2JEBA

Structure of a 9-subunit archaeal exosome bound to mn ions
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
277
structure length
273
Chain Sequence
GHMSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPLAYETFEPGPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 81
structure length 273
sequence length 277
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2jebA01
5C0XD 5K36C 4OO1D 4AIMA 4OO1F 2JEBB 1E3HA 1UDOA 2WP8A 3KRNA 5C0XA 5JEAA 4IFDC 4BA1A 2PNZA 2C39B 3CDJA 5K36A 3M85G 3H1CA 2C37A 5C0XC 2PO1A 2NN6B 3GCMA 3GLLA 2WNRA 2NN6E 4IFDA 2C38A 3DD6A 3U1KA 3B4TA 2BA1D 2PNZB 2PO2A 4OO1A 3HKMA 1UDSA 2BA0D 4BA2A 1R6MA 2NN6D 2NN6F 2BR2B 2JEAB 4OO1C 3L7ZA 2JE6A 2PO0B 3CDIA 1R6LA 3M7NG 1OYRA 2JEBA 2WP8B 5C0XB 2NN6C 1E3PA 5JEAB 4BA1B 3GMEA 3M85D 5JEAE 4NBQA 2C39A 5K36B 1UDQA 2C37B 5K36E 2PO1B 2WNRB 2NN6A 5C0XF 4IFDB 2C38B 5JEAF 5JEAD 1OYPA 4IFDE 1OYSA 5K36F 5K36D 2PO2B 4OO1B 1UDNA 5C0XE 4BA2B 4OO1E 2BA1G 2BR2A 4IFDD 4IFDF 2BA0G 3M7ND 5JEAC 2JEAA 4AIDA 3L7ZB 2JE6B 4AM3A 2PO0A
chains in the Genus database with same CATH superfamily
5K36C 2O3ZA 4DR3E 2UUAE 2DEJA 4LFBI 4KHPE 2WP8A 5A2QQ 4DR1I 4DUYI 3UHMA 1RREA 4RPFA 4WUDA 1XMQI 3ZM7A 4JI4I 2E1RA 3H1CA 3J81C 1I94E 1H7UA 1IBKE 2UUAI 4Z7CA 4GQUA 4MDTA 3K1JA 4KHPI 2XEXA 2HKEA 4YHHE 4JI7E 2C38A 1A6FA 1N34E 2R3VA 3U1YA 4USMA 4MU0A 3T1HE 2AJ4A 4FN5A 4LF9E 5IWAE 4K0KE 2BM1A 1I94I 1R6MA 1IBKI 2AE8A 1MX0A 2NN6D 3D4JA 2WW4A 2ZBKB 4DR2E 4YHHI 1NHIA 4JI7I 1N34I 3ZKBA 2JE6A 1PIEA 5LMUE 4DV7E 1FJGE 4OKGA 2HK2A 2CVEA 5A2QC 4U3BA 3J7AM 4U3DA 4DV6E 1Z5BA 5DROA 5DRPA 2OI2A 4JI6E 2CGEA 2LJPA 1EA6A 4BA1B 5JEAE 4B3RI 3H4LA 4JYAE 2V8PA 5K36B 4OX9E 4X66E 4J3DA 2C37B 5LMUI 3LTOA 3V2UC 1USUA 1N0UA 4MYTA 2V2ZA 5C0XF 4X65E 5JEAF 4DV6I 4JI6I 1OYSA 4JI5I 1Z59A 3V5RA 3NZKA 4JYAI 3QT6A 4OO1B 4OX9I 2F4VE 4X66I 2UXBE 2UXDE 2HHHI 4JI2E 4WUCA 5FLXQ 2E5LI 2VQFI 4X65I 3QT7A 3M7ND 5FWKA 2V2VA 4AM3A 5DRQA 5C0XD 1VI7A 2Q2EB 3QT5A 3OTOE 2F4VI 1FI4A 3WU4A 2UXDI 1EI1A 1UDOA 1NHJA 1Z0VA 1B62A 4IFDC 4DV4I 4BA1A 4DV3I 4LFBE 4YY3I 4DR4E 1H7SA 2C39B 5K36A 2J65A 3M85G 4AQYE 2UUCE 2O1VA 4LF7E 2C37A 3GONA 1YH8A 4I3HA 3GCMA 1XMQE 4LPFA 1PKPA 2NN6E 4MU4A 