3PYFA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with amp-pnp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
296
structure length
296
Chain Sequence
SVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
total genus 80
structure length 296
sequence length 296
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pyfA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pyfA01
4X64E 1XNQI 3Q1QA 3J7AG 4FWDA 4X66I 4JI5E 4NXME 2Q2EB 3F0NA 2V2QA 4KQVA 2BM1A 4LF9I 4DR6E 4FWHA 1HNWE 3ZKBA 1N36I 4FW9A 3T1HI 1EI1A 1PKPA 2EFGA 5LMUE 1ZM2A 1N36E 2X7IA 1XMQE 3J80C 2WW4A 3J81C 4LF8E 3GONA 4LFAE 1H74A 1HR0E 2UXCI 4DV1E 2AJ4A 2DEJA 4DR7E 3JAMC 1IBME 4DR3E 4LFCI 1PVGA 2ZITA 4NXNE 3QT8A 1FI4A 2ZM6E 4JI1I 1BKNA 3T1YE 4JI3I 1Z0GA 4DPXA 1XHKA 2NPFA 4GKKE 2CZ9A 1MU5A 2VQEE 3QT7A 1U2RA 4K0KI 3ZZUA 4JV5I 1DARA 1ZM9A 1RR9A 1H73A 3B82A 1Z5BA 4DR1I 4DR5I 1XMOE 1H7SA 4JYAE 4DUYI 4B3TI 4DV3I 1I94I 3J80Q 3J81Q 3PYDA 4DV6E 4X65E 4DV5E 4DV3E 4JI5I 4P7AA 2UUBI 1PIEA 3D4JA 1ZXMA 4LF5E 1Z5AA 2XEXA 4YY3I 4JI2I 2VQFE 2UXBI 1KVKA 1FWKA 5GMEA 4JI0E 4JI7I 2OI2A 4LF7E 1J5EI 4LF4I 1A6FA 2UUAI 1IBLI 4X64I 1UEKA 2UUAE 4USMA 2V2ZA 4FWGA 4DV0I 2E5LI 4NXMI 1KIJA 2E1RA 1B63A 4DV0E 2E5LE 4DR6I 2DEIA 5IWAE 3ZM7A 1HNWI 4DR2E 5FLXC 1B62A 1EA6A 1HNZE 1Z0EA 4DU8A 3M6AA 1N32E 5LMUI 1WUUA 1XMQI 4LF8I 1N0UA 4LFAI 2UUCE 1HR0I 2BV3A 4DV1I 1D6TA 4GKJE 4OX9E 4EMDA 4DR7I 4R1FA 1IBMI 4AQYI 4DR3I 4DU7A 4HY1A 1Z59A 4NXNI 4AQYE 4MYTA 3WU3A 2ZM6I 1NHIA 3T1YI 4LFBE 5LMNE 3LNUA 1NHJA 3WU4A 4GKKI 2V8PA 2HK3A 2R3VA 2VQEI 1Z0TA 3WU5A 1FKAE 1N34I 1FWLA 1Z5CA 4WUCA 4HACA 1N34E 5IT9C 3K17A 5GMDA 1QZRA 1XMOI 4DV4E 3HULA 4JYAI 3LTOA 2HHHE 2UU9E 4JI4E 5L3JA 3B8HA 2F4VI 2V2VA 3ZKDA 1K47A 4DXLA 2HKJA 1HNXE 4PRXA 2F4VE 4DV6I 4X65I 4DV5I 4JI8E 4YHHI 4LF5I 5BR8E 4JI6I 4YHHE 3B78A 4X62E 4DV2E 1XNRE 4JI6E 3JAMQ 1S16A 2VQFI 3LPSA 2VF3A 4UT4A 4ZVIA 4JI0I 4LF7I 1FJGE 4M1KA 4XTJA 4KHPE 1H72C 4DR4E 4I3HA 2GS8A 3ZZ0A 1KKHA 4DPWA 3V2UC 1IBKE 2UXDI 2R42A 4UTGA 2UXDE 4Z7CA 5IWAI 1H7UA 4DR2I 4B3RE 2J7KA 4B3SE 1S4EA 4B3ME 1HNZI 1N32I 4USKA 1Z0VA 1OJ4A 4MYUA 3OTOE 3ZZTA 1KTVA 2UUCI 4GKJI 4URLA 4OX9I 1RREA 1XNQE 2ZBKB 4FN5A 4X66E 2BM0A 3V5RA 2HFSA 4LF9E 4LFBI 5LMNI 4Z7YA 2HK2A 3T1HE 1N33I 1ZXNA 1N33E 1MX0A 2UXCE 1Z0BA 3H4LA 4PRVA 4DPUA 2X36A 3PYFA 5A2QC 3QT5A 4DV4I 4LFCE 1ZM3A 3PYGA 2HHHI 2UU9I 4JI4I 1N0VC 4JI1E 3K1JA 4JI3E 5FLXQ 4P52A 1HNXI 4JI8I 4HXZA 3PYEA 1Z0CA 5BR8I 4K0KE 1NHHA 4WUBA 4JV5E 4PU9A 4DV2I 4X62I 1XNRI 1Z0WA 2A2CA 1VISA 2HFUA 4DR1E 2LJPA 2HKEA 1MG7A 4JG4A 1NZ0A 2A2DA 4DR5E 4DPYA 2V34A 1FJGI 4HYMA 4KHPI 4DR4I 1ELOA 5LL6R 4DUYE 4B3TE 1I94E 1IBKI 3QT6A 4DPTA 4ED4A 2UUBE 1FNMA 1ZM4A 4B3RI 4LF6I 3J7AM 4B3SI 5IT9Q 4B3MI 4RPFA 5A2QQ 4YY3E 3CWVA 4LF6E 3WU6A 3OTOI 4JI2E 2UXBE 4HACB 4DUZI 4DV7I 4JI7E 1J5EE 4WUDA 4LF4E 4DUZE 4DV7E 1IBLE
chains in the Genus database with same CATH superfamily
1RDRA 3J7AG 2X3GA 2E5IA 2JVRA 2WBMA 1S9GB 3CD6S 2CPDA 5EWFA 3GSDA 2EFQA 1RT3B 5DQGA 3CO9A 4I67A 3CDJA 2E7VA 2PE8A 2GO9A 1OYPA 2NN6A 1HHSA 1YJVA 2X7IA 1FVSA 1ACMB 2RQMA 3T19A 2E44A 4F3OA 1VBKA 4MK8A 2BQ3A 3G4SS 5J1NA 4CO5A 2PD1A 1KC8T 3MAAB 3M8PB 2OMLA 2UUCJ 1MN9A 2F1FA 3QAEA 3QGGA 1XHKA 4RU2A 3AT1B 4ZLNA 4TQRA 2HBZB 2IAJB 5KT5A 1KLNA 3GV8B 2QL9B 1GMVA 3I0SA 4O4RA 1ZM9A 2AT1B 3B82A 3EVOA 3M9OB 1HD0A 2JRSA 1RWUA 2MJUA 2G0CA 1KEKA 1B7YB 1VRTB 1H2VZ 5JMNA 3VAFA 1WKLA 4DV5E 2C3UA 4LQ3A 1Q53A 3QRPA 4ICLB 4M5DA 2YWWA 3H2VE 3LGMA 1VQ4S 2POKA 3TAPA 1HQEA 3L7ZA 3LP1A 4K5RA 3TAQA 1HA1A 4ZVPB 3UCUP 2V8VA 4JI2I 1KVKA 5KFUA 3BBBA 1LWFB 1RCOB 3S6EA 2PFDA 2AJ1A 4X64I 2ZDPA 1TAQA 4RW7A 5AE2A 3NWGA 1TVRB 3TNVA 4CM0A 1B63A 1TFYA 5HMYA 3GV5B 2QFIA 4QW9A 1L3VA 2VG7B 2YKPA 1JXLA 4DU8A 1N32E 5JEAD 1UZHA 1WUUA 2JHEA 1F5AA 4WJBA 3W2WB 4LF8I 3PTWA 3R27A 4JI2F 2J65A 4TN2A 4ZHRA 5KFPA 5BXIA 3L9ZA 3IFEA 3W1YC 5F9LA 3DRSA 3BV8A 1WEZA 4X64F 1K0VA 4FF1A 1MROA 2OELA 1RWXB 3BGFA 4KO0A 3BSNA 2HZAA 1RI7A 5L9XA 1IQZA 3M8WA 3HX9A 2DXDA 3ZZZA 2AU0A 4HACA 4LF8F 2RRNA 4DUTA 4ZCLA 2CIMA 4C97A 1S6OA 3WQPA 2IYIA 4OZ3A 1Y00A 1NKEA 5E2QA 3A1YG 2VA2A 3ZKDA 2DGSA 2IRUA 4EK2A 5B0DA 2MB0B 1Y60A 4ANEA 1IXKA 2ZEJA 1VC6A 2MLXA 2O1VA 1SV5A 3U1LA 4C11B 1HQUA 1CLFA 4LF7I 2JLGA 1HBMA 2KFYA 1QTNB 1F9FA 5C2GA 4AXJA 2GS8A 2LQ9A 3OVAA 3KJQB 1KKHA 2UVWA 4P2XA 4Z7CA 5IWAI 2CDRB 3GZ7A 3LALA 4C8YA 1Z0VA 3TA0A 3KLVA 2OP5A 4IH7A 2IPOB 1KTVA 4BWMA 1JMTA 3BYPA 4LF7F 3KLFA 1OY9A 3ZTQA 1RREA 3FQKA 3NCPA 2CPFA 2CJAA 1NK8A 3PIOQ 4WKYA 1TUVA 2KT2A 1W26A 3VALA 4RW6A 3TZYA 2V67A 3IG1A 5I3QA 2XO7A 3IS9A 5IWAF 4DN0A 4BA2A 1RT5B 5C0XD 3R7SB 4QR1A 4OQJA 5ETRA 1N32J 1HQUB 4DPUA 2VHGA 1ZM3A 5CCLA 1LWCA 2ZBRA 7AT1B 4ZP8A 1YDLA 1Y4UA 3IRWP 1TL5A 3AAWB 1RAFB 3PYEA 5B0CA 2AWZA 1NM2A 4IDKA 4QIWD 2CVIA 1SIWB 2HFUA 4X4SA 3QJJA 4C98A 4MQYA 4DL4A 4B9SA 1YBUA 3HVTB 4MIAA 4NI2A 1Q5VA 2PO1B 2G2OA 3MCMA 3CCSS 1FDNA 3ONQA 2BXJA 3G86A 3IS9B 3OL8A 3T1AA 4JYAJ 4DZ6A 1T8EA 4BA2B 3HVRA 3P5TL 5GVQA 4DL7A 4ID5A 3GCMA 3U02A 4B3RI 4B3SI 5A2QQ 4Q5VA 3CWVA 2VDIA 3EJMA 4JI2E 5DDRC 2W7OA 4K4ZA 4J91A 2PC6A 3GIJA 3THTA 2NXJA 2YNGA 4DV7E 3BM7A 2MLZA 1LWCB 4X64E 1PAEX 4KC5A 4XTTA 4HTIA 1YJUA 2J76E 4XK8C 1WKJA 5CYMB 2M88A 2OEJA 1VQ8S 3GJQB 4FS1A 4B3RF 4IR1A 4B3SF 2WSFC 2FVCA 4EFAC 2WW4A 4LF8E 4USVA 3MECA 1RWKB 4DR2J 5L38A 1S1TB 5IM0B 1Q95G 1XWLA 2DO4A 3PACA 3BBCA 1FI4A 2VFVA 1RT7A 2KFZA 2KM8C 4WFYA 3A13A 1FX2A 1EQMA 4ZPWR 5HO4A 5K36A 3ZZUA 2R2UA 2YKQA 3MM9A 3R3TA 3Q2SC 5KFHA 2PEHA 8RUCA 2XCAA 2C37A 3AY0A 1D9DA 3H98A 3KJNB 2UV8A 1HI0P 3TOQA 3TWZA 3QZ7A 2A1BA 2E29A 2LECA 1XC9A 1EZZB 5LOQA 4MT1A 3EE3A 3MEDB 4DJBA 4P7AA 3HSJA 4GVBB 2RIJA 2LA6A 1YIJS 1UETA 4N8OA 1BGXT 1M0SA 2CQGA 3BJYA 1NK4A 3MECB 1VOMA 1BUXA 2ZH4A 3VAKA 3RR7A 3GIMA 4LF7E 5ETOA 1TL3A 2IA0A 1A6FA 2MPUA 2DNZA 2G2ZA 4H4OB 2X3DA 4USIA 5D3GA 4Y2AA 3UPFA 4PQUB 1KVIA 5FWKA 5IWAE 4U7UD 2M0GB 5K36B 5KT3A 1OY6A 5HJYA 2CWKA 2MGZB 4P9SA 3O3LA 4IOCQ 2QMUB 4NLQA 3G71S 1X4GA 3T5JA 1RXOB 5JEAF 2PSZA 3EX7B 5HROB 4DV7J 3AA9A 5KG6A 3MM7B 4X64J 3LA0A 5HQLA 1VQLS 3BSCA 2DITA 3LNUA 3MMAB 4DZDA 1XNQJ 2LXIA 2L9NA 1KOHA 2EG2A 2V8PA 1LFWA 2LQ5A 4ZPCA 3P3GA 1N34I 2RNEA 4Q0BB 3I4PA 2FVPA 2IY5B 1IKWA 5DRQA 2LEPA 2AZ3A 3DRRA 4NLWA 3TQEA 1Q8BA 1YLXA 2GJFA 2FJAB 1Q0NA 1N34F 4JI6I 3PS3A 1CS4A 5KFEA 2VQFI 1I1GA 2DH7A 4WXOA 2YWGA 3DLKB 2E1CA 1S1VA 5DGAA 4KSEB 4EO6A 1KDNA 4LOMA 1U1KA 2LDYA 3V2UC 3DLEA 1TTHB 3CCZA 4J9MA 3RAQA 4B3RE 3UCGA 4B3SE 3HD1A 4JI6F 4E8UA 4FBUA 3AQPA 2D1CA 2OH2A 2VQFF 1RU2A 5A8KA 1Z2LA 3K8WA 5HVFA 2VBYA 3K8VA 3T6JA 1EETB 2I0XA 1DLOB 3V5RA 1Q8KA 5HBMB 2GIRA 5KFSA 4K5SA 1H7WA 2AGQA 1X4HA 2HHTA 1UDSA 1VRUB 2CQCA 3PCOB 5IWAJ 1IVZA 1PC5A 1U02A 4ES1A 1ZXNA 3KLHA 5D0HA 5B0EA 2CPXA 3LAKA 3ADAC 1WC4A 5IT4A 5F8GA 1WEXA 3I0RB 