3PYFA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with amp-pnp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
296
structure length
296
Chain Sequence
b'SVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 80
structure length 296
sequence length 296
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pyfA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pyfA01
4DR2E 4ED4A 4DR5E 2NPFA 4LF6E 2HKJA 1EA6A 3K17A 1HNXI 1XMOE 1N34I 1KKHA 3WU3A 1HNZI 4JG4A 5BR8E 3QT8A 1D6TA 4X65E 1Z0WA 5LL6R 4JI3I 4JI3E 3V5RA 1Z0GA 1Z0TA 2XEXA 4B3SI 4FW9A 1MX0A 4DV0I 1H72C 1DARA 1MG7A 3ZKBA 2X7IA 4USMA 2EFGA 4WUDA 4JI6I 3ZZTA 4YY3I 2DEJA 1HNWI 5GMEA 4JI6E 4DR4I 2CZ9A 1HNWE 1HR0I 4DR4E 2WW4A 1XNQI 2UUBI 1XNRI 1HR0E 2UXCI 1XNQE 2UUBE 1XNRE 2UXCE 2ZBKB 4EMDA 1N36I 2E5LI 3D4JA 2J7KA 3QT5A 3ZZUA 2ZITA 4GKJI 4NXNE 1WUUA 2A2CA 4GKJE 4LF7I 3WU6A 5A2QQ 1J5EI 4LF7E 3JAMC 4DR3I 1J5EE 4MYUA 4AQYE 1H73A 1Z5AA 1A6FA 1IBKE 4JI4I 1N0VC 2UXBI 4DPWA 2R3VA 2UUCI 4HXZA 2UXBE 1H7SA 2A2DA 2UUCE 4X64I 5LMUE 4X64E 4X66I 5IWAI 4USKA 4X66E 4GKKI 2BM0A 4JI0I 5IWAE 4DPTA 1Z0VA 4JI1I 4JI2I 2VQFE 4JI0E 4JI1E 5A2QC 3ZM7A 4DUYI 2ZM6E 4OX9I 5FLXC 4DUYE 4B3RI 4LF4E 1KTVA 4B3RE 5IT9Q 4DR1I 4DV1I 4JV5I 4DR1E 4JV5E 2AJ4A 1ZM2A 3B8HA 1NZ0A 1U2RA 4DXLA 1HNXE 4KHPI 2E1RA 2VQEI 1N34E 4DUZI 1HNZE 4DUZE 4M1KA 4JI5I 1Z5BA 4I3HA 1BKNA 4URLA 4FN5A 4JI5E 4DU8A 1MU5A 2HK2A 4LF5I 4B3SE 4DV0E 4PU9A 4LF5E 5IT9C 4HACB 4ZVIA 4DPYA 4HYMA 4YY3E 4JI7I 4HY1A 4JI7E 4LF9I 1N32I 1FNMA 4LF9E 5L3JA 1N32E 3LPSA 1RR9A 2V8PA 1FWLA 1S16A 1N36E 2BV3A 2E5LE 4P52A 3PYDA 2V34A 3F0NA 4DPUA 1Z59A 3PYGA 1EI1A 1B62A 2HKEA 3J80Q 3B82A 1RREA 4DR3E 4DV3I 1FWKA 2UU9I 1QZRA 1ZM4A 4DV3E 2F4VI 2UU9E 2F4VE 4JI4E 3J81Q 4FWGA 1Z5CA 4NXMI 5LMNI 1N33I 4NXME 3WU4A 2DEIA 4JI8I 5LMNE 4JI8E 3J7AG 4JYAI 4PRVA 2HFSA 2OI2A 1XMQI 3ZZ0A 4GKKE 1FJGI 1K47A 4WUCA 1XMQE 4JI2E 1FJGE 1FKAE 2UUAI 4OX9E 2UUAE 1KVKA 2V2ZA 3QT7A 4KQVA 3H4LA 4K0KI 4FWDA 3J81C 4K0KE 1B63A 4DV1E 1H74A 3T1HI 3T1HE 4KHPE 4DR2I 2HK3A 1PKPA 2VQEE 2BM1A 4LF6I 1Z0EA 4X62I 2X36A 4B3TI 4X62E 4LFAI 4MYTA 3J7AM 4P7AA 2HFUA 1XMOI 4B3TE 1NHHA 4LFAE 4PRXA 4FWHA 5BR8I 4X65I 1Z0CA 1UEKA 1KIJA 4WUBA 2GS8A 4DV7I 4DV6I 3LTOA 4DR6I 1FI4A 4DV7E 3M6AA 4DV6E 4DR6E 3HULA 4DR7I 4LFCI 4DV5I 4DR7E 4LFCE 1XHKA 4DV5E 2LJPA 3WU5A 3JAMQ 2R42A 4R1FA 1Z0BA 1NHIA 2V2VA 1ELOA 3GONA 4RPFA 3CWVA 2V2QA 5GMDA 1IBLI 1IBLE 3PYFA 3Q1QA 4NXNI 1ZXNA 3OTOI 3B78A 3OTOE 2UXDI 1H7UA 1OJ4A 2UXDE 4Z7YA 4B3MI 1ZM3A 3QT6A 3T1YI 2Q2EB 5FLXQ 4B3ME 4AQYI 1N33E 1VISA 3T1YE 4XTJA 3PYEA 1IBKI 1NHJA 1ZM9A 4DV2I 4DPXA 1S4EA 4JYAE 4DV2E 4Z7CA 1PIEA 3J80C 4LF8I 4UT4A 1ZXMA 4DV4I 5LMUI 1I94I 4LF8E 1PVGA 4DV4E 3K1JA 4HACA 1I94E 3V2UC 3ZKDA 4YHHI 1N0UA 2VQFI 2HHHI 4YHHE 1IBMI 2HHHE 2ZM6I 4DU7A 4LFBI 2VF3A 1IBME 4LF4I 4UTGA 4LFBE 3LNUA 4DR5I
chains in the Genus database with same CATH superfamily
1A9NB 1LK5A 3M6WA 2DHSA 4LF6E 3UDVA 2DR6A 4B9SA 5LMNF 2BANA 1TK8A 4P2XA 2I2YA 2QA4S 1RTIB 2QLFB 3HX9A 4NYZA 4UY85 1C0UA 4NZ0A 5F8MA 5CAAA 2NN6F 3KNGA 1Z0TA 3KLFA 1CQMA 3P45B 1Q5YA 2F1FA 3BBCA 3BN7A 5FLXY 3OFFA 5E5NA 1LW0A 3QGPA 2HVIA 3PTWA 1AT1B 3TW0A 3ETMA 4FYYB 2UUBE 3CCLS 5C5JA 1EARA 2JE6A 4X62F 1MLAA 4P74A 5C7PA 3SCJE 4OYOA 3POTB 4JYAJ 4DMZA 1YZ6A 2RKIA 1WDDA 4TKTA 1CPZA 4MYUA 3I5AA 4DV6F 1S97A 2CPFA 1F6TA 1QAIA 5IOLA 2DNOA 4DL5A 4ZITA 4MKYA 3TR5A 5DNXA 2VKZG 2WONA 3R1HA 5CD4H 2RQKA 1RHYA 4LSLA 4X66E 4GKKI 2PA3A 5KAKA 1SUQB 4LUBA 3W2VB 4DPTA 1Y60A 2WAQD 2DR8A 4IZJB 2FYXA 3N4WA 5LJ3Y 1UPMB 4NLDA 1R6YA 1Y11A 4F04B 3CW2C 5IT9Q 4NA2A 4N41A 2RQMA 2QIFA 4TY9A 1OYRA 1Y4ZB 3ITHB 3EVWA 3K89A 3QGHA 1U8SA 1N33F 4KHPI 1PYOB 2CADA 2GQCA 5HROB 4AXIA 4N8NA 4QNJA 2VBWA 2YKNB 5HMWA 2AIRB 4MT1A 1SKRA 2PDAA 4DL4A 4ILLA 3QZ8A 2N7CA 1HNWJ 3ICLA 1GMUA 3MCNA 3HKWA 4DR4J 1R7IA 2HK2A 4LF5I 1UCNA 4DV0E 1F2GA 4YDXA 1BC6A 2ZHOA 4PABA 3CUNA 2QMUB 3H8YA 4IRCA 2GW8A 2LA6A 3V4IA 4B9VA 3IWXA 2GFFA 5L3JA 4IZKA 1HYSB 1VQ5S 2E5LE 3UR3C 3EVOA 2HHXA 4USWA 1HBNB 4AQYJ 4LCGA 5L9XA 1OMSA 3AH6A 2OSQA 1EQ0A 1WC4A 4WJBA 8AT1B 2FVQA 4LCFA 2C38B 4JI3F 1UDSA 1PO6A 2Z5BB 1WC5A 2PA8D 4DV3E 1AZSA 2CG8A 1LXJA 2WZ1A 2XLJA 1TV6B 2KFZA 1YJNS 2YKPA 4KPYA 2E7WA 4NZ6A 4BA1B 3NBPB 2GVZA 3ISNC 3EGNA 1KS2A 2UXCF 5C0XC 2IC3B 1UWBB 4O3NA 2EI5A 4RWWA 3NAHA 4NLVA 4J9OA 3BB5A 2DNPA 2V2ZA 3BSCA 3T5HA 2HZAA 3PRVA 3M05A 3I0RB 3L3CA 2CPJA 1WHVA 2PSZA 2MSTA 2J9CA 3IG1A 3VAIA 4CH1A 3P4UB 1O6XA 1R6MA 5AXLA 3J7YI 1VQMS 4FXWA 2G0CA 2R4FA 2W9BA 2MKCA 1AFJA 1CJKA 4YY3J 1XMOI 4B3TE 2B51A 4OX6A 3CDBA 2HMIB 1NSQA 3PJWA 1XBWA 4PZVA 2QYGA 1YVFA 3W61A 4IFDE 4DR6E 3DYAA 1N5YA 2B9YA 1YRTA 1OQ3A 5J2QA 4DV5I 3MMBB 2EVZA 3TEGA 3HVRA 1Z0BA 5KG0A 3VV2B 4JV5F 3MCOA 4FS1A 2J0XA 4H54A 2MZRA 1LNQA 2VICA 3C16B 4CLSA 2VQEF 2AYBA 2GMLA 1FX2A 3QAEA 4XDCA 5KFPA 3M2RA 4WFZA 2DGSA 4BWMA 1F60B 4NXNI 1JXVA 5B7WA 4JI8J 3OTOE 4KIAA 4YFUA 2FIUA 4ZP6A 3NOCA 3M9MB 1IN0A 3DHXA 1OYEA 2VKRA 3H2LA 3W8GA 2JEFA 1Y3JA 3I5BA 4JP8A 1DTTB 1SIWB 3MUMP 4WK3A 4A46A 1PVGA 1S0MA 1RA7A 3C14B 2AGOA 1OQ6A 1XWLA 3G9CA 2F8MA 4QR1A 1RYRA 4F0MA 3RW6A 4DR3F 1XERA 1ZH5A 3L7PA 2U1AA 4B3OA 3O44A 4DL6A 1IKXB 3C6TA 1REVB 2XZDB 1NK8A 4NXMF 4AIDA 2KL8A 4EFAC 1V5IB 2J76E 1HK7A 2ZH8A 2GQ2A 1X8DA 3IBWA 2KVQE 5DROA 3NMAA 2XEXA 3Q86A 3UDLA 3BPDA 5JEAC 1FFSB 5FJ4A 3ZKBA 1NUEA 3CE8A 4QYRA 1N88A 3MPYA 3UWTA 4FVMA 4IG3A 1EETA 5I42B 1LQ9A 1QJHA 3CEDA 2IVMA 3SFGA 3HKZD 4CO0A 3Q23A 4F25A 1GXTA 1U02A 3HKMA 1KFDA 1YJ7A 2ACYA 3VAJA 2VPYB 1UJ5A 4DCOB 1VQ7S 3BZQA 1VLOA 1Y0HA 2OGUA 2OPPB 4LIRA 3UD3P 3M8ZA 1TMJA 4OHYA 3B4MA 3MEEA 4HLBA 1RTDA 5T41A 1J5EE 2C2EA 4KAIA 1Z5AA 1A6FA 5GAGI 1N0VC 1NH8A 2B8QA 1VQKS 2ROGA 1NJXA 3DD6A 3ZNJ1 5HATA 3ZO7A 3O2IA 3Q8VA 3UQSA 2UUCE 2J6TA 2QJ3A 1QAYA 3VR1A 3GFHA 4JBCA 5KOXA 3V81A 2HZVA 1WF0A 1RE1B 1RDRA 1LWXA 4DUYE 4RW9A 1RAEB 1XJWB 3BSNA 5KFJA 1NK5A 3MOJB 1R6VA 4DF8A 3CCWA 2E1RA 3BO4A 3LP1B 1ZYQA 4DUZE 3OHAA 2MQPA 3BKFA 2RHQB 1S7HA 3DRSA 3MHYA 4LSNB 2GGPB 3HHLC 1FRLA 2V68A 1JX4A 3QLHB 1FWPA 2IIHA 2DIUA 4UF4A 4MU0A 3CJ2A 5IQQA 3OVAA 1RTJB 3Q83A 1FT8A 3LA0A 4ECVA 2RD5C 4ETZA 4LF9E 5SZTA 3PS3A 4CNYA 5KFDA 2RRNA 1SBRA 2IDEA 1WC6A 1T9VA 4XIUA 2YPZA 1VR6A 3VGVA 2Q66A 1IKVA 1UFWA 2BRKA 5KFUA 3B82A 2I9SA 3LANA 1E6YB 1ZA1B 3GFYA 5K20B 5LMUJ 3LGHA 2GJ2A 4DLGA 4PRFA 3KJVB 4X64J 2F4VE 1WC1A 2V8DA 2ROEA 4V1Ak 2GIQA 2RDDA 4P2SA 3EXYA 5GAHU 1RTIA 4QW9A 4C11B 2ZJQQ 3HZEA 2O3ZA 3P76A 3WDOA 4I0WA 4DLEA 5KFSA 2C3UA 1D9FA 4DR1J 4CLKA 1FJGE 2UUAI 2E29A 1RAOA 4K5SA 2LXIA 3KHLA 1FTRA 3SSQA 3DOKB 1RWVB 4RKUC 2FVPA 4DV1E 4AXJA 4ZHRB 3T1HI 4IFDA 2CJYB 4H4KC 4A8MP 1SI9A 4ICLB 2GCFA 2L41A 2GIRA 1FRJA 3GTYX 2OO4A 4UUWA 3POTA 1WC0A 3OR2B 3AJ2A 2MKYA 4FWHA 2ROPA 3JS9A 1LFWA 2D9PA 3ELHA 5B0AA 4WF9Q 1FXDA 2ACMA 