3PYFA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with amp-pnp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
296
structure length
296
Chain Sequence
SVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 80
structure length 296
sequence length 296
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pyfA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pyfA01
3ZZUA 2X7IA 3PYFA 4JI6E 1XNQI 2R42A 1MU5A 2E5LI 1PVGA 4X64I 1Z5BA 4JI2I 4GKKI 3T1HE 4LF8E 4LFCE 1RR9A 4DV3E 4JI0E 2UU9I 4DR6I 2UUCI 2V2VA 1H7SA 1ELOA 1N33E 1FI4A 5BR8E 3GONA 1VISA 4JI3I 5FLXQ 4DV5E 1HNXI 3PYDA 4AQYI 1N36E 3QT6A 4Z7CA 4DUZE 1B62A 4X65E 2A2CA 4DR1I 4LF9I 2HHHE 4YY3E 4P7AA 3WU6A 3J80Q 4RPFA 3J81C 2VF3A 4NXNI 5A2QQ 2UUBI 4DR7I 3J7AG 4ZVIA 1HNWE 4B3SI 2E1RA 1HR0E 2UUAE 4NXME 5LMUI 4LF6I 4DV1E 4PRVA 4LF7E 1FKAE 4DR4E 4DV6E 4JI7E 2ZITA 4JYAE 1OJ4A 1MG7A 1HNZI 1BKNA 4LFAI 2ZM6I 4KHPI 1J5EI 1XHKA 4DV7E 4JI1E 3T1YE 4DUYI 2F4VI 1Z0TA 4B3RI 1S4EA 3ZM7A 5IWAI 1NHIA 3B82A 5IT9C 1ZM9A 1Z0CA 4DR3E 1I94I 2OI2A 4JI4I 1N34E 3HULA 4MYUA 2HKEA 3QT5A 3V5RA 2ZBKB 4B3MI 4HY1A 4LF5I 4LFBI 2HFUA 3CWVA 1QZRA 4JI6I 4WUCA 1FJGE 3PYEA 2VQEE 4DV4E 3OTOI 3T1HI 4LF8I 1N32I 4HXZA 1XMQE 1MX0A 5FLXC 4DV3I 2HK3A 1EA6A 2GS8A 1XNQE 1FWLA 2HKJA 1NZ0A 4DXLA 2HFSA 4JI2E 4USMA 4X62I 4X66E 4DV5I 3V2UC 4GKKE 5L3JA 4DR5E 4PRXA 4PU9A 5GMEA 1K47A 2V8PA 3J7AM 2CZ9A 3J80C 1FNMA 4FN5A 5LMNE 5A2QC 2UU9E 3QT7A 2A2DA 4DR6E 1IBMI 1N0VC 4XTJA 1HNXE 4I3HA 4JI5I 1H72C 4OX9I 3K17A 4B3TE 4GKJI 2DEIA 1ZXNA 1HR0I 1XMOI 1FWKA 2UUAI 2UXBE 4NXMI 2BM0A 4ED4A 2BM1A 1XNRI 4DV1I 3WU5A 2HK2A 4DV6I 4NXNE 4WUDA 4DV0E 4JYAI 4DR7E 1A6FA 4R1FA 1B63A 4FWHA 5LMUE 1KIJA 4LF6E 3LPSA 1KKHA 3JAMC 4DV7I 4DV2E 1IBKI 2UXCI 2BV3A 2LJPA 1PIEA 3ZZ0A 4LFAE 4EMDA 1EI1A 3JAMQ 2UXDE 1N0UA 1D6TA 1Z0WA 2WW4A 4HACA 2VQFI 4LF4I 4JI8E 1N34I 1KTVA 4DR2E 3B78A 1Z59A 2F4VE 4YHHI 4DU8A 1Z0VA 1H73A 1IBLE 2V2ZA 4JV5I 4FWGA 1PKPA 4WUBA 1I94E 2R3VA 4JI4E 1Z5CA 1ZM4A 1KVKA 1FJGI 4K0KE 1U2RA 4B3ME 3Q1QA 4LF5E 2VQEI 4DV4I 2XEXA 4LFCI 4DU7A 1XMQI 5GMDA 4DPTA 4Z7YA 4DPYA 4JI0I 2E5LE 1Z0GA 1N33I 4X64E 2V34A 3LNUA 5BR8I 1S16A 4X66I 3OTOE 4DPWA 4DR5I 4URLA 4KQVA 1N36I 1N32E 4DUZI 1Z0BA 2AJ4A 5LMNI 4X65I 2UUCE 2HHHI 4YY3I 4JI3E 4FWDA 2EFGA 3K1JA 4X62E 4UT4A 4AQYE 4M1KA 3WU4A 4B3TI 2DEJA 1H74A 1HNWI 1IBME 4DR1E 4LF9E 2UXBI 2X36A 4LF7I 4JI5E 4OX9E 4DR4I 4JI7I 2UUBE 4DV0I 4GKJE 4B3SE 4FW9A 2J7KA 1XMOE 3J81Q 4HYMA 1XNRE 5LL6R 3B8HA 3ZKBA 4DPUA 4JI1I 4DV2I 3D4JA 3T1YI 3LTOA 1HNZE 1ZM2A 4P52A 1Z0EA 3WU3A 3ZKDA 2ZM6E 4KHPE 4JG4A 1RREA 2UXDI 1J5EE 3QT8A 4USKA 1UEKA 4DR3I 1H7UA 1IBKE 3ZZTA 2UXCE 4JI8I 4MYTA 3H4LA 4DUYE 4DR2I 4B3RE 3M6AA 4DPXA 4HACB 4UTGA 2Q2EB 1IBLI 1ZXMA 5IWAE 1Z5AA 2V2QA 1WUUA 2VQFE 4LF4E 3PYGA 4YHHE 2NPFA 5IT9Q 1NHJA 4K0KI 1DARA 4LFBE 1ZM3A 4JV5E 1NHHA 3F0NA
chains in the Genus database with same CATH superfamily
3FBCA 1S6UA 5C25B 3JQMA 4WKRA 1XNQI 2B4PA 3EZUA 4FYYB 1IKYB 3NXZA 4NX9A 2R8GA 3DI6B 2C2EA 2V2KA 4CZCA 5DROA 1X9SA 2Z5EA 1IKVB 1RQ0A 1U8WA 2CVIA 3CMES 5H9FJ 3EGWB 1S99A 1MU2A 3O3LA 2CQ0A 2EFNA 3VR1A 1NSPA 1JXVA 3GV5B 2J76E 3W7BA 4ZLLA 2VUGA 4KO0A 2NN6D 2DNQA 4UF4A 1MN9A 1FHTA 4KGMA 3FVYA 4KC5A 5ETVA 4ZPAA 4IOBA 4KKOA 1YH8A 2HFOA 2KH9A 4LBHA 1W7WA 2R7VA 2FD2A 4PRVA 3EVMA 2W4DA 1FKAE 3EGVA 1K8AT 4EBCA 3KG4A 3HO1A 2HGNA 4WJBA 3UVJB 3DYAA 3DFEA 1NK4A 8AT1B 4X65J 4CP5A 1HBOB 1J5EI 3MF5A 3C46A 5GVQA 5DGBA 2VBZA 4ILRA 3QZ7A 1R6YA 2DHSA 2ZDPA 4C6AA 7FDRA 3PO4A 2F4VI 1Z0TA 4HHJA 3P45B 2LEAA 2VZ9A 1IXKA 2EEYA 2GMHA 3EVWA 2J0XA 4NLPA 5GAEI 2HVHA 1GTEA 3L7UA 4L74A 3HHDA 4J37A 3UDCA 1SC6A 3W1YC 4QJVA 2C22A 3IM9A 2VQEF 3KK3A 1HWLA 3OVAA 4HHHA 1LWFB 2QA1A 3MEEB 2LDIA 1UTAA 1RT7B 2ZOFA 4ZN3A 4QIVA 1XNQF 2WOMB 5J2QB 1TKZB 4NCAA 5CXTA 3MAAB 5MAOA 4L72B 2NLWA 1YWXA 2FC9A 4X4UA 1N48A 4P7VA 1QLNA 2BA0G 3W9JA 5D6GA 2V50A 4P73A 3CB4A 3C66A 4ZP8A 3I31A 3IWLA 4DF8A 2PO1B 2P9EA 4ZLJA 1H72C 4B3TE 4MMOA 2G0JA 4YMEA 4KPYA 3DRPB 4I7FB 3HHLA 1HR0I 1XMOI 4ED4A 2BM1A 2YPYA 3WU5A 1GX6A 4JI2J 4BA2B 3IP0A 1LWCA 3CC2S 4DR7E 2HHVA 4NCBA 3R8YA 3VVUA 3G96A 2BANA 1VQ5S 4JBCA 5EX3A 4BA1A 4YB6A 1KKHA 1FTCA 1HI1A 4NLOA 4V19J 2F4VF 2UXCI 3MD1A 3ZZ0A 1Q5YA 2UUTA 4EMDA 2B8PA 2FHMA 2E1PA 3JAMQ 2DTJA 2UXDE 3KLGB 2DR7A 1EJ7L 5MLCV 2IBOA 3K7RA 1M1KT 2E29A 4PPDA 3MTKA 4KGZB 5G4DA 2E5HA 4IUFA 3CCZA 1I51B 3KHGA 2ZNYA 1H73A 3OT9A 2K7JA 4B3SJ 2AHOB 1JLGB 2CPDA 4P10A 2OTJS 4DBQA 1NMEB 1H38A 3CJTA 3NGSA 4DSEA 1CULA 5E3AA 2B51A 4AL6A 1Z5CA 4ERDA 3Q1QA 4LFCI 1H6KX 3BO2A 1XMQI 5LXRA 3HDSA 1S1WB 2ZOMA 2GQQA 1N33I 1PCAA 3OTOE 1VQ4S 3FCWA 3W2WB 3ISZA 2KKHA 1RT1B 5C2GA 2W01A 5IWAJ 3CXCR 2IVMA 1V6HA 2YTCA 3FBEA 2KM8B 1X5PA 4FWDA 3K1JA 3MM5A 1KFSA 1UP1A 3H90A 4YDDB 2DEJA 3RAXA 3LP0B 1XMOF 1FDNA 4ECXA 1UVLA 4O4GB 1Y7PA 2UXBI 5KFPA 1VRTB 1I3OB 3PTWA 3QPIA 4DV0I 2MTLA 2J9EA 4GVLA 3NAIA 4DS5A 4D3HA 1MWYA 1YJVA 2K7KA 2UXCF 3PNIA 3DKDA 1IKXB 4FF2A 2XZWA 2B3TB 3WU3A 4KHPE 1Z2ZA 1U45A 1UPMB 2EKNA 1YTYA 1WNEA 3MI7X 1NJYA 3ZZTA 1XR5A 2Z5BA 2IC3B 4U3BA 3CTRA 3EZ5A 4Y65A 2LQ5A 2W7AA 2AIRB 1SBRA 4F4XA 3Q8SB 2RHSB 2VQFE 2YKNB 3PYGA 1VRUA 3MAHA 4K4XA 4LFCF 1BHNA 1XMQF 1EP4B 5ETTA 2M88A 5DZ6A 2I6WA 2A18A 1N33F 4IFVB 1UA0A 3KLHB 4WU2A 1PVGA 2AKWB 2EFOA 1NB2A 1REVA 5FJ4A 5D4OA 5KG2A 3IN5A 4UY85 4YS2A 1H7WA 4OYPA 1IR0A 4H4OA 5CYQA 1FNOA 4DV5E 5H1SV 5KFBA 6FDRA 5EN1A 2PNZB 3A3OB 4O4RA 4DUZE 1DFDA 1RA7A 2XY6A 2UXBF 3C8YA 3CJ2A 1SJRA 4DV0F 1PJ5A 2J9CA 2RU3A 4PG7A 3LGHA 1FJGJ 3GR1A 4F4YA 5DDQC 4G1IA 2VKZG 3SFGA 2HHTA 1HFEL 3POTA 4WK1A 1SJFA 5AJ3J 3CCWA 3VZIA 5HMZA 2DO0A 1LW0B 4NBQA 4LF7E 1TL3B 5E2QA 4IZJB 1T9VA 5G0RA 4ALZA 2N3OA 1HNZI 1UJ6A 3OSNA 1BQNB 1PBAA 2Y0SD 4C2MA 1UPPA 2BW2A 2I1RA 2ZH5A 5ETNA 4ZVPB 3K2YA 1WD6A 3T1YE 2L9DA 3BGLA 2JH3A 2KYZA 1S4EA 2MKCA 2EK6A 4YEAA 3GU0A 3UNYA 5IT9Y 4NA1A 2DNYA 3O44A 2CQ3A 2ZJRQ 3AH6A 3SQGA 4AIDA 2C2NA 5K8PA 2OELA 4URGA 5HBMA 4FYVB 4J9PA 1VC6A 1RAEB 2YWWA 1CJTA 2FHOB 2E66A 5D4LA 4WUCA 5HATA 5DG9A 4DV4E 2QE5A 4M5HA 4LRAA 5E3PA 1KVIA 3QBCA 1FWLA 3HHLD 2NXNA 3DGPA 4OJ3A 3SYZA 3R7NB 3D1QA 1VS3A 4X62I 4GKKE 3AJDA 1HWJA 2G0IA 5IT0A 5JEAE 4DR6E 1IBMI 3N9UC 4WPAA 1RHQB 1C0UA 2PNMA 4JI5I 3ILOA 4I1TA 2J9DA 1SCJB 4RNNA 1X8DA 3RU0A 1ZXNA 4DL6A 4GVBA 2HEKA 4R8UA 4F26A 4O3QA 1NHUA 2OPQA 1B99A 3DHXA 3DRRA 2BE2A 2DNRA 3FCVA 4R1FA 2IOPA 2BRKA 1NKCA 2XLIA 2WONB 2NN6B 2IAJA 5CYMA 2B7BB 4FYDA 5E33A 4Y2KA 1RWXB 4GO7X 1EKRA 4C3LA 1KTVA 3SBMA 2CJYB 2V8VA 3IBCB 4CYUB 2JRSA 3DOMA 3FZBA 4OJHA 2V2ZA 3Q8RB 3C16A 2I38A 2H1YA 3KJNB 2KG0A 2YNIA 2Y8WA 1ZM4A 1WSVA 4LF5E 3KJQB 2GX8A 4WE1B 1HNIB 2GFFA 1HK7A 1NU4A 3IWXA 1UVMA 5D78A 1MMLA 4X62F 4JB8B 5BR8I 1T95A 4DR5I 2W7PA 2J5AA 3MOJB 5I3QA 3K57A 1TAQA 1IBMF 3ET6A 3JTPA 3BQ2A 5A0YA 4IS9A 4AT1B 4DL0C 