2JEBA

Structure of a 9-subunit archaeal exosome bound to mn ions
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
277
structure length
273
Chain Sequence
GHMSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPLAYETFEPGPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
total genus 81
structure length 273
sequence length 277
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2jebA01
1R6LA 3CDIA 4AIDA 5JEAE 5JEAD 4OO1F 2NN6F 1R6MA 5K36F 2JEAB 4AM3A 4OO1B 2JE6B 2NN6E 3M7NG 2BA0D 4OO1C 4OO1E 1E3HA 2PO0B 5K36A 1UDSA 2BA1G 1OYRA 2JEAA 1E3PA 2JEBA 2NN6A 3H1CA 2BA0G 3KRNA 1UDNA 2PO2B 5C0XD 4IFDD 4IFDA 5C0XC 5C0XA 1UDOA 2NN6C 3GMEA 3B4TA 2NN6D 2BA1D 2C37B 3HKMA 5K36D 2C38A 4IFDF 3GLLA 5JEAC 4BA2A 2PO0A 3L7ZB 5K36B 5C0XE 4IFDE 4IFDB 5C0XB 2WP8A 2PO1A 2JEBB 2BR2A 2C39A 2PO2A 5JEAF 4BA1A 1UDQA 3M85G 5JEAA 5C0XF 3GCMA 2PNZB 3L7ZA 3CDJA 2C37A 2C38B 2WNRA 4OO1A 4BA2B 4IFDC 2JE6A 4NBQA 3DD6A 4AIMA 4BA1B 1OYSA 5JEAB 2WP8B 2PO1B 2BR2B 4OO1D 2C39B 2PNZA 3M85D 5K36C 3M7ND 1OYPA 5K36E 2WNRB 3U1KA 2NN6B
chains in the Genus database with same CATH superfamily
1R6LA 3CDIA 4AIDA 3PS1A 5JEAE 1J5EI 5JEAD 1IBLI 4B3MI 5K36F 4JI5I 1ZM4A 2O1UA 4DV3E 3CWVA 1USVA 4DR1I 4QNKA 1XMQE 4JI6E 2NN6E 3PYDA 4HACA 4JI1E 2UU9E 4JI5E 2DEJA 1FWLA 4QNJA 4R1FA 4JG4A 3Q6NA 1E3HA 2Z5CB 1H7UA 5LL6R 5IT9C 3PYFA 2UXCI 2BA1G 1KKHA 2WW4A 4X64E 1OYRA 2JEAA 1E3PA 4DV7E 2JEBA 2NN6A 3D4JA 4U3BA 3JAMC 4DV2E 2XEXA 1PKPA 1N32E 1PVGA 2HK3A 2UUBI 4LF5E 1N33E 2HKEA 3OTOI 3PYGA 4JYAI 1XNRI 1MG7A 5C0XC 1UDOA 4FW6A 4DUZE 3GMEA 4LFCE 4DR6I 3B4TA 2NN6D 2R3VA 2NPFA 2HHHI 4DV0E 2BA1D 2O1WA 4K0KE 3P3EA 3ZKBA 2CGEA 3Q1QA 4X66E 4LF6E 4IFDF 5LMUE 5JEAC 1D6TA 4DPUA 5C0XE 5DROA 4IFDB 1H72C 4DU8A 4PRVA 2BR2A 2C39A 4U3DA 4DUYI 2PO2A 4KHPI 1FJGI 4DV4I 4DU7A 5JEAF 1Y4SA 4Z7YA 3K85A 5JEAA 1IBME 4B3RI 1RREA 4X62I 4DR2E 4DR3E 4OX9I 3P3CA 4YY3E 1NHJA 1Z5CA 4J3DA 2E5LE 4K0KI 2HHHE 2O1TA 2C37A 3CDJA 4USMA 4DR6E 2AJ4A 5GMDA 1RR9A 1H74A 4WUDA 4ISAA 1N33I 5DNXA 2CG9A 1HNXI 4JI7I 4DV2I 4DR5I 1B62A 4UT4A 1N36I 4OO1D 1MX0A 3M85D 3QT5A 1Z5AA 3WU4A 4FW9A 1OJ4A 3M7ND 4P7AA 4LFBE 4MYUA 4JI3E 5K36E 1ZXNA 1UEKA 3HULA 1NHHA 3ZZUA 4OO1F 4JI6I 1Y5YA 