3PYFA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with amp-pnp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
296
structure length
296
Chain Sequence
SVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 80
structure length 296
sequence length 296
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pyfA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pyfA01
3V2UC 4YY3I 3ZKDA 1FNMA 5FLXC 5A2QQ 3PYGA 2UXDE 3Q1QA 4I3HA 4DV0I 3ZZUA 4LF6E 4JV5I 3T1HI 4DUZI 1Z0WA 4HY1A 2UXCI 3ZZ0A 3V5RA 2A2CA 4LF4I 1MG7A 4ZVIA 2X36A 2UXBI 4X64E 3OTOE 1N32I 1HNXE 4DPWA 1XMOI 3QT5A 2UXBE 5BR8E 2LJPA 4LFCE 3WU5A 4JV5E 4LF6I 4JI8E 1HNWE 2NPFA 1VISA 2HFSA 1NZ0A 4OX9I 4LF8I 3J7AM 4R1FA 4DR2I 4JI1E 1HNZE 5LMNI 2BM1A 1N36I 4LFBI 4JI0E 4LF5E 3T1YI 4LF7E 3T1HE 1ZM4A 4XTJA 1IBKE 5FLXQ 1XNRE 4YHHI 4DPTA 3QT6A 2HHHE 5IT9Q 4NXNE 4JI2E 3LTOA 4X62I 1H72C 3PYEA 1KTVA 4DV5I 2VQEE 1IBLE 1IBLI 4X65I 3WU4A 4FWDA 4DR3I 4PU9A 1D6TA 3WU6A 1FI4A 4ED4A 4JG4A 1EI1A 2UUAI 4DR7I 1IBKI 1H73A 1ZM3A 4GKJE 4DPXA 2XEXA 4LF7I 4JI4I 1N36E 4LFBE 4DR4I 4X66E 4X62E 3K17A 1J5EE 4GKJI 1HNZI 2GS8A 2EFGA 2VQFE 1B62A 4OX9E 5LMUI 1I94E 2E5LE 4JYAE 4P7AA 4DV4I 1HNWI 1XHKA 1ZM2A 1FJGE 3T1YE 1MU5A 1Z5CA 4B3ME 4JI6I 4DV2I 4FWGA 1N0VC 4KQVA 4LFAI 3JAMC 4JI5E 5LL6R 3PYDA 4DPUA 4DR6E 4YHHE 1NHJA 4LFAE 4RPFA 1Z0EA 4B3SE 4WUDA 1IBMI 2HK3A 3J7AG 2UUBE 1FWKA 1NHIA 4K0KI 2HFUA 4HYMA 4DUZE 4K0KE 1N0UA 4PRVA 5BR8I 3LNUA 4DR2E 3LPSA 3J81Q 4LF8E 4AQYE 4YY3E 2ZITA 1Z0VA 2F4VI 2ZM6E 1RREA 2UXCE 4B3MI 2UUBI 1XNQE 4LFCI 1FJGI 4KHPE 1IBME 1S4EA 2UUAE 4WUBA 2V8PA 3GONA 3ZM7A 1FKAE 2VF3A 1H7SA 4JYAI 2R42A 3JAMQ 4DPYA 1N32E 3OTOI 3CWVA 4DV2E 3PYFA 4JI6E 1Z0TA 2CZ9A 4JI4E 4GKKE 4DV5E 2HKJA 4URLA 1OJ4A 3J80C 4DV0E 2J7KA 5A2QC 1MX0A 5GMDA 2VQFI 1HR0E 5L3JA 4LF9E 1J5EI 1Z5AA 4X66I 2UUCI 4DXLA 4DV6E 5IWAI 4JI0I 4X65E 4LF5I 2BM0A 1ZXMA 1S16A 4DU8A 2VQEI 1N33E 1Z5BA 1ELOA 1RR9A 1Z59A 2A2DA 4JI2I 4LF9I 1ZXNA 4DUYE 2HHHI 2V2ZA 4B3TI 1XNRI 1WUUA 3B78A 3M6AA 1Z0BA 4JI7I 1H74A 4Z7CA 3J81C 4HACB 3HULA 2ZBKB 1B63A 2F4VE 1N34E 2V2VA 1HNXI 1U2RA 4DV7I 4NXMI 4LF4E 4KHPI 2V34A 3H4LA 4FWHA 5LMNE 4JI1I 4B3SI 1BKNA 2BV3A 2UXDI 2ZM6I 2HK2A 5IT9C 4DR6I 1Z0GA 4DU7A 2DEIA 3ZKBA 4NXME 1XMQE 4JI3E 1XMOE 1XMQI 4JI3I 4UT4A 2Q2EB 4AQYI 4JI5I 1N34I 4JI8I 1K47A 4DR5I 1QZRA 1UEKA 1KKHA 3D4JA 4DR5E 2HKEA 1I94I 2E5LI 5LMUE 1ZM9A 3F0NA 3B8HA 4X64I 4DUYI 3K1JA 2X7IA 4UTGA 4DV3I 1Z0CA 4DV1E 3WU3A 4HXZA 2UU9E 2E1RA 4EMDA 4B3RE 4FN5A 4WUCA 3ZZTA 4MYUA 4USMA 2UUCE 4M1KA 4Z7YA 4FW9A 3QT7A 1A6FA 4DV4E 1HR0I 3J80Q 4USKA 2WW4A 4DV7E 4DR3E 4DR1I 1NHHA 1H7UA 1N33I 2R3VA 4B3RI 2AJ4A 4DR4E 4MYTA 2UU9I 1PKPA 4JI7E 1FWLA 2OI2A 3B82A 4NXNI 4DR7E 1EA6A 4B3TE 1KIJA 1PIEA 1PVGA 3QT8A 2DEJA 4PRXA 1DARA 5GMEA 4GKKI 1XNQI 4P52A 5IWAE 4DV6I 2V2QA 4DV1I 1KVKA 4HACA 4DV3E 4DR1E
chains in the Genus database with same CATH superfamily
1SQEA 5HSPA 1FKAF 2KO1A 2R8KA 3RAQA 3D5MA 1FKPB 9RUBA 1V5IB 2HURA 4U7CA 1AROP 1SQGA 1T94A 5JEAC 5E7OB 2EBGA 3V81A 3OUYA 1FNMA 2OPPB 4EO8A 4BA1A 4ZIWA 4ZS6A 4HH0A 3RAXA 4RW9A 4F3OA 1SC4B 2EW9A 3DXBA 2ZUAA 2C37A 2CQHA 2B56A 2BR0A 4DV0I 3ONQA 3M7NG 2JT2A 1YRUA 3ZZUA 3HKWA 2KM8C 3KLIB 1RJJA 4AL7A 4RW7A 4CT9A 3V81B 4FF1A 1Z0WA 2V5HG 5ETRA 5LL6d 1KD1T 5E3RA 2IIHA 3UDVA 5JEAE 4F36A 3V5RA 3QNWB 3BR8A 2Z5BB 1Z5CA 4A46A 1XNQJ 2WSFC 2HWHA 3IGVA 2VOPA 5A76A 3DN9A 4FF2A 1UVLA 2UXBI 3AQOA 4OKGA 2CPYA 2PA8D 4P73A 3OTOE 5KG6A 1PG5B 1U24A 2PMWA 3LQVA 2ZBIA 2JRSA 1OYPA 3QT5A 3CJ3A 1HR0F 1G7CB 4RUAA 3T19A 2C3MA 2WBMA 3D6TB 5J2NA 1NK6A 4QJVA 1NJXA 2HNZA 3BREA 2EVZA 2LJPA 1IBMI 1Q53A 1SI9A 3FFIB 4OLPA 2A6OA 3GFHA 4L3NA 2ADCA 4LFCE 5IC6B 2KXFA 4WYLA 3ZXWA 2A0FB 3Q6NA 4LF8J 2NZCA 3B4DA 4F3QA 3VAKA 4IS9A 5HI7A 4DG1A 3W63A 5K36A 2FYXA 2CNOB 4F3MA 1PGZA 1M1HA 2FJEB 4PPZA 2CJYB 4QWAA 5K14B 4DSIA 4JI4F 4PQUB 3IWXA 4WFZA 4FYDA 1A0OB 1HNWE 3T1HF 4MIWA 1D9FA 2ADBA 4B9LA 4DSKA 2KKHA 4ID5B 1NK8A 3AB2B 1SCJB 4O44B 3GCMA 3HKMA 1JLBA 1UEUA 2HFSA 5I42B 3OR1A 3V4MA 4LF4F 1VC0A 5FWKA 3T41A 5CCMA 2C2KB 5ETSA 4XK8C 5GADU 5EWFA 2OFHX 3U7JA 4DUTA 1VQ4S 3M8YA 2WVEA 3SQGA 3QBCA 3J7AM 3Q8UA 4JI1E 1GMVA 2QTWA 3UR0A 3MCMA 4KV8B 4NEZA 1U6BA 4DCOB 4IOBA 3GILA 5I3UB 4HL9A 2VODA 5LMNI 2HQFA 1VCTA 3CCLS 2RQCA 4OJ3A 3MECA 1KVIA 4IRKA 2XHWA 1BXNA 3GSIA 4N47A 2BJ1A 4IO9Q 2HHVA 3CDUA 4M5NA 4ETXA 3T1YI 2PNZA 4JI0E 4LF7E 4XDDA 2MY7A 2HZAA 2XLIA 1N5YA 1B7YB 1LK7A 1U26A 3D54A 4PG5A 2ATCB 3EMTA 3IR5B 4F4AA 2HGNA 5DG9A 4DR4F 4DG1B 4PXEA 1DTTA 4DL0C 5FLXQ 4OX9E 2DR9A 2FJVA 5M2RA 1AT1B 1Q95G 1XNRE 4BS2A 2OH2A 4OZJA 3DRPB 3QT6A 1CS4A 2W9AA 5DNXA 2IAJB 2M88A 1J5EF 2DRDA 3M6UA 1XJWB 2CA9A 4A8KA 3V4IB 4J37A 4MMOA 3MWBA 4CO4A 1TTHB 2HIQA 2OLWA 2MKHA 2XMWA 1RWOB 1PAUB 3A4TA 3BDPA 4V1Ak 3LTOA 4OHVA 2KH9A 2E1PA 3DNCA 1HNVA 1K8AT 1H72C 4FW6A 4X62I 4ZVSB 1FFSB 1DJ0A 1URRA 2XS5A 1R89A 2MDAA 2VQEE 2FC9A 4DV5I 1GFWB 1F3VA 2HNDB 2WB1D 4LSLB 1EETA 2K1RA 3PTWA 4MFBA 5FDLA 4XPEA 2E29A 4H4MA 5C24B 2XO7A 2XC9A 1IBLE 5HQMA 3RB0A 3V4IA 2HSEB 1N5TA 1WG4A 1CJKB 1FRJA 1N36F 3CCTA 3RR8A 2ZC4A 3V6HA 4JI3F 1RE1B 5A0YA 4WK3A 1ITPA 2OFGX 3OT9A 3NOCA 4DR3I 2ALYB 1U2FA 4ZVFA 1DTTB 1RHYA 3QFWA 3WU6A 2DRBA 1FI4A 3T1AA 2IBOA 3AY0A 4IG3B 2IC3B 3K5MA 4F4YA 1SKSA 1LXNA 4JG4A 2HHWA 2RSQA 1UEVA 1EARA 4OZ5A 3QFHA 2OPQA 5KFRA 1UVIA 3M4XA 1ZM3A 4EO6A 4WXWA 1S9GB 4DPXA 5KFYA 1TL5A 1Q86T 1ZAWA 3EUNA 3W5XA 4DZDA 4HTJA 4DFKA 4FBUA 1Y6ZA 4KV8A 2Z5CB 2BOAA 3ZZYA 4YS2A 1DAXA 4R0EA 4TVAB 4DV4J 1TVRA 4U3BA 3P3EA 4JP8A 1N36E 1JLEA 1R8HA 2HQ3A 1ZZNA 1B3TA 1RKIA 4N8OA 3UI3A 2ZZNA 1MWYA 1NUEA 2E7VA 1K9MT 2B4OA 3K17A 3RW7A 3UCZP 1IBKF 4V19X 2Y1LB 3KNAA 2P8IA 3PS1A 1J5EE 1HNZI 5LJ3Y 4FW3A 3MPYA 1HWLA 4LF6F 2MQOA 4IZJB 3BPSP 5LMNJ 3UHMA 2IM2A 3ENVA 1TKZB 5AE3A 1UVMA 5LMUI 3H42A 3MTJA 2L41A 2E5LE 2VESA 4U6PA 1NZ8A 3Q23A 2HAFA 1IUJA 1T3OA 2HFZA 3ZC4A 4B3MI 1V5VA 3L7PA 1F9FA 2C39B 1SXLA 4OV1A 1T05B 2FJDB 4C8OA 4X64F 1X4AA 2YX7A 2UUTA 4IR1A 1HNWI 1SC1B 3R2DJ 1VK8A 2BJ7A 1XHKA 1ZM2A 3J81U 5DO2A 1R6VA 5JMNA 2OD4A 2G0CA 1GTHA 1XXEA 4WP9A 3NCPA 2V69A 4CH1A 1XTZA 3VAHA 2PD1A 4JV2A 5EL9A 4B3RI 1HWIA 4ZPDA 1HQEB 1Q7LB 4DV2I 2G13A 2HBQB 3BDEA 1N0VC 4DZ6A 2CWXA 2CADA 1LWXA 2IRUA 4X4RA 1WNEA 3JAMC 5JEAD 3ZO7A 1RTIB 4ECVA 4AXJA 3RBXA 2RHSB 4YDDB 1Y0HA 2IDLA 4ITSA 4MKVA 4PG6A 5KFEA 3DLEA 4YEAA 3MFHA 2BANB 4OYZA 4WFYA 2H65B 4F0MA 5AXNA 1RT3A 3MPVA 3Q24A 3BQ0A 2C2EA 4DR6E 2AMCB 4YY3F 3VALA 4ZMMA 2DCLA 3BQ1A 3DM2B 3WC0A 1GT8A 2RVJA 2W24A 2QC3A 4ISAA 4WUDA 1DFDA 2DNYA 4LRCA 2WRMA 1QTNB 3BGRB 1N32J 4PWDA 3KOAA 3B4TA 3ZZZA 2HFUA 1V9OA 4I6AA 2QLXA 3RBZA 2CNLB 4A8OA 2BOPA 3GU0A 5FJ4A 4DUZE 2X51A 1HBMB 2D3OR 2W7AA 2XTJP 1VQNS 4CIOA 2AJ2A 1VQPS 3LNUA 2RDIA 2VICA 2UUCJ 2GHWA 4W98A 5L9NA 3KLVA 3CD0A 3MZIA 9ATCB 1EETB 