1Y4SA 4XTJA 2A2CA 4NXMI 3DD6A 1IBME 5LMNI 1XNQI 4MYUA 5L3JA 4DR4I 4USKA 2PNZB 4OO1A 1UDSA 4AQYI 5FLXC 2UUCI 2CZ9A 4LF7I 3PS3A 2NN6F 2BR2B 3Q6NA 4UTGA 2VQEE 4B3ME 2UXCE 4HY1A 4LFCI 5EKWA 4IS9A 1ZXMA 2Z5BB 1IBMI 4OO1C 1FKAE 3J7AG 3CDIA 1R6LA 1HNWI 1Z5AA 3WU6A 1XHKA 1DARA 1MG7A 2ZITA 4LOMA 2IOPA 4Z7YA 5DNXA 4DPTA 1MU5A 2VQEI 4B3MI 3GMEA 4DV2E 5DRRA 2UXCI 4DV5I 2GO3A 2C39A 1Z0EA 1KVKA 4N3OA 3M6AA 4IZJB 2IESA 4B3RE 2PO1B 2WNRB 4DU7A 3WU5A 1H72C 4DPXA 4IFDB 4LF8E 5ELWA 2NPFA 4DV2I 3B8HA 1USVA 1HNZE 2PNMA 1XXEA 1NZ0A 5K36D 4FWGA 2PO2B 1ELOA 5C0XE 4JI3I 4JI5E 3PYEA 3Q6MA 2X36A 2BA1G 4R1FA 2J7KA 3B78A 2BR2A 1J5EI 2BA0G 5JEAC 3L7ZB 4LF8I 1D6TA 2HHHE 2Z5BA 4DXLA 1HNZI 2E5LE 2VQFE 2PNLA 1Y60A 3B82A 4OO1D 1ZM9A 2Z5CB 4AIMA 1H73A 1BKNA 2HFUA 3J80Q 3KRNA 2BV3A 3P3EA 1K47A 1VISA 4LCGA 4B3TI 1Z0GA 3CDJA 4DR7E 2VESA 1Z0BA 2A2DA 1H74A 1U2RA 4NXNE 3P3CA 4DU8A 4DV4E 4JI1E 4DV3E 4IZJA 4YY3E 4JG4A 4X62E 2PO1A 3GLLA 2WNRA 4LCFA 4IFDA 1B63A 1N32I 4GKKE 4FW7A 3B4TA 4IZKB 2UUBE 4P52A 1HNXI 3PS1A 4DR7I 4NXME 2Z5EA 2PO2A 5LMNE 1RHYA 4MU3A 4LFAE 1XNQE 3HULA 4P7AA 4NXNI 1QZRA 4JI1I 4DR6I 4X62I 4JV5I 2O1TA 1FNMA 3WU3A 4FW5A 4DUZE 3L7ZA 4GKKI 4URLA 4EMDA 2BM0A 2UUBI 1ZM2A 4LFCE 2Z5CA 1KIJA 3PYDA 3J80C 1IBLE 4LFAI 4HACB 1OYRA 1ZXNA 5C0XB 2NN6C 5GMEA 1E3PA 5JEAB 1N36E 1HNWE 3M85D 3LPSA 4FWHA 1RR9A 1XMOI 2GO4A 3T1YE 4DUZI 3ZZTA 1OJ4A 4OZEA 4JI0I 3P3GA 1UDQA 4PRVA 5K36E 2R42A 4DV5E 5DNLA 2O1WA 4LF5I 4FWDA 2HKJA 1UEKA 4MQYA 1IBLI 5LL6R 2IOQA 4PRXA 2GQ0A 1OYPA 3P06A 1N36I 2UU9E 1ZM3A 4KQVA 4IZKA 3PRYA 1ZM4A 4DR5E 3PS2A 3T1YI 5K36F 1UDNA 4IZJD 4ZVIA 4DPUA 4BA2B 4OO1E 2HFSA 5BR8I 4IFDD 2V2QA 4JI3E 4DR3I 2IERA 2UU9I 3K85A 3LNUA 2V34A 3CWVA 1J5EE 1XNRE 3JAMQ 4OO1F 4DR5I 2CG9A 4ISAA 4QNJA 2JEBB 4DV1E 4PU9A 1E3HA 4HACA 2X7IA 5C0XA 5JEAA 2PNZA 4WUBA 1Z0CA 4DV0E 1Z0WA 4FW3A 4DPYA 2EFGA 1N33E 3Q1QA 3F0NA 5C0XC 1XNRI 3HJCA 4B3TE 2NN6B 3T1HI 4DV1I 1HR0E 4LF9I 3QT8A 2JT2A 3U1KA 5IWAI 4K0KI 1P42A 4B3SE 1S16A 1KTVA 2BA1D 4DV0I 1NHHA 1N32E 3PYFA 3HKMA 2O1UA 1N33I 2BA0D 1Z5CA 4DR2I 4BA2A 1Y6ZA 1HNXE 1Z0TA 1HK7A 1Y4UA 4MU1A 4QNKA 4LF6E 1N0VC 2JEAB 4DV7I 1FJGI 1HR0I 4DR6E 2VF3A 4ED4A 3JAMC 4JV5E 2PO0B 4B3SI 2GS8A 