2JEBA

Structure of a 9-subunit archaeal exosome bound to mn ions
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
277
structure length
273
Chain Sequence
b'GHMSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPLAYETFEPGPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 81
structure length 273
sequence length 277
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2jebA01
2NN6B 1E3PA 2NN6C 1UDSA 4IFDE 2PO0B 2NN6E 2JEAA 2WNRB 4OO1B 4OO1C 1R6LA 4BA1B 4OO1E 3L7ZA 5K36F 3M85G 1OYRA 2PO2B 5K36B 1UDQA 5K36C 3GMEA 3B4TA 5JEAA 5K36E 3H1CA 2NN6D 4IFDF 4AIMA 5C0XA 2BA0G 2WP8A 2BR2A 4OO1D 4IFDB 4IFDC 4OO1F 3CDIA 2C38B 4BA2A 3GLLA 1OYSA 5K36D 2BA1G 1R6MA 2PO1B 2C37B 4IFDA 3DD6A 2PNZB 2NN6A 4IFDD 2PO0A 3U1KA 2WNRA 4OO1A 4BA1A 2C39B 1E3HA 2JE6B 2JEBB 2PO2A 4AIDA 5K36A 3CDJA 4NBQA 3KRNA 3L7ZB 3M85D 3M7NG 2C39A 2JE6A 5JEAF 2JEBA 5JEAB 5JEAC 2C38A 1UDOA 5JEAE 2BA0D 5C0XB 5C0XC 2WP8B 2BR2B 5C0XE 2PO1A 4AM3A 1OYPA 2C37A 1UDNA 2JEAB 2PNZA 4BA2B 3GCMA 2BA1D 5JEAD 3HKMA 2NN6F 3M7ND 5C0XD 5C0XF
chains in the Genus database with same CATH superfamily
2A2DA 5IT9Q 4LFAI 4IFDE 3K17A 1H7UA 3JAMQ 2NN6E 2JEAA 4DR3E 1N34E 4FW9A 4BA1B 4GQUA 2CGEA 5DRPA 1HNXE 2VQFI 1UDQA 3B4TA 5JEAA 1IBLE 1Z5CA 4LFAE 2NN6D 2OI2A 5DRQA 4AIMA 2BM1A 4Z7CA 4LFCI 4IFDC 3GONA 1OJ4A 4OO1F 4DU8A 2Z5CA 1HNWI 1B63A 1RR9A 4K0KI 1FWKA 1HR0I 3GLLA 4WUBA 4HACB 1N32I 3QT7A 1OYSA 1DARA 1EA6A 4KHPI 1XXEA 4DPWA 2UXCI 5GMDA 2BA1G 1MG7A 4JI1I 1S4EA 3CWVA 4IFDA 4ISAA 3PS1A 2NN6A 4FWGA 3Q6NA 2HK3A 4B3TI 1HR0E 4HXZA 4X66I 3P76A 4DV7I 4B3SI 1N32E 4LOMA 4DV5I 2JE6B 2IERA 4NXME 4KHPE 2GO4A 2A2CA 2V8PA 2UXCE 1WUUA 2PNLA 4JI1E 4DV6I 2ZM6I 5BR8I 2Q2EB 2V2QA 3M6AA 4JI4I 2F1DA 4FWHA 4B3TE 2CVEA 4X66E 4DV7E 5JEAF 2JEBA 5JEAB 2C38A 4DR6I 1XNQI 4USKA 5BR8E 2BA0D 4X62I 5C0XC 4DV6E 4FW5A 4OZEA 2PO1A 3NZKA 2IESA 4JI4E 4M1KA 2CG9A 2Z5CB 1UDNA 4LCGA 3WU6A 4ZVIA 5DNXA 3GCMA 4JV5I 3J81Q 3ZKBA 4OKGA 4Z7YA 1EI1A 3OTOI 4EMDA 1HNZI 2DEJA 3B78A 4B3RE 1XMOI 1XNQE 5EKWA 2NN6F 3M7ND 4IZJA 3WU4A 2J7KA 2NN6B 1E3PA 1PIEA 1N33I 4DV4I 1K47A 5IT9C 1N36I 3K85A 4GKKI 4OO1C 4X65I 1Y6ZA 1USUA 3HULA 3L7ZA 1NHJA 2O3ZA 3OTOE 4DR3I 3M85G 4FW3A 1OYRA 1N34I 