4TY9A 1OY8A 2LEAA 3RRHA 3MAAA 4F02A 2LXIA 2OAUA 4B3TF 2QV6A 4KPYA 3K5PA 4YY3E 4Q0BB 4OZEA 4B3SF 1G4CA 4JI5F 2ZITA 1EQ0A 2M8DB 3ISND 4IFDF 2W2QP 3ETMA 5CYQA 2RKIB 1CEZA 2YNIA 3CMES 4ZVOB 4DR3F 1M90T 4M5MA 2ZM6E 3M7ND 2I38A 5IV4A 2DD8S 2EG1A 2VFVA 2W4DA 3C16B 4QW9A 3EPGA 4CCHA 1FXDA 2KFZA 5KFIA 4TNOA 5J2MB 4HHJA 3PO4A 3F44A 1T9UA 2FDNA 3LPYA 2ILYA 3M30B 3VZHA 3S7RA 3WIVA 3CMAS 3MURP 4LREA 4QYRA 3TA0A 1N33F 1IBME 2YKAA 1XMOF 5B0FA 3I32A 2HFNA 3A3NB 4DV5F 3CJTA 3ZZRA 3KKFA 2MQMA 1EAYC 3IRXA 5HMZA 1DQ8A 4P72A 2KVQE 1QLNA 4YR3A 5EUHA 4XIUA 1NMEB 2OTLS 3AT1B 4C8YA 1O5JA 4P10A 1J5EJ 5F0WA 2XMTA 5BR8F 2CJKA 4DPYA 2F3JA 2KT5A 2DNGA 2F1FA 1QUVA 4PAAA 2ROPA 1UJ4A 2HHQA 2JHEA 4IG0A 3SQOP 2LMIA 3CW2C 4DL5A 1JXVA 3FDSA 4K2JA 3RB3A 2EK6A 3MEKA 3MF5A 1Z0TA 3CULA 3FNNA 2BA0G 1MU2A 2CZ9A 2CKWA 4NCAA 2OP5A 1C0TA 4QPXA 4WFXA 2N82B 4ER8A 4ELVA 4IH7A 4C3LA 4DV5E 3SFGA 2GHVC 5KT7A 2QL9B 1OJ4A 1AYEA 1JLBB 2JX2A 2MZSA 3I9V9 4ZCKA 3VHQA 1KHWA 5EHHA 5LT5A 1OSDA 4PYAA 5BYRA 4U95A 3K5LA 4X4OA 1NDKA 3Q2TC 2WCXA 4L76A 2VHGA 3MTKA 4X66J 5A2QC 2HVIA 3W3SA 1HWUA 1S4FA 4Y2MA 1S6QB 2VPXB 3M8PB 5KFPA 2OJ3A 3MPDA 4P2MA 4GQUA 1H3DA 2YQ3A 1C1CA 1Y3JA 2J5AA 2VASA 3HSGA 3QO9B 5GMDA 4L75A 4U67Q 4RNMA 2FJAB 2LDYA 5HVGA 1NSKL 4B3RF 1EB0A 4DX6A 2AD9A 2OSQA 2E5LJ 2VQFF 3PS3A 5E3AA 1WG5A 1WHWA 3HZEA 1JNZB 2QMWA 5KFAA 5KG4A 4E2FB 1NSPA 3PJ9A 4YP3A 3LANA 3GTYX 4XO0A 3MI7X 3KHHA 2NZ4A 3DRRA 4ZP6A 1I51B 5IWAI 4DV4F 4DV6E 4LF5I 3C66A 2BM0A 4DN9A 2OUGA 5KAKA 1Y3KA 2FGOA 2XB2D 2B43A 3CDJA 1U6FA 4HR2A 3R7BB 5DZ7A 2IVMA 4DU8A 1IBMF 2CVEA 1N33E 2DNOA 3DMJB 1RAGB 3IM8A 5CHCB 1NM2A 3KLEB 2CDQA 1M5PC 8AT1B 1R0CB 2RD5C 4DL3A 2AU0A 2NXNA 1VBKA 1UZHA 2ZOGA 3SEOA 5DG7A 1U1QA 1HPZB 2HRTA 4GKJF 2YXLA 2HHHI 5G0RB 2WB4A 4RNNA 2DNHA 4ZJOA 4YB1P 4NRTA 2JE6A 2BJ9A 1PYTA 2EI5A 3DLBA 4DHVA 1H2TZ 3LA0A 6FD1A 1XMOJ 4OO1C 2OPPA 2B5JB 1RBAA 1HPZA 2CNKB 1HHQA 4JI1F 4K50A 4QNKA 3GZ7A 4G1QB 4LRFA 1JLCA 3MCOA 2KB2A 2XMVA 2GO3A 5E33A 4B3SJ 2D41A 2XGQA 1Y5IB 4ZVTB 3KJVA 5DDPC 1R8AA 2QEXS 2ZWOA 4TU9A 3HULA 1IJFB 2K2PA 2Z30B 3KYLA 2KRRA 4LQ3A 1UDNA 4LF7J 2ZBKB 2POKA 2F4VE 4AXIA 4LCHA 3GG1A 3EWGA 3GG0A 2V2VA 3GR0A 4BWJA 3M9MB 2MKYA 5DDQC 2GQCA 3JSYA 4I1TA 4GKJJ 4ZK7M 3PACA 1S7IA 2J8SA 4NA1A 4YOEA 4NLWA 1SKWA 1RB0A 5D4PA 2OO4A 4NRUA 4B3MF 4X4VA 3CSKA 2IRXA 5C0XD 2G2YA 1X4DA 4CLZA 3FQLA 2C2NA 4QR0A 4KAIA 3OLAA 2CQBA 5DETA 4DDFA 3KLFA 4RWXA 4NZ6A 1LK5A 4ZA1A 2CJXB 3H4LA 2FQQB 3I0SA 2Z8QA 5LSOA 4USWA 2DGXA 2P5VA 4TQRA 5J2PA 3MCNA 5F9LA 2E7XA 1EJ7L 4OJGA 2UVWA 4J9SA 3H5XA 1X0PA 4JI1I 2PNZB 1BKNA 2KT3A 4IZJA 5KFFA 2UXDI 3BJYA 1DRZA 1RZMA 3CB4A 1RYSA 5IT9C 4F0HA 4C9DA 8ATCB 1Z0GA 3OR2A 5HK4A 2DGQA 1U1PA 1NJZA 1NB7A 1TVRB 1KVJA 1NBEB 3PNIA 1U2CA 2P6SA 3M6XA 2DY9A 2HBZB 1WORA 2VL1A 2FZGB 4QOTA 1LWFA 2EFNA 1NK0A 2GO8A 3H5SA 1K47A 3OFFA 3EXYA 1OPIA 3ICLA 2I5JA 2PO0A 4QNJA 1G3OA 2CYYA 1QZRA 4DR5I 1O0PA 3J80U 2FJXA 1I1GA 1UEKA 3A1YG 2AZ1A 3O44A 4N76A 3D3CJ 1ZA2B 5IZHA 4M5GA 2WHOA 3HSZA 4TN2A 2ASDA 1HNXF 1H6KX 3NNHA 3IR7B 5F8LA 1RACB 3BKFA 3M2RA 3NG8A 5CQGA 3TEHB 2VQFJ 2KTQA 4H54A 4D3HA 1TP7A 4DR5E 3SI8A 1X4GA 2KZZA 3S8SA 1RTDA 1TAQA 3AQPA 4IUFA 2C38A 1TUGB 1XR6A 3LOUA 4USTA 2HNZB 1I94I 3QAUA 1L3UA 2R2TA 4IFDA 3HP6A 1FKOA 1KONA 1S6OA 2L9NA 1IBMJ 2RKIA 3PRVA 4TLRA 3MMCA 1FE4A 4EWTA 4ILMA 2O1VA 2VU5A 2H9ZA 4NI2A 5ETVA 3TJ9A 5EKWA 2J0SD 3HT3A 2RQMA 2YNIB 4OX8A 4Y2AA 1ZZFA 5JJBA 1JJ2R 2PE8A 3MM5B 3ILIA 4ZCIA 3W64A 1KS2A 1PILA 2AGOA 3QIPB 2F65A 4O3OA 5FLXU 3PHTA 1VBYA 3CUNA 3WU3A 4UW2A 4OYXA 4CLYA 5CXTA 3I0RB 4JI2J 3G9CA 3LGHA 4EI2A 3POTB 1YI2S 4FN5A 3UQSA 4WUCA 1A7GE 4NASA 4MYUA 4USMA 1YJTA 2PO2B 5AXKA 4AQYF 3KLIA 4ECUA 2MEWA 2YY3A 3QGPA 3QIDA 4DS5A 2M3DA 2E9ZA 4KTQA 4JI6F 1EKSA 3CJKA 3SFUA 5KFTA 1FEHA 3AJ2A 2B51A 2K06A 3QT7A 4KGZB 1WEXA 4MKAA 4AYBD 4CO2A 4USKA 2BR2B 3J80Q 4NYPA 3BGRA 5B0CA 5CYMA 3VZIA 1XC9A 1OYSA 1WOPA 3SSQA 1S16A 4KR0B 4GKKJ 1Y11A 1RT1B 3CGIA 3K59A 4K4ZA 1N33I 1KOHA 4OFZA 2R3VA 2BANA 4NLPA 3GLLA 3Q22A 4QWCA 1S9EB 3DLEB 3DOLB 4HDHA 4KHPJ 2FZCB 1EP4B 2UU9I 2HQGA 3VTIA 1F2GA 2H54B 5I42A 3QJLA 2HIYA 4NZ0A 2RHQB 1ZH5A 1FWLA 2IMOA 1WEZA 3MMJA 3UNYA 2U1AA 4OI4A 3KDOA 2AGPA 4YB6A 5K8NA 2F5GA 1YX2A 2NXJA 2ZE2B 2WVDA 3M1VB 4NXNI 2RQKA 5C25A 2JEBA 2N3OA 5H9EK 1N36J 5F8IA 4AL5A 1RAFB 1X4CA 2M70A 2BRKA 4HDGA 2VBXA 4B17A 1HI0P 5K36B 3KJNB 1QM9A 1SJRA 2H5JB 2J9EA 4J5OA 3RGIA 3KLFB 1EIYB 2XHCA 4ID8A 4RW6B 4D3GA 4LCFA 3R5DA 4DL6A 3PO5A 3KWMA 2BJ3A 5RUBA 1OO0B 2PSZA 3OTDA 3PCOB 3J7A1 3CWJA 2CQIA 2DEJA 3DLKA 4J9VA 4PXDA 1VRUA 4GKKF 2VB6A 1U8SA 5C25B 3JSBA 2AGQA 2BDPA 4YN3B 3FEXB 1KQGB 4ANEA 4KH1B 4LF4J 2JDJA 3K8WA 2I2YA 5IV3A 2ZWPA 4P52A 1U02A 5D15A 5LJ5Y 3M9NB 3M8QB 4ES3A 3KXDA 2ZH7A 3WC2A 4OX9J 3NZKA 2V2QA 4QR1A 3R6LB 2ROGA 3PRYA 3BV8A 4X4UA 3I5BA 4DV1I 3DOLA 5DRRA 4DV3E 1NKEA 3X1LB 1D09B 1FCAA 4YUDA 1IM6A 5M2UA 1WJ9A 4FKYA 3V2UC 3JSMA 1YHQS 1TK8A 4PABA 1IKYB 5KT6A 1N5SA 3C6TA 1K1QA 1RAEB 1S9GA 3ISNC 3V6JA 1U48A 2JVOA 2M7SA 3ZKDA 5FLXC 4PR6A 2J9CA 3UE2A 4UZBA 1X4BA 4CWBA 5IT4A 2VOOA 5A2QQ 2ILZA 5DRQA 1FNOA 1SH0A 1YG0A 1Q1KA 3P4UB 2G2OA 3R5AA 5A0YB 5JUMA 2ZHAA 4C3MA 2HRUA 3OLBA 3OUYB 1H98A 1F5CA 4BA1B 1K0VA 1Q8LA 2PO2A 3ELHA 2RRNA 1UW9A 4L74A 5ETNA 3C14B 2VBYA 2IM3A 3WBZA 1FRMA 1PCAA 1WI8A 3POTA 3GPAA 4X4PA 3KJVB 1NSAA 2KJWA 4NYZA 2FTRA 2HRYA 2K7JA 4CLSA 1MG7A 1XN9A 4LSLA 4ZVIA 4IFDC 4C0HA 1ZTWA 2FLLA 1JLGA 4CNZA 2F63A 4B3RJ 1RHQB 4MFBB 5FDLB 1GMWD 2NN6D 1B0TA 3K0JA 4KYZA 3GCXP 3EGVA 1HNXE 2DNMA 3NGTA 4I2QA 4MKYA 4CLUA 2NS1B 3FZ2A 1HWJA 1CULA 2XSJB 3MUVP 2SXLA 4DR5F 2JJ4D 4MDTA 3T5LA 4YY3J 5DM7Q 4FPRA 5AE1A 2EXUA 1C1CB 2W4PA 3OTCA 3QO9A 2NR0A 4NLUA 2K8GA 2KYZA 1LWEB 5B0BA 4ZVPB 3FMBA 2HGLA 3P5TL 5I4MA 2YKNB 3EJMA 4J91A 1NB2A 3AA9A 3QLHA 1S1TB 4WZMA 4ZCLA 3DU5A 4HVZA 4WPAA 4DR1F 2FHOB 4ECYA 1S12A 2RILA 2UXCF 2QLWA 1TELA 2UXDF 3G6YA 2LDIA 3AXMA 3KLGB 1SJ3P 1TKXB 2MHNA 3MHYA 4YDXA 1Q7YT 3NMAA 4TY8B 4PKDB 1RWKB 4RW8B 4ALZA 4ZPVR 2GQ0A 1LWFB 1R6YA 2PDAA 5DLGA 2J65A 4OX9I 3N4WA 4I7FB 2MQPA 1MSWD 3BPDA 2VFRA 4Q8FA 1TL1B 2DISA 1TUVA 2MZTA 3EGZA 5KG0A 2RUSA 4IZJD 4DR2I 2H51B 4RR5A 4OYBA 5KT5A 2W2PP 4ID5A 4LF9J 3O5TB 3OR1B 3CEDA 2WVFA 2BM1A 4NX9A 1DLOB 1S72S 1BQNA 5KG5A 3QWPA 4G65A 2GGPA 5A8RA 4B3OA 3TUIC 3W9JA 3T1HE 1HNIA 3EVWA 2QA2A 2Z58B 1RWUA 3IAS9 3R27A 4P9SA 2DNQA 2G0JA 3DYAA 4MT1A 5K14A 5F8HA 4PQUA 1P6TA 4FS2A 5HJXA 5HQLA 4JI4J 2HHPA 2F4VF 3HCXA 2MKCA 4H4KA 1XQIA 3BSNA 5KFVA 1FD2A 1KQFB 2CJQA 4K5RA 4Q43A 2R2SA 5E3CA 4FP9A 5H9EJ 4LT6A 4KHRA 1NK9A 1R8CA 2ZZMA 1KOOA 1M5SA 1XR5A 4JBCA 3C16A 2XY7A 1IQTA 1GK8A 4OO1B 2YNGB 3FCVA 3HFZB 3N6MA 4Y2KA 4PWWA 5J2NB 3VVTA 4UY8T 5IT9Q 2RU9A 1G1XA 3HJVA 3W61A 1TL3B 2EKYA 2GIFA 3DLGA 1IVZA 2Y3YA 4IKAA 2YWGA 1RXOB 3PX4A 3J7YU 2V50A 1H2UX 