4RPFA 1B63A 2F1DA 4DPYA 2JEAB 4GKKE 4DR2I 3PYEA 2JE6B 2GO3A 4LF7I 4LCHA 1IBLE 3M7NG 3WU6A 1J5EE 1ZM9A 4DUYE 1FJGE 4LCFA 1YH8A 1NHIA 4OO1C 4OO1E 4FWGA 3HJCA 4GQUA 2VQFI 4DR7I 1HR0I 2VF3A 1USUA 3ZZ0A 4B3SE 4LF4I 5K36A 2HKJA 4IS9A 1UDSA 5LMUI 2UXBE 4LF6I 4DV6I 1FWKA 2BA0G 3KRNA 4MU0A 1MU5A 1XMOI 1N0UA 1K47A 5C0XA 2NN6C 4MDTA 4ED4A 1XNRE 2Z5BA 2UUBE 3QT7A 2E1RA 2C37B 1XNQI 1XHKA 2EFGA 5DNLA 4JI0I 4LOMA 2F4VE 1H7SA 2BV3A 3GLLA 4HY1A 2UXDI 2UXCE 2X7IA 2O1VA 4HXZA 4IZJD 2VQEI 4JI4I 1HNWE 2IERA 4JI2I 2Q2EB 3F0NA 4JI1I 4EMDA 1ELOA 4DV3I 4B3ME 2VESA 3L7ZA 4DV5I 4DXLA 1VI7A 4FWDA 5EKWA 3PRYA 2J7KA 5FLXQ 5DRPA 5LMNE 4IZKB 1XXEA 4LCGA 2JE6A 4WUCA 2ZM6E 2HFSA 4NBQA 3J81C 4PU9A 4AIMA 5IWAI 1Z0EA 3J7AM 2AE8A 1OYSA 3P76A 2BR2B 3H4LA 1Z5BA 5A2QC 2J65A 1KTVA 1U2RA 4LF8E 2WNRB 4DV1I 1HNZE 2GO4A 2PNLA 4AQYE 1HNWI 2A2DA 3QT8A 4AM3A 3T1YE 2ZITA 4NXNE 4JI0E 2UUAE 2BA0D 2V2VA 4B3TE 1IBKE 4URLA 4AQYI 2O3ZA 4JV5E 4UTGA 4GKJE 1HNZI 1KVKA 1VISA 4DR4E 4OZEA 4NXME 3LPSA 4OKGA 4HACB 2PO2B 4IFDD 5BR8E 1I94E 4IZJB 4IFDA 3T1HE 4LF4E 2Z5EA 2IESA 1H73A 1HR0E 3B82A 3WU3A 4LFAI 3HKMA 5LMNI 2LJPA 1ZXMA 2C38A 4IZKA 1BKNA 4LF7E 2PO0A 4DPWA 4X65E 5ELWA 1N34E 5C0XB 1S16A 3J80C 2GS8A 5EL9A 5DRQA 3ZKDA 5A2QQ 1FI4A 2HFUA 3K1JA 4X65I 1FNMA 1Z0CA 4BA1A 4JI2E 3M85G 2V2ZA 4FWHA 3J81Q 5C0XF 2IOPA 4YHHE 4JI8I 2Z5BB 3LNUA 1NZ0A 2F4VI 4LFAE 3ZZTA 3PS2A 3PS3A 1XNQE 2C38B 3B78A 2R42A 3B8HA 3T1HI 1A6FA 2IOQA 3Q6MA 4FW5A 1KIJA 4BA2B 1Z0VA 4IFDC 4USKA 3GONA 4BA1B 2BM1A 2WP8B 4WUBA 2PO1B 2PNMA 1XMOE 2HK2A 4DR4I 2Z5CA 2C39B 4YY3I 4OX9E 1P42A 4GKJI 4P52A 2X36A 4MQYA 2UXBI 1IBKI 3U1KA 4KHPE 3J7AG 1ZM3A 2NN6B 3UHMA 4B3SI 3ZM7A 4MU4A 4DR7E 4NXNI 2VQFE 2NN6F 1R6MA 4JI8E 4YHHI 1Y6ZA 1Z0BA 4OO1B 4FW3A 1PIEA 1WUUA 1Y60A 4GKKI 1S4EA 4IZJA 4N3OA 3U1YA 4XTJA 4LF8I 2PO0B 1N34I 4LFCI 1Y4UA 4JI3I 2ZBKB 4JYAE 4ZVIA 4LFBI 4LF5I 4DPTA 2JT2A 4FW4A 4PRXA 3H1CA 2DEIA 1UDNA 5C0XD 4I3HA 2V8PA 2ZM6I 4FN5A 1N36E 4X64I 2BM0A 2A2CA 3WU5A 4HYMA 4DR5E 1Z0WA 4JI7E 1HNXE 1YHCA 1QZRA 1I94I 4MU1A 5BR8I 4DV5E 5K36D 3NZKA 2UU9I 3V5RA 3JAMQ 4NXMI 3P06A 2E5LI 4BA2A 1XMQI 4DR1E 3L7ZB 5K36B 4DPXA 4DR3I 2CZ9A 4X62E 4IFDE 2OI2A 4JV5I 5IT9Q 1IBMI 4B3RE 2WP8A 