4DV0I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv0I00
4KQVA 3OTOE 1H7SA 4DR5E 1Z0CA 4DUYI 1HR0I 4P7AA 5BR8E 1NZ0A 4DR6I 2ZBKB 2HFSA 2BM1A 5BR8I 4NXMI 3Q1QA 1NHHA 2V2QA 4B3TE 4ED4A 4DV5I 4DV1E 3ZZUA 2V2VA 2UUBE 4DV1I 4DV3E 4MYTA 4B3ME 1H73A 1DARA 1J5EI 4DR7E 4LF5I 4LF8I 2OI2A 2V34A 2VQFE 1FJGI 4X62E 1S4EA 3LNUA 1ZM9A 4DXLA 2VQFI 1FJGE 1N0VC 4LF7I 2F4VE 3J81Q 2UXCE 1N36I 4DR5I 3J7AG 4DV4E 3H4LA 1MU5A 2F4VI 3WU6A 1KTVA 2ZM6I 4LF5E 5LMUI 4YHHI 4DV4I 2VQEI 5GMDA 4DV7I 2HFUA 3GONA 2E5LI 4PRVA 4UT4A 3QT6A 1HNZE 4P52A 4Z7YA 1H7UA 3B78A 2AJ4A 4X65E 4USMA 4LFAE 1WUUA 1ELOA 1B63A 4JI6I 4DV3I 2X36A 2CZ9A 1PVGA 2A2CA 4R1FA 1Z0TA 4B3MI 4JYAI 1J5EE 4RPFA 4DPWA 4X62I 2DEJA 4DPUA 5IT9C 5IT9Q 4FW9A 1Z0BA 1FWLA 2UU9E 3QT7A 1K47A 1HNXE 1N33I 1FKAE 4LFCI 2VQEE 4NXNE 5FLXC 4FWDA 4WUBA 4KHPE 1Z0VA 1B62A 4X64I 4ZVIA 4DR2I 4DV2E 5IWAE 1XNQE 2X7IA 4GKKE 2GS8A 3ZKBA 2HK2A 1NHJA 2DEIA 1ZM4A 4AQYI 4X64E 4M1KA 1XNQI 4JI3E 4HY1A 1HNWE 4PU9A 4USKA 2V2ZA 4K0KI 1RREA 4LF9I 1D6TA 1IBKI 2UXDE 1I94I 3PYGA 2HK3A 2UUBI 2NPFA 1KVKA 3J80Q 4LF4I 4DPTA 4JI6E 4YHHE 1IBME 2HHHE 1ZM3A 1ZXMA 1FWKA 3ZZ0A 1EI1A 3CWVA 2HHHI 3OTOI 1N32E 4DUYE 4DV0I 1OJ4A 3WU5A 3PYFA 4B3RE 1MX0A 4JI5I 4KHPI 3LPSA 4DR2E 1RR9A 1Z5CA 5LMNE 3WU4A 4OX9E 2UXBI 1XMQE 3T1HI 1FNMA 5IWAI 4DV0E 2ZM6E 1Z59A 3QT8A 4FWGA 4UTGA 1Z0WA 1HNZI 4LF6I 4LFBE 1XMOE 4DR4E 4DV7E 1N0UA 3F0NA 1U2RA 1HNXI 1MG7A 2A2DA 4X66E 2UUCE 1N34I 4OX9I 2UXDI 1KKHA 4JI0E 3ZM7A 1IBLE 2R42A 3T1HE 4YY3I 3B82A 2ZITA 4LF4E 4DU7A 4WUDA 1A6FA 4DUZE 1NHIA 4X65I 3JAMQ 4DV2I 1BKNA 3J81C 4NXME 4LFAI 4AQYE 4B3SE 4HYMA 3J80C 2J7KA 4B3RI 4JV5I 4JI4E 1N32I 3WU3A 4JI3I 1IBLI 3PYDA 4B3SI 4PRXA 4DV6I 1VISA 1IBKE 4DR1E 5A2QC 3T1YE 3J7AM 3K17A 1FI4A 1Z5AA 4DR6E 4DU8A 1N33E 4LFCE 4DPYA 3PYEA 4DR3I 1KIJA 1H72C 4LFBI 2R3VA 3M6AA 4YY3E 4GKKI 3ZZTA 3ZKDA 4LF9E 4JI1I 2UUAI 1PKPA 4DUZI 2E1RA 4I3HA 4LF8E 1HNWI 5FLXQ 5L3JA 3V2UC 4DR3E 4JI7E 4JV5E 1H74A 4K0KE 2HKJA 1EA6A 4HACA 4JG4A 3V5RA 4DV6E 1ZM2A 3LTOA 4JI4I 3JAMC 1Z5BA 3T1YI 4DPXA 3QT5A 4X66I 4LF7E 4WUCA 4DR1I 4JI2E 2WW4A 4JYAE 1XNRE 5LMNI 1Z0EA 2EFGA 5GMEA 2BV3A 1ZXNA 4URLA 4JI8I 1XMQI 4EMDA 1XNRI 4JI5E 4HACB 5LL6R 2V8PA 2UU9I 4Z7CA 1XHKA 2E5LE 4JI8E 4GKJI 4LF6E 4JI1E 4DR4I 2Q2EB 1PIEA 1S16A 5A2QQ 4JI2I 1HR0E 4GKJE 2UUCI 4B3TI 4DV5E 2UUAE 4JI7I 4JI0I 3D4JA 1XMOI 2HKEA 4MYUA 3HULA 4HXZA 5LMUE 1Z0GA 1N34E 1QZRA 4XTJA 1UEKA 2VF3A 1I94E 2UXBE 4NXNI 3K1JA 4DR7I 4FN5A 4FWHA 2BM0A 2UXCI 1IBMI 1N36E 3B8HA 2LJPA 2XEXA
chains in the Genus database with same CATH superfamily