1KONA 4IFVA 4E98A 2P2CB 2GNKA 5GAGU 3DLEB 3EPIA 3K1JA 1QAIA 3BGRA 4DR7J 2V8HA 1F2GA 3WC0A 4J5OA 2HLUA 1FK9B 2IDLA 1F9HA 1OYRA 4OO1B 2C39A 3MMCA 3T1YJ 4DV2I 4AL6A 3KK1A 2Y3YA 3S1TA 1WHYA 2XNQA 4K4UA 3AOCA 1UJ6A 5E41A 3AHPA 4A8XA 5IQ6A 1ELOA 1MWZA 2OLWA 3PJXA 3AB2B 3HHKA 3C15B 1YQHA 3CCES 3DC2A 2XMMA 3SYZA 4LUBA 3FZBA 4DPOA 4ELTA 3NEKA 1N8RT 2RKIA 3VF0B 1U1QA 2ZD1B 4DV2F 1PBUA 2NUHA 3G6ES 2XB2D 4LF5J 3W61A 2WZ1A 3BBFA 3RB4A 4DUZE 2QYCA 5JEAE 3NRBA 4WK1A 3UD3P 4KGVB 4EGLA 4O4GA 2FZKB 4JI5E 3IWLA 4KBIA 3M2UA 1IKXA 3E3XA 4LF9I 2NLWA 4GVLA 1LK7A 4U7CA 4YR3A 1BQMB 2VPXB 3CUNA 1N36I 1SJ3P 1EI1A 4FF2A 3KK1B 1U6ZA 3HHNB 4QQBA 3EXCX 3R6GB 3GYXB 3DXBA 1MNEA 2B43A 2J0QD 2YX1A 1GTEA 1G3OA 2ZITA 1PVGA 1Y5YA 2GMHA 1TKTB 1GMWD 4LF9F 3GV7B 2NPFA 4IZJA 1RHQB 3IWXA 3HDSA 1N36F 2ZVSA 1PJ7A 2F63A 4M5GA 1WTFA 3AB4B 3QT7A 3DYAA 3US5A 1KD1T 1E6YB 1I3OB 2RF2A 4ZKAA 3GMEA 2KRBA 4ZDNA 2W1BA 1XMBA 2WTFA 5J2MA 1Q86T 1FRIA 4WP3A 1FRMA 2VH7A 3MM5B 1SH2A 4K2XA 3DOKB 2GQ2A 1VHFA 5EX0A 3GMGA 2EBGA 2HBRB 2H4YB 3NG8A 2LDIA 3FCWA 1JKHB 3GFXA 4QIFA 5DM6Q 2VQFE 3W3SA 2HWHA 1S6QA 4LF4I 3DHXA 4Y28C 3L09A 1R8AA 2R7QA 3ENWA 1SQEA 1Q16B 4N77A 3CD0A 1HNWI 4XPEA 2W2NP 5FLXC 1N5VA 2FLNA 4G1IA 1NK6A 3TA2A 2HQIA 5LMUI 2RU9A 2QSWA 4F4XA 4X4OA 2CPYA 2OD4A 1D6TA 4LF4F 3KLGA 2K06A 5AE1A 4HY1A 4DCJB 2YX7A 4NXNI 4DUZJ 2CPEA 2I5JB 3FNNA 1LW0B 1H6KX 1R0AB 3EMTA 3ZZYA 2BABA 3HHDA 1NHJA 4RBVA 4JI5J 2BA9A 4GKKI 1HNWF 4TLRA 4WP8A 5LMUF 2GQQA 4U9RA 2BA0D 2JEAB 5IT9C 3NBPA 1S6QB 1N6QA 3P6YC 3HFKA 1FD2A 4NXNF 4OKGA 5C5JA 3EDRB 3OXGA 1SJFA 3MEEB 3GPAA 1VS3A 4GKKF 2VPWB 3CDEA 1APSA 3NOGA 1Z4UA 1P27B 3T5LA 3ZNUA 4DV2E 1LW2B 4OX8A 3NGSA 4TKTA 4A8YA 2V6AA 3ITHA 2YH1A 2J7WA 4F2SA 4BCAA 2VF3A 3CE8A 4GC6A 1WF0A 2AGOA 1VIOA 4RKUC 5JJBA 3AA8A 3SXLA 2NN6D 4P7TA 1RA6A 2DGOA 2W9BA 4OO1F 2AEFA 5ETPA 2A6OA 4ILMA 5K36C 3UWTA 1HNVB 4FF3A 3LWMA 4PZVA 4RW8A 2DNHA 5H1SV 2OPRA 1N6QB 3MDFA 4URLA 2CRLA 1WI8A 2C2DA 3U1NA 4EBCA 1FKPA 2UXBJ 5HMWA 1NSKL 3SCKE 2J6SA 1HYSB 4LF9E 2QZ8A 1RHJB 4LRAA 3D1QA 3R5JB 2OD6A 1ZA2B 2BEFA 3GU0A 1HL6A 3UDEA 2JDJA 3GG0A 1TMMA 4Q8FA 4PXBA 2FHJD 5CZVA 2C3PA 2ZKTA 2KHCA 2UU9I 3JSYA 3TAMA 4HYKA 2H9ZA 1JLFA 4P72A 4ECTA 3OSPA 1SCJB 2LVWA 3E51A 2H1YA 4PPDA 4FW6A 1UVIA 4ILLA 2QA4G 4KGZB 2BE2A 4FW4A 4OI4A 5F8IA 2CG8A 2JNJA 2UU9F 3P8BB 4TY9A 2D9PA 5L1JA 1VYAA 3FCVA 1EJ7L 3M6XA 4O44A 6AT1B 3L3CA 7FD1A 3MEGA 3MZIA 2GFFA 4Y6IA 4X65J 3OTOI 2KJVA 4A8SA 5HL7Q 4ZCIA 2HVDA 5K20B 1X7VA 4LF4E 2CQ3A 1YJWS 3PG9A 2BKNA 3PRDA 2HNYA 4ES3A 5JVHQ 2DRDA 4OYXA 3SZ2A 2QN6B 2KDOA 4NZ7A 3PO4A 3EZOA 1HNWE 1YJRA 1J5OA 3M8RA 1WORA 3DFEA 5L9NA 5LMUE 2QA1A 3NCQA 3SSRA 1IM4A 2LA4A 3OTOF 1NEEA 2R8JA 2DEJA 3J7YU 3HJFA 2PO4A 4CO1A 1H0HB 4YFUA 4W98A 2VODA 5F8NA 4NXNE 4O44B 2YKAA 4DN9A 3IMQJ 4X4RA 3HP6A 1ULRA 4GKKE 4QNJA 4LF9J 3ET6A 1MU5A 4OO1C 4JV5I 1ZAWA 4DFJA 3BGLA 1RBOB 4Q44A 2B4UA 3M1VB 4IG0B 3NCRA 3OFEA 5ITHA 2WVDA 1JLCB 4U8YA 2K8GA 2BRLA 3L7UA 3ENQA 4F26A 4DV3I 2E5GA 4O23A 4USWA 5IQQA 3IM8A 4G1QA 1X4EA 1J5OB 3N28A 3O2IA 2Z30B 4FXVA 3M7ND 1Z5AA 4DSEA 3UN3A 4KV8A 4JV5F 1U8WA 5ETNA 3RBXA 2VFUA 1RUSA 3R8YA 1SQGA 1QSSA 4AIMA 1JXEA 3H2LA 2EI5A 2RSQA 3DLJA 1F9EB 1JLQA 3FGVA 2BACA 3HMJG 4PEOA 2D74B 2V4QA 4C48A 4NWBA 3CCJS 2Z2ZA 2BQRA 1B62A 1KLMA 1NSAA 1RTDB 1GX5A 2HHSA 2OJ3A 4MU3A 1SVDA 4R8UB 1R31A 1ROFA 3Q22A 1NUEA 4X4VA 1S6PA 1FWPA 1IBMI 4DR3I 2VJUA 3JQKA 2ZC4A 3JTPA 4ZIVA 3FRZA 1HBUA 2C3YA 4AXIA 3ZZPA 5L1KA 5KFMA 3ZZRA 3D67A 2PA3A 4KB7A 2JEGA 2W2PP 2ZZMA 3OR2A 1Z5CA 1ZETA 1S1UB 4M5NA 4LCFA 5LMUJ 2MQLA 1GXTA 5KFCA 1CJTB 2GO8A 4W92B 3W65A 1IBMF 4DR3F 4LREA 2J5AA 2UU9E 1TFWA 4ERDA 5L3JA 4PUOB 2GGPB 4YQWA 3VZIA 2FVRA 2DNKA 2HGNA 1DTQA 3M30A 1T9YA 4OYZA 3HT0A 1VGYA 4LF1A 4IFDB 4GKKJ 1JJCB 4LCGA 5CYQB 2FGCA 4K0KJ 4M1KA 1Q7YT 3RBDA 4TY8B 4B3OA 2BBEA 2HHQA 3CIMA 3G8QA 5KFGA 1NO8A 4KH1B 3Q8RB 2GJ2A 4WZQA 2VG6A 1T05B 1ZAVA 1G4CA 2WONA 3C14B 1UFKA 5HMZA 1YGYA 1FDDA 3D28A 3OTOE 3ENVA 5DZ6A 2N82B 3RBZA 3R5CA 5J1PA 4OX9I 4DS5A 1CQNA 1UDOA 1P1TA 3QO9B 3PJWA 2CG9A 2O1PA 4FN5A 1UZDA 2B6AB 2YBVA 2OGUA 5KG0A 4I2PB 5CA5A 3KMQA 5L1IA 2XGQA 2D69A 5EWGA 4DL5A 5ETMA 3GYGA 4OHYA 2WVCA 2CQBA 2BANA 4DQQA 1YH8A 4ZCKA 2HAIA 4P71A 4PG7A 1OY8A 1A0OB 2ZHAA 4OX9F 2VUGA 1EHWA 4P6QA 2Q79A 1D3WA 1Y5NB 2BA0G 4J9VA 4MU0A 4M5IA 2MYFA 3JQMA 2VG6B 1HNXI 2GAHC 3OJUA 1WG1A 1S12A 2YKMB 4JI8I 1NCLA 1UVNA 5BR8I 4JV5E 2XS5A 1M90T 5KG5A 2VQEJ 5IS2A 4LVNP 4C7QA 4DPYA 1FJGI 5DLGA 5HAOA 5C25A 1HMVB 2LQ8A 3Q8PB 4CLTA 4ZP7A 2ZC3A 4B08A 4C8NA 5CCMA 1XMOJ 4NA1A 1HNXF 3H5UA 4JI8F 3NZKA 1NPPA 1FDBA 1ZM4A 1J27A 2GO3A 5BR8F 3VZHA 4DV6J 2R2TA 2BANB 3KYLA 1WSVA 3GFHA 1REGX 2WVBA 4N3OA 3CC2S 2JE6A 5EL9A 2PNMA 1FJGF 2IVMA 2ZWPA 3UVJA 2HZCA 1WC1A 1JLGA 2QV6A 3CJKA 2G0IA 2V4JA 4U67Q 4LIWA 3LP2A 3OVBA 4UW2A 2MZ1A 1VRQC 3PV8A 2KN4A 3E8OA 1A9NB 2Z58B 4URSA 2CG4A 5EX3A 3MCSA 1KHVA 3J81C 2HBQB 1U1OA 3GONA 8AT1B 3OXFA 3UO0A 3PO5A 4U3BA 4XDDA 4ECUA 1SL1A 3OTOJ 1H3DA 1IBME 4DR3E 4C0OC 3G87A 4N47A 1AZSA 2GVZA 2IOQA 2D7SA 1XBWA 2IMWP 3KRNA 1XN9A 2OPPA 4F3QA 2RMLA 1FRLA 2YPZA 3PEHA 1LXNA 2Q43A 2HVZA 3N79A 1WDTA 4MKVA 1PG5B 5AJ3F 1JLGB 3K0JA 4NBQA 2ACYA 1GX6A 3J81Y 4J9PA 1RT4A 1RT1A 3CJ3A 2QFJA 4CCHA 1YG0A 4A46A 2LMIA 2HHUA 2IOPA 3NNCA 4S0MA 1U24A 2NS1B 2WOMB 2G9OA 2NN6E 3KG0A 1U6FA 4JV5J 5J1EA 1WF1A 2YKNA 1SC1B 3F56A 2UUAI 3TVZA 2E9ZA 3ZTPA 4CLLA 1NHUA 4B9UA 4PABA 4ZN3A 1USUA 4G3IA 4DL3A 3QAUA 3POTA 1VDHA 4OJHA 5KFOA 1BXNA 3CJ8A 4WBFA 1GAOA 2K3IA 2VC0A 3EWGA 3BO4A 4CT9A 1MMNA 1XMQI 4KFBA 1OSDA 3V6DA 1HR0I 2BV3A 1MLAA 4RUCA 3G82A 4EMDA 4OX9E 2UUAF 2Y0SD 2O67A 4Y34A 5ELWA 4PWWA 2BR2A 5T7LB 2JFDA 4ED7A 1T9XA 1YJ7A 2GVDA 4M5KA 1N5SA 1KQKA 1XMQF 1UEVA 3JSRA 4MK7A 4A8MP 3N4WA 2VV5A 3K5MA 1HR0F 4O3OA 4RW4B 2F40A 4F4AA 2XMVA 4OHZA 4RJVA 2HAFA 2WRMA 1I51B 2Y0BB 3POTB 2V2VA 2F4VI 1RBLA 4ANDA 3NY0A 3FDSA 2KT5A 1S72S 1HNXE 3Q23A 3Q8SB 2ZJQQ 4JI8E 3HHLA 1BLUA 5BR8E 3GIRA 4J9UE 3DLBA 4KFBB 3CF5Q 1Y6ZA 1RB0A 5KFBA 5IV4A 4NPOA 2CKWA 2PI4A 1OYSA 2DT9A 4I1TA 4NZ0A 3M7NG 4KKOB 1FJGE 3Q89A 4J7CA 5DM7Q 1RTJB 3IRXA 2M2BA 2DCLA 1C1BA 3N6NA 2JFKA 2F4VF 3GCXP 5KG4A 3A3NB 2ZH6A 4OLOA 1B99A 1RACB 1UA0A 2EFNA 2GVDB 4OZJA 2KL8A 3JSMA 4O0NA 4DUYJ 2L9WA 1RTHB 4YN3B 1OJ4A 2XTJP 1CJKA 3BO3A 2QC3A 2UUBJ 3RG6A 2W9CA 2RAQA 1S0VA 1X9WA 5ETSA 4ZVEA 4H4KC 2HHWA 4IZJD 3EPGA 4LRFA 2CDQA 2MKCA 2FY8A 1H7XA 1X31C 1J5EJ 3C16A 3RRKA 2RS8A 5DG7A 4OHVA 3VAJA 1UW4A 2HNZA 4CTAB 1H2UX 1OIAA 5GAEI 5K14A 1NAQA 4DR6J 1IWAA 4FVMA 1OPZA 1N33E 3P3CA 2DIVA 2V9WA 1NDCA 1TMJA 1C1BB 2MDAA 3PHEA 3MPYA 2HHHI 4OX9J 2QLXA 5KFQA 2M8HA 1UDNA 3M8SA 5CQGA 3BEGB 3CTRA 4ELUA 4IFDC 3BH6B 2DCUB 5E3PA 1RAJA 3J7A1 3K58A 2D9OA 1BWEA 1H98A 4RO0A 1MG7A 1WC6A 3AH6A 4ECZA 2RRBA 4KHPI 4ZJLA 3K7RA 3OUYA 2X51A 2HHHF 