4KQVA 2CVEA 2PO1A 2V34A 2JEBB 4DV4E 2VQEE 4JI4E 4B3TI 5DRRA 4Z7CA 2UUAI 2UXDE 1UDQA 3LTOA 3T1YI 4MU3A 3GCMA 4M1KA 1HK7A 1DARA 1EI1A 1ZM2A 2UUCI 4LF9I 2PNZB 1FKAE 3V2UC 1N0VC 1Z0TA 4X66I 2WNRA 3J80Q 4DV1E 4OO1A 1RHYA 4DV0I 2V2QA 3P3GA 1Z59A 3QT6A 3DD6A 2GQ0A 4DV6E 4DUZI 3K17A 5JEAB 1EA6A 3OTOE 5FWKA 2UUCE 4LF9E 1N32I 4MYTA 2PNZA 5IWAE 5K36C 4DV7I 4FW7A 3M6AA 1Z0GA 5GMEA 1OYPA 5FLXC 4LPFA 5L3JA
chains in the Genus database with same CATH topology
1R6LA 3CDIA 4AIDA 5JEAE 5JEAD 4OO1F 2NN6F 1R6MA 5K36F 2JEAB 4AM3A 4OO1B 2JE6B 2NN6E 3M7NG 2BA0D 4OO1C 4OO1E 1E3HA 2PO0B 5K36A 1UDSA 2BA1G 1OYRA 2JEAA 1E3PA 2JEBA 2NN6A 3H1CA 2BA0G 3KRNA 1UDNA 2PO2B 5C0XD 4IFDD 4IFDA 5C0XC 5C0XA 1UDOA 2NN6C 3GMEA 3B4TA 2NN6D 2BA1D 2C37B 3HKMA 5K36D 2C38A 4IFDF 3GLLA 5JEAC 4BA2A 2PO0A 3L7ZB 5K36B 5C0XE 4IFDE 4IFDB 5C0XB 2WP8A 2PO1A 2JEBB 2BR2A 2C39A 2PO2A 5JEAF 4BA1A 1UDQA 3M85G 5JEAA 5C0XF 3GCMA 2PNZB 3L7ZA 3CDJA 2C37A 2C38B 2WNRA 4OO1A 4BA2B 4IFDC 2JE6A 4NBQA 3DD6A 4AIMA 4BA1B 1OYSA 5JEAB 2WP8B 2PO1B 2BR2B 4OO1D 2C39B 2PNZA 3M85D 5K36C 3M7ND 1OYPA 5K36E 2WNRB 3U1KA 2NN6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6L A;  3CDI A;  4AID A;  5JEA E;  5JEA D;  4OO1 F;  2NN6 F;  1R6M A;  5K36 F;  2JEA B;  4AM3 A;  4OO1 B;  2JE6 B;  2NN6 E;  3M7N G;  2BA0 D;  4OO1 C;  4OO1 E;  1E3H A;  2PO0 B;  5K36 A;  1UDS A;  2BA1 G;  1OYR A;  2JEA A;  1E3P A;  2JEB A;  2NN6 A;  3H1C A;  2BA0 G;  3KRN A;  1UDN A;  2PO2 B;  5C0X D;  4IFD D;  4IFD A;  5C0X C;  5C0X A;  1UDO A;  2NN6 C;  3GME A;  3B4T A;  2NN6 D;  2BA1 D;  2C37 B;  3HKM A;  5K36 D;  2C38 A;  4IFD F;  3GLL A;  5JEA C;  4BA2 A;  2PO0 A;  3L7Z B;  5K36 B;  5C0X E;  4IFD E;  4IFD B;  5C0X B;  2WP8 A;  2PO1 A;  2JEB B;  2BR2 A;  2C39 A;  2PO2 A;  5JEA F;  4BA1 A;  1UDQ A;  3M85 G;  5JEA A;  5C0X F;  3GCM A;  2PNZ B;  3L7Z A;  3CDJ A;  2C37 A;  2C38 B;  2WNR A;  4OO1 A;  4BA2 B;  4IFD C;  2JE6 A;  4NBQ A;  3DD6 A;  4AIM A;  4BA1 B;  1OYS A;  5JEA B;  2WP8 B;  2PO1 B;  2BR2 B;  4OO1 D;  2C39 B;  2PNZ A;  3M85 D;  5K36 C;  3M7N D;  1OYP A;  5K36 E;  2WNR B;  3U1K A;  2NN6 B; 
#chains in the Genus database with same CATH topology