4KQVA 4BA1B 2C37B 3OTOE 1H7SA 2O1UA 4DR5E 4MQYA 1OYRA 1Z0CA 4DUYI 3GMEA 1HR0I 4P7AA 5BR8E 5JEAD 4IFDC 1NZ0A 1YH8A 4DR6I 2ZBKB 2HFSA 2BM1A 5BR8I 4NXMI 3Q1QA 1NHHA 2V2QA 4B3TE 2NN6B 4ED4A 4DV5I 5C0XC 2IESA 4DV1E 5C0XE 4IFDA 3ZZUA 2V2VA 2UUBE 4DV1I 4DV3E 4MYTA 2NN6D 4B3ME 1H73A 1VI7A 3NZKA 1DARA 1J5EI 3CDIA 4DR7E 4LF5I 4FW7A 4LF8I 2OI2A 2V34A 2VQFE 1FJGI 4X62E 1S4EA 3LNUA 1ZM9A 5DRQA 4DXLA 2WP8B 2IOQA 2VQFI 1FJGE 1N0VC 4LF7I 2F4VE 3J81Q 5JEAB 2UXCE 1N36I 4DR5I 3J7AG 1RHYA 3L7ZA 3P3GA 5DNXA 2PNZA 4DV4E 1UDNA 3DD6A 3H4LA 1MU5A 1USUA 2F4VI 3WU6A 1KTVA 2ZM6I 4LF5E 4AM3A 5LMUI 4YHHI 4DV4I 2JT2A 2O1WA 5JEAC 2VQEI 3K85A 5GMDA 4DV7I 2HFUA 3GONA 2E5LI 4PRVA 2GQ0A 4UT4A 2PO0A 2PO2A 3QT6A 2JE6A 1HNZE 4LCGA 4P52A 4Z7YA 1H7UA 2WNRA 3CDJA 3B78A 2AJ4A 5EL9A 4X65E 4OO1E 4USMA 4IZKA 4GQUA 4LFAE 1WUUA 3PS2A 2JEBB 1ELOA 1B63A 4JI6I 4DV3I 2X36A 2CZ9A 1PVGA 2A2CA 4R1FA 4OO1B 5C0XB 1Z0TA 1R6MA 4B3MI 4JYAI 1J5EE 4RPFA 4U3BA 4OO1F 1YHCA 4DPWA 4X62I 2DEJA 4DPUA 3M85G 5IT9C 5IT9Q 4FW9A 1Z0BA 3P06A 1FWLA 3Q6MA 2UU9E 3QT7A 1K47A 1Y5YA 1HNXE 1N33I 1FKAE 4LFCI 2VQEE 1E3HA 4FW3A 4AIMA 4NXNE 5FLXC 4IZJB 3UHMA 4FWDA 4WUBA 4KHPE 1Z0VA 1B62A 4OO1D 4X64I 4ZVIA 4DR2I 4DV2E 5IWAE 1XNQE 2X7IA 2O1TA 2GS8A 4GKKE 2BA0D 1P42A 3ZKBA 2HK2A 2IOPA 5DNLA 1NHJA 2DEIA 1ZM4A 4AQYI 2JEBA 4X64E 4M1KA 1XNQI 4JI3E 2GO4A 4HY1A 5JEAA 1HNWE 4PU9A 4USKA 2V2ZA 4K0KI 1RREA 4LF9I 1D6TA 1IBKI 2UXDE 1I94I 3PYGA 4OKGA 1OYPA 2HK3A 2AE8A 2UUBI 2NPFA 1KVKA 3J80Q 4LF4I 2O3ZA 4DPTA 4JI6E 4YHHE 1IBME 2HHHE 1ZM3A 4IFDD 2NN6E 1ZXMA 4MU4A 1FWKA 3ZZ0A 1OYSA 1EI1A 3CWVA 2HHHI 3OTOI 3HJCA 5C0XA 4IFDE 1N32E 3U1KA 3PRYA 4DUYE 3L7ZB 4IZJA 4DV0I 1OJ4A 3WU5A 4IZKB 3PYFA 4B3RE 1MX0A 2J65A 4OZEA 4JI5I 5DROA 4KHPI 3LPSA 4DR2E 1RR9A 5DRRA 1Z5CA 5LMNE 4IFDF 3WU4A 2O1VA 3P76A 4OX9E 2PO2B 2PO0B 2UXBI 2CGEA 1XMQE 3T1HI 1FNMA 5IWAI 4DV0E 2ZM6E 1Z59A 3QT8A 4FWGA 4UTGA 1Z0WA 1HNZI 4LF6I 4LFBE 4IFDB 1XMOE 4OO1A 4MU0A 4DR4E 4DV7E 3M85D 1N0UA 3F0NA 1U2RA 1HNXI 1MG7A 2A2DA 4X66E 2UUCE 3GCMA 1N34I 4IS9A 4OX9I 2UXDI 1KKHA 2CG9A 4JI0E 3ZM7A 1IBLE 2R42A 3T1HE 4YY3I 3B82A 2WNRB 2ZITA 4LF4E 4DU7A 4WUDA 1A6FA 2JE6B 1NHIA 4DUZE 4X65I 4FW4A 3JAMQ 1R6LA 1BKNA 1HK7A 1USVA 4DV2I 3J81C 4NXME 4LFAI 4U3DA 2F1DA 4AQYE 4B3SE 4HYMA 3J80C 2J7KA 2PNLA 4JV5I 4JI4E 4B3RI 1N32I 3WU3A 4JI3I 4LCHA 1IBLI 3PYDA 2NN6C 4B3SI 4PRXA 4DV6I 1VISA 5C0XD 2C38B 1IBKE 2PNZB 4DR1E 4N3OA 5A2QC 3T1YE 3J7AM 4FW6A 3K17A 5K36E 3PS1A 1FI4A 4AIDA 4IZJD 1Z5AA 4DR6E 2WP8A 3M7NG 4DU8A 1N33E 5K36D 4LFCE 4DPYA 3PYEA 4ISAA 2C39A 5JEAE 4DR3I 1KIJA 1H72C 5K36F 4LFBI 2JEAA 2Z5CB 5FWKA 2R3VA 3M6AA 4YY3E 2BR2A 4GKKI 3ZZTA 1UDOA 3ZKDA 4LF9E 4JI1I 2PNMA 2UUAI 1PKPA 4DUZI 5EKWA 4MDTA 2E1RA 4I3HA 2NN6A 4LF8E 2Z5BA 1HNWI 5FLXQ 2PO1B 5L3JA 3V2UC 4QNJA 4DR3E 4JI7E 4JV5E 1H74A 4K0KE 2HKJA 1EA6A 4HACA 3B4TA 3P3EA 3HKMA 4JG4A 3V5RA 2Z5BB 4MU1A 1Y4UA 4DV6E 1ZM2A 3LTOA 4JI4I 3JAMC 1Z5BA 3H1CA 3T1YI 4DPXA 3GLLA 2BR2B 2C37A 5DRPA 4BA1A 3QT5A 4X66I 2JEAB 4LF7E 4J3DA 4WUCA 4DR1I 3PS3A 4QNKA 3U1YA 2WW4A 