1OO0B 3FEXB 2IC3B 3PKMA 3EZUA 2C2ZB 3UN2A 5B08A 1DRZA 2BA1G 4PXDA 2H4WB 3Q8QB 3QNWB 5KT4A 2VICA 3A4TA 4LF6E 1R6LA 2O1TA 2Z5CB 4P2SA 2Z2MA 3D1HA 3Q6MA 3FRYA 1TKZB 3IAS9 4KHPF 5A0YB 1S1XA 1CJVB 1RWOB 3TUJC 2V2QA 5JUMA 2ZJRQ 3FUYA 3ILJA 1ZPVA 4M5JA 2BW7A 3FK4A 1S48A 1RZMA 4DDFA 1HNIB 2VZ9A 5L39A 2EFGA 1ZM2A 5M2RA 1H2TZ 1S7HA 1XMQE 2V50A 2DR6A 3H4DA 1HR0E 4YB6A 2QLBB 1HNZJ 2JEBB 4ETZA 2JWNA 4FXWA 1IKYA 2KRRA 2AQ4A 2UV8G 3DOLA 1HWKA 3MCNA 3W63A 4C8OA 3JXOA 3ZTRA 5F3TA 2CNLB 2XMKA 1N88A 2KJWA 2N4CA 3AD9C 1KBRA 2EK6A 3DM2A 1H73A 1JXVA 1N33J 1L3SA 4RNHA 2Z56B 3C3LA 1S1XB 2EG1A 5A8WB 2PN6A 2FIUA 3GJSB 4LBIA 2Z5EA 5AJ3J 1WI6A 4MFBA 4B17A 3J81Q 1B0VA 2ZHBA 4C9DA 1TV6A 4ECXA 3TX8A 2W7AA 2DGWA 1HBOA 2OFGX 1P9YA 2CQ1A 4FKXA 3TJ8A 1LFPA 4JUZA 2MZQA 5H9EJ 1F3FA 1SBRA 1S49A 3HPOA 1YRXA 1IBLI 2DNOA 4KJIA 3M2VA 2MHNA 3D0IE 1C0UB 2V2ZA 2XGPA 4NCBA 5D0RA 1U0HA 3EXYA 3BPDA 1BD6A 5GAGI 3M6AA 4AM3A 1SUQB 4JV0A 3CDIA 4MK9A 1VQSA 4DV1I 4LF6J 1PJ6A 1HBNA 1TL1B 4DU7A 1IBLF 2IBKA 4O3QA 3K5LA 3WU3A 5B09A 3UN5A 4ED2A 3OSNA 3LAMA 3GG1A 5HMXA 2R9LA 1K1QA 2B9EA 2K7KA 3C6TA 2W4DA 3DMJB 4QWAA 4WE1A 3U1MA 2DNRA 4ZPTR 4FYDA 3CULA 3C66A 2N7CA 3HZGA 4DV1F 1XMQJ 3Q24A 1R7IA 1FKOB 4ED1A 1HW8A 3NWRA 4CYUA 3M2VB 2HHHE 2VA3A 5KFTA 5KTQA 2WP8A 2YH0A 1REVA 1CQMA 1U0HB 2LYVA 4GMKA 4DFPA 4OX7A 3AXKA 3VAMA 5E3RA 3UFCX 4B9NA 2CPHA 4C0BA 3CB4A 1URNA 3FMBA 4DF4A 2CXEA 4K4YA 3D6FB 2EKYA 1IJFB 1GMUA 1U47A 2HFNA 4IKAA 2BW2A 4KHPE 1H72C 3GWCA 2MSSA 3D6TB 2ZOMA 1E3HA 2FVQA 4M95A 3W60A 2M7SA 2V0NA 3R6LB 4HI1A 3H2UB 1VJQA 4NYZA 1AB8A 1DQ9A 2NCKL 3TUZC 2LKZA 2QJ3A 1UWBB 4MYUA 1CJUA 1S79A 1F0XA 2UUCI 4NRTA 1NDLA 1V5VA 1MWQA 4CYUB 1LOUA 1UVLA 3HD2A 3N6LA 3D3BJ 1REVB 3D9BA 3P5BP 3SSSA 3D6MB 2R7WA 3PW2A 1OYDA 1Q81T 3GTYX 2D3OR 4H4MB 1VQOS 2P8IA 3BREA 1YJNS 3OL9A 4V19X 2RRAA 2UUCF 1X9SA 2C3OA 3J7AN 1S9EA 4L6V3 1HW9A 4RWWA 3FBBA 3BSOA 2A10A 3PS1A 4YB5A 3D1OA 3KG4A 3AJDA 4MU1A 3IXQA 2MY8A 2F4FA 2MLYA 4I6AA 4A4JA 1B64A 1Z0WA 4LR9A 2A2CA 5LSOA 2PI5A 2AEMA 3KFWX 2DGQA 1FESA 2B4VA 2LU1A 2OEKA 3TO8A 1VCTA 2RUGA 2E9TA 3KXDA 2HPUA 2RVJA 3NS7B 3SDEA 2H3EB 3C2PA 1X4DA 2QEXS 1C0TA 1TUGB 5JXSA 3DLGB 2ZUAA 4BA1A 2YNIB 5KG2A 3I32A 4MAKA 1R43A 2IJNA 1JK9B 2W4CA 1IBLE 2KH9A 1KVJA 3NL0A 3NKYA 4WZMA 4ECVA 1JLBA 1YZ7A 4BDPA 3I5CA 4IOBA 4FWHA 3HHLC 4D3GA 3LP0A 5KG3A 1WD6A 2AMCB 3W9JA 4FF4A 1X5OA 4ZPVR 4K4TA 3HT3A 4DV1E 2FC8A 1DQAA 4WIQA 1QAYA 2M9KA 2YVSA 2Y1IA 2OUGA 2AKWB 3WC2A 4KYZA 3T9ZA 3PFEA 2FHMA 3HZEA 1B0PA 1H38A 1Z0GA 1X4CA 1AA1B 1LNQA 3DOMA 3AOBA 3IA0A 1M5KC 2SXLA 3MM6B 1U6BA 3H5SA 1VQ5S 4GO7X 5CABA 3ZFVA 4M5MA 4EI2A 2L3MA 3ZO7A 3RJMB 2JVOA 4USHA 4NCGA 4KGMA 2EBEA 1R8HA 4JI4J 3CMQA 2C3MA 2KO1A 5DNLA 2AP6A 2GMJA 4CLZA 2YWHA 1Y4SA 4IZKB 1LV5A 4YY3I 3HSZA 3EGVA 3D6HB 2J7UA 2RDIA 4ZS6A 4NL5A 2Z57B 3R5AA 2B4PA 5HQMA 4L75A 2GV1A 4DL0C 2P6SA 1I6JA 4DR4J 1VQYA 4KIAA 2VFTA 2PMWA 3PDNA 3J7ZT 3ZM7A 3QATA 4DCPB 3ISNC 4YY3F 1YI2S 4CH7A 1SH3A 2UUCE 4OYIA 1O6XA 1RWWB 5B0GA 3NAIA 1M1KT 2Q6BA 5G0RA 5J2NB 1N4LA 2MQQA 3CC4S 1W7WA 4F36A 2DK2A 2V69A 3FKBA 4CLWA 5KFFA 5F8LA 1WC0A 2HVEA 4FW5A 2XHCA 3MMBB 2VESA 4X66J 3CPWR 4R25A 5KAKA 2WW8A 4PRFA 2ATLA 3QRRA 4WFBQ 1FWLA 4LSLA 4ZPDA 4QWEA 3R1HA 1D1UA 1UAWA 1YBAA 2WNRB 2QGFB 1WOSA 2FLLA 1HWUA 2ZH5A 4JYAI 4NLOA 4QWBA 1S9GA 2IM1A 5IZHA 1WEYA 1NDKA 5HSPA 2J0WA 3BQ0A 4PRXA 3AOAA 3FFIA 3FZ2A 2CVEA 5K8MA 2Z2LA 1JLAA 1EIYB 4K4WA 2UVUA 4X4NA 2LEAA 4AFFA 4ELVA 1PGZA 4RZRA 4UQGA 3MAAA 3M8PA 4XTJA 1B7FA 4JYAF 1B70B 3A8IA 3J81U 1MMLA 2HLTA 4GC7A 1PYOB 5DRPA 1R3NA 4IG3B 4ZITA 3FJ2A 4NLGA 1WELA 5AXNA 3BKTA 1YWXA 1U1LA 4N41A 1AFIA 3K59A 2AZ1A 4DR2I 3FMWA 2IAJA 4NLUA 3DRYA 2OO4A 4OJGA 5K8PA 4PQAA 2JEJA 2ADCA 4W90B 4DI6A 4HTJA 2GC8A 4B9VA 1VRTA 2XMJA 4ENOA 3ULHA 4OI6A 3HO1A 2EFOA 4F67A 2OSQA 4ICLA 3FFIB 3RYLA 3HVWA 3JTNA 3PX6A 3WIVA 4DR2F 4QU7A 3KK3B 3NMAA 4LPFA 4DCOB 2ZBPA 4NXMJ 2GIFA 1JLAB 4HKQA 2BOAA 1C4AA 1S6UA 1RAHB 1NHVA 1LWFA 4UUWA 1FE0A 4UOGA 3MFHA 5H9EK 4KQZA 3NP5A 1TVRA 2AGPA 2DR9A 5D15A 1XR7A 2AYEA 1NK7A 2ZBQA 2HGLA 2R7RA 4HT7A 3CCTA 1RBAA 4HLBA 4C3KA 1LQ9A 2FC9A 2QL7B 4PPZA 2VG7A 3A3PB 3I96A 4LBPA 4RBUA 3W2WA 3VGUA 3MD1A 3MPDA 1IR1A 5LJ5Y 4C3LA 2LJPA 2MKKA 2A2DA 3K2YA 4J9SA 4HYMA 1UW9A 4EYHB 1TK8A 2YNFB 3M2RB 3J80U 2Z8QA 1NJYA 4HEA9 1RAIB 2HRYA 4C8LA 4YMEA 4WK3A 1WKKA 2CQHA 3BSAA 2FJXA 4YY3E 2DIUA 2I8EA 2AF6A 4DV7I 3MR2A 3LO3A 3H42A 3CCMS 3D3CJ 2QG9B 1XNQI 1S1WB 2NREA 1MU2B 2AEJA 3W7BA 3J81j 2Q2EB 3CJTA 4ETXA 4MU4A 2BVZA 2Y1RI 2LLZA 2DNYA 2RS2A 4ZJOA 4AL7A 2ROPA 5E3CA 4DLGA 3MURP 2HRTA 3NMRA 4X4UA 3WX4A 4C11A 1DJ0A 3VR1A 4DV7F 2VOOA 2AJ4A 3NS5A 3PRVA 2J9CA 2HQ3A 1XNQF 1RHMB 2KKHA 3T41A 4J9OA 4YB7A 4K59A 2CPJA 3MM8A 3HHLD 2ALZA 4DG1B 4OZ1A 1G2EA 3M8YA 3T5HA 1XR5A 5KOXA 2HIQA 4FPRA 4WTOB 5KG7A 4A8OA 1QAJA 2GHVC 1TKXA 5FD1A 2VG5B 2Q3PA 4OYAA 1QDUB 1BQNB 1SIZA 1NZ8A 1VLOA 3DGPB 3UW1A 4JYAE 1URRA 3TEGA 3M32A 3DI6B 4Y3CA 2E9RX 2XQCA 4LSNB 4MJKA 5KFXA 2ALYB 2ZE2B 3QGIA 3RRHA 4DL6A 2XLIA 2OFHX 1RT5A 1HHQA 4C4WA 4ED0A 1PIEA 1ZXMA 4LQ9A 3UR3C 3W62A 4CZCA 4PG6A 1A7GE 2XEXA 3V4MA 1DFDA 2NXUA 3QLHA 4ZCMA 2CYYA 4K50A 5JEAB 2KVIA 3MM8B 1UEKA 4FWGA 2YQ3A 2E1RA 4DV0E 4HT5A 1NKCA 2HQCA 2DEIA 1TKXB 4DR2E 1PJ5A 3MR5A 2B9YA 5F8MA 2KXNB 2KYZA 2V68A 1TKDA 4YY3J 3HVTA 1ZH5A 1RHYA 2R7XA 5IOLA 4D3HA 2PO1A 3MR7A 4DR7I 3CCUS 3M32B 1WNEA 3M85D 2L9DA 4OYMA 1KSPA 1FJCA 2WSCC 1NDPA 1SI9A 3CO0P 3T1YI 1U1RA 3CD5A 3MAHA 1S9FA 4EO8A 2HQGA 2IVYA 1RLCL 3F73A 1SL2A 1VQNS 3QLHB 4DR7F 1SKRA 1SJQA 5CYMA 3V81A 3OXLA 3T1YF 4Z2XA 1XTZA 4IUFA 3LQVA 4LF5I 1M1HA 4DMZA 3Q86A 3JAMY 1VK8A 3G6VA 1KFDA 3PX0A 1S1TA 5IM0A 5KG1A 1RYRA 4ZVIA 3G8SA 3U27A 9ATCB 2X1FA 4I3HA 2R7TA 1O51A 4TXSA 5J2PB 2B5JA 2GQ0A 1VI7A 5IC4B 1HD1A 2YQ0A 2HVHA 2UXDE 1FVQA 5AT1B 1X5SA 4LF5F 2J7KA 2C22A 1OSCA 2HWIA 2ILZA 3HSDA 4NASA 1P9QC 2DHSA 4ZA1A 2NZ4A 1U4BA 1L5UA 5C0XB 2EPIA 2VOPA 1XNQE 2HHPA 2VDHA 3V81B 4JI7J 4WIIA 3OLBA 1AYEA 3MEDA 4M5LA 5LMNI 4Z7YA 4GVBA 2GIQA 2MEWA 4FW7A 1NB2A 2DXFA 2PMZD 3I56S 4DV0J 4DOZA 3KLEB 2F65A 1TZ0A 2ZH1A 3HFZB 5HK4A 2YWEA 4IYQA 3HKZD 3QIPB 2DR8A 1R6YA 2RHQB 2RILA 4H4OA 3FC9A 3I4HX 1RLDA 2B5JB 2LCWA 3EGWB 1RT6B 3SCJE 5LMNF 4PQUA 1WOPA 2XWYA 1VR6A 5KOWA 1ZOTA 3P76A 1B4SA 2MGZA 1FKAF 3JYTB 1NHHA 1VISA 4FXDA 2HKEA 4CO0A 1NZ0A 2BJ7A 4DQSA 1UP1A 3LPYA 1NHKL 2V34A 2HW3A 4ECWA 2HZVA 5HROA 3I5BA 1TU0B 3SQGA 4R5PA 3MM7A 5I3UB 4ISAA 3M05A 5GAEU 3MMAA 4UZBA 4FKYA 2IFXA 5DG8A 4I68A 1KR4A 2CJBA 3TI0A 2CZVC 3CT9A 2C1EB 3O44A 3N5BA 4Q0BA 2CGEA 4RR5A 2VBXA 2PGCA 4DUZI 1IN0A 3IGNA 4NMLA 4KE5A 4JI5I 5DJBA 1CG2A 2CA9A 4ZLPA 3MD3A 1F60B 2BR0A 2ZFHA 1S77D 3MOZA 3P4UB 1NJWA 3JQJA 1FTCA 1PBAA 3KNAA 2JX2A 2BJ8A 2GO4A 4IFYB 5HVGA 1QVGR 1ZZNA 2UXDJ 2GJIA 3VGTA 4ZLJA 4DSJA 2MQ8A 4CLUA 4G6VB 3AJ2A 