3AOAA 2XO7A 2ZH4A 3GSIA 4DN9A 1RT2B 3MR2A 3Q6MA 2BRLA 3MM6B 1X4GA 5DLFA 2KXFA 4ZJLA 3BR8A 3GV8B 4LFCE 1RU1A 2GIFA 5J1NA 2CG4A 3SIPB 3GLLA 3MMJA 4IH5A 3FSXA 1SUQA 3W2VA 2BJ3A 3LP2B 4IZJA 2UU9J 4LPFA 2MKJA 1KHWA 1W25A 1ZBTA 4P2FA 1TKZB 1EAYC 2VG5B 4ZVSB 2R8IA 5LMNJ 3A3NB 2FGCA 1YJWS 4B3SF 1ZXNA 3G6VA 5IM0B 4N7TA 1OYSA 2UXDI 3G82B 2LCWA 4LBIA 5HROA 3QT6A 3V6JA 2YKNA 3K8WA 5K8MA 4PG8A 5I3QA 3JSMB 1YWXA 5IV3A 4KY3A 1ULRA 3EGWB 3VWSA 1DBDA 3BQ2A 3M8SA 4O44B 1PSDA 1UVKA 3HM9A 5J2PB 3F73A 5JJBA 4YHHE 1FA0A 1MNEA 1RLDA 3RUBL 3CVKA 4X62J 1SC6A 1FDAA 4K4ZA 1HYSA 2ZZMA 2WP8B 4DSKA 1FO1A 2IAJB 2LA4A 1HBNA 3UCGA 2NN6C 3H5SA 1R27B 1UTAA 2EK1A 4DV6J 2ALYB 3JSRA 2C38A 2YKQA 2Z5BA 1FD2A 4IFVB 4NRUA 3M8PB 3HK2A 4C8ZA 1TV6A 1QDUB 4IOCQ 2D69A 4G1IA 1MX0A 2XMWA 4A8WA 4I56A 4BA1A 4PKDB 1B70B 3NBPA 4MK8A 1ZAXA 1OO0B 5KFXA 2IC3A 1UWBA 1WG5A 3QFHA 2DNMA 2XULA 1XNQE 1RBAA 1Q53A 2DXFA 2MLYA 5E7OB 2AJ1A 2VDHA 1VFJA 2HRTA 3I0RA 3I55S 1N33J 5A0YB 4DFKA 2ZITA 1SJ3P 4OLPA 3NAIA 1HI1A 3ISND 2GJIA 5C0XD 2ZKTA 3K85A 4FW6A 4QPXA 1RWKB 4ZVUB 2M3DA 3OSNA 2HRYA 3J81j 2HMIA 5LJ5Y 3LH2S 2ATLA 4DPWA 1S10A 2JJ4D 3FRZA 1D9AA 5KFYA 3IM9A 3I82A 5DDOC 3DNCA 4ZCLA 3A3PB 4K4SA 5AXNA 4ZIWA 2B43A 5E33A 2W1BA 4HVZA 2IA0A 3BYRA 4BC7A 1QAXA 4LIWA 3MMBA 2FTRA 4OX9I 3HP6A 4URGA 4B3RI 2UV8A 2A18A 3KG4A 1FRKA 2B8PA 4OZNA 2C28A 3C16A 3S8SA 4JI3J 1DY3A 3TX8A 2OAUA 4LRDA 4Y34A 2W7PA 3HSZA 4ED3A 2HS3A 1WF2A 1YHQS 2FD2A 4CO4A 2R2TA 4FN5A 3IAM9 1WI8A 4JI5E 2GQ0A 3O1LA 5E3QA 5A8RB 2GA7A 3JSYA 8RUCA 2UXCJ 3EWGA 3PDNA 4ILRA 1HBOB 4P72A 5IC6B 2MLZA 4QYZJ 3R2CJ 5HQMA 4I7FB 3C14A 2MQQA 2GVDB 4LRCA 1ZPWX 4WP9A 5D4PA 4A8KA 2J0WA 3BF4A 2V34A 1WD6A 2P9GA 2UVWA 3PYGA 2RILA 1HIYA 5E41A 2CJQA 2A3JA 2Z8QA 1Z1ZA 2M52A 1REVA 4UQTA 3N6LA 2VC1A 3CNQP 4LMZA 4UW2A 2E5HA 2OTLS 4I64A 2DR5A 2NS1B 5D0GA 4WKYA 2Y1JA 1HW8A 2GJFA 2NZCA 4JYAI 2MHEA 4FBUA 3KJFB 4JI2E 2K1RB 2ZH2A 4FKXA 3KK1B 4JV5J 4NLGA 2EG1A 1X4AA 5I42A 3E2EA 4K4XA 3NNAA 2VQEJ 1S77D 2Q3PA 4OJ3A 2LEAA 4UOFA 4DX6A 4NLSA 1OSDA 4QWCA 4NASA 2G0IA 2F5GA 3SXLA 2VQEE 3MZIA 5JEAD 2YQ0A 1XQIA 2RB7A 3ET6B 1Q78A 2EBEA 2OPPA 4PXCA 5KG4A 2HQFA 1SH3A 3SDEB 3MR3A 1I6JA 4MU4A 3MCSA 4M5IA 3D28A 5KFVA 2HBQB 3LTOA 4WFNQ 2ZM6F 5LSRA 1U7LA 4KV8B 1BWVA 4DR7E 4L3NA 1D3WA 3T5JA 2RAQA 4DR3J 1NHIA 4JUZA 4KHPF 4OFZA 4X4SA 3HJFA 3LALA 2XZWA 4EBCA 2F3JA 2DB1A 4ED7A 4NXMJ 2G0JA 3L9ZA 3SQOP 1R8BA 4LF5F 1XK8A 1CJUB 2Y3YA 3FQKA 1HWJA 1D9DA 4C98A 1S9EB 3LP1A 2Q2EB 4B3ME 4AQYI 3M7VA 3R27A 3VGUA 4LSNA 3FBEA 4NLUA 2GGPA 4NL5A 1C4AA 3PO5A 1R0CB 2R7SA 3QLHA 5DZ7A 2V8GA 2Y8WA 1SKUB 2HHHI 3THPA 1RTJA 3QBCA 3ULHA 2BX6A 1EJ7L 2IRXA 1C0TB 2VF3A 3Q8SB 4LFBE 2PMHA 2NXCA 3OL6A 4F3MA 3HHLD 1NDLA 2DNNA 3J7A1 4DR5I 3UO0A 1JLQB 3VVUA 3GFZA 1VQ9S 3G6XA 2G2OA 1CC8A 3TUIC 4GQUA 3MAHA 4JG4A 3QT8A 1E6YA 4FF3A 2I8EA 3U7JA 2B7BB 3KJVA 1S59A 2CQHA 2E66A 1NK6A 2YXLA 4RBUA 2XMUA 3AJDA 3MEGB 4TQSA 5D77A 2YX1A 1IM4A 3TA2A 3FJ2A 1J27A 3MUTP 4C11A 1RT3B 4YY3I 1FRHA 4FYXB 5GMEA 2R7WA 4NLTA 3FRYA 1KQFB 2AU0A 1XNRI 1OIAA 1A6LA 5HLFB 1RT5B 2BA0D 1VJWA 4FXDA 5K14B 4HH0A 1DRZA 2HVDA 4OKGA 3DOKA 4RUAA 3QT5A 1XMOF 3VAHA 4ZHRA 5EL9A 1KC8T 2DVIA 2PNLA 5JVGQ 4ED8A 5A2QQ 3JAMC 4ICLA 5HMZA 4UZCA 3CDIA 2B56A 3KLHB 3BGRB 3OR2A 1SC1B 4ZN3A 2AX1A 4DV5F 2FZKB 1YIJS 2P9EA 4GO7X 2UXBE 3BGUA 5KFIA 4WE1B 1RT2A 3CPWR 4K2JA 2ZH7A 1HD1A 3MM6A 4CO5A 3GIMA 3TJ9A 2F1DA 4R0JA 2NREA 4JI1I 2BJDA 1OY9A 3TAMB 1HLWA 2BKNA 4NXNF 3LP2A 3JAMU 4FW4A 2F63A 1RK8A 3TRGA 4K4VA 3AFGA 5DDPC 4CRJA 3D5MA 1TKZA 4DQRA 4Z37A 5ETNA 1Q7YT 2VG5A 2HAIA 2ADCA 4ED6A 3X3UA 4URLA 5RUBA 5CYMA 5IM0A 4CO1A 4ES1A 1Z2ZA 3G82A 3MM5B 4OJHA 1L3UA 4Y2MA 2XYGB 1FRXA 1RAAB 2HQGA 3QZ7A 1N5QA 3JSMA 3H98A 2CQ0A 4DDFA 1VYAA 2VASA 1Y10A 2CJKA 1LW2B 5EWFA 4O44A 2VG7B 2C1EB 5J2PA 2C2RA 1UZDA 1L3KA 2IESA 1WEXA 3F0NA 1PBUA 3CXCR 3QPIA 4D3GA 2MKKA 3NKYA 5HMXA 2WP8A 1U2CA 2IAJA 3SCIE 2JWNA 2BUNA 3IM8A 1A7GE 2AJ0A 4KO0B 5F8IA 4Q44A 1Z5CA 4FWGA 3L7UA 3QGIA 4CWBA 5HJYA 3KMSA 4IFVA 3WU4A 3M8PA 5EN1A 4CH0S 3CD0A 1NK9A 1VDHA 2DXEA 2I0XA 2W8LA 3BDPA 4FW5A 3OTDA 5MLCV 1RWWB 2DISA 2ZOGA 3BO3A 2NN6D 4DFJA 5CABA 5IT4A 1IKYB 3RYLA 5D15A 2BVZA 2HFNA 2Z56B 2CG9A 4ED1A 2ZWPA 1WNEA 1OPZA 3DLGB 3CDWA 4B3SJ 1JJHA 2HGLA 2BM1A 5A0YA 1Z0EA 5DM6Q 3SV3A 4I6AA 2XYPB 1VBXA 1UEUA 1LWCB 1AYEA 3OFEA 1HBUB 4F0KA 2PI4A 1YDLA 3KK2B 3HSDA 3CF5Q 1UEKA 2CKWA 2ATCB 5B08A 1GT8A 5HAOA 2QE5A 4EZ6A 3AJ1A 3TO8A 2K7JA 2QMWA 2HURA 3HFVA 3OUYB 3GONA 1VGYA 2IBOA 2V5HG 4A8QA 2L9WA 4KFBB 1E3HA 1UDQA 3SZ2A 4LJMA 4KSEB 2CQIA 3BH6B 1A0OB 3D9BA 4XTTA 4DUTA 5I3UB 7FD1A 1S99A 2DY9A 2C3OA 1TL7B 4QCLA 4ZJOA 2ZBCA 4FBTA 1YJRA 2PO1B 5A8RA 4FDFA 3HFKA 4DV2E 4ANCA 2KKHA 3M2UB 1PIEA 1OS5A 3TP2A 3ZZRA 2W2NP 4DV4I 5LMUI 5AXMA 1HBOA 1SH0A 2D41A 2IVYA 1IBMI 2V4QA 4I7FA 2WVBA 2B4OA 1QLNA 2GVDA 2NYHA 4LBPA 1T8EA 4G3IA 3LNUA 4ANDA 4ZPCA 2OHDA 3GFXA 4C3KA 3EE3A 4AL6A 1K44A 6FD1A 4CQ1A 3K5NA 2FQQB 3K17A 1HNXI 2ZH5A 1N48A 2MKSA 4B9NA 2RQ4A 1UP1A 2M0GB 4WIQA 2ZDPA 5CA5A 2CZVC 5IQ6A 3NXZA 2ZJPQ 4AL7A 5D4OA 5HN0A 1RYSA 4C8NA 1CG2A 1BWEA 2VB6A 2J9EA 2UUAF 1HFEL 3FCWA 3G6YA 3AA9A 1IWGA 4J9QA 1VQOS 4JV2A 1T9YA 2LLZA 3Q24A 4I2QB 2DR7A 2FJXA 2PFFB 1HBMB 5FWKA 2AX0A 3M9NB 4EYHB 3KLGB 1HD0A 2K1RA 1HR0E 3T1HF 3KK1A 2XTJP 1S7IA 4CLFA 5J2NB 1T94A 1VI7A 1VQNS 1X9WA 1RT1A 3RAMA 4L74A 2CQ1A 3TUZC 3KJQB 2IJNA 4GKJI 2QA1A 1GXUA 4LF7I 4JV1A 1YITS 4EBEA 1UVNA 3I9ZA 3ET6A 3W9JA 4A8XA 3MTJA 1B7YB 1LOUA 2VA2A 1C1CB 2NXEA 1MN7A 5B0GA 5J1PA 1Y7PA 3SDEA 4OO1E 4HXZA 2K8GA 2FC8A 1P1LA 3QYYA 4USTA 1W26A 2J6UA 4OYBA 5IWAE 2QGFB 1UPPA 5K36E 4KV8A 2Z58B 3CJ8A 3DDNA 2XLKA 2CJBA 3CMAS 1F9FA 2WOMB 4OI0A 4ELTA 4X65J 3X1LB 3IGNA 5D0HA 2UXDF 3CJ0A 4F4YA 3M7NG 3IAS9 1SKWA 2DY1A 2CJ9A 1IJFB 4CZCA 2SXLA 3CDEA 5KG5A 3M7ND 4C3LA 4DL3A 3OLBA 3TJ8A 1CJUA 1OPIA 3FCHA 1S9EA 1HPZB 4M5NA 3SMZA 4QWAA 3QRRA 4HYMA 2CFXA 2R7OA 2ZZTA 4JI7I 3GCMA 1R8AA 1FNMA 3BM7A 3OJUA 3I0SB 3BSOA 2MB0B 2KN4A 2DPJA 1C0TA 1EI1A 3SYZA 2QMXA 3PX4A 2HKEA 4U7CA 2AYGA 1PAEX 5LT5A 1JLQA 1RREA 5GADU 2LKZA 2OTJS 2DD8S 3T9NA 4URQU 2EFQA 1FFWB 4D3HA 5EX0A 3T3FA 2M9KA 2YNHB 2FVCA 3J81Q 2AD9A 4CT8A 1FF2A 2WVCA 4WZQA 2ZM6J 1N33I 2XY7A 1P8GA 2DEIA 4PCQA 5K8OA 5B0CA 3OL8A 3M4XA 2PI5A 4PRVA 3MEGA 4GKKE 2LDYA 2BE9B 4WUCA 3HHDA 1XMQE 4RJVA 4MKAA 3PIOQ 3IO1A 4J9UE 1NNDA 1T0TV 1RT3A 4U8YA 3MMCB 1HNZJ 4KHPJ 1X7VA 4K0KI 1JLGB 1Y6ZA 5HLFA 1RT5A 5F8GA 4F50A 5K14A 5BYSA 5ETPA 1WKLA 5HMYA 4FS2A 4AT1B 5K8PA 4KHPE 4DR2I 4MTPA 1KN6A 4LF5J 4I2PB 4HDGA 2HEKA 3EMTA 1RP5A 5H9EK 4LCHA 4ZS6A 1F0XA 2HFUA 3DXBA 5DRQA 2B9WA 3MM7B 5KFWA 3KLHA 1M5HA 2BE7D 4RO0A 4Y28C 4DV7I 3LOUA 2QC3A 3N5FA 2CQ2A 4Y2KA 2K2PA 3RB6A 2ZOFA 2CPYA 1T3NA 4OX9F 4B3RF 4ISAA 2M2BA 2VPZB 2R7UA 5DRRA 4NCAA 1QE1B 1JLBB 1YG0A 3KJNB 