4JI2E 4JYAE 1E3PA 4FW5A 1XNRE 5LMNI 5K36B 1Z0EA 2EFGA 5GMEA 2BV3A 4MU3A 1ZXNA 4BA2B 4URLA 4JI8I 1XMQI 4EMDA 1XNRI 4JI5E 1Y6ZA 4HACB 5LL6R 2V8PA 2UU9I 2GO3A 4Z7CA 1XHKA 2E5LE 4JI8E 4GKJI 4LF6E 4JI1E 4BA2A 4LOMA 1UDQA 4DR4I 2C38A 2Q2EB 1PIEA 1S16A 5A2QQ 4JI2I 5K36A 1HR0E 3P3CA 4GKJE 2UUCI 4B3TI 4DV5E 2BA0G 2UUAE 4JI7I 5JEAF 4JI0I 2IERA 4LCFA 3D4JA 1XMOI 2CVEA 2HKEA 4MYUA 3HULA 2NN6F 4HXZA 2C39B 5LMUE 1Z0GA 2Z5EA 2BA1D 1N34E 3M7ND 1QZRA 4XTJA 1UEKA 2BA1G 5ELWA 1UDSA 1Y60A 2VF3A 5K36C 1I94E 2UXBE 2PO1A 4NXNI 1Y4SA 5C0XF 3K1JA 4DR7I 4FN5A 4FWHA 2BM0A 3Q6NA 2UXCI 4NBQA 3KRNA 2VESA 1N36E 1IBMI 1XXEA 3B8HA 4LPFA 2LJPA 4OO1C 2XEXA 2Z5CA
chains in the Genus database with same CATH topology
4KQVA 3OTOE 1H7SA 2O1UA 4DR5E 1Z0CA 4DUYI 1HR0I 4P7AA 5BR8E 1NZ0A 4DR6I 2ZBKB 2HFSA 2BM1A 5BR8I 4NXMI 3Q1QA 1NHHA 2V2QA 4B3TE 4ED4A 4DV5I 4DV1E 3ZZUA 2V2VA 2UUBE 4DV1I 4DV3E 4MYTA 4B3ME 1H73A 1DARA 1J5EI 4DR7E 4LF5I 4LF8I 2OI2A 2V34A 2VQFE 1FJGI 4X62E 1S4EA 3LNUA 1ZM9A 4DXLA 2IOQA 2VQFI 1FJGE 1N0VC 4LF7I 2F4VE 3J81Q 2UXCE 1N36I 4DR5I 3J7AG 4DV4E 3H4LA 1MU5A 1USUA 2F4VI 3WU6A 1KTVA 2ZM6I 4LF5E 5LMUI 4YHHI 4DV4I 2O1WA 2VQEI 3K85A 5GMDA 4DV7I 2HFUA 3GONA 2E5LI 4PRVA 2GQ0A 4UT4A 3QT6A 1HNZE 4P52A 4Z7YA 1H7UA 3B78A 2AJ4A 4X65E 4USMA 4IZKA 4LFAE 1WUUA 1ELOA 1B63A 4JI6I 4DV3I 2X36A 2CZ9A 1PVGA 2A2CA 4R1FA 1Z0TA 4B3MI 4JYAI 1J5EE 4RPFA 4DPWA 4X62I 2DEJA 4DPUA 5IT9C 5IT9Q 4FW9A 1Z0BA 3P06A 1FWLA 3Q6MA 2UU9E 3QT7A 1K47A 1HNXE 1N33I 1FKAE 4LFCI 2VQEE 4NXNE 5FLXC 4IZJB 4FWDA 4WUBA 4KHPE 1Z0VA 1B62A 4X64I 4DR2I 4ZVIA 4DV2E 5IWAE 1XNQE 2X7IA 2O1TA 2GS8A 4GKKE 3ZKBA 2HK2A 2IOPA 1NHJA 2DEIA 1ZM4A 4AQYI 4X64E 4M1KA 1XNQI 4JI3E 4HY1A 1HNWE 4PU9A 4USKA 2V2ZA 4K0KI 1RREA 4LF9I 1D6TA 1IBKI 2UXDE 1I94I 3PYGA 2HK3A 2UUBI 2NPFA 1KVKA 3J80Q 4LF4I 4DPTA 4JI6E 4YHHE 1IBME 2HHHE 1ZM3A 1ZXMA 1FWKA 3ZZ0A 1EI1A 3CWVA 2HHHI 3OTOI 3HJCA 1N32E 3PRYA 4DUYE 4IZJA 4DV0I 1OJ4A 3WU5A 4IZKB 3PYFA 4B3RE 1MX0A 4JI5I 4KHPI 3LPSA 4DR2E 1RR9A 1Z5CA 5LMNE 3WU4A 2O1VA 4OX9E 2UXBI 2CGEA 1XMQE 3T1HI 1FNMA 5IWAI 4DV0E 2ZM6E 1Z59A 3QT8A 4FWGA 4UTGA 1Z0WA 1HNZI 4LF6I 4LFBE 1XMOE 4DR4E 4DV7E 1N0UA 3F0NA 1U2RA 1HNXI 1MG7A 2A2DA 4X66E 2UUCE 1N34I 4OX9I 2UXDI 1KKHA 2CG9A 4JI0E 3ZM7A 1IBLE 2R42A 3T1HE 4YY3I 3B82A 2ZITA 4LF4E 4DU7A 4WUDA 1A6FA 4DUZE 1NHIA 4X65I 3JAMQ 4DV2I 1BKNA 1HK7A 1USVA 3J81C 4NXME 4LFAI 4AQYE 4B3SE 3J80C 4HYMA 2J7KA 2PNLA 4JV5I 4JI4E 4B3RI 1N32I 3WU3A 4JI3I 1IBLI 3PYDA 4B3SI 4PRXA 4DV6I 1VISA 1IBKE 4DR1E 4N3OA 5A2QC 3T1YE 3J7AM 3K17A 1FI4A 4IZJD 1Z5AA 4DR6E 4DU8A 1N33E 4LFCE 4DPYA 3PYEA 4DR3I 1KIJA 1H72C 4LFBI 2Z5CB 5FWKA 2R3VA 3M6AA 4YY3E 4GKKI 3ZZTA 3ZKDA 4LF9E 4JI1I 2PNMA 2UUAI 1PKPA 4DUZI 2E1RA 4I3HA 4LF8E 2Z5BA 1HNWI 5FLXQ 5L3JA 3V2UC 4DR3E 4JI7E 4JV5E 1H74A 4K0KE 2HKJA 