3I31A 2R9LA 1KTVA 1U09A 3M2VA 2QYGA 1HK7A 3R3TA 1PJ5A 3HX9A 3E51A 2YBVA 2YWHA 3IMQJ 4ZLLA 3C2PA 4X65I 5C2GA 2Y1IA 2JH3A 4OX7A 5D4LA 1Y9OA 4DFJA 1R0BG 4I2PB 5J2QA 2DR7A 1UFWA 2J6UA 1Z2ZA 8RUCA 3P49B 2W2MP 2BQUA 4ANCA 2R4FA 3HFVA 1D8YA 4FW7A 4Y3CA 2P9CA 4OYIA 4KY3A 2C37B 1U4BA 1TUWA 4RW7B 3HO1A 3UN3A 2IVYA 2PFDA 3DFEA 1FRKA 4M63A 4NXNF 5MLCV 4LVNP 3RB4A 1L3TA 1E3HA 5BYQA 3BEGB 4X65J 2ZKTA 1S1XB 3U1NA 2QL7B 3G8QA 2QX0A 5A8WB 3KTQA 1EI1A 4KC5A 3FRYA 2UUAI 2ZHOA 1EKRA 1NNDA 1WDTA 2QO3A 3JSMB 1HNXJ 1IBKI 4GKJE 2XI3A 1U0SA 4NLSA 4TLQA 2J7UA 3FSXA 2UXBJ 3TQ1A 3FKBA 2ATLA 2E9TA 1HLWA 3HHLB 2UUCF 1WF2A 5DRKA 5DDRC 2BX6A 3G6XA 3NGRA 2KU7A 4LFBE 1LXJA 4KFBA 4LBPA 2AYBA 3PX6A 5ETOA 2A6MA 1T9WA 5KFLA 1VQ6S 1IKVA 2C2MB 1HQEA 4GKJI 1C4CA 2KG0A 1TKTB 3SCKE 2HFVA 1UDOA 3W1YC 3W9IA 3OV7A 3RG6A 3R5JB 1X5PA 2Y8YA 3FUYA 1GAOA 1VFJA 5IQQA 4DQQA 2E9RX 1UVKA 1SVDA 4N5SA 3H4DA 4JYAE 4P7AA 3UR3C 5KFHA 2JEAB 4DV4I 2GA7A 2D7SA 4J9NA 1JLAA 1RT5A 2BW2A 3C15A 3BS9A 4OIXA 4WYWA 5E3QA 4CO3A 4FNIA 3TA2A 5DS7A 2OPSB 3AD7C 1FESA 4Y34A 3H98A 4I64A 5LXYA 4CTAA 4QWBA 3D2WA 2QA4S 4FS1A 1KLMB 3M1VA 5BR8J 2Y1RI 3CDAA 3CO0P 4NWBA 1O51A 1UFLA 1N34J 1IKXB 2FLOA 2BMBA 2OMOA 5D0EA 3K58A 1RHMB 3RRKA 1MU5A 4B3ME 2V0NA 3D66A 2KJVA 1OY6A 1M5VC 1JXLA 1SUQB 2RRBA 4F4KA 4JV1A 5H9FK 1LFPA 4LFAI 2BEFA 1R31A 1CQNA 1RBLA 4P7TA 4RNHA 3JYTB 1VQ7S 2ZBQA 1Y7PA 2GVZA 3IAM9 3ZM7A 1U49A 2IOPA 2XYGB 4E8UA 3GLJA 2HVDA 2NXCA 1Y5YA 5J1PA 2W9BB 2VKRA 1WSVA 2OPQB 4K7QA 3T1YE 3CDIA 4LFAE 3G86A 2D3ZA 5KFJA 3G87A 1Z0EA 3N6NA 3DD6A 2BR2A 3CO9A 3KK3A 2C3YA 2MJUA 3MMBA 3PFEA 4ES2A 2W9CB 2CPDA 5ETMA 3EX7B 3MR2A 4OJ1A 2QA4G 4J9PA 3LWLA 5F8NA 3GYGA 4CYUB 2GO4A 1FWKA 1KTQA 1HBNA 5HBMB 1BY9A 1CC7A 1PJ7A 3G8TA 1REVA 2BQ3A 1O8BA 3B4MA 4HYMA 2BKOA 3JAMU 2CWKA 3I55S 4FPIA 2GAHC 3DI6A 3IG1A 4CNYA 4DR1J 3TJ8A 3NRBA 4ED1A 3RBDA 4P2FA 1VBXA 2NSBA 2QT7A 1H7WA 3UD5A 3BSOA 2NUHA 2AJ1A 1HD1A 4BC9A 2LU2A 4ECXA 2RRAA 2ZH3A 1XR7A 3TRGA 1F0XA 3QGHA 1TZ0A 2GJ2A 1S6PB 2AJ0A 3ITHA 2COLA 3MMCB 3CCZA 4M5HA 3TA1A 4CQ1A 1MMLA 2ZJPQ 1S97A 2D3UA 4NLQA 1RAIB 2CRLA 5C42A 4R8UB 2FLNA 3VR1A 5K36D 1S1WB 4CLPA 3A8JA 3OTBA 3TEGA 3R8YA 1MN7A 2KVIA 4I6WA 4YQWA 1ROFA 3T5HA 1DTQA 2DY1A 3FGVA 4RUCA 1UPPA 1FRLA 4ERDA 1XNQE 1FJGI 4KHPE 2K3IA 3MEEA 1BQXA 4P74A 4ZP9A 2VPYB 4GVBB 5IT0A 2UUAE 5GAHI 3OL7A 2KT2A 4K8RA 3TUZC 3EGNA 2VDIA 3NEKA 3P5BP 3Q86A 3TYTA 7FD1A 2ZH4A 2I5JB 4ZITA 3D6MB 5KFUA 3GJTB 4JI1J 1RISA 2IJFA 1AZSA 2HQCA 1RLCL 4DR2J 4A8FA 3OTEA 1F6TA 1UVJA 1N32E 2Q43A 1ZBTA 1RI7A 2ACMA 4LF5J 3K5NA 4PUOA 3DU6A 1MMDA 1G6BA 3E01B 4OX6A 3HFKA 1H38A 4LF6J 4JI6E 2BACA 4ZDNA 3MEDA 2GIRA 5D0RA 3PR4A 3IFEA 2J0QD 3O1LA 5L39A 1HA1A 1NHKL 2XSFA 4OZ3A 2W8LA 2RDJA 2O1WA 3P76A 4UUXA 3TZYA 3QSIA 1FDAA 2DGOA 2HKJA 2IOQA 2WONA 5LMUF 1UA0A 3J80C 2QA1A 1F5BA 3MUMP 1CJUB 4CT8A 4X64J 4DV0E 4GKKE 1U0HA 2OEKA 2YWKA 2EFOA 3AOAA 4O3RA 1TAUA 2PO1B 5G4DA 2F8EX 1FTCA 2FGCA 2DGVA 3CMQA 1UJ5A 3PHEA 4OQJA 4BWMA 4C6AA 1PBAA 3OHAA 1JJCB 5HP1B 4NLVA 3KHRA 3FFIA 4EZ9A 1MX0A 1WEYA 4OI3A 4WFAQ 2ALZA 3IGNA 4J3DA 3PM9A 1CVJA 3JXOA 4DF8A 1J5EI 3S6EA 5T14A 1I94J 1TKZA 4ZLPA 1Z5AA 4LF5F 4I6YA 2QIFA 3R7SB 2U2FA 4X65E 2NYHA 1RT4B 2LCWA 4ICLA 5C42B 1U7LA 1RP5A 3HLUA 3D68A 2OEJA 3LP1B 1ZXMA 4BA2B 1VQ5S 4G1IA 2MGZA 3OHBA 2DCUB 4RNFA 4O0IA 1QVGR 3A13A 1GQEA 5HQ8A 4AD6A 4O3PA 1LWCA 2A2DA 3RYLA 3DRYA 4J7CA 3TO8A 1RR9A 1Z59A 4JI2I 4LF9I 4JV0A 2HWTA 1U47A 1SKRA 3BZQA 4ED2A 3OVAA 5IQ6A 2B5JA 2QLFB 2PI4A 2J7WA 2HS0A 4XTJA 3HDSA 3M2UA 4FYYB 3Q83A 4NE9C 4DJBA 2PEBA 2GMHA 4ECRA 2VQEJ 2HMIA 4LIWA 4MK9A 4WWSA 3HHEA 3HHLC 2R7SA 3DI6B 1RAOA 1WUUA 3B78A 2FD2A 3K2YA 1YBTA 1IKWA 5KFCA 3RW6A 2X3GA 2K3KA 2ERRA 3W5ZA 3AOCA 4O23A 3TW0A 3H25A 3SSSA 1I6JA 3C8YA 5CABA 1GMUA 3J80Y 3HF5A 4NOHA 4NYOA 1X60A 1HD0A 1XMQI 3KLHB 1OMSA 3R1HA 1H74A 4U8YA 4UOGA 1WDDA 2VH7A 2YX4A 2ZNYA 3BO4A 1T0TV 3B54A 1JLFA 2KN4A 1Y10A 1RKJA 1MWQA 1RT6A 3ET6B 1BQMA 3DRRB 2UV8G 4HT5A 2N7CA 3CCVS 3R1LA 1B63A 5C0XB 1N34E 2PEHA 1N4LA 4P71A 2EG2A 2GIQA 3SMZA 1VC6A 1R8BA 2ZC3A 5IFMA 3H5UA 4ZPAA 3JYTA 1HIYA 2QG9B 3QSYB 2HGMA 4DV7I 5AXLA 1NJWA 4RBVA 5L1JA 1N48A 4LOMA 3I82A 3M85D 2JWNA 1IXKA 2DNPA 4LRBA 4EYIB 1PYOB 3W9HA 5HLFB 3BBCA 3G2XA 1B7FA 2JLGA 1H7SA 3DHXA 1RTJA 2XMJA 5DQGA 2PNLA 2GJIA 1LV5A 2MZRA 2XLKA 5HJYA 1HHSA 4NPOA 1PYSB 1FF2A 2V34A 3L7OA 3ENWA 4MKBA 1HNZJ 4IRDA 4HTIA 1LNQA 4Q5VA 1HKAA 2R8HA 4KIAA 5LMNE 1OSCA 1N5YB 2FC8A 2W25A 4FXWA 5EWEA 2ZM6F 5ETKA 3NNCA 2XCAA 3UW1A 3TQEA 4B3SI 1VI7A 1CSJA 3AB4B 1TL7A 2MMYA 2V4JB 1D9DA 4LBIA 2OSRA 5F8GA 2OPRA 1QDUB 4O4RA 3IRWP 2ZM6I 2ASJA 3KK1A 1APSA 4F8RA 1RT2B 4GC6A 3OXGA 3C3LA 4JI3E 4F2SA 1WHXA 3P6YC 4NXME 2DRAA 1GX5A 2VC0A 1RT7B 2XCPA 4RU2A 2B4VA 2KRBA 3MM8B 2CPXA 3L4BC 4HYKA 1Q82T 4B9TA 3CDEA 1NDLA 1WSRA 1ULRA 3IWLA 4ATNA 4MIAA 1OYEA 3I4PA 3HHLA 2VG6B 4DL2A 3KLHA 2ACYA 1CJTB 3DGVA 2GCFA 5IOLA 1WC4A 4C4WA 4ZN3A 6AT1B 1S1VB 1UZDA 1N56A 2AF6A 1HBOB 5CCLA 2E5GA 1HW8A 2DXEA 2EFQA 3S01A 3ZTRA 3CCQS 4ED5A 3MGJA 2GNKA 4O3SA 2OGUA 1F9EB 3J81j 2CPEA 3KNGA 3BN7A 3AXKA 3LAMA 2AQ4A 4BBYA 5J2MA 2DPIA 1E3PA 5HMYA 1B0PA 4AIDA 2MSTA 4KGVB 4TU8A 1T9TA 4A48A 4WBFA 5KFQA 2E5LI 3RBEA 3NGKA 3NS6A 1ZM9A 1U8WA 1LEOA 5L9XA 2E1AA 3F0NA 3HHDA 2MYFA 4ZPCA 4C0BA 5J2QB 1X7VA 5CYQB 4PG8A 1TMJA 1NJYA 1BHNA 3ADAC 1IWAA 2MGZB 3GFXA 3MD3A 1V6HA 3H90A 4IFYA 4DI6A 1Z0CA 3L7UA 1S1UA 2GZOA 2J6SA 2V8GA 3CNQP 3IWNC 1QAIA 1FO1A 2F40A 2L9DA 5K36E 3OL6A 2FUG9 2UU9E 4WP8A 4HI2A 3AJ1A 3C6UA 4IOCQ 3NGDA 1S77D 2VUGA 4GO5X 3OTOJ 1XMBA 2HHHJ 1RABB 3TVKA 2RS2A 4HHHA 4M1KA 2VG7A 3FBFA 1E6VB 4O3QA 1HHTP 1QAYA 3FEZA 5F41A 1NRKA 3DM2A 4F4ZA 1PKUA 2ZH6A 3GQCA 2DXFA 3F73A 3MUTP 1C0UB 2YPYA 3DYAB 1U1NA 3GSDA 3DOMA 3NP5A 4LRDA 3HXMA 4LF7F 1NHHA 2ZBRA 1S0NA 4A47A 1NDCA 1P8GA 4B3OB 2JSXA 3L9ZA 3TAPA 4O4GA 1QSYA 4M5IA 4PG7A 4CLTA 2AX0A 4IO1A 3QATA 1RGVA 1V3ZA 3GB0A 3G4SS 4DFPA 5DROA 3FEYB 3DRSA 2GJFA 3W2WB 3IS9B 4N77A 1Q0NA 1N6QB 1B99A 2P6TA 4GRSA 5HROB 4NMLA 1LW0A 3IO1A 1AZSB 4UQGA 1W2BR 1NDPA 4F26A 2O1UA 1KFDA 1DZ5A 4DR7E 1VLOA 2VBZA 3MM6A 1WKLA 4Y00A 3H2VE 5KFZA 4DCJB 5HMWA 2RF2B 3HVTA 5AJ3F 1T03B 1Y60A 5CYJA 1PIEA 2W2OP 2WOMB 3R5GA 2HQDA 2HAIA 2Q3PA 4OZ2A 5DZ6A 5C2CA 5KFOA 1KC8T 3MEEB 3K7RA 5JEAA 1QY7A 1QSSA 1RWWB 1FWPA 3I5AA 4RX6A 2UXCJ 3QT8A 2A3JA 4IDKB 4PRXA 2F9JA 1DARA 1E6YB 2HEKA 4K2XA 4FF4A 4QPTA 5HLFA 2WNRB 3MMAB 1IR1A 5GMEA 1QE1A 2XULA 3NBPB 5DGBA 2DITA 2MKKA 4GKKI 2HVZA 4LFAJ 1BGXT 3WQPA 1Q4RA 4UQTA 1H7XA 4JB8B 3FRZA 4DLEA 1SH2A 4NA2A 1P9QC 5H9FJ 3IM9A 5BJRA 5EGYA 3GV8B 2F1DA 3SCLE 4I2QB 4F04B 5C0XA 2ZD1A 1YWXA 2Z57B 3BKTA 3MM7B 4HACA 3BYPA 2FY8A 1MW7A 3KFWX 3UDCA 3GJSB 4F67A 5IM0A 2D3O1 4HEA9 3GMGA 4M5JA 4OYAA 4DX7A 1MMNA 4ZKAA 1HMVB 1NCLA 2V63A 5C0XE 4YY3I 1SJQA 4CRJA 3TAMA 1GMWA 5KFGA 