1RT5B 5DNXA 2DRBA 1WC5A 4JI5F 2H9ZA 3MOZA 1FD8A 3UWTA 2MY7A 3NOGA 2IMOA 1ZZNA 3DDKA 2XB2D 3AQPA 3EXCX 4ZIWA 3NWGA 2EI5A 3GYNA 2JHEA 3Q22A 1JLEA 1O8BA 3MEDA 3GIJA 2DNLA 3J81Y 4KT0C 4O3NA 3R5AA 5F9NA 3RW6A 4B3SE 2WK4A 4FW9A 2P8IA 4IG0A 5F8MA 3JYTB 2VPYB 5KFOA 3JTOA 1RAIB 3V4IA 4B3RF 4QPXA 2JWNA 1FKOA 5L8RC 4KYZA 1USVA 4OI4A 5DETA 4OL8A 2LXIA 2HHUA 2U1AA 2R8KA 1FKPA 3BSOA 3ENVA 2WNRB 1IBKE 4MK8A 1OMSA 3TEHB 2UUBJ 3M6AA 1GXLA 5IWAE 3E8OA 2JEBA 3MPYA 2V2QA 4WU3A 3M6XA 4C8YA 2X1AA 1UJ5A 3QWUA 2Z58B 1ZPVA 4QWBA 4X4SA 1C1CA 2FZCB 4KE5A 1WEXA 1N52B 2RVJA 5A8KA 1AW0A 4F50A 1V3ZA 2DGSA 1KHWA 1D3WA 4I6AA 5BR8F 4WYLA 2R42A 3VVTA 4G1QA 4WFAQ 3I32A 2VOOA 3NMRA 3L7ZA 1FEHA 1VQSA 3K58A 2A1BA 1Q1KA 1WF1A 3E01A 2UUCI 1AUSL 1RCXB 4HH0A 1S1VB 1TL1A 5FLXQ 5HQ8A 1DBDA 4V1Ak 3NOCA 4XDCA 1N36E 4QU7A 3HCXA 4PQUA 4C0OC 1B62A 2CNNB 4M5IA 3OVBA 4BC9A 4LMZA 3OBIA 1WHXA 2AW0A 1R43A 1K0TA 4NXNI 1H7XA 2WVBA 1KOOA 5HI7A 2KRRA 5T7LA 3M8PA 1DLOB 4NXME 3P8BB 4DV7F 3M9NB 3KFWX 5KFEA 3T6BA 4CM0A 4ZVRB 1R6MA 4ZHRA 4JYAE 1OJ4A 5J2NA 4DFJA 1JMTA 2MJNA 4KBIA 1MN7A 4B17A 4P72A 1S9FA 2O1WA 4KGXB 2K1RB 3IFEA 3WIVA 4DCJB 1IM6A 3GJSB 4ECZA 1D0EA 2Z5CB 3W3SA 4ZPDA 2QA4G 3JSMA 4JP8A 4XK8C 4AL5A 3V6JA 1HYSB 1AZSA 3CDJA 5IOLA 1P9YA 3OUYA 1HBMA 3VGUA 1T05A 2GC8A 3QT5A 4I2QA 2CQDA 1KS2A 4NLSA 2MZTA 2KFNA 3M2VA 1UVJA 4OZ0A 2AYGA 2YBVA 2XCPA 1M90T 3ILJA 4JI1J 3UPFA 2Y9HA 1WG4A 1FJGE 3TAPA 5KT2A 3UN5A 3KHRA 5FLXC 2W8KA 4NCGA 2VFTA 2GS8A 2OLWA 1R6VA 3TJAA 3DRSA 3TZYA 2PI5A 4USMA 1MU2B 1FF2A 1R6LA 4U8YA 4FS2A 4KTQA 3AY0A 2UU9E 3KUEA 2XYPB 4NXNF 3KRNA 3OL7A 2FC8A 4KO0B 4OHWA 2D1CA 1SV5A 4J9VA 3KLVA 3GFHA 3CJSA 4KKOB 2VDIA 3M7ND 2AX1A 5I3PA 3AD7C 4FWHA 2OPPA 5LMNJ 1T8EA 1MLAA 4QPTA 3DYAB 3D5MA 3C6UA 2IY5B 4LBPA 4YR2A 1TV6A 2R7UA 3KJVA 2FVSA 2ASLA 3AAWB 4CO2A 2KN4A 2RF2A 2BX6A 2DITA 5F8IA 4LRDA 2POKA 2MLXA 2XMAA 4NMLA 1X0FA 2DHHA 2HQGA 4ZPBA 2DHAA 4Q44A 3KK3B 4X64F 1RT2A 1DAXA 2MY8A 1H2TZ 3FRZA 4H4KC 2I8EA 4DV2J 2NYIA 4U7UK 4FKXA 3R1LA 3MMJA 1NM2A 5KOXA 1TKTA 1S79A 1Y0HA 1NSQA 2WVCA 2DGUA 2YWGA 1TK5A 3IGVA 3CD6S 1TTHB 3M2UA 5I42A 3MPWA 4WXWA 1CJUA 2MQPA 4WTYA 2E5GA 1Q8LA 5DRKA 2DNMA 5HQLA 1U8SA 4C8KA 1SXLA 3O1LA 4ID5A 1VQ8S 4YY3I 3P06A 5KTQA 4KFBA 4J9LA 4B3TI 1W2BR 1OYRA 4LRCA 3OTBA 2OSQA 4ZMMA 3NBPA 1B7FA 2FLPA 3RGIA 3M8RA 1U4BA 3BSCA 5DNLA 3HHLB 5CZVA 3FQKA 4F67A 1P6TA 1LWCB 1XNRE 2VFVA 5LXYA 5ETOA 3Q8QB 5F8NA 1RHKB 2ROGA 3NEKA 3UN3A 4IFDA 2BANB 4IR9A 4BA1B 3MTJA 2UXDI 3TQEA 4LF9J 3ISND 4IDKA 4PQAA 3PCOB 3PR5B 1OIAA 2QFJA 2W7OA 2C2ZB 3ZZZA 4BLGA 1WKJA 3WX8A 4J91A 2VG5A 3WIUA 2RS8A 4ELVA 1DARA 4G1PA 1CULB 4JV5E 3OLBA 1RJJA 3FBFA 4JI6E 1MU5A 1FA0A 1WI8A 4ZCIA 4B02A 2KU7A 1JJ4A 1Y5LB 2W24A 1YJUA 3UDLA 2GAGC 2OEKA 4JI0E 4OYWA 4YY3F 2UV8G 3BYRA 3I5BA 1SC3B 4OV1A 2JLEA 2NSBA 3PKYA 4YHHJ 4UUWA 4CLFA 2DYAA 4NWBA 4TQSA 2MKSA 2FJBB 1JXLA 1YJRA 3MM5B 2NN6F 4DV6F 1PYTA 5GAHU 2C3YA 2EVZA 4M5DA 2VF3A 2GMJA 3RUBL 5A2QQ 4WCEQ 1YQHA 3D6FB 2QSFA 2B9EA 1NJWA 1OYSA 2XHWA 3OR1A 1S59A 3WBZA 4F0KA 2XMVA 2GGPA 3LP1A 2F9DA 1B70B 2JFDA 3V6DA 3VAKA 2NXUA 1DTTA 4CO3A 1M5HA 3G6VA 3L95X 4KHPI 2FPHX 2XSJA 3JXOA 1DTQA 4ZCLA 2CA9A 1D1UA 2EFPA 5K9FA 1VBYA 2OGUA 2X1GA 3KHLA 4C8ZA 5M2UA 1F2HA 2CNOB 2YWKA 1IM4A 3Q86A 2MYFA 2Z5BB 2R7RA 1I94I 2FYXA 4JI4I 4NLTA 3W63A 2U2FA 4JI7J 5DS7A 3DXSX 3RTVA 3P3DA 2OHDA 2XS2A 2V69A 4QR2A 1FJCA 1VRUB 2JX2A 1U2FA 3KNGA 1KRPA 3J81j 3X3UA 1KC8T 2HRUA 2ZC4A 3PM9A 2LFVA 3DDIA 3GLLA 1HW8A 5C0XA 2RD5C 3MDFA 3HD1A 4X4PA 3EXYA 3JB9k 2YVSA 1PBUA 4DR3J 1REVB 2G1HA 2HFSA 4DV5I 3V2UC 1AFJA 1RTDA 4ZJLA 4H4OB 4J9UE 1FNMA 5CYQB 5A2QC 1WC1A 4KB7A 5K8MA 1TU0B 2ATCB 2VL1A 2K3IA 1XN9A 3KK2A 3ENWA 1S1UA 3F73A 5KFNA 2HHQA 2WSCC 1YJWS 2P2CB 2D3O1 2C2KB 4MK9A 3N6MA 3NGDA 1NK9A 1RWMB 5KFJA 4DX5A 4PPZA 2YX1A 1FWKA 3OHBA 3L3CA 1SUQA 3POTB 2GJFA 2VJVA 2IVFB 3MCOA 4L75A 2BVZA 1S6QA 3CT9A 1UW9A 1NPRA 2HZVA 3IR7B 4KHPF 3RB6A 1U2CA 2IHR1 2CPZA 1U02A 4OO1C 5G0RB 3PX0A 1IUJA 1NDPA 3JAMY 4MAKA 3V4MA 3CJKA 3TRGA 4WP9A 4A8KA 2EG1A 3I9ZA 1I94F 4JI4F 1S9EA 2YWHA 2WW4A 4Z2XA 2L41A 3V81A 1RP5A 3RR8A 4TN2A 1VYAA 3FMWA 4DU8A 1FESA 1HHQA 1Q8BA 3TVYA 1WC4A 1QE1A 1U49A 1XERA 3SQGB 3R1HA 1JJCB 2WVEA 2B9XA 3LWLA 5HBMB 4LPFA 4K5SA 1C0TA 4C11A 1HWIA 4DX7A 1PC5A 3FEZA 5LOQA 1CJTB 3C2PA 1RGVA 4LFAJ 2RQCA 1SC4B 4DV4I 3CDAA 5H9EK 5GMDA 3UR3C 3MUVP 4P2XA 4Z7YA 3B4MA 3DU6A 2YKAA 4NEZA 1S1XA 1Z0GA 1WC3A 5GAHI 4DUTA 1S16A 5C7PA 2FHJA 3DGPB 1WG5A 3TO8A 1BD6A 4X65I 1RKIA 3BO4A 2FGCA 4OJGA 4MKYA 1FFGB 2XNQA 2OPRA 1QDUB 4UT4A 4P2SA 3AJ2A 4FXDA 2F7VA 4S0MA 3J81U 1C0UB 3G6YA 2DPIA 1U48A 4G3IA 2NXJA 2XY5A 2E5LJ 1ZBTA 4R0JA 2NUHA 3OJUA 3CJ3A 2YX7A 4GVBB 2YNGA 4R8UB 5GADU 1PJ6A 4DV3J 3QWPA 3SSQA 3PRBA 1E6YA 2ASYA 3CJ4A 2OPQB 1FNXH 3DRRB 2BE2B 4PYAA 4U7CA 1MWQA 1WDTA 4MKVA 3D4JA 4F4ZA 3UHMA 5CZXA 4P52A 1PG5B 4OFZA 3BS9A 1PYSB 2KO1A 3P5BP 4OX7A 1E3HA 4KY3A 2IAJB 5CYMB 3MAQA 4Q43A 4XIUA 1QM9A 2EW9A 2BMBA 1RWPB 3BGOP 4OZNA 1EHWA 2QJ3A 3B4TA 1G2EA 1MWZA 3A4TA 1QY7A 4GKJJ 2BE9B 1ZXMA 4DI6A 3JQKA 1S7IA 1WUUA 4ENOA 1F9HA 1JLCA 3DOMB 1NK7A 3CDWA 3QAUA 3C16B 2V94A 3BBCA 1GK8A 2CRLA 2VD3A 3BGUA 2X51A 2YNIB 1RAAB 1N5TA 1NHVA 2XS5A 4R5PA 2F9JA 3FSYA 3ZZUA 3BREA 1ZAWA 4EYIB 3MECA 4ZPTR 4RW9A 1SIZA 2E44A 1XK8A 1F5AA 1OSDA 4JI2I 3QZ8A 2XMWA 4X65F 1RU1A 3PZPA 3QRRA 2M7SA 1Y60A 4EBEA 4FF4A 5HL7Q 3ET6B 5B7WA 5IM0A 5A0YB 2XMTA 2RAQA 4LREA 1ZAVA 3D3BJ 4AD6A 1IQTA 1U09A 3L4BC 4KPCA 3HZGA 4P7AA 4C8NA 1K73T 5HMWA 3JS9A 1JJHA 3GJRB 3T1HJ 4LF8J 4PG5A 1JLEB 2GHWA 3A12A 3MEDB 4B3SI 1IKWA 3OTDA 2BBEA 2MEWA 2FJAB 4BC7A 3NLCA 4X66J 2HSEB 4IG0B 5A6WA 4NRTA 3MXHP 4NZ7A 3V4IB 2PE8A 2ZBRA 2GHPA 1FKOB 2DH9A 4ZK7M 1U1PA 3CCES 3UCZP 5CAAA 1GH8A 4HTIA 3P5TL 3AD8C 1FKPB 4ZVQB 1VQMS 1T9TA 4ICLA 5IWAI 5C0XD 3GR0A 2NN6C 3M30A 1Q0NA 2VV5A 2KJVA 3Q8UA 4FVMA 1RHMB 3K89A 1NDLA 2WRMA 1FEEA 2JEJA 2JEBB 1H2VZ 1MW7A 3UDEA 1EIYB 4O3PA 4MU1A 5IQQA 1YVFA 1TUVA 1DQ8A 3VGSA 1C1CB 4RW8A 4JI2F 1A0OB 5A8KB 3AOAA 3GQCA 1F5BA 3DN9A 3TWZA 4OZ5A 2VQEE 3VWSA 5F9LA 2BR2A 4G1QB 3VQTA 2YX4A 3L7ZB 2YQ1A 4OZLA 1XNQE 2FQQB 4LIWA 5CYJA 4C3KA 3R5DA 1B64A 4I0WA 4J5OA 4PRXA 3E01B 5FDLA 3PW7A 1VC0A 1IBLJ 5GMEA 2PI4A 2V8PA 1JB0C 1TL1B 1UEVA 2KXHA 4QIWD 1FX4A 3US5A 5JXSA 1VQOS 5E3RA 4PQUB 3N6LA 4B3SF 4HDHA 1OWXA 1XBWA 3AXMA 3NS7B 4PR6A 1WDDA 4NXMI 4OZ1A 3RG6A 2PD1A 2P9GA 5T7LB 3M8PB 4I69A 1VC5A 2CXEA 1CJKA 2E7WA 5KFYA 4JYAI 1I6JA 5I3UA 4BWMA 3UNGC 3DLBA 3Q8YA 4ZHRB 2XI3A 2DO4A 4JI3J 1HNXJ 1UVNA 5IS2A 1SKRA 3HX9A 2LJPA 1PIEA 1OQ3A 1O0PA 2HG4A 5IWAF 2BJDA 4Q5VA 4W98A 1R8CA 4WFYA 3U1YA 4MIWA 4YB1P 3OPKA 1VMBA 2MJUA 3JSMB 2ACMA 2EXUA 1AZSB 3N6NA 5RUBA 4JV0A 3OUYB 1HBMB 3D54A 2F4VE 2W4CA 4GC7A 1K44A 1WWHA 1RYRA 2M8DB 2FHJD 1T05B 4UZBA 2NREA 1DRZA 4I2QB 4FW5A 1KLNA 2KZZA 