4DUZF 1X8DA 1NJXA 3DLKA 4DR7E 2JEFA 2W2QP 4JI5F 1CC7A 3SQGB 4R5PB 1WJ9A 2ILYA 4OMFG 1IQTA 4J37A 4GKJJ 3T1YE 3G6XA 2J0SD 4FS2A 1SC6A 2K2PA 3VGSA 4FW3A 2KVQE 1U2RA 3QWPA 4J9LA 2CJKA 3UDVA 4CI0B 4ATNA 1K8AT 4N8NA 1Z5BA 4DR1I 1RHUB 5F3ZA 3ETMA 1EETA 1NLKL 1DLOA 4OIXA 1EP4B 1FRXA 5HBMA 5MAOA 4QYZJ 1YRTA 2CNNB 3W9HA 1VRUA 2IM3A 3I87A 4LF5E 1CBKA 2KFNA 4ZLLA 1VC0A 3MGJA 2RQKA 5D4NA 1HLWA 4AUKA 1M5VC 4YS2A 2IMOA 3L95X 4DR1F 2UXBI 3QFWA 2GA7A 1HQ2A 2N3LA 3I0RA 3B4TA 1AUDA 3H0PA 2NXNA 4WU3A 1RWNB 3IM9A 2DPIA 5C42B 1FK9A 4OO1A 1XK8A 5LJ3Y 1HK7A 5DRKA 2ZH2A 2XMTA 2NXCA 4IRCA 1IBKJ 4QYRA 3B6BA 3DCAA 2UXBF 2KYXA 1CPZA 3NGUA 4WXWA 2ZZNA 1UTAA 1D8YA 1RISA 4WTYA 2GAGC 3C15A 4A8WA 2O1WA 2HFVA 5LMNE 3BDEA 3CMAS 2Z2YB 3CXCR 2R7VA 3WU4A 1FXDA 4PKDB 1O8BA 2HS4A 4GO5X 3WDOA 3OTBA 2ZD1A 1FKAE 2DNGA 2PFFB 2D41A 3V4IB 2B8QA 3X3UA 3TANA 4BS2A 3MHYA 1GH8A 5C0XF 4DX8H 3OTDA 3FBEA 1UVMA 1WF2A 3Q2TC 1UCNA 2EW9A 2W25A 1YITS 3R2DJ 1BQMA 1OMSA 4X65I 2QLJB 2BUNA 2ZOGA 4YHHE 1TL7B 2CPZA 1SKSA 1JJ2R 2JC1A 3OVSA 2LU2A 2MKJA 3MR6A 3JAMQ 3PR4A 1S16A 2FUG9 1YJTA 2HSEB 2DNMA 3DGVA 3MFIA 2P9GA 4QPTA 4G65A 4ZP9A 5JEAC 1CULB 1TKTA 2AJ0A 2PNZA 2HWTA 4NA2A 3E01B 1HARA 3DXSX 2FJVA 4X65F 4DSLA 2GX8A 1UDQA 4JV1A 4UY85 1D09B 1Y9OA 1RWVB 1E6YA 5LM7E 2Z5BA 5A8RA 3LF0A 1KHWA 4DSKA 4HR2A 1T9VA 1RTIB 3I6PA 1Y3KA 1K1SA 2B0GA 3QJLA 3Q8VA 2CJ9A 3MM5A 2WHOA 4O3PA 3DOKA 1NB7A 5K9FA 2KXHA 2JLEA 3KNGA 3QGPA 2HGMA 3ILOA 1U1PA 5C7PA 2XI2A 3M85G 1DBDA 1JKHA 4A47A 3CCVS 4I6YA 2RDDA 1NH7A 3MXHP 2HS0A 1MX0A 2HFOA 5K8NA 1T03B 1VQ7S 4PRVA 3H40A 2DJWA 3PYFA 4LFAJ 3G9CA 2PNZB 3PYGA 2ZZTA 2JOQA 1NK0A 4BWJA 1LWEA 4AIDA 1QY7A 1P42A 1KP6A 2C2RA 1TL4A 5T14A 5LMNJ 3CVKA 3RW7A 2Z5BB 3KUEA 2G2YA 5A8RB 4WUBA 4PU9A 3ZC4A 4HHHA 2UZAA 2WVEA 2LQJA 3DU5A 4DR1E 2XULA 4HDGA 1NMEB 4KAIA 2M5YA 2FLPA 2HEKA 2C38B 2I5JA 2H5IB 1YJ9S 1LW0A 4UOFA 5C2CA 1R0AA 3ZTOA 5KFAA 3M9MB 2Y9HA 4RNNA 1JJHA 3VV2B 8ATCB 3QT6A 2XNRA 1SH0A 4QIGA 2IRXA 2NSBA 2I1RA 4RPFA 3IAM9 2JEAA 4PCQA 1L3UA 2UXBE 4YHHJ 5KFNA 1VJWA 1CEZA 1IR2A 4WUDA 2RUSA 1QE1B 4F25A 3EICA 5D0GA 3F0NA 1LWEB 3MEEA 1IKVB 1LW2A 2XSJB 4JB8B 1K9MT 3FSIA 4ECYA 4X4QA 1YKWA 3MTKA 5KFVA 5C0XE 1FEEA 1ZZFA 4MIWA 2R7SA 1RQ0A 1IJEB 5L8RC 4CLKA 2HYIB 1RT2B 1IWGA 3R97A 5ETKA 4LCHA 3I82A 1YSJA 4YDXA 2GQCA 4BBYA 2EXUA 2RD5C 3CIZA 1C1CA 1RGVA 2KM8B 4CH1A 1UL3A 3KJFB 1HNVA 3SI8A 4EZ9A 2P5VA 4MKAA 4K0KI 1EX8A 4DWIA 2GW8A 1RR9A 2CADA 3NXZA 1FFSB 3CCLS 2XZTB 2UVVA 1E6VB 2NYIA 4OI0A 4X2BA 3KHLA 4J3DA 4ZVUB 4YR2A 1RTZA 1HYSA 5L1LA 2B56A 2QYGA 2F7VA 1AFJA 3RB6A 1V6HA 1FJ7A 4X65E 1IBCB 4FVCA 1RWPB 2XLKA 5DLFA 4K0KF 2KZZA 2V63A 1NSPA 5C24B 3PRYA 4ZPAA 2B4OA 3MUVP 4K7QA 5GADU 3KJVB 4OYPA 4DR1J 2ZBIA 3TR5A 1TR0A 1JJ4A 4KHMA 4PG5A 2VJVA 3OFFA 2HNDB 4H54A 2E5LE 1FXLA 1C1CB 4LR7A 2KXFA 2VB6A 4NLDA 3VTIA 2BKOA 3SQOP 3KK2B 3W5YA 3I9V9 3KWMA 3ILIA 4WFXA 5CD4A 1VLYA 2VL1A 1V9OA 2VONA 4KTQA 4AQYE 3OFGA 3ZZOA 5HI7A 4FP9A 2C2KB 3GR0A 1D9AA 4KR0B 2M52A 3M8QA 5FJ4A 2VQEI 1Z0TA 2LFVA 1WTBA 3U1YA 1JLEB 2DTJA 2YX4A 5GMDA 3K5OA 1QZRA 1XMOI 3VGVA 3GIKA 5FDLB 2DHHA 2PO2B 3SSQA 2XZDB 2HKJA 2FHJA 2ACMA 4X4TA 4DV6I 3BGUA 3CJRA 1S7IA 4B02A 1PCAA 1DAXA 4JI1J 2KI2A 2B7CB 2V8GA 2VQEF 4R0EA 4OZLA 2PMHA 2NN6B 4YOEA 4QNKA 5KFZA 3KDNA 5F0WA 3OQ2A 4J90A 3BR8A 4DS4A 1XMOF 4I64A 1UJ5A 1RHKB 2DNLA 1R6MA 2XCPA 2OTLS 3PW0A 2DHGA 4ZVOB 2DR7A 4DV6F 4K4XA 2NXEA 4NZ6A 4IQXA 3M8QB 2U2FA 4B3TJ 3VVTA 1QSLA 1S0NA 2EWHA 3M1VA 2XYGB 3THPA 4IG0A 3I0SB 4M8LA 1JLCA 1S97A 4C0HA 2CQ2A 1Q7LB 4RX6A 4TVAB 1MWYA 2BQUA 2UP1A 2ZUGA 2WSEC 1C2PA 3FBCA 3SCLE 3RGIA 4QYZK 2RQ4A 1R8CA 2E5LJ 4M5DB 1WHVA 4OI1A 2HQFA 4R0JA 4TU9A 2EC0A 2A6MA 1HQEB 1LWXA 3LP1B 3L7ZB 5CXTA 3CCQS 4P75A 3TW0A 3BN4A 4CO2A 1RE1B 3N0VA 4ED5A 3PW7A 4BC7A 2KZMA 1D8ZA 4RW7B 2X1GA 4AQYJ 5LXYA 1LKZA 3D7SB 1RTDA 4K0KE 2R2SA 4R8UA 4WYLA 2R4FA 2CQPA 4H4KA 3CJ4A 4UOCA 4ZHRB 2L08A 5ETQA 3DRSB 3OHAA 3PS2A 1ZAXA 2CPIA 1Q1KA 1MROB 1S99A 1HHTP 2YKOA 1U0SA 4KO0B 4J9RA 4ZMMA 3JAMU 4AD6A 2H5JB 1S1UA 3QGHA 2QO3A 3OL7A 4DV5J 4HACB 2ZNYA 3U1KA 1CJTA 1FA0A 3N6MA 4PUOA 4FDFA 2GGPA 4CNYA 3R1LA 4CO4A 4Z37A 3VAHA 4YR0A 4KQVA 3QSIA 3OHBA 3C46A 2ASDA 4IFDA 3OFHA 4PG8A 3OL6A 3RRGA 1FD8A 1GXLA 5CYQA 1NK5A 3CSKA 1SV5B 1VIXA 1KN6A 4TY8A 1WG5A 1FXRA 2VFSA 4CLSA 4V19J 1HBMB 1N52B 1QTMA 3D0HE 3IP0A 4CNZA 4KPYA 4FBTA 1RADB 1T05A 3UDCA 2MQNA 4ECQA 3DRXA 2XMWA 3C14A 4OHXA 2VQEE 4LRDA 3MPVA 4P2MA 3OT9A 5ETLA 2XLJA 3PEJA 1XMOE 3QO9A 4MTPA 4NLTA 3KLFB 3MI7X 1F2HA 1SB6A 4LVOP 2H54B 2B6AA 4DUYI 4L3NA 5T41A 2GHPA 2HURA 4I2PA 3WHIA 1FNXH 4DV6E 4RW6B 4RWXA 3IG1B 1NJZA 1YZ6A 2UUBI 4TQSA 4QIVA 2B9XA 3UHMA 1RAGB 5IC6B 3NGTA 3L7OA 2MZJA 2J9DE 2BA1D 1J5EI 3QQCD 2VPYB 3DN9A 3TEHB 1WDDA 3FBFA 4YEAA 1FO1A 4YB1P 4O3SA 4DUYF 3Q8YA 1KIJA 4CP5A 2YKMA 4DR6I 2APOA 2D3O1 2UUBF 1EKRA 2ZVIA 5D8HB 3EVMA 3SV4A 2NN6F 3GR1A 2DVIA 2PIIA 2UVRA 4LJMA 4DEZA 1S0OA 1FDAA 1FT8A 4UF4A 4WU2A 1N0UA 3OBIA 4IDKB 3MUTP 3V6JA 4I69A 4O3NA 1J5EF 1HMVA 1T94A 2H65B 5K36D 1KFSA 4NI2B 3C8YA 1MSWD 3GILA 4BC9A 2DR5A 3I9ZA 4DQPA 1U2FA 3AXMA 4DR6F 4DX6A 4ZOSA 3NS6A 1DHMA 3QMQA 1X5TA 4ID5B 3WU5A 3D2WA 3OPKA 2DGXA 4UQTA 3N01A 3R7BB 2EKNA 1HI8A 3BKUA 5DQHA 1UFWA 3HULA 4Q43A 2YNGB 5AXLA 1B0TA 1BHNA 4ZIWA 2IHR1 2DY9A 2FHKA 2F9JA 3W5ZA 2AW0A 1VMBA 1V3ZA 1TQLA 3MWBA 2FHOB 5I42A 3TJAA 1U09A 2YPYA 2MHEA 5CZXA 2XY5A 2IYGA 2MZTA 4UT4A 2E1MC 2WB1D 4DPWA 3QSYB 3W5XA 4OZ0A 1RT7B 2V5HG 3RZAA 3GFYA 3L4BC 1PILA 4F4KA 1S4EA 2IIHA 1HNZI 1FRKA 3MM9B 1FRJA 4DX5A 3HJCA 2BJEA 3VHQA 2RE1A 4OX6A 5E3QA 2C37B 4Q7AA 4E2FB 4JI2J 1EB0A 1VHIA 4HHJA 4I4BA 1HI1A 3Q6NA 1UWAA 3NGDA 4ES2A 4L3KA 3R5GA 3ETOA 5I42B 4EUVA 5D4LA 1VQ6S 2G1DA 2UUTA 2WOMA 1HNZF 1N33I 3MPWA 3EGNA 2ZH9A 3W2VA 2QE5A 4DV4I 1NH8A 4DQRA 1TL3B 4LF8J 4L72B 5KFIA 2KU7A 3R5BA 4MKBA 5D3GB 4G1PA 1IR0A 2FB0A 2DRBA 1N33F 4URGA 2NN6C 5B0AA 1D0EA 2XC9A 4NCAA 2JL9A 3PIPQ 4DV4F 2O66A 3DLLQ 3CCWA 2ERRA 2COLA 4OO1D 5T7LA 4PWDA 4DUYE 4OYOA 2P6TA 2J6TA 5KT7A 1VFJA 4P74A 3CJ5A 2UUBE 4UZCA 1GTHA 4C8MA 4LF6I 2JEIA 2AX0A 1U8SA 5KT2A 1AW0A 3W2VB 4RW4A 2Z4PA 2DNQA 1J5EE 3VCDA 1PYTA 3IBCB 4TU8A 4QCLA 5AXMA 2M3DA 3K85A 1IKWB 5EN1A 3Q1QA 2O3ZA 2ASYA 3DRRB 2IESA 4LF7J 2QIFA 2KHDA 4DR6E 3CC7S 5LXRA 3ZKBA 3E2EA 2DH9A 3P49B 5G4DA 4LF6F 5B7WA 4FW9A 2A18A 1LXJA 1PKPA 2OMOA 3J80C 2KG0A 4F0HA 4I7FA 2UXCI 2F1DA 2KG1A 1CS4B 4KKOA 4F04B 2R8GA 2O3DA 1RTJA 3RAMA 2F8MA 1X4AA 2R8KA 4PWDB 2AJFE 1S1VB 4A8KA 3C6UA 1W2IA 4C6AA 2W2OP 3LW5C 4DPXA 5KFJA 2RHSB 1RTHA 3KDOA 4YP3A 3NGRA 3UQSA 3MUMP 3OR1A 5B0BA 4F4YA 1HWLA 2UXCF 2LEBA 1SL0A 4DR5I 4WYWA 1ICEB 3I5AA 2Q66A 5A8KB 1KQGB 1UPPA 3PFOA 2M4MA 3R2CJ 2GCFA 1ZA1B 1OPIA 2QLFB 3J80Y 2VD3A 5D6GA 2ROEA 2ADBA 1WWHA 3M8ZA 4JOUA 2FQQB 4F4WA 2HG4A 4O3RA 4CTAA 3PW5A 1X5PA 3KTQA 5GMKa 