3PYFA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with amp-pnp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
296
structure length
296
Chain Sequence
SVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 80
structure length 296
sequence length 296
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pyfA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pyfA01
4LF9I 4DUZE 2UUAE 4DR3E 2HHHE 4B3SI 2VF3A 4B3RI 4URLA 2X7IA 1N36I 1IBLI 2AJ4A 1K47A 3WU4A 1NZ0A 1I94E 2R3VA 1FKAE 4DV7I 1NHJA 3B82A 3LTOA 1ELOA 3WU5A 4JI7I 1HR0I 2Q2EB 2VQFE 1N34I 4DR6I 2BV3A 4JG4A 3WU6A 5FLXC 3QT5A 5BR8I 4DV6I 4K0KI 4DV5I 3B78A 3HULA 4LF9E 3T1HE 1BKNA 2A2DA 4OX9I 4B3SE 4B3RE 2V2VA 1N0VC 4B3MI 1N36E 4DPYA 1IBLE 1HNZI 1OJ4A 2V2QA 4DV7E 4JV5I 2DEIA 1ZXNA 1QZRA 1HR0E 3JAMQ 1XMQI 1N34E 4DR6E 4JI1I 1D6TA 5A2QC 4MYUA 2E5LI 3B8HA 2UXCI 3PYFA 5IWAI 3J80Q 5BR8E 1Z0CA 2OI2A 4DV6E 4K0KE 4JI4I 4DV5E 1MX0A 4OX9E 3H4LA 2HFSA 4B3ME 4PRXA 4DR5I 2UUCI 2X36A 4X66I 1HNZE 4JI0E 1HNWI 4DR4I 4JV5E 4LFBI 4YHHI 1H74A 3PYDA 1WUUA 4GKJI 2VQEI 3J7AG 3F0NA 1XMQE 2VQFI 4JI8I 4JI1E 4NXNI 1MU5A 4UTGA 2UXCE 3V5RA 4DV3I 4HACB 1EI1A 4JI4E 3J81C 4RPFA 3T1HI 2WW4A 4FWHA 5LMNI 4DV2I 4FW9A 2DEJA 1NHHA 4DR5E 2UUCE 4X66E 1IBMI 1HNWE 4DPTA 4DR4E 4LFBE 4YHHE 4ED4A 2R42A 4P7AA 4XTJA 4GKJE 2VQEE 4JI8E 4NXNE 1PVGA 1H73A 4DU8A 3V2UC 2BM0A 2V8PA 1B63A 1ZM9A 4DV3E 1HNXI 3PYGA 4PU9A 3M6AA 4WUDA 4LF5I 1ZXMA 5LMNE 4DV2E 4JI5E 1Z5BA 4JI0I 4JI3I 1IBME 4DXLA 1XNRI 4HXZA 4ZVIA 3CWVA 1B62A 3ZZ0A 4P52A 1S16A 4JYAI 1Z0BA 3ZM7A 1A6FA 4LF4I 1Z0VA 1IBKI 3LPSA 1HNXE 3PYEA 2UXBI 1MG7A 4USKA 1PIEA 1FWLA 2BM1A 1XNQI 4LF7I 4LF5E 1FJGI 4KQVA 1XMOI 4JI3E 4X65I 4DV0I 4NXMI 1J5EI 4R1FA 4LFCI 1XNRE 1H7UA 4GKKI 4LF6I 1XHKA 2HKEA 1ZM3A 4JYAE 4WUCA 4DV4I 4M1KA 1Z5AA 3D4JA 4LF4E 3QT8A 1IBKE 4DR7I 5FLXQ 1KIJA 1Z59A 4LF8I 2UXBE 2EFGA 4FWDA 1RR9A 4JI2I 3WU3A 2UUBI 1XNQE 5LMUI 4WUBA 4LF7E 4X62I 1FJGE 1ZM4A 4EMDA 1N32I 5IT9C 3LNUA 4JI5I 4DR2I 1XMOE 3J7AM 4X65E 4DV0E 4NXME 1J5EE 3J80C 4FN5A 4LFCE 1RREA 2CZ9A 1FNMA 4GKKE 4LF6E 2LJPA 4HY1A 2HK2A 1S4EA 4JI6I 4DV4E 3T1YI 1N0UA 1KVKA 1EA6A 5A2QQ 4DR7E 3QT7A 1Z0TA 4HYMA 4LF8E 2V34A 2ZITA 4JI2E 1VISA 1FI4A 1H72C 2UUBE 5LMUE 4YY3I 4X64I 4X62E 3ZZUA 4Z7YA 1NHIA 1N32E 4DR2E 4KHPI 2UU9I 4AQYI 2ZBKB 1FWKA 3K17A 2XEXA 4DPXA 1Z5CA 2UXDI 3ZKBA 4B3TI 4DUYI 4Z7CA 4JI6E 3T1YE 4DR1I 3GONA 2E1RA 4HACA 3ZZTA 4LFAI 4DV1I 3J81Q 4FWGA 4YY3E 4JI7E 2ZM6I 4X64E 1KKHA 2A2CA 4USMA 3Q1QA 5IT9Q 4KHPE 5GMEA 2UU9E 4AQYE 1DARA 3OTOI 1N33I 4MYTA 1Z0EA 5GMDA 2J7KA 2F4VI 2UXDE 4B3TE 4DUYE 2UUAI 2GS8A 1H7SA 4DPUA 4DUZI 4DR3I 2HHHI 1Z0GA 1Z0WA 4DR1E 1I94I 3K1JA 4PRVA 4LFAE 4DU7A 4DV1E 1PKPA 3JAMC 2ZM6E 2V2ZA 5LL6R 2NPFA 2HKJA 2E5LE 1KTVA 3QT6A 3ZKDA 3OTOE 5L3JA 1ZM2A 1U2RA 5IWAE 1UEKA 2HK3A 4I3HA 1N33E 4UT4A 4DPWA 2F4VE 2HFUA
chains in the Genus database with same CATH superfamily
2OSQA 1PBUA 4CCHA 1QD1A 2DHGA 1TV6A 4LIRA 3D5MA 1I94E 4IS9A 2QSWA 5C0XB 1Q0NA 1NPRA 1YJTA 1N34I 3SCJE 5DROA 3ULHA 5KFCA 3VVTA 4PWUA 3NOCA 4DV6I 3I0RB 3B78A 3HULA 1TKZA 3T1HE 2I9SA 4CLFA 2RH3A 4B3RE 3WZ0A 1WHXA 3C3LA 4RNHA 1TL7B 4M5HA 1V5IB 3SSRA 2M88A 4A8YA 2KRBA 3OR1A 4ILRA 3MF5A 1HBNB 4JBCA 3MI7X 2XY7A 1S76D 2MQQA 1FXLA 1AUDA 4ZVEA 3OVAA 3QO9A 3BSAA 2QZ8A 3M8YA 1FVQA 4DR1F 1V6HA 3F73A 4OZ2A 5D77A 2CZVC 2L9NA 3V81A 3CDUA 5BR8E 1WKKA 4IDKA 2OI2A 3VZHA 4DCOB 2XQCA 1T3OA 3A8EA 1GX6A 3CJ0A 4JI1J 3OXGA 1SKUB 5KFPA 5F3ZA 3NAIA 1U1KA 3UO0A 3PW7A 2AE8A 4DUZF 2AP6A 2QLFB 1RYRA 2MZ1A 1HL6A 4RNNA 2HHXA 5T7LA 1UPMB 2XWXA 4RNMA 2MLXA 4PG7A 4NRUA 4HACB 3V6JA 4P9SA 2RS8A 5CQGA 5KG3A 3TRGA 5KT3A 4JI8J 3IR5B 3OD2A 3T1HI 4X62F 5D78A 1DRZA 4H4MB 3PW4A 1OQ3A 4FXVA 5L46A 1BWEA 2AGOA 2IVMA 2ZH8A 2IVFB 2O1VA 2JJ4D 3DXBA 3SBMA 4G1PA 4DU8A 1N36F 1C0TA 4U8VA 4R8UB 1NJWA 3AA8A 3SSSA 2MTLA 1IKVB 4UUXA 3MPYA 2MKYA 3L09A 3W61A 4DFMA 5CYQB 1FJCA 2JE6B 1Y6ZA 1DQAA 2OHDA 1Q5YA 1RBAA 2GX8A 1R31A 1HW9A 1MN9A 4LF1A 3EPGA 1KLMA 4LBIA 3MEEA 1FDBA 4QR1A 4N77A 3J81U 1FX4A 2NCKL 3MMCB 4NLUA 2Y9HA 1IBKI 3P6YC 4IKAA 2HQCA 3CCTA 4QWCA 2IA0A 1JK9B 3PHTA 4NPOA 1PAUB 4YP3A 1IR0A 3MAQA 2CJAA 2YY3A 1FRXA 2CQ1A 1X7VA 3N5FA 2CQCA 3GILA 2UXCF 3ZNJ1 4JI3E 1Y9OA 4TU7A 1RISA 4R1FA 2OKQA 2FJEB 4WXWA 5KFZA 4F4WA 1TL3A 1RLCL 4K2XA 1NXIA 1VQYA 4ETXA 5HMWA 1VBZA 3I82A 2N3LA 2B9WA 3EYZA 1KIJA 2EG1A 1RQ0A 1RHKB 3JS9A 3KDOA 4JI2I 1CJUB 1REGX 3GV7B 1XNQE 4NEYA 2R8JA 1XIQA 3TUJC 3CE8A 4LRBA 4ETZA 4DV0E 1VK3A 1AA1B 4IRCA 2QFIA 1RTZA 5K36F 1FNMA 1Y5LB 4LF6E 1RBOB 4HR2A 1S9FA 2H4YB 4DV2F 4ALZA 1TP7A 4ZVOB 1CJTA 4P2FA 1S6PB 1XR7A 1F5BA 2FDNA 2HW3A 1Z0TA 4WIIA 3K2YA 3PY8A 2JL9A 3W9JA 2DGVA 4RBTA 5LMUE 4J9NA 1FNXH 1J2VA 2AJ0A 2IJNA 3ET6A 2DNNA 2Y1IA 1HNXF 3BGOP 1NBEB 2IRUA 2RB7A 1SL0A 4QIEA 2N82B 3FEXB 1NK7A 3EZOA 1IWAA 5D4LA 4UY85 5EL9A 2UU9J 1VC5A 4IG0A 3WQPA 4PWDB 4USHA 3ZZYA 3HT0A 3L7PA 3VTIA 4U3BA 2B5JB 4MT1A 3AD7C 4B3TJ 1X4FA 3J81Q 2MMYA 3I5BA 2WBMA 2FHJA 2JVRA 4WIQA 3B4MA 5C25A 1C0UB 1CJVB 2W25A 4DUYE 4DPUA 2HMIB 3C16B 1WC5A 4WWSA 4HI1A 1NUEA 2VPZB 1V3SA 4CO2A 4P2MA 1C2PA 2IA6A 4DV1E 4XO0A 2V2ZA 4ZA1A 4TYAA 2ILYA 2OPSA 4I6AA 3GCXP 4I3HA 2UV8A 3MAAA 4Y2MA 1YK9A 1X60A 4OYXA 5KFVA 5A8RB 1Q81T 2XZDB 5I3UA 1QUVA 4DS5A 1FFGB 4HT7A 4I1TA 3PW5A 1SJQA 3MTJA 3X3UA 3W9IA 1D09B 4M94A 1S9GB 1RTIB 5CD4H 3W2VB 1UAWA 3HF5A 8ATCB 4K4UA 1NZAA 3PIPQ 2LFVA 3TZZA 2DXDA 1UVNA 2OAUA 1JNRB 4RW8A 3BDEA 4MDTA 2YH1A 3HVWA 2LMIA 3ENQA 1HQ2A 4W90B 4DEZA 4LQ3A 3GFXA 3W1YC 2Q43A 4KHPF 3SIPB 3QMQA 4OO1E 2ZH6A 2JC1A 1YHQS 1VRTA 4PXEA 4KY3A 3HHEA 4RJVA 3EX7B 4P72A 1D6TA 1XERA 3CC2S 2GQ0A 3BQ1A 3HT3A 1EKSA 4CZCA 2R7OA 4NMLA 1K44A 5C7PA 4ED1A 4HKQA 1XMQJ 3C14B 4NZ7A 2GC8A 2ZOGA 4OX9E 5D0RA 4F0KA 1RAEB 3DOKB 5D0GA 2CQIA 4DR4I 2VPWB 3LP1B 2J0WA 4CDIA 2D9OA 4Y0FA 4N7TA 1Y10A 4JI1E 5KFTA 1PJ5A 3CJKA 3GCMA 5ETMA 2J7WA 3LALA 3RAQA 2VASA 2VPYB 3NS5A 4HLBA 2DISA 4PG4A 3V6DB 2BUNA 2BRKA 3I4PA 2AEMA 9RUBA 2VESA 2JEAA 2KHDA 4OO1A 3GQCA 2OH2A 1T9XA 1Q82T 5A2QU 5IQ6A 2NSBA 4F0HA 2FUG9 3TW0A 3S6EA 5LMNJ 2QL7B 3KHHA 4DF8A 5AJ3F 4YDDB 4JI8E 3I6PA 4U67Q 3NGKA 3SZ2A 4MKBA 2H51B 2BM0A 2V8PA 1B63A 5J1PA 1KTQA 5JMNA 2CKWA 1VFJA 2MLZA 4NYOA 1U02A 4QPTA 1J5OA 2DR8A 2AJFE 3K8VA 4ZVTB 4DV6J 4K4TA 1XNRI 1X8DA 1WEZA 3PV8A 3KJQB 4ZMMA 1SL2A 1TUVA 4I68A 2FLLA 4WE1A 3CTRA 4NA2A 2VICA 5HO4A 1R7IA 4FS1A 1ROFA 5EUHA 1REVB 3RW7A 1MN7A 3KJFB 2D41A 1R8BA 4LF7I 3TAMA 3PS2A 2VB6A 1A0OB 2QA4S 3R5DA 3W7BA 5IWAF 1N5SA 3T6BA 1T03B 4NLXA 1N5YA 4ECUA 3PRBA 4Q8FA 1V3RA 1XMOJ 1F3VA 2MJNA 4M1KA 1SXLA 3DRXA 1Y3KA 4NXMJ 2UUCF 1O51A 3TWZA 2ZH4A 3PEJA 4NL5A 2NXUA 4NYPA 1RR9A 1R8PA 1ULRA 3WU3A 4WFZA 2B6AB 3CT9A 2V6AA 2VQFF 4MIWA 2NZ4A 1S1WB 5IT9C 5KT6A 3FEZA 1M0SA 1SH2A 1GX5A 3FMBA 4GKKE 4ZP6A 3UDLA 2UUTA 2J7UA 