1WOSA 1N5QA 2NN6A 1VQLS 1FK9A 2JEIA 4LSNA 1M0SA 5GAHU 1URNA 1C4AA 3TWZA 4MJKA 2UXDE 1Q5VA 2HS3A 3PFOA 1VQKS 3CJQA 5F3ZA 3A12A 4C11B 3TI0A 1P9YA 4I3HA 1RHJB 2JC0A 1UMJA 3L09A 2KHDA 2RE1A 3DC2A 4F25A 4DUZI 2F4VJ 2NN6B 4RW4A 4OO1D 2YKQA 3DLHA 4LF8I 4CLWA 4LFAF 2RU3A 3RTVA 1FT8A 2A2CA 2YWWA 4H4MB 5C24A 3P8BB 2K1RB 3THTA 5H1SV 3H4BA 3VAJA 2NLWA 3ISZA 1Q8KA 2GQ2A 3BB5A 4ZVGA 3DRXA 2R2UA 2V68A 1LWCB 2N4DA 4OHXA 4DV0J 3EM1A 4LQ9A 4ECWA 1AA1B 3BGUA 4OL8A 4X64E 3OD2A 4RBUA 5KFNA 1MROB 4ILLA 3ETOA 4H4OB 2CIMA 5L1LA 4BA2A 3MEGA 4DPWA 1S6UA 2IM0A 4K4SA 1RT4A 4ICLB 4EEYA 5F8MA 4FXVA 2GAGC 4C3KA 5EN1A 5IT9Y 2V4RA 2D1CA 1IR2A 4WKRA 3SDEB 4ZN1A 2FVRA 4B9NA 2B4UA 2J9DA 1VQYA 1GXTA 2RB7A 3NBPA 3MMAA 3FCHA 3J7ZT 2ASLA 5JEAB 2M4MA 1VIXA 1ZAVA 1HBUA 2MQNA 5K20B 2IBKA 3GWCA 2B9WA 3ULHA 3WU5A 1WF1A 4FVCA 3S1TA 3MOZA 5AJ3J 1KR4A 1F2HA 3C15B 2LVWA 2BYCA 4PZVA 3G82A 4ZHRB 3CXCR 3PW4A 2JEAA 3QZ7A 5THWA 3CJSA 3A3OB 5KG3A 2Y1JA 4JI8E 1YRTA 2DYAA 4TYBA 3DKDA 4F50A 2NPFA 2XO6A 2DH9A 1U0HB 1SPBP 2VG5B 2GVDA 1CJUA 1WG1A 2QN6B 2X3DA 2IDEA 2ZOFA 1CQMA 2GQQA 3CT9A 3OXFA 4IYQA 4KPCA 4USHA 3ILJA 1JLQA 3T5JA 2UP1A 3MXHP 1RTHB 3R5BA 2C3UA 4OJHA 3HVRA 4ECZA 2ZNZA 5HVHA 4PYDA 4QQBA 5KT3A 4FXDA 1IBLI 5CZVA 1VS3A 4UF4A 3IS9A 1N6QA 3VVUA 3LP2A 2IY5B 2ROEA 1CLFA 4JV5F 3FC9A 3E01A 2BJEA 5I3QA 4WCEQ 1YDLA 4PUOB 3D1QA 1M5OC 2MQQA 1JLQB 2LP4A 2X1FA 1JIHA 4WE1A 3UN5A 2F8HA 2BVZA 2CNNB 2CQ1A 2ZDPA 3OW2R 4BDPA 1N36I 3Q8RB 4LF5E 2VIHA 2W4CA 4FBTA 2DJWA 2ZDOA 2LQ9A 5CH7B 2V8DA 2FHMA 2M8HA 3VAFA 3A8KA 1ZM4A 2PI5A 3IN5A 4FF3A 1EQMA 1Y00A 2ZVSA 2ZH5A 5CD4A 3GV5B 1IBKE 3G82B 1XMQJ 3V6DA 2XWYA 4RZRA 1E6VA 2BE2B 1IN0A 1HARA 1Z2LA 2FHJD 3D1OA 1DTQB 1RTZA 5HN0A 1M5KC 3D28A 2Y0SD 1WTBA 2HHHE 3GE9A 1KQKA 3QZ8A 3H5YA 3ZTSA 4NXNE 2DIUA 3D67A 4EK2A 3KRNA 4JI2E 1B70B 4KHPF 1D8ZA 1RHKB 1GH8A 4URGA 3BN4A 3PYEA 2PN6A 4PG4A 2VONA 4KO0A 4DR3J 3N01A 1Q16B 1SC3B 1LQ9A 1S6PA 3CD7A 4IR9A 4GVLA 5ETTA 1AW0A 1Z1ZA 2WK4A 4DN0A 5K8MA 1VGYA 1OYRA 5FD1A 3PXGa 3PKMA 1M1KT 3BBFA 4MQYA 4EGLA 1DHMA 1FKOB 4L6V3 4FWDA 1W7WA 4ES1A 2LEBA 4N7TA 4PU9A 3MD1A 1D6TA 4X4SA 4ECSA 4DV6J 1GEHA 2YKOA 3WX4A 2MZQA 2IRYA 1KSPA 1YJ7A 2BJDA 4RUHA 4NLRA 4JI7F 2O1TA 2ZH1A 4DR7I 4WXOA 4DSLA 1H73A 2IFXA 1WC1A 1JKHA 1TV6A 1FD8A 2I0XA 2Z5EA 3KG0A 4RUBA 1BC6A 3AFGA 4RL1A 3AD8C 2XEXA 4J90A 4C8ZA 3GYNA 3KDNA 2VKZG 3OFHA 2PO0B 3BR9A 3MR5A 4DUYJ 4Q2LA 5D3GA 3GJRB 2HHXA 4JI4I 3VAMA 1RT7A 4NMXA 4F4WA 4ZVUB 4X66E 4JV5I 4X62E 3BSAA 1WKKA 3LP0B 2NUUG 5KFMA 2UUBF 4MU4A 2PC6A 2GS8A 3LGMA 5L1KA 2JLFA 1TL7B 2EFGA 2V4JA 4WTOB 1B62A 4CLFA 1DY3A 2R7XA 5KG1A 4RLEA 4XPCA 4TQSA 3I4HX 3A8IA 1FTRA 2YKMA 2DR6A 3H1CA 1X31C 2CZVC 2HBRB 3EVOA 2E44A 1B0VA 1KLMA 4FKXA 5D0HA 4JI2F 3R97A 2O3DA 2B9YA 2DH8A 1D1UA 2AHOB 1PO6A 2IMWP 5E0OA 1TFWA 2IYGA 2NXUA 3QMQA 2MZ1A 5DG8A 2BZ2A 4OZ1A 3OVSA 2BE9B 4DV3F 1FJGE 2BUNA 4WK1A 5D8HB 3W60A 1WHYA 4IRCA 3MM6B 1KNZA 5HANA 5C0XF 1LW2B 1SKUB 3AOBA 3HHNB 2BW7A 1EZZB 2RH3A 2DIVA 4XDCA 3T9ZA 5A8KA 1HYSA 4FWGA 2AZ3A 4KQVA 3D1HA 3C19A 4JI5E 3SCJE 4IQXA 5T7LA 3LP0A 3PW7A 3N28A 4K5SA 2AX1A 3PYDA 2CZ4A 4LR8A 3TNVA 1U1MA 2CFXA 2E5JA 2RMLA 2Z0GA 3R5CA 4XTTA 2Z2LA 4WFBQ 4OHYA 1FXLA 1PSDA 4ZIVA 2F4FA 5DQIA 3MM9B 1VQ9S 4YHHE 1X9SA 4URQU 3JAMY 1YJRA 3JSRA 4RPFA 5F0UA 5EDWA 1J27A 2AW0A 2AJFE 2W2NP 2Z2MA 1JKHB 1T95A 1TV6B 3D7SB 2MPUA 2O66A 3M6WA 4B08A 2ZJQQ 3VGTA 5L1IA 3OSPA 2HK3A 3J7AG 4G6VB 3P45B 4DV1J 4C11A 1NJIT 3W2VA 4ILRA 1OQ3A 4DV3J 3HD1A 3PY8A 4URLA 4K0KI 3GIJA 5B08A 2P9EA 1N0UA 2JE6B 1KWMA 2NREA 4ED7A 3CCMS 2QSWA 2F7VA 3L7ZA 5BR8I 2QLBB 4AIMA 1UWBA 4DR2E 1IKYA 2MY8A 3J81Q 3KUEA 5E2QA 4JI7J 3C6UB 1F3FA 3UD3P 1RHRB 2NN6E 2OEMA 1X4HA 1GXUA 1Q79A 2I9SA 2E7WA 2KI2A 4KO0B 4C8KA 2XS7A 2EEYA 2ZUGA 3IR6B 5CZXA 2CQCA 2X1AA 4OHWA 3G71S 3TX0A 1VJWA 4DQIA 3WIUA 3KJFB 5LMNF 1TQLA 2H3EB 3ILOA 1FE0A 2XGPA 4JV5J 4P2XA 4OV6A 1RREA 4YFUA 4RBTA 4NCGA 1Y5LB 4NXNJ 3MAQA 2QRRA 5GAEU 2M0GB 2UXCE 2BQRA 3OJSA 4WIQA 2G9OA 2YNFA 3JB9k 1W26A 3X3UA 2WVBA 2MKIA 4NXMF 1YQHA 1UWAA 4RO0A 2CG4A 3KG4A 2IVFB 4USVA 1X5SA 3U1MA 1S4EA 3DOKB 3FZBA 4YB7A 4C7QA 3V6DB 4WUBA 2YPZA 5AT1B 3KJQB 2GX8A 3K5OA 1QJHA 2FVPA 2UU9F 3A3PB 3N5FA 1QUPA 1HBOA 2GC8A 4X4TA 2L3MA 2AJQA 4M5LA 4WJBA 5HVFA 2QFJA 4DUYF 1FJCA 3QYYA 2CPFA 2LQ8A 3ZTQA 2LA4A 4Y0FA 3G6VA 2XS2A 2KHCA 1LW0B 3RAMA 1Q5YA 4ZLJA 1J5OA 4ETZA 2XMAA 2C2DA 1YJ9S 2UUBJ 4PXCA 3OTOI 3CWVA 4DEZA 2CQ2A 2FHKA 1Y4UA 4DV2E 4Q44A 1WI6A 1C0TB 3W8GA 2JEFA 1ZAXA 2K7KA 1S9EA 2A10A 4K59A 4ZOSA 4F0KA 1HQUA 3OQ2A 2EFPA 5E41A 1HQ2A 4F4XA 2BE7D 3BH7B 1XNRF 1C1BB 1SQFA 1RDRA 2R7QA 2ZEJA 3M32B 4JI4E 1HFEL 3DDKA 3P3GA 1YLXA 2ZBPA 2RAQA 1WC0A 3NOGA 3K89A 4IG0B 2GW8A 1FDNA 2B4PA 4N8NA 4WU2A 4AT1B 1PJ6A 1C2PA 3HVAA 1F9HA 2VG5A 1YGYA 1RU2A 1YKWA 1R7IA 2Z2YB 3CC7S 3U1KA 3OVBA 3TZZA 5B7WA 4L73A 4I68A 1N34F 5A6WA 4IZKB 2W7PA 2CPJA 2QZ8A 3PJWA 3MDFA 4UOHA 2YKNA 2UVVA 4AFFA 4DV2F 2B9EA 4O3NA 1HR0E 2LA6A 1FVQA 4ED6A 1X8DA 2WW8A 3WHIA 1EHWA 4LF9E 3VGSA 1SL0A 1FERA 2B8PA 1B4SA 2B3TB 4R5PA 4DSFA 4WF9Q 4X66I 2UUCI 4ELUA 1H0HB 4H4OA 1U1OA 3OFGA 2VFTA 4JI0I 2XSJA 2GV1A 1S1UB 3CVKA 3M7VA 3G8SA 2XYPB 1S0MA 2IHR1 3PIPQ 2FJWA 1QSLA 2R7UA 3JTPA 1KRPA 1BQMB 2UUWA 2L08A 4YR2A 4DV7F 4TXSA 1Z5BA 2ZOMA 3MCSA 1K1SA 2Q1LA 1FJ7A 2XY5A 4LR7A 5ELWA 4ZVHA 4PRFA 4QCLA 4IFDB 1O6XA 4W92B 4DUYE 1RAHB 4J9LA 3PEHA 4A8QA 4A8WA 2W7OA 1JB0C 2F8MA 5KFXA 3EZUA 3CC4S 4X62J 4JI6J 4JOUA 5HBMA 3IG1B 3KHLA 4B3TI 1XNRI 3HT0A 2I6WA 4IFVA 4J9KA 1RYRA 2HYIB 3BSCA 4LIRA 4LSNB 4X65F 2KFYA 2ZH9A 3M6AA 1FRHA 1HBNB 4ED3A 4P2SA 4ECTA 3PW2A 1OS5A 2LLZA 4MH8A 1L3KA 5DM6Q 2EK1A 1L5UA 1CJTA 4IH5A 2JNJA 3MM9A 5KOXA 3J81C 3VWSA 2QMXA 2CPHA 2OTJS 5C5JA 1UP1A 2RIJA 3US5A 2DVIA 3PR5B 3HJFA 2NXEA 2HWIA 3H2UB 1CC8A 3I56S 1HYSB 2YX1A 3LO3A 2V9WA 4JI8F 2VC1A 4DCPB 4EBEA 1RTIA 1IBKJ 1HNXI 2WNRA 1Y4SA 4KKOA 3GIRA 1XK8A 2N7YA 2XI2A 5DLFA 3NKYA 2IJNA 3QAEA 3UCUP 1QE1B 2FVCA 3AAWB 1NLKL 4ZPTR 2XBPA 4NXMI 2J0XA 3Q8VA 2BA0D 4DBQA 4LF4E 2OPSA 1T8EA 2NN6F 2WZ1A 2P9GA 1N5VA 4EUVA 2CG9A 4MU1A 1FDDA 4LCGA 4OMFG 7FDRA 2RJZA 2DNKA 4OHZA 3QRPA 5KFBA 5K36C 1OY9A 2CQDA 2MHEA 1RUSA 3CJ8A 4E98A 5KG2A 1SJFA 1AFIA 4FWHA 4CO5A 3EXCX 3PKYA 3NWGA 1NZAA 3JQJA 4WP3A 4N56A 3CE8A 1FFWB 2O67A 4ZPBA 1VYAA 4ED8A 2MTLA 3HHLD 1BWEA 2BV3A 4OX9F 1ZTTA 3FQKA 3DHWC 3O3LA 4AE5A 3Q8YA 4HH1A 5SZTA 2LXFA 5LXRA 5JXSA 2LYVA 2BRLA 4KE5A 3VGVA 3W2WA 1JX4A 1C1BA 1KHVA 3ZKBA 1XMQE 4M5DA 4FDFA 3D3BJ 4KFBB 4QW8A 4E0DA 4JI3I 3ET6A 4UT4A 4V19J 4OZ0A 4C48A 1WACA 1FX4A 2Q2EB 4JI5I 2I8EA 5JEAF 4FYVB 2RDDA 2KZMA 4DPOA 1YRXA 1RU1A 2XG8A 1HWKA 3IA0A 4O4GB 4DV7J 3T1YJ 4JI8I 1RT1A 1X5OA 2G1HA 3VV2B 5HL7Q 2HHTA 1HL6A 3LALA 1KKHA 4DV2J 5LOQA 2HLTA 2UVUA 2CVIA 3BO2A 1N32F 1SJ1A 3D4JA 1QAJA 4N41A 2EWHA 3ZZPA 4X62F 4H4KC 2J9DE 3NY0A 