2AEFA 1RAJA 4YOEA 2HNYB 1ELOA 4Q7AA 3I5CA 3TAMA 2XMMA 3CWVA 4ZVEA 3ILOA 3W60A 1IBLI 4NCGB 1SQGA 4YUDA 4XPEA 1FTCA 1T11A 1XEZA 3B78A 2MJUA 1BXNA 3GJSB 5LXRA 1Q8IA 5KG3A 4A8SA 2K7KA 3H25A 1I5OB 3G8SA 1RKIA 3T1YE 1SB6A 2DCUB 3MM5A 1VCTA 4OZ0A 1LK7A 2VFUA 1S6PA 4E2FB 2MZJA 3T5KA 3EZOA 2G1DA 1Y5NB 2XLIA 2WRMA 3CSKA 4LQ9A 3DRPB 4I1TA 5CH7B 4QIVA 1LW2A 2DO0A 3BV8A 4KC5A 6AT1B 2ZE2A 4NRTA 2VG7A 4DSIA 2W2MP 3AY0A 1XMOJ 2JEAB 1KQGB 5LSLA 1RAIB 4JI4F 3OVBA 4M5LA 2V4RA 4C0OC 2B3TB 4URSA 3FFIB 1XMOE 1RTZA 3GJQB 2FDNA 4AD6A 2KM8C 1N5VA 3R5CA 4JYAF 4DV5J 4J9PA 4KO0A 2IYIA 3JTNA 2V4JB 2KDOA 3M8WA 4WYWA 3R5GA 1LEOA 4ZVTB 1R0AB 4RNHA 4CYUB 1VMBA 2DKOB 4OHVA 1LFPA 1X4HA 3CC7S 4UOHA 4EK2A 1CBKA 2L08A 2R2RA 3EM1A 2UUBI 3FVYA 4NCBA 2Z57B 5KOWA 1WDTA 4NEYA 2RJZA 1T3OA 4EMDA 1IKYA 2XHCA 3D4JA 4J7CA 3WHIA 3MMAB 3ZTOA 1NSAA 2QFJA 3PX6A 2E5GA 4B9MA 4NXNE 1QM9A 2A2CA 4ED5A 3DLGA 4DZDA 2I5JA 2V50A 3QQCD 3W7BA 3ONQA 4ED0A 4DR3I 3K2YA 2M4MA 3NP5A 4QR0A 3J7YU 1LWCA 3QRQA 2IRYA 4XAKA 2D3ZA 1HBUA 4OZ5A 2JLFA 4X66I 4K7QA 2H1YA 3HJVA 3HSGA 1WHXA 3N28A 4NMLA 2VPWB 5E0OA 2FVSA 3ILJA 4JI0E 1NHUA 1YX2A 3MXHP 2PE8A 1HWIA 3H1CA 4ZCIA 4F36A 1KDNA 4OZ3A 2FJWA 1EQMA 2F8EX 2MXYA 3OUYA 3CJRA 4N77A 2IMWP 4RNOA 4QW8A 3EPGA 1R8HA 2XSFA 2DTJA 5G4DA 2KTQA 4IO9Q 2YNIB 1HNVB 3IRXB 4WZMA 3AD7C 2JDJA 3RR8A 1VIOA 3CTRA 5I3UA 1TL7A 4PU9A 3HXMA 2OPRB 4K50A 1CULB 4LRBA 1G1XA 1PAUB 2OPQB 5ETTA 4UUXA 2QYCA 2HHHF 2PO1A 1FESA 3OT9A 5F8JA 3M2UA 1OYDA 4LSLB 4RLEA 2OD6A 2QO3A 2DCLA 4DR5F 1PJ6A 1OY6A 3HF5A 3B54A 1S16A 3TAQA 1PG5B 3P3CA 4M94A 4DPUA 2L3MA 2UUTA 4USHA 4OHZA 5E2QA 5BR8F 3EJMA 2CJAA 1IR2A 1MWQA 4DV3I 1UJ6A 3H0PA 3IFEA 4L3KA 2K06A 3KHRA 2D9OA 4JV0A 1YRUA 2MSSA 4KT0C 4N5SA 3RAXA 4TY8B 3JTOA 2YWEA 1UFLA 1XNRF 4PWDB 1B3TA 4U67Q 1YBUA 3KUGA 2JZ5A 7FDRA 4I2QA 1KVKA 1MROB 1X5OA 3E3XA 4QWDA 3KLGA 4FWDA 1U1KA 4NZ7A 1XTZA 2HBZB 2VIHA 2BJEA 2UV8G 4W98A 5J2NA 1PKPA 2MQ8A 1GMWA 1WHYA 1T03B 1N5TA 2FHKA 1BUXA 4B3TI 2A6OA 2QLJB 2HRUA 3RZAA 2HS4A 4OX7A 4CM2A 2J0QD 1VS3A 5KT7A 1GH8A 1NHVA 3IR6B 4U95A 2ERRA 3NMRA 3A12A 3PZPA 5AE3A 1C1CA 4JI1F 4DR6I 5J2MB 5KT3A 5GAGU 4MU1A 1X5SA 4ZIVA 4WK1A 2QL9B 5ELWA 4I68A 2P8IA 5I3PA 1RCXB 3S01A 2J9DE 2E44A 3DLLQ 2V9KA 4LBHA 4DSJA 4K5RA 3IG1B 3NWGA 5EWGA 3RB0A 2PMWA 3N6NA 2WOMA 3PR5B 3ETOA 3OXGA 3C8YA 4EZ9A 3OTOI 4F02A 4WU3A 3M85G 2X1GA 3FSYA 2W9BB 1JIHA 5HK4A 1HI8A 5JUMA 2OPSB 3C2PA 1VISA 2JEBB 2DNKA 2UUAJ 1TL3B 1M0SA 1ZM9A 5CZXA 1ICEB 3ENVA 1HPZA 2Z2LA 4UT4A 5J2QB 4LF8E 4PXBA 2N4CA 3TEHB 2O01C 1I94E 1VK3A 3T9ZA 3T1HJ 1SC4B 4RUBA 2VQFI 4PUOB 4PWWA 1JQGA 3NS6A 3JQJA 2HQ3A 1U8WA 4IO1A 3G86A 1QSSA 2IOPA 3GYGA 3T5LA 3I0SA 2PGCA 2CVIA 2JC1A 4F2SA 3R7NB 5KT5A 2CPIA 3HHKA 4ECWA 4HI1A 3QJJA 4ETXA 1RHUB 4ZVFA 1I51B 4QWBA 3PW7A 2LEPA 1RABB 2YNHA 2QLXA 1U6BA 4OZEA 4B3SI 3MTKA 5HVGA 1QTMA 3RR7A 1RWNB 2ZUGA 3HMJG 3SCKE 3EX7B 2KYXA 4JI6E 1X5PA 2B7CB 4BDPA 2MLXA 1MWZA 4U6PA 4ELVA 1UVIA 3L7ZB 4ZPVR 2CPHA 2ZBKB 1HNIA 5DO2A 2OD4A 2UXDJ 2MJNA 4CT9A 5B0BA 4NX9A 2QL5B 1JLGA 4O4GB 7AT1B 3P06A 1M90T 2VFTA 4MH8A 2EWHA 4RUCA 5HBMB 2RNEA 1J5EI 4A48A 4I2PA 3OSPA 2VUGA 2XNQA 3TUPA 2EKYA 3UD4P 3MM7A 4KGMA 2UUCI 5F3ZA 2LFVA 4PAAA 4CLYA 2ASLA 5LXYA 4MIBA 4HDHA 2GO8A 4J9SA 4DUYI 4NYPA 3SV4A 4F26A 1QE1A 4J37A 4DWIA 1JLBA 2LQ8A 2ZVSA 2HNYA 3TZXA 3H4BA 3R5BA 2KXNB 4F4AA 2AT1B 4DUZI 1RI7A 4NCGA 5L8RC 2VA3A 3RJMB 1UVJA 4IOAQ 2LECA 4DV4F 3ILLA 5LMUF 5KT2A 4KKOB 3QGGA 3DKDA 4QU7A 1IBMF 4QOTA 2V69A 4LF9I 1X4FA 2XWYA 2RRAA 2ZBRA 2F65A 4ALZA 1UDOA 1N32E 2BV3A 3A3OB 3DRPA 3FQLA 3C3LA 2IA6A 3CWJA 3D6HB 5H1SV 3K8VA 5KG1A 2HGMA 3KKFA 1HNXF 1ZOTA 2JOQA 2XGPA 2HHSA 2JEAA 2H48B 3GB0A 4L76A 1UETA 1TL1B 2DGVA 2F4VI 1TAQA 2FLPA 2HWTA 2ZUAA 2Y1LB 2CQ3A 3FFIA 2WB4A 4NLPA 4RWXA 3CCSS 1VOMA 2XMKA 2HQCA 4BBYA 5CXTA 2DT9A 4LF4J 2NXUA 4MK9A 4OX9J 4B3RJ 5C0XB 1RQ0A 2V4JA 3TZZA 2N7YA 2E9ZA 1R0AA 4TLRA 1FJGI 3RBEA 4DEZA 4CYUA 2FC9A 3CD7A 3D1HA 3MFHA 4OX9E 2HBRB 6FDRA 1U1OA 4IR1A 1X9MA 2WNRB 1VQ6S 4GKJF 4LF7F 1RBOB 4LR7A 3BYPA 4RL1A 2JX2A 3MMAA 4V19J 1N56A 1NJWA 2ZHBA 4NPOA 4OYZA 4H4MB 4LFAE 2VOOA 2P2CB 5D0EA 2E1CA 4X65I 1Y5YA 4P6QA 2HQDA 3NL0A 4OLOA 3ZZYA 4BCAA 3CC2S 3W62A 1YKWA 3VQTA 4LFCI 3HVWA 3OFHA 1RBLA 1U24A 3GQCA 3U1KA 2VV5A 3H59A 1H38A 3B6BA 2KG0A 4QZVB 4I67A 1JJ2R 3ZTRA 1O5JA 2LQ9A 4X84A 3TVZA 4JI4J 3OTEA 2YVSA 4IFDB 1XR6A 2ZWOA 4NA1A 2PEHA 3PXGa 3R1LA 1OJ4A 1WSRA 2YNIA 3SBMA 1F5CA 1NAQA 4O3PA 1HNVA 3IRXA 2HG4A 4JI7F 1IUJA 4ECTA 4JYAE 3MM9A 2OPRA 1CULA 1N36F 4PEOA 3LGNA 3DU5A 2IDLA 2OPQA 3LAMA 1KVIA 4YP3A 2FY1A 2DHHA 3FGVA 4YHHI 3K57A 4A4JA 4UQGA 5A6PA 2VHGA 1S9GB 2ZM6I 4DOZA 1TL4A 4QQBA 4IRKA 2RT3A 3JAMY 3H5YA 5KT6A 1JB0C 1EA6A 2PT0A 1HNZI 2N3OA 4NLOA 3AD8C 4FPRA 2QFIA 4USUA 1RWUA 1VHIA 3PW5A 4B08A 3W8PA 1NK7A 3HLUA 4DPOA 2DGTA 1FEHA 4YN3B 4TY8A 2KHCA 4USMA 2JEIA 3CDUA 4K0KF 2CZ9A 4U3DA 2DH7A 1HNWE 4PWDA 4DR4E 1M5VC 1NKBA 2M88A 2WW4A 4RX6A 1XNQI 2QTWA 1PJ7A 3KOAA 1GX6A 3TWZA 4DR2F 3Q8RB 1MROA 4ZVHA 3BGLA 4O3RA 3ZZUA 2BKPA 2OJ3A 1XR5A 2ZC3A 1TK5A 1NPKA 4ZPDA 1MSWD 5KFLA 3JQMA 3GZ7A 3QWUA 3D0GE 3F44A 3NGTA 1T03A 5C0XE 3VALA 5KFNA 4DV7F 5F9NA 4AQYE 3NS7B 1RAGB 2P5VA 3DOMB 4P73A 1ZZNA 2HHHJ 3TAPA 3UE2A 1HMVB 1P1TA 1SJRA 3G96A 2KU7A 3OFGA 2I38A 5J2MA 3U1MA 2J65A 2E1MC 4DR5J 1NXIA 4ILMA 3ZM7A 9RUBA 2EC2A 5CZVA 2AZ1A 1KTVA 3MM8B 1IBLF 5BR8J 2Z2ZA 1QY7A 1GXLA 2LDIA 4EI2A 3CDJA 4M5MA 4X4RA 4OZJA 3MGJA 3A13A 1JLAB 4M5KA 5THWA 5DGBA 4JI5I 1DHMA 3Q8PB 5K5MA 5H9FJ 2UVUA 2BQUA 1VBKA 4AL5A 1XNRJ 2OPSA 2JEBA 2HYIB 1TL3A 5L46A 4YY3E 3LWMA 1T9UA 2DNGA 4N3OA 3A8EA 2DITA 4LF6F 4DL2A 2P6TA 4PUOA 3SCLE 3GIKA 2BR2B 3D6FB 2EPIA 4OV1A 4W90B 3EZ5A 1IXKA 1UW9A 2HVHA 1RAHB 4RU9A 3AD9C 2GQQA 4N8OA 1B0PA 3BR9A 2A6MA 1VQSA 4ID8A 4JI1J 4WP8A 2B6AB 4KGKA 3H2VE 4JI8E 3DRYA 2UUBF 2AGQA 2JT2A 5EX3A 2O1VA 4QYZK 4FKYA 1MWYA 3H4LA 2LQ5A 4HTJA 1WC3A 4EO6A 3KXDA 2BA1G 4WCEQ 3DMJB 2H5IB 3L7ZA 2KRBA 4A47A 5HVFA 4ZLNA 2BBEA 1IR0A 4IR9A 2BYCA 1KLMB 4O4GA 5JEAE 3ZXWA 4BWJA 4KH1B 1RHJB 3PVXA 4MYTA 3PFEA 5HBMA 2UZAA 3FDSA 1XMBA 3AOCA 1KBRA 2B9EA 3CO0P 2VDIA 4X66F 2J8AA 4R0EA 4RNNA 4AIMA 2WBMA 3FZBA 4L72B 1FI4A 2OLWA 4F4ZA 4DR7I 3P5TL 3AT1B 2C2DA 1K1QA 3C19A 1M5KC 4C8KA 3VF0B 3GV5B 4FYWB 3BGOP 2BE2B 1FEEA 3N79A 2ZD1B 1FX4A 1F5AA 3RG6A 4M5DB 1PGZA 1RHQB 4DV0F 4Y2AA 4L75A 1ROFA 3EDRB 2VBXA 4B3MI 1ZM3A 1T95A 2RU3A 5FLXQ 4MIAA 2Y8YA 3PYEA 4AYBD 1H0HB 2G9OA 5IV4A 1RKJA 1S4EA 2W4PA 3CCES 1FE0A 4KKOA 4JB8B 5F3TA 3A8JA 2DGWA 4ZN1A 4C7QA 3KTQA 4C8MA 4TU7A 2PIIA 3ZTSA 3BGFA 5D4LA 4PG6A 3P3DA 5DS7A 3W63A 3RTVA 4LFBI 2DRAA 3MD3A 4KTQA 4DV3F 4U96A 2XC9A 2RMLA 3R9LA 2NN6B 3ZFVA 2HKJA 4DFPA 2R2UA 3GPAA 1F9HA 2R8HA 1EP4B 2DHXA 3MR5A 1Y4UA 5AT1B 1TL1A 2YTCA 3EPIA 5M2RA 4P10A 2NSCA 2CAJA 4R8UB 3T1AA 2QL7B 2QA4G 4FW9A 