1EA6A 4HACA 4JG4A 3V5RA 2Z5BB 1Y4UA 4DV6E 1ZM2A 3LTOA 4JI4I 3JAMC 1Z5BA 3T1YI 4DPXA 3QT5A 4X66I 4LF7E 4WUCA 4DR1I 4JI2E 2WW4A 4JYAE 1XNRE 5LMNI 1Z0EA 2EFGA 5GMEA 2BV3A 1ZXNA 4URLA 4JI8I 1XMQI 4EMDA 1XNRI 4JI5E 1Y6ZA 4HACB 5LL6R 2V8PA 2UU9I 4Z7CA 1XHKA 2E5LE 4JI8E 4GKJI 4LF6E 4JI1E 4DR4I 2Q2EB 1PIEA 1S16A 5A2QQ 4JI2I 1HR0E 4GKJE 2UUCI 4B3TI 4DV5E 2UUAE 4JI7I 4JI0I 3D4JA 1XMOI 2HKEA 4MYUA 3HULA 4HXZA 5LMUE 1Z0GA 2Z5EA 1N34E 1QZRA 4XTJA 1UEKA 2VF3A 1I94E 2UXBE 4NXNI 1Y4SA 3K1JA 4DR7I 4FN5A 4FWHA 2BM0A 3Q6NA 2UXCI 1IBMI 1N36E 3B8HA 2LJPA 2XEXA 2Z5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQV A;  3OTO E;  1H7S A;  4DR5 E;  1Z0C A;  4DUY I;  1HR0 I;  4P7A A;  5BR8 E;  1NZ0 A;  4DR6 I;  2ZBK B;  2HFS A;  2BM1 A;  5BR8 I;  4NXM I;  3Q1Q A;  1NHH A;  2V2Q A;  4B3T E;  4ED4 A;  4DV5 I;  4DV1 E;  3ZZU A;  2V2V A;  2UUB E;  4DV1 I;  4DV3 E;  4MYT A;  4B3M E;  1H73 A;  1DAR A;  1J5E I;  4DR7 E;  4LF5 I;  4LF8 I;  2OI2 A;  2V34 A;  2VQF E;  1FJG I;  4X62 E;  1S4E A;  3LNU A;  1ZM9 A;  4DXL A;  2VQF I;  1FJG E;  1N0V C;  4LF7 I;  2F4V E;  3J81 Q;  2UXC E;  1N36 I;  4DR5 I;  3J7A G;  4DV4 E;  3H4L A;  1MU5 A;  2F4V I;  3WU6 A;  1KTV A;  2ZM6 I;  4LF5 E;  5LMU I;  4YHH I;  4DV4 I;  2VQE I;  5GMD A;  4DV7 I;  2HFU A;  3GON A;  2E5L I;  4PRV A;  4UT4 A;  3QT6 A;  1HNZ E;  4P52 A;  4Z7Y A;  1H7U A;  3B78 A;  2AJ4 A;  4X65 E;  4USM A;  4LFA E;  1WUU A;  1ELO A;  1B63 A;  4JI6 I;  4DV3 I;  2X36 A;  2CZ9 A;  1PVG A;  2A2C A;  4R1F A;  1Z0T A;  4B3M I;  4JYA I;  1J5E E;  4RPF A;  4DPW A;  4X62 I;  2DEJ A;  4DPU A;  5IT9 C;  5IT9 Q;  4FW9 A;  1Z0B A;  1FWL A;  2UU9 E;  3QT7 A;  1K47 A;  1HNX E;  1N33 I;  1FKA E;  4LFC I;  2VQE E;  4NXN E;  5FLX C;  4FWD A;  4WUB A;  4KHP E;  1Z0V A;  1B62 A;  4X64 I;  4ZVI A;  4DR2 I;  4DV2 E;  5IWA E;  1XNQ E;  2X7I A;  4GKK E;  2GS8 A;  3ZKB A;  2HK2 A;  1NHJ A;  2DEI A;  1ZM4 A;  4AQY I;  4X64 E;  4M1K A;  1XNQ I;  4JI3 E;  4HY1 A;  1HNW E;  4PU9 A;  4USK A;  2V2Z A;  4K0K I;  1RRE A;  4LF9 I;  1D6T A;  1IBK I;  2UXD E;  1I94 I;  3PYG A;  2HK3 A;  2UUB I;  2NPF A;  1KVK A;  3J80 Q;  4LF4 I;  4DPT A;  4JI6 E;  4YHH E;  1IBM E;  2HHH E;  1ZM3 A;  1ZXM A;  1FWK A;  3ZZ0 A;  1EI1 A;  3CWV A;  2HHH I;  3OTO I;  1N32 E;  4DUY E;  4DV0 I;  1OJ4 A;  3WU5 A;  3PYF A;  4B3R E;  1MX0 A;  4JI5 I;  4KHP I;  3LPS A;  4DR2 E;  1RR9 A;  1Z5C A;  5LMN E;  3WU4 A;  4OX9 E;  2UXB I;  1XMQ E;  3T1H I;  1FNM A;  5IWA I;  4DV0 E;  2ZM6 E;  1Z59 A;  3QT8 A;  4FWG A;  4UTG A;  1Z0W A;  1HNZ I;  4LF6 I;  4LFB E;  1XMO E;  4DR4 E;  4DV7 E;  1N0U A;  3F0N A;  1U2R A;  1HNX I;  1MG7 A;  2A2D A;  4X66 E;  2UUC E;  1N34 I;  4OX9 I;  2UXD I;  1KKH A;  4JI0 E;  3ZM7 A;  1IBL E;  2R42 A;  3T1H E;  4YY3 I;  3B82 A;  2ZIT A;  