4LF6 I;  2UXD I;  4DR3 I;  4Z7Y A;  2UXB E;  4DV2 E;  1I94 E;  4LF9 E;  4LF7 I;  4GKJ E;  5BR8 E;  4MYT A;  1QZR A;  4DV7 I;  4ED4 A;  5A2Q C;  4DV3 I;  2F4V E;  1ZXM A;  4UTG A;  1N36 E;  1K47 A;  2BM1 A;  4DXL A;  4DV5 I;  4DV4 E;  5LMN E;  2A2C A;  5L3J A;  2HHH E;  4B3S E;  2HK2 A;  4LFC E;  4DR5 I;  4P7A A;  1Z0V A;  4JI5 E;  4NXM I;  1PIE A;  2UUA E;  4FWG A;  2E1R A;  4DPU A;  2HK3 A;  2UXB I;  4YY3 E;  4B3M E;  1H7U A;  1XNR E;  2HFU A;  3V2U C;  1S16 A;  4DV2 I;  1I94 I;  2Q2E B;  4ZVI A;  4LF9 I;  5FLX Q;  4JYA I;  1HNX E;  3H4L A;  4JI7 E;  4JI3 E;  2V34 A;  5BR8 I;  5GME A;  1S4E A;  1KTV A;  2HKJ A;  4HYM A;  2F4V I;  2R42 A;  4USM A;  1IBL E;  1N36 I;  3J81 Q;  1HR0 E;  4DV4 I;  5LMN I;  4AQY E;  4JI2 E;  1Z0W A;  4B3T I;  4B3S I;  2WW4 A;  2ZBK B;  1MX0 A;  4LFC I;  1NHI A;  4LF7 E;  4DPT A;  4JI5 I;  4OX9 I;  1FNM A;  4X65 E;  4FWH A;  2UUA I;  4FW9 A;  2J7K A;  4DV3 E;  2UUC I;  3K1J A;  4JI4 E;  4PRV A;  4YY3 I;  1MG7 A;  4B3M I;  4LFB E;  3M6A A;  4DV5 E;  1XNR I;  4X64 E;  5IT9 Q;  4MYU A;  2XEX A;  3T1Y E;  1HNX I;  3ZKD A;  4R1F A;  2X36 A;  4JI7 I;  4JI3 I;  1BKN A;  4WUD A;  1RR9 A;  2VQF E;  5LMU E;  1NHH A;  5FLX C;  1IBL I;  1FWL A;  2V2Q A;  1HR0 I;  3J80 C;  4JYA E;  2X7I A;  4AQY I;  3WU6 A;  4KHP E;  1XMO E;  3CWV A;  4JI2 I;  4DR4 E;  4X65 I;  3J7A G;  2VQE E;  2UXC E;  4JI4 I;  4UT4 A;  1XNQ E;  1NHJ A;  4LFB I;  4LF4 E;  3B8H A;  4P52 A;  4X64 I;  4K0K E;  1Z0E A;  3T1Y I;  4HXZ A;  2VF3 A;  1A6F A;  2DEI A;  4B3T E;  3T1H E;  4DUZ E;  4JI0 E;  4LFA E;  4OX9 E;  2VQF I;  1Z0T A;  5LMU I; 
#chains in the Genus database with same CATH topology
 4U3B A;  2UUC E;  2CGE A;  5IT9 C;  4QNK A;  1HNW I;  1EA6 A;  2BR2 A;  4FW4 A;  2BM0 A;  1KVK A;  2CVE A;  2OI2 A;  5IWA E;  4X62 I;  1OYR A;  3V5R A;  4LF5 E;  3KRN A;  4IFD D;  2A2D A;  4KHP I;  1XMO I;  4OZE A;  4WUB A;  2HFS A;  4DR4 I;  2AE8 A;  4DR7 E;  4DR1 I;  2VQE I;  3JAM Q;  4YHH E;  2UXC I;  1PKP A;  2GO4 A;  3M85 G;  4OKG A;  1XNQ I;  2IES A;  3Q1Q A;  4LF4 I;  4EMD A;  1KIJ A;  4K0K I;  1XMQ E;  4USK A;  1E3H A;  1UDO A;  3K85 A;  4HY1 A;  3T1H I;  3CDI A;  5LL6 R;  3QT7 A;  1NZ0 A;  3PYE A;  5C0X B;  3B4T A;  4DUZ I;  4JI0 I;  1Z0B