4TYAA 4M5JA 1MG7A 3CCUS 2VG6B 3CJKB 2OFGX 2X7IA 3TZWA 5C0XA 1HQUB 2HHWA 4PXEA 3PW4A 3G71S 2D3UA 3TA0A 3H7HB 3G2XA 3PG9A 3LQVA 1NB7A 3OV7A 4TN2A 2GHPA 2WNRA 4B3TF 3R7BB 3MPVA 3ENWA 3CMQA 2OMLA 3WU6A 3P3GA 3FZ2A 2CQCA 4IFDF 4DV4J 4DR6F 2C3PA 2GV1A 4QJVA 4YMEA 4NLXA 4H4MA 2XNRA 2XS7A 3RRKA 1M5OC 2UXBI 2WB1D 2BACA 2GMJA 1IBMJ 5LMUE 4C48A 4X64E 1MMDA 4HKQA 2BM0A 3PRBA 5DG7A 4M5GA 4BC9A 3MEDB 1V9OA 2AEJA 4Q8FA 5EWEA 1NSKL 1HNXJ 3K5MA 1U47A 4G1QB 4OYPA 2XM3A 2LXUA 3DLHA 3OTOF 1BLUA 5IXUA 2XWXA 4PQUA 2FHJD 4DR1E 3Q0AA 1WTFA 2Z2YB 1S0OA 2Y9HA 1J2VA 1HNXE 2RF2B 4XK8C 2DPIA 3PS2A 3H5UA 3EYZA 3MCMA 2APOA 2H5EA 3SSSA 2DRBA 1TAUA 2MZTA 2MQMA 1HQEB 3IA0A 1DFDA 1UMJA 1S1UB 1SCJB 2KB2A 3PEJA 2VQFF 1HHSA 3OR1B 3DM2B 2CPZA 4HY1A 4C2MA 1VLYA 2W4CA 2Q6BA 4RR5A 4EYIB 2LU1A 3E01B 1Q86T 4GKJJ 1H7XA 3LPSA 3NRBA 4LF7J 1S72S 5M2UA 2WBRA 4ES3A 1C4CA 1KOHA 1S9GA 1Q82T 5HSPA 4X4VA 4X4UA 3I4PA 3NNHA 4RZRA 4EO8A 5KFEA 5IT9Y 2UU9E 3CMES 3FMBA 3FSIA 2F9DA 1W2BR 5CYMB 2RE1A 5ETQA 3HJCA 3ENQA 2YQ3A 4YEAA 4ECZA 1BHNA 2RS2A 3B4DA 5LMNE 5B0FA 1CJVA 3RU0A 4QR2A 1YJUA 5KFFA 4ZPBA 3HVTB 4U7UD 1S6OA 1S5ZA 4F4XA 2NN6E 1G2EA 4E8UA 4MMOA 3KLEB 1AXQA 5EHHA 4A8FA 2W2QP 2PNZB 5DRPA 3KLVA 1H74A 2VFRA 1J5EF 1X4DA 5IT0A 4YB1P 1FRIA 4Z2XA 2CQDA 4Q43A 3R5JB 4X62E 2MDAA 1S49A 2WVEA 3DCAA 5U47A 2UUCF 3NY0A 3N0VA 4JI7J 3MF5A 2H3EB 4U3BA 4LRAA 1KIJA 4WUBA 1B0VA 1Y00A 1PKUA 2CWKA 1N36J 5ETLA 3RAQA 1NM2A 3DOMA 4FVCA 4DV6E 4DUYF 1HMVA 1NKEA 1X60A 2LJPA 2CNLB 3R8YA 1SXLA 2V2VA 4AUKA 2FPHX 5KFAA 4DUZF 2CJXB 3MM8A 1S57A 2CNOB 2V2QA 5L1IA 1FDBA 4FZVA 3E51A 1WORA 3HPOA 1NZAA 3GCXP 3Q1QA 1PC4A 1UVLA 1JLAA 1VRTB 1N33E 1IBKI 1H3DA 1UEVA 4DV2I 4LF9F 3QWPA 3OD2A 4K0KJ 1D8YA 4ECQA 1TTHB 2AYMA 2VJVA 2HHQA 3D54A 1ITPA 3ZKDA 4BLGA 2CQPA 2OSRA 4GO5X 3BPSP 4DR2J 3I9V9 3ENAA 3IMQJ 4B17A 4LF4I 1TKTB 4OZLA 1KQSR 1HWUA 5KFBA 3O5TB 5K8NA 2W25A 3PJ9A 2BW7A 4DR2E 2F4VF 2BR2A 1Q1KA 5L1KA 2NPFA 4OYWA 3SI8A 2YX4A 4Y00A 4L6V3 4Y6IA 3GU0A 4ZPAA 1ZTWA 4TU8A 4DV7J 1N34I 1KKHA 4OL8A 3WQPA 1VRQC 1AW0A 3VZIA 1FJ7A 1DAXA 4DSFA 4IUFA 4JI3E 3DOLB 1FJGF 5HQ8A 3G8QA 2XGQA 1FERA 2G4BA 1BY9A 2B6AA 1GNKA 3W66A 3CB4A 4DV1F 1ZAWA 2CXEA 4CO2A 4C97A 1HR0I 1TZ0A 3W64A 1IBLJ 4IYQA 4J9MA 4C8LA 1QUVA 2YH0A 2UXCE 4GMKA 3CT9A 2QRRA 1Q0NA 2C22A 3J7ZT 1XC9A 5F8LA 1NPPA 3HFZB 1KQKA 4CP5A 4HHHA 5L38A 2J7KA 3DMJA 5HP1B 1F1BB 1V3SA 2F4FA 3D68A 3QJLA 3W9IA 4H4KA 1HI0P 5KFGA 4X65F 4FF1A 1VQYA 3KDOA 3CJ3A 1Z4UA 3W2WB 1KLMA 2HAFA 1XIQA 4MU3A 4RW7B 2VL1A 1DLOB 1HHQA 4JI4I 4LFCF 2V67A 3M1VB 3C46A 4HHJA 2R7TA 1NDCA 4C8OA 1ACMB 3GG1A 1B4SA 2A2DA 3CCVS 1Z2LA 5HO4A 2GO9A 5IWAI 3KLIB 2CRLA 2Q79A 1RUSA 1TMMA 1Z0VA 3KUEA 3HHEA 2HS0A 4LF6J 3GWCA 1IWAA 3R3TA 5MAOA 1FJCA 5FIIA 3C6UB 1RT1B 2BE2A 4IG0B 2ZD1A 3DGVA 1UA0A 5KFZA 4JV5E 2VFVA 1ZM2A 2JFDA 3B8HA 3W3SA 2GZOA 5ETVA 4DSLA 1WF1A 4DXLA 4R25A 2ZVIA 4M5DA 4GVLA 4P7TA 3HO1A 2PEBA 1BKNA 3KWMA 4MFBB 3KNAA 2GO3A 2H4WB 2VESA 4OJGA 4USIA 3Q8QB 2GX8A 3TVYA 4I6WA 4CTAB 4UOGA 2UUBJ 3WZ0A 3I56S 1Q95G 3NGKA 4YHHF 2R7XA 4TVAB 4DSEA 4RU2A 3IBCB 2YH1A 5B0DA 4IKAA 3PIPQ 4NYOA 4OX8A 4OYMA 5ETMA 2MY7A 4DF4A 2M8HA 4PR6A 3DLBA 4YR3A 1RR9A 1NK4A 3NGRA 3K5LA 2C37B 3P8BB 2JLEA 1HNZF 3TQ1A 1TP7A 1F9EB 3J80Q 3PRDA 2XMTA 4K2XA 3MPDA 5DG9A 1BQXA 3DLKB 4PQAA 4DR3E 2NN6A 1CS4A 1KOOA 2CPEA 1KP6A 4CLPA 4MQYA 1O8BA 2IM3A 3UNGC 4WWSA 4X66J 1EP4A 1D09B 4OYAA 1KSPA 5DJBA 4NLYA 5JMNA 3HHNB 4NXME 1URRA 3RRGA 2NQPA 2AE8A 2QEXS 4R8UA 1XNQF 1XMQI 2IBKA 2VG6A 3CJKA 1T7PA 2WW8A 2G2YA 3BREA 1CSJA 1HQUA 1S6UA 2ZKUA 3A1YG 1RHKB 1LXNA 3NLCA 3CJQA 1B63A 1QSYA 3JXOA 3W5ZA 2BJ7A 2W2PP 2W4DA 4ZPWR 5D0RA 4DV0J 2ZNZA 1SV5B 1FDNA 1TKXB 4A8YA 4CLZA 3QO9B 3NCQA 3GSDA 2CZ4A 1RGVA 1SQFA 1U09A 4WU2A 2AZ3A 2YX7A 4LR9A 4HEA9 1DQ8A 5BR8I 3R97A 4WKRA 2DRDA 3HSJA 4P75A 5HJXA 1UVMA 4IH7A 2AJFE 1KLNA 2MZQA 3TA1A 3S6EA 4FF4A 2E5LJ 4W4MA 3D67A 3M6AA 1IQZA 2FVRA 4HHUA 3SSRA 3GE9A 1TKDA 1FXRA 2P6SA 1OYPA 1RTHB 3UDEA 4ZP8A 4ZDNA 2COLA 2BXJA 2D3O1 1BE4A 3MEDA 4XPCA 4DV3J 5KFKA 2MGZA 5JVHQ 2NCKL 3CIMA 3UCZP 4G1QA 1IQTA 4K59A 4JI5F 3NG8A 5GMDA 2UUWA 3LAKA 1R8CA 4USVA 1D1UA 1SQEA 4F4KA 2J6SA 1FK9B 1RZMA 2RF2A 1X4BA 3UN3A 1ZA2B 1SC3B 3P3EA 3T1YI 3KMQA 3DI6B 5ETKA 4ZP9A 1R3NA 3U1LA 1P6TA 4H4OA 1HQEA 1ZXMA 5DZ6A 2OMOA 4RW8B 2BEFA 1S1UA 3K1JA 2IHR1 3V2UC 1TFWA 3OR1A 4HT7A 2MQLA 3DM2A 2M8DB 2DHGA 3NZKA 2QA2A 2RVJA 3IP0A 1R89A 1JLCA 3E01A 1QD1A 4B3TJ 2FZGB 2K3KA 1X0PA 1LWFB 4OYIA 5F9LA 1PJ5A 2BQ3A 3VTIA 4KGXB 2WVFA 2O1TA 4ENOA 5ITHA 4X2BA 4EEYA 4DR6J 3WU3A 2ZZNA 1V3ZA 2CNKB 2V8VA 3ISZA 3G4SS 2A10A 3KFWX 2R8GA 4JI2F 3EZUA 5DRKA 3UHMA 3KUHA 3IS9B 2XMAA 1UA1A 2OIHA 1TUVA 1S6PB 3T19A 1R8PA 5LM7E 4HT5A 2PFDA 4GC7A 5ADZA 3JSBA 1U1MA 3M2VB 3HVTA 1HWLA 2XYHB 2VBZA 4ZOSA 3HD2A 3K59A 2JSXA 2XCPA 3OTOJ 3W5XA 2DJWA 2ZE2B 1N6QB 2DR9A 3KLEA 5EDWA 4IFDC 2BABA 2L9DA 3M30B 2PNZA 3LWLA 2JNJA 4F7VA 2L9NA 4B02A 1IKWB 1AB8A 1RU2A 4O3SA 2PO2B 5C42B 2PMZD 4Q45A 2N4DA 1SJFA 1H73A 1SL1A 5D78A 2JC0A 4DG1B 4DR7F 4CLLA 3PV8A 2N82B 2VQFJ 4OYXA 4QBUA 3AQOA 4PYAA 3O3LA 4Y2CA 3BSAA 4B9UA 4GC6A 4CCHA 1WOSA 2K3IA 4C9DA 4USKA 4MKBA 1FKPB 3FEXB 2V63A 4JI0I 4NLWA 2VQFE 2XQCA 3A8IA 3AB2B 1O51A 4OO1B 4WIIA 4LQ3A 1RXOB 4RBTA 5A76A 3HT0A 3TNVA 2AJ2A 4B3MF 1HARA 3NGSA 3UW1A 5K36B 2I5JB 1NDKA 3GILA 3BQ1A 3CC4S 2OP5A 3CO9A 1BQNB 1Q8LA 4NI2B 1L3VA 2D1CA 3PKMA 2VPXB 4B3SE 1VRTA 2Y0BB 5F41A 2LYVA 1N5SA 2H5JB 3G87A 1NJZA 3I96A 5HANA 4LFBF 2R8KA 1PYSB 1TU0B 1WKJA 1S0VA 5KFQA 1U1QA 4FNIA 3FBFA 3TZYA 3M32B 2V8PA 1FWLA 3BJYA 4P52A 1J5EJ 1HKAA 1X0FA 3OPKA 4OHWA 1N54B 1TKTA 4K4TA 2UVRA 2UVVA 1GEHA 3H20A 1B7FA 1FWKA 1N4LA 2UUCJ 4ZLJA 1QZRA 1ZM4A 1IVZA 2MEWA 1U1PA 2XY6A 1USUA 2EEYA 2XS5A 1U1NA 2J7WA 4DUYJ 2M70A 2RH3A 1KNZA 3DOLA 3WBZA 2V8HA 5GAEI 4LR8A 1U6FA 3CJSA 1K47A 1F2HA 2B4UA 3KG1A 4KGVB 3MPWA 4F4WA 2L48A 1U4BA 4ZPTR 4DUZJ 1J5OB 3MFIA 3MR6A 2FHOB 4ITSA 4O3OA 4YDDB 2I1RA 2GMHA 2ZDOA 2N3LA 4RNMA 5HP1A 1FJEB 1AROP 3R6LB 3CCQS 2UXBF 5KFTA 5LSOA 1L3TA 1G3OA 3W2WA 1L3SA 3BKUA 4ZCMA 4RW7A 4Q0BB 5A8KB 1Q8KA 4LF9J 3JYTB 1QVFR 1DLOA 1S1WB 2GS8A 1AA1B 4OZ2A 3M1VA 5DQGA 2VOPA 1P42A 3KHGA 3ZTQA 2X51A 5BYRA 1YQHA 3KLIA 2R42A 4WTOB 2GHWA 3DGPB 4IDKB 2NXJA 2F4VJ 5L1JA 1S76D 2PC6A 4ELUA 4MKVA 5HL7Q 4P9SA 3C6UA 1GX5A 4IG0A 4Y3CA 4OI3A 4ZMMA 2QV6A 2D7SA 3M8YA 1YTYA 2OKQA 2BOPA 1H7UA 4Z7YA 1FJGJ 1EB0A 1H2VZ 2BA9A 2ZEJA 2DNQA 4J9KA 3S1TA 1NHJA 4MFBA 2XMVA 4DPXA 2AV5A 2B0GA 4Z7CA 4CTAA 4LF8I 4E0DA 4DV1J 5K9FA 1I94I 3BBBA 4AM3A 1BD6A 1NBEB 2IOQA 1KHVA 1VRUB 2FUG9 3F56A 2ZC4A 1S12A 2Y1RI 4ZVGA 3M9OB 3D0IE 5LL6d 5T7LB 4Q8EA 8ATCB 2C37A 1XN9A 2RDJA 3UCUP 1GQEA 1JKHB 2KJWA 2C2OB 3ZZOA 3O6QA 1AFIA 2KM8B 1MMNA 3DLKA 4WXWA 1D6TA 3J80Y 3OLAA 1N8RT 4LFCJ 4X65E 2E7XA 3RBZA 3QIPB 1RAFB 1UAWA 3D6TB 1Z0GA 