4LF4 E;  4DU7 A;  4WUD A;  1A6F A;  4DUZ E;  1NHI A;  4X65 I;  3JAM Q;  4DV2 I;  1BKN A;  3J81 C;  4NXM E;  4LFA I;  4AQY E;  4B3S E;  4HYM A;  3J80 C;  2J7K A;  4B3R I;  4JV5 I;  4JI4 E;  1N32 I;  3WU3 A;  4JI3 I;  1IBL I;  3PYD A;  4B3S I;  4PRX A;  4DV6 I;  1VIS A;  1IBK E;  4DR1 E;  5A2Q C;  3T1Y E;  3J7A M;  3K17 A;  1FI4 A;  1Z5A A;  4DR6 E;  4DU8 A;  1N33 E;  4LFC E;  4DPY A;  3PYE A;  4DR3 I;  1KIJ A;  1H72 C;  4LFB I;  2R3V A;  3M6A A;  4YY3 E;  4GKK I;  3ZZT A;  3ZKD A;  4LF9 E;  4JI1 I;  2UUA I;  1PKP A;  4DUZ I;  2E1R A;  4I3H A;  4LF8 E;  1HNW I;  5FLX Q;  5L3J A;  3V2U C;  4DR3 E;  4JI7 E;  4JV5 E;  1H74 A;  4K0K E;  2HKJ A;  1EA6 A;  4HAC A;  4JG4 A;  3V5R A;  4DV6 E;  1ZM2 A;  3LTO A;  4JI4 I;  3JAM C;  1Z5B A;  3T1Y I;  4DPX A;  3QT5 A;  4X66 I;  4LF7 E;  4WUC A;  4DR1 I;  4JI2 E;  2WW4 A;  4JYA E;  1XNR E;  5LMN I;  1Z0E A;  2EFG A;  5GME A;  2BV3 A;  1ZXN A;  4URL A;  4JI8 I;  1XMQ I;  4EMD A;  1XNR I;  4JI5 E;  4HAC B;  5LL6 R;  2V8P A;  2UU9 I;  4Z7C A;  1XHK A;  2E5L E;  4JI8 E;  4GKJ I;  4LF6 E;  4JI1 E;  4DR4 I;  2Q2E B;  1PIE A;  1S16 A;  5A2Q Q;  4JI2 I;  1HR0 E;  4GKJ E;  2UUC I;  4B3T I;  4DV5 E;  2UUA E;  4JI7 I;  4JI0 I;  3D4J A;  1XMO I;  2HKE A;  4MYU A;  3HUL A;  4HXZ A;  5LMU E;  1Z0G A;  1N34 E;  1QZR A;  4XTJ A;  1UEK A;  2VF3 A;  1I94 E;  2UXB E;  4NXN I;  3K1J A;  4DR7 I;  4FN5 A;  4FWH A;  2BM0 A;  2UXC I;  1IBM I;  1N36 E;  3B8H A;  2LJP A;  2XEX A; 
#chains in the Genus database with same CATH topology
 4KQV A;  4BA1 B;  2C37 B;  3OTO E;  1H7S A;  2O1U A;  4DR5 E;  4MQY A;  1OYR A;  1Z0C A;  4DUY I;  3GME A;  1HR0 I;  4P7A A;  5BR8 E;  5JEA D;  4IFD C;  1NZ0 A;  1YH8 A;  4DR6 I;  2ZBK B;  2HFS A;  2BM1 A;  5BR8 I;  4NXM I;  3Q1Q A;  1NHH A;  2V2Q A;  4B3T E;  2NN6 B;  4ED4 A;  4DV5 I;  5C0X C;  2IES A;  4DV1 E;  5C0X E;  4IFD A;  3ZZU A;  2V2V A;  2UUB E;  4DV1 I;  4DV3 E;  4MYT A;  2NN6 D;  4B3M E;  1H73 A;  1VI7 A;  3NZK A;  1DAR A;  1J5E I;  3CDI A;  4DR7 E;  4LF5 I;  4FW7 A;  4LF8 I;  2OI2 A;  2V34 A;  2VQF E;  1FJG I;  4X62 E;  1S4E A;  3LNU A;  1ZM9 A;  5DRQ A;  4DXL A;  2WP8 B;  2IOQ A;  2VQF I;  1FJG E;  1N0V C;  4LF7 I;  2F4V E;  3J81 Q;  5JEA B;  2UXC E;  1N36 I;  4DR5 I;  3J7A G;  1RHY A;  3L7Z A;  3P3G A;  5DNX A;  2PNZ A;  4DV4 E;  1UDN A;  3DD6 A;  3H4L A;  1MU5 A;  1USU A;  2F4V I;  3WU6 A;  1KTV A;  2ZM6 I;  4LF5 E;  4AM3 A;  5LMU I;  4YHH I;  4DV4 I;  2JT2 A;  2O1W A;  5JEA C;  2VQE I;  3K85 A;  5GMD A;  4DV7 I;  2HFU A;  3GON A;  2E5L I;  4PRV A;  2GQ0 A;  4UT4 A;  2PO0 A;  2PO2 A;  3QT6 A;  2JE6 A;  1HNZ E;  4LCG A;  4P52 A;  4Z7Y A;  1H7U A;  2WNR A;  3CDJ A;  3B78 A;  2AJ4 A;  5EL9 A;  4X65 E;  4OO1 E;  4USM A;  4IZK A;  4GQU A;  4LFA E;  1WUU A;  3PS2 