4IOAQ 4NLRA 4I7FB 3KUGA 3THVA 3KLHB 3RW6A 1FWKA 3A12A 4DR5F 1Y11A 1N54B 2MKSA 2J0XA 1ZS6A 1PSDA 3VAIA 3C6UB 1UPMB 4IFVB 1RWMB 4N76A 4XPCA 3BGRB 3BZQA 1WC5A 3JTOA 2HQDA 3O6QA 3DDNA 1HNZE 3OR1B 2YNHA 2C39B 2BE9B 3MMCB 2IBOA 4XIUA 3CDUA 3QYYA 4B3RJ 3ILLA 5A6WA 3MEKA 4B3SJ 3BGOP 4USJC 2DHAA 1NNDA 2IC3A 2RT3A 2ZDOA 3IWNC 1R27B 5F41A 1UVJA 2E5HA 4ED3A 2XBPA 3L7PA 5DG9A 4DX7A 3SFGA 3LGHA 5K36F 3G8TA 1KS2A 2Z5CA 2RKIB 4WKRA 3V6HA 1N34E 2OAUA 4PG4A 4CT8A 3K17A 1NSQA 2IVFB 1TKZA 1F6TA 5DZ7A 3UCZP 5A0YA 1LK5A 4DV4E 2ATCB 5L46A 1U26A 3LTOA 1CJVA 2VBWA 2CUYA 2DXEA 3DHWC 1CSJA 3QJPA 2JJ4D 4O4GB 3H59A 1NPRA 4MIBA 2E1PA 3M2UB 4I6WA 1IKXB 3S01A 2OKQA 1RAOA 1HNIA 2YNHB 2HRUA 3MF5A 4J9NA 4C8KA 4JI6E 2PNLA 3N5FA 2JEBA 4KT0C 2ZBCA 2JLFA 4JI0I 2O01C 1UA1A 2GZOA 2HBYB 4U7UK 3VVUA 4IO1A 4B9LA 3AD8C 2FD2A 4HVZA 5A76A 3UNGC 4QPXA 3TA1A 3PX4A 1H7UA 5A2QU 4IZJB 1GQEA 2R8IA 1VBYA 4USKA 3DYAB 2J6UA 4WFZA 2RF2B 3RU0A 1T3NA 4JI0F 1I5OB 4AT1B 1OQ3A 2DHXA 2NYHA 5A8WA 4UUXA 5THWA 3CGIA 5HANA 5J2MB 3GE9A 2FY1A 4CRJA 5JVGQ 2M8DB 4CLYA 4ZJQA 4LFBI 5EDWA 4OL8A 2JT2A 2UXCE 1RJJA 1Z0BA 3CJ0A 1F3VA 1V5IB 5D4OA 2XSFA 2FPHX 1C0UA 2AHOB 3IBWA 5FLXY 4JI4I 3K89A 5AE3A 3TARA 4LRBA 2FJEB 4LFBF 5IFMA 2XS2A 3H1CA 1DTTA 1SUQA 4X62I 1XNRI 4F50A 2YWFA 4P10A 4L76A 4NLPA 3BKFA 2CQ4A 1T9TA 3QRQA 4QU6A 1TL1A 4DR5E 2DNPA 4OJ3A 1N34J 3A8JA 3HXMA 4DR4I 3NOCA 3KLGB 1RAAB 2QT7A 4JI4F 3DU6A 4DV4J 1E3PA 4F4ZA 3LANA 9RUBA 2MQOA 5IT9Y 2W4PA 3DMJA 3PNIA 1FNMA 4TLQA 3PJ9A 1Y10A 3M9NB 4B3MI 1KOOA 3GSIA 4X62F 1XNRF 1TELA 1X4BA 1YK9A 2QA2A 5LT5A 1FKOA 1NPKA 4CQ1A 3GLLA 4JI6J 1U48A 3NBPB 2D3UA 3S8SA 5GAHU 4CDIA 4DR4F 4DL2A 4CWBA 2XWXA 3EYZA 2RDJA 2CNOB 4FWDA 1RU1A 2VQFJ 4X66I 3TUIC 3W9IA 2FTRA 2LXUA 3AD7C 1GFWB 5D77A 2XY6A 4A48A 5K36E 1DTTB 1T7PA 4B3MF 4C3MA 1N36E 3RB3A 1H74A 4OZ5A 3G2XA 3ITHB 1O5JA 1BQXA 1X4FA 2B51A 4LFCI 3Q83A 2C42A 1RKIA 2PDAA 4CLPA 1P8GA 3QWUA 4X66F 3BF4A 2G4BA 4JI3I 2ZH3A 2C2MB 4PWUA 5BYSA 3PVXA 1QUPA 2AX1A 2CZ9A 2W9BB 4OI2A 4MKYA 1UWBA 1QAXA 2V2KA 2VU5A 3CNQP 2QLWA 2AV5A 4RW8B 2MZRA 2OPRB 1AXQA 2UXCJ 3MMJA 4LFCF 3DD6A 5CH7B 1TK0A 4N7TA 1FKPB 2OPSA 4JI3F 1I94I 3J80Q 4LMZA 3CEDA 4H4MA 3BPSP 3LUYA 1SPBP 5SUHA 4DBQA 3AODA 1RYSA 1HFEL 1AT1B 2DO0A 3JS9A 2BOPA 3A8EA 4K2JA 5GMEA 4JI0E 2BKPA 3HSGA 4DV2J 4Y2MA 4DR5J 4DSFA 2C28A 5B0FA 4ER8A 3BYRA 4ZP6A 5CHCB 4NXMI 5LL6d 1T9UA 1I94F 3R7NB 3TAMB 2YY3A 1JLFB 1EKSA 4F0MA 2WBRA 3TQ1A 4GQUA 1RHRB 3MR3A 2AJQA 4URQU 1V3RA 2DRAA 3OW2R 2HS3A 1BWVA 2MTLA 1S10A 4HI2A 2DGTA 5K8OA 4E0DA 2AYMA 2BE2B 3DLHA 2DB1A 1S5ZA 2OPSB 3A8KA 2ZM6I 4NXMF 1X60A 2VFRA 2AYBA 4C2MA 2AYGA 4LFBE 3CW2C 5EKWA 3OTEA 3DLGA 2R3VA 1VBZA 4RW9A 2R2RA 4ZVTB 3MEGB 2YNIA 4QBUA 2F5GA 1NZAA 1WG4A 2WB4A 1N36J 4DHVA 5FIIA 3HLUA 4WPAA 3KHRA 4LT6A 1UMJA 2A0FB 4J9QA 4JI4E 4I2QA 2ZM6F 3B8HA 2HNYB 1Z2ZA 4IO9Q 4IH5A 4DXLA 1SJRA 2VBZA 2C2OB 1IM6A 4FYYB 3AQOA 3KHHA 4OO1E 4LF2A 3B78A 4X62E 1XNRE 4OLPA 1XJWB 2Y8WA 2CFXA 2J9EA 5K5MA 4QW8A 1ZTWA 2ZWOA 2BX6A 2IDEA 4DR4E 7FDRA 4ZVGA 4IFDD 3GLJA 3VQSA 2EVZA 5AXKA 3ZZ0A 2QRRA 3KOAA 3P3EA 5HQ8A 2C2NA 4UTGA 1L3KA 4DV3F 4NEYA 3TUPA 4RW9B 1NU4A 3MM6A 3ET6B 3EDQB 4B3ME 1T9WA 5DNXA 4Q2MA 3RAXA 2FJWA 3KMSA 1M5OC 4K4SA 4KY3A 3O1LA 3W64A 2W7PA 1N56A 1T95A 1S57A 4JI0J 4I2QB 1X0PA 4ZVRB 4X66E 4P73A 1ZYQA 1NRKA 2OPQA 4IS9A 4LF4J 1FF2A 5BJRA 1B3TA 3T3FA 4NEZA 2HK2A 4G1QB 3M4XA 4OV6A 4IZKA 4I56A 3AFGA 2F3JA 4KV8B 1HNWJ 3NAHA 1XQIA 4ZVQB 2V9KA 5KFYA 5M2PA 2X1BA 1RABB 2B9WA 3BN7A 4LFCE 1Y5LB 2IM2A 5GADI 4RU9A 3QFHA 3KUHA 1JLQB 4JI3E 4WFAQ 5FLXQ 2RU3A 3ZXWA 2E5JA 2FZGB 4NXNJ 4LFBJ 4TNOA 4HXZA 4YDDB 1TP7A 5ETVA 3UI3A 4MDTA 1KLMB 4YUDA 5E33A 3GCWP 3WX8A 3TX0A 1W2BR 5J2NA 1A6LA 4OZNA 3K5PA 1S6PB 4HL9A 1YBTA 2G1HA 4J9KA 2I2YA 2OPQB 4NA3A 2IM0A 1I94E 1V3SA 3MMBA 1HBUB 5E7OB 3J7AM 5IT9Q 4ID8A 5F9NA 4PYDA 2E1AA 2HFZA 4KPCA 3WU6A 1RAEB 3OR2B 2WNRA 2LXFA 3CDBA 3GFZA 4X62J 1XNRJ 5DO2A 5HVHA 3I55S 1N5TA 2O5DA 4NXME 1X9MA 1VC5A 1R0BG 2BM1A 3HM9A 3GIIA 3TVYA 4OYWA 3O5TB 4CH0S 1DTQB 3M30B 1JNZB 2MKIA 1HIYA 2L41A 4Q45A 3BS9A 4B3MJ 2DGVA 4RUHA 1SKWA 3ISZA 3N9UC 4M94A 2MKYA 1HWIA 4F7VA 3QT8A 4IG3A 5BYRA 4B3OB 2ZM6E 2WVFA 3NNHA 1BKNA 1GNKA 1QSYA 2K1RA 4AE5A 3H7HB 2XO6A 3ICLA 1FFGB 4JV2A 3PY8A 4A8FA 2WONB 4IRDA 2W24A 4GRSA 1QVFR 3ZTSA 5CD4H 1H7SA 4CLFA 1M5HA 2QA4S 4NLSA 3C19A 3D0GE 2HMIA 4LFCJ 3FSXA 3KK3A 4DV3E 2OEMA 4JI3J 3KG1A 2UU9J 2JSXA 1G6BA 1KNZA 2D3ZA 4ECRA 1S4FA 2W8KA 4LBHA 3NGKA 4JBCA 2MSTA 4ILRA 4EU0A 1EAYC 4JI7I 4RLEA 2OI2A 5HJXA 2XYPB 2X1AA 4RBTA 4DFMA 5DQIA 4N5SA 4DV0I 3D54A 2J8SA 2K1RB 3GB0A 2M70A 2G0JA 1U2CA 4KHRA 2LQBA 1I94J 1PAUB 3CDAA 2Z0GA 2C2EA 3IR5B 4IRKA 4RNMA 2FGOA 5SZTA 4JI7F 4NRUA 2FLOA 1T0TV 3K5NA 1RA7A 4TU7A 3OV7A 2YNFA 4F3MA 1M5SA 1ZBTA 2HMIB 3M2RA 5C25B 3DNCA 4DV0F 5D78A 3RTVA 5KFRA 1BY9A 1NHIA 2ZNZA 3LOUA 3JB9k 2AJ2A 2H48B 2IJRA 1FFWB 4PYAA 2XZWA 2BE7D 1BC6A 5E3AA 3H5XA 1C4CA 2KTQA 2MMYA 2FYXA 3DDIA 4LR8A 1OS5A 1WOOA 1S1WA 4USUA 2JE6B 1R6VA 1MU2A 2ZOFA 5A6PA 4QJVA 3UVJB 2QTWA 4OI3A 1SJ4P 1SQFA 4WP9A 4ALZA 3CJKB 1Q4RA 2V4JB 1K47A 2ZM6J 2I38A 3LP2B 4NMXA 3QBCA 2CJXB 3H4BA 1KQFB 2XYHB 2G13A 3X1LB 3PRBA 2ZKUA 3ENAA 3TZZA 5H9FJ 2HHXA 1T3OA 1G7CB 3LPSA 1Q5YA 1U45A 2L48A 3RB0A 2ROGA 1UEUA 4DG1A 3UR0A 2OTJS 1T02A 3UE2A 2UXDI 1R8BA 2R7UA 1AZSB 1U49A 4NYOA 2GVZB 1MW7A 2VG5A 1XIQA 2Q1LA 2V94A 4P2FA 3EZ5A 3P45B 1OWXA 2XMAA 2DBBA 4DV3J 4IFDF 2VPZB 4DFKA 1BQNA 1Q82T 1PC4A 1FNOA 4IH6A 2OPPB 2R8HA 3D66A 2MXYA 4LIRA 3DGPA 1GT8A 5F8JA 4GKJI 1Z1ZA 4EBEA 2VIHA 3DI6A 4NX9A 5KT6A 4LSNA 2ZBKB 2ZE2A 1U1NA 5IT0A 3FQLA 4Y2CA 1K0TA 2UXDF 3R9LA 4F2RA 4M5HA 3T5KA 1RT4B 4Q8EA 1RT1B 1WC3A 3MAQA 2AD9A 2P9CA 3KHGA 3G96A 2WAQD 5CAAA 3H4LA 4GKJF 5JEAA 5J1EB 3WZ0A 4NYPA 2YKNB 4V1Ak 1JQGA 4B9MA 5MLCV 4QOTA 5DRRA 4KGKA 1RCXB 4OZEA 2ASJA 1IBMJ 4DR3J 2DKOB 4NLVA 2IA6A 1S59A 2V4RA 5DETA 4OYBA 1SXLA 3W66A 4A8QA 3Q0AA 3W8PA 2W01A 2BMBA 1NK9A 2DISA 1Y0HA 3UDLA 2FDNA 4HHUA 3V6DB 2UUWA 1D9FA 3RUBL 5KFKA 3UNYA 2DNNA 3G82B 1M1GA 1FRHA 2HVIA 3PM9A 5IV3A 5LL6R 1N5QA 4FNHA 1FTRA 1N48A 2BR2B 1IBKI 1QJHA 3ZNJ1 4ED4A 3F44A 1PYSB 2PT0A 1NJIT 4AL5A 2CJQA 2MQMA 5KFDA 4JI7E 3GJTB 2EK1A 4ECSA 3T9NA 2XI3A 5EGYA 1CVJA 2U1AA 4FYWB 3BQ2A 2DY1A 1U25A 1IBKF 3O8WA 3OD2A 3M6UA 2BDPA 2CNKB 3T1HI 2QL5B 3HHLB 3EVWA 4EYIB 1EQ0A 4B9TA 3IO1A 4EWTA 3CJSA 3VAGA 3JAMC 2JZ5A 5J2PA 1SC3B 4LRCA 5ADZA 3IRXB 1R89A 3ISND 3SBMA 1KQSR 1BMQB 3GYNA 5EWEA 3D5MA 1L3TA 3OJSA 1CC8A 3T1HF 2A3JA 4RL1A 3JSMB 3RBEA 1YVFA 2NSCA 4ZVFA 2RB7A 3H8YA 4DQIA 3MPUB 1CJKB 5C0XA 4FYXB 2BJ1A 2W9CB 5FLXU 2NQPA 3PYDA 1S76D 1UJ4A 3C16B 2OSRA 5D0EA 4PXEA 3IBFB 4OFZA 4OZ2A 3HFVA 4IFDE 4PR6A 3KLEA 3MOJB 2HNZB 1HNXJ 4Y2IA 1F5BA 5K14B 3JSBA 4JI8J 2R7OA 3QIPA 5BR8J 1R8PA 1WHXA 4NLYA 3F41A 2MZSA 2F8EX 4Y00A 