3M7NG 1FWLA 4FW9A 2ZM6E 5IT9Q 4M1KA 4GKJE 2JEBA 2WP8B 4LF6I 5GMDA 4FW6A 1Y5YA 4NBQA 4UT4A 3PYGA 2ZM6I 4JI8E 1XMOE 4HYMA 4LF4E 3J81Q 2NN6A 4GKJI 4JI0E 2HK3A 4X64E 2C38B 5JEAD 1KKHA 4HXZA 5EL9A 4LF5E 4IFDE 2UXBI 3ZZUA 1FWKA 1YHCA 4JI2I 2F1DA 1S4EA 3P76A 4LCHA 1PVGA 4JI8I 4LF4I 4DR1E 4DUYE 1WUUA 4IFDF 2DEIA 4FW4A 4X64I 2JEAA 4AIDA 2JE6B 3ZZ0A 3OTOI 3ZKDA 5BR8E 3K17A 4JI4E 4DPWA 2PO0A 5IT9C
chains in the Genus database with same CATH topology
5C0XD 5K36C 4OO1D 4AIMA 4OO1F 2JEBB 1E3HA 1UDOA 2WP8A 3KRNA 5C0XA 5JEAA 4IFDC 4BA1A 2PNZA 2C39B 3CDJA 5K36A 3M85G 3H1CA 2C37A 5C0XC 2PO1A 2NN6B 3GCMA 3GLLA 2WNRA 2NN6E 4IFDA 2C38A 3DD6A 3U1KA 3B4TA 2BA1D 2PNZB 2PO2A 4OO1A 3HKMA 1UDSA 2BA0D 4BA2A 1R6MA 2NN6D 2NN6F 2BR2B 2JEAB 4OO1C 3L7ZA 2JE6A 2PO0B 3CDIA 1R6LA 3M7NG 1OYRA 2JEBA 2WP8B 5C0XB 2NN6C 1E3PA 5JEAB 4BA1B 3GMEA 3M85D 5JEAE 4NBQA 2C39A 5K36B 1UDQA 2C37B 5K36E 2PO1B 2WNRB 2NN6A 5C0XF 4IFDB 2C38B 5JEAF 5JEAD 1OYPA 4IFDE 1OYSA 5K36F 5K36D 2PO2B 4OO1B 1UDNA 5C0XE 4BA2B 4OO1E 2BA1G 2BR2A 4IFDD 4IFDF 2BA0G 3M7ND 5JEAC 2JEAA 4AIDA 3L7ZB 2JE6B 4AM3A 2PO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X D;  5K36 C;  4OO1 D;  4AIM A;  4OO1 F;  2JEB B;  1E3H A;  1UDO A;  2WP8 A;  3KRN A;  5C0X A;  5JEA A;  4IFD C;  4BA1 A;  2PNZ A;  2C39 B;  3CDJ A;  5K36 A;  3M85 G;  3H1C A;  2C37 A;  5C0X C;  2PO1 A;  2NN6 B;  3GCM A;  3GLL A;  2WNR A;  2NN6 E;  4IFD A;  2C38 A;  3DD6 A;  3U1K A;  3B4T A;  2BA1 D;  2PNZ B;  2PO2 A;  4OO1 A;  3HKM A;  1UDS A;  2BA0 D;  4BA2 A;  1R6M A;  2NN6 D;  2NN6 F;  2BR2 B;  2JEA B;  4OO1 C;  3L7Z A;  2JE6 A;  2PO0 B;  3CDI A;  1R6L A;  3M7N G;  1OYR A;  2JEB A;  2WP8 B;  5C0X B;  2NN6 C;  1E3P A;  5JEA B;  4BA1 B;  3GME A;  3M85 D;  5JEA E;  4NBQ A;  2C39 A;  5K36 B;  1UDQ A;  2C37 B;  5K36 E;  2PO1 B;  2WNR B;  2NN6 A;  5C0X F;  4IFD B;  2C38 B;  5JEA F;  5JEA D;  1OYP A;  4IFD E;  1OYS A;  5K36 F;  5K36 D;  2PO2 B;  4OO1 B;  1UDN A;  5C0X E;  4BA2 B;  4OO1 E;  2BA1 G;  2BR2 A;  4IFD D;  4IFD F;  2BA0 G;  3M7N D;  5JEA C;  2JEA A;  4AID A;  3L7Z B;  2JE6 B;  4AM3 A;  2PO0 A; 
#chains in the Genus database with same CATH topology