A;  3P3G A;  4LFA I;  2E5L I;  4DV1 E;  1USU A;  4PRX A;  1U2R A;  3PYF A;  1ZM3 A;  5A2Q Q;  4MU4 A;  1Y4U A;  5IWA I;  4LF5 I;  3GLL A;  1Z5A A;  4M1K A;  4DPX A;  4URL A;  2PO1 A;  1D6T A;  1H74 A;  2PO1 B;  2UU9 E;  2JE6 A;  1H73 A;  4IFD A;  3P76 A;  2ZM6 E;  1HNZ E;  2JE6 B;  4DR7 I;  1J5E E;  2V2Z A;  4IFD B;  3LPS A;  1IBM E;  1FWK A;  4YHH I;  1N0V C;  3HUL A;  3ZZT A;  3PS2 A;  5EL9 A;  4JV5 E;  1Z5C A;  3P3E A;  2VES A;  4B3R I;  3B82 A;  1HNW E;  2R3V A;  2GO3 A;  4X62 E;  2C38 A;  1XMQ I;  1E3P A;  1P42 A;  3JAM C;  5DRR A;  4RPF A;  2C38 B;  4DV0 E;  1KKH A;  1IBK E;  2V8P A;  3K17 A;  4AM3 A;  1ZM4 A;  1VIS A;  3DD6 A;  3OTO E;  2BV3 A;  3J81 C;  4FW5 A;  2PO2 A;  4DV1 I;  4DR1 E;  4JI6 E;  4FWD A;  4FW6 A;  1USV A;  4ISA A;  4GKK E;  4LCF A;  1FJG E;  2BA1 D;  1ZXN A;  2CZ9 A;  2PO2 B;  4LF8 E;  3Q6N A;  1Z0G A;  2BA0 G;  4GQU A;  1FKA E;  4IZJ A;  1N34 E;  4X66 E;  2LJP A;  4DV6 E;  3LNU A;  3U1K A;  4IZJ B;  1N33 E;  2UU9 I;  4PU9 A;  3M7N G;  2DEJ A;  4FN5 A;  5FWK A;  2ZIT A;  4LCG A;  2ZM6 I;  1HNZ I;  4NBQ A;  2V2V A;  2E5L E;  1J5E I;  3B78 A;  2GS8 A;  1IBM I;  1UDS A;  1XXE A;  3GON A;  2IOQ A;  4JV5 I;  2WNR A;  2CG9 A;  4DU8 A;  3LTO A;  1XHK A;  3NZK A;  5K36 F;  1MU5 A;  2JEB A;  4DR6 E;  5K36 C;  1VI7 A;  3QT8 A;  2WNR B;  2UUB E;  5ELW A;  2EFG A;  2BR2 B;  3HJC A;  3Q6M A;  5DRP A;  1N0U A;  2F1D A;  4DV0 I;  1FI4 A;  5DRQ A;  1N32 E;  4DPY A;  1IBK I;  3WU3 A;  4DPW A;  3ZM7 A;  3OTO I;  4DUY E;  1OYS A;  2AJ4 A;  4JI6 I;  4JI1 I;  4GKK I;  1R6M A;  1FJG I;  4NXN E;  4LF8 I;  2O1T A;  4B3R E;  1DAR A;  4Z7C A;  4I3H A;  1WUU A;  1Z0C A;  1N34 I;  4X66 I;  1B62 A;  2PNM A;  4DV6 I;  4GKJ I;  1N33 I;  3U1Y A;  3J80 Q;  4JI8 E;  1ELO A;  5K36 D;  3ZKB A;  3PS3 A;  1PVG A;  3M85 D;  4DR2 E;  4LF6 E;  3PYD A;  2UXD E;  4DR3 E;  5GMD A;  3ZZ0 A;  4AIM A;  2WP8 A;  1H72 C;  4DR6 I;  3F0N A;  2UUB I;  4LCH A;  4XTJ A;  1ZM2 A;  2HHH I;  3ZZU A;  3D4J A;  3QT6 A;  1N32 I;  1Z59 A;  4DV7 E;  4WUC A;  4HAC A;  4DUY I;  3WU5 A;  4HAC B;  5JEA F;  4NXN I;  5JEA C;  1UEK A;  2PNL A;  1H7S A;  3WU4 A;  3QT5 A;  4DU7 A;  1Z5B A;  3PYG A;  4FW3 A;  1ZM9 A;  4DR5 E;  1RRE A;  5C0X F;  1OJ4 A;  4JG4 A;  