2JEBA

Structure of a 9-subunit archaeal exosome bound to mn ions
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
277
structure length
273
Chain Sequence
GHMSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPLAYETFEPGPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 81
structure length 273
sequence length 277
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2jebA01
5JEAE 3CDIA 2BA1G 5K36D 1E3PA 5K36F 4AIDA 4IFDA 4BA2B 4OO1A 2NN6E 1R6LA 3GMEA 2BA0G 2NN6C 2WNRB 2WP8A 3H1CA 5JEAA 2C37A 1OYSA 5C0XE 1UDOA 3M85G 4IFDB 4AIMA 1UDQA 2NN6A 4OO1B 4NBQA 3CDJA 2WP8B 2C38A 3M7ND 2PO0A 5JEAB 5K36E 2C37B 2JE6A 3HKMA 5K36C 2PO2A 2PO1A 4OO1D 5C0XA 1UDNA 1OYPA 2C39A 4BA1A 2PNZA 5JEAD 5JEAF 1R6MA 3DD6A 3U1KA 2NN6B 5K36A 1UDSA 2C38B 2PO0B 2BA0D 3GLLA 2JE6B 2JEBB 2PO2B 2PO1B 3M7NG 5C0XB 2C39B 4BA1B 4IFDD 4IFDF 2PNZB 2JEBA 4OO1F 5C0XD 5C0XF 1E3HA 5K36B 2BA1D 5JEAC 2BR2A 3L7ZA 2JEAB 3B4TA 2NN6D 2NN6F 1OYRA 2JEAA 4AM3A 3M85D 4IFDE 4BA2A 4IFDC 3GCMA 3KRNA 2BR2B 3L7ZB 2WNRA 4OO1E 4OO1C 5C0XC
chains in the Genus database with same CATH superfamily
1EA6A 3CDIA 2JT2A 1N34I 2UUAI 2HFUA 1I94E 1HNWI 3PYDA 4FW5A 1IBKI 4LF7I 3K1JA 4DPTA 4AQYI 1H7SA 4DR6I 2CGEA 1Z59A 4FW3A 4DR1E 1FI4A 2DEJA 1FKAE 5ELWA 1R6LA 5L3JA 4IZJB 1KIJA 1KKHA 2WNRB 5JEAA 4JI2I 5A2QQ 2XEXA 1XNQI 4FW6A 2UXCE 2AE8A 4P7AA 3JAMQ 4RPFA 2Z5BA 5C0XE 3T1HI 5A2QC 4K0KE 4DR5I 3WU5A 2O1UA 4EMDA 4PRVA 3JAMC 4Z7CA 4KQVA 2V2ZA 4JYAI 4B3ME 4YY3E 4DR3E 2C38A 1XNRE 2CZ9A 2C37B 4FWDA 5K36C 1BKNA 2CVEA 4GKJI 1NHHA 2UUBI 4DV1E 3UHMA 4BA1A 5DROA 1N36I 3NZKA 3P76A 2NN6B 4IZJD 2VF3A 3P06A 1OJ4A 1XMOI 4M1KA 5K36A 3J81Q 1UDSA 4HY1A 4NXME 2JEBB 4HXZA 4ED4A 2PO1B 3M7NG 1EI1A 5GMEA 4LF5I 3J81C 4MU4A 2O3ZA 2PNZB 1Z5BA 4DV2I 4DPWA 4JI6I 1YH8A 4LOMA 4DR7E 4GKKI 4DU8A 4IS9A 5DRQA 4LCHA 4LF9I 1Y4UA 4MYUA 3ZKDA 4DV0I 4LF4E 3ZKBA 2Z5CA 2UUCI 2NN6D 2E1RA 1NHJA 1OYRA 2NN6F 1N32I 4KHPE 3PS1A 1N0UA 2AJ4A 2O1VA 3PRYA 2VQFE 2UXDI 2R3VA 4JI8E 2ZBKB 1MU5A 3CWVA 4DR4I 1USVA 1FWLA 4B3TI 2BM0A 4IFDC 3M6AA 4DV3I 2HFSA 1PIEA 3KRNA 2BR2B 4USKA 1S16A 4OO1C 2BV3A 3M7ND 4LFAI 1IBMI 3T1YE 4JI4I 2BA1G 2BM1A 4AIDA 4DV7E 1D6TA 1I94I 1PVGA 4IFDA 4X62E 4LCGA 