 5K36 C;  2O3Z A;  4DR3 E;  2UUA E;  2DEJ A;  4LFB I;  4KHP E;  2WP8 A;  5A2Q Q;  4DR1 I;  4DUY I;  3UHM A;  1RRE A;  4RPF A;  4WUD A;  1XMQ I;  3ZM7 A;  4JI4 I;  2E1R A;  3H1C A;  3J81 C;  1I94 E;  1H7U A;  1IBK E;  2UUA I;  4Z7C A;  4GQU A;  4MDT A;  3K1J A;  4KHP I;  2XEX A;  2HKE A;  4YHH E;  4JI7 E;  2C38 A;  1A6F A;  1N34 E;  2R3V A;  3U1Y A;  4USM A;  4MU0 A;  3T1H E;  2AJ4 A;  4FN5 A;  4LF9 E;  5IWA E;  4K0K E;  2BM1 A;  1I94 I;  1R6M A;  1IBK I;  2AE8 A;  1MX0 A;  2NN6 D;  3D4J A;  2WW4 A;  2ZBK B;  4DR2 E;  4YHH I;  1NHI A;  4JI7 I;  1N34 I;  3ZKB A;  2JE6 A;  1PIE A;  5LMU E;  4DV7 E;  1FJG E;  4OKG A;  2HK2 A;  2CVE A;  5A2Q C;  4U3B A;  3J7A M;  4U3D A;  4DV6 E;  1Z5B A;  5DRO A;  5DRP A;  2OI2 A;  4JI6 E;  2CGE A;  2LJP A;  1EA6 A;  4BA1 B;  5JEA E;  4B3R I;  3H4L A;  4JYA E;  2V8P A;  5K36 B;  4OX9 E;  4X66 E;  4J3D A;  2C37 B;  5LMU I;  3LTO A;  3V2U C;  1USU A;  1N0U A;  4MYT A;  2V2Z A;  5C0X F;  4X65 E;  5JEA F;  4DV6 I;  4JI6 I;  1OYS A;  4JI5 I;  1Z59 A;  3V5R A;  3NZK A;  4JYA I;  3QT6 A;  4OO1 B;  4OX9 I;  2F4V E;  4X66 I;  2UXB E;  2UXD E;  2HHH I;  4JI2 E;  4WUC A;  5FLX Q;  2E5L I;  2VQF I;  4X65 I;  3QT7 A;  3M7N D;  5FWK A;  2V2V A;  4AM3 A;  5DRQ A;  5C0X D;  1VI7 A;  2Q2E B;  3QT5 A;  3OTO E;  2F4V I;  1FI4 A;  3WU4 A;  2UXD I;  1EI1 A;  1UDO A;  1NHJ A;  1Z0V A;  1B62 A;  4IFD C;  4DV4 I;  4BA1 A;  4DV3 I;  4LFB E;  4YY3 I;  4DR4 E;  1H7S A;  2C39 B;  5K36 A;  2J65 A;  3M85 G;  4AQY E;  2UUC E;  2O1V A;  4LF7 E;  2C37 A;  3GON A;  1YH8 A;  4I3H A;  3GCM A;  1XMQ E;  4LPF A;  1PKP A;  2NN6 E;  4MU4 A;  1Y4S A;  4XTJ A;  2A2C A;  4NXM I;  3DD6 A;  1IBM E;  5LMN I;  1XNQ I;  4MYU A;  5L3J A;  4DR4 I;  4USK A;  2PNZ B;  4OO1 A;  1UDS A;  4AQY I;  5FLX C;  2UUC I;  2CZ9 A;  4LF7 I;  3PS3 A;  2NN6 F;  2BR2 B;  3Q6N A;  4UTG A;  2VQE E;  4B3M E;  2UXC E;  4HY1 A;  4LFC I;  5EKW A;  4IS9 A;  1ZXM A;  2Z5B B;  1IBM I;  4OO1 C;  1FKA E;  3J7A G;  3CDI A;  1R6L A;  1HNW I;  1Z5A A;  3WU6 A;  1XHK A;  1DAR A;  1MG7 A;  2ZIT A;  4LOM A;  2IOP A;  4Z7Y A;  5DNX A;  4DPT A;  1MU5 A;  2VQE I;  4B3M I;  3GME A;  4DV2 E;  5DRR A;  2UXC I;  4DV5 I;  2GO3 A;  2C39 A;  