1QAYA 2GIFA 5C0XE 2AD9A 3EE3A 2PT0A 4I6YA 5ETRA 3M2VB 4DL5A 2MXYA 1L3SA 3QATA 1FJGI 1FCAA 4N77A 3MGJA 1Q79A 1XWLA 2AU0A 1TFWA 5B0EA 1SL2A 3BF4A 2QMWA 4JI8J 2CQ4A 2YNHA 4LF1A 4NCGB 1WEZA 2YH1A 2IRYA 1K1SA 3DRSB 9ATCB 3SV3A 3LA0A 1WF2A 4A8YA 5EHHA 2G9OA 3DCAA 5A8WA 2Z8QA 3R5CA 3GIMA 2DT9A 1S49A 4M1KA 2FY8A 1RZMA 2JEAA 1HW9A 4P9SA 2GO4A 2B5JA 2H48B 2IM0A 2F63A 2KVQE 4HT5A 2HBZB 3CIMA 1NH7A 2PO4A 2DXEA 1SV5B 3BSAA 2YWFA 2XNRA 4K59A 3BH7B 2J7KA 3CWJA 3KLIA 1XMOE 3FKBA 2HFNA 3OTCA 2WB4A 3B8HA 3KHHA 1Y00A 4K4ZA 3NNCA 2A6OA 2GHVC 4CRJA 4XTTA 2ZZNA 2OPPB 3DRYA 4TQRA 1ZM2A 2D74B 4MT1A 1K9MT 4ECTA 1GFWB 1VQ6S 4DR1J 4USKA 3C6UB 3QIDA 3IG1A 1H3DA 3VAIA 2UXCE 2KL8A 1TV6B 4PXDA 3KJVB 4U67Q 1FE0A 3TZZA 2WB1D 1Q7LB 2PA8D 2RF2B 3J7AN 4OZJA 4PG6A 3VALA 1RT3A 2NYHA 1Z5AA 4DQQA 4DZ6A 3PHTA 4OI2A 2Y1JA 1FJGF 1KQGB 5IT9Q 1A9NB 1HMVA 1T9YA 1RT2B 4MTPA 2JLGA 2FLOA 5AJ3F 1KONA 3I82A 1Y4SA 2EKYA 1TKTB 3ZTPA 1RWKB 2F4FA 4KR0B 2FVRA 1CBKA 1S6OA 2Z56B 4LFCE 4U7UD 3M2UB 4C0HA 5I42B 4DV3E 5DDRC 5FLXY 2J0SD 1CJUB 1N33E 3RBDA 3GONA 4IH6A 4WFXA 2L9WA 3CDBA 2Z4PA 3UFCX 4ED1A 4ID5B 2AGQA 3ADAC 3SI8A 2FJDB 4RU2A 1Y4UA 1JWWA 2HS3A 5I4MA 5KFIA 1Y5YA 3J80Q 4RPFA 3NBPB 4ZPVR 5A6PA 2RH3A 1XXEA 2JEFA 2EFVA 4M5KA 4B9VA 2HWIA 2XTJP 2DNKA 3DMJA 5J2PB 3EZOA 5H9FK 4CCHA 4C8OA 5JEAC 3CJ0A 2V6AA 2I0XA 2AJ1A 4RJVA 2E9RX 2MZJA 4LSLA 4YB7A 4IFDB 2BABA 3KG1A 2OO4A 1KFDA 3FDSA 3G71S 5H9EJ 2O1UA 1T02A 2OP5A 4IDKB 2LVWA 1ZH5A 3KK1A 1HNWJ 5HANA 1PGZA 5DO2A 5IT9C 1T0TV 1Y10A 1Y6ZA 3EGZA 4QR0A 3MZIA 1P1TA 2ZBKB 3N5BA 1YZ7A 3M7NG 4F25A 3FFIA 2VG5B 3OQ2A 4F7VA 2OMOA 3VZHA 4ED0A 1BXNA 4JI6I 3OL8A 1GAOA 4M95A 4M5JA 1RTZA 3R5BA 4K4YA 4DSKA 4C0BA 4IG3A 2BJ8A 4Y34A 2MQNA 2NXEA 2V68A 1UWAA 4ZCMA 4QYRA 5T14A 4X66E 3I0RA 1D9AA 2ZBCA 1YRUA 5DRRA 5L38A 3G9CA 3J80C 5GAGU 3J7Z5 3B4DA 1WHYA 5CCMA 2ZKTA 4K50A 3HVTA 2AMCB 4W90B 2QA4S 4K0KJ 3M8SA 4DHVA 4I56A 1NO8A 4OZEA 4DF4A 2ZJPQ 4M5DB 5CD4H 2AWZA 4YR0A 2HVEA 3SZ2A 2VPXB 1VK3A 3FRYA 2Q43A 4J7CA 3JAMU 3I55S 1BY9A 3ICLA 3OR1B 4QWEA 2GGPB 3LP1B 1M5SA 4KH0B 1KIJA 3G87A 2D9OA 3V6DB 3HHLC 3PJXA 2PO2A 2AYBA 3NKYA 1DTTB 2RT3A 2XSJB 1DTQB 3QAEA 1UETA 1RBLA 3LPEA 3MR2A 3L9ZA 2QRRA 3K5MA 2DR8A 3H1CA 1IBLE 2G13A 1SKWA 1RWUA 2EBEA 4M5LA 4OLPA 1XTZA 4G6VB 2HHPA 3OFGA 2HAFA 2N4CA 2AJ0A 4F3MA 3CVKA 1NK6A 4OYOA 2RILA 5KFQA 4W4MA 3CF5Q 5KG7A 1BGXT 3ZXWA 3GILA 2VFUA 1RTIA 5C0XB 2R2RA 3DU5A 3MHYA 4KQVA 2JFKA 3QRQA 1HIYA 3CCTA 4K4TA 4G65A 2QMUB 3T5LA 2YWEA 1RTDB 4FP9A 2HS0A 4JI3E 1VBXA 1KQFB 2UUBF 3MURP 4X62E 2RU9A 4HLBA 4B3MJ 2XG8A 1PJ7A 2CQCA 1S1UB 1IBME 1EKSA 4F0MA 3LGNA 3RB4A 4JI5E 3W61A 2WP8A 1S1TA 3B54A 3GFYA 1SUQB 1T9WA 3AODA 5KFUA 1S6QB 3G8SA 1S48A 4ED2A 4HH1A 1C4CA 1UA1A 3AB4B 4JI1I 3GZ7A 3FEXB 1NK0A 3LTOA 2BQRA 3RZAA 2CJBA 4JG4A 3GIKA 3QT8A 2HVDA 1UEKA 3F41A 4OX9J 2FUG9 5EWFA 2DK2A 4B3RE 1S9EB 2YKOA 3V81B 1XR6A 2HFZA 2A3JA 5HAOA 4TKTA 1RWNB 1QE1B 1HPZA 3M8QA 4MFBA 2LP4A 2X1FA 1NHJA 1B4SA 2VA3A 4RUHA 3HJCA 5D3GA 4F36A 1C0TB 1J5EJ 4C11B 4ECYA 1MSWD 1DZ5A 2BEFA 2CDQA 5DM7Q 1URRA 3K5LA 1S1XB 3S7RA 2ZHBA 2DISA 2N7YA 2ASJA 3BKFA 2OD6A 5CABA 4LF4J 1N34J 2ZH2A 5BR8E 1N6QA 2WSEC 4HL9A 1R8AA 1TZ0A 1RAFB 4RBUA 2F1DA 4QWAA 2OPRB 4EU0A 2PIIA 4ZN1A 5A2QY 4TYBA 2HBRB 3R2CJ 2OTLS 1PAUB 3P6YC 4USTA 2H5EA 4GO5X 3ELHA 2M5YA 4JI1F 2YNGB 1F1BB 1NBEB 5L9XA 1E6YB 1QAIA 1RBAA 2CPYA 4DSFA 2R7TA 3DNCA 4M5NA 2HHHJ 2AYMA 3EUNA 3CCVS 4DV7E 2P6TA 5ADZA 2ZOGA 3NNHA 2N82B 4J9RA 3M85D 4JOUA 3PO5A 1P9QC 2X3DA 3JSYA 2HQFA 1HR0J 2QG9B 4LQ3A 3E51A 4DR4J 2HKEA 5ETQA 2R8HA 4EWTA 2CPIA 2VC0A 2ZUAA 2AYEA 1JLCB 4TLRA 4X4OA 5FWKA 2YKMA 2Y0BB 1Q7YT 2MPUA 1FVQA 3DLEA 3IRXA 4R5PB 1L3VA 4O3SA 2R4FA 3N5FA 1NPPA 1HARA 2B7CB 3MECB 4ZJQA 5LMNF 4RW9B 2JL9A 3OXFA 1EA6A 1N5QA 3D3CJ 4RLEA 3DOLA 4CLZA 2DGWA 3RAMA 4CH7A 4DR2J 2Y1IA 2C1EB 3MMBA 1R0AA 3RW7A 4PU9A 4RUCA 1ZETA 5IM0B 1CS4A 4MIBA 1ZAXA 3AT1B 4IZJD 5DRPA 4M5GA 2GMLA 3TA0A 1Q4RA 1X5OA 4TU8A 2PNLA 3M1VA 2W4PA 2CG4A 1ZA2B 5LSOA 1VIXA 1XMQJ 3MMAA 2PC6A 4FYXB 2G0CA 4ZPWR 3NGKA 4DV2F 1JNRB 2DCUB 2OPSA 4LJMA 1U6FA 2IM2A 4ZP7A 4NXNE 1IKWB 1P8GA 1RWVB 4NZ0A 3I5AA 2LU2A 5HP1A 5T41A 3WC0A 1B63A 4USJC 1S0OA 2B4OA 2IERA 1HKAA 4ZVEA 2DKOB 1PC4A 3GSDA 4OX6A 1APSA 4JV2A 3WHIA 2H3EB 4QR1A 2Q1LA 4BCAA 1RCOB 4CLSA 4F4AA 1YX2A 2GIRA 4C98A 5B0BA 3QGGA 1M0SA 1V3SA 1CQMA 1RHYA 2KZMA 4ICLB 3D6TB 2ASDA 3NWRA 3M30B 4YHHI 2PFDA 2B4VA 4H54A 3BN4A 3HFZB 3ZFVA 4X4NA 4LF6J 5E7OB 3CPWR 1KVKA 4K0KE 3GCXP 3ITHA 3GB0A 2VQEI 2ZUGA 1HNVA 3R7SB 4RW8B 2JSXA 1JKHA 5IV3A 4DG1A 3BGRA 2BR2B 1QTNB 2HQDA 4X64E 3K85A 3BZQA 2GJ2A 3TX0A 3H40A 4WXOA 3T5KA 2G2YA 4CLLA 2E5JA 1BQXA 2MKHA 2LCWA 1VBZA 2X3GA 1TL5A 2RUSA 5FDLB 2W8LA 1L3KA 1LXJA 1RAHB 2EFGA 3EX7B 3DHWC 3QGIA 2GIQA 3AB2B 2M52A 3KG0A 3HHKA 1S6PA 4IFDF 5KG1A 1KQKA 2PSZA 3RBEA 4QNJA 4RNHA 1RHJB 4JI7I 3CJ5A 1SI9A 3MCMA 1JXEA 1TQLA 4DPOA 1SQEA 2L9NA 2DH7A 2DR6A 3P3GA 1CJKB 2MKKA 2Q66A 5I3UB 5D15A 3Q83A 4QU6A 4B9SA 2VASA 4K7QA 3TOQA 2R2UA 3GPAA 1Z0EA 4OYMA 1NZ8A 4KAIA 4M8LA 4X4RA 4H4KA 4DR3I 3FBBA 1Y5NB 4YHHF 4PG8A 4KH1B 4X4QA 2HURA 4UTGA 3K5OA 2UUWA 1IJFB 4LR7A 3IGNA 4HYKA 3ZC4A 1HNZJ 4LR9A 4U9RA 4LFBE 1KN6A 2CUYA 3H2VE 1NHHA 2XS7A 4WZMA 4DN0A 1OYEA 2CQBA 5EDWA 3R6GB 4RBVA 5FLXU 1RAJA 4ZS6A 1UDNA 1JIHA 3BR8A 2LYVA 1VRQC 3EPGA 4OMFG 3CDEA 3HXMA 5SUHA 2PFFB 2YNHB 4IQXA 3ISNC 2MHNA 3EDRB 2GO3A 4OIXA 4TLQA 4E2FB 3EJMA 3FCHA 2KB2A 1WC0A 1A6LA 4CDIA 4CO4A 2L3MA 3P4UB 4N5SA 5A8WB 5B0FA 4YY3E 4JI7F 2AJQA 2JEAB 5JMNA 1WSRA 4NYZA 2HWTA 4OI6A 2B5JB 1UCNA 5KG3A 1CVJA 2LU1A 4F0HA 2OD4A 3A8EA 2J65A 3IR5B 2DBBA 1T11A 3T5HA 2NN6E 1P27B 4DV6E 5DQIA 1XEZA 3CW2C 1YK9A 3KLIB 3LQVA 4C7QA 4TY9A 4LFAI 2XYHB 3BPSP 4AXJA 3SMZA 1FO1A 1ZTWA 4DR3F 3RBXA 3OFFA 3PEHA 4ZVTB 4RKUC 2ZNZA 2O66A 1CC7A 1X7VA 1U1NA 3CCSS 3KMQA 3BQ0A 4B9LA 1J5OA 3IG1B 3LUYA 3QSIA 5C0XF 3G86A 2FTRA 2A10A 2VG6A 1N34E 1RT3B 3A3PB 1GX5A 1VQ7S 2XC9A 3CWVA 3KLEA 4N56A 4J9KA 3U1LA 1UW4A 1HMVB 4DS4A 2O67A 4Y2MA 2IESA 1CG2A 3EGNA 1TMJA 1X4FA 2M0GB 2CKWA 5D4NA 4J9NA 4DV3I 3GCMA 1Z2LA 4Z37A 3BBFA 4CLPA 4YOEA 2VONA 5BXIA 1X4DA 2IYGA 1H2UX 4Q8EA 5L3JA 3CE8A 3KKFA 1Q8IA 3QGHA 1K47A 2CZ9A 4CLYA 2VBWA 3DM2A 1X31C 2BA1D 3OFEA 2NZCA 5KT5A 4I3HA 1QAJA 1IBCB 4N3OA 1HLWA 2Q6CA 4GKJI 2V5HG 1ZS6A 3H5SA 1EQMA 2DGQA 1RXOB 2JZ5A 4DR5J 4LFAF 3BN7A 3GWCA 4LF2A 1Y5IB 3DMJB 5EGYA 2GZOA 3P76A 3JAMC 2NS1B 3FJ2A 2YY3A 4A8FA 2AX0A 5J1PA 4LSLB 1U1KA 2H5JB 1M5PC 2UZAA 4Y2AA 2W2OP 2BACA 3GMGA 1HI0P 2LQ9A 4C48A 1S10A 4LUBA 2BW7A 3KK1B 4DR2E 4HT7A 1HA1A 1OPIA 1J2VA 1F3FA 4FW6A 2K06A 3R3TA 5LMUJ 2E5LF 4WUBA 1I94E 4JI4E 2VBXA 3FFIB 2VH7A 5M2RA 5ETPA 1IN0A 4DV3F 3TI0A 3IS9A 2XEXA 1SQGA 2RDDA 4Y0FA 2E1CA 3PHEA 1U47A 5E3QA 2V34A 1IWGA 4HR2A 4X66I 4U95A 2HNDA 2Y1LB 3WX4A 4IG3B 5L1IA 1TUGB 