1Z0EA 1RREA 3B78A 3P3GA 4DV5E 1MG7A 4LF8E 4OO1A 2NN6E 1HR0E 2BA0G 3J7AM 1H7UA 3WU4A 4JI5I 4X64E 4FWHA 2DEIA 1HNZI 4B3RE 4XTJA 1PKPA 3LTOA 4DV6E 1ZXNA 4LF6I 1FWKA 4J3DA 3D4JA 3M85G 1RR9A 2O1WA 1FJGE 1H73A 3V2UC 1ZM4A 1P42A 4DUZE 3CDJA 2WP8B 3QT5A 2HHHE 5BR8I 3ZM7A 1ZXMA 4NXNE 5C0XA 4USMA 4DUYI 4DR2I 1UEKA 4X65I 5JEAD 5LMNE 5JEAF 1R6MA 3DD6A 4DV4E 2OI2A 3U1KA 4JI0E 4QNJA 2WW4A 5EL9A 1ZM9A 4JV5E 4JI7I 1N33E 2PO0B 5IWAE 2BA0D 3GLLA 2JE6B 2GO4A 1J5EI 2PO2B 3OTOE 4OX9I 4DPYA 4MU0A 1HNXI 1KTVA 2C39B 4PU9A 4LFBE 4MYTA 4P52A 2ZM6E 3P3CA 4LFCI 2F4VI 4IZKA 1HK7A 4B3SI 3B8HA 3ZZUA 4JI1I 1N34E 2UUAE 1Y60A 4X66I 4HACA 1IBKE 2VQEI 4LF7E 5DNXA 1XMQI 4AQYE 4DR6E 3B4TA 4OKGA 2Q2EB 1IBLI 2JEAA 1ELOA 1YHCA 4JI2E 2VQFI 3V5RA 4JI8I 1XNQE 1FNMA 1Y6ZA 2E5LI 3GCMA 3L7ZB 3T1HE 2IESA 2WNRA 3QT8A 2A2CA 4DR5E 4WUCA 4JI3I 2EFGA 4JYAE 1E3PA 3T1YI 1ZM3A 4N3OA 4GKJE 4DXLA 2UUBE 4HYMA 4GQUA 4BA2B 3F0NA 1N36E 3GMEA 4DV5I 4LF8I 2NN6C 3PYFA 1HR0I 3Q1QA 2C37A 1VI7A 3PYGA 2HKJA 5LL6R 4WUDA 3QT6A 4DPUA 4UTGA 1XMOE 5DRPA 1KVKA 5LMUI 4MDTA 4AIMA 2NN6A 1Y4SA 4LF5E 5IT9Q 3ZZ0A 4DV2E 3WU3A 5JEAB 4JI6E 4ISAA 1QZRA 3HKMA 2PO1A 4GKKE 4OO1D 4DR1I 5IT9C 1UDNA 2GO3A 2PNZA 1Z0WA 2Z5BB 2O1TA 4FWGA 3B82A 1N0VC 4LF9E 2UXCI 3PYEA 4JI0I 4DV0E 4U3DA 2UUCE 2NPFA 2C38B 1N32E 2UXBE 4MQYA 4K0KI 4R1FA 3J80Q 2UXDE 1Z0CA 3Q6NA 2CG9A 4BA1B 4OZEA 4B3MI 1NHIA 2V2QA 4YY3I 4DR3I 4B3TE 3J7AG 4DR4E 3PS3A 1XNRI 4LFBI 3J80C 4DV3E 5DRRA 5C0XD 5C0XF 1E3HA 4FW9A 3LPSA 4U3BA 2HKEA 2ZM6I 4DV1I 1XHKA 5K36B 2BA1D 1IBME 1Z0BA 4YHHE 4FN5A 4JI4E 5JEAC 2BR2A 3LNUA 4ZVIA 2IOQA 2JEAB 2UU9E 1DARA 4NXMI 3U1YA 4JI5E 1XXEA 1HNZE 5FWKA 3HJCA 1Z5AA 2X36A 3M85D 4URLA 3K17A 4LF6E 4DR7I 2PNLA 1B62A 3PS2A 2Z5CB 1NZ0A 5JEAE 1WUUA 1B63A 1HNWE 1U2RA 5K36D 5K36F 1USUA 2X7IA 4LCFA 5BR8E 4LF4I 4DR2E 3H4LA 4DUYE 4KHPI 4X65E 1VISA 2WP8A 1Y5YA 3H1CA 2V2VA 2VESA 2GQ0A 4WUBA 4MU3A 4IZJA 4JI7E 2Z5EA 1OYSA 1MX0A 1UDOA 4FW7A 2IOPA 4I3HA 1J5EE 4IFDB 4DU7A 4OX9E 1UDQA 1HNXE 4DPXA 4OO1B 4NBQA 5DNLA 4QNKA 2PO0A 4DV7I 5K36E 2JE6A 4LFCE 4MU1A 2F4VE 2PO2A 4X62I 2V8PA 3GONA 2J65A 4B3SE 1OYPA 2C39A 3HULA 4JI1E 4X64I 1Z0TA 5EKWA 5GMDA 1Z5CA 4X66E 1A6FA 1Z0VA 4PRXA 2VQEE 4B3RI 