1Z0E A;  1KVK A;  4N3O A;  3M6A A;  4IZJ B;  2IES A;  4B3R E;  2PO1 B;  2WNR B;  4DU7 A;  3WU5 A;  1H72 C;  4DPX A;  4IFD B;  4LF8 E;  5ELW A;  2NPF A;  4DV2 I;  3B8H A;  1USV A;  1HNZ E;  2PNM A;  1XXE A;  1NZ0 A;  5K36 D;  4FWG A;  2PO2 B;  1ELO A;  5C0X E;  4JI3 I;  4JI5 E;  3PYE A;  3Q6M A;  2X36 A;  2BA1 G;  4R1F A;  2J7K A;  3B78 A;  2BR2 A;  1J5E I;  2BA0 G;  5JEA C;  3L7Z B;  4LF8 I;  1D6T A;  2HHH E;  2Z5B A;  4DXL A;  1HNZ I;  2E5L E;  2VQF E;  2PNL A;  1Y60 A;  3B82 A;  4OO1 D;  1ZM9 A;  2Z5C B;  4AIM A;  1H73 A;  1BKN A;  2HFU A;  3J80 Q;  3KRN A;  2BV3 A;  3P3E A;  1K47 A;  1VIS A;  4LCG A;  4B3T I;  1Z0G A;  3CDJ A;  4DR7 E;  2VES A;  1Z0B A;  2A2D A;  1H74 A;  1U2R A;  4NXN E;  3P3C A;  4DU8 A;  4DV4 E;  4JI1 E;  4DV3 E;  4IZJ A;  4YY3 E;  4JG4 A;  4X62 E;  2PO1 A;  3GLL A;  2WNR A;  4LCF A;  4IFD A;  1B63 A;  1N32 I;  4GKK E;  4FW7 A;  3B4T A;  4IZK B;  2UUB E;  4P52 A;  1HNX I;  3PS1 A;  4DR7 I;  4NXM E;  2Z5E A;  2PO2 A;  5LMN E;  1RHY A;  4MU3 A;  4LFA E;  1XNQ E;  3HUL A;  4P7A A;  4NXN I;  1QZR A;  4JI1 I;  4DR6 I;  4X62 I;  4JV5 I;  2O1T A;  1FNM A;  3WU3 A;  4FW5 A;  4DUZ E;  3L7Z A;  4GKK I;  4URL A;  4EMD A;  2BM0 A;  2UUB I;  1ZM2 A;  4LFC E;  2Z5C A;  1KIJ A;  3PYD A;  3J80 C;  1IBL E;  4LFA I;  4HAC B;  1OYR A;  1ZXN A;  5C0X B;  2NN6 C;  5GME A;  1E3P A;  5JEA B;  1N36 E;  1HNW E;  3M85 D;  3LPS A;  4FWH A;  1RR9 A;  1XMO I;  2GO4 A;  3T1Y E;  4DUZ I;  3ZZT A;  1OJ4 A;  4OZE A;  4JI0 I;  3P3G A;  1UDQ A;  4PRV A;  5K36 E;  2R42 A;  4DV5 E;  5DNL A;  2O1W A;  4LF5 I;  4FWD A;  2HKJ A;  1UEK A;  4MQY A;  1IBL I;  5LL6 R;  2IOQ A;  4PRX A;  2GQ0 A;  1OYP A;  3P06 A;  1N36 I;  2UU9 E;  1ZM3 A;  4KQV A;  4IZK A;  3PRY A;  1ZM4 A;  4DR5 E;  3PS2 A;  3T1Y I;  5K36 F;  1UDN A;  4IZJ D;  4ZVI A;  4DPU A;  4BA2 B;  4OO1 E;  2HFS A;  5BR8 I;  4IFD D;  2V2Q A;  4JI3 E;  4DR3 I;  2IER A;  2UU9 I;  3K85 A;  3LNU A;  2V34 A;  3CWV A;  1J5E E;  1XNR E;  3JAM Q;  4OO1 F;  4DR5 I;  2CG9 A;  4ISA A;  4QNJ A;  2JEB B;  4DV1 E;  4PU9 A;  1E3H A;  4HAC A;  2X7I A;  5C0X A;  5JEA A;  2PNZ A;  4WUB A;  1Z0C A;  4DV0 E;  1Z0W A;  4FW3 A;  4DPY A;  2EFG A;  