A;  2JEB B;  1ELO A;  1B63 A;  4JI6 I;  4DV3 I;  2X36 A;  2CZ9 A;  1PVG A;  2A2C A;  4R1F A;  4OO1 B;  5C0X B;  1Z0T A;  1R6M A;  4B3M I;  4JYA I;  1J5E E;  4RPF A;  4U3B A;  4OO1 F;  1YHC A;  4DPW A;  4X62 I;  2DEJ A;  4DPU A;  3M85 G;  5IT9 C;  5IT9 Q;  4FW9 A;  1Z0B A;  3P06 A;  1FWL A;  3Q6M A;  2UU9 E;  3QT7 A;  1K47 A;  1Y5Y A;  1HNX E;  1N33 I;  1FKA E;  4LFC I;  2VQE E;  1E3H A;  4FW3 A;  4AIM A;  4NXN E;  5FLX C;  4IZJ B;  3UHM A;  4FWD A;  4WUB A;  4KHP E;  1Z0V A;  1B62 A;  4OO1 D;  4X64 I;  4ZVI A;  4DR2 I;  4DV2 E;  5IWA E;  1XNQ E;  2X7I A;  2O1T A;  2GS8 A;  4GKK E;  2BA0 D;  1P42 A;  3ZKB A;  2HK2 A;  2IOP A;  5DNL A;  1NHJ A;  2DEI A;  1ZM4 A;  4AQY I;  2JEB A;  4X64 E;  4M1K A;  1XNQ I;  4JI3 E;  2GO4 A;  4HY1 A;  5JEA A;  1HNW E;  4PU9 A;  4USK A;  2V2Z A;  4K0K I;  1RRE A;  4LF9 I;  1D6T A;  1IBK I;  2UXD E;  1I94 I;  3PYG A;  4OKG A;  1OYP A;  2HK3 A;  2AE8 A;  2UUB I;  2NPF A;  1KVK A;  3J80 Q;  4LF4 I;  2O3Z A;  4DPT A;  4JI6 E;  4YHH E;  1IBM E;  2HHH E;  1ZM3 A;  4IFD D;  2NN6 E;  1ZXM A;  4MU4 A;  1FWK A;  3ZZ0 A;  1OYS A;  1EI1 A;  3CWV A;  2HHH I;  3OTO I;  3HJC A;  5C0X A;  4IFD E;  1N32 E;  3U1K A;  3PRY A;  4DUY E;  3L7Z B;  4IZJ A;  4DV0 I;  1OJ4 A;  3WU5 A;  4IZK B;  3PYF A;  4B3R E;  1MX0 A;  2J65 A;  4OZE A;  4JI5 I;  5DRO A;  4KHP I;  3LPS A;  4DR2 E;  1RR9 A;  5DRR A;  1Z5C A;  5LMN E;  4IFD F;  3WU4 A;  2O1V A;  3P76 A;  4OX9 E;  2PO2 B;  2PO0 B;  2UXB I;  2CGE A;  1XMQ E;  3T1H I;  1FNM A;  5IWA I;  4DV0 E;  2ZM6 E;  1Z59 A;  3QT8 A;  4FWG A;  4UTG A;  1Z0W A;  1HNZ I;  4LF6 I;  4LFB E;  4IFD B;  1XMO E;  4OO1 A;  4MU0 A;  4DR4 E;  4DV7 E;  3M85 D;  1N0U A;  3F0N A;  1U2R A;  1HNX I;  1MG7 A;  2A2D A;  4X66 E;  2UUC E;  3GCM A;  1N34 I;  4IS9 A;  4OX9 I;  2UXD I;  1KKH A;  2CG9 A;  4JI0 E;  3ZM7 A;  1IBL E;  2R42 A;  3T1H E;  4YY3 I;  3B82 A;  2WNR B;  2ZIT A;  4LF4 E;  4DU7 A;  4WUD A;  1A6F A;  2JE6 B;  1NHI A;  4DUZ E;  4X65 I;  4FW4 A;  3JAM Q;  1R6L A;  1BKN A;  1HK7 A;  1USV A;  4DV2 I;  3J81 C;  4NXM E;  4LFA I;  4U3D A;  2F1D A;  4AQY E;  4B3S E;  4HYM A;  3J80 C;  2J7K A;  2PNL A;  4JV5 I;  4JI4 E;  4B3R I;  1N32 I;  3WU3 A;  4JI3 I;  4LCH A;  1IBL I;  3PYD A;  2NN6 C;  4B3S I;  4PRX A;  4DV6 I;  1VIS A;  5C0X D;  2C38 B;  1IBK E;  2PNZ B;  4DR1 E;  4N3O A;  5A2Q C;  3T1Y E;  3J7A M;  4FW6 A;  3K17 A;  5K36 E;  3PS1 A;  1FI4 A;  4AID A;  4IZJ D;  1Z5A A;  4DR6 E;  2WP8 A;  3M7N G;  4DU8 A;  1N33 E;  5K36 D;  4LFC E;  4DPY A;  3PYE A;  4ISA A;  2C39 A;  5JEA E;  4DR3 I;  1KIJ A;  1H72 C;  5K36 F;  4LFB I;  2JEA A;  2Z5C B;  5FWK A;  2R3V A;  3M6A A;  4YY3 E;  2BR2 A;  4GKK I;  3ZZT A;  1UDO A;  3ZKD A;  4LF9 E;  4JI1 I;  2PNM A;  2UUA I;  1PKP A;  4DUZ I;  5EKW A;  