 1R6L A;  3CDI A;  4AID A;  3PS1 A;  5JEA E;  1J5E I;  5JEA D;  1IBL I;  4B3M I;  5K36 F;  4JI5 I;  1ZM4 A;  2O1U A;  4DV3 E;  3CWV A;  1USV A;  4DR1 I;  4QNK A;  1XMQ E;  4JI6 E;  2NN6 E;  3PYD A;  4HAC A;  4JI1 E;  2UU9 E;  4JI5 E;  2DEJ A;  1FWL A;  4QNJ A;  4R1F A;  4JG4 A;  3Q6N A;  1E3H A;  2Z5C B;  1H7U A;  5LL6 R;  5IT9 C;  3PYF A;  2UXC I;  2BA1 G;  1KKH A;  2WW4 A;  4X64 E;  1OYR A;  2JEA A;  1E3P A;  4DV7 E;  2JEB A;  2NN6 A;  3D4J A;  4U3B A;  3JAM C;  4DV2 E;  2XEX A;  1PKP A;  1N32 E;  1PVG A;  2HK3 A;  2UUB I;  4LF5 E;  1N33 E;  2HKE A;  3OTO I;  3PYG A;  4JYA I;  1XNR I;  1MG7 A;  5C0X C;  1UDO A;  4FW6 A;  4DUZ E;  3GME A;  4LFC E;  4DR6 I;  3B4T A;  2NN6 D;  2R3V A;  2NPF A;  2HHH I;  4DV0 E;  2BA1 D;  2O1W A;  4K0K E;  3P3E A;  3ZKB A;  2CGE A;  3Q1Q A;  4X66 E;  4LF6 E;  4IFD F;  5LMU E;  5JEA C;  1D6T A;  4DPU A;  5C0X E;  5DRO A;  4IFD B;  1H72 C;  4DU8 A;  4PRV A;  2BR2 A;  2C39 A;  4U3D A;  4DUY I;  2PO2 A;  4KHP I;  1FJG I;  4DV4 I;  4DU7 A;  5JEA F;  1Y4S A;  4Z7Y A;  3K85 A;  5JEA A;  1IBM E;  4B3R I;  1RRE A;  4X62 I;  4DR2 E;  4DR3 E;  4OX9 I;  3P3C A;  4YY3 E;  1NHJ A;  1Z5C A;  4J3D A;  2E5L E;  4K0K I;  2HHH E;  2O1T A;  2C37 A;  3CDJ A;  4USM A;  4DR6 E;  2AJ4 A;  5GMD A;  1RR9 A;  1H74 A;  4WUD A;  4ISA A;  1N33 I;  5DNX A;  2CG9 A;  1HNX I;  4JI7 I;  4DV2 I;  4DR5 I;  1B62 A;  4UT4 A;  1N36 I;  4OO1 D;  1MX0 A;  3M85 D;  3QT5 A;  1Z5A A;  3WU4 A;  4FW9 A;  1OJ4 A;  3M7N D;  4P7A A;  4LFB E;  4MYU A;  4JI3 E;  5K36 E;  1ZXN A;  1UEK A;  3HUL A;  1NHH A;  3ZZU A;  4OO1 F;  4JI6 I;  1Y5Y A;  4RPF A;  1B63 A;  2F1D A;  4DPY A;  2JEA B;  4GKK E;  4DR2 I;  3PYE A;  2JE6 B;  2GO3 A;  4LF7 I;  4LCH A;  1IBL E;  3M7N G;  3WU6 A;  1J5E E;  1ZM9 A;  4DUY E;  1FJG E;  4LCF A;  1YH8 A;  1NHI A;  4OO1 C;  4OO1 E;  4FWG A;  3HJC A;  4GQU A;  2VQF I;  4DR7 I;  1HR0 I;  2VF3 A;  1USU A;  3ZZ0 A;  4B3S E;  4LF4 I;  5K36 A;  2HKJ A;  4IS9 A;  1UDS A;  5LMU I;  2UXB E;  4LF6 I;  4DV6 I;  1FWK A;  2BA0 G;  3KRN A;  4MU0 A;  1MU5 A;  1XMO I;  1N0U A;  1K47 A;  5C0X A;  2NN6 C;  4MDT A;  4ED4 A;  1XNR E;  2Z5B A;  2UUB E;  3QT7 A;  2E1R A;  2C37 B;  1XNQ I;  1XHK