1Z0BA 1S7HA 1S57A 3I0RB 4OV6A 4A48A 1VR6A 2RKIA 3OR2A 3V6HA 3JTNA 3THVA 2CPXA 3DLGA 4GKJF 3SDEA 2E7XA 3HVTB 5ITHA 2PDAA 5KFMA 4KQZA 2BQUA 4OO1A 3MUTP 1JLAA 1FRXA 4CT8A 4K2XA 3LP2A 4DLEA 1LK7A 2W2QP 3FSIA 3J7YI 1N32J 4AE5A 5FIIA 1LWEA 4DL4A 1LWXA 2JEIA 2R7OA 2UUCJ 2R2SA 1QVFR 4DPUA 4BS2A 2G2ZA 2XLKA 1JLFA 2QLWA 3L09A 2HQCA 2C2OB 4DCOB 2PO2B 4LVNP 2QGFB 2VIHA 2OEJA 2R7SA 2DGVA 3NRBA 2YH0A 1ZA1B 2CQHA 3I5CA 5K14A 2G2OA 4DPXA 1WTBA 4RNOA 2EPIA 1IBLI 4DMZA 4USUA 2CJKA 4F4WA 4ED5A 3D28A 4P2FA 4DV1J 4C4WA 2HW3A 1EP4A 1OS5A 3DLKA 4GQUA 2DCLA 2KXFA 3D0HE 1F0XA 3T1HF 3NGTA 2HWHA 4LF8F 3UO0A 1HL6A 3W64A 2HLTA 2QEXS 2IM3A 2YQ3A 4OHYA 3W5YA 4TYAA 3ILLA 4X66F 1T3OA 4O3RA 3LGMA 3SCKE 1Z5BA 1NB7A 3A8IA 1RTIB 1FRLA 3UD3P 1RKJA 2WBRA 5A2QU 4JI3I 1HNXI 5IXUA 4NA2A 5A8RA 1HHTP 5KT3A 3GG1A 2VG7A 5IC6B 3J80Y 4X65E 3EVOA 4NLYA 3HPOA 3HK2A 2DGOA 2MMYA 3OL6A 2KHDA 1BWVA 1NUEA 3J7AG 3F56A 5KFZA 4QYZJ 1WTFA 4U3DA 2WP8B 5KFHA 5HK4A 2C42A 1RTJA 1S1TB 1VDHA 6FD1A 2VB6A 5KG0A 2ZITA 1YDLA 2J0QD 3GJQB 3AD9C 2DJWA 1BKNA 2FY1A 3TUPA 1S97A 5A76A 2EWHA 1RTHA 4FF3A 1OYPA 4OX8A 1XJWB 5E3CA 1IBLF 1S77D 4B3RI 1HWKA 1RAOA 3MM9A 3Q8PB 1RT6A 2RS2A 4ECQA 1TKXA 3JQJA 2ZD1A 1HD1A 3D6MB 2UVUA 4PXCA 3M8QB 4MFBB 1YRXA 5D3GB 1RYSA 2EFQA 1NH8A 5AXLA 1NDCA 4OHZA 1T3NA 3ZTRA 3TQ1A 2Z57B 4AFFA 1KR4A 4HXZA 3S01A 3Q0AA 8ATCB 4JI3F 1HNXF 4U6PA 1TUWA 2W9AA 2CG9A 4JI2E 3BKUA 3D6HB 4FW4A 2H65B 3MM8A 3CCJS 1HQEA 4FN5A 1N6QB 5C0XC 1RE1B 4K8RA 2JJ4D 2KFZA 1MROA 3KTQA 5AXNA 4NPOA 2C2DA 2XWXA 4EI2A 4C9DA 3PIPQ 4D3GA 1Q16B 2PMHA 1HQ2A 3C6TA 1KEKA 4ATNA 3UI3A 1XR7A 1AROP 2XQCA 1K1QA 2DHGA 2D3UA 2AEMA 3D1OA 2ZDOA 4O0IA 2PEBA 2R8IA 4J9MA 1EAYC 4JI8F 3R7BB 4DV7I 2ALYB 2ZH6A 5IQ6A 1UDQA 4B3TJ 3EPIA 1VQPS 3MR5A 2RSQA 2PMZD 1MMNA 1Z1ZA 2ZC3A 4AUKA 1UAWA 4KSEB 2MQMA 5L9NA 2M9KA 2JEGA 4DR7J 4ZKAA 1XIQA 2XYGB 2C2MB 4EFAC 5F8GA 5BYSA 5JVHQ 4Q8FA 2OFGX 5DLGA 3NCRA 2P6SA 2WVFA 3HVWA 2UXDJ 2YKMB 2E9TA 3GJTB 3IRXB 4JUZA 4ECVA 4DPYA 3IXQA 2HGLA 4DX8H 4A8WA 3M8WA 2HVZA 3PEJA 2DGTA 2ILZA 4DUYJ 1F9EB 4RW7A 1YBUA 3AHPA 3BDEA 1O6XA 3M6WA 3M6UA 4DR1F 3KUGA 3MMBB 2A6MA 1R0AB 1S9GA 2MZ1A 3KWMA 1D8ZA 3ETOA 4NLUA 4DFKA 1RI7A 2HNZA 4QIGA 1CS4B 3SCLE 3S1TA 4DEZA 3MM6A 4FKYA 3ZO7A 3QLHA 3M1VB 4P71A 1BWEA 3G8TA 2V67A 2LEPA 3Q2TC 1HNWI 5DJBA 4OZ3A 1DQ9A 3TYTA 3QO9A 4RO0A 5EL9A 1U1LA 3EWGA 3CULA 1SKUB 1UEUA 3MMAB 3ZZRA 3OTOJ 2FDNA 4PXBA 4O3OA 2CJXB 2OPSB 3N0VA 3IC1A 5IZHA 1VQKS 3VAJA 3P49B 5HP1B 3D67A 5CCLA 1YJTA 4NEYA 2Z2LA 4PKDB 1G7CB 4ZLPA 3PW5A 2VFRA 4OI3A 1S4FA 5KFDA 1S76D 3RB0A 4WFBQ 2FVCA 3IRWP 3NZKA 4B3OA 4IKAA 2O3ZA 4NYPA 3R5JB 2FHKA 4MJKA 1W26A 3WDOA 2CZ4A 3CNQP 2DHXA 1X5SA 4K0KI 3UR0A 1GNKA 3MCSA 3H98A 2ZE2A 3FGVA 3ITHB 3QJJA 1KOHA 2DGXA 3VF0B 5HO4A 5AXKA 1HNVB 1JKHB 4UOCA 3TA1A 4X64I 2YPZA 3ENAA 4Q0BA 3PX4A 4DG1B 3BGRB 4I2PA 2OIHA 3M85G 4DFMA 2VQFJ 3NY0A 3T1AA 4LR8A 1L3UA 4DZDA 2J6UA 4O44A 1HNWF 4QBUA 1X4CA 1IQZA 3GFZA 4EBDA 4L3NA 1T03A 4TXSA 1S6PB 1LNQA 2F8MA 3J7ZT 4FXVA 5K20B 1VHFA 2RHQB 3IAS9 2ROPA 2OAUA 3OXLA 2O1VA 1R27B 1R8PA 2E1RA 3W5XA 1RACB 1A7GE 3LPYA 4A8QA 2IIHA 4DV1E 4NA3A 3H2UB 4U8VA 4LBIA 1RT4A 2GQ2A 2IJNA 4DV5J 4NI2A 2HQIA 1MG7A 4DUZJ 4W92B 1NAQA 4J90A 1BE4A 3HFVA 5F8LA 2JVOA 2WBMA 2AP6A 4CH1A 2QC3A 1ZZFA 1AUDA 1LQ9A 2NSCA 4YP3A 4LF7J 2OI2A 2O3DA 2IYIA 3GYXB 3HULA 2MQQA 4K0KF 2KFYA 2CADA 4B3MI 5J1NA 3ZZYA 4LFBI 2ZBQA 5B0AA 3R2DJ 4IRDA 3UD4P 4FPIA 3T1YJ 4NOHA 1NK5A 1X9MA 4NLGA 2C37A 5J1EA 3BV8A 4N8OA 3THPA 2ILYA 2RDIA 2WZ1A 3RR7A 1NZ0A 3F44A 3LAMA 1SQFA 4DXLA 4QIEA 4CO5A 4F4KA 5M2PA 3HKMA 1KP6A 4EZ9A 2J9DE 1SH2A 5C2CA 1WHWA 1CC8A 3TEGA 3QJLA 2C2RA 3I56S 4OX9I 5JEAA 4DV4J 4WF9Q 1QD1A 5HROA 4NYOA 1M5VC 1AT1B 1UWBA 2XWYA 3W65A 5C5JA 2MSSA 1SJQA 2L08A 1Q78A 5KFLA 1JX4A 5AT1B 4TY8A 4DV6I 4GKKJ 3HKWA 4CLWA 1A6FA 2HLUA 2V9WA 3G4SS 4DR6J 1TK0A 2CPEA 3H25A 1H0HB 1X4AA 4AQYJ 1FX2A 1N54B 1J27A 1EI1A 4FVCA 3UE2A 1C2PA 3I6PA 2LQ8A 3VTIA 1J5OB 4LF4I 1N34I 4B3MF 1VI7A 2XZDB 4AYBD 4LFBF 1UDOA 4MKBA 2QLBB 2QV6A 2VG6B 1VLOA 4HTJA 1U1QA 4OYBA 2IDEA 3HZEA 3KLEB 1U2RA 3NS6A 1XMBA 2HBQB 2VESA 1M5KC 2CVEA 4I6WA 4DPTA 3HT0A 4O0NA 3U1KA 1V5VA 4RL1A 3HJFA 2F1FA 2QLFB 1IVZA 3GTYX 3LNUA 2D9PA 2XLJA 5F8HA 3R9LA 4OYAA 1RB0A 4IRKA 4OX9F 3V6KA 2HHHI 2M2BA 3TUJC 5F3ZA 3NMAA 3VAFA 4LF5J 3DM2B 4LSNA 1ITPA 3MMCA 3ZNUA 4P75A 2AJ2A 1DJ0A 3T5JA 3RBZA 9RUBA 3OHAA 4RU9A 3QFHA 4J9OA 2ZZTA 1WJ9A 4DDFA 4DR4I 2UUBE 4N8NA 2CAJA 1WHVA 1J5EF 4DSLA 1U25A 2D41A 4MH8A 5KFRA 3LAKA 3D2WA 2B0GA 4DQRA 3IWNC 2FVPA 2ADBA 3H8YA 1R8HA 4K2JA 4NL5A 2B4UA 3UQSA 2N7CA 3VV2B 3BGFA 2CJQA 1MMDA 2PO0A 2KDOA 2F40A 4LF4F 1N34F 3T9NA 5IT9U 2J7UA 4MYTA 4EO8A 4DUYE 4DR2I 4R0EA 3HSGA 1VHIA 2HHXA 4P6QA 3K0JA 1Y3JA 2DRAA 4MU3A 4K4WA 5HVFA 1IWAA 4M5MA 2HPUA 3CO0P 4H4MA 5HSPA 3CJ8A 2X1BA 3PYFA 5B0CA 2C3UA 3SSRA 3IS9B 1IBKJ 5KG6A 2OEMA 4WZQA 3OTEA 5IT4A 1SPBP 2ACYA 3OV7A 2GW8A 4ZVGA 2JDJA 3H4DA 2ZFHA 2OJ3A 2H4YB 1EARA 2HHHF 2HNDB 3J80U 1T94A 2KXNB 3MCNA 4QW8A 3DDNA 4KJIA 1P1LA 3QT6A 4CLUA 1HR0F 3GV8B 2RKIB 3OR2B 2E5IA 2IBKA 2EBGA 3DLGB 3SDEB 5JJBA 4DR4F 1ULRA 2BJ3A 3W60A 4OO1B 4LCHA 1JLAB 2KM8C 3SCJE 1FK9A 3LP2B 1Q8KA 4LF6I 2WSFC 4UUXA 2DIUA 1HQUA 2DVIA 1LWEB 3UCUP 1N88A 2R7QA 2V4JA 1N36J 3M2RA 1JLFB 3DRXA 3ZZOA 3GSIA 3I4PA 2B56A 2CWXA 4JI1E 4DR2F 2BA1G 4NE9C 2CQPA 4DJBA 3OLAA 1O51A 3B82A 4NXMJ 5K14B 2BOPA 1Z0CA 3Q6NA 1KNZA 4MYUA 2W9CA 4JYAJ 3DLKB 2KJWA 1PKUA 2W2PP 2AJFE 4CM2A 1B0PA 4RNMA 4J9QA 3VAHA 2AF6A 2CG8A 5C24A 1U1MA 4CNYA 1N5YA 2VICA 1RHUB 5JEAD 1F5CA 2QFIA 4ED7A 4DN9A 1W2IA 2BJ9A 2ZVSA 4KV8A 4K4SA 2HKJA 1OY8A 3I87A 1KD1T 3HHNB 2OMLA 3WZ0A 2CYYA 3J7AM 2M3DA 5LMNE 3R97A 3H5XA 3AXKA 5A8RB 4BWJA 4DOZA 4FBTA 2VG7B 1UFKA 2YKPA 2B9WA 4ZP6A 4YR3A 4N7TA 4IFDD 2DR9A 4LF6F 1TL4A 2C39A 2OFHX 1SL0A 4FZVA 4Y6IA 5DQGA 1SB6A 3RRKA 2EC2A 4WK3A 2AE8A 1RTJB 4AIMA 3TR5A 4IO9Q 1Q95G 2UU9J 1CJVA 3LPSA 5HQMA 3UDVA 4DV2E 4Y00A 5EWGA 2K3KA 2MZRA 2RB7A 1U1RA 2QN6B 1RTHB 1D6TA 4FBUA 2B6AA 5DDOC 1FWPA 4P7TA 3MM9B 3PACA 1Z59A 1RT6B 2IFXA 1TKXB 4ZVSB 2ZD1B 3R5GA 2W2MP 2ZH7A 4Y3CA 3SXLA 2J8AA 4X4VA 2FLLA 3RAQA 2IMWP 2JE6A 1GQEA 3LW5C 3Q89A 2IA6A 2ROEA 4QIFA 3VAGA 2LEBA 4ISAA 4OYZA 1NSKL 4RZRA 1CPZA 2Z2MA 1Y11A 3QGPA 1NHKL 4CO0A 4ECRA 2XO7A 1QJHA 3PW4A 2LDYA 2AJ4A 1FT8A 1NJXA 3ONQA 3MM8B 1D9DA 1HQEB 2EC0A 4AQYE 1AB8A 4B08A 1MROB 3RRGA 3MWBA 3BB5A 5FD1A 1YHCA 4DQSA 2MLYA 4USVA 2QZ8A 2DXDA 4LF9E 4MK7A 1NLKL 4PABA 3IMQJ 1KVJA 1HNZF 3C6TB 3O6QA 1WC6A 3GIIA 4DFPA 4ZP9A 4CLKA 4IFDE 2IRXA 5LL6R 2FJEB 1RWOB 3ZKBA 2HZAA 4F3QA 1XC9A 3U27A 2IJRA 4FF1A 3G6ES 4ANDA 3OXGA 4RW4A 8RUCA 5DRQA 3VHQA 4LIRA 3GFXA 1X4HA 4NLXA 4OHXA 1SJ1A 3RJMB 1RREA 1LK5A 3DC2A 2NPIA 3KXDA 5DG8A 2HHWA 5K36A 4O23A 2LECA 4P74A 3W9IA 2XMMA 3MPUB 1B0VA 3DD6A 4K5RA 2Q2EB 4FW7A 