2B7CB 2PA8D 1WTFA 1BD6A 2XSFA 5A2QQ 1C1BB 3T6JA 1GMVA 1LWEA 1H72C 3M8WA 3AOAA 2ZE2B 4K59A 2P9GA 1BQMB 2KXNB 3ZZUA 1LKZA 4IRKA 4DL2A 2X1AA 5KFXA 1RAAB 2RAQA 5C2CA 4FXDA 5B0EA 2C2EA 1XXEA 2KFNA 1KVIA 3R27A 2HBRB 4PG6A 2HIYA 1G4CA 5KFIA 3POTB 3GV8B 1SL1A 5KG0A 3IN5A 5M2RA 3V4MA 3QRPA 4TLQA 2G13A 4X64E 1HYSA 3D0GE 3FQLA 1FNOA 3THTA 4OL8A 4Q0BB 3PXGa 2DPJA 1FXRA 4LF4F 2UU9E 1ZA1B 1RT4A 1TK8A 4PABA 1P9YA 4MYTA 1VQKS 5G0RB 3UD5A 4B3TE 2XSJB 4E0DA 4L73A 4EBEA 3OTOJ 2DNLA 3MMAA 3MMBB 4X65F 2ATCB 4ZIVA 4URQU 3SQOP 3MM8B 4DBQA 3TP2A 2V4JA 2CNKB 4P2XA 1UWAA 1C4CA 2MB0B 3MEDA 4QQBA 2R8KA 1HBMA 4PYDA 3NMAA 5L3JA 4QZVB 3BH7B 2Z5CB 4DJBA 1OSDA 2AMCB 4JI2J 1YZ6A 4PQAA 1RU1A 4BDPA 1FE4A 3R7BB 1QDUB 1W26A 2DVIA 1FERA 2GJ2A 5KT7A 2F5GA 4LREA 3US5A 3TYTA 2E1CA 1EZZB 4LF9J 4PPZA 2XMJA 3PJ9A 4IO1A 1FO1A 1QVFR 4OO1C 3QSIA 4A8OA 3V4IA 3R97A 3CJ5A 4F7VA 3HX9A 1SBRA 1BKNA 1HMVA 3BO4A 2L9DA 2M0GB 3OFEA 1YWXA 1WKLA 1NDLA 2JEGA 1IKYB 3R8YA 3KLVA 3HVTA 1HNVA 2XNQA 3M32A 1RACB 2R2TA 1HPZA 5DDPC 1UETA 3AB2B 4L3KA 1RTJB 2DNZA 4I2QB 1B4SA 1AB8A 2C28A 3GU0A 3MR5A 4FZVA 4FW3A 4JI4I 4KQZA 1FF2A 1RTHA 2HVIA 2LCWA 3TA0A 3W3SA 4KV8B 3JSBA 4I7FB 1XQIA 1HNZE 1ZZFA 1LW0A 3N4WA 1R0BG 3AH6A 4DWIA 4QYZK 2Y1RI 1F0XA 4GKJI 1AXQA 1XMQE 2HHHF 1L3VA 3IRWP 4RW6B 4A8WA 3NBPA 1F5AA 2CNOB 3J7ZT 1HNWJ 1WDDA 4AL5A 3AQPA 4LFBJ 1Y60A 4J3DA 4S0MA 4WTYA 4MTPA 2YBVA 2PD1A 1MU2B 1LW2A 5KG2A 1GXTA 2C2NA 4RUAA 2J5AA 1Z4UA 2YX1A 3H4BA 1RT6B 5F8IA 2FVSA 2VJVA 4B9SA 1IBMI 1P6TA 2R7RA 2D1CA 2NUHA 2QX0A 2FVCA 2GVZA 3K5PA 2KZMA 2HQIA 1HWLA 2HWHA 2PO2B 3GG1A 4ZN3A 3N9UC 3OVBA 3C6UB 2ADCA 2V68A 2YH0A 4KYZA 1VIOA 1ZM9A 1DURA 2AT1B 3GFYA 4DX6A 2AJQA 3BV8A 4FYVB 2HS4A 5LMNE 1N34F 2ROGA 4JI5E 4XDDA 2IDLA 2M3DA 4FF1A 4DV6F 4ZVIA 2BJ9A 2H48B 3T5JA 2IC3B 3ZZ0A 2E1PA 3ZM7A 4J9SA 2PN6A 3IM9A 1VQMS 1NHKL 3WX8A 4NOHA 3OJSA 5KG4A 3HI9A 4E2FB 5D0EA 3KMQA 1BXNA 2J9EA 4J37A 1U49A 3HVAA 2DYAA 1E3HA 3VWSA 4YB5A 1FDNA 4CO3A 1Q8BA 3RZAA 2SXLA 3RRKA 4ID5A 1SH3A 3SFGA 1XHKA 4J9MA 1RT2B 4KJIA 2HKEA 1VYAA 4OFZA 1ZM3A 3QRQA 1RAOA 4F04B 4H4KA 4J91A 2VG7A 1YG0A 2CUYA 2FLNA 2VC0A 2FJDB 2H65B 5K5MA 1VGYA 1SIZA 3CCVS 1HWKA 3MCSA 5H1SV 3JQJA 4DV4J 2DKOB 5E41A 3RG6A 1HKAA 4JI5I 1XMOE 3J7Z5 4C11B 4NXME 3MM7A 2VU5A 2R7WA 3DU5A 3SMZA 2V8GA 2HHPA 3T1HF 3VAJA 1WC4A 1YITS 1JLGB 5AE1A 4Q2LA 4IZKB 2I1RA 1EA6A 3RAXA 4ZPVR 4LUBA 1K73T 5LJ3Y 5KFRA 3P3EA 2JLGA 2ZITA 3SDEB 3R5JB 3PO4A 2XGPA 2PI4A 2CXEA 2W9BB 1NDCA 2ROEA 1B0VA 1VMBA 3UDCA 3NCPA 4D3HA 2DT9A 3IA0A 1FWKA 4WU2A 1XBWA 1PAEX 4O3QA 2XMMA 5K36B 4KPCA 4RW9A 1AROP 1RT5B 1UZDA 4YY3J 5F8JA 3H4DA 3CD5A 3H42A 3TZWA 1WD6A 3Q83A 4Z7CA 1NDKA 2C3UA 4YR0A 1VQLS 1U1PA 2FTRA 4B9UA 5J2NB 3DGVA 3WC0A 1CJUA 1E6VA 4QWAA 2AEFA 2ALYB 4ATNA 3KXDA 2LQ9A 4MU3A 2FY1A 1IBKF 3R6LB 5K8NA 2PEBA 3IR6B 3GV5B 3M6UA 3L3CA 4LF7J 2F4VI 1T02A 1GXLA 3P5TL 2UUAI 1ZZNA 1S6PA 1RWVB 1HNIB 4ED7A 5M2PA 4WP3A 4DU7A 5HLFB 1WSRA 1UFLA 1YJ7A 1UW4A 3HK2A 1F9HA 2X3DA 3DRSB 4C0BA 3OTOE 1HHTP 1UEKA 2EFQA 3NXZA 2OTLS 1R6LA 4M8LA 4JI2F 1VIXA 2XB2D 1UWBB 4FPIA 3AJDA 2VPXB 3BGRB 3MEGA 4PWDA 1U09A 2NXNA 4NRTA 2GVDA 1OYRA 4UZCA 2B5JA 1ELOA 1YVFA 5IOLA 4OI1A 1YZ7A 1HR0I 2QO3A 2VA2A 4HDHA 5L8RC 3M85D 5C24A 1IJFB 4LJMA 1KS2A 4K0KI 1M5HA 2RD5C 2HMIA 2WVEA 4LF9E 3C16A 2N3OA 1W7WA 2BZ2A 2MKKA 1ZOTA 3KLHA 5J2QA 1YGYA 2ASJA 4DPYA 5GADI 2Z8QA 4JI3F 2NXEA 3KHGA 3DOLB 7FDRA 4JV5I 1DAXA 2CJYB 3NS6A 5GMKa 1TFWA 2PNMA 4IZJD 2OJ3A 3E01B 1N4LA 2DR5A 5KT5A 1LWCB 1VRUA 1RT7B 1EJ7L 2HGNA 2DGWA 4B17A 4J9PA 1M5SA 2EC0A 2KYXA 3LP0B 3PTWA 4Q8EA 2E5LJ 4PRXA 4CO4A 3QZ7A 3GLJA 3IAS9 2JZ5A 2RDDA 2UVVA 3W2VA 3MFIA 2FZKB 3HXMA 1H74A 1WUUA 1XK8A 4JP8A 1VCTA 1S10A 3SCIE 4UTGA 1HD1A 4ZP8A 4CNZA 2HHUA 4IUFA 1S6OA 2WW4A 4H4KC 3R6GB 3UR3C 2CJ9A 1JLQB 5GADU 1HNWE 4DPTA 4LFBE 2RSQA 4DZ6A 4OZJA 4P7AA 3RBEA 5A8WA 1U47A 2AF6A 2R8IA 4CYUB 5ETOA 3N01A 2K3KA 4NMXA 3PYGA 1S1TA 1EIYB 3HJFA 4MKAA 4IH6A 3TZXA 3BBFA 2HVDA 4OLPA 4E8UA 1Z5BA 4PG8A 1F60B 1Q8KA 2HWTA 1WC3A 3DRPB 2ZD1A 3EXYA 3AODA 3GFHA 2OD6A 5DJBA 5IC4B 1DTQB 1TAUA 3OHAA 1X9WA 2DY9A 3R9LA 3KDNA 1MSWD 1QAJA 2B3TB 2HRTA 1OPIA 4LF2A 4F2SA 3SI8A 4OLOA 1U1MA 1PIEA 2KXHA 2CVEA 3GCWP 2HNYB 5DDQC 4M5LA 4NA3A 3P5BP 3QFHA 5KG7A 3A13A 5C5JA 4ERDA 1F2HA 3TAPA 2OELA 1UMJA 3QT8A 2BJDA 2B7BB 4MK9A 4B3OB 2N7YA 1UDSA 4DR4F 4NLTA 3DRYA 4FF3A 4GKJJ 3BPSP 1HD0A 2WOMB 4KH0B 4DR7J 3CJTA 5AE2A 4WTOB 2XGQA 3RB6A 2KL8A 1W2BR 4DV4E 3T1YI 1WF2A 3CMQA 1PYTA 5KT4A 4TKTA 4JOUA 1MWQA 5JVHQ 1CULB 4BA2B 2V34A 1N6QA 1J27A 4OYPA 2AZ3A 3TUZC 1O5JA 3TAQA 2GAGC 3DU6A 2KU7A 3ILOA 5DLGA 3UR0A 3KHRA 3RRGA 1RCXB 3LGNA 3JQMA 4BC7A 2F7VA 1T03A 1NK0A 2DIVA 3HJCA 2DY1A 3I31A 4QYZJ 3MCNA 5IM0B 4AQYJ 3MAHA 4IH5A 2P5VA 4K7QA 5KFGA 1XNRF 3I87A 3OTEA 2B6AA 4YY3E 1U8WA 1QAIA 1S1WA 1S6QB 4DQRA 4USMA 3IGVA 2NN6D 4ZVPB 3SCKE 2R7QA 2OO4A 4OV6A 4LFAJ 3B54A 3FNNA 3DMJB 5F3TA 1JJ4A 3O44A 2MQMA 5F9NA 3BGFA 4LF7F 1Q79A 1KVJA 2XY6A 3RAMA 3P45B 4DL4A 1TUWA 4PUOB 5JEAA 4A48A 4PRVA 1YQHA 2ZE2A 3W8GA 3UW1A 2AKWB 4WKYA 4P74A 3OUYB 2W9AA 2W2MP 5DG9A 1KQFB 1PC5A 2YNGA 4HVZA 3BM7A 4UT4A 1FJEB 3UCGA 3M2UB 1XJWB 4KB7A 2ZEJA 2VF3A 4M5DA 4WK3A 1T05A 3PX4A 1R6MA 2AJ4A 1K47A 1QSSA 3I0SA 3B4DA 4OYMA 4E98A 4GVBB 3MUMP 1PILA 3AD8C 4OJGA 1NHJA 1RDRA 1A7GE 1L3KA 4UQGA 5DETA 3R5BA 1T95A 1CPZA 4FF4A 5F41A 3PW2A 3LP2B 3VAHA 5HMYA 1Q7LB 3FC9A 3VAGA 1HIYA 4CT9A 2C3MA 2QV6A 3DDKA 4FVCA 4QWBA 4ED2A 2A2DA 1BC6A 2PFFB 3JAMU 1N0VC 3X1LB 5CCLA 3M6XA 3DI6A 3HFVA 2RNEA 3GR1A 3MM6B 5C0XD 5L38A 4ES3A 3SFUA 1JLAA 2RQMA 2CNLB 4N3OA 3PYFA 1UCNA 4NLWA 2WB1D 2C38B 3LH2S 3VAFA 5CYMB 3LWLA 4F2RA 2X1FA 5JUMA 4BWJA 4KHRA 4DR5I 2FQQB 4ECVA 2HZAA 1JLFB 3WIUA 4YB1P 2KVQE 2O3DA 4ZCKA 6FDRA 3ZTQA 3OSPA 2Z2LA 2DR9A 1QUPA 3MR6A 4K4ZA 1MU5A 3IP0A 3MZIA 2GGPA 3Q2TC 1T9VA 2J0SD 4NCAA 5ETQA 3G82A 1EI1A 3GTYX 3VQTA 2PNZA 2YTCA 3JTNA 5IV3A 5T41A 2DH7A 3JTPA 1NPKA 1NHHA 2GO4A 2OGUA 2C39A 2VD3A 2W2QP 3A8IA 2MHNA 1NHVA 4J9OA 2ZZNA 3Q6NA 3C8YA 2YKQA 4GO7X 2NXJA 4C9DA 2Z2MA 3W60A 2YKNA 2YKMA 3M6AA 4WUDA 4MU1A 4X64F 2RILA 4IH7A 2HRYA 2J9DE 2GO9A 3HFZB 5J1EB 5KTQA 3NEKA 3G6XA 3NS7B 2B9XA 4Q5VA 5HBMB 5LL6d 2XZTB 1RWUA 4RW6A 1SQGA 1UEVA 5C42B 2DD8S 2KKHA 3M2VA 2O3ZA 2ZWPA 2UXBI 2E1AA 3R5AA 3HZEA 1FWLA 2XYHB 1YDLA 4KRWA 4OHXA 1RT6A 5D0HA 2VG5A 2K7JA 4K2JA 4KSEB 3Q24A 3EVMA 1CC8A 1S72S 3G86A 2EFPA 3LF0A 4JI4F 3W5ZA 3K85A 1TKZB 1EB0A 4WUCA 4N56A 2GFFA 3KWMA 3U7JA 4LF8I 1OY6A 5H9EK 4EEYA 4QIFA 3K58A 2CJKA 4GKJF 1RZMA 3MD1A 4X62I 2J9DA 2ERRA 2W9CA 3QO9B 2B9EA 3NCQA 1U1QA 5JEAC 2G2OA 5F8LA 5ITHA 3V81B 2B51A 4IDKB 2IC3A 5C0XE 3EXCX 3ZTSA 1N32J 3PZPA 2HK2A 1UA0A 5HMZA 5CXTA 2ASDA 4DR7E 5DS7A 1IBMF 1R8AA 4LSLA 1FI4A 4OJHA 4JI6J 3HJVA 2XCPA 3MR7A 1KN6A 3QWPA 4KGZB 3KK3A 4DDFA 5DDRC 5AXKA 5T7LB 