5FLXQ 1XMQE 4DV6I 2R42A 3WU6A 1IBLE 1ZM2A 3Q6MA 1FJGI 1S4EA 5FLXC 2UXBI 3K85A 2ZITA 5C0XB 2PNMA 2GS8A 4IFDD 4IFDF 4DUZI 2J7KA 2F1DA 2HK2A 2JEBA 2HHHI 2E5LE 2LJPA 4OO1F 1Z0GA 4NXNI 3P3EA 1H72C 5LMNI 4JI3E 4DV4I 2A2DA 2V34A 4LPFA 4YHHI 1RHYA 3L7ZA 4JV5I 2HK3A 1N33I 1H74A 2UU9I 4FW4A 5IWAI 2IERA 3OTOI 4IZKB 3ZZTA 4AM3A 4Z7YA 4IFDE 4BA2A 3QT7A 4HACB 5LMUE 4OO1E 4UT4A 1K47A 5C0XC 4LFAE 4JG4A
chains in the Genus database with same CATH topology
5JEAE 3CDIA 2BA1G 5K36D 1E3PA 5K36F 4AIDA 4IFDA 4BA2B 4OO1A 2NN6E 1R6LA 3GMEA 2BA0G 2NN6C 2WNRB 2WP8A 3H1CA 5JEAA 2C37A 1OYSA 5C0XE 1UDOA 3M85G 4IFDB 4AIMA 1UDQA 2NN6A 4OO1B 4NBQA 3CDJA 2WP8B 2C38A 3M7ND 2PO0A 5JEAB 5K36E 2C37B 2JE6A 3HKMA 5K36C 2PO2A 2PO1A 4OO1D 5C0XA 1UDNA 1OYPA 2C39A 4BA1A 2PNZA 5JEAD 5JEAF 1R6MA 3DD6A 3U1KA 2NN6B 5K36A 1UDSA 2C38B 2PO0B 2BA0D 3GLLA 2JE6B 2JEBB 2PO2B 2PO1B 3M7NG 5C0XB 2C39B 4BA1B 4IFDD 4IFDF 2PNZB 2JEBA 4OO1F 5C0XD 5C0XF 1E3HA 5K36B 2BA1D 5JEAC 2BR2A 3L7ZA 2JEAB 3B4TA 2NN6D 2NN6F 1OYRA 2JEAA 4AM3A 3M85D 4IFDE 4BA2A 4IFDC 3GCMA 3KRNA 2BR2B 3L7ZB 2WNRA 4OO1E 4OO1C 5C0XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA E;  3CDI A;  2BA1 G;  5K36 D;  1E3P A;  5K36 F;  4AID A;  4IFD A;  4BA2 B;  4OO1 A;  2NN6 E;  1R6L A;  3GME A;  2BA0 G;  2NN6 C;  2WNR B;  2WP8 A;  3H1C A;  5JEA A;  2C37 A;  1OYS A;  5C0X E;  1UDO A;  3M85 G;  4IFD B;  4AIM A;  1UDQ A;  2NN6 A;  4OO1 B;  4NBQ A;  3CDJ A;  2WP8 B;  2C38 A;  3M7N D;  2PO0 A;  5JEA B;  5K36 E;  2C37 B;  2JE6 A;  3HKM A;  5K36 C;  2PO2 A;  2PO1 A;  4OO1 D;  5C0X A;  1UDN A;  1OYP A;  2C39 A;  4BA1 A;  2PNZ A;  5JEA D;  5JEA F;  1R6M A;  3DD6 A;  3U1K A;  2NN6 B;  5K36 A;  1UDS A;  2C38 B;  2PO0 B;  2BA0 D;  3GLL A;  2JE6 B;  2JEB B;  2PO2 B;  2PO1 B;  3M7N G;  5C0X B;  2C39 B;  4BA1 B;  4IFD D;  4IFD F;  2PNZ B;  2JEB A;  4OO1 F;  5C0X D;  5C0X F;  1E3H A;  5K36 B;  2BA1 D;  5JEA C;  2BR2 A;  3L7Z A;  2JEA B;  3B4T A;  2NN6 D;  2NN6 F;  1OYR A;  2JEA A;  4AM3 A;  3M85 D;  4IFD E;  4BA2 A;  4IFD C;  3GCM A;  3KRN A;  2BR2 B;  3L7Z B;  2WNR A;  4OO1 E;  4OO1 C;  5C0X C; 
#chains in the Genus database with same CATH topology