1N33 E;  3Q1Q A;  3F0N A;  5C0X C;  1XNR I;  3HJC A;  4B3T E;  2NN6 B;  3T1H I;  4DV1 I;  1HR0 E;  4LF9 I;  3QT8 A;  2JT2 A;  3U1K A;  5IWA I;  4K0K I;  1P42 A;  4B3S E;  1S16 A;  1KTV A;  2BA1 D;  4DV0 I;  1NHH A;  1N32 E;  3PYF A;  3HKM A;  2O1U A;  1N33 I;  2BA0 D;  1Z5C A;  4DR2 I;  4BA2 A;  1Y6Z A;  1HNX E;  1Z0T A;  1HK7 A;  1Y4U A;  4MU1 A;  4QNK A;  4LF6 E;  1N0V C;  2JEA B;  4DV7 I;  1FJG I;  1HR0 I;  4DR6 E;  2VF3 A;  4ED4 A;  3JAM C;  4JV5 E;  2PO0 B;  4B3S I;  2GS8 A;  3M7N G;  1FWL A;  4FW9 A;  2ZM6 E;  5IT9 Q;  4M1K A;  4GKJ E;  2JEB A;  2WP8 B;  4LF6 I;  5GMD A;  4FW6 A;  1Y5Y A;  4NBQ A;  4UT4 A;  3PYG A;  2ZM6 I;  4JI8 E;  1XMO E;  4HYM A;  4LF4 E;  3J81 Q;  2NN6 A;  4GKJ I;  4JI0 E;  2HK3 A;  4X64 E;  2C38 B;  5JEA D;  1KKH A;  4HXZ A;  5EL9 A;  4LF5 E;  4IFD E;  2UXB I;  3ZZU A;  1FWK A;  1YHC A;  4JI2 I;  2F1D A;  1S4E A;  3P76 A;  4LCH A;  1PVG A;  4JI8 I;  4LF4 I;  4DR1 E;  4DUY E;  1WUU A;  4IFD F;  2DEI A;  4FW4 A;  4X64 I;  2JEA A;  4AID A;  2JE6 B;  3ZZ0 A;  3OTO I;  3ZKD A;  5BR8 E;  3K17 A;  4JI4 E;  4DPW A;  2PO0 A;  5IT9 C; 
#chains in the Genus database with same CATH homology
 5C0X D;  5K36 C;  4OO1 D;  4AIM A;  4OO1 F;  2JEB B;  1E3H A;  1UDO A;  2WP8 A;  3KRN A;  5C0X A;  5JEA A;  4IFD C;  4BA1 A;  2PNZ A;  2C39 B;  3CDJ A;  5K36 A;  3M85 G;  3H1C A;  2C37 A;  5C0X C;  2PO1 A;  2NN6 B;  3GCM A;  3GLL A;  2WNR A;  2NN6 E;  4IFD A;  2C38 A;  3DD6 A;  3U1K A;  3B4T A;  2BA1 D;  2PNZ B;  2PO2 A;  4OO1 A;  3HKM A;  1UDS A;  2BA0 D;  4BA2 A;  1R6M A;  2NN6 D;  2NN6 F;  2BR2 B;  2JEA B;  4OO1 C;  3L7Z A;  2JE6 A;  2PO0 B;  3CDI A;  1R6L A;  3M7N G;  1OYR A;  2JEB A;  2WP8 B;  5C0X B;  2NN6 C;  1E3P A;  5JEA B;  4BA1 B;  3GME A;  3M85 D;  5JEA E;  4NBQ A;  2C39 A;  5K36 B;  1UDQ A;  2C37 B;  5K36 E;  2PO1 B;  2WNR B;  2NN6 A;  5C0X F;  4IFD B;  2C38 B;  5JEA F;  5JEA D;  1OYP A;  4IFD E;  1OYS A;  5K36 F;  5K36 D;  2PO2 B;  4OO1 B;  1UDN A;  5C0X E;  4BA2 B;  4OO1 E;  2BA1 G;  2BR2 A;  4IFD D;  4IFD F;  2BA0 G;  3M7N D;  5JEA C;  2JEA A;  4AID A;  3L7Z B;  2JE6 B;  4AM3 A;  2PO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...