3RYLA 1RT2A 4C3KA 1H2UX 2RU9A 4J9UE 2Z57B 2LEBA 2CGEA 5CH7B 1BQNB 4JI7E 5KFNA 1RHYA 1SQEA 4EGLA 4BC9A 4AQYE 2V9KA 4LT6A 1N88A 4K4YA 1C0TB 3R5CA 3TI0A 1X5PA 2KG0A 3IWXA 1TKDA 3WDOA 3K5MA 4G1QA 5KFSA 4QU6A 3ZZOA 2GQCA 2FIUA 3AB4B 4C8ZA 4KIAA 2CA9A 4LFAE 4DR3J 3CCQS 1NCLA 2WRMA 1KLMB 2I2YA 3MEEB 5LL6R 3KHLA 2QLJB 2IJRA 5B09A 2E7VA 3FRZA 4L76A 1VQ4S 4RUCA 5IS2A 2ZJQQ 4DL0C 4DI6A 3MWBA 2GHVC 3OJUA 4JI5F 4NLDA 2A3JA 4UOHA 2PDAA 5E3RA 2VUGA 3D67A 3QFWA 2DPIA 2CPEA 4USTA 4JI7I 1TL3B 4A8QA 3G8TA 5K14A 2MGZA 3Q8PB 4TXSA 4DV5I 1KQSR 3AFGA 3DLKA 3Q8QB 3BO2A 1SV5A 4OYWA 1GQEA 4ECXA 4X4RA 2V2VA 2D3OR 4B3MI 5GAGU 3FJ2A 1B0PA 4ANEA 2Z2YB 2BR0A 1NKEA 1N5QA 2FGOA 2EVZA 2IFXA 3IBCB 4KT0C 1R0AA 3M7VA 2COLA 1NK4A 2Z0GA 1QZRA 2R7VA 1X4GA 4ANCA 2BQRA 4MFBA 1U45A 3GR0A 1UWBA 3CDIA 4ELVA 4X66I 4JI0E 4TQSA 3PO5A 2FHOB 3M8PA 5KFWA 2J6SA 2F4VF 2LQ8A 3SCLE 3T19A 2G2ZA 1B70B 2UUAF 4NXNI 2IM1A 2DHSA 3CEDA 2YQ3A 1AUSL 4IG0B 5F9LA 4YHHJ 3U1YA 3ISZA 2VQEJ 3PW0A 3GZ7A 2ALZA 5E33A 4RPFA 4I4BA 3H0PA 2LXFA 4LPFA 3CCJS 2HHVA 3HHLD 3HSJA 4DV3J 3CD7A 2B8QA 4Y2CA 5C25B 2Y1LB 4EYIB 2AIRB 2F8MA 4NI2A 2UV8G 4XTJA 4Y28C 4ZLPA 3HHDA 2MZSA 3V2UC 4IFDA 5DO2A 3Q8RB 2XBPA 2E5GA 3JYTA 1VQ6S 1HR0F 8AT1B 4ZHRA 3ZFVA 5B08A 3DFEA 5LOQA 1UVLA 3BB5A 1H0HB 4TY9A 5KG1A 4JI0I 1X9SA 4DXLA 1XWLA 5CZXA 1DFDA 3MAAB 4K0KF 4PYAA 4LF5J 1L3TA 3H20A 3OR2A 3OHBA 2MKIA 2C2DA 4ELUA 5I3UB 1TQLA 2CWXA 3LPSA 4FYWB 5DNLA 3KUHA 4JV5F 5KFUA 2E29A 2J0XA 4F4YA 4JYAJ 5HL7Q 4KKOA 2WW8A 2QLXA 5EWGA 1IKXA 3DLBA 4I2PB 1KRPA 2RHQB 1J5EI 2F3JA 4RW8B 5HANA 3CJRA 5DM6Q 2K3IA 1UDQA 2DNYA 5C0XC 1FJ7A 2A0FB 3PFEA 1TL5A 2ABYA 3LNUA 4DR2I 1PYSB 4UZBA 2DGUA 5EN1A 1OY9A 2M4MA 4HT5A 4EBDA 2LJPA 1GAOA 5DGAA 1X0PA 1DJ0A 4Q43A 1JJCB 2W2OP 5DG8A 1H3DA 2IOQA 3FCVA 5B0AA 4J90A 2FC8A 2BE9B 3HD2A 4KGMA 3VAKA 3UVJA 2OIHA 2UUBE 4CLUA 3HSGA 3MUVP 2ZNYA 5KFHA 4WFAQ 4CLSA 1NHIA 1N32E 4QIVA 4JV1A 3CJKB 3WX4A 1MMDA 1HW8A 3JSYA 4USUA 5HROA 4DQIA 2WSCC 2Y1JA 3VAMA 4MKYA 5L1KA 3CMES 4JI6E 2C42A 4WP8A 2JEAB 2KO1A 1VQPS 1RHUB 4OO1B 4HHUA 3NKYA 4MKVA 2JC0A 3TO8A 2WOMA 2ZM6I 2K2PA 3KLEA 4DR1J 3DLEA 3CCRS 3VZIA 3M7NG 3WHIA 2J7KA 1QY7A 2GS8A 2Z56B 3OFFA 3CVKA 4ILMA 3MMJA 2E44A 1GFWB 3CIMA 3BR8A 1NRKA 4LRAA 4OIXA 1HWJA 2VFSA 3K5NA 3R5GA 4MK7A 3W62A 1Y11A 2KXFA 2CPXA 3OSNA 1B64A 2R7TA 3Q6MA 3M8ZA 4X62J 2HFUA 4DR3E 4B3SI 1ZETA 2RQKA 4URLA 3TAMB 1X4HA 1Y7PA 3VR1A 1IBLI 4O23A 3U27A 2O5DA 2R3VA 2CYYA 4AXIA 4DV7I 1X5TA 5CD4A 3IO1A 5FIIA 3DGPA 1N5YB 2G0JA 4DR6I 3T1YF 1DLOB 4RNFA 5FLXC 3Q22A 2EK1A 4OHWA 1XN9A 2IHR1 5KFJA 1FRKA 1UL3A 2VOOA 8RUCA 1U1OA 1RAFB 1YBTA 4IFDC 4Y6IA 3A8JA 1FKPB 3MR3A 1Q78A 2V2QA 4ECQA 4CH7A 3QAEA 4DMZA 4AIMA 3CDWA 2FVQA 2JNJA 4P71A 5H9EJ 1S4FA 5EHHA 3ZZPA 3NGTA 4WK1A 3T9NA 2AYEA 3NWGA 1Q7YT 2VHGA 4JUZA 4AM3A 1X4EA 2UXCJ 2ZZMA 3RUBL 3DCAA 2PO1B 3C15A 1F3FA 1FD2A 3HMJG 3LWMA 1SIWB 3I56S 1D9DA 2CJQA 1YJNS 2QTWA 3PKMA 1SUQA 2XS2A 2MDAA 4ECZA 2WVCA 2QA4G 3CCWA 2CNNB 3CXCR 3IG1A 5DQGA 5JEAF 4CLWA 4EUVA 2WNRA 2E7WA 3AOBA 4FBUA 3D6MB 2KYZA 4MIBA 4R5PA 1HYSB 3G2XA 1YBAA 3G8SA 3BQ2A 4YQWA 2V5HG 3QYYA 1RT4B 4K4VA 2GMJA 4LSNA 4X2BA 4YHHE 2D3ZA 1HLWA 1EKRA 2C2ZB 4DV2J 4ZPCA 2VQEE 2ZH5A 2QYCA 4ZVUB 4L74A 3U1LA 3CCES 2YKPA 1UFKA 3NGRA 3BBBA 3MMAB 2QIFA 4DV3E 3OTCA 3R7NB 4ZPDA 2RKIB 2V4JB 5E3AA 1D8YA 5AE3A 2PO0A 1HNXJ 1HBMB 2DJWA 2RIJA 1NJIT 3E51A 4AT1B 3KNAA 2IESA 2FHKA 3OTBA 2V67A 5IC6B 1NK8A 4PXBA 3B6BA 4IOBA 3K7RA 1Z0VA 1QSYA 3TQEA 1Q4RA 3CJ4A 2FZGB 1U4BA 3GIKA 2J76E 4LF5E 2IPOB 3QIPB 1FJGI 1SC1B 4PXCA 3AJ1A 3V4IB 2WVFA 1EETB 3MTKA 4LFCI 2XMAA 3ADAC 3H2LA 1K0TA 2ZBRA 3BPDA 3D1HA 2MKJA 2KRRA 2Z30B 4JYAE 3ETMA 4X66J 4GC7A 4P75A 3FGVA 4FW6A 4DR5F 1RTDA 4CH1A 2HZCA 2UZAA 4NX9A 1Q53A 4NLSA 5BJRA 2NLWA 1HNVB 2E9TA 2GMHA 3M32B 2ZC4A 4WUBA 1HPZB 1S9EB 4IR1A 3BR9A 3M4XA 4TQRA 1WI6A 5RUBA 3J80C 3Q8SB 1XR6A 5HBMA 1RREA 1UJ4A 1PO6A 3IFEA 5E2QA 5B0BA 2F1DA 1WC1A 5C42A 4OZNA 1RTHB 5LM7E 1RHRB 4O0NA 4HDGA 3JTOA 3N0VA 4AIDA 1W2IA 1LW0B 1HHSA 2HEKA 2ATLA 3EZUA 5ETNA 2V0NA 1M90T 4B9MA 3TA2A 1K1SA 4Z7YA 2GZOA 1FCAA 2Z4PA 3NBPB 3CC7S 1SCJB 1S99A 3BS9A 2DRDA 2WVBA 4XPCA 2JEJA 2HIQA 1T11A 5MAOA 2UXDI 2HFNA 3HHLC 4KHPJ 2ZH7A 1LW2B 2OPRB 2CG9A 4AXJA 2B0GA 2WAQD 1XTZA 4HHHA 1P42A 2W8KA 1DY3A 2GVZB 1NDPA 1CJKA 2IM3A 3L7ZA 1U24A 1IM4A 2LQBA 5GMEA 4CO5A 1Q8IA 1N33I 2UXBF 1RJJA 5K36D 5DDOC 4ZCMA 1JNZB 3P3GA 2BKPA 2EFVA 1BHNA 1NJXA 4DR1E 5K8OA 3BO3A 2MXYA 1NLKL 1BY9A 2GJFA 2HNDA 1I94I 2F4FA 2DGXA 5HI7A 2JEIA 5THWA 3WC2A 2P6TA 5HVGA 4GQUA 2PNLA 3VGSA 1RWPB 3H5YA 2DNMA 4OZ3A 3LOUA 1U2RA 2HK3A 4FW4A 3M9MB 4LF8F 3LUYA 4J9LA 2P2CB 4BHQA 3DYAA 1RI7A 4BA1A 4DUZE 3IMQJ 4B3RI 1WEYA 1VC6A 2HG4A 1TKTA 2MQLA 1LEOA 1BQNA 3I5AA 2I0XA 4DX8H 4A46A 1EQ0A 3G71S 5AJ3J 2PT0A 4ID5B 3FSXA 4YB7A 2VG7B 3PIOQ 1LK5A 5BR8I 3CW2C 1LXJA 2FVRA 3ZZRA 1JLBA 5DGBA 4ZPWR 9ATCB 4IFVA 4EYHB 3NRBA 4V19X 5HVFA 4UY8T 2MJUA 1OYDA 4ZITA 1SH0A 1N36E 1V5VA 4ED8A 4QR0A 2C37A 2RT3A 3Q8VA 1S0NA 3MM7B 2YWEA 1N56A 1PJ6A 2M9KA 2HURA 2DRAA 4OHVA 5G4DA 3QPIA 3KK1A 1E3PA 1R27B 2BJEA 2XG8A 3BGLA 1HI0P 2YQ0A 2WK4A 2LQ5A 1ICEB 3RBZA 3JSRA 1PSDA 3ZTOA 2HFSA 3DLJA 4DG1A 3HO1A 1RWMB 2YNIB 5IWAJ 2VIHA 2X36A 3EVOA 1RWWB 3MECB 4F26A 3BJYA 4RW9B 2W4PA 2JDJA 3FFIA 3NLCA 3D3CJ 2UUCJ 1P1TA 3OV7A 2UXCE 2DCLA 3JSMA 5HVHA 4HH1A 2VQFJ 1E6VB 1HFEL 4FWHA 4KBIA 1USUA 2XWYA 3GIJA 3BF4A 4M5JA 4CLTA 2M8DB 2JVOA 2PSZA 4UF4A 2BANA 1GMWA 1X5SA 1S49A 4DPOA 1XC9A 1I51B 2FYXA 2IYIA 4YEAA 4MU4A 3EE3A 4DV7J 2EKNA 2RQCA 4CLYA 5K36E 2GQQA 1KQKA 4CLZA 4X4TA 4JI7F 4DV2E 1KFSA 3PHEA 1SI9A 1NKBA 1XEZA 4JI3I 4DOZA 2V50A 4OJ3A 3N6LA 2YWHA 4DV5F 1SQFA 1JKHA 2IRXA 3G6VA 1KNZA 1P9QC 4B3MF 1ZAVA 1T8EA 2IBOA 5LXYA 3MEGB 5KFLA 3BQ0A 1AFIA 4EI2A 1HNXE 2ACYA 2GVDB 4USIA 2B4OA 3M1VA 3ZXWA 2PI5A 3MCOA 1VHFA 1XNQI 2P9CA 3ISND 4LF4J 3UN5A 1U0SA 4DV0I 4TY8A 2Q66A 3KRNA 5C24B 4GRSA 2EWHA 4LF6I 2QMWA 2C2RA 3DLGA 3GYXB 4ED5A 2R9LA 4X65J 2JLEA 4X66F 3KLHB 2G9OA 5J2QB 2GO3A 2MYFA 4DF4A 3J7YI 3GSIA 3AAWB 2VKRA 5LMUI 4IYQA 4NXNF 4K4XA 3G9CA 1VRUB 1TZ0A 4L6V3 4KGVB 4CRJA 4RZRA 3PFOA 2O67A 1FX2A 1HK7A 4M5GA 3GJQB 2CWKA 1VISA 1NU4A 5D15A 2KH9A 1RXOB 3LANA 3UNGC 4I2PA 1U2FA 1S0MA 3FBCA 2AJ2A 1R6YA 5KT2A 2ZHOA 1APSA 4IFDF 4URGA 2RQ4A 2VA3A 4DUYI 3GJTB 2IM0A 3PR4A 3RR7A 4ITSA 4JI0F 5IT9U 4QBUA 1B99A 3J7YU 4DV1I 3KTQA 4Y2KA 3N28A 4I56A 1U48A 4KHPE 1DHMA 2AW0A 4NLYA 5A8WB 1FK9A 1LFWA 2L41A 3D0HE 2Z5EA 2BOPA 4WZMA 3D9BA 4TU8A 1S1TB 3I5CA 1U0HA 2U2FA 3BN7A 3QGPA 1OYSA 1D9FA 4KGKA 3E3XA 1J5EF 1S1VA 4PWWA 1DQ8A 4CO1A 4HI2A 1TKXA 2BX6A 2HHHJ 2ZD1B 2GAHC 2NPFA 4D3GA 4O0IA 1BGXT 1ZPWX 1RB0A 1T9TA 3CMAS 3ZKDA 4P6QA 4C98A 3R3TA 1S7IA 4WPAA 2F9JA 5A76A 4C8LA 5KOWA 2W4CA 4ANDA 3GIMA 1L3UA 5J2PA 5FDLB 2DH9A 2ZHBA 4DR2F 3LA0A 4TLRA 2ZVSA 