3TZXA 2F9DA 5F8HA 2UUAE 1LEOA 1RT6A 1XEZA 3DKDA 3EUNA 1FJGJ 5IT9U 4K8RA 3B54A 4F0KA 3Q8UA 2ABYA 2FJBB 3JYTA 1EA6A 1F1BB 5E0OA 3NNAA 1W25A 4ITSA 4WF9Q 1GK8A 2IERA 2MKHA 1WACA 4LFAI 4GKJE 4R1FA 3DRPA 3IGVA 3CDWA 4EBDA 5I3UA 4IR9A 3FEZA 4QWCA 3OUYB 3UD4P 4Y65A 1RSCA 4TYBA 1PKUA 5EUHA 1ITPA 2HK3A 2CQDA 4UOHA 4QIEA 1NKBA 3WIUA 2EEYA 2ZHOA 2OHDA 4N56A 3NLCA 4LFAF 2EFVA 5DS7A 3OTCA 2VASA 4ANCA 2DYAA 1FX4A 3BDPA 3OLAA 1AUSL 1SJ1A 5E5NA 1QM9A 2HIYA 2F4VE 3CMES 4FZVA 4IFYA 3HKMA 1DURA 2CQ0A 3IR6B 4YHHI 3GP9A 3M6WA 4WWSA 1USVA 1P6TA 4ED6A 2E66A 4KRWA 1ZPWX 3HCXA 3DRPB 3SEOA 3HI9A 3PKYA 1Y5IB 1X0FA 4RNFA 2XG8A 1IKYB 4Q2LA 4AYBD 1IBKE 2R42A 4OV1A 5DDOC 4NLXA 5RUBA 3PHTA 5KFLA 3DOLB 4MH8A 4QZVB 2P9EA 4YHHF 5HP1A 4F02A 4RUBA 5I3PA 1JB0C 2W2MP 3W8GA 3ZZTA 6FDRA 1S0MA 4XAKA 1U1MA 3DM2B 3H5YA 1G1XA 3TRGA 3CWJA 1JNRB 3P96A 2CAJA 1EP4A 4ZVSB 3WBZA 3FCHA 1VK3A 3AJ1A 5ETTA 1KTQA 1RP5A 2VC1A 2UUAJ 4MFBB 3TZWA 1FHTA 5I4MA 3T1HE 1TV6B 4I0WA 2VKZG 1HBOB 3LGNA 2FZCB 2KB2A 2X36A 2OIHA 2W8LA 2GHWA 2KT3A 4FPIA 3P3DA 2K7JA 4L74A 1HR0J 1QD1A 1AROP 1N0VC 5LSRA 3BB5A 1YX2A 5C42A 1ZTTA 2VKRA 1VQKS 3TJ9A 3DDKA 5D4PA 4P52A 4DF8A 3LWLA 2I9SA 4X4PA 1HPZA 3PZPA 5HP1B 4WCEQ 1VBXA 1YHQS 4L73A 1BE4A 4DSIA 2YWKA 2Q6CA 5DGBA 4JG4A 1GEHA 3LPEA 4IQMA 3S7RA 1HBNB 3FVYA 4U8VA 1JIHA 2N4DA 3FEYB 4KH0B 2I6WA 4DPTA 1M5PC 2DPJA 2F4VJ 3V4IA 1OQ6A 4XO0A 3C6TB 5LSLA 1MN7A 3QZ8A 4WE1B 2PA8D 3I31A 3CD7A 4X84A 1MMDA 4CO3A 1NXIA 2NUUG 2WP8B 5DROA 1HPZB 2H5EA 5HATA 1OYEA 4RUAA 3G6YA 1YTYA 1TL7A 4CM2A 3RR8A 2JC0A 4LFAE 1TAUA 4DLEA 1N5YA 2V8DA 1FEHA 2WK4A 5H9FK 5DDQC 2FJDB 3T6BA 1CULA 1HKAA 1JWWA 2K3KA 3E01A 4BLGA 4JI1I 1RK8A 1DQ8A 1YRUA 4U3DA 2XS7A 1XXEA 2PO0A 1DZ5A 2N3OA 2RH3A 1DARA 1JX4A 1F5CA 3T1HJ 4U95A 1YHCA 3H20A 1RTIA 2O1UA 1CJUB 3P06A 5HN0A 1TK5A 1Q79A 2YTCA 3MTJA 6FD1A 5J2QA 4JI1F 2XHWA 2E7XA 4B3TI 3M6VA 4ED8A 4ZPBA 5HLFA 5U47A 2RQCA 4C8ZA 4JP8A 2HHHJ 3D4JA 3TYTA 4O0IA 4ZK7M 1UKUA 3CCRS 2Y1JA 1QUVA 3LH2S 5F0UA 1N5YB 1T03A 2NZCA 4UY8T 3BO2A 2CZ4A 2Y8YA 1DY3A 1VQMS 1Y4ZB 1S9EB 2PEBA 3R5DA 4USMA 4OHWA 2E5LI 4B3TF 2IJFA 2MJNA 2ASLA 3KLIA 4KHPJ 2QMWA 3HJVA 1GXUA 2PO0B 2NR0A 2LP4A 2F8HA 1Z0EA 3HHEA 3PW4A 3VQTA 4OJ1A 1QLNA 2WCXA 2C38A 3FSYA 2J9DA 1HWJA 4AQYI 2ZJPQ 2E7WA 2YQ1A 5J2QB 4WFNQ 3EGZA 1Z59A 4W4MA 4MYTA 4ZN1A 2E5LF 1Q8IA 5HLFB 1VQPS 3SDEB 1U7LA 5IXUA 4M63A 2CWXA 5M2UA 5KFWA 1C0TB 4LSZB 4WUCA 3K57A 1SKUB 4BA1B 2IRYA 3BQ1A 2AIRB 1SC4B 1NBEB 1QE1A 4AQYF 4F8RA 1K44A 1VQ9S 2XMUA 1IUJA 1JLBB 3QPIA 4NOHA 1FE4A 3KLIB 1IKVA 5GAHI 3IN5A 3HKWA 4DV5I 5BYQA 3IR7B 3U7JA 2BYCA 4NE9C 1GMWA 2XSJA 3H25A 4U6PA 3LP0B 2B3TB 3UD5A 3SMZA 1Q78A 3KKFA 2CQIA 3IC1A 2HHVA 3SIPB 3GJRB 4RNOA 4PXCA 1RT2A 3M7VA 3SFUA 2MQPA 2AE8A 4QWDA 3B4MA 4DV5F 4P7VA 2GMLA 2DGUA 1K73T 3DOMB 2Y1LB 3ELHA 4Y0FA 1J2VA 3QIDA 2B8PA 1R0CB 3PXGa 3TVKA 1N32I 1TUWA 4XDCA 3TP2A 1FERA 2DD8S 2ZH8A 1Y7PA 3BH7B 3H90A 2EFPA 2JH3A 1E6VA 4HDHA 5C0XC 4HH0A 5EHHA 1Q8LA 1WHWA 5DDPC 4ZVHA 4USTA 3J7Z5 2BM0A 1T11A 2BRKA 2HFSA 3BR9A 3CJQA 1IBLJ 4NCGB 4BHQA 1RKJA 3VWSA 5C24A 2MY7A 3EM1A 1N32F 1PO6A 4U96A 1XR6A 2EC2A 1UVKA 2N7YA 3KJVA 4Y2KA 2B7BB 3B4DA 3V6KA 2CJYB 2QSFA 2H51B 1EARA 1WSRA 3HVAA 5A2QC 3QT5A 2QX0A 3CJ2A 2NPIA 2RJZA 2XY7A 4JI1E 2BJ9A 2HNDA 4DV1J 1O0PA 1XERA 2YXLA 1FCAA 4PAAA 1RT3A 2W9AA 3KK2A 2BJ3A 4MMOA 3A3OB 4HH1A 1Z0CA 4QR0A 5CYJA 3SV3A 4CIOA 4EEYA 3HK2A 1UFLA 2FVSA 2BZ2A 2BJDA 2ZH7A 1KWMA 3D68A 3HF5A 4K4VA 5G0RB 3MCOA 4KGXB 2DH8A 4B3TE 1FJEB 4EZ6A 4TYAA 3J7YI 4FYVB 5A2QY 2J8AA 3GQCA 3SCIE 1P1LA 3PR5B 4QR2A 1JLEA 2QMXA 4LSLB 4FNIA 1KRPA 1Y3JA 2XM3A 5FDLA 2PO2A
chains in the Genus database with same CATH topology
4X64E 1XNQI 3K85A 3Q1QA 3J7AG 4FWDA 4X66I 4JI5E 4NXME 2Q2EB 3F0NA 2V2QA 4KQVA 2BM1A 4LF9I 4DR6E 4FWHA 1HNWE 3ZKBA 1N36I 4FW9A 3T1HI 1EI1A 1PKPA 2EFGA 5LMUE 1ZM2A 1N36E 2X7IA 1XMQE 3J80C 2WW4A 3J81C 4LF8E 3GONA 4LFAE 1H74A 1HR0E 2UXCI 4DV1E 2AJ4A 2DEJA 4DR7E 3JAMC 1IBME 4DR3E 4LFCI 1PVGA 2ZITA 4NXNE 3QT8A 1FI4A 2ZM6E 4JI1I 1BKNA 3T1YE 4JI3I 1Z0GA 4DPXA 1XHKA 2IOQA 2NPFA 4GKKE 4IZJA 2CZ9A 1MU5A 2VQEE 3QT7A 1U2RA 4K0KI 3ZZUA 4JV5I 1DARA 1ZM9A 1RR9A 1H73A 2O1UA 3B82A 1Z5BA 3P06A 4DR1I 4DR5I 1XMOE 1H7SA 4JYAE 2Z5EA 4DUYI 4B3TI 4DV3I 1I94I 3J80Q 3J81Q 3PYDA 4DV6E 4X65E 4DV5E 4DV3E 4JI5I 4P7AA 2UUBI 1PIEA 3D4JA 1ZXMA 4LF5E 2IOPA 1Z5AA 1Y4SA 2XEXA 4IZKB 4YY3I 3PRYA 4JI2I 2VQFE 2UXBI 1KVKA 1FWKA 5GMEA 4JI0E 4JI7I 2OI2A 4LF7E 1J5EI 4LF4I 1A6FA 2UUAI 1IBLI 4X64I 1UEKA 4USMA 2V2ZA 4FWGA 4DV0I 2UUAE 2E5LI 4NXMI 1USUA 1KIJA 2E1RA 1B63A 4DV0E 2E5LE 4DR6I 2DEIA 5IWAE 5FWKA 3ZM7A 1HNWI 4DR2E 5FLXC 1B62A 1HK7A 1EA6A 1HNZE 1Z0EA 4DU8A 3M6AA 1N32E 5LMUI 1WUUA 1XMQI 4LF8I 1N0UA 4LFAI 2UUCE 1HR0I 2BV3A 4DV1I 1D6TA 4GKJE 4OX9E 4EMDA 4DR7I 4R1FA 1IBMI 4AQYI 4DR3I 4DU7A 4HY1A 1Z59A 4NXNI 4AQYE 4MYTA 2O1WA 3WU3A 2ZM6I 1NHIA 3T1YI 4LFBE 5LMNE 3LNUA 1NHJA 3WU4A 4GKKI 2V8PA 2HK3A 2R3VA 2VQEI 1Z0TA 3WU5A 1FKAE 1N34I 2Z5CA 1FWLA 1Z5CA 4WUCA 4HACA 1N34E 5IT9C 3K17A 5GMDA 1QZRA 1XMOI 4DV4E 3HULA 4JYAI 3LTOA 2HHHE 2UU9E 4JI4E 5L3JA 3B8HA 2F4VI 2V2VA 3ZKDA 1K47A 4DXLA 2HKJA 1HNXE 4PRXA 2F4VE 4DV6I 4X65I 4DV5I 4JI8E 4YHHI 4LF5I 5BR8E 4JI6I 4YHHE 3B78A 4X62E 4DV2E 1XNRE 1USVA 1Y6ZA 4JI6E 2O1VA 3JAMQ 2PNLA 1S16A 2VQFI 3LPSA 2VF3A 4UT4A 4ZVIA 4JI0I 4LF7I 1FJGE 4M1KA 4XTJA 4KHPE 1H72C 4DR4E 4I3HA 2GS8A 3ZZ0A 1KKHA 4DPWA 3V2UC 1IBKE 2UXDI 2GQ0A 2R42A 4UTGA 2UXDE 4Z7CA 5IWAI 1H7UA 4DR2I 4B3RE 4IZJB 2J7KA 4B3SE 1S4EA 4B3ME 1HNZI 2Z5BA 1N32I 4USKA 1Z0VA 1OJ4A 4MYUA 3OTOE 3ZZTA 1KTVA 2UUCI 3HJCA 4GKJI 4URLA 4OX9I 1RREA 1XNQE 4IZJD 2CG9A 2ZBKB 4FN5A 4X66E 2BM0A 3V5RA 2HFSA 4LF9E 3Q6NA 4LFBI 5LMNI 4Z7YA 2HK2A 3T1HE 4IZKA 1N33I 1ZXNA 1N33E 1MX0A 2UXCE 1Z0BA 3H4LA 4PRVA 4DPUA 2X36A 3PYFA 5A2QC 3QT5A 4DV4I 4LFCE 1ZM3A 3PYGA 2HHHI 2UU9I 4JI4I 1N0VC 4JI1E 3K1JA 4JI3E 5FLXQ 4P52A 1HNXI 1Y4UA 4JI8I 4HXZA 2Z5BB 3PYEA 1Z0CA 5BR8I 4K0KE 1NHHA 4WUBA 4JV5E 4PU9A 4DV2I 4X62I 1XNRI 1Z0WA 2A2CA 1VISA 2HFUA 4DR1E 2LJPA 2HKEA 1MG7A 4JG4A 1NZ0A 2A2DA 4DR5E 4DPYA 2V34A 1FJGI 4HYMA 4KHPI 4DR4I 1ELOA 5LL6R 4DUYE 4B3TE 1I94E 1IBKI 3QT6A 4DPTA 4ED4A 2UUBE 1FNMA 1ZM4A 4B3RI 4LF6I 3J7AM 4B3SI 5IT9Q 4B3MI 4RPFA 5A2QQ 2CGEA 4YY3E 3CWVA 4LF6E 2O1TA 2Z5CB 3WU6A 3OTOI 4JI2E 2UXBE 4HACB 4DUZI 4DV7I 4JI7E 3Q6MA 4N3OA 1J5EE 4WUDA 2PNMA 4LF4E 4DUZE 4DV7E 1IBLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 E;  1XNQ I;  3Q1Q A;  3J7A G;  4FWD A;  4X66 I;  4JI5 E;  4NXM E;  2Q2E B;  3F0N A;  2V2Q A;  4KQV A;  2BM1 A;  4LF9 I;  4DR6 E;  4FWH A;  1HNW E;  3ZKB A;  1N36 I;  4FW9 A;  3T1H I;  1EI1 A;  1PKP A;  2EFG A;  5LMU E;  1ZM2 A;  1N36 E;  2X7I A;  1XMQ E;  3J80 C;  2WW4 A;  3J81 C;  4LF8 E;  3GON A;  4LFA E;  1H74 A;  1HR0 E;  2UXC I;  