4MDT A;  2E1R A;  4I3H A;  2NN6 A;  4LF8 E;  2Z5B A;  1HNW I;  5FLX Q;  2PO1 B;  5L3J A;  3V2U C;  4QNJ A;  4DR3 E;  4JI7 E;  4JV5 E;  1H74 A;  4K0K E;  2HKJ A;  1EA6 A;  4HAC A;  3B4T A;  3P3E A;  3HKM A;  4JG4 A;  3V5R A;  2Z5B B;  4MU1 A;  1Y4U A;  4DV6 E;  1ZM2 A;  3LTO A;  4JI4 I;  3JAM C;  1Z5B A;  3H1C A;  3T1Y I;  4DPX A;  3GLL A;  2BR2 B;  2C37 A;  5DRP A;  4BA1 A;  3QT5 A;  4X66 I;  2JEA B;  4LF7 E;  4J3D A;  4WUC A;  4DR1 I;  3PS3 A;  4QNK A;  3U1Y A;  2WW4 A;  4JI2 E;  4JYA E;  1E3P A;  4FW5 A;  1XNR E;  5LMN I;  5K36 B;  1Z0E A;  2EFG A;  5GME A;  2BV3 A;  4MU3 A;  1ZXN A;  4BA2 B;  4URL A;  4JI8 I;  1XMQ I;  4EMD A;  1XNR I;  4JI5 E;  1Y6Z A;  4HAC B;  5LL6 R;  2V8P A;  2UU9 I;  2GO3 A;  4Z7C A;  1XHK A;  2E5L E;  4JI8 E;  4GKJ I;  4LF6 E;  4JI1 E;  4BA2 A;  4LOM A;  1UDQ A;  4DR4 I;  2C38 A;  2Q2E B;  1PIE A;  1S16 A;  5A2Q Q;  4JI2 I;  5K36 A;  1HR0 E;  3P3C A;  4GKJ E;  2UUC I;  4B3T I;  4DV5 E;  2BA0 G;  2UUA E;  4JI7 I;  5JEA F;  4JI0 I;  2IER A;  4LCF A;  3D4J A;  1XMO I;  2CVE A;  2HKE A;  4MYU A;  3HUL A;  2NN6 F;  4HXZ A;  2C39 B;  5LMU E;  1Z0G A;  2Z5E A;  2BA1 D;  1N34 E;  3M7N D;  1QZR A;  4XTJ A;  1UEK A;  2BA1 G;  5ELW A;  1UDS A;  1Y60 A;  2VF3 A;  5K36 C;  1I94 E;  2UXB E;  2PO1 A;  4NXN I;  1Y4S A;  5C0X F;  3K1J A;  4DR7 I;  4FN5 A;  4FWH A;  2BM0 A;  3Q6N A;  2UXC I;  4NBQ A;  3KRN A;  2VES A;  1N36 E;  1IBM I;  1XXE A;  3B8H A;  4LPF A;  2LJP A;  4OO1 C;  2XEX A;  2Z5C A; 
#chains in the Genus database with same CATH homology
 4KQV A;  3OTO E;  1H7S A;  2O1U A;  4DR5 E;  1Z0C A;  4DUY I;  1HR0 I;  4P7A A;  5BR8 E;  1NZ0 A;  4DR6 I;  2ZBK B;  2HFS A;  2BM1 A;  5BR8 I;  4NXM I;  3Q1Q A;  1NHH A;  2V2Q A;  4B3T E;  4ED4 A;  4DV5 I;  4DV1 E;  3ZZU A;  2V2V A;  2UUB E;  4DV1 I;  4DV3 E;  4MYT A;  4B3M E;  1H73 A;  1DAR A;  1J5E I;  4DR7 E;  4LF5 I;  4LF8 I;  2OI2 A;  2V34 A;  2VQF E;  1FJG I;  4X62 E;  1S4E A;  3LNU A;  1ZM9 A;  4DXL A;  2IOQ A;  2VQF I;  1FJG E;  1N0V C;  4LF7 I;  2F4V E;  3J81 Q;  2UXC E;  1N36 I;  4DR5 I;  3J7A G;  4DV4 E;  3H4L A;  1MU5 A;  1USU A;  2F4V I;  3WU6 A;  1KTV A;  2ZM6 I;  4LF5 E;  5LMU I;  4YHH I;  4DV4 I;  2O1W A;  2VQE I;  3K85 A;  5GMD A;  4DV7 I;  2HFU A;  3GON A;  2E5L I;  4PRV A;  2GQ0 A;  4UT4 A;  3QT6 A;  1HNZ E;  4P52 A;  4Z7Y A;  1H7U A;  3B78 A;  2AJ4 A;  4X65 E;  4USM A;  4IZK A;  4LFA E;  1WUU A;  1ELO A;  1B63 A;  4JI6 I;  4DV3 I;  2X36 A;  2CZ9 A;  1PVG A;  2A2C A;  4R1F A;  1Z0T A;  4B3M I;  4JYA I;  1J5E E;  4RPF A;  4DPW A;  4X62 I;  2DEJ A;  4DPU A;  5IT9 C;  5IT9 Q;  4FW9 A;  1Z0B A;  3P06 A;  1FWL A;  3Q6M A;  2UU9 E;  3QT7 A;  1K47 A;  1HNX E;  1N33 I;  1FKA E;  4LFC I;  2VQE E;  4NXN E;  5FLX C;  4IZJ B;  4FWD A;  4WUB A;  4KHP E;  