4O23A 3V4MA 4N47A 3LF0A 2JFKA 1PYTA 4CLTA 2W01A 3ILIA 1NDPA 4JI6I 3ZZTA 1KWMA 2DH9A 5IS2A 1U0HB 1RLCL 2HFZA 3GIRA 5J1EB 4LSZB 1KD1T 2BJ1A 4CH7A 1N36I 3FBCA 3S7RA 4DX8H 3GJTB 4KE5A 3DHWC 4WBFA 3ITHA 1WUUA 1D0EA 1EIYB 1SV5A 1TKXA 3C66A 3QO9A 4ID5B 2E7VA 2YKAA 1TFYA 2CA9A 4KHMA 3P5BP 1TVRB 2G1HA 2YQ1A 4YHHJ 4IS9A 3CD6S 1UZHA 4WFXA 4ECXA 2HHUA 1YK9A 1QSLA 5DQHA 2ZM6E 1RTHA 1SH2A 1RWXB 1S1VB 1HNIB 1R31A 2A1BA 2J5AA 4RNFA 2XHWA 3CCZA 1Y5IB 4NA3A 2NUHA 1NZ0A 5C2GA 1U2RA 2FLLA 1SVDA 1HNZE 1JJCB 3N9UC 2JH3A 1IBKF 5E3RA 4ZP7A 4DL7A 4DV2F 2LQBA 5IC4B 4M1KA 4I3HA 3VGSA 1YHCA 1I3OB 2YWWA 1FK9A 4MAKA 4DU8A 2HVEA 1WG4A 2DYAA 3OVSA 5KFCA 4LF5E 1XNQJ 5IT9C 2O1WA 5A2QY 3DI6A 2XG8A 4HACB 3W65A 2IM0A 4QIWD 2Y0SD 2NPIA 4FXVA 4P2MA 4LF4F 2CDRB 3KRNA 5DDQC 1N32I 4RW8A 1M1KT 1NJYA 4ERDA 1YZ7A 2GHVC 4UZBA 3EGVA 4MK7A 1N34F 2KG1A 4ECSA 2AKWB 3VVTA 1ZETA 4QIGA 1SKSA 1LWFA 4IQMA 5F0WA 5B09A 5IT9U 3SQGB 2QSFA 2YPYA 2ILYA 4EWTA 3K7RA 4ER8A 4K4YA 1HR0F 4PXDA 2FJEB 3GIIA 1RJJA 3IS9A 3L4BC 3NS5A 1JWWA 2Z5CB 2R7QA 2H9ZA 2ZH9A 3KHHA 2X1FA 1BMQB 1T02A 2JVRA 3M2VA 2BZ2A 2DO4A 2XB2D 3TYTA 4JI5J 4OI4A 1N6QA 2LMIA 1VQPS 3M30A 1VQ4S 2B4PA 1WHWA 4PYDA 1SJ1A 1WTBA 4LREA 4LF6I 2YNGB 1IKWA 4M5HA 3DLEB 2NXNA 4LFAI 4OO1F 5AXKA 3UVJB 1SL0A 1O0PA 2XCAA 4ZVPB 2PO2A 5C42A 2B5JB 1KEKA 2XSJB 5IWAF 2IJFA 4J5OA 5K36F 1WACA 4DG1A 4IFDD 3UNYA 3KK3B 1FKAF 2V94A 1UFKA 1DTTA 1P9QC 2I6WA 1SPBP 4FYDA 3GR1A 1RB0A 2M5YA 4DV5E 1FKPA 1C1BB 5L1LA 2AYEA 2X1BA 2JL9A 1RHRB 5ETOA 2HWIA 2YNFB 1R6LA 2J0SD 3DDIA 1TR0A 5KG6A 2POKA 4OO1A 4UY8T 1IKXA 4TNOA 3LO3A 5C25B 4CIOA 1K9MT 3CDAA 4ECYA 3GG0A 5K36A 1DJ0A 2GAHC 4JI2J 3MECB 3AQPA 2HWHA 5DDRC 2W9AA 4IZJD 3BBFA 4YQWA 1BQNA 3AODA 3DDKA 4NI2A 4X4NA 2ZH1A 2JVOA 1NHKL 1B99A 2MYFA 3EVMA 2D74B 2DNZA 1NU4A 3U1YA 2FJBB 3T6JA 1TK0A 4G1PA 1S6QB 1UW4A 4KH0B 5DG8A 1W7WA 4DU7A 3THVA 3CJ4A 4S0MA 2J7UA 3M32A 1U1LA 1RWMB 2RRBA 5KG7A 4YB5A 3UPFA 2IFXA 5AJ3F 4HH1A 4QWEA 1QUPA 4U7UK 4DR7J 1LWEB 4XDDA 2KFNA 2QLWA 4GKKF 3UI3A 2E1AA 3QNWB 1XMQF 2C39B 4DV0I 3MM9B 1H72C 1DARA 2C42A 5C24B 3GLJA 2BKOA 2EFGA 3OHBA 4ZVOB 4IH6A 2WTFA 1HNWI 4J90A 4DR4I 2XBPA 4HL9A 2X3DA 4O4RA 4NWBA 3MUVP 1WSVA 3GMEA 3LW5C 2E5LI 4KB7A 1J5OA 4DFMA 4B3MJ 2WSEC 3H2UB 4J9RA 3M8RA 3N6MA 1YGYA 2OELA 1HQ2A 2O1PA 2F9JA 3VGTA 3KYLA 1YBTA 3T41A 1U1RA 2CPXA 4LF2A 1YH8A 3PJXA 2R3VA 3CJ5A 4Q0BA 5KTQA 5A8KA 2KFYA 3JYTA 2HNZB 4Q2MA 2IM1A 4LFBJ 4M95A 1S1WA 1M1HA 1EHWA 3NCRA 4XO0A 1T05B 3CCJS 2G13A 5FLXC 5DQIA 4I6YA 1VQ8S 1B0TA 2ZBPA 3DGPA 4IDKA 3KG0A 4DQSA 1H7WA 1X4EA 3OTCA 2KT2A 2AJ4A 5L9NA 5D4NA 5CYQB 4NMXA 3T1YF 5DM7Q 4KQZA 2DGQA 4NBQA 2KHDA 4G65A 1Z5BA 2FJAB 2X3GA 1R0BG 3PACA 1KFSA 4LVOP 4KBIA 3E8OA 2BA0G 2M7SA 5FLXU 1BQMB 1Q7LB 3K5PA 2G2ZA 2O3DA 1NEEA 2ZHAA 5I4MA 2BW2A 2ZJRQ 3PFOA 1FVSA 3H5XA 3QMQA 4I4BA 2XY5A 1DTQB 3BDEA 3P6YC 1VRUA 4ZVRB 4C0BA 2OH2A 1LKZA 2HLUA 3AXKA 2YWGA 3K5OA 5T14A 5T7LA 2UXBJ 2YKOA 1JKHA 3U02A 2GO4A 2PN6A 1JNRB 2NUUG 2CPDA 2NSBA 2HW3A 1SIZA 3RGIA 2BQRA 5H9FK 1U0SA 1NZ8A 4DBQA 3VAKA 3QIPA 4JI8I 3M85D 5FDLB 2KZMA 4N76A 2HFSA 3OXLA 2Z5EA 3ZZ0A 3I31A 4DS4A 3PW2A 2CQGA 4WP3A 4DQPA 2UUAE 1U0HA 3QT7A 1MMLA 3OBIA 1RWOB 3IC1A 3MR7A 5J1EA 2V9WA 1RT4B 5G0RB 1Y9OA 2KXHA 3T1HE 2HK3A 1X4CA 4ES2A 4EU0A 5EKWA 3MAAB 4WTYA 5CYJA 4X4QA 4PRXA 3GIJA 3QJPA 1RISA 4ID5A 3LGMA 2FZCB 2VBYA 3MOZA 4ZLPA 4JI0F 2VODA 1TVRA 4K4WA 3BO2A 3HDSA 3WIUA 4DCJB 1OWXA 2PNMA 3NOGA 2ZH6A 3J81Y 2HHTA 4IQXA 4DCPB 4C0HA 3WU5A 3OTBA 4HI2A 3A4TA 2DH8A 4BHQA 3H40A 1B64A 1U45A 2NZ4A 5AE1A 1S1VA 2QSWA 4PG7A 1DQAA 2AWZA 3JTPA 2R8JA 5ETSA 1YLXA 1U26A 1HHTP 5F8HA 2U2FA 1WOPA 2UXDE 2R7VA 5KFHA 1TUWA 2YBVA 1PBAA 4TXSA 2CWXA 4WFYA 2QZ8A 5GMKa 2EBGA 2HBYB 3DRRB 1NB2A 1YSJA 3M6XA 3VCDA 3CIZA 3LPYA 4HACA 4CDIA 4YR0A 2C2ZB 2MZSA 1N0UA 3PKYA 4YB7A 1KVJA 4ZVQB 1WKKA 4WFAQ 5HVHA 2LXFA 3MURP 3A8KA 2BOAA 4BS2A 4W92B 2BJ8A 5SUHA 5CD4A 1M5SA 4HR2A 2ZFHA 2KYZA 1RA6A 3C15B 5GAHI 1G7CB 2EFOA 3HI9A 1KONA 1Z0WA 1NLKL 3CULA 3SQGA 2W7OA 2EW9A 4BA2B 2W9CB 2WVDA 2Y1IA 1ZPVA 1H98A 2PO4A 1S0NA 4DX5A 2KJVA 3UFCX 3WX4A 2JEJA 4EBDA 3MEKA 1JLFB 3GMGA 2Z5CA 3HT3A 2PD1A 3MPUB 2IJRA 1TQLA 2HSEB 3AHPA 2ZBQA 4DHVA 1ZAVA 3VAGA 1NO8A 4OV6A 2PO0B 2Z2MA 4DI6A 3RRHA 2JRSA 4I69A 1IR1A 1Y4SA 3K58A 1SJ4P 1IBKJ 4LVNP 5D3GB 3PY8A 1V6HA 4DV2J 3P96A 1V5VA 2R2SA 3CCTA 2YNGA 3DLEA 3OJSA 3UVJA 1IBKE 3GYNA 4AFFA 3EICA 4LT6A 3JB9k 2B5JA 2RU9A 3U1NA 1XR7A 2IYGA 2XSJA 1H7SA 4X64I 1GTEA 3Q22A 3UN2A 2HHVA 3KK3A 3ZZPA 3QRPA 2HVZA 2Q1LA 3V6DB 2CQ4A 4PG5A 3ZZZA 4LF4E 5IFMA 2ZBIA 4B3RE 1N34J 1C1BA 4O0NA 2DK2A 4U9RA 4DR1I 2YKMB 3DRXA 2EFVA 4DV1I 2YNFA 1VBZA 4FNHA 1GMVA 4ANEA 2YWHA 3R5DA 1N34E 4KJIA 1E3PA 2ASDA 3J7Z5 5C25A 2KZZA 1EKSA 2KO1A 1UWAA 3QSIA 3R5AA 4LF8F 2DGUA 2JLGA 1I94F 2DNYA 3MECA 1HR0J 2J9DA 1JXLA 2KH9A 1APSA 2EXUA 1D8ZA 4ZVIA 1WG1A 4DPYA 3VHQA 1FKOB 2E5JA 3IR5B 2AP6A 1JMTA 4USJC 1TL5A 1S1XB 1USVA 5CCMA 5L39A 1S6QA 3DC2A 4RBVA 4YB6A 3PYDA 1CVJA 3G6ES 1QAJA 2WSCC 4MIWA 3FNNA 1KR4A 4PQUB 1Z59A 3UD5A 1AUDA 1K1SA 3WIVA 1RCOB 3FUYA 4A8OA 2A0FB 2MQNA 1WELA 2NLWA 2UU9I 2ILZA 3RBDA 5BYQA 1VC6A 4QNKA 1X5TA 3L09A 1T9XA 4JI4E 1FNOA 5IWAJ 3L95X 4R5PB 2IRUA 5AE2A 1NK0A 1LWEA 2NYIA 5LMNI 4JI6F 2ZH3A 2WSFC 3NWRA 3J7AG 3IGVA 2C39A 3FEYB 2IM2A 3DFEA 2QX0A 3FK4A 2OEMA 4NE9C 2OEJA 1FKAE 5C24A 1QTNB 4ZLLA 3QATA 1OY8A 1W2IA 2QT7A 2F40A 3D6MB 4OO1C 3QIDA 4TQRA 1S9FA 4OI6A 2KVIA 3DLJA 4KR0B 2W7AA 5KFMA 1YBAA 4F3QA 5K36C 1M1GA 1K73T 3RB3A 4GVBB 5A8WB 4X62I 2X36A 4AE5A 2JHEA 2AHOB 3J7AM 9ATCB 3HVAA 1CC7A 3FMWA 2VC0A 2DIVA 2F8HA 2R7RA 1OSCA 3J7AN 3D1OA 3BS9A 2LQJA 3OQ2A 3RB4A 1CJVB 4DV6I 3JQKA 4OI2A 4X4PA 2H54B 2ASYA 5JEAB 2HHPA 4FP9A 2HNZA 2FGOA 4JOUA 4ZA1A 1CEZA 1U48A 1VK8A 2AEMA 3R7SB 2XZTB 1T05A 1WEZA 1Q8BA 4ZCKA 2AGPA 4Y0FA 1HL6A 4F2RA 1REGX 4LOMA 2AQ4A 3OXFA 4V19X 1UJ4A 4IFYB 2NR0A 5EGYA 5AJ3J 1FFGB 2KI2A 1T9TA 3US5A 1RSCA 4YR2A 3WX8A 1XXEA 5CYQA 2DNRA 3LP0B 1VC5A 4WFBQ 4GKKJ 1VBYA 3QSYB 3D0HE 1XMQJ 2LVWA 2VZ9A 1NKCA 1ZS6A 4XTJA 2V2KA 4KYZA 3LUYA 4EGLA 2HPUA 1H6KX 3MD1A 2C2NA 4DQIA 3W5YA 2QN6B 4ZKAA 5F0UA 1N32F 2LEBA 3J80C 1M5PC 4NOHA 4ECUA 2HNDB 5JXSA 1BQMA 1P27B 1JNZB 4EUVA 4K8RA 1EZZB 2HHHE 2XI3A 3PHEA 4UTGA 2XI2A 1ZZFA 4J9VA 2MZ1A 4IOBA 2DGOA 1DTQA 3BN4A 3EUNA 2HIYA 1CJTB 1RT6B 4DR5E 3CD5A 2W8KA 2DGXA 4C4WA 5BR8E 1C2PA 4DS5A 3J80U 1VIXA 3BGRA 5C2CA 5LL6R 4JI3I 5KT4A 4IRDA 2HQIA 3HHLB 3THTA 4O0IA 1MN9A 4WE1A 1I1GA 1FHTA 1YJ9S 5FDLA 2DEJA 3GP9A 3V6KA 1KRPA 2UXCI 4WXOA 4E98A 1XNRE 1MU2B 1GAOA 2VJUA 2O5DA 1DZ5A 2JEGA 2V0NA 1SL2A 2FJDB 1K0VA 4K4UA 3PR4A 1L5UA 4LFAF 1Q5VA 3T1YJ 3Q2TC 2FHMA 3GYXB 2ZOMA 4LRFA 1RT4A 4DL0C 2KT5A 5G0RA 1NCLA 1NMEB 1JLEB 3M8QB 3FBBA 1RWPB 1E6VB 1JJ4A 3MAAA 3AAWB 3H4DA 2AMCB 2B9XA 4B9LA 1G6BA 4HTIA 1U2FA 4ED2A 4PPDA 