1FNMA 4YY3I 4B3MI 1S16A 1QZRA 5K36C 4LCHA 3J7AG 4RPFA 1N33E 1ELOA 2NPFA 1N36E 4GKKE 1KKHA 4NXNI 1KIJA 1MX0A 1IBLI 3H4LA 4ED4A 1FWLA 3CDIA 3LNUA 2C38B 1HK7A 4YY3E 4B3ME 3PYGA 2HFSA 3U1YA 2V34A 2PO1B 4XTJA 3T1YE 2GQ0A 4DR1I 4X64E 4WUDA 4NXNE 4IFDD 2AE8A 2IOPA 3U1KA 1ZM2A 1XNRI 1XHKA 3Q1QA 2X7IA 3J7AM 1E3HA 3V5RA 4DV3I 4FW7A 4P52A 2EFGA 2GS8A 3WU5A 3QT5A 1FI4A 2PO2A 5LMUI 4DR1E 4NXMI 4OX9I 4LF6E 2J65A 2JT2A 3KRNA 2X36A 3L7ZB 3PYDA 1XNRE 4MDTA 2C39A 2VESA 4GKJE 4DV3E 1UDOA 1Z0BA 5LMUE 1I94E 4OX9E 2O1UA 3UHMA 1ZM9A 5LL6R 5C0XE 1VISA 3ZZ0A 4IZKA 1IBKI 3ZZUA 5DROA 1KVKA 2UUCI 2PNZA 2JEAB 1Z5AA 4DUZI 3F0NA 5EL9A 4LF5E 4DR2I 1ZXNA 4LF9E 4JI3E 1Y4SA 3J81C 4DR5E 4DPTA 5C0XD 4UTGA 2UXDI 4IZJD 2Z5EA 2HKJA 1NHIA 1YH8A 1UDSA 3ZM7A 4B3RI 1IBKE 4HYMA 4URLA 2UUCE 4DUZE 4DR2E 4OO1E 2E1RA 5DNLA 4JI7I 4LF8I 2UUAE 4AQYI 4UT4A 2R3VA 1Z0TA 4FN5A 1IBMI 1PKPA 2PO2B 3D4JA 3T1HI 1FJGI 3QT6A 3B82A 2DEIA 4DR7E 2UXDE 5K36E 4IFDF 5C0XA 1B62A 2BA0G 2WP8A 1YHCA 3P3GA 4JI5I 4OO1D 4IFDB 2WW4A 4JI7E 4LF8E 4U3DA 4AQYE 3P3EA 1Z0CA 4LPFA 4BA2A 1IBME 5A2QQ 3T1HE 1FJGE 4MU0A 2VQEI 1Z0VA 4LFBI 2UU9E 4JI2I 5K36D 1H7SA 4JI8E 3P3CA 4DR4I 4IZKB 4JI5E 3DD6A 2PNZB 2V2ZA 4MU1A 2PNMA 1NZ0A 2PO0A 1Y60A 2Z5BA 2WNRA 1USVA 4OO1A 3T1YI 3Q6MA 4FWDA 4X64I 2UXBI 2VQEE 1PVGA 4JI0I 4LFBE 4JI2E 2JEBB 2BV3A 4JG4A 1J5EI 1U2RA 4DR4E 2BM0A 5DRRA 4AIDA 5K36A 4YHHI 2HFUA 4NBQA 4DV0I 2UUBE 3WU3A 4USMA 3PS2A 4P7AA 4JI6I 1N0UA 2JE6A 3PS3A 2UXBE 3ZZTA 4LF6I 4JI0E 3HJCA 1Z5BA 1XMQI 2HK2A 1D6TA 4MYUA 5JEAC 1J5EE 4DXLA 4YHHE 5C0XB 2O1WA 4GKJI 2O1VA 2WP8B 2HKEA 4IZJB 3V2UC 2V2VA 4DV0E 4AM3A 1OYPA 4DU7A 2C37A 1I94I 5IWAI 4JI6E 4DV1E 4DUYE 4R1FA 3PYFA 2IOQA 1Z59A 4BA2B 2GO3A 1XMQE 2R42A 2BA1D 3HKMA 4QNJA 4LF5I 3ZKDA 5ELWA 3J80C 4LF9I 4N3OA 4JI3I 2NN6C 2E5LI 4DR5I 2PO0B 1Z0EA 2Z5BB 2WNRB 4OO1B 5IWAE 1H72C 4DPUA 2VQFE 1R6LA 4J3DA 2XEXA 1MU5A 3K1JA 4PU9A 5K36F 2ZITA 1ZXMA 2F4VI 1ZM4A 1Z0GA 4MQYA 5K36B 3GMEA 4I3HA 4LFCE 2LJPA 2UUAI 4PRVA 4U3BA 3H1CA 2E5LE 1HNWE 2O1TA 3J80Q 4K0KE 3QT8A 2CZ9A 2BR2A 1NHHA 4FW6A 4DR7I 1ZM3A 4HY1A 1H74A 3P06A 2F4VE 5FLXC 3B8HA 4LF7I 5A2QC 2VF3A 1R6MA 4FW4A 1RREA 2C37B 5FWKA 4PRXA 4B3SE 5LMNI 2UU9I 3LTOA 4DV5E 