3HD1A 2PO4A 5D8HB 2BV3A 1QSLA 3WU6A 1SJ1A 4H54A 1N52B 2M70A 2NYHA 2PMZD 1L5UA 2LEAA 3M8RA 2LA6A 2MEWA 1N34J 4OX9I 3DRRA 1BWVA 4ZJOA 3SXLA 2XM3A 4TNOA 3JQKA 1ZH5A 3ZO7A 2UXDJ 2XTJP 2LVWA 5ELWA 2DO4A 1SJFA 5DNXA 2WVDA 1VQ9S 4WFBQ 4JI1I 4DL5A 2FLOA 1H2VZ 1HBUA 1JMTA 2BA1G 4RBVA 1N6QB 1Q5VA 2ZM6F 1RP5A 5DM7Q 2XO6A 3Q2SC 4WP9A 1Y4ZB 1NZ8A 4QIWD 1N33J 1ZTWA 2I8EA 4F4XA 2AU0A 3D2WA 1HQUA 1S77D 1F5CA 3HCXA 3F0NA 2XS5A 1OSCA 4JI8I 1DLOA 3KLIA 5KAKA 4YB6A 4G65A 3SQGB 1LFPA 2KJWA 5U47A 3JAMY 3S7RA 3PEHA 2KI2A 1FKAF 2MQNA 3R1HA 4LCGA 3AY0A 4DSJA 5IT0A 2HS0A 1FKPA 2DCUB 3DN9A 4N5SA 2UUCE 3D68A 3TVYA 3KUEA 5SUHA 4WBFA 4C3MA 5ETVA 2HHWA 2XC9A 3T1HJ 1XR5A 4B02A 4C7QA 1SB6A 2HLTA 5KFFA 3NP5A 3GYNA 4DL6A 4B3RJ 4B3SF 3PRDA 4F4AA 5HJYA 1IBLF 3BDPA 1VQ5S 1HI8A 4RWXA 4DV7F 5JEAB 3IXQA 4U96A 3NAHA 2AX1A 3DOMA 3N5BA 4RUBA 4DR6F 4QNJA 2PO1A 4OX6A 4JB8B 4RWWA 2YNGB 2XS7A 3P76A 1QTMA 3MM9A 3QJLA 2GNKA 4DSKA 3AD9C 1NKCA 4OI2A 4V1Ak 4M5DB 1T05B 4YR2A 4UUWA 3I0SB 2HNZA 1MG7A 2F8EX 2NSCA 4EO6A 1KLNA 4C4WA 2BJ1A 2JH3A 4KQVA 1TAQA 1IBKJ 2FB0A 2HGLA 1F1BB 3OBIA 2AWZA 2QJ3A 4GKKI 1F9EB 2W7AA 1JLCB 3C6TA 1HHQA 1UDOA 4LF4E 2HQFA 5A0YA 2V9WA 3DI6B 1RKIA 2MQ8A 2RKIA 2ADBA 3TX8A 1R0CB 3I32A 3A3OB 3UCUP 4LCFA 4X4UA 3S1TA 1C1CA 1JLAB 4X65E 4ZLNA 4M95A 3BKTA 1G7CB 3PM9A 2EEYA 2KHCA 3PJWA 4Y3CA 4HH0A 1T7PA 1PBAA 3IS9A 2ZDPA 3QIPA 4RX6A 4X64I 4OHZA 1UPPA 2FZCB 3VGUA 3KMSA 1EETA 1TMJA 4EK2A 2UU9I 4MU0A 3K17A 2BJ7A 3LPEA 3UWTA 3DXSX 2OPPA 2W4DA 3D6FB 2GGPB 2V8VA 1VQOS 3ZNUA 3G82B 1TUGB 1H7WA 2PNZB 4B3TI 3NGSA 2VOPA 2ZUGA 4ZP7A 4JI3J 3GONA 2CJXB 3PJXA 2VONA 2G0IA 2IMWP 2C39B 3QWUA 1S9EA 4FWGA 2CZ4A 4HTJA 4M5MA 1FFWB 2R7SA 5FWKA 1K1QA 1FWPA 4EBCA 5GMDA 1S5ZA 1XNQJ 2GMLA 2MY8A 2YKNB 2YKMB 1PC4A 1Z0GA 1FJGF 1DTTA 5CHCB 1BLUA 4LFCF 4KPYA 4NEZA 1KD1T 4DUTA 1RWNB 3VHQA 3K89A 1Q8LA 7FD1A 3BREA 2H5IB 2YNHA 2BA0G 1WF1A 3M2VB 2HZVA 5LMUJ 3G96A 4RU2A 4HL9A 2HHHE 2E5IA 2OPRA 3THPA 2VG5B 3L4BC 2ZNZA 3ZTPA 3M9OB 1GMUA 2EW9A 4ICLA 4ECSA 3L7UA 4LSZB 3FUYA 5JJBA 4XK8C 4DHVA 3W5YA 2AHOB 4OYOA 2ZUAA 1YX2A 4FP9A 2JLFA 1WHVA 2KT2A 5HP1A 2RMLA 5A6WA 1H6KX 1WOPA 5A6PA 5A8KA 1WI8A 3W63A 2OMLA 3IRXA 2QSFA 2W9CB 1N54B 1HNZI 1JLEA 4FXWA 1Y5YA 1EX8A 4MQYA 3HLUA 3U1MA 4XPEA 2DEIA 3KJVB 2UXDF 4GC6A 2I38A 1TK5A 4H4OA 1XMQI 4J9RA 1N34E 4O44B 3CO0P 2KFYA 3DLHA 1Y4UA 1NM2A 5HMXA 4C8NA 1RHMB 4DV6E 4MMOA 1NSPA 4Q2MA 3LAMA 4LSLB 2HVHA 4ZKAA 1LQ9A 4F3QA 5F8GA 1SKWA 1N33F 3KK3B 4ZP9A 2BR2A 2LU2A 4PQUA 2L3MA 4NASA 2JRSA 4DSLA 4UOGA 2HS3A 4DR4J 3I55S 4AUKA 4R0JA 3O2IA 1I94F 1Q16B 1QM9A 4Z2XA 4X4OA 1X4DA 5ETTA 3QLHA 2JEFA 5LMNI 1F9FA 2XMVA 4FW9A 1KEKA 4ILLA 1WC6A 1R8CA 3D1QA 1YJ9S 1HQEA 3I4HX 2R42A 4P10A 4KO0B 2GIQA 4B3RF 3P96A 2AYMA 4G1QB 2VDIA 4YMEA 1PGZA 5F8NA 1QLNA 3K5LA 1U6FA 3NGUA 2KTQA 3AXMA 1ZBTA 1UZHA 1PKUA 1VI7A 5ETKA 3EMTA 1D8ZA 1ZXMA 2YNIA 5B7WA 5DRPA 1M5OC 1UW9A 5F8MA 1N8RT 1TVRA 2FHJD 3MR2A 2WONA 3MECA 5BR8F 3OT9A 1RT1A 1Z1ZA 2CADA 3CD0A 1X4CA 3MPDA 4OX9J 2MLYA 4F67A 4DX7A 3NG8A 1BMQB 4O3RA 1UJ6A 1O6XA 1XNRJ 2NQPA 2YWWA 3TQ1A 4J5OA 4P7TA 2U1AA 3GLLA 1I1GA 2H1YA 3Q8YA 1S0VA 5SZTA 1XMOI 2E5JA 2WSFC 1GT8A 2X1GA 3AJ2A 4NXMI 5K14B 4EO8A 4DL3A 1B7YB 2MGZB 4KFBA 1HBOA 2BE2A 3DLKB 1RABB 4IG3A 5B0GA 1SV5B 1RAGB 3D4JA 4NLRA 2DNRA 1IBKE 1U1RA 1G1XA 5ETRA 4RR5A 3AA9A 4LIWA 3VVUA 1LWFA 2GO8A 2JWNA 3Q0AA 1R0AB 4YFUA 2YWFA 2BKOA 1RE1B 3CDBA 4ES1A 4QU7A 4OZ0A 3J7AM 4NCBA 1Q86T 3O5TB 2Z5BB 3GG0A 4KE5A 3KLGB 2MQOA 3DNCA 4MFBB 1S1UA 2B43A 1S12A 1HWIA 2GA7A 3QGIA 5LSLA 3DM2A 5J2MB 2HAIA 2XYGB 2YWKA 3QNWB 3M6WA 1RT3A 3M8PB 1SVDA 2LU1A 4JI2E 3OFGA 5FLXY 4PR6A 3HHNB 1UEUA 2GHPA 2QFJA 3GIIA 1BUXA 1KHVA 2ZBKB 2UVUA 4OHYA 1D0EA 4C2MA 3RBXA 5DQIA 2VBWA 4DPXA 4RKUC 4FPRA 2M7SA 3R1LA 3GJRB 4QW9A 3ILLA 2ZBQA 4EZ9A 3L9ZA 3NCRA 4NLQA 4K5RA 4UQTA 1JXEA 3FDSA 2XO7A 5K9FA 2JFDA 3M30A 4XDCA 2J6TA 4NI2B 1FD8A 3OTOI 1FEHA 4IFDB 1UVIA 2RDIA 1IKWA 2LP4A 3JYTB 1XNQF 1H7SA 2X3GA 1YHCA 2B4VA 4ZHRB 2IERA 5M2UA 2MSSA 4L3NA 4DV0F 1CBKA 4OO1D 5CZVA 2JFKA 1NEEA 4GKKJ 2DRBA 1Y0HA 5ETLA 4LF6F 2ZOFA 2UUWA 5HAOA 5LT5A 1M5PC 3G8QA 5L1LA 3OR2B 2XNRA 2XZWA 1VJWA 2X51A 4ZVSB 4ZK7M 3VAIA 3J7A1 2ZH9A 1OO0B 3VV2B 1EQMA 3TVKA 3NOGA 5ETPA 4LF9I 5LMUF 4KKOB 3CO9A 1IKXB 5DRQA 2J65A 2RF2A 1I5OB 1OY8A 3HKZD 4YOEA 2E7XA 4ZOSA 4JG4A 1SJ3P 1GEHA 4F4KA 3M7ND 1P8GA 1M1HA 4PXDA 4X64J 1OMSA 3UN3A 2VBXA 1KBRA 4PG5A 2CIMA 5EWFA 3DHXA 3H40A 4ES2A 2D7SA 1T9YA 2ZBCA 4Y00A 2HQGA 5D3GA 4DUYF 2DGTA 4CP5A 4PPDA 5EX3A 1NJZA 1EP4A 2VFVA 4DV1F 5DLFA 2YNFA 3CWJA 5FDLA 4B9TA 1MX0A 2OEMA 3UVJB 1TMMA 2EFNA 2MKSA 1CS4A 4LRFA 1NH7A 2KG1A 4JV2A 1HNWI 4JI4J 4LFBI 5I42A 3MPUB 5HROB 3TJ9A 2G2YA 2JOQA 3GB0A 3S8SA 1SC6A 1UVJA 3L95X 1RHQB 5IT4A 1S0OA 4C8YA 4USWA 2GV1A 4PKDB 4O4GA 1IR1A 2HVZA 1WOOA 1JXLA 3J81C 5I3QA 2CQDA 3J80Y 5EKWA 1WHYA 3KLEB 3TANA 3P3CA 1CQNA 3PDNA 1YH8A 3DLEB 4QJVA 4DR4E 4R0EA 4ED4A 2EG2A 2BQUA 2XMTA 3IWNC 1VRQC 2CG4A 1FT8A 1E6YA 1GXUA 1H73A 1IBMJ 3PNIA 4OO1F 1R8HA 2BA9A 3PRYA 2ZJRQ 3CCUS 3P49B 2QRRA 2CPZA 2QEXS 3ENAA 2DNOA 3KK2A 3HKWA 1RBLA 4RW7A 3D3BJ 3KG4A 5I3PA 2GHWA 3O6QA 1VLYA 2JEBA 2GJIA 3GFZA 2JHEA 4LMZA 1JB0C 1B62A 2LA4A 4OX9F 3SQGA 2UP1A 4USJC 1HNZJ 5BXIA 1UFWA 2R8GA 2R2SA 4J7CA 4EFAC 3MPVA 2XULA 1NB7A 2XMUA 3DGPB 4JI1F 4FNHA 1U7LA 3HHLB 3TNVA 3F44A 4N8OA 1XNRE 2FY8A 1H7UA 4U95A 4IZJA 4F3OA 3L7OA 4KAIA 1PYOB 4DV4I 5IFMA 4C0OC 1Z5AA 5EGYA 2NREA 3FQKA 2RHSB 4A8KA 2C3OA 4WU3A 2GCFA 1CSJA 1TL4A 1M5VC 3H90A 2UVRA 1X31C 4W92B 4QWDA 4LF7E 5LXRA 4JI8F 4YS2A 1SPBP 2KB2A 3VALA 3OLBA 5IV4A 4ER8A 1TL1A 2F9DA 3ITHA 4CNYA 4ID8A 3OL8A 2HPUA 4JI5J 1S4EA 2EK6A 1N0UA 3RBDA 1VQNS 3QT7A 3QJJA 4HYMA 3C15B 2QMUB 3MGJA 3W64A 5AXMA 3W9HA 4YY3I 3ILJA 1NSQA 1SUQB 3FZBA 3H5UA 2ASYA 2CDQA 3CGIA 3UHMA 2OSRA 2Z2ZA 3IG1B 1JLCA 4OZ1A 2WNRB 2VFUA 4WFNQ 1WELA 2XHCA 4R5PB 1NSKL 2R2RA 5F0WA 1WHWA 4LSNB 3DHWC 1WKJA 4AL7A 2A2CA 2Y8YA 3K8WA 2EBGA 2MZJA 1DARA 2ZH3A 2VG6A 1S7HA 4KR0B 3GMEA 4IOAQ 3CJQA 1TR0A 2CQGA 2HHTA 2H5EA 2PO0B 1RLDA 2F4VJ 1N5TA 4K5SA 4GKKF 2UUAJ 3KKFA 1S1XA 1PKPA 3S01A 4RU9A 4QOTA 1ZAWA 2E5LE 5E3CA 2LXIA 4I69A 3KJNB 3M2RA 1VC0A 3RU0A 5B0FA 4DPWA 1MW7A 2W2PP 2HQ3A 3MOZA 4NCGA 4FNIA 1QE1A 1RA7A 2C3PA 1NZ0A 1KHWA 4OZ5A 3EGNA 1WJ9A 3WU5A 2ZVIA 2NN6E 1KR4A 3DC2A 3AHPA 3EGZA 3A1YG 1WDTA 1NK6A 1RTDB 3KNGA 3N6NA 3CCMS 1HR0J 3M9NB 4DFJA 4CTAA 4F02A 1FTRA 1YKWA 2UU9F 5IXUA 4K0KJ 2ZBPA 2BXJA 2IAJA 3FBEA 2ZHAA 4AD6A 2OPQA 3JAMQ 4B3TF 3W65A 4Q7AA 5HQ8A 5A2QC 2E5LI 4CLLA 4JV5J 3KUGA 3UI3A 2EFOA 2FHMA 3NMRA 3EVWA 2YX4A 1S97A 2C2KB 1WACA 3BYPA 3B4TA 4YUDA 2DR7A 2IVYA 4RLEA 5L9NA 2O1UA 3SEOA 2J6UA 1VQ7S 3PYDA 2FJBB 3VGVA 2NN6A 2HFOA 3LW5C 4ZCLA 4OX7A 1K8AT 1RKJA 4HHJA 4U7CA 1S57A 4IO9Q 2ILZA 2G1HA 2PC6A 4O3SA 4JI4E 1W25A 4DQPA 3KLFB 3MUTP 2PFDA 1I6JA 4ZS6A 4LCHA 1CJKB 3L7ZB 2A10A 1YJWS 3J7AN 3FZ2A 5KFMA 5I4MA 2DTJA 4JV0A 5E7OB 3H25A 3KJVA 3Q86A 3UQSA 2PGCA 4NLPA 4GKJE 4O44A 3EGVA 3K5OA 1S6UA 1VHIA 2HNDB 4IQMA 4RW4A 2QMXA 1IQTA 1OS5A 2L9WA 2DNHA 2VC1A 4DLGA 3P3DA 2V94A 1IBME 4O4RA 3MCMA 4HXZA 3VQSA 1AZSA 2UVWA 5DG7A 3DYAB 3MOJB 2OP5A 2KN4A 4P52A 4BA1B 3M8QA 3RJMB 4FF2A 4K50A 2C3YA 1HNZF 2I5JA 1TKTB 3CF5Q 2RRAA 2BM1A 4C6AA 1XMQF 2WBRA 1YIJS 3IR7B 2DHXA 2R2UA 1MMNA 4A8MP 1VBXA 5C0XA 1YRTA 4KO0A 1JLBB 4ZJLA 4IFVB 4ECWA 1C4AA 4DR7I 3J81j 2GIRA 4BBYA 2C37B 3I0RA 3NL0A 1LV5A 2C1EB 2EFGA 2AX0A 3MFHA 3R2DJ 1TL7A 1WC0A 4OYBA 1D9AA 4EMDA 4DN9A 2OEJA 1RWKB 3KK1B 1FRJA 5D6GA 1HBNA 4A4JA 2J0QD 3CJ3A 3EWGA 2AJ1A 5HJXA 3OL7A 6AT1B 2DXEA 4DZDA 3P4UB 2G4BA 5KG6A 4C48A 5LMNF 4DG1B 4LVNP 1X4BA 4B9NA 4UW2A 5LJ5Y 1SC3B 4U7UK 2BBEA 2NR0A 4IFYB 2ZKTA 3T1YJ 2QGFB 3FFIB 2CQPA 1KP6A 3I9ZA 1CLFA 4AQYI 1OYPA 4Y65A 2BOAA 4ENOA 1K9MT 4OI4A 2CPDA 3CIZA 1Z5CA 3JSMB 4WKRA 5JVGQ 1FXDA 2PMHA 4N8NA 1FEEA 4DL7A 6FD1A 2B56A 4DCPB 1B0TA 4W98A 4XAKA 4O3OA 4HACA 2YVSA 3KG1A 4LFAI 4IQXA 1N48A 5JXSA 2BANB 1KKHA 3RRHA 4H4MA 3Q1QA 3CNQP 2Y0SD 3A8KA 2Z5BA 5HQMA 5KFOA 1VBYA 1FVSA 5CABA 5J1NA 3KLGA 1M1KT 3EJMA 3TEGA 5EDWA 4ZIWA 1MWZA 4QNKA 4DSEA 5J2MA 1Z0WA 4R8UA 1XMOF 1URRA 1CC7A 4NXMF 3IWLA 3TR5A 1IKVA 2QA1A 1G3OA 1NMEB 3ENVA 5LSRA 5CYQA 4LBHA 3FMWA 2JE6A 1LWXA 4MAKA 1JKHB 2YPZA 2A1BA 2ZOMA 1ZS6A 1G2EA 2OD4A 4YDXA 3TVZA 5IT9Y 2F4VE 2NN6C 3M1VB 2UUAE 3MMCA 3H5SA 2FC9A 3GPAA 2F1FA 4CM2A 2Q79A 2HHSA 1KQGB 4TY8B 2HAFA 3RTVA 1T9UA 4G6VB 3B82A 1GK8A 2Q2EB 4CH0S 1NHUA 4BWMA 3DLGB 3IBFB 1U1LA 5CYJA 3FVYA 4ISAA 3BEGB 2BVZA 3BH6B 4X84A 4A47A 1FRMA 1SKSA 1NB2A 2G1DA 2AEJA 1F6TA 1OPZA 2KM8C 1EAYC 4I6WA 1HR0E 4FS2A 3PX6A 1JJ2R 1S48A 4KHMA 3RB0A 4K0KE 3OXLA 2D9PA 2RE1A 1ZAXA 2RDJA 4NYZA 2B8PA 1WSVA 3OTOF 1KONA 4ZVGA 3G6YA 5FLXU 4JV5E 4PEOA 2E1MC 3GSDA 3J7AG 2A18A 2RRNA 4DR5J 3HPOA 1Y00A 3TUPA 2QE5A 1X9MA 2GW8A 2HGMA 4WYLA 2CAJA 3OXFA 5E5NA 5K8MA 4FW5A 1WOSA 1KFDA 2YXLA 3BKUA 3G6ES 3T41A 2IY5B 1FK9B 4OZLA 4FKXA 2X1BA 3HVRA 1UVMA 4PCQA 3V6HA 2P6SA 5MLCV 4LF9F 2DK2A 3LQVA 1Q95G 1U0HB 2AYBA 2ZBIA 1C0UA 1Y4SA 2CG8A 3OL6A 1UJ5A 1CJVA 2BA1D 2NS1B 4LVOP 1S1VB 1Y5NB 2LDYA 1TKXB 3PS3A 1FE0A 3EM1A 3DDIA 3PKYA 4WFXA 2IDEA 4GO5X 2PEHA 4N47A 4TVAB 2Q6BA 2BMBA 1S16A 2WP8B 1KSPA 3F41A 1TK0A 1A6FA 5J2PB 2V4QA 1Y3JA 2OUGA 4A8FA 5JEAD 5A8RA 4ZDNA 4CI0B 5KFQA 4USKA 3C2PA 1YSJA 3VCDA 5LSOA 3RGIA 1RCOB 2IBKA 4FBTA 1OYEA 3P06A 2UXBJ 1S9GA 1RTIA 1WG1A 3MM5B 4MH8A 3Q23A 3FK4A 2MPUA 1IWGA 3DRRB 2MY7A 4HYKA 4WF9Q 5FLXQ 5K8PA 1HNWF 4LFBF 2BDPA 5L39A 2R7UA 1IQZA 2BRLA 3KG0A 5H9FK 2UUBI 5KFKA 1QJHA 4C97A 4Y2AA 1N32I 1Q1KA 5K20B 1FHTA 3ONQA 4LF8J 2RRBA 2OMOA 2CZ9A 2B4UA 2Y0BB 1HBUB 4TN2A 2ZH2A 3ENWA 4HY1A 3W5XA 4Y34A 3UD4P 1YJUA 4JI6I 1WG4A 1A9NB 1R43A 2DGQA 3OQ2A 3VGTA 3JXOA 3KYLA 2K06A 4ECRA 3C14A 1VJQA 1TTHB 2DHHA 1HQUB 2QL5B 3UD3P 5KFYA 2F63A 3HHLA 5D4NA 3LPYA 1VLOA 3DOKA 3KLIB 4LBPA 4K4SA 4I64A 3LP1A 1HARA 2F40A 2H54B 1D1UA 1ZTTA 4R25A 3T1YE 4DN0A 7AT1B 2W24A 3V6DA 2MKCA 1FRIA 3J80U 2HBZB 1O0PA 3T5HA 3SV4A 1AFJA 2XCAA 4DSFA 1XMBA 3T1AA 2HWIA 4CQ1A 3HDSA 4X4VA 5C2GA 5HATA 4P73A 5HK4A 2DR6A 2A6MA 4BCAA 2WCXA 5KOXA 2BW7A 4FYYB 4F3MA 4NBQA 2DGOA 4DR3I 1ZPVA 3D7SB 3DOMB 1U25A 3KOAA 3AQOA 2QYGA 3DDNA 4UOFA 3MM9B 2PA3A 1U1NA 3CULA 3GJSB 4N76A 4FYXB 4DV4F 1RAIB 1EHWA 3D6TB 5KFDA 4M5NA 1WTBA 2HNZB 2LKZA 4MIAA 4CO0A 4AE5A 2N4CA 4MJKA 2KT5A 2Q1LA 2M52A 1RWOB 5F0UA 1REVA 2KZZA 2FJWA 5JEAE 1LNQA 2BW2A 3O8WA 4WFYA 1ZA2B 3LTOA 3NZKA 2LXUA 2AZ1A 1AYEA 3C6TB 2POKA 1FKOB 4C0HA 4LR7A 3EUNA 2HQDA 1CG2A 2EI5A 2CQBA 5A0YB 4JI7J 2XY5A 2ZZTA 5F8HA 4WJBA 4YY3F 4G1IA 2AV5A 4FDFA 3QJPA 4M63A 4J9KA 1C1CB 3NWRA 4DV5J 3MURP 4GMKA 3C46A 4OMFG 4B3MJ 3BBCA 1YJVA 3H7HB 5EX0A 2MZRA 4HTIA 4MYUA 3H1CA 1RWXB 4DFPA 4ZPTR 5CA5A 3CDAA 3EGWB 3RR8A 2BA0D 3J80Q 1VS3A 3RB3A 2DO0A 2DXFA 2R7XA 3CUNA 2C22A 3IS9B 2CPHA 2CPYA 2QT7A 3H4LA 2CPFA 4ZPAA 4ZPBA 2DBBA 4QCLA 4BS2A 1C1BA 5DRRA 4OZEA 4OYZA 2IRYA 2CQHA 4YHHI 2OPPB 1YLXA 1BQMA 2VQEI 3QIDA 1AT1B 2P8IA 5AT1B 3ZTRA 3GIRA 1M5KC 4DV3I 1U6BA 1VDHA 5B0DA 4X4SA 4NXNJ 2QL9B 3PX0A 4DR5E 1RYSA 2R8HA 3POTA 4EWTA 4C8KA 2RUSA 1VK8A 2CVIA 3DLLQ 3D66A 5KFEA 3UCZP 1LK7A 2BACA 2AD9A 1JX4A 4O3NA 1VOMA 4DQSA 4Q0BA 5IZHA 2CPJA 2WZ1A 5ADZA 4UOCA 1DTTB 5E3PA 2KDOA 2VL1A 1U6ZA 3TARA 5G0RA 5FD1A 4F0MA 3Q8UA 4X4PA 2XSJA 4LF5I 1U26A 2L08A 3MMBA 2K1RB 3HFKA 1WNEA 1QTNB 4DQQA 3MM8A 3AXKA 4P2SA 1WWHA 2YNHB 4RL1A 4U8YA 3CWVA 3TEHB 4RNOA 4JYAI 2Y8WA 4JI0J 2LDIA 3G87A 2OFHX 2Z5CA 1IM6A 4MK8A 4ICLB 3KLFA 4QW8A 3NGDA 2CRLA 4PZVA 5ETSA 1MROB 2CDRB 5GVQA 3TA1A 5AXLA 1KOHA 1QAYA 4FVMA 2E5LF 4G3IA 4P7VA 1UA1A 3I9V9 5HP1B 1WEXA 1SJ4P 1KC8T 5A8KB 3IRXB 4C8MA 4RUHA 1TU0B 3QATA 4XTTA 3SV3A 1J5EJ 1JLEB 4B9VA 2UXBE 2DITA 3CC4S 1T9WA 2FVPA 1O8BA 1IVZA 2NN6F 1RAJA 4H4OB 3BKFA 4ZVRB 2VJUA 1FDAA 1IKYA 1FDDA 2DHAA 2HSEB 2IIHA 3D28A 4FYDA 3K57A 2ASLA 3NNAA 4QIGA 2AQ4A 1JIHA 3ELHA 3FBFA 1RTJA 1FRLA 2VBYA 4F25A 2APOA 3FSYA 4DR2J 1CEZA 4Q44A 4NE9C 2M8HA 4I2QA 4QWEA 4LF8E 2BJ3A 1TFYA 2H9ZA 3W2WB 2PE8A 2ZKUA 4KV8A 4X62E 4I67A 1IR2A 2O1PA 3NY0A 3NNCA 1RA6A 3U1NA 4I7FA 2BR2B 1MMLA 4PQUB 2WSEC 2CPIA 1VQSA 1VQ8S 3O3LA 4TYBA 4NA1A 1WG5A 2EBEA 3VF0B 3W66A 2BABA 3QLHB 3E8OA 5B0CA 4DR1I 4U7UD 3EPIA 1TV6B 2O1WA 2XMWA 2ZDOA 1HQEB 2XI2A 3OW2R 1MU2A 1JXVA 2BE7D 1UDNA 2DNKA 4ZVFA 4L75A 2PO2A 2ZM6J 2W1BA 4DUZI 2V63A 3C6UA 1ACMB 4B08A 5GAEI 3N79A 3UPFA 2O01C 2D3UA 3T5KA 1TVRB 2WONB 1PJ7A 1S59A 3OR1B 4IFYA 3OLAA 3AOCA 3W8PA 2QC3A 1RT1B 3C66A 2VFRA 5C0XF 3JAMC 4ZJQA 1P1LA 5IQQA 5KG5A 1G6BA 2GIFA 3QT6A 3J81Y 3V6KA 1ZM2A 4DR7F 2EC2A 1R89A 4U9RA 4CLPA 4IFDD 2UUBJ 4OJ1A 4OV1A 1RUSA 2X7IA 1N36I 4ZCIA 3WU4A 4OQJA 4ZLLA 3JB9k 4B3SJ 1NAQA 2NXCA 4KFBB 1HBOB 3ZC4A 1IBLJ 2BE2B 3G4SS 3ETOA 4IG3B 1BE4A 4AYBD 1TELA 4F8RA 4AFFA 4OKGA 4ZVHA 4NZ0A 2OEKA 5CCMA 2K8GA 4CWBA 4DR6J 4U6PA 2BJ8A 1LWFB 5GAEU 3UE2A 3PG9A 2FJAB 3QBCA 4AQYF 5CAAA 4EZ6A 3BSOA 1IN0A 2CQ4A 2VV5A 1RSCA 1H38A 1ZXNA 1S1UB 3FBBA 3K0JA 4C11A 2LLZA 5H9FJ 2UXCI 2C2OB 3DM2B 1U2CA 1D3WA 1Z0CA 1I3OB 3TJAA 5D4OA 4LFAF 4DV5E 1RT3B 4DX5A 1JLGA 5KFBA 4DS4A 4IZKA 4J9VA 4B3ME 2D3O1 2B9YA 5GAGI 2ZFHA 2OTJS 2Z58B 1H98A 2ZH1A 5L1JA 3SDEA 2LYVA 3TZYA 2QLWA 4Y2IA 1YJRA 3PACA 3C19A 1RU2A 3FKBA 2W9BA 3CJ2A 2MZQA 4K4WA 2JSXA 3CD6S 2FJVA 3LAKA 5K36A 3GWCA 1RHJB 3PVXA 3PS1A 1RT5A 3HSDA 4CLKA 5GAHI 3BSCA 4LR9A 4ELTA 3PR5B 3MD3A 4KGXB 4DV2I 2NYIA 4F36A 3M30B 2VODA 2NPIA 5J2NA 2YQ1A 1ITPA 4X66E 4WXOA 3GMGA 4AL6A 2AYGA 3IBWA 2YPYA 3R2CJ 1DBDA 1X5OA 2DNGA 3TJ8A 1IKWB 5BYQA 4NXNE 2V8HA 3PRVA 3K59A 4O3PA 3OFHA 1PVGA 2NUUG 4I6YA 1VR6A 1HNXI 2CFXA 4Z37A 2CQ2A 2W8LA 4WCEQ 2HFVA 4CM0A 1HNIA 1UTAA 4YN3B 5D4PA 2IJFA 2QA2A 3D6HB 3TUIC 