4NXM E;  1EI1 A;  4JI8 I;  5K36 E;  3UHM A;  4KQV A;  3J7A M;  1B63 A;  4BA2 A;  2HKE A;  2J65 A;  2NPF A;  3CDJ A;  4DR2 I;  4JI1 E;  4LF6 I;  4BA2 B;  2UXD I;  5K36 A;  4DR3 I;  2JT2 A;  4Z7Y A;  2UXB E;  4OO1 F;  4OO1 C;  5K36 B;  4DV2 E;  1I94 E;  4LF9 E;  5EKW A;  4N3O A;  4LF7 I;  4GKJ E;  2O1W A;  5BR8 E;  5JEA D;  1HK7 A;  4IFD F;  4MYT A;  1QZR A;  4DV7 I;  4ED4 A;  5A2Q C;  3GME A;  4DV3 I;  2F4V E;  4IZK A;  2JEA A;  4QNJ A;  1ZXM A;  4UTG A;  1N36 E;  1K47 A;  5C0X D;  2BM1 A;  4IZK B;  4DXL A;  2JEA B;  4DV5 I;  2C37 A;  4DV4 E;  1RHY A;  5LMN E;  2A2C A;  2JEB B;  5L3J A;  2HHH E;  4B3S E;  2HK2 A;  4LFC E;  4DR5 I;  4P7A A;  1Z0V A;  2PO0 A;  4JI5 E;  4NXM I;  1PIE A;  2UUA E;  4OO1 D;  4FWG A;  4MQY A;  2NN6 F;  2NN6 C;  2E1R A;  4DPU A;  1R6L A;  2HK3 A;  4IS9 A;  4MDT A;  4J3D A;  4YY3 E;  2UXB I;  4B3M E;  1H7U A;  1XNR E;  2HFU A;  3V2U C;  1S16 A;  2Z5E A;  4DV2 I;  1I94 I;  2Q2E B;  4ZVI A;  4LF9 I;  5FLX Q;  4JYA I;  1HNX E;  3H4L A;  1YHC A;  3H1C A;  5JEA E;  4JI7 E;  4JI3 E;  2V34 A;  5BR8 I;  5GME A;  1S4E A;  1Y6Z A;  1UDN A;  1KTV A;  5JEA A;  2HKJ A;  4HYM A;  2F4V I;  2R42 A;  1UDQ A;  1OYP A;  4USM A;  1IBL E;  5JEA B;  5C0X E;  1N36 I;  3J81 Q;  1HR0 E;  5DNX A;  4DV4 I;  5C0X A;  5LMN I;  4U3D A;  4AQY E;  1Y4S A;  2NN6 D;  2WP8 B;  4JI2 E;  1Z0W A;  4B3T I;  2WW4 A;  2ZBK B;  4B3S I;  1MX0 A;  4LFC I;  1NHI A;  4LF7 E;  4DPT A;  3PS1 A;  4OO1 E;  4JI5 I;  4OX9 I;  2PNZ A;  1FNM A;  4LPF A;  4X65 E;  4FWH A;  2UUA I;  4FW9 A;  4MU3 A;  2J7K A;  2PNZ B;  4DV3 E;  2UUC I;  3K1J A;  3P3C A;  4OO1 A;  3HKM A;  4JI4 E;  4IZJ D;  4PRV A;  5DRO A;  4YY3 I;  1MG7 A;  4B3M I;  4LFB E;  4OO1 B;  3M6A A;  4DV5 E;  4IFD E;  1XNR I;  4BA1 A;  4X64 E;  5IT9 Q;  4MYU A;  2XEX A;  3T1Y E;  4LOM A;  1HNX I;  3ZKD A;  4BA1 B;  4R1F A;  2X36 A;  2O1V A;  4JI7 I;  4JI3 I;  5C0X C;  1BKN A;  4WUD A;  2Z5C A;  2GQ0 A;  1RR9 A;  2VQF E;  2IOP A;  5LMU E;  2Z5C B;  4FW7 A;  1NHH A;  5FLX C;  1Y60 A;  1IBL I;  2BA1 G;  1FWL A;  3GCM A;  2V2Q A;  1HR0 I;  2O3Z A;  3J80 C;  2NN6 E;  4JYA E;  2X7I A;  4AQY I;  3WU6 A;  4KHP E;  1XMO E;  2Z5B A;  3CWV A;  4JI2 I;  4DR4 E;  2NN6 A;  1YH8 A;  2Z5B B;  2O1U A;  4X65 