4JI8I 4LF4I 1Y4UA 5GMEA 4QNKA 4MU3A 4BA1A 4LF7E 2C39B 2ZM6E 2AJ4A 1VI7A 5FLXQ 5L3JA 1BKNA 3CDJA 5LMNE 1H73A 1FKAE 1KTVA 4MYTA 1P42A 4MU4A 4DV2I 2HHHI 4IS9A 4LF4E 4DR6E 3M85D 3M7NG 4X62E 2UUBI 4JYAI 4HACA 5JEAE 3PYEA 1Y5YA 2BR2B 3JAMC 1RHYA 4JV5E 1UEKA 4DPXA 4DV2E 4LCFA 2HHHE 1HNZE 1N0VC 1Z0WA 1XMOE 4WUCA 4JYAE 1A6FA 5JEAD 3PRYA 4DV4E 1HNXI 4DPYA 4DV1I 4KQVA 4DUYI 2ZBKB 4X65E 5C0XF 3LPSA
chains in the Genus database with same CATH topology
2NN6B 1E3PA 2NN6C 1UDSA 4IFDE 2PO0B 2NN6E 2JEAA 2WNRB 4OO1B 4OO1C 1R6LA 4BA1B 4OO1E 3L7ZA 5K36F 3M85G 1OYRA 2PO2B 5K36B 1UDQA 5K36C 3GMEA 3B4TA 5JEAA 5K36E 3H1CA 2NN6D 4IFDF 4AIMA 5C0XA 2BA0G 2WP8A 2BR2A 4OO1D 4IFDB 4IFDC 4OO1F 3CDIA 2C38B 4BA2A 3GLLA 1OYSA 5K36D 2BA1G 1R6MA 2PO1B 2C37B 4IFDA 3DD6A 2PNZB 2NN6A 4IFDD 2PO0A 3U1KA 2WNRA 4OO1A 4BA1A 2C39B 1E3HA 2JE6B 2JEBB 2PO2A 4AIDA 5K36A 3CDJA 4NBQA 3KRNA 3L7ZB 3M85D 3M7NG 2C39A 2JE6A 5JEAF 2JEBA 5JEAB 5JEAC 2C38A 1UDOA 5JEAE 2BA0D 5C0XB 5C0XC 2WP8B 2BR2B 5C0XE 2PO1A 4AM3A 1OYPA 2C37A 1UDNA 2JEAB 2PNZA 4BA2B 3GCMA 2BA1D 5JEAD 3HKMA 2NN6F 3M7ND 5C0XD 5C0XF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 B;  1E3P A;  2NN6 C;  1UDS A;  4IFD E;  2PO0 B;  2NN6 E;  2JEA A;  2WNR B;  4OO1 B;  4OO1 C;  1R6L A;  4BA1 B;  4OO1 E;  3L7Z A;  5K36 F;  3M85 G;  1OYR A;  2PO2 B;  5K36 B;  1UDQ A;  5K36 C;  3GME A;  3B4T A;  5JEA A;  5K36 E;  3H1C A;  2NN6 D;  4IFD F;  4AIM A;  5C0X A;  2BA0 G;  2WP8 A;  2BR2 A;  4OO1 D;  4IFD B;  4IFD C;  4OO1 F;  3CDI A;  2C38 B;  4BA2 A;  3GLL A;  1OYS A;  5K36 D;  2BA1 G;  1R6M A;  2PO1 B;  2C37 B;  4IFD A;  3DD6 A;  2PNZ B;  2NN6 A;  4IFD D;  2PO0 A;  3U1K A;  2WNR A;  4OO1 A;  4BA1 A;  2C39 B;  1E3H A;  2JE6 B;  2JEB B;  2PO2 A;  4AID A;  5K36 A;  3CDJ A;  4NBQ A;  3KRN A;  3L7Z B;  3M85 D;  3M7N G;  2C39 A;  2JE6 A;  5JEA F;  2JEB A;  5JEA B;  5JEA C;  2C38 A;  1UDO A;  5JEA E;  2BA0 D;  5C0X B;  5C0X C;  2WP8 B;  2BR2 B;  5C0X E;  2PO1 A;  4AM3 A;  1OYP A;  2C37 A;  1UDN A;  2JEA B;  2PNZ A;  4BA2 B;  3GCM A;  2BA1 D;  5JEA D;  3HKM A;  2NN6 F;  3M7N D;  5C0X D;  5C0X F; 
#chains in the Genus database with same CATH topology