4ZLJA 4NZ6A 4C3LA 4X4QA 5HLFA 3TX0A 3D1OA 5DRKA 2RU3A 3QGGA 2B4PA 2IOPA 4CIOA 3DRSA 3D0IE 3Q89A 4IRDA 4IR9A 1CJTB 4L72B 4IFDE 3PYEA 5GAHU 3A3PB 2KJVA 1EARA 3BGRA 3T3FA 4M5KA 2DNPA 2RF2B 1QAXA 2FGCA 3ICLA 3ET6B 3OVSA 4ZVQB 2FPHX 2ZJPQ 3N6MA 5DZ7A 4PRFA 3ZZZA 3WIVA 1FJGJ 4ED6A 2E9RX 3T5LA 3IAM9 5L9XA 2O66A 2HBYB 4DFKA 4LFCJ 3BN4A 3UDEA 2V2KA 1MLAA 2IMOA 4FWDA 3FCHA 1OQ6A 3QZ8A 1OWXA 4OYIA 2MQPA 2N7CA 4OX8A 5D3GB 2HHQA 2HBQB 1WORA 3DOLA 5DZ6A 1J5EE 5FJ4A 2W2NP 1IUJA 4TU9A 1GNKA 1WF0A 3A3NB 1EP4B 4A8XA 3HHKA 2WP8A 3CCSS 3E01A 2YNFB 1LWCA 3KFWX 1X4AA 1RT7A 1R6VA 3HM9A 1CS4B 4OI6A 1DZ5A 2R4FA 3BGUA 3T9ZA 2F8HA 3H98A 1V9OA 3LP0A 3LGHA 2VZ9A 2HLUA 5I42B 3MDFA 3THVA 4DR2E 4KHPI 2HRUA 2OFGX 1NH8A 2OPSB 3FCWA 2IM2A 2ROPA 4O4GB 2XEXA 3MM5A 4USVA 1SJRA 4I0WA 1NO8A 4RBUA 1F2GA 1VBKA 4LQ9A 1USVA 2W7PA 1CVJA 2YKOA 3MXHP 1DQ9A 2E1RA 2OLWA 1MWYA 3FEYB 3H59A 3LO3A 2WB4A 5A2QY 2XLKA 1JLQA 4X4NA 2C2MB 2PIIA 5IT9Q 2EXUA 2ACMA 1E6YB 1T3NA 3M85G 2ZWOA 4WZQA 1R3NA 4ZN1A 3CCLS 3H5XA 1GH8A 5HSPA 1NSAA 2WTFA 2QN6B 4CYUA 1YBUA 3DD6A 1NPPA 2QLBB 2MSTA 3KK2B 3BSNA 3K1JA 4RW7B 3PCOB 4KC5A 3U02A 1VRTB 1JWWA 2JEBB 2ZM6E 1Z2ZA 2J9CA 1PG5B 4ECYA 1N5VA 2HKJA 1KTVA 1I94J 5IWAE 1OIAA 3DRPA 4B9LA 2AGQA 2UUBF 1URNA 1DTQA 1N32F 2FJXA 3CPWR 3WBZA 2VFTA 5K36C 2BQ3A 4LR8A 1P27B 1FKAE 1RADB 3CSKA 2L48A 2J8SA 2YX7A 4OYAA 5E3QA 4IZJB 2GQ2A 2HNYA 3I96A 2VQFE 2HFZA 4JI6F 3DKDA 1Z2LA 2D74B 3QT5A 2V4RA 4M5IA 3M6VA 2I6WA 1NK9A 4LOMA 3AT1B 1SC4B 5HQLA 4NLGA 2KT3A 4B3SE 1IXKA 2J8AA 2Y3YA 4B3OA 5BR8J 1IBLE 3CDEA 4EU0A 1OJ4A 1HA1A 4DV7E 2Q3PA 3EZ5A 1TL1B 2DGSA 2F65A 2M5YA 3ITHB 4F50A 4DR6E 2JT2A 3FRYA 2P9EA 3B8HA 2LQJA 4QPXA 4QYRA 5IWAI 5EWEA 2BKNA 1H7XA 3H2VE 2XHWA 2DNQA 5L1IA 1FFSB 3R7SB 1AW0A 3HP6A 1CULA 2UUCI 1NK5A 4BA2A 1J5OB 4WYWA 5T14A 2FLPA 4XIUA 3H8YA 1UKUA 4HEA9 3TOQA 4DUZJ 4DR3F 2VQFI 3GP9A 1FKOA 1BQXA 2W01A 2DB1A 2A6OA 4BLGA 3V5RA 4WE1B 1Y5IB 2MKHA 1LXNA 4YR3A 3RW6A 3SSQA 2XLIA 2MZTA 4C8OA 5IM0A 2LECA 4ECTA 3FSIA 2E9ZA 2DEJA 2D69A 2NZCA 2V69A 1B7FA 2PMWA 4IOCQ 1NNDA 2RVJA 2VG6B 3CB4A 3EDQB 3MEKA 3BYRA 1IJEB 3QRRA 1UVKA 1S6QA 3HSZA 1KWMA 1RAHB 2M2BA 2AGPA 1N36J 5HN0A 2CQ0A 2W7OA 3ILIA 2HVEA 5E0OA 3DMJA 1KDNA 4J9QA 2RUGA 3U1KA 4PU9A 3OPKA 1CQMA 1S1XB 3CDJA 2N4DA 1K0VA 3QSYB 2DH8A 4PUOA 3F56A 2XYPB 2CQ3A 4FKYA 3MPWA 4LRDA 4KH1B 3IM8A 2FD2A 3M2RB 3OUYA 3EDRB 4RO0A 3A12A 3CJ8A 3EICA 1Z0BA 2G0CA 4LF4I 2V8DA 1T94A 4NCGB 5BYSA 1QE1B 1M1GA 3M2UA 3HKMA 1RK8A 3CCZA 1S79A 2H3EB 2K7KA 1LWEB 4QR2A 1JJHA 1H2TZ 3NNHA 2KFZA 4V19J 4LRCA 3D54A 4CT8A 4X65I 3O1LA 4GVBA 2RS2A 4N41A 1X0FA 1MNEA 2XI3A 2E5HA 3QQCD 3LP2A 1KOOA 2DIUA 4DSIA 4CTAB 4DV0J 2JX2A 1YTYA 5AXNA 1Z59A 1U8SA 4LF6J 1A6LA 1HI1A 4YHHF 2IAJB 3UFCX 4OI0A 1LOUA 2VQEF 2OPQB 4F4ZA 2K1RA 1FJGE 1SKRA 5DQHA 1ZM4A 1FRHA 2RJZA 4FN5A 4W4MA 3M8SA 1B3TA 4LFCE 3MM6A 4DV3F 1V3ZA 2XMKA 3ISNC 3HZGA 4FW7A 1YRXA 1JQGA 1QVGR 1FESA 4ED0A 2IYGA 2YWGA 4NLOA 3BZQA 1KVKA 4NLVA 2YKAA 2BYCA 2C38A 1UP1A 1NJYA 5CYMA 1MROA 3GYGA 3MHYA 4K8RA 4OI3A 4Q45A 3OTDA 2ZC3A 2NN6B 3QGHA 4DLEA 3UN2A 3MEDB 4PAAA 1JLFA 5KFAA 4U3DA 4ED3A 3A4TA 4GVLA 3ZKBA 1T0TV 4LF5F 1RGVA 2HYIB 2O1TA 3OL9A 1GTHA 3LGMA 4URSA 2VBZA 3QAUA 3ZZTA 4DUYJ 2EKYA 3GE9A 4JYAF 1GTEA 4DCJB 2LEPA 1HWUA 2H4WB 3IC1A 1L3SA 3UDVA 2Q6CA 3CJSA 1IBCB 4DV1J 1FTCA 1Z0EA 4NWBA 1FA0A 2UXDE 2KM8B 1YRUA 4RW4B 2HHHI 2XLJA 1HMVB 2WHOA 5BYRA 3M05A 2CJBA 3HVTB 1YI2S 3W2WA 2H5JB 1AZSB 1PCAA 2VKZG 3UNYA 3SYZA 2QG9B 2E66A 3RB4A 3E2EA 4A8SA 2BEFA 1GMWD 3IGNA 5J1EA 3M8QB 3P8BB 1ZYQA 2EPIA 2VDHA 1N33E 4KTQA 2I5JB 2KVIA 2VH7A 2MHEA 3H2UB
chains in the Genus database with same CATH topology
4LF9I 4DUZE 2UUAE 4DR3E 2HHHE 4B3SI 2VF3A 4B3RI 4URLA 2X7IA 1N36I 1IBLI 2AJ4A 1K47A 3WU4A 1NZ0A 1I94E 2R3VA 1FKAE 4DV7I 1NHJA 3B82A 3LTOA 1ELOA 3WU5A 4IZJB 4JI7I 1HR0I 2Q2EB 2VQFE 1N34I 4DR6I 2BV3A 4JG4A 3WU6A 5FLXC 3QT5A 5BR8I 4DV6I 4K0KI 4DV5I 3B78A 3HULA 4LF9E 3T1HE 1BKNA 2A2DA 4OX9I 4B3SE 4B3RE 2V2VA 1N0VC 4B3MI 1N36E 4DPYA 1IBLE 1HNZI 1OJ4A 2V2QA 4DV7E 4JV5I 2DEIA 1ZXNA 1QZRA 2PNMA 1HR0E 3JAMQ 4IZJD 1XMQI 1N34E 4DR6E 4JI1I 1D6TA 2GQ0A 4N3OA 4MYUA 5A2QC 3B8HA 2E5LI 2UXCI 3PYFA 1Y4UA 5IWAI 3J80Q 5BR8E 1Z0CA 2OI2A 4DV6E 4K0KE 4JI4I 4DV5E 1MX0A 4OX9E 3H4LA 4IZKA 2HFSA 4B3ME 4PRXA 4DR5I 2UUCI 2X36A 4X66I 1HNZE 4JI0E 2O1UA 1HNWI 4DR4I 4JV5E 4LFBI 4YHHI 1H74A 3PYDA 1WUUA 4GKJI 2VQEI 3J7AG 3F0NA 1XMQE 2VQFI 4JI8I 4JI1E 4NXNI 1MU5A 4UTGA 2UXCE 3V5RA 4DV3I 4HACB 1EI1A 4JI4E 3J81C 4RPFA 3T1HI 2WW4A 4FWHA 5LMNI 1USUA 4DV2I 4FW9A 2DEJA 1NHHA 4DR5E 2UUCE 4X66E 1IBMI 1HNWE 4DPTA 4DR4E 4LFBE 4YHHE 4ED4A 2R42A 4P7AA 4XTJA 4GKJE 2VQEE 4JI8E 4NXNE 2O1VA 1PVGA 1H73A 4DU8A 3V2UC 2BM0A 2V8PA 3Q6NA 1B63A 1Y4SA 1ZM9A 3PRYA 4DV3E 1HNXI 3PYGA 4PU9A 3M6AA 4WUDA 4LF5I 1ZXMA 5LMNE 4DV2E 4JI5E 1Y6ZA 1Z5BA 4JI0I 4JI3I 1IBME 4DXLA 1XNRI 4HXZA 4ZVIA 3CWVA 1B62A 3ZZ0A 4P52A 1S16A 4JYAI 2IOPA 1Z0BA 3ZM7A 1A6FA 4LF4I 2Z5CA 1Z0VA 1IBKI 3LPSA 1HNXE 3PYEA 2UXBI 1MG7A 4USKA 1PIEA 1FWLA 2BM1A 1XNQI 4LF7I 4LF5E 1FJGI 4KQVA 1XMOI 3P06A 4JI3E 4X65I 4DV0I 4NXMI 1J5EI 4R1FA 4LFCI 1XNRE 1H7UA 4IZJA 4GKKI 4LF6I 3K85A 1XHKA 2HKEA 1ZM3A 4JYAE 4WUCA 4DV4I 4M1KA 1Z5AA 3D4JA 4LF4E 3QT8A 1IBKE 4DR7I 5FLXQ 1KIJA 1Z59A 4LF8I 2UXBE 2EFGA 4FWDA 1RR9A 4JI2I 3WU3A 2UUBI 1XNQE 5LMUI 4WUBA 4LF7E 4X62I 1FJGE 1ZM4A 4EMDA 1N32I 5IT9C 3LNUA 4JI5I 4DR2I 1XMOE 3J7AM 4X65E 4DV0E 4NXME 1J5EE 3J80C 2Z5BB 4FN5A 4LFCE 1RREA 2CZ9A 1FNMA 4GKKE 4LF6E 2LJPA 4HY1A 2HK2A 1S4EA 4JI6I 4DV4E 4IZKB 1N0UA 3T1YI 1KVKA 1EA6A 1HK7A 5A2QQ 4DR7E 3QT7A 1Z0TA 4HYMA 4LF8E 2IOQA 2V34A 2ZITA 4JI2E 1VISA 1FI4A 1H72C 2UUBE 5LMUE 4YY3I 4X64I 4X62E 3ZZUA 4Z7YA 1NHIA 1N32E 4DR2E 4KHPI 2UU9I 4AQYI 2ZBKB 1FWKA 3K17A 2XEXA 3HJCA 4DPXA 1Z5CA 2UXDI 3ZKBA 4B3TI 4DUYI 4Z7CA 1USVA 4JI6E 2O1TA 3T1YE 4DR1I 3GONA 2CG9A 2E1RA 2CGEA 4HACA 2O1WA 3ZZTA 4LFAI 4DV1I 3J81Q 4FWGA 4YY3E 4JI7E 2ZM6I 4X64E 1KKHA 2A2CA 4USMA 5FWKA 3Q1QA 5IT9Q 4KHPE 5GMEA 2UU9E 2Z5BA 4AQYE 1DARA 3OTOI 2Z5EA 1N33I 4MYTA 1Z0EA 5GMDA 2J7KA 2F4VI 2UXDE 4B3TE 4DUYE 2GS8A 1H7SA 4DUZI 4DPUA 4DR3I 2HHHI 2UUAI 1Z0GA 1Z0WA 4DR1E 1I94I 3K1JA 4PRVA 4LFAE 4DU7A 4DV1E 1PKPA 3JAMC 2ZM6E 2V2ZA 5LL6R 2NPFA 2PNLA 2HKJA 2E5LE 1KTVA 3QT6A 3ZKDA 3OTOE 5L3JA 1ZM2A 1U2RA 5IWAE 1UEKA 2HK3A 4I3HA 2Z5CB 1N33E 4UT4A 4DPWA 3Q6MA 2F4VE 2HFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 I;  4DUZ E;  2UUA E;  4DR3 E;  2HHH E;  4B3S I;  2VF3 A;  4B3R I;  4URL A;  2X7I A;  1N36 I;  1IBL I;  2AJ4 A;  1K47 A;  3WU4 A;  1NZ0 A;  1I94 E;  2R3V A;  1FKA E;  4DV7 I;  1NHJ A;  3B82 A;  3LTO A;  1ELO A;  3WU5 A;  4JI7 I;  1HR0 I;  2Q2E B;  2VQF E;  1N34 I;  4DR6 I;  2BV3 A;  4JG4 A;  3WU6 A;  5FLX C;  3QT5 A;  5BR8 I;  4DV6 I;  4K0K I;  4DV5 