I;  5DNL A;  3P06 A;  3J7A G;  4IFD C;  2VQE E;  2NN6 B;  2UXC E;  4JI4 I;  4AID A;  4UT4 A;  2BA0 D;  1XNQ E;  1NHJ A;  4LFB I;  4LF4 E;  3B8H A;  4P52 A;  3L7Z A;  4X64 I;  4K0K E;  1Z0E A;  1Y5Y A;  3T1Y I;  4HXZ A;  4MU0 A;  2VF3 A;  3L7Z B;  3M7N D;  1A6F A;  2C37 B;  2DEI A;  4MU1 A;  4B3T E;  3T1H E;  2C39 A;  4DUZ E;  2IER A;  4JI0 E;  4LFA E;  3PRY A;  4OX9 E;  2C39 B;  2VQF I;  1Z0T A;  5LMU I;  2PO0 B; 
#chains in the Genus database with same CATH homology
 2UUC E;  2CGE A;  5IT9 C;  1HNW I;  1EA6 A;  2BM0 A;  1KVK A;  2OI2 A;  4X62 I;  5IWA E;  3V5R A;  4LF5 E;  2A2D A;  4KHP I;  1XMO I;  4WUB A;  2HFS A;  4DR4 I;  4DR7 E;  4DR1 I;  2VQE I;  3JAM Q;  4YHH E;  2UXC I;  1PKP A;  1XNQ I;  3Q1Q A;  4LF4 I;  4EMD A;  1KIJ A;  4K0K I;  1XMQ E;  4USK A;  3K85 A;  4HY1 A;  3T1H I;  4DUZ I;  5LL6 R;  3QT7 A;  1NZ0 A;  3PYE A;  4JI0 I;  1Z0B A;  4LFA I;  2E5L I;  4DV1 E;  1USU A;  4PRX A;  1U2R A;  3PYF A;  1ZM3 A;  5A2Q Q;  1Y4U A;  5IWA I;  4LF5 I;  4URL A;  1Z5A A;  4M1K A;  4DPX A;  1D6T A;  1H74 A;  2UU9 E;  1H73 A;  2ZM6 E;  1HNZ E;  4DR7 I;  1J5E E;  2V2Z A;  3LPS A;  1IBM E;  1FWK A;  4YHH I;  1N0V C;  3HUL A;  3ZZT A;  4JV5 E;  1Z5C A;  4B3R I;  3B82 A;  1HNW E;  2R3V A;  4X62 E;  1XMQ I;  3JAM C;  4RPF A;  4DV0 E;  1KKH A;  1IBK E;  2V8P A;  3K17 A;  1ZM4 A;  1VIS A;  3OTO E;  2BV3 A;  3J81 C;  4DR1 E;  4DV1 I;  4JI6 E;  4FWD A;  1USV A;  4GKK E;  1FJG E;  2CZ9 A;  1ZXN A;  4LF8 E;  3Q6N A;  1Z0G A;  1FKA E;  4IZJ A;  1N34 E;  4X66 E;  2LJP A;  4DV6 E;  3LNU A;  4IZJ B;  1N33 E;  2UU9 I;  4PU9 A;  2DEJ A;  4FN5 A;  5FWK A;  2ZIT A;  2ZM6 I;  1HNZ I;  2V2V A;  2E5L E;  1J5E I;  3B78 A;  2GS8 A;  1IBM I;  3GON A;  2IOQ A;  4JV5 I;  2CG9 A;  4DU8 A;  3LTO A;  1XHK A;  1MU5 A;  4DR6 E;  3QT8 A;  2UUB E;  2EFG A;  3HJC A;  3Q6M A;  1N0U A;  4DV0 I;  1FI4 A;  1N32 E;  4DPY A;  1IBK I;  3WU3 A;  4DPW A;  3ZM7 A;  3OTO I;  4DUY E;  2AJ4 A;  4JI6 I;  4JI1 I;  4GKK I;  1FJG I;  4NXN E;  4LF8 I;  2O1T A;  4B3R E;  1DAR A;  4Z7C A;  4I3H A;  1WUU A;  1Z0C A;  1N34 I;  4X66 I;  1B62 A;  2PNM A;  4DV6 I;  4GKJ I;  1N33 I;  3J80 Q;  4JI8 E;  1ELO A;  3ZKB A;  1PVG A;  4DR2 E;  4LF6 E;  3PYD A;  2UXD E;  4DR3 E;  5GMD A;  