 1EA6 A;  3CDI A;  2JT2 A;  1N34 I;  2UUA I;  2HFU A;  1I94 E;  1HNW I;  3PYD A;  4FW5 A;  1IBK I;  4LF7 I;  3K1J A;  4DPT A;  4AQY I;  1H7S A;  4DR6 I;  2CGE A;  1Z59 A;  4FW3 A;  4DR1 E;  1FI4 A;  2DEJ A;  1FKA E;  5ELW A;  1R6L A;  5L3J A;  4IZJ B;  1KIJ A;  1KKH A;  2WNR B;  5JEA A;  4JI2 I;  5A2Q Q;  2XEX A;  1XNQ I;  4FW6 A;  2UXC E;  2AE8 A;  4P7A A;  3JAM Q;  4RPF A;  2Z5B A;  5C0X E;  3T1H I;  5A2Q C;  4K0K E;  4DR5 I;  3WU5 A;  2O1U A;  4EMD A;  4PRV A;  3JAM C;  4Z7C A;  4KQV A;  2V2Z A;  4JYA I;  4B3M E;  4YY3 E;  4DR3 E;  2C38 A;  1XNR E;  2CZ9 A;  2C37 B;  4FWD A;  5K36 C;  1BKN A;  2CVE A;  4GKJ I;  1NHH A;  2UUB I;  4DV1 E;  3UHM A;  4BA1 A;  5DRO A;  1N36 I;  3NZK A;  3P76 A;  2NN6 B;  4IZJ D;  2VF3 A;  3P06 A;  1OJ4 A;  1XMO I;  4M1K A;  5K36 A;  3J81 Q;  1UDS A;  4HY1 A;  4NXM E;  2JEB B;  4HXZ A;  4ED4 A;  2PO1 B;  3M7N G;  1EI1 A;  5GME A;  4LF5 I;  3J81 C;  4MU4 A;  2O3Z A;  2PNZ B;  1Z5B A;  4DV2 I;  4DPW A;  4JI6 I;  1YH8 A;  4LOM A;  4DR7 E;  4GKK I;  4DU8 A;  4IS9 A;  5DRQ A;  4LCH A;  4LF9 I;  1Y4U A;  4MYU A;  3ZKD A;  4DV0 I;  4LF4 E;  3ZKB A;  2Z5C A;  2UUC I;  2NN6 D;  2E1R A;  1NHJ A;  1OYR A;  2NN6 F;  1N32 I;  4KHP E;  3PS1 A;  1N0U A;  2AJ4 A;  2O1V A;  3PRY A;  2VQF E;  2UXD I;  2R3V A;  4JI8 E;  2ZBK B;  1MU5 A;  3CWV A;  4DR4 I;  1USV A;  1FWL A;  4B3T I;  2BM0 A;  4IFD C;  3M6A A;  4DV3 I;  2HFS A;  1PIE A;  3KRN A;  2BR2 B;  4USK A;  1S16 A;  4OO1 C;  2BV3 A;  3M7N D;  4LFA I;  1IBM I;  3T1Y E;  4JI4 I;  2BA1 G;  2BM1 A;  4AID A;  4DV7 E;  1D6T A;  1I94 I;  1PVG A;  4IFD A;  4X62 E;  4LCG A;  1Z0E A;  1RRE A;  3B78 A;  3P3G A;  4DV5 E;  1MG7 A;  4LF8 E;  4OO1 A;  2NN6 E;  1HR0 E;  2BA0 G;  3J7A M;  1H7U A;  3WU4 A;  4JI5 I;  4X64 E;  4FWH A;  2DEI A;  1HNZ I;  4B3R E;  4XTJ A;  1PKP A;  3LTO A;  4DV6 E;  1ZXN A;  4LF6 I;  1FWK A;  4J3D A;  3D4J A;  3M85 G;  1RR9 A;  2O1W A;  1FJG E;  1H73 A;  3V2U C;  1ZM4 A;  1P42 A;  4DUZ E;  3CDJ A;  2WP8 B;  3QT5 A;  2HHH E;  5BR8 I;  3ZM7 A;  1ZXM A;  4NXN E;  5C0X A;  4USM A;  4DUY I;  4DR2 I;  1UEK A;  4X65 I;  5JEA D;  5LMN E;  5JEA F;  1R6M A;  3DD6 A;  4DV4 E;  2OI2 A;  3U1K A;  4JI0 E;  4QNJ A;  