4DV1 E;  2AJ4 A;  2DEJ A;  4DR7 E;  3JAM C;  1IBM E;  4DR3 E;  4LFC I;  1PVG A;  2ZIT A;  4NXN E;  3QT8 A;  1FI4 A;  2ZM6 E;  4JI1 I;  1BKN A;  3T1Y E;  4JI3 I;  1Z0G A;  4DPX A;  1XHK A;  2NPF A;  4GKK E;  2CZ9 A;  1MU5 A;  2VQE E;  3QT7 A;  1U2R A;  4K0K I;  3ZZU A;  4JV5 I;  1DAR A;  1ZM9 A;  1RR9 A;  1H73 A;  3B82 A;  1Z5B A;  4DR1 I;  4DR5 I;  1XMO E;  1H7S A;  4JYA E;  4DUY I;  4B3T I;  4DV3 I;  1I94 I;  3J80 Q;  3J81 Q;  3PYD A;  4DV6 E;  4X65 E;  4DV5 E;  4DV3 E;  4JI5 I;  4P7A A;  2UUB I;  1PIE A;  3D4J A;  1ZXM A;  4LF5 E;  1Z5A A;  2XEX A;  4YY3 I;  4JI2 I;  2VQF E;  2UXB I;  1KVK A;  1FWK A;  5GME A;  4JI0 E;  4JI7 I;  2OI2 A;  4LF7 E;  1J5E I;  4LF4 I;  1A6F A;  2UUA I;  1IBL I;  4X64 I;  1UEK A;  2UUA E;  4USM A;  2V2Z A;  4FWG A;  4DV0 I;  2E5L I;  4NXM I;  1KIJ A;  2E1R A;  1B63 A;  4DV0 E;  2E5L E;  4DR6 I;  2DEI A;  5IWA E;  3ZM7 A;  1HNW I;  4DR2 E;  5FLX C;  1B62 A;  1EA6 A;  1HNZ E;  1Z0E A;  4DU8 A;  3M6A A;  1N32 E;  5LMU I;  1WUU A;  1XMQ I;  4LF8 I;  1N0U A;  4LFA I;  2UUC E;  1HR0 I;  2BV3 A;  4DV1 I;  1D6T A;  4GKJ E;  4OX9 E;  4EMD A;  4DR7 I;  4R1F A;  1IBM I;  4AQY I;  4DR3 I;  4DU7 A;  4HY1 A;  1Z59 A;  4NXN I;  4AQY E;  4MYT A;  3WU3 A;  2ZM6 I;  1NHI A;  3T1Y I;  4LFB E;  5LMN E;  3LNU A;  1NHJ A;  3WU4 A;  4GKK I;  2V8P A;  2HK3 A;  2R3V A;  2VQE I;  1Z0T A;  3WU5 A;  1FKA E;  1N34 I;  1FWL A;  1Z5C A;  4WUC A;  4HAC A;  1N34 E;  5IT9 C;  3K17 A;  5GMD A;  1QZR A;  1XMO I;  4DV4 E;  3HUL A;  4JYA I;  3LTO A;  2HHH E;  2UU9 E;  4JI4 E;  5L3J A;  3B8H A;  2F4V I;  2V2V A;  3ZKD A;  1K47 A;  4DXL A;  2HKJ A;  1HNX E;  4PRX A;  2F4V E;  4DV6 I;  4X65 I;  4DV5 I;  4JI8 E;  4YHH I;  4LF5 I;  5BR8 E;  4JI6 I;  4YHH E;  3B78 A;  4X62 E;  4DV2 E;  1XNR E;  4JI6 E;  3JAM Q;  1S16 A;  2VQF I;  3LPS A;  2VF3 A;  4UT4 A;  4ZVI A;  4JI0 I;  4LF7 I;  1FJG E;  4M1K A;  4XTJ A;  4KHP E;  1H72 C;  4DR4 E;  4I3H A;  2GS8 A;  3ZZ0 A;  1KKH A;  4DPW A;  3V2U C;  1IBK E;  2UXD I;  2R42 A;  4UTG A;  2UXD E;  4Z7C A;  5IWA I;  1H7U A;  4DR2 I;  4B3R E;  2J7K A;  4B3S E;  1S4E A;  4B3M E;  1HNZ I;  1N32 I;  4USK A;  1Z0V A;  1OJ4 A;  4MYU A;  3OTO E;  3ZZT A;  1KTV A;  2UUC I;  4GKJ I;  4URL A;  4OX9 I;  1RRE A;  1XNQ E;  2ZBK B;  4FN5 A;  4X66 E;  2BM0 A;  3V5R A;  2HFS A;  4LF9 E;  4LFB I;  5LMN I;  4Z7Y A;  2HK2 A;  3T1H E;  1N33 I;  1ZXN A;  1N33 E;  1MX0 A;  2UXC E;  1Z0B A;  3H4L A;  4PRV A;  4DPU A;  2X36 A;  3PYF A;  5A2Q C;  3QT5 A;  4DV4 I;  4LFC E;  1ZM3 A;  3PYG A;  2HHH I;  2UU9 I;  4JI4 I;  1N0V C;  4JI1 E;  3K1J A;  4JI3 E;  5FLX Q;  4P52 A;  1HNX I;  4JI8 I;  4HXZ A;  3PYE A;  1Z0C A;  5BR8 I;  4K0K E;  1NHH A;  4WUB A;  4JV5 E;  4PU9 A;  4DV2 I;  4X62 I;  1XNR I;  1Z0W A;  2A2C A;  1VIS A;  2HFU A;  4DR1 E;  2LJP A;  2HKE A;  1MG7 A;  4JG4 A;  1NZ0 A;  2A2D A;  4DR5 E;  4DPY A;  2V34 A;  1FJG I;  4HYM A;  4KHP I;  4DR4 I;  1ELO A;  5LL6 R;  4DUY E;  4B3T E;  1I94 E;  1IBK I;  3QT6 A;  4DPT A;  4ED4 A;  2UUB E;  1FNM A;  1ZM4 A;  4B3R I;  4LF6 I;  3J7A M;  4B3S I;  5IT9 Q;  4B3M I;  4RPF A;  5A2Q Q;  4YY3 E;  3CWV A;  4LF6 E;  3WU6 A;  3OTO I;  4JI2 E;  2UXB E;  4HAC B;  4DUZ I;  4DV7 I;  4JI7 E;  1J5E E;  4WUD A;  4LF4 E;  4DUZ E;  4DV7 E;  1IBL E; 
#chains in the Genus database with same CATH topology
 1RDR A;  3J7A G;  2X3G A;  2E5I A;  2JVR A;  2WBM A;  1S9G B;  3CD6 S;  2CPD A;  5EWF A;  3GSD A;  2EFQ A;  1RT3 B;  5DQG A;  3CO9 A;  4I67 A;  3CDJ A;  2E7V A;  2PE8 A;  2GO9 A;  1OYP A;  2NN6 A;  1HHS A;  1YJV A;  2X7I A;  1FVS A;  1ACM B;  2RQM A;  3T19 A;  2E44 A;  4F3O A;  1VBK A;  4MK8 A;  2BQ3 A;  3G4S S;  5J1N A;  4CO5 A;  2PD1 A;  1KC8 T;  3MAA B;  3M8P B;  2OML A;  2UUC J;  1MN9 A;  2F1F A;  3QAE A;  3QGG A;  1XHK A;  4RU2 A;  3AT1 B;  4ZLN A;  4TQR A;  2HBZ B;  2IAJ B;  5KT5 A;  1KLN A;  3GV8 B;  2QL9 B;  1GMV A;  3I0S A;  4O4R A;  1ZM9 A;  2AT1 B;  3B82 A;  3EVO A;  3M9O B;  1HD0 A;  2JRS A;  1RWU A;  2MJU A;  2G0C A;  1KEK A;  1B7Y B;  1VRT B;  1H2V Z;  5JMN A;  3VAF A;  1WKL A;  4DV5 E;  2C3U A;  4LQ3 A;  1Q53 A;  3QRP A;  4ICL B;  4M5D A;  2YWW A;  3H2V E;  3LGM A;  1VQ4 S;  2POK A;  3TAP A;  1HQE A;  3L7Z A;  3LP1 A;  4K5R A;  3TAQ A;  1HA1 A;  4ZVP B;  3UCU P;  2V8V A;  4JI2 I;  1KVK A;  5KFU A;  3BBB A;  1LWF B;  1RCO B;  3S6E A;  2PFD A;  2AJ1 A;  4X64 I;  2ZDP A;  1TAQ A;  4RW7 A;  5AE2 A;  3NWG A;  1TVR B;  3TNV A;  4CM0 A;  1B63 A;  1TFY A;  5HMY A;  3GV5 B;  2QFI A;  4QW9 A;  1L3V A;  2VG7 B;  2YKP A;  1JXL A;  4DU8 A;  1N32 E;  5JEA D;  1UZH A;  1WUU A;  2JHE A;  1F5A A;  4WJB A;  3W2W B;  4LF8 I;  3PTW A;  3R27 A;  4JI2 F;  2J65 A;  4TN2 A;  4ZHR A;  5KFP A;  5BXI A;  3L9Z A;  3IFE A;  3W1Y C;  5F9L A;  3DRS A;  3BV8 A;  1WEZ A;  4X64 F;  1K0V A;  4FF1 A;  1MRO A;  2OEL A;  1RWX B;  3BGF A;  4KO0 A;  3BSN A;  2HZA A;  1RI7 A;  5L9X A;  1IQZ A;  3M8W A;  3HX9 A;  2DXD A;  3ZZZ A;  2AU0 A;  4HAC A;  4LF8 F;  2RRN A;  4DUT A;  4ZCL A;  2CIM A;  4C97 A;  1S6O A;  3WQP A;  2IYI A;  4OZ3 A;  1Y00 A;  1NKE A;  5E2Q A;  3A1Y G;  2VA2 A;  3ZKD A;  2DGS A;  2IRU A;  4EK2 A;  5B0D A;  2MB0 B;  1Y60 A;  4ANE A;  1IXK A;  2ZEJ A;  1VC6 A;  2MLX A;  2O1V A;  1SV5 A;  3U1L A;  4C11 B;  1HQU A;  1CLF A;  4LF7 I;  2JLG A;  1HBM A;  2KFY A;  1QTN B;  1F9F A;  5C2G A;  4AXJ A;  2GS8 A;  2LQ9 A;  3OVA A;  3KJQ B;  1KKH A;  2UVW A;  4P2X A;  4Z7C A;  5IWA I;  2CDR B;  3GZ7 A;  3LAL A;  4C8Y A;  1Z0V A;  3TA0 A;  3KLV A;  2OP5 A;  4IH7 A;  2IPO B;  1KTV A;  4BWM A;  1JMT A;  3BYP A;  4LF7 F;  3KLF A;  1OY9 A;  3ZTQ A;  1RRE A;  3FQK A;  3NCP A;  2CPF A;  2CJA A;  1NK8 A;  3PIO Q;  4WKY A;  1TUV A;  2KT2 A;  1W26 A;  3VAL A;  4RW6 A;  3TZY A;  2V67 A;  3IG1 A;  5I3Q A;  2XO7 A;  3IS9 A;  5IWA F;  4DN0 A;  4BA2 A;  1RT5 B;  5C0X D;  3R7S B;  4QR1 A;  4OQJ A;  5ETR A;  1N32 J;  1HQU B;  4DPU A;  2VHG A;  1ZM3 A;  5CCL A;  1LWC A;  2ZBR A;  7AT1 B;  4ZP8 A;  1YDL A;  1Y4U A;  3IRW P;  1TL5 A;  3AAW B;  1RAF B;  3PYE A;  5B0C A;  2AWZ A;  1NM2 A;  4IDK A;  4QIW D;  2CVI A;  1SIW B;  2HFU A;  4X4S A;  3QJJ A;  4C98 A;  4MQY A;  4DL4 A;  4B9S A;  1YBU A;  3HVT B;  4MIA A;  4NI2 A;  1Q5V A;  2PO1 B;  2G2O A;  3MCM A;  3CCS S;  1FDN A;  3ONQ A;  2BXJ A;  3G86 A;  3IS9 B;  3OL8 A;  3T1A A;  4JYA J;  4DZ6 A;  1T8E A;  4BA2 B;  3HVR A;  3P5T L;  5GVQ A;  4DL7 A;  4ID5 A;  3GCM A;  3U02 A;  4B3R I;  4B3S I;  5A2Q Q;  4Q5V A;  3CWV A;  2VDI A;  3EJM A;  4JI2 E;  5DDR C;  2W7O A;  4K4Z A;  4J91 A;  2PC6 A;  3GIJ A;  3THT A;  2NXJ A;  2YNG A;  4DV7 E;  3BM7 A;  2MLZ A;  1LWC B;  4X64 E;  1PAE X;  4KC5 A;  4XTT A;  4HTI A;  1YJU A;  2J76 E;  4XK8 C;  