2UUAJ 1RA6A 7FD1A 1XNRJ 1LW2A 4PUOA 2OH2A 1C1BA 4KGVB 2GVDA 2IRUA 1S0MA 4YHHE 1KSPA 2MQLA 2IDLA 2BZ2A 1VFJA 3Q8VA 3DLJA 4WBFA 1B0TA 5KG5A 4IZKA 3M05A 2HFVA 2Z2YB 2RNEA 3EMTA 2CQGA 2HYIB 5LL6d 4RW7B 1HI8A 5D0RA 1RDRA 2HBYB 2N3LA 2V2VA 3QSYB 4LCGA 4OHVA 5HVHA 1JLQA 1S9GB 4JV5J 2HNZB 1UKUA 4JI6J 4ZVFA 1UZHA 4RR5A 2Z30B 3MM6B 1M5OC 4RX6A 1RISA 3QLHB 3W8GA 4E98A 3QO9B 4CI0B 4ECSA 4WFZA 4C8MA 5L1KA 4JI0J 1SJ3P 5LMUI 3U1MA 3AQOA 4USIA 3AA8A 4OI1A 2CQIA 4JI7E 1EZZB 4EGLA 4IQMA 3A3NB 5CD4A 5DG7A 1U26A 1EX8A 1FFWB 1UVIA 5J2NB 1XHKA 1X60A 2XGPA 2KRBA 3HT3A 3P96A 4X4TA 3GYGA 4ER8A 1S72S 1B7YB 2K2PA 3A1YG 2ZH4A 4DR3E 4B3OB 2XHCA 2CJ9A 4WIQA 1YZ6A 2GNKA 1R7IA 5HMXA 3CC4S 3NCPA 4ECWA 4L76A 1QZRA 3TZXA 2MHEA 1RHRB 5IFMA 1OY6A 2MGZA 1VJQA 4DR5F 1QAXA 2DD8S 4WYWA 1JQGA 5HN0A 2G4BA 4FDFA 5GMKa 5J2MA 2R7WA 2ZE2B 3HJVA 2JC1A 1N32I 3HVAA 4Q0BB 1R0CB 5BYRA 1Z4UA 5IC4B 3VGTA 4I2PB 5DLFA 2ADCA 2DXFA 4LSZB 3D66A 1Y3KA 2A2DA 4DLGA 1VIOA 2W2NP 3G8QA 4O44B 1FRMA 3RYLA 2QLJB 3K17A 3Q23A 1SH3A 1ACMB 1NJIT 4UY8T 1T03B 4AXIA 5LMUF 1FRIA 3CJQA 4MIAA 3HI9A 4DV1I 3FEYB 2KVIA 2OKQA 2ZBIA 1SL1A 2H5IB 1X0PA 2AGOA 3DOKA 4OYIA 1RT4B 2CDRB 4NI2B 3LWMA 3VGVA 3HKZD 2HIQA 4ZVHA 1RUSA 4L73A 5U47A 1YHQS 4LFAE 5F41A 2UVVA 1N0UA 1EETA 4LVOP 3I96A 4HACA 3HP6A 4RW6A 2CPJA 3B78A 4K4UA 1Z0VA 1SKSA 3MFHA 4LCFA 5EKWA 3CD0A 1QTMA 1PKPA 4CWBA 1WELA 4UZCA 3LOUA 2KT2A 2DPJA 1N32F 2VFSA 5KT7A 4ZA1A 4EK2A 5KT4A 2ZM6J 2UUCF 3IBWA 3J7A1 1F9FA 3OW2R 4DCPB 2E5LE 4E0DA 4OO1F 2C37B 4ID8A 2XZTB 5J1EB 1QSYA 4ZITA 4XPCA 1LFPA 2UVRA 1Q82T 3CSKA 1BUXA 1RSCA 4URLA 5D0HA 1NK8A 2CNKB 3G82A 2BXJA 4YDXA 2W9BA 5DZ7A 2FVQA 4XPEA 2RDJA 3CEDA 3SSSA 5CH7B 4DV1F 5JEAB 2DY1A 4KFBB 3IAM9 2LQBA 1FXDA 5K36D 2W25A 5HROB 1X4BA 2HHSA 1TKDA 2WTFA 3UN2A 4A4JA 1UWBB 2APOA 4GKJE 2AT1B 3KNAA 2MLZA 5AE3A 1ZOTA 4TY8B 1RBOB 4A47A 1O5JA 4C97A 3TA2A 3E2EA 4OKGA 3W62A 3HSZA 4DL7A 2AZ3A 5DGAA 2ABYA 2ERRA 1YBAA 2A0FB 2L48A 3MEGA 3NS5A 2HIYA 2C28A 1UMJA 1EQ0A 4PYDA 4J9SA 2GQ0A 4EUVA 3TJ8A 2VPWB 2I5JA 1NZAA 2F5GA 5D4PA 4FPRA 5AE2A 1QSLA 2XMKA 3MEKA 2BKPA 4JV1A 3MPDA 4QWDA 4USWA 4ZJOA 4QCLA 2RRNA 1YJ9S 3CGIA 1ICEB 4NRUA 4ZDNA 1T7PA 2X7IA 1R31A 3BR9A 3HF5A 2O5DA 4P2MA 1UL3A 3T1HE 1IR2A 3C14A 4LF8E 2GVZA 2BE7D 2DH8A 4Q45A 1RR9A 5KFWA 2HNYA 3RB3A 2GO8A 1SVDA 2P9CA 2VOPA 2FZKB 2A2CA 1FKAF 5KFVA 1DHMA 1X4EA 2ALZA 1X9WA 3TAMA 4LSNB 3MMCB 2UUBI 4DR7I 1TAUA 5J2PA 1RU2A 2UUAE 2UP1A 2KT5A 4B9UA 1HBNA 3O2IA 2IVYA 1KHVA 3CIZA 3M6VA 5K36E 2ZH9A 1WOOA 4OZ2A 2NR0A 4A8OA 2LQJA 2XBPA 3H20A 2ZZMA 4DUYI 2PO0B 1FTRA 5KFTA 4HHUA 2GQCA 3PX6A 1NHIA 2LMIA 3KLFA 3DLHA 1G1XA 3V5RA 1TVRA 1TFYA 2QYGA 5KFKA 2EK1A 2MZQA 3MM7A 2BDPA 4YQWA 2CGEA 4NASA 2WCXA 5ELWA 5HVGA 4H4MB 2JLFA 2G1DA 4BDPA 4OYXA 2RMLA 3OTOI 2AGPA 1BC6A 2HK3A 1PSDA 1N56A 3QYYA 2RRBA 4ED8A 1T9XA 3H2LA 5CHCB 3AJ1A 4B3TF 2PA3A 3M9MB 3PY8A 1PAEX 5KG4A 4PWWA 2HMIA 3VQSA 2E7VA 1AXQA 3ENQA 4UOGA 1NNDA 4FS1A 1N0VC 2R7XA 1HNXE 4DR7F 5KFGA 3NGUA 1U6ZA 3JSBA 2VQEJ 3I4HX 1R89A 3JSRA 3PS2A 3KK2B 3VCDA 1S0NA 2CPHA 1U0HA 1Y4ZB 1XNQJ 2R9LA 4FYWB 5ETSA 1NJZA 3QRPA 2NQPA 1FK9B 3P3CA 4CT9A 3CCMS 1YGYA 2UXDF 3PRYA 1HQUB 3Q6MA 3H5UA 4Q2MA 1CLFA 1E3PA 1LKZA 1FJ7A 4QOTA 3HSJA 2V4JB 1YLXA 3M2RB 2DRDA 4DUYF 2FJVA 5KOWA 3S8SA 1GTHA 2QX0A 1SJ4P 5K5MA 4PWDA 1GXUA 2BA9A 1AYEA 1CQNA 3CJKB 1GMVA 5D8HB 2VQFI 3PIOQ 4JI8E 5JVGQ 1U7LA 2VU5A 2W9CB 4BHQA 1TR0A 3OTOF 1P42A 2M70A 5D77A 1B3TA 4RUBA 1YIJS 4DU7A 5LJ5Y 3EDQB 5C24B 2VC1A 1N5YB 2O1TA 3LO3A 2HS4A 2ZEJA 3SFUA 2F4VJ 4DSIA 4KV8B 2KHCA 4DUZI 3ZTSA 5LMNI 5KFXA 1RAGB 4HDGA 2H51B 2LKZA 1VJWA 1K0VA 4PWUA 3WU4A 3OSPA 3H59A 1H74A 3WQPA 4DR1E 2COLA 4YFUA 2VHGA 2X36A 4LF7I 2YNFA 2PN6A 2C39B 3QQCD 3W2VA 3B6BA 3HD2A 3H42A 3N79A 4YB5A 1LV5A 2XY7A 1D8YA 4I67A 5LM7E 2BYCA 4ETXA 1WKLA 3CCLS 1LFWA 4DV2I 2MSTA 4PG4A 4PZVA 3T1YI 1CJVB 2XMJA 3M9OB 2HZCA 2ZM6E 4U96A 2NZ4A 4CQ1A 1YI2S 2VQFF 3GMEA 1H7UA 1BQMA 3OFHA 1I5OB 4A46A 2V8DA 2QT7A 4TVAB 4TNOA 3TAQA 2B6AB 1N4LA 3MD3A 1FDAA 1XMOJ 4YN3B 1KDNA 3M32A 3W8PA 1JLBA 3TZWA 3LF0A 3NG8A 4QQBA 4DL2A 2J6TA 5B08A 1HD0A 4CNZA 2NPFA 2FIUA 4DSJA 4NLWA 1ZM3A 3PXGa 2JE6B 4NLRA 3SQOP 2IA0A 4UQTA 3PW0A 3QMQA 2LXFA 5L1JA 3C15A 4DV5F 2ZJQQ 2UXCJ 3PW2A 3TARA 4DUZF 4GKKI 3QIPA 3TANA 3ETMA 4IOAQ 5AXMA 2B43A 2DNPA 2ZH1A 4DR6I 2SXLA 1H7SA 4ECUA 1DQAA 1VISA 4AQYI 3HHEA 2ZH8A 4WP8A 4LF7F 4ILLA 4LF9I 1HBUA 2BOAA 3BEGB 2QL9B 4URQU 3CD5A 1D9FA 3CDIA 3I9V9 4MDTA 2H54B 3BDPA 4AL7A 4LFCJ 4CTAA 1SC1B 3GP9A 1HNWE 1PILA 1N33J 3PRDA 4C3MA 1UDSA 3T1YF 1E6VA 1FXLA 3KYLA 3AFGA 1N8RT 1GXTA 1QUVA 2RJZA 3GLJA 3IBFB 2HAIA 5L39A 2KI2A 4ZVUB 4RW4B 1YRTA 3NP5A 6AT1B 3KDOA 1M1GA 4UOHA 1SH0A 1WOSA 3TX8A 4IR1A 2F8EX 1FD2A 5K36B 1TP7A 4RUAA 1FFSB 3R6LB 5JUMA 3ZM7A 5E0OA 2D3ZA 2AZ1A 4EYHB 2UXBJ 2XCAA 4KIAA 2IOQA 4QYZK 4DV4F 3N28A 4DV0J 5C42A 3H7HB 4KHMA 3OJSA 1LW2B 2O01C 4LF5I 4PUOB 3U1NA 4DWIA 3BSNA 1TL7A 1C1BB 4IFYA 3G6XA 2GVDB 1H98A 2V8GA 4B9NA 5D0EA 2Q3PA 2XI2A 2QIFA 4RNFA 1D09B 4CLTA 5HLFA 4GKKF 3CO9A 2JC0A 3MR7A 2PMWA 5JEAF 1LEOA 1YJNS 1NRKA 4DR6F 2C38A 1QSSA 4M63A 4OLOA 4IZKB 2RIJA 5DQHA 4ZPCA 4QW9A 1TELA 1WKKA 3U02A 1HWUA 3FQLA 4AQYF 2VJUA 5HJXA 2ZKUA 4Q7AA 1WF0A 2O1PA 2DNGA 1OPZA 3D7SB 4LF9F 1Q5VA 3PFOA 1JLQB 1NXIA 3I0SA 3T9ZA 5DM6Q 2JNJA 1I1GA 3O5TB 1T9UA 1VCTA 1NPKA 5KAKA 3NL0A 1QVGR 2DEIA 5E41A 1RLDA 3M8ZA 4ELUA 2D7SA 2M8HA 4FNHA 5KFAA 3HMJG 4UQGA 2BKNA 3BBBA 2RQMA 4DQIA 1REGX 1U6BA 3KMSA 2AEJA 2QL5B 1IBKI 4OI0A 4N47A 4QNKA 2GCFA 2N4DA 3TJ9A 1UVKA 2V4QA 1KLMA 3AOCA 4PCQA 2HVIA 2BA0D 1ROFA 1Z0WA 2DR5A 2I9SA 5ETMA 2UVWA 1UJ4A 4OQJA 3FK4A 1QUPA 2JOQA 4PXEA 4LF5F 3QFWA 3Q2SC 3TNVA 3HM9A 2DY9A 1JJ2R 1CSJA 1WI6A 1S12A 1VK8A 1UZDA 3EYZA 5C25A 4B3ME 2RQ4A 4IRCA 1R3NA 1IKYA 2OSRA 5AE1A 2OUGA 3DI6A 2MGZB 4DQPA 4F2SA 5J2MB 1IKVA 1OO0B 2CZVC 4DPWA 4I4BA 1N36I 1W25A 5GADI 3PJWA 3HFKA 2NXCA 4MQYA 3W9HA 2C3PA 1U1OA 3CCUS 3RRHA 2CJAA 1UFWA 2E1MC 2BUNA 5CQGA 3M4XA 3BM7A 3KJFB 4V19X 2RQKA 2GAHC 4OX9E 2QLXA 2FZGB 2XSFA 3PDNA 1ZTTA 2ZWPA 1IBKF 1S5ZA 3UVJA 3DOKB 4X62J 5F0UA 4KRWA 1FDBA 1HBOA 2ZHAA 5K8NA 1IBMJ 1J5EE 3K5NA 2RRAA 3MFIA 1Q81T 1UFLA 4JI5J 4EO6A 2Y8YA 1EETB 1VQNS 3J7YU 2XGQA 5CA5A 5EUHA 4HACB 3K59A 4RW6B 2Z0GA 1U0SA 2CIMA 1LWFA 4IH5A 3MEEA 4XAKA 1RT7A 4LF4E 3W5ZA 4Y2IA 3PG9A 2WOMA 5J2QA 1NSAA 5ETKA 1TKZA 2BR0A 1F3VA 3MAAA 2FJXA 2C3OA 4NLVA 4TU9A 2E5LI 2CWKA 1N36F 2D69A 4B3RJ 2K8GA 3DGVA 1F60B 1ZYQA 2P5VA 2BJ1A 4ED6A 2UU9I 2QO3A 1FI4A 3ZTQA 1IJEB 3TVKA 5EWEA 1URNA 4NLQA 2YKQA 2PO1A 3G82B 4NXMF 2W9BB 4C8LA 1EB0A 3ZZPA 2E9ZA 2YXLA 2HHHE 3DRPA 2R8JA 1YITS 2ZWOA 4K4VA 2Q79A 4I7FA 4B9MA 4JYAF 3WU6A 2LLZA 4ZVIA 3S6EA 4I68A 3MUMP 4BA2A 1HR0E 4NZ6A 4A8SA 5LT5A 4RWXA 3LH2S 5BR8J 3Q24A 4DR4E 5IV4A 2FB0A 1V5IB 4L3KA 4ES1A 3CJRA 2HGMA 3EM1A 