I;  3B78 A;  3HUL A;  4LF9 E;  3T1H E;  1BKN A;  2A2D A;  4OX9 I;  4B3S E;  4B3R E;  2V2V A;  1N0V C;  4B3M I;  1N36 E;  4DPY A;  1IBL E;  1HNZ I;  1OJ4 A;  2V2Q A;  4DV7 E;  4JV5 I;  2DEI A;  1ZXN A;  1QZR A;  1HR0 E;  3JAM Q;  1XMQ I;  1N34 E;  4DR6 E;  4JI1 I;  1D6T A;  5A2Q C;  4MYU A;  2E5L I;  3B8H A;  2UXC I;  3PYF A;  5IWA I;  3J80 Q;  5BR8 E;  1Z0C A;  2OI2 A;  4DV6 E;  4K0K E;  4JI4 I;  4DV5 E;  1MX0 A;  4OX9 E;  3H4L A;  2HFS A;  4B3M E;  4PRX A;  4DR5 I;  2UUC I;  2X36 A;  4X66 I;  1HNZ E;  4JI0 E;  1HNW I;  4DR4 I;  4JV5 E;  4LFB I;  4YHH I;  1H74 A;  3PYD A;  1WUU A;  4GKJ I;  2VQE I;  3J7A G;  3F0N A;  1XMQ E;  2VQF I;  4JI8 I;  4JI1 E;  4NXN I;  1MU5 A;  4UTG A;  2UXC E;  3V5R A;  4DV3 I;  4HAC B;  1EI1 A;  4JI4 E;  3J81 C;  4RPF A;  3T1H I;  2WW4 A;  4FWH A;  5LMN I;  4DV2 I;  4FW9 A;  2DEJ A;  1NHH A;  4DR5 E;  2UUC E;  4X66 E;  1IBM I;  1HNW E;  4DPT A;  4DR4 E;  4LFB E;  4YHH E;  4ED4 A;  2R42 A;  4P7A A;  4XTJ A;  4GKJ E;  2VQE E;  4JI8 E;  4NXN E;  1PVG A;  1H73 A;  4DU8 A;  3V2U C;  2BM0 A;  2V8P A;  1B63 A;  1ZM9 A;  4DV3 E;  1HNX I;  3PYG A;  4PU9 A;  3M6A A;  4WUD A;  4LF5 I;  1ZXM A;  5LMN E;  4DV2 E;  4JI5 E;  1Z5B A;  4JI0 I;  4JI3 I;  1IBM E;  4DXL A;  1XNR I;  4HXZ A;  4ZVI A;  3CWV A;  1B62 A;  3ZZ0 A;  4P52 A;  1S16 A;  4JYA I;  1Z0B A;  3ZM7 A;  1A6F A;  4LF4 I;  1Z0V A;  1IBK I;  3LPS A;  1HNX E;  3PYE A;  2UXB I;  1MG7 A;  4USK A;  1PIE A;  1FWL A;  2BM1 A;  1XNQ I;  4LF7 I;  4LF5 E;  1FJG I;  4KQV A;  1XMO I;  4JI3 E;  4X65 I;  4DV0 I;  4NXM I;  1J5E I;  4R1F A;  4LFC I;  1XNR E;  1H7U A;  4GKK I;  4LF6 I;  1XHK A;  2HKE A;  1ZM3 A;  4JYA E;  4WUC A;  4DV4 I;  4M1K A;  1Z5A A;  3D4J A;  4LF4 E;  3QT8 A;  1IBK E;  4DR7 I;  5FLX Q;  1KIJ A;  1Z59 A;  4LF8 I;  2UXB E;  2EFG A;  4FWD A;  1RR9 A;  4JI2 I;  3WU3 A;  2UUB I;  1XNQ E;  5LMU I;  4WUB A;  4LF7 E;  4X62 I;  1FJG E;  1ZM4 A;  4EMD A;  1N32 I;  5IT9 C;  3LNU A;  4JI5 I;  4DR2 I;  1XMO E;  3J7A M;  4X65 E;  4DV0 E;  4NXM E;  1J5E E;  3J80 C;  4FN5 A;  4LFC E;  1RRE A;  2CZ9 A;  1FNM A;  4GKK E;  4LF6 E;  2LJP A;  4HY1 A;  2HK2 A;  1S4E A;  4JI6 I;  4DV4 E;  3T1Y I;  1N0U A;  1KVK A;  1EA6 A;  5A2Q Q;  4DR7 E;  3QT7 A;  1Z0T A;  4HYM A;  4LF8 E;  2V34 A;  2ZIT A;  4JI2 E;  1VIS A;  1FI4 A;  1H72 C;  2UUB E;  5LMU E;  4YY3 I;  4X64 I;  4X62 E;  3ZZU A;  4Z7Y A;  1NHI A;  1N32 E;  4DR2 E;  4KHP I;  2UU9 I;  4AQY I;  2ZBK B;  1FWK A;  3K17 A;  2XEX A;  4DPX A;  1Z5C A;  2UXD I;  3ZKB A;  4B3T I;  4DUY I;  4Z7C A;  4JI6 E;  3T1Y E;  4DR1 I;  3GON A;  2E1R A;  4HAC A;  3ZZT A;  4LFA I;  4DV1 I;  3J81 Q;  4FWG A;  4YY3 E;  4JI7 E;  2ZM6 I;  4X64 E;  1KKH A;  2A2C A;  4USM A;  3Q1Q A;  5IT9 Q;  4KHP E;  5GME A;  2UU9 E;  4AQY E;  1DAR A;  3OTO I;  1N33 I;  4MYT A;  1Z0E A;  5GMD A;  2J7K A;  2F4V I;  2UXD E;  4B3T E;  4DUY E;  2UUA I;  2GS8 A;  1H7S A;  4DPU A;  4DUZ I;  4DR3 I;  2HHH I;  1Z0G A;  1Z0W A;  4DR1 E;  1I94 I;  3K1J A;  4PRV A;  4LFA E;  4DU7 A;  4DV1 E;  1PKP A;  3JAM C;  2ZM6 E;  2V2Z A;  5LL6 R;  2NPF A;  2HKJ A;  2E5L E;  1KTV A;  3QT6 A;  3ZKD A;  3OTO E;  5L3J A;  1ZM2 A;  1U2R A;  5IWA E;  1UEK A;  2HK3 A;  4I3H A;  1N33 E;  4UT4 A;  4DPW A;  2F4V E;  2HFU A; 
#chains in the Genus database with same CATH topology
 2OSQ A;  1PBU A;  4CCH A;  1QD1 A;  2DHG A;  1TV6 A;  4LIR A;  3D5M A;  1I94 E;  4IS9 A;  2QSW A;  5C0X B;  1Q0N A;  1NPR A;  1YJT A;  1N34 I;  3SCJ E;  5DRO A;  3ULH A;  5KFC A;  3VVT A;  4PWU A;  3NOC A;  4DV6 I;  3I0R B;  3B78 A;  3HUL A;  1TKZ A;  3T1H E;  2I9S A;  4CLF A;  2RH3 A;  4B3R E;  3WZ0 A;  1WHX A;  3C3L A;  4RNH A;  1TL7 B;  4M5H A;  1V5I B;  3SSR A;  2M88 A;  4A8Y A;  2KRB A;  3OR1 A;  4ILR A;  3MF5 A;  1HBN B;  4JBC A;  3MI7 X;  2XY7 A;  1S76 D;  2MQQ A;  1FXL A;  1AUD A;  4ZVE A;  3OVA A;  3QO9 A;  3BSA A;  2QZ8 A;  3M8Y A;  1FVQ A;  4DR1 F;  1V6H A;  3F73 A;  4OZ2 A;  5D77 A;  2CZV C;  2L9N A;  3V81 A;  3CDU A;  5BR8 E;  1WKK A;  4IDK A;  2OI2 A;  3VZH A;  4DCO B;  2XQC A;  1T3O A;  3A8E A;  1GX6 A;  3CJ0 A;  4JI1 J;  3OXG A;  1SKU B;  5KFP A;  5F3Z A;  3NAI A;  1U1K A;  3UO0 A;  3PW7 A;  2AE8 A;  4DUZ F;  2AP6 A;  2QLF B;  1RYR A;  2MZ1 A;  1HL6 A;  4RNN A;  2HHX A;  5T7L A;  1UPM B;  2XWX A;  4RNM A;  2MLX A;  4PG7 A;  4NRU A;  4HAC B;  3V6J A;  4P9S A;  2RS8 A;  5CQG A;  5KG3 A;  3TRG A;  5KT3 A;  4JI8 J;  3IR5 B;  3OD2 A;  3T1H I;  4X62 F;  5D78 A;  1DRZ A;  4H4M B;  3PW4 A;  1OQ3 A;  4FXV A;  5L46 A;  1BWE A;  2AGO A;  2IVM A;  2ZH8 A;  2IVF B;  2O1V A;  2JJ4 D;  3DXB A;  3SBM A;  4G1P A;  4DU8 A;  1N36 F;  1C0T A;  4U8V A;  4R8U B;  1NJW A;  3AA8 A;  3SSS A;  2MTL A;  1IKV B;  4UUX A;  3MPY A;  2MKY A;  3L09 A;  3W61 A;  4DFM A;  5CYQ B;  1FJC A;  2JE6 B;  1Y6Z A;  1DQA A;  2OHD A;  1Q5Y A;  1RBA A;  2GX8 A;  1R31 A;  1HW9 A;  1MN9 A;  4LF1 A;  3EPG A;  1KLM A;  4LBI A;  3MEE A;  1FDB A;  4QR1 A;  4N77 A;  3J81 U;  1FX4 A;  2NCK L;  3MMC B;  4NLU A;  2Y9H A;  1IBK I;  3P6Y C;  4IKA A;  2HQC A;  3CCT A;  4QWC A;  2IA0 A;  1JK9 B;  3PHT A;  4NPO A;  1PAU B;  4YP3 A;  1IR0 A;  3MAQ A;  2CJA A;  2YY3 A;  1FRX A;  2CQ1 A;  1X7V A;  3N5F A;  2CQC A;  3GIL A;  2UXC F;  3ZNJ 1;  4JI3 E;  1Y9O A;  4TU7 A;  1RIS A;  4R1F A;  2OKQ A;  2FJE B;  4WXW A;  5KFZ A;  4F4W A;  1TL3 A;  1RLC L;  4K2X A;  1NXI A;  1VQY A;  4ETX A;  5HMW A;  1VBZ A;  3I82 A;  2N3L A;  2B9W A;  3EYZ A;  1KIJ A;  2EG1 A;  1RQ0 A;  1RHK B;  3JS9 A;  3KDO A;  4JI2 I;  1CJU B;  1REG X;  3GV7 B;  1XNQ E;  4NEY A;  2R8J A;  1XIQ A;  3TUJ C;  3CE8 A;  4LRB A;  4ETZ A;  4DV0 E;  1VK3 A;  1AA1 B;  4IRC A;  2QFI A;  1RTZ A;  5K36 F;  1FNM A;  1Y5L B;  4LF6 E;  1RBO B;  4HR2 A;  1S9F A;  2H4Y B;  4DV2 F;  4ALZ A;  1TP7 A;  4ZVO B;  1CJT A;  4P2F A;  1S6P B;  1XR7 A;  1F5B A;  2FDN A;  2HW3 A;  1Z0T A;  4WII A;  3K2Y A;  3PY8 A;  2JL9 A;  3W9J A;  2DGV A;  4RBT A;  5LMU E;  4J9N A;  1FNX H;  1J2V A;  2AJ0 A;  2IJN A;  3ET6 A;  2DNN A;  2Y1I A;  1HNX F;  3BGO P;  1NBE B;  2IRU A;  2RB7 A;  1SL0 A;  4QIE A;  2N82 B;  3FEX B;  1NK7 A;  3EZO A;  1IWA A;  5D4L A;  4UY8 5;  5EL9 A;  2UU9 J;  1VC5 A;  4IG0 A;  3WQP A;  4PWD B;  4USH A;  3ZZY A;  3HT0 A;  3L7P A;  3VTI A;  4U3B A;  2B5J B;  4MT1 A;  3AD7 C;  4B3T J;  1X4F A;  3J81 Q;  2MMY A;  3I5B A;  2WBM A;  2FHJ A;  2JVR A;  4WIQ A;  3B4M A;  5C25 A;  1C0U B;  1CJV B;  2W25 A;  4DUY E;  4DPU A;  2HMI B;  3C16 B;  1WC5 A;  4WWS A;  4HI1 A;  1NUE A;  2VPZ B;  1V3S A;  4CO2 A;  4P2M A;  1C2P A;  2IA6 A;  4DV1 E;  4XO0 A;  2V2Z A;  4ZA1 A;  4TYA A;  2ILY A;  2OPS A;  4I6A A;  3GCX P;  4I3H A;  2UV8 A;  3MAA A;  4Y2M A;  1YK9 A;  1X60 A;  