 2A2D A;  5IT9 Q;  4LFA I;  4IFD E;  3K17 A;  1H7U A;  3JAM Q;  2NN6 E;  2JEA A;  4DR3 E;  1N34 E;  4FW9 A;  4BA1 B;  4GQU A;  2CGE A;  5DRP A;  1HNX E;  2VQF I;  1UDQ A;  3B4T A;  5JEA A;  1IBL E;  1Z5C A;  4LFA E;  2NN6 D;  2OI2 A;  5DRQ A;  4AIM A;  2BM1 A;  4Z7C A;  4LFC I;  4IFD C;  3GON A;  1OJ4 A;  4OO1 F;  4DU8 A;  2Z5C A;  1HNW I;  1B63 A;  1RR9 A;  4K0K I;  1FWK A;  1HR0 I;  3GLL A;  4WUB A;  4HAC B;  1N32 I;  3QT7 A;  1OYS A;  1DAR A;  1EA6 A;  4KHP I;  1XXE A;  4DPW A;  2UXC I;  5GMD A;  2BA1 G;  1MG7 A;  4JI1 I;  1S4E A;  3CWV A;  4IFD A;  4ISA A;  3PS1 A;  2NN6 A;  4FWG A;  3Q6N A;  2HK3 A;  4B3T I;  1HR0 E;  4HXZ A;  4X66 I;  3P76 A;  4DV7 I;  4B3S I;  1N32 E;  4LOM A;  4DV5 I;  2JE6 B;  2IER A;  4NXM E;  4KHP E;  2GO4 A;  2A2C A;  2V8P A;  2UXC E;  1WUU A;  2PNL A;  4JI1 E;  4DV6 I;  2ZM6 I;  5BR8 I;  2Q2E B;  2V2Q A;  3M6A A;  4JI4 I;  2F1D A;  4FWH A;  4B3T E;  2CVE A;  4X66 E;  4DV7 E;  5JEA F;  2JEB A;  5JEA B;  2C38 A;  4DR6 I;  1XNQ I;  4USK A;  5BR8 E;  2BA0 D;  4X62 I;  5C0X C;  4DV6 E;  4FW5 A;  4OZE A;  2PO1 A;  3NZK A;  2IES A;  4JI4 E;  4M1K A;  2CG9 A;  2Z5C B;  1UDN A;  4LCG A;  3WU6 A;  4ZVI A;  5DNX A;  3GCM A;  4JV5 I;  3J81 Q;  3ZKB A;  4OKG A;  4Z7Y A;  1EI1 A;  3OTO I;  4EMD A;  1HNZ I;  2DEJ A;  3B78 A;  4B3R E;  1XMO I;  1XNQ E;  5EKW A;  2NN6 F;  3M7N D;  4IZJ A;  3WU4 A;  2J7K A;  2NN6 B;  1E3P A;  1PIE A;  1N33 I;  4DV4 I;  1K47 A;  5IT9 C;  1N36 I;  3K85 A;  4GKK I;  4OO1 C;  4X65 I;  1Y6Z A;  1USU A;  3HUL A;  3L7Z A;  1NHJ A;  2O3Z A;  3OTO E;  4DR3 I;  3M85 G;  4FW3 A;  1OYR A;  1N34 I;  1FNM A;  4YY3 I;  4B3M I;  1S16 A;  1QZR A;  5K36 C;  4LCH A;  3J7A G;  4RPF A;  1N33 E;  1ELO A;  2NPF A;  1N36 E;  4GKK E;  1KKH A;  4NXN I;  1KIJ A;  1MX0 A;  1IBL I;  3H4L A;  4ED4 A;  1FWL A;  3CDI A;  3LNU A;  2C38 B;  1HK7 A;  4YY3 E;  4B3M E;  3PYG A;  2HFS A;  3U1Y A;  2V34 A;  2PO1 B;  4XTJ A;  3T1Y E;  2GQ0 A;  4DR1 I;  4X64 E;  4WUD A;  4NXN E;  4IFD D;  2AE8 A;  2IOP A;  3U1K A;  1ZM2 A;  1XNR I;  1XHK A;  3Q1Q A;  2X7I A;  3J7A M;  1E3H A;  3V5R A;  4DV3 I;  4FW7 A;  4P52 A;  2EFG A;  2GS8 A;  3WU5 A;  3QT5 A;  1FI4 A;  2PO2 A;  5LMU I;  4DR1 