A;  2EFG A;  5DNL A;  4JI0 I;  4LOM A;  2F4V E;  1H7S A;  2BV3 A;  3GLL A;  4HY1 A;  2UXD I;  2UXC E;  2X7I A;  2O1V A;  4HXZ A;  4IZJ D;  2VQE I;  4JI4 I;  1HNW E;  2IER A;  4JI2 I;  2Q2E B;  3F0N A;  4JI1 I;  4EMD A;  1ELO A;  4DV3 I;  4B3M E;  2VES A;  3L7Z A;  4DV5 I;  4DXL A;  1VI7 A;  4FWD A;  5EKW A;  3PRY A;  2J7K A;  5FLX Q;  5DRP A;  5LMN E;  4IZK B;  1XXE A;  4LCG A;  2JE6 A;  4WUC A;  2ZM6 E;  2HFS A;  4NBQ A;  3J81 C;  4PU9 A;  4AIM A;  5IWA I;  1Z0E A;  3J7A M;  2AE8 A;  1OYS A;  3P76 A;  2BR2 B;  3H4L A;  1Z5B A;  5A2Q C;  2J65 A;  1KTV A;  1U2R A;  4LF8 E;  2WNR B;  4DV1 I;  1HNZ E;  2GO4 A;  2PNL A;  4AQY E;  1HNW I;  2A2D A;  3QT8 A;  4AM3 A;  3T1Y E;  2ZIT A;  4NXN E;  4JI0 E;  2UUA E;  2BA0 D;  2V2V A;  4B3T E;  1IBK E;  4URL A;  4AQY I;  2O3Z A;  4JV5 E;  4UTG A;  4GKJ E;  1HNZ I;  1KVK A;  1VIS A;  4DR4 E;  4OZE A;  4NXM E;  3LPS A;  4OKG A;  4HAC B;  2PO2 B;  4IFD D;  5BR8 E;  1I94 E;  4IZJ B;  4IFD A;  3T1H E;  4LF4 E;  2Z5E A;  2IES A;  1H73 A;  1HR0 E;  3B82 A;  3WU3 A;  4LFA I;  3HKM A;  5LMN I;  2LJP A;  1ZXM A;  2C38 A;  4IZK A;  1BKN A;  4LF7 E;  2PO0 A;  4DPW A;  4X65 E;  5ELW A;  1N34 E;  5C0X B;  1S16 A;  3J80 C;  2GS8 A;  5EL9 A;  5DRQ A;  3ZKD A;  5A2Q Q;  1FI4 A;  2HFU A;  3K1J A;  4X65 I;  1FNM A;  1Z0C A;  4BA1 A;  4JI2 E;  3M85 G;  2V2Z A;  4FWH A;  3J81 Q;  5C0X F;  2IOP A;  4YHH E;  4JI8 I;  2Z5B B;  3LNU A;  1NZ0 A;  2F4V I;  4LFA E;  3ZZT A;  3PS2 A;  3PS3 A;  1XNQ E;  2C38 B;  3B78 A;  2R42 A;  3B8H A;  3T1H I;  1A6F A;  2IOQ A;  3Q6M A;  4FW5 A;  1KIJ A;  4BA2 B;  1Z0V A;  4IFD C;  4USK A;  3GON A;  4BA1 B;  2BM1 A;  2WP8 B;  4WUB A;  2PO1 B;  2PNM A;  1XMO E;  2HK2 A;  4DR4 I;  2Z5C A;  2C39 B;  4YY3 I;  4OX9 E;  1P42 A;  4GKJ I;  4P52 A;  2X36 A;  4MQY A;  2UXB I;  1IBK I;  3U1K A;  4KHP E;  3J7A G;  1ZM3 A;  2NN6 B;  3UHM A;  4B3S I;  3ZM7 A;  4MU4 A;  4DR7 E;  4NXN I;  2VQF E;  2NN6 F;  1R6M A;  4JI8 E;  4YHH I;  1Y6Z A;  1Z0B A;  4OO1 B;  4FW3 A;  1PIE A;  1WUU A;  1Y60 A;  4GKK I;  1S4E A;  4IZJ A;  4N3O A;  3U1Y A;  4XTJ A;  4LF8 I;  2PO0 B;  1N34 I;  4LFC I;  1Y4U A;  4JI3 I;  2ZBK B;  4JYA E;  4ZVI A;  4LFB