4X66F 3DOKA 1XWLA 2MLYA 4IG3A 2VPWB 3RB6A 3CJKB 3VCDA 1NHUA 5IT9U 3OL9A 3D9BA 4B3SE 4I2PA 5A6PA 2HKEA 4MIBA 4LF4I 2FPHX 2R7WA 1NK4A 5LMUE 1P27B 1CJKA 1V3RA 2Z2ZA 2G1DA 3TR5A 3B8HA 4Q45A 1D0EA 2DHHA 2A18A 4Q7AA 2E5LF 3DMJA 4HHUA 1FDBA 3DDIA 4I56A 1U1LA 2AIRB 2DT9A 2NYIA 2V6AA 2YVSA 3LPEA 3NGUA 5IS2A 1IJEB 5DGAA 3LP1A 3K1JA 2X7IA 4UTGA 4DV3I 4LF8E 2B8QA 3L95X 1MROA 1UA1A 3Q6MA 4A8SA 3U27A 1TL3A 1VIOA 2XMUA 3M2VB 3T1YF 1N8RT 1S0VA 1S7HA 3LWMA 1UWBB 1K73T 4QWDA 2AP6A 2Y8WA 2B9XA 1Q8BA 2AEFA 3SXLA 4ELTA 2HVHA 4B3RE 1TL4A 2BE2A 4ZVQB 2W01A 2XLJA 3TAQA 2DK2A 3CC2S 2VFSA 1U1KA 4BHQA 4C8MA 2DNRA 1N33J 5IWAJ 1S6QA 3M8PA 3T3FA 2PIIA 4FW9A 4DV4E 4DV5J 4NLOA 4MK8A 3JQMA 3ZNJ1 2JOQA 3P3DA 5J1EA 2R7VA 1I3OB 4FZVA 4U8VA 5A8RB 3CCJS 4DV1F 3TARA 1W25A 2N3LA 4WE1B 4B9MA 2CPIA 2H5IB 4UOFA 4Y65A 1CBKA 5K9FA 3T6JA 1ZYQA 3EDRB 4JYAF 3N79A 3W62A 1H7UA 2DHSA 3HK2A 3M85G 1N54B 2AJ4A 3DXSX 4DOZA 3VGUA 3W7BA 4YMEA 2E5HA 1VHFA 1SJ4P 3CD6S 1FFGB 1X4FA 2BKNA 1PAEX 4OI6A 4MAKA 1PKPA 3AA8A 3HD2A 3KK1B 2ABYA 5DDOC 3OBIA 4Y2IA 5A2QU 4ZVEA 3GIKA 4QBUA 4DLGA 2OI2A 3UVJA 4NBQA 1TMMA 4NLTA 1TR0A 5ETPA 4DUZJ 2LKZA 1JMTA 1LW2A 3RUBL 1XERA 4OI2A 5D4NA 4DSEA 1NH8A 1S1TA 3IRXB 1KIJA 3CJRA 4PXBA 3U1YA 4EFAC 4WTYA 2AE8A 3EE3A 1RTJB 4OO1A 4ANDA 5GMKa 2YWEA 3NCQA 2RF2A 3HVTB 1LWEA 3QQCD 1ACMB 5AE2A 4Y28C 5JVGQ 4KKOB 2L48A 3H2LA 1BE4A 2B7BB 4DR6J 2NPIA 2ZM6J 1XNQI 3I87A 4CLLA 1Z4UA 5KFKA 2DPJA 2YQ0A 4J9OA 1IWGA 1S79A 1XIQA 3D6HB 3H8YA 5HROA 1AB8A 2AT1B 4PEOA 3ITHB 4KGKA 2VJUA 2QSFA 1YVFA 2IA0A 2AYMA 1KVKA 3FVYA 4EZ6A 3KUGA 4DFMA 4HT7A 1VOMA 1JLFB 4USUA 3AHPA 5DJBA 2HS4A 5CA5A 2KG1A 3H7HB 3FJ2A 4LF9F 1UTAA 3Q2SC 3R2CJ 3ENQA 3DCAA 2QMUB 2MXYA 2H4YB 3GP9A 5BYSA 4RNOA 5J1EB 3C14A 1VQOS 3PYGA 4RKUC 1BD6A 4IFVB 1R43A 3SIPB 3W65A 2FVQA 1X4EA 4LBHA 1R6MA 3QPIA 2C42A 3Q1QA 3HZGA 4IFDE 4OO1F 2GHPA 4CDIA 4LJMA 1IKWB 4UUWA 4CYUA 4DX8H 1D9AA 1I5OB 2XZWA 2MSSA 2PMHA 3P96A 4P75A 4YHHJ 3T1HI 4HY1A 3IC1A 1SBRA 3CCRS 2WP8A 2UXCI 3ZZ0A 3T5KA 1CJVB 1UW4A 4OYPA 3UD4P 4ZP7A 3MOJB 2FZKB 3FK4A 4C0OC 5DRPA 3PEJA 3T6BA 5L8RC 3KHGA 5EWGA 3ZTOA 3R7NB 2KYXA 5IM0B 4LUBA 1TKDA 4L3KA 1MLAA 2X36A 2NCKL 1CG2A 1WELA 3KLEA 4TKTA 2C28A 4RU9A 4FW4A 1FRXA 3E2EA 1N32I 2J6TA 3J7AN 2R7TA 4AM3A 1DQ9A 3TZWA 3LAKA 2GMLA 3I96A 2FHJA 3IBCB 3LF0A 2O5DA 1VQ8S 3E3XA 4DQPA 5GAGI 4GMKA 4U7UD 1XMOI 4UZCA 4ED0A 3DGPB 2UXBE 1FX2A 5CAAA 3KK2A 1GTEA 1FJGF 1YJWS 3H0PA 3EZ5A 1E6YA 2IJRA 5BR8E 1NXIA 3GFZA 3K57A 2YQ1A 5HATA 4WU3A 3HJCA 4FNHA 1R27B 2DB1A 4KGXB 3I6PA 1YZ6A 4U7UK 4KT0C 1VRUB 1RLDA 3O8WA 3DLKB 4KHMA 1JQGA 3NGSA 4DV6F 4JV5E 2HNYB 4LF6I 1S9FA 2JFDA 1AUDA 4OZNA 3RJMB 4P6QA 4AQYJ 2C39A 1XEZA 1T03A 2HG4A 2D74B 5K36F 2VFUA 1IBLJ 2VQEF 3W8PA 1S1VA 4QIGA 1LFWA 2JL9A 2ZE2A 3H59A 2LECA 5L46A 1VISA 3BM7A 3QGIA 2JEBB 3MPUB 3LP2B 5K8PA 4DR1I 1TKTA 4KSEB 4JUZA 3I9ZA 5HMXA 1NZ0A 2PNMA 4FW5A 1EP4A 3Q8PB 4R0JA 2HZCA 1FKAE 2AEMA 3M8SA 4WKYA 1JJHA 2VZ9A 4DUZF 1NHVA 4OI0A 2J76E 5KG7A 1P42A 1MWZA 3OXLA 3N6LA 3PJXA 4OYOA 4HKQA 4R1FA 1YBUA 4I7FA 1HNZE 2GVDB 1DBDA 1RTHA 4B02A 2DGTA 4RW8A 3TUJC 4DR2F 1JNRB 3DOMB 4I0WA 4LFBI 3KLGA 2BBEA 3M8WA 5CYMB 1F5AA 1OYDA 2CJAA 2CUYA 2G2ZA 4NXMJ 1SL1A 1S5ZA 1X9WA 1MN9A 2V67A 3HSDA 4X2BA 4AUKA 3I5CA 3JTOA 2HNYA 5E5NA 2BA9A 2CQ3A 3VQTA 1NKCA 4JI3J 1V3SA 3CJ0A 2YKPA 1AXQA 4QIVA 4ZJQA 4DPTA 4NLYA 3P3CA 2ZBCA 4K4UA 1FRIA 1RWVB 4KB7A 4NCGB 3KK2B 1DQAA 3DGPA 3M30A 3PV8A 1YIJS 2BA1G 1RA6A 4EBDA 4LF2A 1WWHA 2XZDB 2VJVA 4LMZA 2D9OA 1CULB 7AT1B 4WZQA 2MJNA 1S57A 2VA2A 2FIUA 1HR0J 1HNWF 1WTFA 3W66A 2O01C 3SV4A 2G4BA 2XM3A 3CIZA 2V4QA 2BXJA 3M05A 1KP6A 4LRAA 4Q0BA 2UVRA 2YH0A 1CJVA 3NAHA 2RQ4A 3JTNA 2YNGA 3KUHA 3NL0A 3WU4A 1RK8A 1T3NA 1VRTB 1IR0A 1M1GA 4ECQA 2M2BA 4LFBF 2Q6CA 2R7OA 1RTDB 4OO1E 2HHHF 2D69A 3ZFVA 1XMQF 2EC0A 2C38B 2R8JA 3RR7A 1HBMA 1YJVA 2XNRA 5GVQA 2CJ9A 1WF0A 2Z5CA 3PVXA 4PQAA 1VR6A 3BGOP 3KK3B 2W9CA 3CCUS 4ED4A 5LM7E 2V8VA 1R0AA 2DH7A 1BQNB 3MECB 2D9PA 2YWFA 3MPWA 1RAJA 5IXUA 1HMVA 4FYXB 4MTPA 2E1MC 3U1LA 4S0MA 2KL8A 3NLCA 4QYZK 1ZS6A 1AFJA 4LF7I 4CZCA 5T7LB 3DDNA 1TK5A 1NPPA 3NCRA 4PCQA 4DR4I 5GAGU 2DHXA 3R9LA 2H5EA 5A8KB 1ZETA 5JVHQ 2G0IA 4O0NA 1YZ7A 4NZ7A 2N4CA 1T9YA 4TY8A 1JWWA 1IQZA 2J8AA 3NNAA 1TKXA 2VQFE 2R7RA 3N9UC 4WFNQ 1USVA 2V2KA 1T02A 2PT0A 3EDQB 3NS5A 4R5PB 1XBWA 5D0GA 2MKJA 2Y0BB 2Q66A 2NN6C 1SC6A 2WBRA 1I94E 4YR0A 1UETA 3BYRA 3EZOA 4IFDD 3GIIA 4DR4J 2DO0A 2JFKA 2WOMA 1IBLF 2O3ZA 2WP8B 3N5BA 4USJC 1YJNS 2UU9J 1HI1A 3EVMA 2ZKUA 3E8OA 3BH6B 3OTOF 4QYZJ 4IZKA 2YKMB 3FBBA 1JLAB 1RT5B 1N88A 3Q89A 3J7YI 3NS7B 3HPOA 2NSCA 4DR7J 4KQZA 4MU3A 3UVJB 2OMLA 2Z56B 4J9RA 1GXLA 2WONB 2EC2A 1L3VA 1XNQF 3CCWA 2W8KA 2MB0B 3M32A 4JI6I 3TVZA 1U6ZA 3TJAA 1BLUA 1KBRA 1BWVA 3LUYA 1HQUB 1RADB 5I3PA 3RRGA 1Y5NB 3CJ5A 2B0GA 3K8VA 5D3GB 4QU6A 5LL6R 2QE5A 3GMEA 1JLGB 1YK9A 2C1EB 4Z2XA 3QRQA 1JK9B 3QJJA 4DPUA 1R6LA 5GADI 1RA7A 3C46A 3F41A 3QGGA 2YH1A 1QAXA 2WVCA 3PDNA 2B6AA 1U1RA 1X5TA 1S0OA 1J5OB 3V6KA 2VD3A 3TUPA 1NHJA 1RQ0A 4F7VA 3GIMA 1S1XA 1C0UA 5LMUJ 2H4WB 1RWXB 1UDQA 3TVYA 2UUBE 3LGNA 5F8JA 2EKNA 1UJ6A 1WKJA 3KG1A 5HO4A 1NHIA 5B09A 3M9OB 2C2RA 2LQJA 3EPIA 2Z4PA 3GYXB 4K0KE 2QJ3A 5FIIA 4HI1A 1RSCA 2XMMA 1IM4A 1REGX 3UO0A 3ZTPA 2DKOB 2M9KA 1S10A 1A9NB 4PRVA 2CDRB 3C6TB 5F3TA 2AKWB 5D78A 2B7CB 1FKPA 3KMSA 3LPSA 4OYWA 4C98A 1NSQA 1JJ4A 3ZZOA 4R8UA 2RT3A 1OPZA 2M52A 4AQYE 2LEPA 1USUA 4DV0F 4NLXA 4CM2A 5ADZA 1VRQC 1AUSL 1Z0VA 2HNDA 4IFYB 3FBEA 2F4VI 3IP0A 4F2RA 2YNHB 1UL3A 1RWNB 1BUXA 3AH6A 3UPFA 5F9NA 3IBFB 2PMZD 3MR6A 3J81Y 4TYAA 5IC4B 3D0HE 1BMQB 2XWXA 3H40A 2HW3A 2IYIA 2BA1D 1Q78A 4U9RA 5J1NA 3TOQA 2M5YA 3W5YA 4BCAA 2IESA 2UUBI 2DTJA 3F56A 1CS4B 2BJ8A 2V9KA 5B0GA 3CJ4A 5HP1A 2JEJA 4KGMA 4LFCI 2CAJA 2HQIA 1REVB 4L72B 3JS9A 4B9VA 2MLXA 5K8OA 2XY6A 1FJEB 3W2VB 1KDNA 2V8PA 2KXHA 1P1TA 3IXQA 3HKZD 5L38A 3OL8A 3GONA 3ILLA 4W4MA 3TX8A 2XQCA 1UVNA 2VF3A 2LQ5A 5DQHA 3CCSS 3O6QA 2R42A 4JYAI 3CD5A 2RUGA 2VDHA 4NLDA 2KM8B 1YH8A 3JAMQ 2DBBA 2UXDJ 1NPRA 2DGWA 3N0VA 4YHHF 2HBYB 2VG6A 4ZP8A 4CH0S 1NPKA 4AL6A 4CH7A 2WTFA 3CPWR 4LFCJ 4G1PA 1IBCB 5A2QY 3OPKA 3PZPA 5I3UA 4WIIA 4JI0J 3PYFA 1VLYA 3PW0A 4M5DB 2GMJA 2QFIA 2UV8A 1VMBA 3VF0B 1RT2A 2XYHB 5CD4H 3MM8A 4FVMA 1PC5A 2HHUA 2GFFA 2HVEA 4N3OA 1GX6A 3GJQB 3P06A 2XNQA 1W2IA 3AODA 2ZJRQ 4ZCMA 1TK0A 4J9MA 2J0WA 1NEEA 1NK7A 1Q81T 2E1CA 1YTYA 4JI8J 3A8EA 3HSJA 1T7PA 2UZAA 4LF6E 1SH3A 4BC7A 2E66A 2VBWA 3GR1A 2J7KA 3QLHB 2MKSA 2MZJA 4KH0B 4DQRA 1WOOA 1X0FA 4ENOA 4CTAB 3NMRA 5LSRA 3KMQA 2CPZA 6FDRA 2PO4A 1UDSA 1HBUB 1N52B 2AYEA 1MNEA 3Q0AA 3D0GE 1HNZF 2VQFI 3VAIA 5L3JA 4X84A 3FBCA 4CO1A 1S1WA 1FNXH 4QIEA 2I1RA 3DLJA 4JI0F 1KFSA 5C7PA 1G2EA 4M94A 3NWRA 4DXLA 1U45A 3MEGB 1KN6A 2EBEA 2LQBA 4NLGA 3CDBA 1NO8A 3MM5A 3QWUA 2NQPA 2PO1A 