E;  4NXM I;  4OX9 I;  4LF6 E;  2J65 A;  2JT2 A;  3KRN A;  2X36 A;  3L7Z B;  3PYD A;  1XNR E;  4MDT A;  2C39 A;  2VES A;  4GKJ E;  4DV3 E;  1UDO A;  1Z0B A;  5LMU E;  1I94 E;  4OX9 E;  2O1U A;  3UHM A;  1ZM9 A;  5LL6 R;  5C0X E;  1VIS A;  3ZZ0 A;  4IZK A;  1IBK I;  3ZZU A;  5DRO A;  1KVK A;  2UUC I;  2PNZ A;  2JEA B;  1Z5A A;  4DUZ I;  3F0N A;  5EL9 A;  4LF5 E;  4DR2 I;  1ZXN A;  4LF9 E;  4JI3 E;  1Y4S A;  3J81 C;  4DR5 E;  4DPT A;  5C0X D;  4UTG A;  2UXD I;  4IZJ D;  2Z5E A;  2HKJ A;  1NHI A;  1YH8 A;  1UDS A;  3ZM7 A;  4B3R I;  1IBK E;  4HYM A;  4URL A;  2UUC E;  4DUZ E;  4DR2 E;  4OO1 E;  2E1R A;  5DNL A;  4JI7 I;  4LF8 I;  2UUA E;  4AQY I;  4UT4 A;  2R3V A;  1Z0T A;  4FN5 A;  1IBM I;  1PKP A;  2PO2 B;  3D4J A;  3T1H I;  1FJG I;  3QT6 A;  3B82 A;  2DEI A;  4DR7 E;  2UXD E;  5K36 E;  4IFD F;  5C0X A;  1B62 A;  2BA0 G;  2WP8 A;  1YHC A;  3P3G A;  4JI5 I;  4OO1 D;  4IFD B;  2WW4 A;  4JI7 E;  4LF8 E;  4U3D A;  4AQY E;  3P3E A;  1Z0C A;  4LPF A;  4BA2 A;  1IBM E;  5A2Q Q;  3T1H E;  1FJG E;  4MU0 A;  2VQE I;  1Z0V A;  4LFB I;  2UU9 E;  4JI2 I;  5K36 D;  1H7S A;  4JI8 E;  3P3C A;  4DR4 I;  4IZK B;  4JI5 E;  3DD6 A;  2PNZ B;  2V2Z A;  4MU1 A;  2PNM A;  1NZ0 A;  2PO0 A;  1Y60 A;  2Z5B A;  2WNR A;  1USV A;  4OO1 A;  3T1Y I;  3Q6M A;  4FWD A;  4X64 I;  2UXB I;  2VQE E;  1PVG A;  4JI0 I;  4LFB E;  4JI2 E;  2JEB B;  2BV3 A;  4JG4 A;  1J5E I;  1U2R A;  4DR4 E;  2BM0 A;  5DRR A;  4AID A;  5K36 A;  4YHH I;  2HFU A;  4NBQ A;  4DV0 I;  2UUB E;  3WU3 A;  4USM A;  3PS2 A;  4P7A A;  4JI6 I;  1N0U A;  2JE6 A;  3PS3 A;  2UXB E;  3ZZT A;  4LF6 I;  4JI0 E;  3HJC A;  1Z5B A;  1XMQ I;  2HK2 A;  1D6T A;  4MYU A;  5JEA C;  1J5E E;  4DXL A;  4YHH E;  5C0X B;  2O1W A;  4GKJ I;  2O1V A;  2WP8 B;  2HKE A;  4IZJ B;  3V2U C;  2V2V A;  4DV0 E;  4AM3 A;  1OYP A;  4DU7 A;  2C37 A;  1I94 I;  5IWA I;  4JI6 E;  4DV1 E;  4DUY E;  4R1F A;  3PYF A;  2IOQ A;  1Z59 A;  4BA2 B;  2GO3 A;  1XMQ E;  2R42 A;  2BA1 D;  3HKM A;  4QNJ A;  4LF5 I;  3ZKD A;  5ELW A;  3J80 C;  4LF9 I;  4N3O A;  4JI3 I;  2NN6 C;  2E5L I;  4DR5 I;  2PO0 B;  1Z0E A;  2Z5B B;  2WNR B;  4OO1 B;  5IWA E;  1H72 C;  4DPU A;  2VQF E;  