I;  4LF5 I;  4DPT A;  2JT2 A;  4FW4 A;  4PRX A;  3H1C A;  2DEI A;  1UDN A;  5C0X D;  4I3H A;  2V8P A;  2ZM6 I;  4FN5 A;  1N36 E;  4X64 I;  2BM0 A;  2A2C A;  3WU5 A;  4HYM A;  4DR5 E;  1Z0W A;  4JI7 E;  1HNX E;  1YHC A;  1QZR A;  1I94 I;  4MU1 A;  5BR8 I;  4DV5 E;  5K36 D;  3NZK A;  2UU9 I;  3V5R A;  3JAM Q;  4NXM I;  3P06 A;  2E5L I;  4BA2 A;  1XMQ I;  4DR1 E;  3L7Z B;  5K36 B;  4DPX A;  4DR3 I;  2CZ9 A;  4X62 E;  4IFD E;  2OI2 A;  4JV5 I;  5IT9 Q;  1IBM I;  4B3R E;  2WP8 A;  4KQV A;  2CVE A;  2PO1 A;  2V34 A;  2JEB B;  4DV4 E;  2VQE E;  4JI4 E;  4B3T I;  5DRR A;  4Z7C A;  2UUA I;  2UXD E;  1UDQ A;  3LTO A;  3T1Y I;  4MU3 A;  3GCM A;  4M1K A;  1HK7 A;  1DAR A;  1EI1 A;  1ZM2 A;  2UUC I;  4LF9 I;  2PNZ B;  1FKA E;  3V2U C;  1N0V C;  1Z0T A;  4X66 I;  2WNR A;  3J80 Q;  4DV1 E;  4OO1 A;  1RHY A;  4DV0 I;  2V2Q A;  3P3G A;  1Z59 A;  3QT6 A;  3DD6 A;  2GQ0 A;  4DV6 E;  4DUZ I;  3K17 A;  5JEA B;  1EA6 A;  3OTO E;  5FWK A;  2UUC E;  4LF9 E;  1N32 I;  4MYT A;  2PNZ A;  5IWA E;  5K36 C;  4DV7 I;  4FW7 A;  3M6A A;  1Z0G A;  5GME A;  1OYP A;  5FLX C;  4LPF A;  5L3J A; 
#chains in the Genus database with same CATH homology
 1R6L A;  3CDI A;  4AID A;  5JEA E;  5JEA D;  4OO1 F;  2NN6 F;  1R6M A;  5K36 F;  2JEA B;  4AM3 A;  4OO1 B;  2JE6 B;  2NN6 E;  3M7N G;  2BA0 D;  4OO1 C;  4OO1 E;  1E3H A;  2PO0 B;  5K36 A;  1UDS A;  2BA1 G;  1OYR A;  2JEA A;  1E3P A;  2JEB A;  2NN6 A;  3H1C A;  2BA0 G;  3KRN A;  1UDN A;  2PO2 B;  5C0X D;  4IFD D;  4IFD A;  5C0X C;  5C0X A;  1UDO A;  2NN6 C;  3GME A;  3B4T A;  2NN6 D;  2BA1 D;  2C37 B;  3HKM A;  5K36 D;  2C38 A;  4IFD F;  3GLL A;  5JEA C;  4BA2 A;  2PO0 A;  3L7Z B;  5K36 B;  5C0X E;  4IFD E;  4IFD B;  5C0X B;  2WP8 A;  2PO1 A;  2JEB B;  2BR2 A;  2C39 A;  2PO2 A;  5JEA F;  4BA1 A;  1UDQ A;  3M85 G;  5JEA A;  5C0X F;  3GCM A;  2PNZ B;  3L7Z A;  3CDJ A;  2C37 A;  2C38 B;  2WNR A;  4OO1 A;  4BA2 B;  4IFD C;  2JE6 A;  4NBQ A;  3DD6 A;  4AIM A;  4BA1 B;  1OYS A;  5JEA B;  2WP8 B;  2PO1 B;  2BR2 B;  4OO1 D;  2C39 B;  2PNZ A;  3M85 D;  5K36 C;  3M7N D;  1OYP A;  5K36 E;  2WNR B;  3U1K A;  2NN6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...