4HI1A 2F8HA 3KLGA 1NCLA 4PRFA 4GC6A 3MEGB 2QL7B 5KT6A 1V9OA 3ZNJ1 3NAHA 1G3OA 4F02A 4HVZA 5F0WA 1BMQB 1JLGA 4F04B 2I5JB 2IPOB 3CDUA 1FRJA 4YUDA 4E8UA 2JVRA 3FNNA 2Z2ZA 2HFUA 1FXRA 1WORA 5BYQA 2CPFA 4F8RA 4DV7J 2FGOA 5HMYA 3EICA 3IO1A 5DDPC 4IYQA 3T3FA 3PYEA 1S1WA 2CNLB 3T1HI 4LF8I 1GEHA 2UU9F 3BJYA 1XMQE 3VAMA 3K8WA 4HEA9 3W2WA 3HVRA 1RT1A 3C14B 2GVZB 4IOCQ 2ZHOA 2VBYA 3BQ1A 2BKOA 2ZH3A 2HNYB 2GA7A 2IJFA 4X84A 1N5VA 2J7WA 5K8OA 4ZIVA 3QT7A 1BLUA 3LP0A 2WAQD 4Y28C 1R0BG 4O4GA 3BH6B 2MQ8A 1VRTA 4QWCA 4ZOSA 3TAMB 1USUA 2DB1A 2UUAI 2UXBE 1LOUA 1XNRI 4WUDA 4DV0E 2PGCA 3FC9A 1HBNB 2AV5A 1L5UA 5THWA 5LSRA 1IKXA 4LF6E 2B9YA 1NKBA 2MDAA 2QTWA 5B0GA 2BV3A 5ETLA 4IO1A 3GV7B 3IM8A 3W66A 4WWSA 4A8XA 1FE4A 1RK8A 2IC3A 1VGYA 4UOFA 2DNZA 2CQ1A 4CO1A 4NXNJ 3OD2A 3KLFB 3TP2A 3M8YA 1X4GA 4IFDC 3AOBA 2KT3A 2MKJA 1YG0A 2YKNA 4JV5I 3U7JA 2BJ7A 2ATLA 1TVRB 2WVDA 3MM7B 2FLNA 2H4WB 4IFVA 3NGRA 1KQSR 1VLYA 3KLHA 2C3MA 1V3RA 4WKYA 2JT2A 4JI0I 3T19A 3A8KA 1ZPWX 3FZ2A 2QSWA 4ILMA 3L7PA 3H5YA 4F3OA 2PNZA 4LQ9A 1OYDA 2BQ3A 4RBTA 3GIRA 5KFFA 5EX0A 2HMIB 2CFXA 3PS3A 4FXWA 4KGKA 3OL9A 1FRHA 1TMMA 1C4AA 3GCWP 1GT8A 2UUAF 4PEOA 3D1HA 1XNRF 2HRYA 2MB0B 4X64J 2XM3A 5K36F 2D3OR 1L3TA 1U0HB 2LA6A 2Y3YA 2FJWA 1CEZA 1LW0A 1VQLS 1TL3A 1DY3A 3QNWB 4IZJA 3J81Q 1U24A 2DNNA 2ZVIA 3KUHA 1MNEA 3NCQA 1BQNA 1Q86T 2VDHA 1HNZE 3H4BA 2NCKL 3TUIC 2VODA 3FSXA 4WP3A 2J6SA 4DX6A 4JI8I 4R25A 2ZBPA 4PWDB 2I2YA 5B09A 4JV5F 4NLDA 4ES2A 2HQ3A 2RE1A 1FJEB 4JI6F 1TK8A 2WHOA 3OVSA 3E3XA 1KBRA 1F6TA 3A8JA 2KG1A 2KTQA 3N01A 4JI0F 3UW1A 3F0NA 1HPZB 3D0IE 3GE9A 3GG0A 1RADB 3LALA 3CMQA 3BKTA 3AA9A 4HI2A 1RWWB 3PS1A 3PJ9A 4QZVB 1GMWA 2F65A 4L6V3 1S0VA 2LA4A 4ELTA 3FMBA 1ELOA 2B8QA 4X2BA 4LOMA 3PYDA 3TVZA 4LFBJ 1VOMA 3D68A 4Z7CA 7AT1B 3PFEA 2V0NA 2HRTA 1X5TA 3SV4A 4DR1I 3UCGA 5F3TA 1RABB 3J81C 3DXBA 3K8VA 4ES3A 2YNFB 1AFIA 3W2VB 1JK9B 2QMXA 2W1BA 1RLCL 2VPZB 4ZVOB 4B9TA 1XQIA 1OSCA 3CD7A 1NDKA 1PYOB 2WONA 1Y9OA 2NN6A 3PV8A 2ZM6I 4YY3J 2M4MA 5L1LA 3CUNA 1YSJA 3CCQS 1FVSA 3BYPA 4DL3A 2EG2A 1BQMB 2Q6BA 1ZM9A 4CYUA 2BRLA 4EEYA 2IM1A 4DV6J 1VQ9S 4CIOA 4UW2A 3M32B 3HLUA 2GO9A 4HY1A 1JLBB 5KFCA 3O8WA 3CMAS 4KHRA 4WTOB 5GAGI 3C19A 4WE1A 1HNIA 1KWMA 1JNZB 2J8SA 3PRVA 5LJ3Y 1YJ7A 2UV8A 3SCIE 4WIIA 2MKIA 5SZTA 3C15B 1R8BA 1MX0A 3DLEB 4OO1D 3SEOA 2R2TA 3MR6A 4N41A 3QIPB 1FERA 1AA1B 2V9KA 1NKEA 3ILIA 3L7OA 3TUZC 3DLLQ 1RT5A 4XO0A 4DR5E 3BPDA 3DOLB 2DNOA 4PAAA 2XO6A 3SIPB 4XTJA 3C3LA 2XMUA 4IH7A 3LANA 2NUUG 4MU0A 4RWWA 1HBUB 4J3DA 5B0DA 4HKQA 5HJYA 2AQ4A 3UD5A 2GV1A 2KYXA 3KDNA 4URSA 2BM0A 4CTAB 4OJ1A 4GMKA 3P3EA 3T6JA 2HK2A 1WEYA 3JYTA 2LXUA 2ZM6F 5LSLA 2DNHA 3D9BA 4LRFA 3QJPA 1E6VB 4NMXA 1FRKA 2AEFA 5LMUE 4WFNQ 4LRBA 2QYCA 3WC2A 1IR1A 1SIWB 2MKYA 3MR3A 3KOAA 2WNRA 4XDDA 4ZLNA 4CH0S 2J0WA 2V63A 2XULA 2DIVA 4MKAA 5F8JA 3PR4A 2YQ0A 2V8HA 3H0PA 1N5SA 1F2GA 4Q2LA 4ED3A 4AM3A 5C42B 2V4RA 4FWGA 1OQ6A 4Y2CA 2R3VA 2E1AA 4F2RA 1TL7B 3K5PA 4IFYB 4FNIA 4A8MP 4I64A 4USHA 2PEHA 3HSDA 1GMUA 3FUYA 4KHPJ 5HLFB 5GAEU 1G4CA 1WACA 2CQ2A 3THTA 2MZSA 1Q53A 3ZTOA 1FDDA 3MPVA 2C38B 2GJIA 3X1LB 4M94A 1N32E 1DURA 2VA2A 1S1VA 2MQOA 3IA0A 2UUCE 1I94J 3T41A 4JI4J 3NNAA 1KTQA 4OO1E 2Y1RI 1YKWA 1YBTA 2QA2A 1LXNA 2RUGA 3ULHA 4LT6A 1G6BA 3I0SB 3PKMA 3R27A 3PVXA 1WOPA 1DLOA 5L46A 4ANCA 3BO3A 5BJRA 1M1HA 3CCRS 4ZCKA 4EZ6A 3A13A 1NEEA 4N76A 3CC7S 4ETZA 4HYMA 4ANEA 1WG1A 5E5NA 4MU4A 2K1RA 3ZKDA 1HHSA 2BJEA 2Z5CA 4ITSA 4FW3A 3N4WA 3TW0A 1KLMB 4GRSA 1HYSA 2VKRA 1VBKA 3H4LA 1GMWD 5D0GA 2F3JA 3IR6B 3G2XA 1OY9A 2WW8A 3M7VA 4BBYA 5K36C 5KFSA 4TU7A 3D0GE 1PO6A 1VQYA
chains in the Genus database with same CATH topology
3ZZUA 2X7IA 3PYFA 4JI6E 1Y4SA 1XNQI 2R42A 1MU5A 2E5LI 1PVGA 4X64I 1Z5BA 4JI2I 4IZKA 4GKKI 3T1HE 2Z5EA 4LF8E 4LFCE 1RR9A 4DV3E 4JI0E 2UU9I 4DR6I 2UUCI 2V2VA 1H7SA 1ELOA 1N33E 1FI4A 5BR8E 3GONA 1VISA 4JI3I 5FLXQ 4DV5E 1HNXI 3PYDA 4AQYI 1N36E 3QT6A 4Z7CA 4DUZE 1B62A 4X65E 1Y4UA 2A2CA 4DR1I 4LF9I 2HHHE 4YY3E 4P7AA 3WU6A 3J80Q 4RPFA 3J81C 2VF3A 4NXNI 5A2QQ 2UUBI 4DR7I 3J7AG 4ZVIA 2O1VA 1HNWE 4B3SI 2E1RA 1HR0E 2UUAE 4NXME 5LMUI 4LF6I 4DV1E 4PRVA 4LF7E 1FKAE 4DR4E 4DV6E 4JI7E 4IZJB 2ZITA 4JYAE 1OJ4A 1MG7A 1HNZI 1BKNA 4LFAI 2ZM6I 4KHPI 1J5EI 1XHKA 2O1WA 4DV7E 4JI1E 2O1UA 3T1YE 2Z5CB 4DUYI 2F4VI 1Z0TA 4B3RI 1S4EA 3ZM7A 5IWAI 1NHIA 3B82A 5IT9C 2Z5BB 1ZM9A 1Z0CA 4DR3E 1Y6ZA 3Q6NA 1I94I 2OI2A 4JI4I 1N34E 2IOQA 3HULA 4MYUA 2HKEA 3QT5A 3V5RA 2ZBKB 4B3MI 4HY1A 4LF5I 4LFBI 2HFUA 3CWVA 1QZRA 2CGEA 4JI6I 5FWKA 4WUCA 1FJGE 3PYEA 2VQEE 4DV4E 3OTOI 3T1HI 4LF8I 1N32I 4HXZA 1XMQE 1MX0A 5FLXC 4DV3I 2HK3A 1EA6A 4IZKB 2GS8A 1XNQE 1FWLA 2HKJA 1NZ0A 4DXLA 2CG9A 2HFSA 4JI2E 4USMA 4X62I 4X66E 4DV5I 3V2UC 4GKKE 5L3JA 4DR5E 4PRXA 4PU9A 5GMEA 1K47A 2V8PA 3J7AM 2CZ9A 3J80C 1FNMA 4FN5A 5LMNE 5A2QC 2UU9E 3QT7A 2A2DA 4DR6E 4IZJD 1IBMI 1N0VC 4XTJA 2PNMA 2PNLA 1HNXE 4I3HA 4JI5I 1H72C 4OX9I 3K17A 4N3OA 4B3TE 4GKJI 2DEIA 1ZXNA 1USUA 1HR0I 1XMOI 1FWKA 2UUAI 2UXBE 4NXMI 2BM0A 4ED4A 2BM1A 1XNRI 4DV1I 3WU5A 2HK2A 4DV6I 4NXNE 4WUDA 4DV0E 4JYAI 4DR7E 1A6FA 3PRYA 4R1FA 1B63A 2IOPA 4FWHA 3Q6MA 5LMUE 1KIJA 4LF6E 3LPSA 1KKHA 3JAMC 4DV7I 4DV2E 1IBKI 2UXCI 2BV3A 2LJPA 1PIEA 3ZZ0A 4LFAE 4EMDA 1EI1A 3JAMQ 2UXDE 1N0UA 1D6TA 1Z0WA 2WW4A 4HACA 2VQFI 4LF4I 4JI8E 1N34I 1KTVA 4DR2E 3B78A 1Z59A 2F4VE 4YHHI 4DU8A 1Z0VA 1H73A 1IBLE 2V2ZA 4JV5I 4FWGA 1PKPA 4WUBA 1I94E 2R3VA 4JI4E 1Z5CA 1ZM4A 1KVKA 1FJGI 4K0KE 1U2RA 4B3ME 3Q1QA 4LF5E 2VQEI 4DV4I 2XEXA 4LFCI 4DU7A 1HK7A 1XMQI 5GMDA 2O1TA 4DPTA 4Z7YA 4DPYA 4JI0I 2E5LE 1Z0GA 1N33I 4X64E 2V34A 3K85A 3LNUA 5BR8I 1S16A 4X66I 3OTOE 4DPWA 4DR5I 4URLA 4KQVA 1N36I 1N32E 4DUZI 1Z0BA 2AJ4A 5LMNI 4X65I 2UUCE 2HHHI 4YY3I 4JI3E 4FWDA 2EFGA 3K1JA 4X62E 3P06A 4UT4A 4AQYE 4M1KA 3WU4A 4B3TI 2DEJA 1H74A 1HNWI 1IBME 4DR1E 4LF9E 2UXBI 2X36A 4LF7I 4JI5E 4OX9E 4DR4I 4JI7I 2UUBE 4DV0I 4GKJE 4B3SE 4FW9A 4IZJA 2J7KA 1XMOE 3J81Q 4HYMA 1XNRE 5LL6R 3B8HA 3ZKBA 4DPUA 4JI1I 4DV2I 3D4JA 3T1YI 3LTOA 1HNZE 1ZM2A 4P52A 1USVA 1Z0EA 3WU3A 3ZKDA 2ZM6E 4KHPE 4JG4A 1RREA 2UXDI 1J5EE 2Z5CA 3QT8A 4USKA 1UEKA 4DR3I 1H7UA 1IBKE 3ZZTA 2UXCE 4JI8I 2Z5BA 4MYTA 3H4LA 4DUYE 4DR2I 4B3RE 2GQ0A 3M6AA 4DPXA 4HACB 4UTGA 2Q2EB 1IBLI 1ZXMA 5IWAE 1Z5AA 2V2QA 1WUUA 2VQFE 4LF4E 3PYGA 4YHHE 2NPFA 5IT9Q 1NHJA 4K0KI 1DARA 4LFBE 1ZM3A 3HJCA 4JV5E 1NHHA 3F0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZU A;  2X7I A;  3PYF A;  4JI6 E;  1XNQ I;  2R42 A;  1MU5 A;  2E5L I;  1PVG A;  4X64 I;  1Z5B A;  4JI2 I;  4GKK I;  3T1H E;  4LF8 E;  4LFC E;  1RR9 A;  4DV3 E;  4JI0 E;  2UU9 I;  4DR6 I;  2UUC I;  2V2V A;  1H7S A;  1ELO A;  1N33 E;  1FI4 A;  5BR8 E;  3GON A;  1VIS A;  4JI3 I;  5FLX Q;  4DV5 E;  1HNX I;  3PYD A;  4AQY I;  1N36 E;  3QT6 A;  4Z7C A;  4DUZ E;  1B62 A;  4X65 E;  2A2C A;  4DR1 I;  4LF9 I;  2HHH E;  4YY3 E;  4P7A A;  3WU6 A;  3J80 Q;  4RPF A;  3J81 C;  2VF3 A;  4NXN I;  5A2Q Q;  2UUB I;  4DR7 I;  3J7A G;  4ZVI A;  1HNW E;  4B3S I;  2E1R A;  1HR0 E;  2UUA E;  4NXM E;  5LMU I;  4LF6 I;  4DV1 E;  4PRV A;  4LF7 E;  1FKA E;  4DR4 E;  4DV6 E;  4JI7 E;  2ZIT A;  4JYA E;  1OJ4 A;  1MG7 A;  1HNZ I;  1BKN A;  4LFA I;  2ZM6 I;  4KHP I;  1J5E I;  1XHK A;  4DV7 E;  4JI1 E;  3T1Y E;  4DUY I;  2F4V I;  1Z0T A;  4B3R I;  1S4E A;  3ZM7 A;  5IWA I;  1NHI A;  3B82 A;  5IT9 C;  1ZM9 A;  1Z0C A;  4DR3 E;  1I94 I;  2OI2 A;  4JI4 I;  1N34 E;  3HUL A;  4MYU A;  2HKE A;  3QT5 A;  3V5R A;  2ZBK B;  4B3M I;  4HY1 A;  4LF5 I;  4LFB I;  2HFU A;  3CWV A;  1QZR A;  4JI6 I;  4WUC A;  1FJG E;  3PYE A;  2VQE E;  4DV4 E;  3OTO I;  3T1H I;  4LF8 I;  1N32 I;  4HXZ A;  1XMQ E;  1MX0 A;  5FLX C;  4DV3 I;  2HK3 A;  1EA6 A;  2GS8 A;  1XNQ E;  1FWL A;  2HKJ A;  1NZ0 A;  4DXL A;  2HFS A;  4JI2 E;  4USM A;  4X62 I;  4X66 E;  4DV5 I;  3V2U C;  4GKK E;  5L3J A;  4DR5 E;  4PRX A;  4PU9 A;  5GME A;  1K47 A;  2V8P A;  3J7A M;  2CZ9 A;  3J80 C;  1FNM A;  4FN5 A;  5LMN E;  5A2Q C;  2UU9 E;  3QT7 A;  2A2D A;  4DR6 E;  1IBM I;  1N0V C;  4XTJ A;  1HNX E;  4I3H A;  4JI5 I;  1H72 C;  4OX9 I;  3K17 A;  4B3T E;  4GKJ I;  2DEI A;  1ZXN A;  1HR0 I;  1XMO I;  1FWK A;  2UUA I;  2UXB E;  4NXM I;  2BM0 A;  4ED4 A;  2BM1 A;  1XNR I;  4DV1 I;  3WU5 A;  2HK2 A;  4DV6 I;  4NXN E;  4WUD A;  4DV0 E;  4JYA I;  4DR7 E;  1A6F A;  4R1F A;  1B63 A;  4FWH A;  5LMU E;  1KIJ A;  4LF6 E;  3LPS A;  1KKH A;  3JAM C;  4DV7 I;  4DV2 E;  1IBK I;  2UXC I;  2BV3 A;  2LJP A;  1PIE A;  3ZZ0 A;  4LFA E;  4EMD A;  1EI1 A;  3JAM Q;  2UXD E;  1N0U A;  1D6T A;  1Z0W A;  2WW4 A;  4HAC A;  2VQF I;  4LF4 I;  4JI8 E;  1N34 I;  1KTV A;  4DR2 E;  3B78 A;  1Z59 A;  2F4V E;  4YHH I;  4DU8 A;  1Z0V A;  1H73 A;  1IBL E;  2V2Z A;  4JV5 I;  4FWG A;  1PKP A;  4WUB A;  1I94 E;  2R3V A;  4JI4 E;  1Z5C A;  1ZM4 A;  1KVK A;  1FJG I;  4K0K E;  1U2R A;  4B3M E;  3Q1Q A;  4LF5 E;  2VQE I;  4DV4 I;  2XEX A;  4LFC I;  4DU7 A;  1XMQ I;  5GMD A;  4DPT A;  4Z7Y A;  4DPY A;  4JI0 I;  2E5L E;  1Z0G A;  1N33 I;  4X64 E;  2V34 A;  3LNU A;  5BR8 I;  1S16 A;  4X66 I;  3OTO E;  4DPW A;  4DR5 I;  4URL A;  4KQV A;  1N36 I;  1N32 E;  4DUZ I;  1Z0B A;  2AJ4 A;  5LMN I;  4X65 I;  2UUC E;  2HHH I;  4YY3 I;  4JI3 E;  4FWD A;  2EFG A;  3K1J A;  4X62 E;  4UT4 A;  4AQY E;  4M1K A;  3WU4 A;  4B3T I;  2DEJ A;  1H74 A;  1HNW I;  1IBM E;  4DR1 E;  4LF9 E;  2UXB I;  2X36 A;  4LF7 I;  4JI5 E;  4OX9 E;  4DR4 I;  4JI7 I;  2UUB E;  4DV0 I;  4GKJ E;  4B3S E;  4FW9 A;  2J7K A;  1XMO E;  3J81 Q;  4HYM A;  1XNR E;  5LL6 R;  3B8H A;  3ZKB A;  4DPU A;  4JI1 I;  4DV2 I;  3D4J A;  3T1Y I;  3LTO A;  1HNZ E;  1ZM2 A;  4P52 A;  1Z0E A;  3WU3 A;  3ZKD A;  2ZM6 E;  4KHP E;  4JG4 A;  1RRE A;  2UXD I;  1J5E E;  3QT8 A;  4USK A;  1UEK A;  4DR3 I;  1H7U A;  1IBK E;  3ZZT A;  2UXC E;  4JI8 I;  4MYT A;  3H4L A;  4DUY E;  4DR2 I;  4B3R E;  3M6A A;  4DPX A;  4HAC B;  4UTG A;  2Q2E B;  1IBL I;  1ZXM A;  5IWA E;  1Z5A A;  2V2Q A;  1WUU A;  2VQF E;  4LF4 E;  3PYG A;  4YHH E;  2NPF A;  5IT9 Q;  1NHJ A;  4K0K I;  1DAR A;  4LFB E;  1ZM3 A;  4JV5 E;  1NHH A;  3F0N A; 
#chains in the Genus database with same CATH topology
 3FBC A;  1S6U A;  5C25 B;  3JQM A;  4WKR A;  1XNQ I;  2B4P A;  3EZU A;  4FYY B;  1IKY B;  3NXZ A;  4NX9 A;  2R8G A;  3DI6 B;  2C2E A;  2V2K A;  4CZC A;  5DRO A;  1X9S A;  2Z5E A;  1IKV B;  1RQ0 A;  1U8W A;  2CVI A;  3CME S;  5H9F J;  3EGW B;  1S99 A;  1MU2 A;  3O3L A;  2CQ0 A;  2EFN A;  3VR1 A;  1NSP A;  1JXV A;  3GV5 B;  2J76 E;  3W7B A;  4ZLL A;  2VUG A;  4KO0 A;  2NN6 D;  2DNQ A;  4UF4 A;  1MN9 A;  1FHT A;  4KGM A;  3FVY A;  4KC5 A;  5ETV A;  4ZPA A;  4IOB A;  4KKO A;  1YH8 A;  2HFO A;  2KH9 A;  4LBH A;  1W7W A;  2R7V A;  2FD2 A;  4PRV A;  3EVM A;  2W4D A;  1FKA E;  3EGV A;  1K8A T;  4EBC A;  3KG4 A;  3HO1 A;  2HGN A;  4WJB A;  3UVJ B;  3DYA A;  3DFE A;  1NK4 A;  8AT1 B;  4X65 J;  4CP5 A;  1HBO B;  1J5E I;  3MF5 A;  3C46 A;  5GVQ A;  5DGB A;  2VBZ A;  4ILR A;  3QZ7 A;  1R6Y A;  2DHS A;  2ZDP A;  4C6A A;  7FDR A;  3PO4 A;  2F4V I;  1Z0T A;  4HHJ A;  3P45 B;  2LEA A;  2VZ9 A;  1IXK A;  2EEY A;  2GMH A;  3EVW A;  2J0X A;  4NLP A;  5GAE I;  2HVH A;  1GTE A;  3L7U A;  4L74 A;  3HHD A;  4J37 A;  3UDC A;  1SC6 A;  3W1Y C;  4QJV A;  2C22 A;  3IM9 A;  2VQE F;  3KK3 A;  1HWL A;  3OVA A;  4HHH A;  1LWF B;  2QA1 A;  3MEE B;  2LDI A;  1UTA A;  1RT7 B;  2ZOF A;  4ZN3 A;  4QIV A;  1XNQ F;  2WOM B;  5J2Q B;  1TKZ B;  4NCA A;  5CXT A;  3MAA B;  5MAO A;  4L72 B;  2NLW A;  1YWX A;  2FC9 A;  4X4U A;  1N48 A;  4P7V A;  1QLN A;  2BA0 G;  3W9J A;  5D6G A;  2V50 A;  4P73 A;  3CB4 A;  3C66 A;  4ZP8 A;  3I31 A;  3IWL A;  4DF8 A;  2PO1 B;  2P9E A;  4ZLJ A;  1H72 C;  4B3T E;  4MMO A;  2G0J A;  4YME A;  4KPY A;  3DRP B;  4I7F B;  3HHL A;  1HR0 I;  1XMO I;  4ED4 A;  2BM1 A;  2YPY A;  3WU5 A;  1GX6 A;  4JI2 J;  4BA2 B;  3IP0 A;  1LWC A;  3CC2 S;  4DR7 E;  2HHV A;  4NCB A;  3R8Y A;  3VVU A;  3G96 A;  2BAN A;  1VQ5 S;  4JBC A;  5EX3 A;  4BA1 A;  4YB6 A;  1KKH A;  1FTC A;  1HI1 A;  4NLO A;  4V19 J;  2F4V F;  2UXC I;  3MD1 A;  3ZZ0 A;  1Q5Y A;  2UUT A;  4EMD A;  2B8P A;  2FHM A;  2E1P A;  3JAM Q;  2DTJ A;  2UXD E;  3KLG B;  2DR7 A;  1EJ7 L;  5MLC V;  2IBO A;  3K7R A;  1M1K T;  2E29 A;  4PPD A;  3MTK A;  4KGZ B;  5G4D A;  2E5H A;  4IUF A;  3CCZ A;  1I51 B;  3KHG A;  2ZNY A;  1H73 A;  3OT9 A;  2K7J A;  4B3S J;  2AHO B;  1JLG B;  2CPD A;  4P10 A;  2OTJ S;  4DBQ A;  1NME B;  1H38 A;  3CJT A;  3NGS A;  4DSE A;  1CUL A;  5E3A A;  2B51 A;  4AL6 A;  1Z5C A;  4ERD A;  3Q1Q A;  4LFC I;  1H6K X;  3BO2 A;  1XMQ I;  5LXR A;  3HDS A;  1S1W B;  2ZOM A;  2GQQ A;  1N33 I;  1PCA A;  3OTO E;  1VQ4 S;  3FCW A;  3W2W B;  3ISZ A;  2KKH A;  1RT1 B;  5C2G A;  2W01 A;  5IWA J;  3CXC R;  2IVM A;  1V6H A;  2YTC A;  3FBE A;  2KM8 B;  1X5P A;  4FWD A;  3K1J A;  3MM5 A;  1KFS A;  1UP1 A;  3H90 A;  4YDD B;  2DEJ A;  3RAX A;  3LP0 B;  1XMO F;  1FDN A;  4ECX A;  1UVL A;  4O4G B;  1Y7P A;  2UXB I;  5KFP A;  1VRT B;  1I3O B;  3PTW A;  3QPI A;  4DV0 I;  2MTL A;  2J9E A;  4GVL A;  3NAI A;  4DS5 A;  4D3H A;  1MWY A;  1YJV A;  2K7K A;  2UXC F;  3PNI A;  3DKD A;  1IKX B;  4FF2 A;  2XZW A;  2B3T B;  3WU3 A;  4KHP E;  1Z2Z A;  1U45 A;  1UPM B;  2EKN A;  1YTY A;  1WNE A;  3MI7 X;  1NJY A;  3ZZT A;  1XR5 A;  2Z5B A;  2IC3 B;  4U3B A;  3CTR A;  3EZ5 A;  4Y65 A;  2LQ5 A;  2W7A A;  2AIR B;  1SBR A;  4F4X A;  3Q8S B;  2RHS B;  2VQF E;  2YKN B;  3PYG A;  1VRU A;  3MAH A;  4K4X A;  4LFC F;  1BHN A;  1XMQ F;  1EP4 B;  5ETT A;  2M88 A;  