4B3TJ 1XNRJ 1VDHA 2QL5B 3H20A 4NEYA 2DGUA 3M6VA 3VAGA 1NU4A 1QVFR 2BKPA 3MAAB 4M5KA 3CDWA 5BXIA 2VQEI 2MLZA 5B0AA 5KTQA 1LKZA 2AWZA 2JC1A 1ELOA 4Y6IA 3HVWA 4DL4A 2CGEA 1VBZA 1RBOB 1S59A 4RJVA 3CJ2A 3R6GB 3WZ0A 5M2PA 1FEEA 2IA6A 2PFFB 1ZA1B 1ZXNA 3CTRA 3ZNUA 5LSLA 1YSJA 2HLUA 2OHDA 3EGWB 4K4TA 2AYGA 2Z5BA 4W90B 3D0IE 1JLCB 5KOWA 2KFNA 2V2ZA 1SL2A 3LH2S 4NCBA 3UDLA 1KEKA 4PWDB 4UOCA 1J2VA 1Q8IA 4K4YA 1JXEA 2HMIB 2JLEA 3FSYA 4KBIA 4RW9B 3MR3A 1Z0BA 3ENAA 2Q6BA 2WSCC 5G0RA 3M2UB 4DR7F 4JI7I 1GNKA 1KQSR 4J9UE 3CCES 2W9BA 1KLNA 1YJUA 1RT3B 2GO9A 4DR6F 2HPUA 2DO4A 5E3PA 4Z7CA 2QYCA 3EYZA 4DWIA 4I67A 2B6AB 2ZD1B 4HACB 4R25A 1S99A 3BGLA 5ETLA 3SV3A 2ZFHA 2OKQA 2PA3A 4IH6A 4TU7A 2OELA 1VQSA 2VV5A 5MAOA 4KJIA 3K85A 5KT4A 4K4XA 1QTMA 2HHSA 2C2OB 3D6FB 3GFYA 1SUQA 2ZH8A 2XMKA 3DLGB 4HLBA 2Q79A 1FHTA 4PPDA 5GAEI 4DR5J 4DS4A 1U2RA 2UUAJ 2ASYA 1P1LA 2XZTB 3M8QA 2MQ8A 3MR7A 3UDEA 5EX0A 5KFDA 3AD9C 2V8HA 3RZAA 1NK5A 2FLPA 1Y4ZB 1K44A 2CXEA 2R8GA 3O2IA 5J2PB 3HHKA 5B0DA 2JVRA 1VHIA 5IWAF 4YHHI 1SIZA 4RW6A 2EPIA 3UNGC 4ZPWR 4DMZA 1VQMS 2YTCA 1UPMB 1L3SA 2DGSA 5AXMA 4KHPI 3EICA 5U47A 3TP2A 3AJDA 3U02A 3THVA 4M8LA 2X1BA 2O1PA 2ZVIA 1HI8A 4GO7X 1PC4A 2HZVA 1FVSA 2AEJA 1TU0B 1VJQA 1S48A 3OJUA 4LVOP 5B0EA 1U25A 2HK2A 2C3OA 3CF5Q 1RHUB 4DR6I 4DU7A 2DEIA 1QD1A 4FYWB 2QGFB 2JZ5A 3MFIA 3LW5C 2MQLA 1XMOE 1MU2B 4U3DA 2L9WA 3BKUA 3MEDB 3BBBA 4KRWA 3UWTA 5KFWA 2UUAF 1OIAA 2KXNB 1FJGJ 4AQYI 2ZH2A 1R8PA 1JLEB 2FB0A 4P7VA 3FCWA 2LXUA 3HMJG 3PS2A 1SV5B 1N34I 4Y2CA 2F9DA 5KT2A 2W1BA 2UXBF 3GCWP 3WX8A 1K0TA 4QIWD 3NXZA 4QZVB 4OLOA 2DHGA 2HFOA 4I4BA 4G1QA 4C97A 1S49A 4CP5A 4ZJLA 4EU0A 1RAAB 2IC3A 5A8WA 4URSA 3QRRA 3PW5A 2C2ZB 1F60B 1NH7A 2BABA 3HM9A 2APOA 2VG7B 4ZHRA 3PIOQ 3FMWA 3CIMA 4GVBA 2ZHBA 4QR2A 2YNFB 4YB5A 1UCNA 3G6ES 2FY1A 2CJBA 3BGFA 1A6LA 4XAKA 4JI5J 1B64A 5DNLA 4OZLA 3SBMA 4G3IA 2R8IA 2CG8A 2RNEA 2WAQD 2R2RA 3T1HJ 3I0RA 5ITHA 2C22A 3OSNA 3SDEA 4Z37A 3SZ2A 2CQ0A 1UKUA 3WDOA 1ZPVA 1SB6A 3QIPA 4MK7A 3G96A 4C2MA 1VRTA 1I94F 1FA0A 1D3WA 4X64I 4DUYI 3SYZA 3B6BA 4PWUA 5D6GA 4J9QA 4QU7A 1HNVB 4B9SA 2DNLA 4CI0B 4DV1E 2V94A 2A1BA 2PGCA 4RWWA 4I69A 4C8NA 2DHAA 1F1BB 3BQ2A 2VA3A 4HXZA 4MU0A 4OYMA 4NI2B 1ICEB 2KDOA 3L7ZB 1S76D 1T9XA 2H48B 2EFVA 1PBUA 3DLLQ 2E1RA 5K5MA 3THPA 4EMDA 1RWPB 1TFYA 3DRPA 5HAOA 3ZZTA 1UAWA 2FJBB 2CQPA 4RW4B 3SSRA 4B3MJ 4LPFA 2IAJA 2UUCE 3M2RB 2JEGA 4OI1A 1H2VZ 2FVSA 3L3CA 2Y9HA 3PRDA 5FLXY 3BF4A 1WC6A 4LF1A 4Z7YA 3VQSA 1NKBA 1A6FA 4DX5A 1HR0I 3RU0A 1RCOB 3Q8QB 1X9MA 4ZVRB 1HNIB 2WW4A 4DV7E 4DR3E 1FK9B 1VK3A 1RCXB 2GGPB 3MMBB 2X1GA 3HI9A 1DLOA 3TAMB 3JQKA 2CQGA 1T11A 3IBWA 2H1YA 2VPZB 3PG9A 4DL7A 4IQMA 1VC5A 1CPZA 1R3NA 2ZZTA 2GVZB 3TZXA 1SIWB 1SV5A 3PRBA 1TL1A 3J7Z5 4GC7A 2OIHA 4X4NA 3MM7A 2C3PA 2RS8A 4MYTA 5SUHA 5T41A 4B9UA 3PX0A 4DR4E 1WHVA 1HNWJ 5EX3A 3OR2B 4CO0A 4ZLNA 4USIA 3OFEA 4U96A 4M95A 2LU1A 2IM1A 2OPRB 3SQGB 4LR9A 1M5HA 4CLKA 4LSZB 3QJPA 4K0KF 4JI7E 3UFCX 2DR5A 2DR8A 2CQ4A 1OQ6A 3B82A 1OWXA 4EYHB 4Q2MA 2DNZA 1R0AB 1WD6A 1HW9A 4DSJA 4DQSA 1EA6A 4A8YA 4BLGA 5KFSA 4QWEA 4O44A 4K4WA 1IKXA 1YITS 1RWMB 4LFBJ 1WC3A 1LOUA 4IDKA 4B3TE 1T9VA 2E5IA 1DURA 4LF8F 1EX8A 4Q8EA 4NA3A 3GV7B 4DF4A 4C8LA 2AV5A 3M8RA 4IOAQ 2P2CB 3I0SB 4QIFA 4A4JA 1ZPWX 4X4QA 1T05A 4CM0A 4EBCA 4A8MP 3BO3A 1PVGA 3UN2A 1NAQA 3Q8SB 2QLJB 1WC5A 5D4OA 3SCIE 4NL5A 2DXDA 4JYAJ 3M8ZA 2IERA 5D77A 2DNNA 2WSEC 3NAIA 2LFVA 1IKVB 5ETQA 1YHCA 5C0XC 2YNHA 4K4VA 4UY85 1ZOTA 5IWAE 4DV6I 1UFKA 3FSIA 1RT6B 1FXRA 3DRSB 3T9NA 4K0KJ 3MAHA 4LFCF 1YBAA 4A8XA 2IPOB 3TANA 4DR1E 3UCGA 2OD6A
chains in the Genus database with same CATH topology
3V2UC 4YY3I 3ZKDA 1FNMA 5FLXC 5A2QQ 3PYGA 2UXDE 3Q1QA 4I3HA 4DV0I 3ZZUA 4LF6E 4JV5I 3T1HI 4DUZI 1Z0WA 4HY1A 2UXCI 3ZZ0A 3V5RA 2Z5BB 2A2CA 4LF4I 1MG7A 4ZVIA 2X36A 2UXBI 4X64E 3OTOE 1N32I 1HNXE 4DPWA 1XMOI 3QT5A 2UXBE 5BR8E 2LJPA 3HJCA 4LFCE 3WU5A 4JV5E 4LF6I 3Q6NA 4JI8E 1HNWE 2NPFA 1VISA 2HFSA 1NZ0A 2GQ0A 2PNMA 5FWKA 4OX9I 4LF8I 3J7AM 4R1FA 4IZJD 4DR2I 4JI1E 1HNZE 2Z5CA 5LMNI 2BM1A 1N36I 4LFBI 4JI0E 4LF5E 3T1YI 4LF7E 3T1HE 1ZM4A 4XTJA 1IBKE 5FLXQ 1XNRE 4YHHI 4DPTA 3QT6A 2HHHE 5IT9Q 4NXNE 4JI2E 4X62I 3LTOA 1H72C 3PYEA 1KTVA 4DV5I 1HK7A 2VQEE 1IBLE 1IBLI 4X65I 3WU4A 4FWDA 4DR3I 4PU9A 1D6TA 3WU6A 1FI4A 4ED4A 4JG4A 1EI1A 2UUAI 2O1TA 4DR7I 1IBKI 1H73A 1ZM3A 4GKJE 2Z5EA 4DPXA 1Y6ZA 2XEXA 2Z5CB 4LF7I 4JI4I 1N36E 4LFBE 4DR4I 4X66E 4X62E 3K17A 1J5EE 4GKJI 1HNZI 2GS8A 2EFGA 2VQFE 1B62A 4IZJB 1USVA 4OX9E 5LMUI 1I94E 2E5LE 4JYAE 4P7AA 4DV4I 1HNWI 4IZKA 1XHKA 1ZM2A 1FJGE 3T1YE 1MU5A 1Z5CA 4B3ME 4JI6I 4DV2I 4FWGA 1N0VC 4KQVA 4LFAI 3JAMC 4JI5E 5LL6R 3PYDA 2IOPA 4DPUA 4DR6E 4YHHE 1NHJA 4LFAE 4RPFA 1Z0EA 4B3SE 4WUDA 1IBMI 2HK3A 3J7AG 2UUBE 1FWKA 1NHIA 4K0KI 2HFUA 4HYMA 4DUZE 4K0KE 1N0UA 4PRVA 5BR8I 3LNUA 4DR2E 3LPSA 3J81Q 4LF8E 4AQYE 1USUA 4YY3E 2ZITA 1Z0VA 2F4VI 2ZM6E 1RREA 2UXCE 4B3MI 2UUBI 1XNQE 4LFCI 1FJGI 4KHPE 1IBME 1S4EA 2UUAE 4WUBA 2V8PA 3GONA 3ZM7A 1FKAE 2VF3A 1H7SA 4JYAI 2R42A 3JAMQ 4DPYA 1N32E 3OTOI 3CWVA 1Y4UA 4DV2E 3PYFA 4JI6E 1Z0TA 2CZ9A 2O1WA 4N3OA 3P06A 4JI4E 4GKKE 4DV5E 2HKJA 4URLA 2IOQA 1OJ4A 3J80C 4DV0E 2J7KA 5A2QC 4IZKB 1MX0A 5GMDA 2VQFI 1HR0E 5L3JA 4LF9E 1J5EI 1Z5AA 4X66I 2UUCI 4DXLA 4DV6E 5IWAI 4JI0I 4X65E 4LF5I 2BM0A 1ZXMA 1S16A 4DU8A 2VQEI 1N33E 1Z5BA 1ELOA 1RR9A 1Z59A 2A2DA 4JI2I 4LF9I 1ZXNA 4DUYE 2Z5BA 2HHHI 2V2ZA 4B3TI 1XNRI 1WUUA 3B78A 3M6AA 1Z0BA 4JI7I 1H74A 4Z7CA 3J81C 4HACB 3HULA 2ZBKB 1B63A 2F4VE 1N34E 2V2VA 1HNXI 1U2RA 1Y4SA 4DV7I 4NXMI 4LF4E 2PNLA 2CG9A 3K85A 4KHPI 2V34A 3H4LA 4FWHA 5LMNE 4JI1I 4B3SI 1BKNA 2BV3A 4IZJA 2UXDI 2ZM6I 2HK2A 5IT9C 4DR6I 1Z0GA 4DU7A 2DEIA 3ZKBA 4NXME 1XMQE 4JI3E 1XMOE 1XMQI 4JI3I 4UT4A 2Q2EB 4AQYI 4JI5I 1N34I 4JI8I 1K47A 4DR5I 1QZRA 1UEKA 1KKHA 3D4JA 4DR5E 2HKEA 1I94I 2E5LI 5LMUE 1ZM9A 3F0NA 3B8HA 2O1VA 4X64I 4DUYI 3K1JA 2X7IA 4UTGA 4DV3I 1Z0CA 3Q6MA 4DV1E 3WU3A 4HXZA 2UU9E 2E1RA 4EMDA 4B3RE 4FN5A 4WUCA 3ZZTA 4MYUA 4USMA 2UUCE 4M1KA 4Z7YA 4FW9A 3QT7A 1A6FA 4DV4E 1HR0I 3J80Q 4USKA 2WW4A 4DV7E 4DR3E 4DR1I 1NHHA 1H7UA 1N33I 2R3VA 4B3RI 2AJ4A 4DR4E 4MYTA 2UU9I 1PKPA 4JI7E 1FWLA 2OI2A 3B82A 2O1UA 4NXNI 4DR7E 1EA6A 4B3TE 1KIJA 1PIEA 1PVGA 3QT8A 2DEJA 4PRXA 1DARA 5GMEA 4GKKI 1XNQI 4P52A 5IWAE 4DV6I 2V2QA 3PRYA 4DV1I 1KVKA 4HACA 4DV3E 4DR1E 2CGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2U C;  4YY3 I;  3ZKD A;  1FNM A;  5FLX C;  5A2Q Q;  3PYG A;  2UXD E;  3Q1Q A;  4I3H A;  4DV0 I;  3ZZU A;  4LF6 E;  4JV5 I;  3T1H I;  4DUZ I;  1Z0W A;  4HY1 A;  2UXC I;  3ZZ0 A;  3V5R A;  2A2C A;  4LF4 I;  1MG7 A;  4ZVI A;  2X36 A;  2UXB I;  4X64 E;  3OTO E;  1N32 I;  1HNX E;  4DPW A;  1XMO I;  3QT5 A;  2UXB E;  5BR8 E;  2LJP A;  4LFC E;  3WU5 A;  4JV5 E;  4LF6 I;  4JI8 E;  