2FHJA 5HI7A 1Q4RA 3I87A 1F3FA 1URNA 2DNHA 1UL3A 3RBXA 3D3BJ 4JI2I 4JI1E 5A2QC 4OI1A 3HCXA 4LF1A 3SFUA 1FVQA 3H90A 1F3VA 2IMOA 4FW7A 4DQQA 2CVEA 1FDDA 4MJKA 2P9CA 1FE4A 1FCAA 4JV5I 2RUSA 3VQSA 1TUGB 3D7SB 2VQEI 2BA1D 3Q89A 2XMJA 4J3DA 1YI2S 3BEGB 4N56A 2DHAA 2CQBA 3IWLA 4KGZB 1NRKA 3ADAC 3D66A 1ZTTA 2HLTA 5A2QU 4WPAA 4RUHA 2C2KB 3UDCA 3LPEA 1GFWB 4RW6B 2E9TA 3AB4B 3DRRA 3QFWA 4DZ6A 1FXLA 3MI7X 1RT7B 3QAUA 4NXNJ 1K0TA 5CHCB 2EC0A 3CJTA 2F7VA 4PG4A 4RW4B 2OFHX 3KDNA 1CQNA 5D8HB 1S1TB 3GCWP 4MDTA 3V6HA 3TUJC 1KTQA 3G8TA 2DXDA 4L73A 1B62A 3DN9A 5DLGA 2BANB 3TJAA 1UKUA 4CI0B 4ATNA 1BGXT 3PHTA 3Q6NA 1C0UB 3PM9A 5HQLA 2DBBA 3C15A 1FNXH 3KLFB 3CCMS 3KK2A 4JI0J 2LU2A 4NXMI 1SJQA 4C6AA 3AXMA 2BJ9A 4CO3A 1HNWF 4DR4F 1PCAA 4BA2A 2E1PA 2W9CA 1IBCB 1S79A 1LW0B 2CUYA 3W1YC 3D1QA 3IWNC 5BXIA 1QVGR 3PO4A 4QIEA 2E5LF 2W2OP 3D2WA 3WC2A 4PWUA 3O8WA 2BDPA 4KQVA 3OL9A 2JE6B 1JLFA 3TI0A 4DJBA 2QLBB 4CNZA 1YJVA 5C0XF 2W24A 3OW2R 3UN5A 1TELA 2YWFA 2CIMA 1Q81T 2RKIB 4AQYF 4KFBA 4FF2A 2PO0A 2VD3A 3IXQA 1CS4B 2C3YA 1RACB 1P9YA 3EDQB 5D3GA 4P7AA 1NHHA 4C8YA 4NLQA 3PEHA 4KHRA 1VC0A 3EGZA 4J9LA 2Z4PA 2EKNA 2WONB 3BKTA 2V6AA 1K8AT 3PNIA 2KT3A 2B4VA 2H4YB 1CLFA 3HULA 5DETA 3GR0A 2J8SA 4DX7A 3NEKA 1XHKA 3NCPA 2AF6A 2GAGC 1HW9A 3JAMQ 1RADB 3N01A 2HFVA 2E9RX 3V6DA 4RPFA 2ALZA 5DNLA 1LV5A 5E3AA 1U49A 1VQLS 4QPTA 2YKMA 2IERA 2H65B 3FC9A 1WJ9A 1NPRA 4OIXA 2RDIA 2HFOA 4YY3F 4OZ1A 4M8LA 3R6GB 5CQGA 3BH7B 2Z0GA 3V4IB 1X31C 2MHNA 4DV4E 3Q8UA 3SEOA 3TARA 4IZKB 1VHFA 2ABYA 1HBMA 1VJQA 1GK8A 1FKOA 4FW3A 1G4CA 5B0EA 2MGZB 3GJRB 1IBME 2D3OR 1S1XA 3I32A 3L7OA 4ED4A 3I6PA 2C2MB 1AZSB 3CCRS 4JI8F 4F8RA 1NJIT 1HA1A 2CGEA 1YJTA 2GVZB 3TQEA 3V5RA 4QU6A 4R5PA 2E5IA 4G6VB 3RW7A 4H4OB 2OEKA 2YWKA 3T6BA 4WUDA 2R9LA 1FD8A 2VONA 2LP4A 4Y2IA 3DU6A 2C3MA 1WOOA 5GAEU 5IZHA 4TYBA 3N5BA 2MKIA 5A6WA 5GVQA 1JLCB 4DN0A 5JEAF 2XO6A 4F67A 2YY3A 1DURA 4ECRA 1U25A 4B9TA 1IM6A 5EUHA 2OUGA 3NGDA 1CJKB 1FRMA 4GKJE 4LF7E 1N52B 3I4HX 4J91A 2ADBA 1RHMB 2GNKA 4GVBA 4LF8J 5A8WA 4QIFA 1I94J 1DQ9A 4NEZA 3W9HA 4Q2LA 3IR7B 4OO1D 3DYAB 1WWHA 1N5YB 4X4OA 2QG9B 2BMBA 2AW0A 1NSPA 2O1UA 3IN5A 5K36D 2FJVA 1EX8A 2RQCA 5JEAA 3ZC4A 4PPZA 3FEZA 3Q8YA 2O67A 5ETRA 4O3QA 3M2RB 3EXCX 1S4FA 1PC5A 4F3OA 3VZHA 3ZTPA 2MY8A 5DGAA 4IFYA 4U8VA 2IPOB 2Q43A 2EFPA 3FCVA 4NLRA 3AOBA 1AUSL 3P49B 4JI6J 3ZNUA 4UOCA 2VU5A 3LP0A 3M6UA 3R2DJ 1MU5A 2WCXA 1JXEA 1F5BA 1U6ZA 4OJ1A 3WC0A 1HWKA 5FD1A 2RIJA 3TVKA 2O66A 2RHSB 4WYLA 3GV7B 4OMFG 4JI7E 2CNNB 2FLNA 3HD1A 1Y3KA 2ZNYA 4ZJQA 2HNDA 3AA8A 3MMCA 4CM0A 1N36E 4YS2A 1T9WA 4B3OB 3C6TB 3NNCA 5F8NA 1JK9B 5BJRA 3TX0A 2MKHA 2WHOA 1CJTA 1RT6A 2KRRA 5H9EJ 4Q5VA 5E3CA 2XS2A 2H51B 4FPIA 4C3MA 1S48A 3H42A 2DNLA 3MAQA 1H2TZ 2FB0A 1WEYA 4KPCA 2BR0A 2HGNA 2GC8A 3MDFA 4F0HA 3HHLA 3IBFB 2OI2A 4IG3B 1EETB 1Y5LB 1R43A 4ZK7M 4KRWA 3FKBA 3U27A 5KFRA 1YRXA 3VAMA 2EG2A 5E3PA 1H2UX 3M6VA 5D6GA 3D3CJ 2HIQA 1PILA 2CDQA 3J81C 2MPUA 4K0KE 2Z30B 2EK6A 1MU2A 4M63A 1V3RA 1UDNA 3MEEB 1RTDB 3CGIA 3MWBA 2FLOA 3TOQA 2VFSA 2MQOA 2RS8A 2FY8A 1JLEA 1NH7A 3M8QA 1E6VA 4X64F 3PW0A 2EFNA 1Z0CA 4P71A 2AJQA 3DXSX 1N32J 1GTHA 4Y65A 2Q6CA 1Q79A 3PCOB 4DV7E 4X4TA 1GMWD 3V81B 3PX0A 3F41A 3B4TA 2MMYA 3J81U 2X1AA 4RW9B 4DR1F 4R1FA 2ASJA 3HZGA 2VH7A 2IY5B 1Q16B 4FYVB 5KG2A 5LOQA 3PS1A 2MTLA 1MW7A 1IBLE 3PYFA 3VAFA 2WK4A 5KFOA 3UR0A 3DRSB 3BQ0A 3PRYA 1IJEB 3IRWP 4CLUA 3TANA 1WI6A 4OQJA 4OHXA 1X9SA 2RSQA 3NGUA 3Q2SC 5CCLA 3K0JA 5M2PA 2IVFB 4GRSA 4RW6A 3OL7A 2CYYA 2UP1A 1RT7A 4J9NA 4TLQA 4LFAJ 2RUGA 1EKRA 4HYKA 2HZCA 1IKVB 4RW4A 4CLWA 4TU9A 4P7VA 5GADI 2UU9F 1S1TA
chains in the Genus database with same CATH topology
4DR2E 4ED4A 4DR5E 2NPFA 4LF6E 2HKJA 2O1TA 1EA6A 3K17A 1HNXI 1XMOE 1N34I 1KKHA 3WU3A 1HNZI 1HK7A 1Y4UA 4JG4A 5BR8E 3QT8A 1D6TA 2Z5BA 4X65E 1Z0WA 2CGEA 5LL6R 4JI3I 4JI3E 3V5RA 1Z0GA 1Z0TA 2XEXA 4B3SI 4FW9A 1MX0A 4DV0I 1H72C 1DARA 1MG7A 3ZKBA 2X7IA 4USMA 2EFGA 4WUDA 4JI6I 3ZZTA 4YY3I 2DEJA 1HNWI 5GMEA 4JI6E 4DR4I 2CZ9A 5FWKA 1HNWE 1HR0I 4DR4E 2Z5CA 2WW4A 1XNQI 2UUBI 1XNRI 1HR0E 2UXCI 1XNQE 2UUBE 1XNRE 2UXCE 2ZBKB 4EMDA 1N36I 2E5LI 3D4JA 2J7KA 3QT5A 1Y4SA 3ZZUA 3P06A 2ZITA 4GKJI 4NXNE 1WUUA 2A2CA 2PNLA 4GKJE 4LF7I 3WU6A 5A2QQ 1J5EI 4LF7E 3JAMC 3K85A 4DR3I 1J5EE 4MYUA 4AQYE 1H73A 1Z5AA 1A6FA 1IBKE 4JI4I 1N0VC 2UXBI 4DPWA 2R3VA 2UUCI 4HXZA 2UXBE 1H7SA 2A2DA 2UUCE 4X64I 5LMUE 4X64E 4X66I 2O1UA 5IWAI 4USKA 4X66E 4GKKI 2BM0A 4JI0I 5IWAE 4DPTA 1Z0VA 4JI1I 4JI2I 2VQFE 4IZJB 4JI0E 4JI1E 5A2QC 3ZM7A 4DUYI 2ZM6E 4OX9I 5FLXC 4DUYE 4B3RI 4LF4E 1KTVA 4B3RE 5IT9Q 4DR1I 4DV1I 4JV5I 4DR1E 4JV5E 2AJ4A 1ZM2A 3B8HA 1NZ0A 1U2RA 4DXLA 1HNXE 4KHPI 2E1RA 2VQEI 1N34E 4DUZI 1HNZE 4DUZE 4M1KA 4JI5I 1Z5BA 4I3HA 1BKNA 4URLA 4FN5A 4JI5E 4DU8A 2GQ0A 1MU5A 2HK2A 4LF5I 4B3SE 4DV0E 4PU9A 4LF5E 5IT9C 2O1WA 4HACB 4ZVIA 4DPYA 4HYMA 4YY3E 4JI7I 4HY1A 4JI7E 4LF9I 4N3OA 1N32I 1FNMA 4LF9E 5L3JA 1N32E 3LPSA 1RR9A 4IZKA 2V8PA 1FWLA 1S16A 1N36E 2BV3A 1USVA 2E5LE 4P52A 3PYDA 2V34A 3F0NA 4DPUA 1Z59A 3PYGA 1EI1A 1B62A 2HKEA 3J80Q 3B82A 1RREA 4DR3E 4DV3I 2Z5BB 1FWKA 2UU9I 1QZRA 1ZM4A 4DV3E 2F4VI 2UU9E 3Q6NA 2F4VE 1USUA 4JI4E 3J81Q 3HJCA 4FWGA 1Z5CA 4NXMI 5LMNI 1N33I 4NXME 3WU4A 2DEIA 4JI8I 5LMNE 4JI8E 3J7AG 4JYAI 4PRVA 2HFSA 2OI2A 2Z5EA 1XMQI 3ZZ0A 2O1VA 4GKKE 1FJGI 1K47A 2Z5CB 4WUCA 1XMQE 4JI2E 1FJGE 1FKAE 2UUAI 4OX9E 2UUAE 1KVKA 2V2ZA 3QT7A 4KQVA 3H4LA 4K0KI 1Y6ZA 4FWDA 3J81C 2CG9A 1B63A 4K0KE 4DV1E 1H74A 3T1HI 3T1HE 4KHPE 4DR2I 2HK3A 1PKPA 2VQEE 2BM1A 4LF6I 1Z0EA 4X62I 2X36A 4B3TI 4X62E 4LFAI 4MYTA 3J7AM 4P7AA 2HFUA 1XMOI 4B3TE 1NHHA 4LFAE 4PRXA 4FWHA 5BR8I 4X65I 1Z0CA 1UEKA 1KIJA 4WUBA 3Q6MA 2GS8A 4DV7I 4DV6I 3LTOA 4DR6I 1FI4A 4DV7E 3M6AA 4DV6E 4DR6E 2PNMA 3HULA 4DR7I 4LFCI 4DV5I 4DR7E 4LFCE 1XHKA 4DV5E 2LJPA 3WU5A 3JAMQ 2R42A 4R1FA 1Z0BA 1NHIA 2V2VA 4IZJA 1ELOA 3GONA 4RPFA 3CWVA 2V2QA 5GMDA 1IBLI 1IBLE 3PYFA 3Q1QA 4NXNI 1ZXNA 3OTOI 3B78A 3OTOE 2UXDI 1H7UA 1OJ4A 3PRYA 2UXDE 4Z7YA 4B3MI 1ZM3A 3QT6A 3T1YI 2Q2EB 4IZJD 5FLXQ 4B3ME 4AQYI 1N33E 1VISA 3T1YE 4XTJA 3PYEA 1IBKI 1NHJA 1ZM9A 4DV2I 4DPXA 1S4EA 4JYAE 4DV2E 4Z7CA 1PIEA 3J80C 4LF8I 4UT4A 1ZXMA 4DV4I 5LMUI 1I94I 4LF8E 1PVGA 4DV4E 3K1JA 4HACA 1I94E 3V2UC 4IZKB 3ZKDA 4YHHI 2IOQA 1N0UA 2VQFI 2HHHI 4YHHE 1IBMI 2HHHE 2ZM6I 4DU7A 4LFBI 2VF3A 1IBME 4LF4I 4UTGA 4LFBE 2IOPA 3LNUA 4DR5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 E;  4ED4 A;  4DR5 E;  2NPF A;  4LF6 E;  2HKJ A;  1EA6 A;  3K17 A;  1HNX I;  1XMO E;  1N34 I;  1KKH A;  3WU3 A;  1HNZ I;  4JG4 A;  5BR8 E;  3QT8 A;  1D6T A;  4X65 E;  1Z0W A;  5LL6 R;  4JI3 I;  4JI3 E;  3V5R A;  1Z0G A;  1Z0T A;  2XEX A;  4B3S I;  4FW9 A;  1MX0 A;  4DV0 I;  1H72 C;  1DAR A;  1MG7 A;  3ZKB A;  2X7I A;  4USM A;  2EFG A;  4WUD