1R6L A;  4J3D A;  2XEX A;  1MU5 A;  3K1J A;  4PU9 A;  5K36 F;  2ZIT A;  1ZXM A;  2F4V I;  1ZM4 A;  1Z0G A;  4MQY A;  5K36 B;  3GME A;  4I3H A;  4LFC E;  2LJP A;  2UUA I;  4PRV A;  4U3B A;  3H1C A;  2E5L E;  1HNW E;  2O1T A;  3J80 Q;  4K0K E;  3QT8 A;  2CZ9 A;  2BR2 A;  1NHH A;  4FW6 A;  4DR7 I;  1ZM3 A;  4HY1 A;  1H74 A;  3P06 A;  2F4V E;  5FLX C;  3B8H A;  4LF7 I;  5A2Q C;  2VF3 A;  1R6M A;  4FW4 A;  1RRE A;  2C37 B;  5FWK A;  4PRX A;  4B3S E;  5LMN I;  2UU9 I;  3LTO A;  4DV5 E;  4JI8 I;  4LF4 I;  1Y4U A;  5GME A;  4QNK A;  4MU3 A;  4BA1 A;  4LF7 E;  2C39 B;  2ZM6 E;  2AJ4 A;  1VI7 A;  5FLX Q;  5L3J A;  1BKN A;  3CDJ A;  5LMN E;  1H73 A;  1FKA E;  1KTV A;  4MYT A;  1P42 A;  4MU4 A;  4DV2 I;  2HHH I;  4IS9 A;  4LF4 E;  4DR6 E;  3M85 D;  3M7N G;  4X62 E;  2UUB I;  4JYA I;  4HAC A;  5JEA E;  3PYE A;  1Y5Y A;  2BR2 B;  3JAM C;  1RHY A;  4JV5 E;  1UEK A;  4DPX A;  4DV2 E;  4LCF A;  2HHH E;  1HNZ E;  1N0V C;  1Z0W A;  1XMO E;  4WUC A;  4JYA E;  1A6F A;  5JEA D;  3PRY A;  4DV4 E;  1HNX I;  4DPY A;  4DV1 I;  4KQV A;  4DUY I;  2ZBK B;  4X65 E;  5C0X F;  3LPS A; 
#chains in the Genus database with same CATH homology
 2NN6 B;  1E3P A;  2NN6 C;  1UDS A;  4IFD E;  2PO0 B;  2NN6 E;  2JEA A;  2WNR B;  4OO1 B;  4OO1 C;  1R6L A;  4BA1 B;  4OO1 E;  3L7Z A;  5K36 F;  3M85 G;  1OYR A;  2PO2 B;  5K36 B;  1UDQ A;  5K36 C;  3GME A;  3B4T A;  5JEA A;  5K36 E;  3H1C A;  2NN6 D;  4IFD F;  4AIM A;  5C0X A;  2BA0 G;  2WP8 A;  2BR2 A;  4OO1 D;  4IFD B;  4IFD C;  4OO1 F;  3CDI A;  2C38 B;  4BA2 A;  3GLL A;  1OYS A;  5K36 D;  2BA1 G;  1R6M A;  2PO1 B;  2C37 B;  4IFD A;  3DD6 A;  2PNZ B;  2NN6 A;  4IFD D;  2PO0 A;  3U1K A;  2WNR A;  4OO1 A;  4BA1 A;  2C39 B;  1E3H A;  2JE6 B;  2JEB B;  2PO2 A;  4AID A;  5K36 A;  3CDJ A;  4NBQ A;  3KRN A;  3L7Z B;  3M85 D;  3M7N G;  2C39 A;  2JE6 A;  5JEA F;  2JEB A;  5JEA B;  5JEA C;  2C38 A;  1UDO A;  5JEA E;  2BA0 D;  5C0X B;  5C0X C;  2WP8 B;  2BR2 B;  5C0X E;  2PO1 A;  4AM3 A;  1OYP A;  2C37 A;  1UDN A;  2JEA B;  2PNZ A;  4BA2 B;  3GCM A;  2BA1 D;  5JEA D;  3HKM A;  2NN6 F;  3M7N D;  5C0X D;  5C0X F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...