1HNW E;  2NPF A;  1VIS A;  2HFS A;  1NZ0 A;  4OX9 I;  4LF8 I;  3J7A M;  4R1F A;  4DR2 I;  4JI1 E;  1HNZ E;  5LMN I;  2BM1 A;  1N36 I;  4LFB I;  4JI0 E;  4LF5 E;  3T1Y I;  4LF7 E;  3T1H E;  1ZM4 A;  4XTJ A;  1IBK E;  5FLX Q;  1XNR E;  4YHH I;  4DPT A;  3QT6 A;  2HHH E;  5IT9 Q;  4NXN E;  4JI2 E;  3LTO A;  4X62 I;  1H72 C;  3PYE A;  1KTV A;  4DV5 I;  2VQE E;  1IBL E;  1IBL I;  4X65 I;  3WU4 A;  4FWD A;  4DR3 I;  4PU9 A;  1D6T A;  3WU6 A;  1FI4 A;  4ED4 A;  4JG4 A;  1EI1 A;  2UUA I;  4DR7 I;  1IBK I;  1H73 A;  1ZM3 A;  4GKJ E;  4DPX A;  2XEX A;  4LF7 I;  4JI4 I;  1N36 E;  4LFB E;  4DR4 I;  4X66 E;  4X62 E;  3K17 A;  1J5E E;  4GKJ I;  1HNZ I;  2GS8 A;  2EFG A;  2VQF E;  1B62 A;  4OX9 E;  5LMU I;  1I94 E;  2E5L E;  4JYA E;  4P7A A;  4DV4 I;  1HNW I;  1XHK A;  1ZM2 A;  1FJG E;  3T1Y E;  1MU5 A;  1Z5C A;  4B3M E;  4JI6 I;  4DV2 I;  4FWG A;  1N0V C;  4KQV A;  4LFA I;  3JAM C;  4JI5 E;  5LL6 R;  3PYD A;  4DPU A;  4DR6 E;  4YHH E;  1NHJ A;  4LFA E;  4RPF A;  1Z0E A;  4B3S E;  4WUD A;  1IBM I;  2HK3 A;  3J7A G;  2UUB E;  1FWK A;  1NHI A;  4K0K I;  2HFU A;  4HYM A;  4DUZ E;  4K0K E;  1N0U A;  4PRV A;  5BR8 I;  3LNU A;  4DR2 E;  3LPS A;  3J81 Q;  4LF8 E;  4AQY E;  4YY3 E;  2ZIT A;  1Z0V A;  2F4V I;  2ZM6 E;  1RRE A;  2UXC E;  4B3M I;  2UUB I;  1XNQ E;  4LFC I;  1FJG I;  4KHP E;  1IBM E;  1S4E A;  2UUA E;  4WUB A;  2V8P A;  3GON A;  3ZM7 A;  1FKA E;  2VF3 A;  1H7S A;  4JYA I;  2R42 A;  3JAM Q;  4DPY A;  1N32 E;  3OTO I;  3CWV A;  4DV2 E;  3PYF A;  4JI6 E;  1Z0T A;  2CZ9 A;  4JI4 E;  4GKK E;  4DV5 E;  2HKJ A;  4URL A;  1OJ4 A;  3J80 C;  4DV0 E;  2J7K A;  5A2Q C;  1MX0 A;  5GMD A;  2VQF I;  1HR0 E;  5L3J A;  4LF9 E;  1J5E I;  1Z5A A;  4X66 I;  2UUC I;  4DXL A;  4DV6 E;  5IWA I;  4JI0 I;  4X65 E;  4LF5 I;  2BM0 A;  1ZXM A;  1S16 A;  4DU8 A;  2VQE I;  1N33 E;  1Z5B A;  1ELO A;  1RR9 A;  1Z59 A;  2A2D A;  4JI2 I;  4LF9 I;  1ZXN A;  4DUY E;  2HHH I;  2V2Z A;  4B3T I;  1XNR I;  1WUU A;  3B78 A;  3M6A A;  1Z0B A;  4JI7 I;  1H74 A;  4Z7C A;  3J81 C;  4HAC B;  3HUL A;  2ZBK B;  1B63 A;  2F4V E;  1N34 E;  2V2V A;  1HNX I;  1U2R A;  4DV7 I;  4NXM I;  4LF4 E;  4KHP I;  2V34 A;  3H4L A;  4FWH A;  5LMN E;  4JI1 I;  4B3S I;  1BKN A;  2BV3 A;  2UXD I;  2ZM6 I;  2HK2 A;  5IT9 C;  4DR6 I;  1Z0G A;  4DU7 A;  2DEI A;  3ZKB A;  4NXM E;  1XMQ E;  4JI3 E;  1XMO E;  1XMQ I;  4JI3 I;  4UT4 A;  2Q2E B;  4AQY I;  4JI5 I;  1N34 I;  4JI8 I;  1K47 A;  4DR5 I;  1QZR A;  1UEK A;  1KKH A;  3D4J A;  4DR5 E;  2HKE A;  1I94 I;  2E5L I;  5LMU E;  1ZM9 A;  3F0N A;  3B8H A;  4X64 I;  4DUY I;  3K1J A;  2X7I A;  4UTG A;  4DV3 I;  1Z0C A;  4DV1 E;  3WU3 A;  4HXZ A;  2UU9 E;  2E1R A;  4EMD A;  4B3R E;  4FN5 A;  4WUC A;  3ZZT A;  4MYU A;  4USM A;  2UUC E;  4M1K A;  4Z7Y A;  4FW9 A;  3QT7 A;  1A6F A;  4DV4 E;  1HR0 I;  3J80 Q;  4USK A;  2WW4 A;  4DV7 E;  4DR3 E;  4DR1 I;  1NHH A;  1H7U A;  1N33 I;  2R3V A;  4B3R I;  2AJ4 A;  4DR4 E;  4MYT A;  2UU9 I;  1PKP A;  4JI7 E;  1FWL A;  2OI2 A;  3B82 A;  4NXN I;  4DR7 E;  1EA6 A;  4B3T E;  1KIJ A;  1PIE A;  1PVG A;  3QT8 A;  2DEJ A;  4PRX A;  1DAR A;  5GME A;  4GKK I;  1XNQ I;  4P52 A;  5IWA E;  4DV6 I;  2V2Q A;  4DV1 I;  1KVK A;  4HAC A;  4DV3 E;  4DR1 E; 
#chains in the Genus database with same CATH topology
 1SQE A;  5HSP A;  1FKA F;  2KO1 A;  2R8K A;  3RAQ A;  3D5M A;  1FKP B;  9RUB A;  1V5I B;  2HUR A;  4U7C A;  1ARO P;  1SQG A;  1T94 A;  5JEA C;  5E7O B;  2EBG A;  3V81 A;  3OUY A;  1FNM A;  2OPP B;  4EO8 A;  4BA1 A;  4ZIW A;  4ZS6 A;  4HH0 A;  3RAX A;  4RW9 A;  4F3O A;  1SC4 B;  2EW9 A;  3DXB A;  2ZUA A;  2C37 A;  2CQH A;  2B56 A;  2BR0 A;  4DV0 I;  3ONQ A;  3M7N G;  2JT2 A;  1YRU A;  3ZZU A;  3HKW A;  2KM8 C;  3KLI B;  1RJJ A;  4AL7 A;  4RW7 A;  4CT9 A;  3V81 B;  4FF1 A;  1Z0W A;  2V5H G;  5ETR A;  5LL6 d;  1KD1 T;  5E3R A;  2IIH A;  3UDV A;  5JEA E;  4F36 A;  3V5R A;  3QNW B;  3BR8 A;  2Z5B B;  1Z5C A;  4A46 A;  1XNQ J;  2WSF C;  2HWH A;  3IGV A;  2VOP A;  5A76 A;  3DN9 A;  4FF2 A;  1UVL A;  2UXB I;  3AQO A;  4OKG A;  2CPY A;  2PA8 D;  4P73 A;  3OTO E;  5KG6 A;  1PG5 B;  1U24 A;  2PMW A;  3LQV A;  2ZBI A;  2JRS A;  1OYP A;  3QT5 A;  3CJ3 A;  1HR0 F;  1G7C B;  4RUA A;  3T19 A;  2C3M A;  2WBM A;  3D6T B;  5J2N A;  1NK6 A;  4QJV A;  1NJX A;  2HNZ A;  3BRE A;  2EVZ A;  2LJP A;  1IBM I;  1Q53 A;  1SI9 A;  3FFI B;  4OLP A;  2A6O A;  3GFH A;  4L3N A;  2ADC A;  4LFC E;  5IC6 B;  2KXF A;  4WYL A;  3ZXW A;  2A0F B;  3Q6N A;  4LF8 J;  2NZC A;  3B4D A;  4F3Q A;  3VAK A;  4IS9 A;  5HI7 A;  4DG1 A;  3W63 A;  5K36 A;  2FYX A;  2CNO B;  4F3M A;  1PGZ A;  1M1H A;  2FJE B;  4PPZ A;  2CJY B;  4QWA A;  5K14 B;  4DSI A;  4JI4 F;  4PQU B;  3IWX A;  4WFZ A;  4FYD A;  1A0O B;  1HNW E;  3T1H F;  4MIW A;  1D9F A;  2ADB A;  4B9L A;  4DSK A;  2KKH A;  4ID5 B;  1NK8 A;  3AB2 B;  1SCJ B;  4O44 B;  3GCM A;  3HKM A;  1JLB A;  1UEU A;  2HFS A;  5I42 B;  3OR1 A;  3V4M A;  4LF4 F;  1VC0 A;  5FWK A;  3T41 A;  5CCM A;  2C2K B;  5ETS A;  4XK8 C;  5GAD U;  5EWF A;  2OFH X;  3U7J A;  4DUT A;  1VQ4 S;  3M8Y A;  2WVE A;  3SQG A;  3QBC A;  3J7A M;  3Q8U A;  4JI1 E;  1GMV A;  2QTW A;  3UR0 A;  3MCM A;  4KV8 B;  4NEZ A;  1U6B A;  4DCO B;  4IOB A;  3GIL A;  5I3U B;  4HL9 A;  2VOD A;  5LMN I;  2HQF A;  1VCT A;  3CCL S;  2RQC A;  4OJ3 A;  3MEC A;  1KVI A;  4IRK A;  2XHW A;  1BXN A;  3GSI A;  4N47 A;  2BJ1 A;  4IO9 Q;  2HHV A;  3CDU A;  4M5N A;  4ETX A;  3T1Y I;  2PNZ A;  4JI0 E;  4LF7 E;  4XDD A;  2MY7 A;  2HZA A;  2XLI A;  1N5Y A;  1B7Y B;  1LK7 A;  1U26 A;  3D54 A;  4PG5 A;  2ATC B;  3EMT A;  3IR5 B;  4F4A A;  2HGN A;  5DG9 A;  4DR4 F;  4DG1 B;  4PXE A;  1DTT A;  4DL0 C;  5FLX Q;  4OX9 E;  2DR9 A;  2FJV A;  5M2R A;  1AT1 B;  1Q95 G;  1XNR E;  4BS2 A;  2OH2 A;  4OZJ A;  3DRP B;  3QT6 A;  1CS4 A;  2W9A A;  5DNX A;  2IAJ B;  2M88 A;  1J5E F;  2DRD A;  3M6U A;  1XJW B;  2CA9 A;  4A8K A;  3V4I B;  4J37 A;  4MMO A;  3MWB A;  4CO4 A;  1TTH B;  2HIQ A;  2OLW A;  2MKH A;  2XMW A;  1RWO B;  1PAU B;  3A4T A;  3BDP A;  4V1A k;  3LTO A;  4OHV A;  2KH9 A;  2E1P A;  3DNC A;  1HNV A;  1K8A T;  1H72 C;  4FW6 A;  4X62 I;  4ZVS B;  1FFS B;  1DJ0 A;  1URR A;  2XS5 A;  1R89 A;  2MDA A;  2VQE E;  2FC9 A;  4DV5 I;  1GFW B;  1F3V A;  2HND B;  2WB1 D;  4LSL B;  1EET A;  2K1R A;  3PTW A;  4MFB A;  5FDL A;  4XPE A;  2E29 A;  4H4M A;  5C24 B;  2XO7 A;  2XC9 A;  1IBL E;  5HQM A;  3RB0 A;  3V4I A;  2HSE B;  1N5T A;  1WG4 A;  1CJK B;  1FRJ A;  1N36 F;  3CCT A;  3RR8 A;  2ZC4 A;  3V6H A;  4JI3 F;  1RE1 B;  5A0Y A;  4WK3 A;  1ITP A;  2OFG X;  3OT9 A;  3NOC A;  4DR3 I;  2ALY B;  1U2F A;  4ZVF A;  1DTT B;  1RHY A;  3QFW A;  3WU6 A;  2DRB A;  1FI4 A;  3T1A A;  