1WKJ A;  5CYM B;  2M88 A;  2OEJ A;  1VQ8 S;  3GJQ B;  4FS1 A;  4B3R F;  4IR1 A;  4B3S F;  2WSF C;  2FVC A;  4EFA C;  2WW4 A;  4LF8 E;  4USV A;  3MEC A;  1RWK B;  4DR2 J;  5L38 A;  1S1T B;  5IM0 B;  1Q95 G;  1XWL A;  2DO4 A;  3PAC A;  3BBC A;  1FI4 A;  2VFV A;  1RT7 A;  2KFZ A;  2KM8 C;  4WFY A;  3A13 A;  1FX2 A;  1EQM A;  4ZPW R;  5HO4 A;  5K36 A;  3ZZU A;  2R2U A;  2YKQ A;  3MM9 A;  3R3T A;  3Q2S C;  5KFH A;  2PEH A;  8RUC A;  2XCA A;  2C37 A;  3AY0 A;  1D9D A;  3H98 A;  3KJN B;  2UV8 A;  1HI0 P;  3TOQ A;  3TWZ A;  3QZ7 A;  2A1B A;  2E29 A;  2LEC A;  1XC9 A;  1EZZ B;  5LOQ A;  4MT1 A;  3EE3 A;  3MED B;  4DJB A;  4P7A A;  3HSJ A;  4GVB B;  2RIJ A;  2LA6 A;  1YIJ S;  1UET A;  4N8O A;  1BGX T;  1M0S A;  2CQG A;  3BJY A;  1NK4 A;  3MEC B;  1VOM A;  1BUX A;  2ZH4 A;  3VAK A;  3RR7 A;  3GIM A;  4LF7 E;  5ETO A;  1TL3 A;  2IA0 A;  1A6F A;  2MPU A;  2DNZ A;  2G2Z A;  4H4O B;  2X3D A;  4USI A;  5D3G A;  4Y2A A;  3UPF A;  4PQU B;  1KVI A;  5FWK A;  5IWA E;  4U7U D;  2M0G B;  5K36 B;  5KT3 A;  1OY6 A;  5HJY A;  2CWK A;  2MGZ B;  4P9S A;  3O3L A;  4IOC Q;  2QMU B;  4NLQ A;  3G71 S;  1X4G A;  3T5J A;  1RXO B;  5JEA F;  2PSZ A;  3EX7 B;  5HRO B;  4DV7 J;  3AA9 A;  5KG6 A;  3MM7 B;  4X64 J;  3LA0 A;  5HQL A;  1VQL S;  3BSC A;  2DIT A;  3LNU A;  3MMA B;  4DZD A;  1XNQ J;  2LXI A;  2L9N A;  1KOH A;  2EG2 A;  2V8P A;  1LFW A;  2LQ5 A;  4ZPC A;  3P3G A;  1N34 I;  2RNE A;  4Q0B B;  3I4P A;  2FVP A;  2IY5 B;  1IKW A;  5DRQ A;  2LEP A;  2AZ3 A;  3DRR A;  4NLW A;  3TQE A;  1Q8B A;  1YLX A;  2GJF A;  2FJA B;  1Q0N A;  1N34 F;  4JI6 I;  3PS3 A;  1CS4 A;  5KFE A;  2VQF I;  1I1G A;  2DH7 A;  4WXO A;  2YWG A;  3DLK B;  2E1C A;  1S1V A;  5DGA A;  4KSE B;  4EO6 A;  1KDN A;  4LOM A;  1U1K A;  2LDY A;  3V2U C;  3DLE A;  1TTH B;  3CCZ A;  4J9M A;  3RAQ A;  4B3R E;  3UCG A;  4B3S E;  3HD1 A;  4JI6 F;  4E8U A;  4FBU A;  3AQP A;  2D1C A;  2OH2 A;  2VQF F;  1RU2 A;  5A8K A;  1Z2L A;  3K8W A;  5HVF A;  2VBY A;  3K8V A;  3T6J A;  1EET B;  2I0X A;  1DLO B;  3V5R A;  1Q8K A;  5HBM B;  2GIR A;  5KFS A;  4K5S A;  1H7W A;  2AGQ A;  1X4H A;  2HHT A;  1UDS A;  1VRU B;  2CQC A;  3PCO B;  5IWA J;  1IVZ A;  1PC5 A;  1U02 A;  4ES1 A;  1ZXN A;  3KLH A;  5D0H A;  5B0E A;  2CPX A;  3LAK A;  3ADA C;  1WC4 A;  5IT4 A;  5F8G A;  1WEX A;  3I0R B;  1KON A;  4IFV A;  4E98 A;  2P2C B;  2GNK A;  5GAG U;  3DLE B;  3EPI A;  3K1J A;  1QAI A;  3BGR A;  4DR7 J;  2V8H A;  1F2G A;  3WC0 A;  4J5O A;  2HLU A;  1FK9 B;  2IDL A;  1F9H A;  1OYR A;  4OO1 B;  2C39 A;  3MMC A;  3T1Y J;  4DV2 I;  4AL6 A;  3KK1 A;  2Y3Y A;  3S1T A;  1WHY A;  2XNQ A;  4K4U A;  3AOC A;  1UJ6 A;  5E41 A;  3AHP A;  4A8X A;  5IQ6 A;  1ELO A;  1MWZ A;  2OLW A;  3PJX A;  3AB2 B;  3HHK A;  3C15 B;  1YQH A;  3CCE S;  3DC2 A;  2XMM A;  3SYZ A;  4LUB A;  3FZB A;  4DPO A;  4ELT A;  3NEK A;  1N8R T;  2RKI A;  3VF0 B;  1U1Q A;  2ZD1 B;  4DV2 F;  1PBU A;  2NUH A;  3G6E S;  2XB2 D;  4LF5 J;  3W61 A;  2WZ1 A;  3BBF A;  3RB4 A;  4DUZ E;  2QYC A;  5JEA E;  3NRB A;  4WK1 A;  3UD3 P;  4KGV B;  4EGL A;  4O4G A;  2FZK B;  4JI5 E;  3IWL A;  4KBI A;  3M2U A;  1IKX A;  3E3X A;  4LF9 I;  2NLW A;  4GVL A;  1LK7 A;  4U7C A;  4YR3 A;  1BQM B;  2VPX B;  3CUN A;  1N36 I;  1SJ3 P;  1EI1 A;  4FF2 A;  3KK1 B;  1U6Z A;  3HHN B;  4QQB A;  3EXC X;  3R6G B;  3GYX B;  3DXB A;  1MNE A;  2B43 A;  2J0Q D;  2YX1 A;  1GTE A;  1G3O A;  2ZIT A;  1PVG A;  1Y5Y A;  2GMH A;  1TKT B;  1GMW D;  4LF9 F;  3GV7 B;  2NPF A;  4IZJ A;  1RHQ B;  3IWX A;  3HDS A;  1N36 F;  2ZVS A;  1PJ7 A;  2F63 A;  4M5G A;  1WTF A;  3AB4 B;  3QT7 A;  3DYA A;  3US5 A;  1KD1 T;  1E6Y B;  1I3O B;  2RF2 A;  4ZKA A;  3GME A;  2KRB A;  4ZDN A;  2W1B A;  1XMB A;  2WTF A;  5J2M A;  1Q86 T;  1FRI A;  4WP3 A;  1FRM A;  2VH7 A;  3MM5 B;  1SH2 A;  4K2X A;  3DOK B;  2GQ2 A;  1VHF A;  5EX0 A;  3GMG A;  2EBG A;  2HBR B;  2H4Y B;  3NG8 A;  2LDI A;  3FCW A;  1JKH B;  3GFX A;  4QIF A;  5DM6 Q;  2VQF E;  3W3S A;  2HWH A;  1S6Q A;  4LF4 I;  3DHX A;  4Y28 C;  3L09 A;  1R8A A;  2R7Q A;  3ENW A;  1SQE A;  1Q16 B;  4N77 A;  3CD0 A;  1HNW I;  4XPE A;  2W2N P;  5FLX C;  1N5V A;  2FLN A;  4G1I A;  1NK6 A;  3TA2 A;  2HQI A;  5LMU I;  2RU9 A;  2QSW A;  4F4X A;  4X4O A;  2CPY A;  2OD4 A;  1D6T A;  4LF4 F;  3KLG A;  2K06 A;  5AE1 A;  4HY1 A;  4DCJ B;  2YX7 A;  4NXN I;  4DUZ J;  2CPE A;  2I5J B;  3FNN A;  1LW0 B;  1H6K X;  1R0A B;  3EMT A;  3ZZY A;  2BAB A;  3HHD A;  1NHJ A;  4RBV A;  4JI5 J;  2BA9 A;  4GKK I;  1HNW F;  4TLR A;  4WP8 A;  5LMU F;  2GQQ A;  4U9R A;  2BA0 D;  2JEA B;  5IT9 C;  3NBP A;  1S6Q B;  1N6Q A;  3P6Y C;  3HFK A;  1FD2 A;  4NXN F;  4OKG A;  5C5J A;  3EDR B;  3OXG A;  1SJF A;  3MEE B;  3GPA A;  1VS3 A;  4GKK F;  2VPW B;  3CDE A;  1APS A;  3NOG A;  1Z4U A;  1P27 B;  3T5L A;  3ZNU A;  4DV2 E;  1LW2 B;  4OX8 A;  3NGS A;  4TKT A;  4A8Y A;  2V6A A;  3ITH A;  2YH1 A;  2J7W A;  4F2S A;  4BCA A;  2VF3 A;  3CE8 A;  4GC6 A;  1WF0 A;  2AGO A;  1VIO A;  4RKU C;  5JJB A;  3AA8 A;  3SXL A;  2NN6 D;  4P7T A;  1RA6 A;  2DGO A;  2W9B A;  4OO1 F;  2AEF A;  5ETP A;  2A6O A;  4ILM A;  5K36 C;  3UWT A;  1HNV B;  4FF3 A;  3LWM A;  4PZV A;  4RW8 A;  2DNH A;  5H1S V;  2OPR A;  1N6Q B;  3MDF A;  4URL A;  2CRL A;  1WI8 A;  2C2D A;  3U1N A;  4EBC A;  1FKP A;  2UXB J;  5HMW A;  1NSK L;  3SCK E;  2J6S A;  1HYS B;  4LF9 E;  2QZ8 A;  1RHJ B;  4LRA A;  3D1Q A;  3R5J B;  2OD6 A;  1ZA2 B;  2BEF A;  3GU0 A;  1HL6 A;  3UDE A;  2JDJ A;  3GG0 A;  1TMM A;  4Q8F A;  4PXB A;  2FHJ D;  5CZV A;  2C3P A;  2ZKT A;  2KHC A;  2UU9 I;  3JSY A;  3TAM A;  4HYK A;  2H9Z A;  1JLF A;  4P72 A;  4ECT A;  3OSP A;  1SCJ B;  2LVW A;  3E51 A;  2H1Y A;  4PPD A;  4FW6 A;  1UVI A;  4ILL A;  2QA4 G;  4KGZ B;  2BE2 A;  4FW4 A;  4OI4 A;  5F8I A;  2CG8 A;  2JNJ A;  2UU9 F;  3P8B B;  4TY9 A;  2D9P A;  5L1J A;  1VYA A;  3FCV A;  1EJ7 L;  3M6X A;  4O44 A;  6AT1 B;  3L3C A;  7FD1 A;  3MEG A;  3MZI A;  2GFF A;  4Y6I A;  4X65 J;  3OTO I;  2KJV A;  4A8S A;  5HL7 Q;  4ZCI A;  2HVD A;  5K20 B;  1X7V A;  4LF4 E;  2CQ3 A;  1YJW S;  3PG9 A;  2BKN A;  3PRD A;  2HNY A;  4ES3 A;  5JVH Q;  2DRD A;  4OYX A;  3SZ2 A;  2QN6 B;  2KDO A;  4NZ7 A;  3PO4 A;  3EZO A;  1HNW E;  1YJR A;  1J5O A;  3M8R A;  1WOR A;  3DFE A;  5L9N A;  5LMU E;  2QA1 A;  3NCQ A;  3SSR A;  1IM4 A;  2LA4 A;  3OTO F;  1NEE A;  2R8J A;  2DEJ A;  3J7Y U;  3HJF A;  2PO4 A;  4CO1 A;  1H0H B;  4YFU A;  4W98 A;  2VOD A;  5F8N A;  4NXN E;  4O44 B;  2YKA A;  4DN9 A;  3IMQ J;  4X4R A;  3HP6 A;  1ULR A;  4GKK E;  4QNJ A;  4LF9 J;  3ET6 A;  1MU5 A;  4OO1 C;  4JV5 I;  1ZAW A;  4DFJ A;  3BGL A;  1RBO B;  4Q44 A;  2B4U A;  3M1V B;  4IG0 B;  3NCR A;  3OFE A;  5ITH A;  2WV