A;  4JI6 I;  3ZZT A;  4YY3 I;  2DEJ A;  1HNW I;  5GME A;  4JI6 E;  4DR4 I;  2CZ9 A;  1HNW E;  1HR0 I;  4DR4 E;  2WW4 A;  1XNQ I;  2UUB I;  1XNR I;  1HR0 E;  2UXC I;  1XNQ E;  2UUB E;  1XNR E;  2UXC E;  2ZBK B;  4EMD A;  1N36 I;  2E5L I;  3D4J A;  2J7K A;  3QT5 A;  3ZZU A;  2ZIT A;  4GKJ I;  4NXN E;  1WUU A;  2A2C A;  4GKJ E;  4LF7 I;  3WU6 A;  5A2Q Q;  1J5E I;  4LF7 E;  3JAM C;  4DR3 I;  1J5E E;  4MYU A;  4AQY E;  1H73 A;  1Z5A A;  1A6F A;  1IBK E;  4JI4 I;  1N0V C;  2UXB I;  4DPW A;  2R3V A;  2UUC I;  4HXZ A;  2UXB E;  1H7S A;  2A2D A;  2UUC E;  4X64 I;  5LMU E;  4X64 E;  4X66 I;  5IWA I;  4USK A;  4X66 E;  4GKK I;  2BM0 A;  4JI0 I;  5IWA E;  4DPT A;  1Z0V A;  4JI1 I;  4JI2 I;  2VQF E;  4JI0 E;  4JI1 E;  5A2Q C;  3ZM7 A;  4DUY I;  2ZM6 E;  4OX9 I;  5FLX C;  4DUY E;  4B3R I;  4LF4 E;  1KTV A;  4B3R E;  5IT9 Q;  4DR1 I;  4DV1 I;  4JV5 I;  4DR1 E;  4JV5 E;  2AJ4 A;  1ZM2 A;  3B8H A;  1NZ0 A;  1U2R A;  4DXL A;  1HNX E;  4KHP I;  2E1R A;  2VQE I;  1N34 E;  4DUZ I;  1HNZ E;  4DUZ E;  4M1K A;  4JI5 I;  1Z5B A;  4I3H A;  1BKN A;  4URL A;  4FN5 A;  4JI5 E;  4DU8 A;  1MU5 A;  2HK2 A;  4LF5 I;  4B3S E;  4DV0 E;  4PU9 A;  4LF5 E;  5IT9 C;  4HAC B;  4ZVI A;  4DPY A;  4HYM A;  4YY3 E;  4JI7 I;  4HY1 A;  4JI7 E;  4LF9 I;  1N32 I;  1FNM A;  4LF9 E;  5L3J A;  1N32 E;  3LPS A;  1RR9 A;  2V8P A;  1FWL A;  1S16 A;  1N36 E;  2BV3 A;  2E5L E;  4P52 A;  3PYD A;  2V34 A;  3F0N A;  4DPU A;  1Z59 A;  3PYG A;  1EI1 A;  1B62 A;  2HKE A;  3J80 Q;  3B82 A;  1RRE A;  4DR3 E;  4DV3 I;  1FWK A;  2UU9 I;  1QZR A;  1ZM4 A;  4DV3 E;  2F4V I;  2UU9 E;  2F4V E;  4JI4 E;  3J81 Q;  4FWG A;  1Z5C A;  4NXM I;  5LMN I;  1N33 I;  4NXM E;  3WU4 A;  2DEI A;  4JI8 I;  5LMN E;  4JI8 E;  3J7A G;  4JYA I;  4PRV A;  2HFS A;  2OI2 A;  1XMQ I;  3ZZ0 A;  4GKK E;  1FJG I;  1K47 A;  4WUC A;  1XMQ E;  4JI2 E;  1FJG E;  1FKA E;  2UUA I;  4OX9 E;  2UUA E;  1KVK A;  2V2Z A;  3QT7 A;  4KQV A;  3H4L A;  4K0K I;  4FWD A;  3J81 C;  4K0K E;  1B63 A;  4DV1 E;  1H74 A;  3T1H I;  3T1H E;  4KHP E;  4DR2 I;  2HK3 A;  1PKP A;  2VQE E;  2BM1 A;  4LF6 I;  1Z0E A;  4X62 I;  2X36 A;  4B3T I;  4X62 E;  4LFA I;  4MYT A;  3J7A M;  4P7A A;  2HFU A;  1XMO I;  4B3T E;  1NHH A;  4LFA E;  4PRX A;  4FWH A;  5BR8 I;  4X65 I;  1Z0C A;  1UEK A;  1KIJ A;  4WUB A;  2GS8 A;  4DV7 I;  4DV6 I;  3LTO A;  4DR6 I;  1FI4 A;  4DV7 E;  3M6A A;  4DV6 E;  4DR6 E;  3HUL A;  4DR7 I;  4LFC I;  4DV5 I;  4DR7 E;  4LFC E;  1XHK A;  4DV5 E;  2LJP A;  3WU5 A;  3JAM Q;  2R42 A;  4R1F A;  1Z0B A;  1NHI A;  2V2V A;  1ELO A;  3GON A;  4RPF A;  3CWV A;  2V2Q A;  5GMD A;  1IBL I;  1IBL E;  3PYF A;  3Q1Q A;  4NXN I;  1ZXN A;  3OTO I;  3B78 A;  3OTO E;  2UXD I;  1H7U A;  1OJ4 A;  2UXD E;  4Z7Y A;  4B3M I;  1ZM3 A;  3QT6 A;  3T1Y I;  2Q2E B;  5FLX Q;  4B3M E;  4AQY I;  1N33 E;  1VIS A;  3T1Y E;  4XTJ A;  3PYE A;  1IBK I;  1NHJ A;  1ZM9 A;  4DV2 I;  4DPX A;  1S4E A;  4JYA E;  4DV2 E;  4Z7C A;  1PIE A;  3J80 C;  4LF8 I;  4UT4 A;  1ZXM A;  4DV4 I;  5LMU I;  1I94 I;  4LF8 E;  1PVG A;  4DV4 E;  3K1J A;  4HAC A;  1I94 E;  3V2U C;  3ZKD A;  4YHH I;  1N0U A;  2VQF I;  2HHH I;  4YHH E;  1IBM I;  2HHH E;  2ZM6 I;  4DU7 A;  4LFB I;  2VF3 A;  1IBM E;  4LF4 I;  4UTG A;  4LFB E;  3LNU A;  4DR5 I; 
#chains in the Genus database with same CATH topology
 1A9N B;  1LK5 A;  3M6W A;  2DHS A;  4LF6 E;  3UDV A;  2DR6 A;  4B9S A;  5LMN F;  2BAN A;  1TK8 A;  4P2X A;  2I2Y A;  2QA4 S;  1RTI B;  2QLF B;  3HX9 A;  4NYZ A;  4UY8 5;  1C0U A;  4NZ0 A;  5F8M A;  5CAA A;  2NN6 F;  3KNG A;  1Z0T A;  3KLF A;  1CQM A;  3P45 B;  1Q5Y A;  2F1F A;  3BBC A;  3BN7 A;  5FLX Y;  3OFF A;  5E5N A;  1LW0 A;  3QGP A;  2HVI A;  3PTW A;  1AT1 B;  3TW0 A;  3ETM A;  4FYY B;  2UUB E;  3CCL S;  5C5J A;  1EAR A;  2JE6 A;  4X62 F;  1MLA A;  4P74 A;  5C7P A;  3SCJ E;  4OYO A;  3POT B;  4JYA J;  4DMZ A;  1YZ6 A;  2RKI A;  1WDD A;  4TKT A;  1CPZ A;  4MYU A;  3I5A A;  4DV6 F;  1S97 A;  2CPF A;  1F6T A;  1QAI A;  5IOL A;  2DNO A;  4DL5 A;  4ZIT A;  4MKY A;  3TR5 A;  5DNX A;  2VKZ G;  2WON A;  3R1H A;  5CD4 H;  2RQK A;  1RHY A;  4LSL A;  4X66 E;  4GKK I;  2PA3 A;  5KAK A;  1SUQ B;  4LUB A;  3W2V B;  4DPT A;  1Y60 A;  2WAQ D;  2DR8 A;  4IZJ B;  2FYX A;  3N4W A;  5LJ3 Y;  1UPM B;  4NLD A;  1R6Y A;  1Y11 A;  4F04 B;  3CW2 C;  5IT9 Q;  4NA2 A;  4N41 A;  2RQM A;  2QIF A;  4TY9 A;  1OYR A;  1Y4Z B;  3ITH B;  3EVW A;  3K89 A;  3QGH A;  1U8S A;  1N33 F;  4KHP I;  1PYO B;  2CAD A;  2GQC A;  5HRO B;  4AXI A;  4N8N A;  4QNJ A;  2VBW A;  2YKN B;  5HMW A;  2AIR B;  4MT1 A;  1SKR A;  2PDA A;  4DL4 A;  4ILL A;  3QZ8 A;  2N7C A;  1HNW J;  3ICL A;  1GMU A;  3MCN A;  3HKW A;  4DR4 J;  1R7I A;  2HK2 A;  4LF5 I;  1UCN A;  4DV0 E;  1F2G A;  4YDX A;  1BC6 A;  2ZHO A;  4PAB A;  3CUN A;  2QMU B;  3H8Y A;  4IRC A;  2GW8 A;  2LA6 A;  3V4I A;  4B9V A;  3IWX A;  2GFF A;  5L3J A;  4IZK A;  1HYS B;  1VQ5 S;  2E5L E;  3UR3 C;  3EVO A;  2HHX A;  4USW A;  1HBN B;  4AQY J;  4LCG A;  5L9X A;  1OMS A;  3AH6 A;  2OSQ A;  1EQ0 A;  1WC4 A;  4WJB A;  8AT1 B;  2FVQ A;  4LCF A;  2C38 B;  4JI3 F;  1UDS A;  1PO6 A;  2Z5B B;  1WC5 A;  2PA8 D;  4DV3 E;  1AZS A;  2CG8 A;  1LXJ A;  2WZ1 A;  2XLJ A;  1TV6 B;  2KFZ A;  1YJN S;  2YKP A;  4KPY A;  2E7W A;  4NZ6 A;  4BA1 B;  3NBP B;  2GVZ A;  3ISN C;  3EGN A;  1KS2 A;  2UXC F;  5C0X C;  2IC3 B;  1UWB B;  4O3N A;  2EI5 A;  4RWW A;  3NAH A;  4NLV A;  4J9O A;  3BB5 A;  2DNP A;  2V2Z A;  3BSC A;  3T5H A;  2HZA A;  3PRV A;  3M05 A;  3I0R B;  3L3C A;  2CPJ A;  1WHV A;  2PSZ A;  2MST A;  2J9C A;  3IG1 A;  3VAI A;  4CH1 A;  3P4U B;  1O6X A;  1R6M A;  5AXL A;  3J7Y I;  1VQM S;  4FXW A;  2G0C A;  2R4F A;  2W9B A;  2MKC A;  1AFJ A;  1CJK A;  4YY3 J;  1XMO I;  4B3T E;  2B51 A;  4OX6 A;  3CDB A;  2HMI B;  1NSQ A;  3PJW A;  1XBW A;  4PZV A;  2QYG A;  1YVF A;  3W61 A;  4IFD E;  4DR6 E;  3DYA A;  1N5Y A;  2B9Y A;  1YRT A;  1OQ3 A;  5J2Q A;  4DV5 I;  3MMB B;  2EVZ A;  3TEG A;  3HVR A;  1Z0B A;  5KG0 A;  3VV2 B;  4JV5 F;  3MCO A;  4FS1 A;  2J0X A;  4H54 A;  2MZR A;  1LNQ A;  2VIC A;  3C16 B;  4CLS A;  2VQE F;  2AYB A;  2GML A;  1FX2 A;  3QAE A;  4XDC A;  5KFP A;  3M2R A;  4WFZ A;  2DGS A;  4BWM A;  1F60 B;  4NXN I;  1JXV A;  5B7W A;  4JI8 J;  3OTO E;  4KIA A;  4YFU A;  2FIU A;  4ZP6 A;  3NOC A;  3M9M B;  1IN0 A;  3DHX A;  1OYE A;  2VKR A;  3H2L A;  3W8G A;  2JEF A;  1Y3J A;  3I5B A;  4JP8 A;  1DTT B;  1SIW B;  3MUM P;  4WK3 A;  4A46 A;  1PVG A;  1S0M A;  1RA7 A;  3C14 B;  2AGO A;  1OQ6 A;  1XWL A;  3G9C A;  2F8M A;  4QR1 A;  1RYR A;  4F0M A;  3RW6 A;  4DR3 F;  1XER A;  1ZH5 A;  3L7P A;  2U1A A;  4B3O A;  3O44 A;  4DL6 A;  1IKX B;  3C6T A;  1REV B;  2XZD B;  