1Z0V A;  1B62 A;  4X64 I;  4DR2 I;  4ZVI A;  4DV2 E;  5IWA E;  1XNQ E;  2X7I A;  2O1T A;  2GS8 A;  4GKK E;  3ZKB A;  2HK2 A;  2IOP A;  1NHJ A;  2DEI A;  1ZM4 A;  4AQY I;  4X64 E;  4M1K A;  1XNQ I;  4JI3 E;  4HY1 A;  1HNW E;  4PU9 A;  4USK A;  2V2Z A;  4K0K I;  1RRE A;  4LF9 I;  1D6T A;  1IBK I;  2UXD E;  1I94 I;  3PYG A;  2HK3 A;  2UUB I;  2NPF A;  1KVK A;  3J80 Q;  4LF4 I;  4DPT A;  4JI6 E;  4YHH E;  1IBM E;  2HHH E;  1ZM3 A;  1ZXM A;  1FWK A;  3ZZ0 A;  1EI1 A;  3CWV A;  2HHH I;  3OTO I;  3HJC A;  1N32 E;  3PRY A;  4DUY E;  4IZJ A;  4DV0 I;  1OJ4 A;  3WU5 A;  4IZK B;  3PYF A;  4B3R E;  1MX0 A;  4JI5 I;  4KHP I;  3LPS A;  4DR2 E;  1RR9 A;  1Z5C A;  5LMN E;  3WU4 A;  2O1V A;  4OX9 E;  2UXB I;  2CGE A;  1XMQ E;  3T1H I;  1FNM A;  5IWA I;  4DV0 E;  2ZM6 E;  1Z59 A;  3QT8 A;  4FWG A;  4UTG A;  1Z0W A;  1HNZ I;  4LF6 I;  4LFB E;  1XMO E;  4DR4 E;  4DV7 E;  1N0U A;  3F0N A;  1U2R A;  1HNX I;  1MG7 A;  2A2D A;  4X66 E;  2UUC E;  1N34 I;  4OX9 I;  2UXD I;  1KKH A;  2CG9 A;  4JI0 E;  3ZM7 A;  1IBL E;  2R42 A;  3T1H E;  4YY3 I;  3B82 A;  2ZIT A;  4LF4 E;  4DU7 A;  4WUD A;  1A6F A;  4DUZ E;  1NHI A;  4X65 I;  3JAM Q;  4DV2 I;  1BKN A;  1HK7 A;  1USV A;  3J81 C;  4NXM E;  4LFA I;  4AQY E;  4B3S E;  3J80 C;  4HYM A;  2J7K A;  2PNL A;  4JV5 I;  4JI4 E;  4B3R I;  1N32 I;  3WU3 A;  4JI3 I;  1IBL I;  3PYD A;  4B3S I;  4PRX A;  4DV6 I;  1VIS A;  1IBK E;  4DR1 E;  4N3O A;  5A2Q C;  3T1Y E;  3J7A M;  3K17 A;  1FI4 A;  4IZJ D;  1Z5A A;  4DR6 E;  4DU8 A;  1N33 E;  4LFC E;  4DPY A;  3PYE A;  4DR3 I;  1KIJ A;  1H72 C;  4LFB I;  2Z5C B;  5FWK A;  2R3V A;  3M6A A;  4YY3 E;  4GKK I;  3ZZT A;  3ZKD A;  4LF9 E;  4JI1 I;  2PNM A;  2UUA I;  1PKP A;  4DUZ I;  2E1R A;  4I3H A;  4LF8 E;  2Z5B A;  1HNW I;  5FLX Q;  5L3J A;  3V2U C;  4DR3 E;  4JI7 E;  4JV5 E;  1H74 A;  4K0K E;  2HKJ A;  1EA6 A;  4HAC A;  4JG4 A;  3V5R A;  2Z5B B;  1Y4U A;  4DV6 E;  1ZM2 A;  3LTO A;  4JI4 I;  3JAM C;  1Z5B A;  3T1Y I;  4DPX A;  3QT5 A;  4X66 I;  4LF7 E;  4WUC A;  4DR1 I;  4JI2 E;  2WW4 A;  4JYA E;  1XNR E;  5LMN I;  1Z0E A;  2EFG A;  5GME A;  2BV3 A;  1ZXN A;  4URL A;  4JI8 I;  1XMQ I;  4EMD A;  1XNR I;  4JI5 E;  1Y6Z A;  4HAC B;  5LL6 R;  2V8P A;  2UU9 I;  4Z7C A;  1XHK A;  2E5L E;  4JI8 E;  4GKJ I;  4LF6 E;  4JI1 E;  4DR4 I;  2Q2E B;  1PIE A;  1S16 A;  5A2Q Q;  4JI2 I;  1HR0 E;  4GKJ E;  2UUC I;  4B3T I;  4DV5 E;  2UUA E;  4JI7 I;  4JI0 I;  3D4J A;  1XMO I;  2HKE A;  4MYU A;  3HUL A;  4HXZ A;  5LMU E;  1Z0G A;  2Z5E A;  1N34 E;  1QZR A;  4XTJ A;  1UEK A;  2VF3 A;  1I94 E;  2UXB E;  4NXN I;  1Y4S A;  3K1J A;  4DR7 I;  4FN5 A;  4FWH A;  2BM0 A;  3Q6N A;  2UXC I;  1IBM I;  1N36 E;  3B8H A;  2LJP A;  2XEX A;  2Z5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...