2WW4 A;  5EL9 A;  1ZM9 A;  4JV5 E;  4JI7 I;  1N33 E;  2PO0 B;  5IWA E;  2BA0 D;  3GLL A;  2JE6 B;  2GO4 A;  1J5E I;  2PO2 B;  3OTO E;  4OX9 I;  4DPY A;  4MU0 A;  1HNX I;  1KTV A;  2C39 B;  4PU9 A;  4LFB E;  4MYT A;  4P52 A;  2ZM6 E;  3P3C A;  4LFC I;  2F4V I;  4IZK A;  1HK7 A;  4B3S I;  3B8H A;  3ZZU A;  4JI1 I;  1N34 E;  2UUA E;  1Y60 A;  4X66 I;  4HAC A;  1IBK E;  2VQE I;  4LF7 E;  5DNX A;  1XMQ I;  4AQY E;  4DR6 E;  3B4T A;  4OKG A;  2Q2E B;  1IBL I;  2JEA A;  1ELO A;  1YHC A;  4JI2 E;  2VQF I;  3V5R A;  4JI8 I;  1XNQ E;  1FNM A;  1Y6Z A;  2E5L I;  3GCM A;  3L7Z B;  3T1H E;  2IES A;  2WNR A;  3QT8 A;  2A2C A;  4DR5 E;  4WUC A;  4JI3 I;  2EFG A;  4JYA E;  1E3P A;  3T1Y I;  1ZM3 A;  4N3O A;  4GKJ E;  4DXL A;  2UUB E;  4HYM A;  4GQU A;  4BA2 B;  3F0N A;  1N36 E;  3GME A;  4DV5 I;  4LF8 I;  2NN6 C;  3PYF A;  1HR0 I;  3Q1Q A;  2C37 A;  1VI7 A;  3PYG A;  2HKJ A;  5LL6 R;  4WUD A;  3QT6 A;  4DPU A;  4UTG A;  1XMO E;  5DRP A;  1KVK A;  5LMU I;  4MDT A;  4AIM A;  2NN6 A;  1Y4S A;  4LF5 E;  5IT9 Q;  3ZZ0 A;  4DV2 E;  3WU3 A;  5JEA B;  4JI6 E;  4ISA A;  1QZR A;  3HKM A;  2PO1 A;  4GKK E;  4OO1 D;  4DR1 I;  5IT9 C;  1UDN A;  2GO3 A;  2PNZ A;  1Z0W A;  2Z5B B;  2O1T A;  4FWG A;  3B82 A;  1N0V C;  4LF9 E;  2UXC I;  3PYE A;  4JI0 I;  4DV0 E;  4U3D A;  2UUC E;  2NPF A;  2C38 B;  1N32 E;  2UXB E;  4MQY A;  4K0K I;  4R1F A;  3J80 Q;  2UXD E;  1Z0C A;  3Q6N A;  2CG9 A;  4BA1 B;  4OZE A;  4B3M I;  1NHI A;  2V2Q A;  4YY3 I;  4DR3 I;  4B3T E;  3J7A G;  4DR4 E;  3PS3 A;  1XNR I;  4LFB I;  3J80 C;  4DV3 E;  5DRR A;  5C0X D;  5C0X F;  1E3H A;  4FW9 A;  3LPS A;  4U3B A;  2HKE A;  2ZM6 I;  4DV1 I;  1XHK A;  5K36 B;  2BA1 D;  1IBM E;  1Z0B A;  4YHH E;  4FN5 A;  4JI4 E;  5JEA C;  2BR2 A;  3LNU A;  4ZVI A;  2IOQ A;  2JEA B;  2UU9 E;  1DAR A;  4NXM I;  3U1Y A;  4JI5 E;  1XXE A;  1HNZ E;  5FWK A;  3HJC A;  1Z5A A;  2X36 A;  3M85 D;  4URL A;  3K17 A;  4LF6 E;  4DR7 I;  2PNL A;  1B62 A;  3PS2 A;  2Z5C B;  1NZ0 A;  5JEA E;  1WUU A;  1B63 A;  1HNW E;  1U2R A;  5K36 D;  5K36 F;  1USU A;  2X7I A;  4LCF A;  5BR8 E;  4LF4 I;  4DR2 E;  3H4L A;  4DUY E;  4KHP I;  4X65 E;  1VIS A;  2WP8 A;  1Y5Y A;  