3ZZ0 A;  1H72 C;  4DR6 I;  3F0N A;  2UUB I;  4XTJ A;  1ZM2 A;  2HHH I;  3ZZU A;  3D4J A;  3QT6 A;  1N32 I;  1Z59 A;  4DV7 E;  4WUC A;  4HAC A;  4DUY I;  3WU5 A;  4HAC B;  4NXN I;  1UEK A;  2PNL A;  1H7S A;  3WU4 A;  3QT5 A;  4DU7 A;  1Z5B A;  3PYG A;  1ZM9 A;  4DR5 E;  1RRE A;  1OJ4 A;  4JG4 A;  4NXM E;  1EI1 A;  4JI8 I;  4KQV A;  3J7A M;  1B63 A;  2HKE A;  2NPF A;  4JI1 E;  4DR2 I;  4LF6 I;  2UXD I;  4DR3 I;  4Z7Y A;  2UXB E;  4DV2 E;  1I94 E;  4LF9 E;  4N3O A;  4LF7 I;  4GKJ E;  2O1W A;  5BR8 E;  1HK7 A;  4MYT A;  1QZR A;  4DV7 I;  4ED4 A;  5A2Q C;  4DV3 I;  2F4V E;  4IZK A;  1ZXM A;  4UTG A;  1N36 E;  1K47 A;  2BM1 A;  4IZK B;  4DXL A;  4DV5 I;  4DV4 E;  5LMN E;  2A2C A;  5L3J A;  2HHH E;  4B3S E;  2HK2 A;  4LFC E;  4DR5 I;  4P7A A;  1Z0V A;  4JI5 E;  4NXM I;  1PIE A;  2UUA E;  4FWG A;  2E1R A;  4DPU A;  2HK3 A;  2UXB I;  4YY3 E;  4B3M E;  1H7U A;  1XNR E;  2HFU A;  3V2U C;  1S16 A;  2Z5E A;  4DV2 I;  1I94 I;  2Q2E B;  4ZVI A;  4LF9 I;  5FLX Q;  4JYA I;  1HNX E;  3H4L A;  4JI7 E;  4JI3 E;  2V34 A;  5BR8 I;  5GME A;  1S4E A;  1Y6Z A;  1KTV A;  2HKJ A;  4HYM A;  2F4V I;  2R42 A;  4USM A;  1IBL E;  1N36 I;  3J81 Q;  1HR0 E;  4DV4 I;  5LMN I;  4AQY E;  1Y4S A;  4JI2 E;  1Z0W A;  4B3T I;  2WW4 A;  2ZBK B;  4B3S I;  1MX0 A;  4LFC I;  1NHI A;  4LF7 E;  4DPT A;  4JI5 I;  4OX9 I;  1FNM A;  4X65 E;  4FWH A;  2UUA I;  4FW9 A;  2J7K A;  4DV3 E;  2UUC I;  3K1J A;  4JI4 E;  4IZJ D;  4PRV A;  4YY3 I;  1MG7 A;  4B3M I;  4LFB E;  3M6A A;  4DV5 E;  1XNR I;  4X64 E;  5IT9 Q;  4MYU A;  2XEX A;  3T1Y E;  1HNX I;  3ZKD A;  4R1F A;  2X36 A;  2O1V A;  4JI7 I;  4JI3 I;  1BKN A;  4WUD A;  2Z5C A;  2GQ0 A;  1RR9 A;  2VQF E;  2IOP A;  5LMU E;  2Z5C B;  1NHH A;  5FLX C;  1IBL I;  1FWL A;  2V2Q A;  1HR0 I;  3J80 C;  4JYA E;  2X7I A;  4AQY I;  3WU6 A;  4KHP E;  1XMO E;  2Z5B A;  3CWV A;  4JI2 I;  4DR4 E;  2Z5B B;  2O1U A;  4X65 I;  3P06 A;  3J7A G;  2VQE E;  2UXC E;  4JI4 I;  4UT4 A;  1XNQ E;  1NHJ A;  4LFB I;  4LF4 E;  3B8H A;  4P52 A;  4X64 I;  4K0K E;  1Z0E A;  3T1Y I;  4HXZ A;  2VF3 A;  1A6F A;  2DEI A;  4B3T E;  3T1H E;  4DUZ E;  4JI0 E;  4LFA E;  3PRY A;  4OX9 E;  2VQF I;  1Z0T A;  5LMU I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...