1NK8 A;  4NXM F;  4AID A;  2KL8 A;  4EFA C;  1V5I B;  2J76 E;  1HK7 A;  2ZH8 A;  2GQ2 A;  1X8D A;  3IBW A;  2KVQ E;  5DRO A;  3NMA A;  2XEX A;  3Q86 A;  3UDL A;  3BPD A;  5JEA C;  1FFS B;  5FJ4 A;  3ZKB A;  1NUE A;  3CE8 A;  4QYR A;  1N88 A;  3MPY A;  3UWT A;  4FVM A;  4IG3 A;  1EET A;  5I42 B;  1LQ9 A;  1QJH A;  3CED A;  2IVM A;  3SFG A;  3HKZ D;  4CO0 A;  3Q23 A;  4F25 A;  1GXT A;  1U02 A;  3HKM A;  1KFD A;  1YJ7 A;  2ACY A;  3VAJ A;  2VPY B;  1UJ5 A;  4DCO B;  1VQ7 S;  3BZQ A;  1VLO A;  1Y0H A;  2OGU A;  2OPP B;  4LIR A;  3UD3 P;  3M8Z A;  1TMJ A;  4OHY A;  3B4M A;  3MEE A;  4HLB A;  1RTD A;  5T41 A;  1J5E E;  2C2E A;  4KAI A;  1Z5A A;  1A6F A;  5GAG I;  1N0V C;  1NH8 A;  2B8Q A;  1VQK S;  2ROG A;  1NJX A;  3DD6 A;  3ZNJ 1;  5HAT A;  3ZO7 A;  3O2I A;  3Q8V A;  3UQS A;  2UUC E;  2J6T A;  2QJ3 A;  1QAY A;  3VR1 A;  3GFH A;  4JBC A;  5KOX A;  3V81 A;  2HZV A;  1WF0 A;  1RE1 B;  1RDR A;  1LWX A;  4DUY E;  4RW9 A;  1RAE B;  1XJW B;  3BSN A;  5KFJ A;  1NK5 A;  3MOJ B;  1R6V A;  4DF8 A;  3CCW A;  2E1R A;  3BO4 A;  3LP1 B;  1ZYQ A;  4DUZ E;  3OHA A;  2MQP A;  3BKF A;  2RHQ B;  1S7H A;  3DRS A;  3MHY A;  4LSN B;  2GGP B;  3HHL C;  1FRL A;  2V68 A;  1JX4 A;  3QLH B;  1FWP A;  2IIH A;  2DIU A;  4UF4 A;  4MU0 A;  3CJ2 A;  5IQQ A;  3OVA A;  1RTJ B;  3Q83 A;  1FT8 A;  3LA0 A;  4ECV A;  2RD5 C;  4ETZ A;  4LF9 E;  5SZT A;  3PS3 A;  4CNY A;  5KFD A;  2RRN A;  1SBR A;  2IDE A;  1WC6 A;  1T9V A;  4XIU A;  2YPZ A;  1VR6 A;  3VGV A;  2Q66 A;  1IKV A;  1UFW A;  2BRK A;  5KFU A;  3B82 A;  2I9S A;  3LAN A;  1E6Y B;  1ZA1 B;  3GFY A;  5K20 B;  5LMU J;  3LGH A;  2GJ2 A;  4DLG A;  4PRF A;  3KJV B;  4X64 J;  2F4V E;  1WC1 A;  2V8D A;  2ROE A;  4V1A k;  2GIQ A;  2RDD A;  4P2S A;  3EXY A;  5GAH U;  1RTI A;  4QW9 A;  4C11 B;  2ZJQ Q;  3HZE A;  2O3Z A;  3P76 A;  3WDO A;  4I0W A;  4DLE A;  5KFS A;  2C3U A;  1D9F A;  4DR1 J;  4CLK A;  1FJG E;  2UUA I;  2E29 A;  1RAO A;  4K5S A;  2LXI A;  3KHL A;  1FTR A;  3SSQ A;  3DOK B;  1RWV B;  4RKU C;  2FVP A;  4DV1 E;  4AXJ A;  4ZHR B;  3T1H I;  4IFD A;  2CJY B;  4H4K C;  4A8M P;  1SI9 A;  4ICL B;  2GCF A;  2L41 A;  2GIR A;  1FRJ A;  3GTY X;  2OO4 A;  4UUW A;  3POT A;  1WC0 A;  3OR2 B;  3AJ2 A;  2MKY A;  4FWH A;  2ROP A;  3JS9 A;  1LFW A;  2D9P A;  3ELH A;  5B0A A;  4WF9 Q;  1FXD A;  2ACM A;  3AOA A;  2XO7 A;  2ZH4 A;  3GSI A;  4DN9 A;  1RT2 B;  3MR2 A;  3Q6M A;  2BRL A;  3MM6 B;  1X4G A;  5DLF A;  2KXF A;  4ZJL A;  3BR8 A;  3GV8 B;  4LFC E;  1RU1 A;  2GIF A;  5J1N A;  2CG4 A;  3SIP B;  3GLL A;  3MMJ A;  4IH5 A;  3FSX A;  1SUQ A;  3W2V A;  2BJ3 A;  3LP2 B;  4IZJ A;  2UU9 J;  4LPF A;  2MKJ A;  1KHW A;  1W25 A;  1ZBT A;  4P2F A;  1TKZ B;  1EAY C;  2VG5 B;  4ZVS B;  2R8I A;  5LMN J;  3A3N B;  2FGC A;  1YJW S;  4B3S F;  1ZXN A;  3G6V A;  5IM0 B;  4N7T A;  1OYS A;  2UXD I;  3G82 B;  2LCW A;  4LBI A;  5HRO A;  3QT6 A;  3V6J A;  2YKN A;  3K8W A;  5K8M A;  4PG8 A;  5I3Q A;  3JSM B;  1YWX A;  5IV3 A;  4KY3 A;  1ULR A;  3EGW B;  3VWS A;  1DBD A;  3BQ2 A;  3M8S A;  4O44 B;  1PSD A;  1UVK A;  3HM9 A;  5J2P B;  3F73 A;  5JJB A;  4YHH E;  1FA0 A;  1MNE A;  1RLD A;  3RUB L;  3CVK A;  4X62 J;  1SC6 A;  1FDA A;  4K4Z A;  1HYS A;  2ZZM A;  2WP8 B;  4DSK A;  1FO1 A;  2IAJ B;  2LA4 A;  1HBN A;  3UCG A;  2NN6 C;  3H5S A;  1R27 B;  1UTA A;  2EK1 A;  4DV6 J;  2ALY B;  3JSR A;  2C38 A;  2YKQ A;  2Z5B A;  1FD2 A;  4IFV B;  4NRU A;  3M8P B;  3HK2 A;  4C8Z A;  1TV6 A;  1QDU B;  4IOC Q;  2D69 A;  4G1I A;  1MX0 A;  2XMW A;  4A8W A;  4I56 A;  4BA1 A;  4PKD B;  1B70 B;  3NBP A;  4MK8 A;  1ZAX A;  1OO0 B;  5KFX A;  2IC3 A;  1UWB A;  1WG5 A;  3QFH A;  2DNM A;  2XUL A;  1XNQ E;  1RBA A;  1Q53 A;  2DXF A;  2MLY A;  5E7O B;  2AJ1 A;  2VDH A;  1VFJ A;  2HRT A;  3I0R A;  3I55 S;  1N33 J;  5A0Y B;  4DFK A;  2ZIT A;  1SJ3 P;  4OLP A;  3NAI A;  1HI1 A;  3ISN D;  2GJI A;  5C0X D;  2ZKT A;  3K85 A;  4FW6 A;  4QPX A;  1RWK B;  4ZVU B;  2M3D A;  3OSN A;  2HRY A;  3J81 j;  2HMI A;  5LJ5 Y;  3LH2 S;  2ATL A;  4DPW A;  1S10 A;  2JJ4 D;  3FRZ A;  1D9A A;  5KFY A;  3IM9 A;  3I82 A;  5DDO C;  3DNC A;  4ZCL A;  3A3P B;  4K4S A;  5AXN A;  4ZIW A;  2B43 A;  5E33 A;  2W1B A;  4HVZ A;  2IA0 A;  3BYR A;  4BC7 A;  1QAX A;  4LIW A;  3MMB A;  2FTR A;  4OX9 I;  3HP6 A;  4URG A;  4B3R I;  2UV8 A;  2A18 A;  3KG4 A;  1FRK A;  2B8P A;  4OZN A;  2C28 A;  3C16 A;  3S8S A;  4JI3 J;  1DY3 A;  3TX8 A;  2OAU A;  4LRD A;  4Y34 A;  2W7P A;  3HSZ A;  4ED3 A;  2HS3 A;  1WF2 A;  1YHQ S;  2FD2 A;  4CO4 A;  2R2T A;  4FN5 A;  3IAM 9;  1WI8 A;  4JI5 E;  2GQ0 A;  3O1L A;  5E3Q A;  5A8R B;  2GA7 A;  3JSY A;  8RUC A;  2UXC J;  3EWG A;  3PDN A;  4ILR A;  1HBO B;  4P72 A;  5IC6 B;  2MLZ A;  4QYZ J;  3R2C J;  5HQM A;  4I7F B;  3C14 A;  2MQQ A;  2GVD B;  4LRC A;  1ZPW X;  4WP9 A;  5D4P A;  4A8K A;  2J0W A;  3BF4 A;  2V34 A;  1WD6 A;  2P9G A;  2UVW A;  3PYG A;  2RIL A;  1HIY A;  5E41 A;  2CJQ A;  2A3J A;  2Z8Q A;  1Z1Z A;  2M52 A;  1REV A;  4UQT A;  3N6L A;  2VC1 A;  3CNQ P;  4LMZ A;  4UW2 A;  2E5H A;  2OTL S;  4I64 A;  2DR5 A;  2NS1 B;  5D0G A;  4WKY A;  2Y1J A;  1HW8 A;  2GJF A;  2NZC A;  4JYA I;  2MHE A;  4FBU A;  3KJF B;  4JI2 E;  2K1R B;  2ZH2 A;  4FKX A;  3KK1 B;  4JV5 J;  4NLG A;  2EG1 A;  1X4A A;  5I42 A;  3E2E A;  4K4X A;  3NNA A;  2VQE J;  1S77 D;  2Q3P A;  4OJ3 A;  2LEA A;  4UOF A;  4DX6 A;  4NLS A;  1OSD A;  4QWC A;  4NAS A;  2G0I A;  2F5G A;  3SXL A;  2VQE E;  3MZI A;  5JEA D;  2YQ0 A;  1XQI A;  2RB7 A;  3ET6 B;  1Q78 A;  2EBE A;  2OPP A;  4PXC A;  5KG4 A;  2HQF A;  1SH3 A;  3SDE B;  3MR3 A;  1I6J A;  4MU4 A;  3MCS A;  4M5I A;  3D28 A;  5KFV A;  2HBQ B;  3LTO A;  4WFN Q;  2ZM6 F;  5LSR A;  1U7L A;  4KV8 B;  1BWV A;  4DR7 E;  4L3N A;  1D3W A;  3T5J A;  2RAQ A;  4DR3 J;  1NHI A;  4JUZ A;  4KHP F;  4OFZ A;  4X4S A;  3HJF A;  3LAL A;  2XZW A;  4EBC A;  2F3J A;  2DB1 A;  4ED7 A;  4NXM J;  2G0J A;  3L9Z A;  3SQO P;  1R8B A;  4LF5 F;  1XK8 A;  1CJU B;  2Y3Y A;  3FQK A;  1HWJ A;  1D9D A;  4C98 A;  1S9E B;  3LP1 A;  2Q2E B;  4B3M E;  4AQY I;  3M7V A;  3R27 A;  3VGU A;  4LSN A;  3FBE A;  4NLU A;  2GGP A;  4NL5 A;  1C4A A;  3PO5 A;  1R0C B;  2R7S A;  3QLH A;  5DZ7 A;  2V8G A;  2Y8W A;  1SKU B;  2HHH I;  3THP A;  1RTJ A;  3QBC A;  3ULH A;  2BX6 A;  1EJ7 L;  2IRX A;  1C0T B;  2VF3 A;  3Q8S B;  4LFB E;  2PMH A;  2NXC A;  3OL6 A;  4F3M A;  3HHL D;  1NDL A;  2DNN A;  3J7A 1;  4DR5 I;  3UO0 A;  1JLQ B;  3VVU A;  3GFZ A;  1VQ9 S;  3G6X A;  2G2O A;  1CC8 A;  3TUI C;  4GQU A;  3MAH A;  4JG4 A;  3QT8 A;  1E6Y A;  4FF3 A;  2I8E A;  3U7J A;  2B7B B;  3KJV A;  1S59 A;  2CQH A;  2E66 A;  1NK6 A;  2YXL A;  4RBU A;  2XMU A;  3AJD A;  3MEG B;  4TQS A;  5