3H1C A;  2V2V A;  2VES A;  2GQ0 A;  4WUB A;  4MU3 A;  4IZJ A;  4JI7 E;  2Z5E A;  1OYS A;  1MX0 A;  1UDO A;  4FW7 A;  2IOP A;  4I3H A;  1J5E E;  4IFD B;  4DU7 A;  4OX9 E;  1UDQ A;  1HNX E;  4DPX A;  4OO1 B;  4NBQ A;  5DNL A;  4QNK A;  2PO0 A;  4DV7 I;  5K36 E;  2JE6 A;  4LFC E;  4MU1 A;  2F4V E;  2PO2 A;  4X62 I;  2V8P A;  3GON A;  2J65 A;  4B3S E;  1OYP A;  2C39 A;  3HUL A;  4JI1 E;  4X64 I;  1Z0T A;  5EKW A;  5GMD A;  1Z5C A;  4X66 E;  1A6F A;  1Z0V A;  4PRX A;  2VQE E;  4B3R I;  5FLX Q;  1XMQ E;  4DV6 I;  2R42 A;  3WU6 A;  1IBL E;  1ZM2 A;  3Q6M A;  1FJG I;  1S4E A;  5FLX C;  2UXB I;  3K85 A;  2ZIT A;  5C0X B;  2PNM A;  2GS8 A;  4IFD D;  4IFD F;  4DUZ I;  2J7K A;  2F1D A;  2HK2 A;  2JEB A;  2HHH I;  2E5L E;  2LJP A;  4OO1 F;  1Z0G A;  4NXN I;  3P3E A;  1H72 C;  5LMN I;  4JI3 E;  4DV4 I;  2A2D A;  2V34 A;  4LPF A;  4YHH I;  1RHY A;  3L7Z A;  4JV5 I;  2HK3 A;  1N33 I;  1H74 A;  2UU9 I;  4FW4 A;  5IWA I;  2IER A;  3OTO I;  4IZK B;  3ZZT A;  4AM3 A;  4Z7Y A;  4IFD E;  4BA2 A;  3QT7 A;  4HAC B;  5LMU E;  4OO1 E;  4UT4 A;  1K47 A;  5C0X C;  4LFA E;  4JG4 A; 
#chains in the Genus database with same CATH homology
 5JEA E;  3CDI A;  2BA1 G;  5K36 D;  1E3P A;  5K36 F;  4AID A;  4IFD A;  4BA2 B;  4OO1 A;  2NN6 E;  1R6L A;  3GME A;  2BA0 G;  2NN6 C;  2WNR B;  2WP8 A;  3H1C A;  5JEA A;  2C37 A;  1OYS A;  5C0X E;  1UDO A;  3M85 G;  4IFD B;  4AIM A;  1UDQ A;  2NN6 A;  4OO1 B;  4NBQ A;  3CDJ A;  2WP8 B;  2C38 A;  3M7N D;  2PO0 A;  5JEA B;  5K36 E;  2C37 B;  2JE6 A;  3HKM A;  5K36 C;  2PO2 A;  2PO1 A;  4OO1 D;  5C0X A;  1UDN A;  1OYP A;  2C39 A;  4BA1 A;  2PNZ A;  5JEA D;  5JEA F;  1R6M A;  3DD6 A;  3U1K A;  2NN6 B;  5K36 A;  1UDS A;  2C38 B;  2PO0 B;  2BA0 D;  3GLL A;  2JE6 B;  2JEB B;  2PO2 B;  2PO1 B;  3M7N G;  5C0X B;  2C39 B;  4BA1 B;  4IFD D;  4IFD F;  2PNZ B;  2JEB A;  4OO1 F;  5C0X D;  5C0X F;  1E3H A;  5K36 B;  2BA1 D;  5JEA C;  2BR2 A;  3L7Z A;  2JEA B;  3B4T A;  2NN6 D;  2NN6 F;  1OYR A;  2JEA A;  4AM3 A;  3M85 D;  4IFD E;  4BA2 A;  4IFD C;  3GCM A;  3KRN A;  2BR2 B;  3L7Z B;  2WNR A;  4OO1 E;  4OO1 C;  5C0X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...