2IBO A;  3AY0 A;  4IG3 B;  2IC3 B;  3K5M A;  4F4Y A;  1SKS A;  1LXN A;  4JG4 A;  2HHW A;  2RSQ A;  1UEV A;  1EAR A;  4OZ5 A;  3QFH A;  2OPQ A;  5KFR A;  1UVI A;  3M4X A;  1ZM3 A;  4EO6 A;  4WXW A;  1S9G B;  4DPX A;  5KFY A;  1TL5 A;  1Q86 T;  1ZAW A;  3EUN A;  3W5X A;  4DZD A;  4HTJ A;  4DFK A;  4FBU A;  1Y6Z A;  4KV8 A;  2Z5C B;  2BOA A;  3ZZY A;  4YS2 A;  1DAX A;  4R0E A;  4TVA B;  4DV4 J;  1TVR A;  4U3B A;  3P3E A;  4JP8 A;  1N36 E;  1JLE A;  1R8H A;  2HQ3 A;  1ZZN A;  1B3T A;  1RKI A;  4N8O A;  3UI3 A;  2ZZN A;  1MWY A;  1NUE A;  2E7V A;  1K9M T;  2B4O A;  3K17 A;  3RW7 A;  3UCZ P;  1IBK F;  4V19 X;  2Y1L B;  3KNA A;  2P8I A;  3PS1 A;  1J5E E;  1HNZ I;  5LJ3 Y;  4FW3 A;  3MPY A;  1HWL A;  4LF6 F;  2MQO A;  4IZJ B;  3BPS P;  5LMN J;  3UHM A;  2IM2 A;  3ENV A;  1TKZ B;  5AE3 A;  1UVM A;  5LMU I;  3H42 A;  3MTJ A;  2L41 A;  2E5L E;  2VES A;  4U6P A;  1NZ8 A;  3Q23 A;  2HAF A;  1IUJ A;  1T3O A;  2HFZ A;  3ZC4 A;  4B3M I;  1V5V A;  3L7P A;  1F9F A;  2C39 B;  1SXL A;  4OV1 A;  1T05 B;  2FJD B;  4C8O A;  4X64 F;  1X4A A;  2YX7 A;  2UUT A;  4IR1 A;  1HNW I;  1SC1 B;  3R2D J;  1VK8 A;  2BJ7 A;  1XHK A;  1ZM2 A;  3J81 U;  5DO2 A;  1R6V A;  5JMN A;  2OD4 A;  2G0C A;  1GTH A;  1XXE A;  4WP9 A;  3NCP A;  2V69 A;  4CH1 A;  1XTZ A;  3VAH A;  2PD1 A;  4JV2 A;  5EL9 A;  4B3R I;  1HWI A;  4ZPD A;  1HQE B;  1Q7L B;  4DV2 I;  2G13 A;  2HBQ B;  3BDE A;  1N0V C;  4DZ6 A;  2CWX A;  2CAD A;  1LWX A;  2IRU A;  4X4R A;  1WNE A;  3JAM C;  5JEA D;  3ZO7 A;  1RTI B;  4ECV A;  4AXJ A;  3RBX A;  2RHS B;  4YDD B;  1Y0H A;  2IDL A;  4ITS A;  4MKV A;  4PG6 A;  5KFE A;  3DLE A;  4YEA A;  3MFH A;  2BAN B;  4OYZ A;  4WFY A;  2H65 B;  4F0M A;  5AXN A;  1RT3 A;  3MPV A;  3Q24 A;  3BQ0 A;  2C2E A;  4DR6 E;  2AMC B;  4YY3 F;  3VAL A;  4ZMM A;  2DCL A;  3BQ1 A;  3DM2 B;  3WC0 A;  1GT8 A;  2RVJ A;  2W24 A;  2QC3 A;  4ISA A;  4WUD A;  1DFD A;  2DNY A;  4LRC A;  2WRM A;  1QTN B;  3BGR B;  1N32 J;  4PWD A;  3KOA A;  3B4T A;  3ZZZ A;  2HFU A;  1V9O A;  4I6A A;  2QLX A;  3RBZ A;  2CNL B;  4A8O A;  2BOP A;  3GU0 A;  5FJ4 A;  4DUZ E;  2X51 A;  1HBM B;  2D3O R;  2W7A A;  2XTJ P;  1VQN S;  4CIO A;  2AJ2 A;  1VQP S;  3LNU A;  2RDI A;  2VIC A;  2UUC J;  2GHW A;  4W98 A;  5L9N A;  3KLV A;  3CD0 A;  3MZI A;  9ATC B;  1EET B;  4TY9 A;  1OY8 A;  2LEA A;  3RRH A;  3MAA A;  4F02 A;  2LXI A;  2OAU A;  4B3T F;  2QV6 A;  4KPY A;  3K5P A;  4YY3 E;  4Q0B B;  4OZE A;  4B3S F;  1G4C A;  4JI5 F;  2ZIT A;  1EQ0 A;  2M8D B;  3ISN D;  4IFD F;  2W2Q P;  3ETM A;  5CYQ A;  2RKI B;  1CEZ A;  2YNI A;  3CME S;  4ZVO B;  4DR3 F;  1M90 T;  4M5M A;  2ZM6 E;  3M7N D;  2I38 A;  5IV4 A;  2DD8 S;  2EG1 A;  2VFV A;  2W4D A;  3C16 B;  4QW9 A;  3EPG A;  4CCH A;  1FXD A;  2KFZ A;  5KFI A;  4TNO A;  5J2M B;  4HHJ A;  3PO4 A;  3F44 A;  1T9U A;  2FDN A;  3LPY A;  2ILY A;  3M30 B;  3VZH A;  3S7R A;  3WIV A;  3CMA S;  3MUR P;  4LRE A;  4QYR A;  3TA0 A;  1N33 F;  1IBM E;  2YKA A;  1XMO F;  5B0F A;  3I32 A;  2HFN A;  3A3N B;  4DV5 F;  3CJT A;  3ZZR A;  3KKF A;  2MQM A;  1EAY C;  3IRX A;  5HMZ A;  1DQ8 A;  4P72 A;  2KVQ E;  1QLN A;  4YR3 A;  5EUH A;  4XIU A;  1NME B;  2OTL S;  3AT1 B;  4C8Y A;  1O5J A;  4P10 A;  1J5E J;  5F0W A;  2XMT A;  5BR8 F;  2CJK A;  4DPY A;  2F3J A;  2KT5 A;  2DNG A;  2F1F A;  1QUV A;  4PAA A;  2ROP A;  1UJ4 A;  2HHQ A;  2JHE A;  4IG0 A;  3SQO P;  2LMI A;  3CW2 C;  4DL5 A;  1JXV A;  3FDS A;  4K2J A;  3RB3 A;  2EK6 A;  3MEK A;  3MF5 A;  1Z0T A;  3CUL A;  3FNN A;  2BA0 G;  1MU2 A;  2CZ9 A;  2CKW A;  4NCA A;  2OP5 A;  1C0T A;  4QPX A;  4WFX A;  2N82 B;  4ER8 A;  4ELV A;  4IH7 A;  4C3L A;  4DV5 E;  3SFG A;  2GHV C;  5KT7 A;  2QL9 B;  1OJ4 A;  1AYE A;  1JLB B;  2JX2 A;  2MZS A;  3I9V 9;  4ZCK A;  3VHQ A;  1KHW A;  5EHH A;  5LT5 A;  1OSD A;  4PYA A;  5BYR A;  4U95 A;  3K5L A;  4X4O A;  1NDK A;  3Q2T C;  2WCX A;  4L76 A;  2VHG A;  3MTK A;  4X66 J;  5A2Q C;  2HVI A;  3W3S A;  1HWU A;  1S4F A;  4Y2M A;  1S6Q B;  2VPX B;  3M8P B;  5KFP A;  2OJ3 A;  3MPD A;  4P2M A;  4GQU A;  1H3D A;  2YQ3 A;  1C1C A;  1Y3J A;  2J5A A;  2VAS A;  3HSG A;  3QO9 B;  5GMD A;  4L75 A;  4U67 Q;  4RNM A;  2FJA B;  2LDY A;  5HVG A;  1NSK L;  4B3R F;  1EB0 A;  4DX6 A;  2AD9 A;  2OSQ A;  2E5L J;  2VQF F;  3PS3 A;  5E3A A;  1WG5 A;  1WHW A;  3HZE A;  1JNZ B;  2QMW A;  5KFA A;  5KG4 A;  4E2F B;  1NSP A;  3PJ9 A;  4YP3 A;  3LAN A;  3GTY X;  4XO0 A;  3MI7 X;  3KHH A;  2NZ4 A;  3DRR A;  4ZP6 A;  1I51 B;  5IWA I;  4DV4 F;  4DV6 E;  4LF5 I;  3C66 A;  2BM0 A;  4DN9 A;  2OUG A;  5KAK A;  1Y3K A;  2FGO A;  2XB2 D;  2B43 A;  3CDJ A;  1U6F A;  4HR2 A;  3R7B B;  5DZ7 A;  2IVM A;  4DU8 A;  1IBM F;  2CVE A;  1N33 E;  2DNO A;  3DMJ B;  1RAG B;  3IM8 A;  5CHC B;  1NM2 A;  3KLE B;  2CDQ A;  1M5P C;  8AT1 B;  1R0C B;  2RD5 C;  4DL3 A;  2AU0 A;  2NXN A;  1VBK A;  1UZH A;  2ZOG A;  3SEO A;  5DG7 A;  1U1Q A;  1HPZ B;  2HRT A;  4GKJ F;  2YXL A;  2HHH I;  5G0R B;  2WB4 A;  4RNN A;  2DNH A;  4ZJO A;  4YB1 P;  4NRT A;  2JE6 A;  2BJ9 A;  1PYT A;  2EI5 A;  3DLB A;  4DHV A;  1H2T Z;  3LA0 A;  6FD1 A;  1XMO J;  4OO1 C;  2OPP A;  2B5J B;  1RBA A;  1HPZ A;  2CNK B;  1HHQ A;  4JI1 F;  4K50 A;  4QNK A;  3GZ7 A;  4G1Q B;  4LRF A;  1JLC A;  3MCO A;  2KB2 A;  2XMV A;  2GO3 A;  5E33 A;  4B3S J;  2D41 A;  2XGQ A;  1Y5I B;  4ZVT B;  3KJV A;  5DDP C;  1R8A A;  2QEX S;  2ZWO A;  4TU9 A;  3HUL A;  1IJF B;  2K2P A;  2Z30 B;  3KYL A;  2KRR A;  4LQ3 A;  1UDN A;  4LF7 J;  2ZBK B;  2POK A;  2F4V E;  4AXI A;  4LCH A;  3GG1 A;  3EWG A;  3GG0 A;  2V2V A;  3GR0 A;  4BWJ A;  3M9M B;  2MKY A;  5DDQ C;  2GQC A;  3JSY A;  4I1T A;  4GKJ J;  4ZK7 M;  3PAC A;  1S7I A;  2J8S A;  4NA1 A;  4YOE A;  4NLW A;  1SKW A;  1RB0 A;  5D4P A;  2OO4 A;  4NRU A;  4B3M F;  4X4V A;  3CSK A;  2IRX A;  5C0X D;  2G2Y A;  1X4D A;  4CLZ A;  3FQL A;  2C2N A;  4QR0 A;  4KAI A;  3OLA A;  2CQB A;  5DET A;  4DDF A;  3KLF A;  4RWX A;  4NZ6 A;  1LK5 A;  4ZA1 A;  2CJX B;  3H4L A;  2FQQ B;  3I0S A;  2Z8Q A;  5LSO A;  4USW A;  2DGX A;  2P5V A;  4TQR A;  5J2P A;  3MCN A;  5F9L A;  2E7X A;  1EJ7 L;  4OJG A;  2UVW A;  4J9S A;  3H5X A;  1X0P A;  4JI1 I;  2PNZ B;  1BKN A;  2KT3 A;  4IZJ A;  5KFF A;  2UXD I;  3BJY A;  1DRZ A;  1RZM A;  3CB4 A;  1RYS A;  5IT9 C;  4F0H A;  4C9D A;  8ATC B;  1Z0G A;  3OR2 A;  5HK4 A;  2DGQ A;  1U1P A;  1NJZ A;  1NB7 A;  1TVR B;  1KVJ A;  1NBE B;  3PNI A;  1U2C A;  2P6S A;  3M6X A;  2DY9 A;  2HBZ B;  1WOR A;  2VL1 A;  2FZG B;  4QOT A;  1LWF A;  2EFN A;  1NK0 A;  2GO8 A;  3H5S A;  1K47 A;  3OFF A;  3EXY A;  1OPI A;  3ICL A;  2I5J A;  2PO0 A;  4QNJ A;  1G3O A;  2CYY A;  1QZR A;  4DR5 I;  1O0P A;  3J80 U;  2FJX A;  1I1G A;  1UEK A;  3A1Y G