4OYX A;  5KFV A;  5A8R B;  1Q81 T;  2XZD B;  5I3U A;  1QUV A;  4DS5 A;  1FFG B;  4HT7 A;  4I1T A;  3PW5 A;  1SJQ A;  3MTJ A;  3X3U A;  3W9I A;  1D09 B;  4M94 A;  1S9G B;  1RTI B;  5CD4 H;  3W2V B;  1UAW A;  3HF5 A;  8ATC B;  4K4U A;  1NZA A;  3PIP Q;  2LFV A;  3TZZ A;  2DXD A;  1UVN A;  2OAU A;  1JNR B;  4RW8 A;  3BDE A;  4MDT A;  2YH1 A;  3HVW A;  2LMI A;  3ENQ A;  1HQ2 A;  4W90 B;  4DEZ A;  4LQ3 A;  3GFX A;  3W1Y C;  2Q43 A;  4KHP F;  3SIP B;  3QMQ A;  4OO1 E;  2ZH6 A;  2JC1 A;  1YHQ S;  1VRT A;  4PXE A;  4KY3 A;  3HHE A;  4RJV A;  3EX7 B;  4P72 A;  1D6T A;  1XER A;  3CC2 S;  2GQ0 A;  3BQ1 A;  3HT3 A;  1EKS A;  4CZC A;  2R7O A;  4NML A;  1K44 A;  5C7P A;  4ED1 A;  4HKQ A;  1XMQ J;  3C14 B;  4NZ7 A;  2GC8 A;  2ZOG A;  4OX9 E;  5D0R A;  4F0K A;  1RAE B;  3DOK B;  5D0G A;  2CQI A;  4DR4 I;  2VPW B;  3LP1 B;  2J0W A;  4CDI A;  2D9O A;  4Y0F A;  4N7T A;  1Y10 A;  4JI1 E;  5KFT A;  1PJ5 A;  3CJK A;  3GCM A;  5ETM A;  2J7W A;  3LAL A;  3RAQ A;  2VAS A;  2VPY B;  3NS5 A;  4HLB A;  2DIS A;  4PG4 A;  3V6D B;  2BUN A;  2BRK A;  3I4P A;  2AEM A;  9RUB A;  2VES A;  2JEA A;  2KHD A;  4OO1 A;  3GQC A;  2OH2 A;  1T9X A;  1Q82 T;  5A2Q U;  5IQ6 A;  2NSB A;  4F0H A;  2FUG 9;  3TW0 A;  3S6E A;  5LMN J;  2QL7 B;  3KHH A;  4DF8 A;  5AJ3 F;  4YDD B;  4JI8 E;  3I6P A;  4U67 Q;  3NGK A;  3SZ2 A;  4MKB A;  2H51 B;  2BM0 A;  2V8P A;  1B63 A;  5J1P A;  1KTQ A;  5JMN A;  2CKW A;  1VFJ A;  2MLZ A;  4NYO A;  1U02 A;  4QPT A;  1J5O A;  2DR8 A;  2AJF E;  3K8V A;  4ZVT B;  4DV6 J;  4K4T A;  1XNR I;  1X8D A;  1WEZ A;  3PV8 A;  3KJQ B;  4ZMM A;  1SL2 A;  1TUV A;  4I68 A;  2FLL A;  4WE1 A;  3CTR A;  4NA2 A;  2VIC A;  5HO4 A;  1R7I A;  4FS1 A;  1ROF A;  5EUH A;  1REV B;  3RW7 A;  1MN7 A;  3KJF B;  2D41 A;  1R8B A;  4LF7 I;  3TAM A;  3PS2 A;  2VB6 A;  1A0O B;  2QA4 S;  3R5D A;  3W7B A;  5IWA F;  1N5S A;  3T6B A;  1T03 B;  4NLX A;  1N5Y A;  4ECU A;  3PRB A;  4Q8F A;  1V3R A;  1XMO J;  1F3V A;  2MJN A;  4M1K A;  1SXL A;  3DRX A;  1Y3K A;  4NXM J;  2UUC F;  1O51 A;  3TWZ A;  2ZH4 A;  3PEJ A;  4NL5 A;  2NXU A;  4NYP A;  1RR9 A;  1R8P A;  1ULR A;  3WU3 A;  4WFZ A;  2B6A B;  3CT9 A;  2V6A A;  2VQF F;  4MIW A;  2NZ4 A;  1S1W B;  5IT9 C;  5KT6 A;  3FEZ A;  1M0S A;  1SH2 A;  1GX5 A;  3FMB A;  4GKK E;  4ZP6 A;  3UDL A;  2UUT A;  2J7U A;  2B7C B;  2PA8 D;  1WTF A;  1BD6 A;  2XSF A;  5A2Q Q;  1C1B B;  3T6J A;  1GMV A;  1LWE A;  1H72 C;  3M8W A;  3AOA A;  2ZE2 B;  4K59 A;  2P9G A;  1BQM B;  2KXN B;  3ZZU A;  1LKZ A;  4IRK A;  4DL2 A;  2X1A A;  5KFX A;  1RAA B;  2RAQ A;  5C2C A;  4FXD A;  5B0E A;  2C2E A;  1XXE A;  2KFN A;  1KVI A;  3R27 A;  2HBR B;  4PG6 A;  2HIY A;  1G4C A;  5KFI A;  3POT B;  3GV8 B;  1SL1 A;  5KG0 A;  3IN5 A;  5M2R A;  3V4M A;  3QRP A;  4TLQ A;  2G13 A;  4X64 E;  1HYS A;  3D0G E;  3FQL A;  1FNO A;  3THT A;  4OL8 A;  4Q0B B;  3PXG a;  2DPJ A;  1FXR A;  4LF4 F;  2UU9 E;  1ZA1 B;  1RT4 A;  1TK8 A;  4PAB A;  1P9Y A;  4MYT A;  1VQK S;  5G0R B;  3UD5 A;  4B3T E;  2XSJ B;  4E0D A;  4L73 A;  4EBE A;  3OTO J;  2DNL A;  3MMA A;  3MMB B;  4X65 F;  2ATC B;  4ZIV A;  4URQ U;  3SQO P;  3MM8 B;  4DBQ A;  3TP2 A;  2V4J A;  2CNK B;  4P2X A;  1UWA A;  1C4C A;  2MB0 B;  3MED A;  4QQB A;  2R8K A;  1HBM A;  4PYD A;  3NMA A;  5L3J A;  4QZV B;  3BH7 B;  2Z5C B;  4DJB A;  1OSD A;  2AMC B;  4JI2 J;  1YZ6 A;  4PQA A;  1RU1 A;  4BDP A;  1FE4 A;  3R7B B;  1QDU B;  1W26 A;  2DVI A;  1FER A;  2GJ2 A;  5KT7 A;  2F5G A;  4LRE A;  3US5 A;  3TYT A;  2E1C A;  1EZZ B;  4LF9 J;  4PPZ A;  2XMJ A;  3PJ9 A;  4IO1 A;  1FO1 A;  1QVF R;  4OO1 C;  3QSI A;  4A8O A;  3V4I A;  3R97 A;  3CJ5 A;  4F7V A;  3HX9 A;  1SBR A;  1BKN A;  1HMV A;  3BO4 A;  2L9D A;  2M0G B;  3OFE A;  1YWX A;  1WKL A;  1NDL A;  2JEG A;  1IKY B;  3R8Y A;  3KLV A;  3HVT A;  1HNV A;  2XNQ A;  3M32 A;  1RAC B;  2R2T A;  1HPZ A;  5DDP C;  1UET A;  3AB2 B;  4L3K A;  1RTJ B;  2DNZ A;  4I2Q B;  1B4S A;  1AB8 A;  2C28 A;  3GU0 A;  3MR5 A;  4FZV A;  4FW3 A;  4JI4 I;  4KQZ A;  1FF2 A;  1RTH A;  2HVI A;  2LCW A;  3TA0 A;  3W3S A;  4KV8 B;  3JSB A;  4I7F B;  1XQI A;  1HNZ E;  1ZZF A;  1LW0 A;  3N4W A;  1R0B G;  3AH6 A;  4DWI A;  4QYZ K;  2Y1R I;  1F0X A;  4GKJ I;  1AXQ A;  1XMQ E;  2HHH F;  1L3V A;  3IRW P;  4RW6 B;  4A8W A;  3NBP A;  1F5A A;  2CNO B;  3J7Z T;  1HNW J;  1WDD A;  4AL5 A;  3AQP A;  4LFB J;  1Y60 A;  4J3D A;  4S0M A;  4WTY A;  4MTP A;  2YBV A;  2PD1 A;  1MU2 B;  1LW2 A;  5KG2 A;  1GXT A;  2C2N A;  4RUA A;  2J5A A;  1Z4U A;  2YX1 A;  3H4B A;  1RT6 B;  5F8I A;  2FVS A;  2VJV A;  4B9S A;  1IBM I;  1P6T A;  2R7R A;  2D1C A;  2NUH A;  2QX0 A;  2FVC A;  2GVZ A;  3K5P A;  2KZM A;  2HQI A;  1HWL A;  2HWH A;  2PO2 B;  3GG1 A;  4ZN3 A;  3N9U C;  3OVB A;  3C6U B;  2ADC A;  2V68 A;  2YH0 A;  4KYZ A;  1VIO A;  1ZM9 A;  1DUR A;  2AT1 B;  3GFY A;  4DX6 A;  2AJQ A;  3BV8 A;  4FYV B;  2HS4 A;  5LMN E;  1N34 F;  2ROG A;  4JI5 E;  4XDD A;  2IDL A;  2M3D A;  4FF1 A;  4DV6 F;  4ZVI A;  2BJ9 A;  2H48 B;  3T5J A;  2IC3 B;  3ZZ0 A;  2E1P A;  3ZM7 A;  4J9S A;  2PN6 A;  3IM9 A;  1VQM S;  1NHK L;  3WX8 A;  4NOH A;  3OJS A;  5KG4 A;  3HI9 A;  4E2F B;  5D0E A;  3KMQ A;  1BXN A;  2J9E A;  4J37 A;  1U49 A;  3HVA A;  2DYA A;  1E3H A;  3VWS A;  4YB5 A;  1FDN A;  4CO3 A;  1Q8B A;  3RZA A;  2SXL A;  3RRK A;  4ID5 A;  1SH3 A;  3SFG A;  1XHK A;  4J9M A;  1RT2 B;  4KJI A;  2HKE A;  1VYA A;  4OFZ A;  1ZM3 A;  3QRQ A;  1RAO A;  4F04 B;  4H4K A;  4J91 A;  2VG7 A;  1YG0 A;  2CUY A;  2FLN A;  2VC0 A;  2FJD B;  2H65 B;  5K5M A;  1VGY A;  1SIZ A;  3CCV S;  1HWK A;  3MCS A;  5H1S V;  3JQJ A;  4DV4 J;  2DKO B;  5E41 A;  3RG6 A;  1HKA A;  4JI5 I;  1XMO E;  3J7Z 5;  4C11 B;  4NXM E;  3MM7 A;  2VU5 A;  2R7W A;  3DU5 A;  3SMZ A;  2V8G A;  2HHP A;  3T1H F;  3VAJ A;  1WC4 A;  1YIT S;  1JLG B;  5AE1 A;  4Q2L A;  4IZK B;  2I1R A;  1EA6 A;  3RAX A;  4ZPV R;  4LUB A;  1K73 T;  5LJ3 Y;  5KFR A;  3P3E A;  2JLG A;  2ZIT A;  3SDE B;  3R5J B;  3PO4 A;  2XGP A;  2PI4 A;  2CXE A;  2W9B B;  1NDC A;  2ROE A;  1B0V A;  1VMB A;  3UDC A;  3NCP A;  4D3H A;  2DT9 A;  3IA0 A;  1FWK A;  4WU2 A;  1XBW A;  1PAE X;  4O3Q A;  2XMM A;  5K36 B;  4KPC A;  4RW9 A;  1ARO P;  1RT5 B;  1UZD A;  4YY3 J;  5F8J A;  3H4D A;  3CD5 A;  3H42 A;  3TZW A;  1WD6 A;  3Q83 A;  4Z7C A;  1NDK A;  2C3U A;  4YR0 A;  1VQL S;  1U1P A;  2FTR A;  4B9U A;  5J2N B;  3DGV A;  3WC0 A;  1CJU A;  1E6V A;  4QWA A;  2AEF A;  2ALY B;  4ATN A;  3KXD A;  2LQ9 A;  4MU3 A;  2FY1 A;  1IBK F;  3R6L B;  5K8N A;  2PEB A;  3IR6 B;  3GV5 B;  3M6U A;  3L3C A;  4LF7 J;  2F4V I;  1T02 A;  1GXL A;  3P5T L;  2UUA I;  1ZZN A;  1S6P A;  1RWV B;  1HNI B;  4ED7 A;  5M2P A;  4WP3 A;  4DU7 A;  5HL