5DZ6 A;  2I6W A;  2A18 A;  1N33 F;  4IFV B;  1UA0 A;  3KLH B;  4WU2 A;  1PVG A;  2AKW B;  2EFO A;  1NB2 A;  1REV A;  5FJ4 A;  5D4O A;  5KG2 A;  3IN5 A;  4UY8 5;  4YS2 A;  1H7W A;  4OYP A;  1IR0 A;  4H4O A;  5CYQ A;  1FNO A;  4DV5 E;  5H1S V;  5KFB A;  6FDR A;  5EN1 A;  2PNZ B;  3A3O B;  4O4R A;  4DUZ E;  1DFD A;  1RA7 A;  2XY6 A;  2UXB F;  3C8Y A;  3CJ2 A;  1SJR A;  4DV0 F;  1PJ5 A;  2J9C A;  2RU3 A;  4PG7 A;  3LGH A;  1FJG J;  3GR1 A;  4F4Y A;  5DDQ C;  4G1I A;  2VKZ G;  3SFG A;  2HHT A;  1HFE L;  3POT A;  4WK1 A;  1SJF A;  5AJ3 J;  3CCW A;  3VZI A;  5HMZ A;  2DO0 A;  1LW0 B;  4NBQ A;  4LF7 E;  1TL3 B;  5E2Q A;  4IZJ B;  1T9V A;  5G0R A;  4ALZ A;  2N3O A;  1HNZ I;  1UJ6 A;  3OSN A;  1BQN B;  1PBA A;  2Y0S D;  4C2M A;  1UPP A;  2BW2 A;  2I1R A;  2ZH5 A;  5ETN A;  4ZVP B;  3K2Y A;  1WD6 A;  3T1Y E;  2L9D A;  3BGL A;  2JH3 A;  2KYZ A;  1S4E A;  2MKC A;  2EK6 A;  4YEA A;  3GU0 A;  3UNY A;  5IT9 Y;  4NA1 A;  2DNY A;  3O44 A;  2CQ3 A;  2ZJR Q;  3AH6 A;  3SQG A;  4AID A;  2C2N A;  5K8P A;  2OEL A;  4URG A;  5HBM A;  4FYV B;  4J9P A;  1VC6 A;  1RAE B;  2YWW A;  1CJT A;  2FHO B;  2E66 A;  5D4L A;  4WUC A;  5HAT A;  5DG9 A;  4DV4 E;  2QE5 A;  4M5H A;  4LRA A;  5E3P A;  1KVI A;  3QBC A;  1FWL A;  3HHL D;  2NXN A;  3DGP A;  4OJ3 A;  3SYZ A;  3R7N B;  3D1Q A;  1VS3 A;  4X62 I;  4GKK E;  3AJD A;  1HWJ A;  2G0I A;  5IT0 A;  5JEA E;  4DR6 E;  1IBM I;  3N9U C;  4WPA A;  1RHQ B;  1C0U A;  2PNM A;  4JI5 I;  3ILO A;  4I1T A;  2J9D A;  1SCJ B;  4RNN A;  1X8D A;  3RU0 A;  1ZXN A;  4DL6 A;  4GVB A;  2HEK A;  4R8U A;  4F26 A;  4O3Q A;  1NHU A;  2OPQ A;  1B99 A;  3DHX A;  3DRR A;  2BE2 A;  2DNR A;  3FCV A;  4R1F A;  2IOP A;  2BRK A;  1NKC A;  2XLI A;  2WON B;  2NN6 B;  2IAJ A;  5CYM A;  2B7B B;  4FYD A;  5E33 A;  4Y2K A;  1RWX B;  4GO7 X;  1EKR A;  4C3L A;  1KTV A;  3SBM A;  2CJY B;  2V8V A;  3IBC B;  4CYU B;  2JRS A;  3DOM A;  3FZB A;  4OJH A;  2V2Z A;  3Q8R B;  3C16 A;  2I38 A;  2H1Y A;  3KJN B;  2KG0 A;  2YNI A;  2Y8W A;  1ZM4 A;  1WSV A;  4LF5 E;  3KJQ B;  2GX8 A;  4WE1 B;  1HNI B;  2GFF A;  1HK7 A;  1NU4 A;  3IWX A;  1UVM A;  5D78 A;  1MML A;  4X62 F;  4JB8 B;  5BR8 I;  1T95 A;  4DR5 I;  2W7P A;  2J5A A;  3MOJ B;  5I3Q A;  3K57 A;  1TAQ A;  1IBM F;  3ET6 A;  3JTP A;  3BQ2 A;  5A0Y A;  4IS9 A;  4AT1 B;  4DL0 C;  1RT5 B;  5DNX A;  2DRB A;  1WC5 A;  4JI5 F;  2H9Z A;  3MOZ A;  1FD8 A;  3UWT A;  2MY7 A;  3NOG A;  2IMO A;  1ZZN A;  3DDK A;  2XB2 D;  3AQP A;  3EXC X;  4ZIW A;  3NWG A;  2EI5 A;  3GYN A;  2JHE A;  3Q22 A;  1JLE A;  1O8B A;  3MED A;  3GIJ A;  2DNL A;  3J81 Y;  4KT0 C;  4O3N A;  3R5A A;  5F9N A;  3RW6 A;  4B3S E;  2WK4 A;  4FW9 A;  2P8I A;  4IG0 A;  5F8M A;  3JYT B;  2VPY B;  5KFO A;  3JTO A;  1RAI B;  3V4I A;  4B3R F;  4QPX A;  2JWN A;  1FKO A;  5L8R C;  4KYZ A;  1USV A;  4OI4 A;  5DET A;  4OL8 A;  2LXI A;  2HHU A;  2U1A A;  2R8K A;  1FKP A;  3BSO A;  3ENV A;  2WNR B;  1IBK E;  4MK8 A;  1OMS A;  3TEH B;  2UUB J;  3M6A A;  1GXL A;  5IWA E;  3E8O A;  2JEB A;  3MPY A;  2V2Q A;  4WU3 A;  3M6X A;  4C8Y A;  2X1A A;  1UJ5 A;  3QWU A;  2Z58 B;  1ZPV A;  4QWB A;  4X4S A;  1C1C A;  2FZC B;  4KE5 A;  1WEX A;  1N52 B;  2RVJ A;  5A8K A;  1AW0 A;  4F50 A;  1V3Z A;  2DGS A;  1KHW A;  1D3W A;  4I6A A;  5BR8 F;  4WYL A;  2R42 A;  3VVT A;  4G1Q A;  4WFA Q;  3I32 A;  2VOO A;  3NMR A;  3L7Z A;  1FEH A;  1VQS A;  3K58 A;  2A1B A;  1Q1K A;  1WF1 A;  3E01 A;  2UUC I;  1AUS L;  1RCX B;  4HH0 A;  1S1V B;  1TL1 A;  5FLX Q;  5HQ8 A;  1DBD A;  4V1A k;  3NOC A;  4XDC A;  1N36 E;  4QU7 A;  3HCX A;  4PQU A;  4C0O C;  1B62 A;  2CNN B;  4M5I A;  3OVB A;  4BC9 A;  4LMZ A;  3OBI A;  1WHX A;  2AW0 A;  1R43 A;  1K0T A;  4NXN I;  1H7X A;  2WVB A;  1KOO A;  5HI7 A;  2KRR A;  5T7L A;  3M8P A;  1DLO B;  4NXM E;  3P8B B;  4DV7 F;  3M9N B;  3KFW X;  5KFE A;  3T6B A;  4CM0 A;  4ZVR B;  1R6M A;  4ZHR A;  4JYA E;  1OJ4 A;  5J2N A;  4DFJ A;  1JMT A;  2MJN A;  4KBI A;  1MN7 A;  4B17 A;  4P72 A;  1S9F A;  2O1W A;  4KGX B;  2K1R B;  3IFE A;  3WIV A;  4DCJ B;  1IM6 A;  3GJS B;  4ECZ A;  1D0E A;  2Z5C B;  3W3S A;  4ZPD A;  2QA4 G;  3JSM A;  4JP8 A;  4XK8 C;  4AL5 A;  3V6J A;  1HYS B;  1AZS A;  3CDJ A;  5IOL A;  1P9Y A;  3OUY A;  1HBM A;  3VGU A;  1T05 A;  2GC8 A;  3QT5 A;  4I2Q A;  2CQD A;  1KS2 A;  4NLS A;  2MZT A;  2KFN A;  3M2V A;  1UVJ A;  4OZ0 A;  2AYG A;  2YBV A;  2XCP A;  1M90 T;  3ILJ A;  4JI1 J;  3UPF A;  2Y9H A;  1WG4 A;  1FJG E;  3TAP A;  5KT2 A;  3UN5 A;  3KHR A;  5FLX C;  2W8K A;  4NCG A;  2VFT A;  2GS8 A;  2OLW A;  1R6V A;  3TJA A;  3DRS A;  3TZY A;  2PI5 A;  4USM A;  1MU2 B;  1FF2 A;  1R6L A;  4U8Y A;  4FS2 A;  4KTQ A;  3AY0 A;  2UU9 E;  3KUE A;  2XYP B;  4NXN F;  3KRN A;  3OL7 A;  2FC8 A;  4KO0 B;  4OHW A;  2D1C A;  1SV5 A;  4J9V A;  3KLV A;  3GFH A;  3CJS A;  4KKO B;  2VDI A;  3M7N D;  2AX1 A;  5I3P A;  3AD7 C;  4FWH A;  2OPP A;  5LMN J;  1T8E A;  1MLA A;  4QPT A;  3DYA B;  3D5M A;  3C6U A;  2IY5 B;  4LBP A;  4YR2 A;  1TV6 A;  2R7U A;  3KJV A;  2FVS A;  2ASL A;  3AAW B;  4CO2 A;  2KN4 A;  2RF2 A;  2BX6 A;  2DIT A;  5F8I A;  4LRD A;  2POK A;  2MLX A;  2XMA A;  4NML A;  1X0F A;  2DHH A;  2HQG A;  4ZPB A;  2DHA A;  4Q44 A;  3KK3 B;  4X64 F;  1RT2 A;  1DAX A;  2MY8 A;  1H2T Z;  3FRZ A;  4H4K C;  2I8E A;  4DV2 J;  2NYI A;  4U7U K;  4FKX A;  3R1L A;  3MMJ A;  1NM2 A;  5KOX A;  1TKT A;  1S79 A;  1Y0H A;  1NSQ A;  2WVC A;  2DGU A;  2YWG A;  1TK5 A;  3IGV A;  3CD6 S;  1TTH B;  3M2U A;  5I42 A;  3MPW A;  4WXW A;  1CJU A;  2MQP A;  4WTY A;  2E5G A;  1Q8L A;  5DRK A;  2DNM A;  5HQL A;  1U8S A;  4C8K A;  1SXL A;  3O1L A;  4ID5 A;  1VQ8 S;  4YY3 I;  3P06 A;  5KTQ A;  4KFB A;  4J9L A;  4B3T I;  1W2B R;  1OYR A;  4LRC A;  3OTB A;  2OSQ A;  4ZMM A;  3NBP A;  1B7F A;  2FLP A;  3RGI A;  3M8R A;  1U4B A;  3BSC A;  5DNL A;  3HHL B;  5CZV A;  3FQK A;  4F67 A;  1P6T A;  1LWC B;  1XNR E;  2VFV A;  5LXY A;  5ETO A;  3Q8Q B;  5F8N A;  1RHK B;  2ROG A;  3NEK A;  3UN3 A;  4IFD A;  2BAN B;  4IR9 A;  4BA1 B;  3MTJ A;  2UXD I;  3TQE A;  4LF9 J;  3ISN D;  4IDK A;  4PQA A;  3PCO B;  3PR5 B;  1OIA A;  2QFJ A;  2W7O A;  2C2Z B;  3ZZZ A;  4BLG A;  1WKJ A;  3WX8 A;  4J91 A;  2VG5 A;  3WIU A;  2RS8 A;  4ELV A;  1DAR A;  4G1P A;  1CUL B;  4JV5 E;  3OLB A;  1RJJ A;  3FBF A;  4JI6 E;  1MU5 A;  1FA0 A;  1WI8 A;  4ZCI A;  4B02 A;  2KU7 A;  1JJ4 A;  1Y5L B;  2W24 A;  1YJU A;  3UDL A;  2GAG C;  2OEK A;  4JI0 E;  4OYW A;  4YY3 F;  2UV8 G;  3BYR A;  3I5B A;  1SC3 B;  4OV1 A;  2JLE A;  2NSB A;  3PKY A;  4YHH J;  4UUW A;  4CLF A;  2DYA A;  4NWB A;  4TQS A;  2MKS A;  2FJB B;  1JXL A;  1YJR A;  3MM5 B;  2NN6 F;  4DV6 F;  1PYT A;  5GAH U;  2C3Y A;  2EVZ A;  4M5