1OJ4A

Ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
283
structure length
283
Chain Sequence
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of Isoprenoids: Crystal Structure of 4-Diphosphocytidyl-2C-Methyl-D-Erythritol Kinase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE
total genus 85
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2003-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1oj4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1oj4A01
5BR8I 4LFCI 4XTJA 4X65E 3CWVA 1HNWI 4LF9E 4YHHE 2LJPA 4JI2I 2UXCI 2UXBI 2E1RA 5L3JA 2UU9I 4DV4E 2R42A 1N36I 4GKJE 1Z0WA 5LMUI 4KQVA 4B3MI 4DU7A 4DPYA 4R1FA 4DR3I 4DR1I 4URLA 5LMNI 4JI8E 2UUBI 4K0KI 1XNRE 4DV1E 4DR7I 3F0NA 4YY3E 1HNZI 4DU8A 1Z0BA 1XNRI 4NXME 3T1YE 4M1KA 4JI4I 4GKKE 1FKAE 1XMOI 1B63A 4B3TI 1EI1A 4USMA 1VISA 1IBMI 2UXDE 1HR0I 3LPSA 3J7AM 3HULA 1ZM2A 5GMEA 1HNXE 5LMUE 1DARA 1UEKA 2UUCI 3J80Q 4DV6I 3OTOE 4DV3I 4YHHI 1N33I 2UXDI 1I94I 2A2DA 1IBME 5IT9Q 1HNWE 2R3VA 4X65I 1ELOA 5FLXQ 4DR4I 4B3SE 4X64E 4WUDA 2HK3A 2E5LI 3PYFA 1KKHA 4JI0E 4X66E 1N32E 4HACB 1HNZE 4LFAI 1ZM9A 4YY3I 2ZITA 2DEIA 4DXLA 2V8PA 4LF8E 1Z0CA 5IWAE 4LF5E 2AJ4A 2X36A 3B8HA 4FWGA 3J81C 3QT6A 4JI5E 4LF7I 1NHJA 1XHKA 4DR2E 4DR1E 4X66I 4K0KE 1FJGE 1BKNA 1NHIA 1Z0TA 2J7KA 1IBLE 2GS8A 4NXNI 1A6FA 2XEXA 4B3ME 5LL6R 1H7UA 4KHPE 4LF4E 4GKJI 1N36E 3ZM7A 1MU5A 1RREA 1D6TA 2HHHI 1MG7A 4X62E 4JI6I 1ZM4A 3J81Q 2UU9E 4DR5E 1XMQI 3WU5A 1B62A 2DEJA 4DPXA 4DPUA 1FJGI 3JAMC 4JI7E 3QT5A 4AQYI 1J5EE 1Z59A 4JV5I 4FWHA 4Z7YA 3T1YI 1ZXMA 4NXMI 4UTGA 4DV5E 2F4VI 1ZM3A 3ZZTA 2VQEI 2OI2A 5IT9C 2ZM6I 3Q1QA 3K1JA 2A2CA 4DV5I 2BM0A 2F4VE 3ZZUA 2CZ9A 4LFBE 4JI8I 1MX0A 5LMNE 4PRVA 3B82A 1EA6A 2ZBKB 1K47A 4LF6I 4DV6E 2UUCE 4DR5I 4HY1A 4OX9I 1FWKA 3D4JA 4LF4I 3K17A 1Z5BA 4USKA 4I3HA 2HHHE 1N0UA 4OX9E 1N0VC 1NZ0A 2X7IA 1H72C 4NXNE 1HNXI 2UXBE 4JI2E 4MYTA 1IBLI 1Z0GA 4FWDA 2EFGA 1S16A 2BV3A 1HR0E 2HFSA 4PU9A 5BR8E 4DV0E 4DR6E 1ZXNA 3V2UC 4GKKI 5IWAI 4LF8I 4EMDA 1PKPA 4DR2I 2Q2EB 2VQFI 2V2ZA 2ZM6E 1Z5AA 2VQEE 1S4EA 1Z0VA 3ZKBA 3ZZ0A 4DR4E 4DV0I 4DR6I 1J5EI 1N32I 4DV3E 3J80C 1N33E 4B3RI 2E5LE 3WU6A 3T1HE 4DUYI 4DPTA 5A2QC 1PIEA 5FLXC 3H4LA 4JI6E 4P52A 4X62I 3ZKDA 3QT7A 1I94E 4DV4I 4WUCA 4JI1I 2UXCE 3V5RA 3LNUA 4KHPI 3B78A 3QT8A 1OJ4A 2V34A 4DUYE 1XMOE 3T1HI 1U2RA 5GMDA 4JI4E 4DV7E 3PYGA 4B3RE 2HFUA 4WUBA 4LF7E 3GONA 4RPFA 2VQFE 3LTOA 1FWLA 1IBKE 4B3TE 4HACA 4JI3E 4DV2E 2HKEA 1Z5CA 4LF5I 2UUBE 4JI3I 4LFAE 3PYEA 4JV5E 4DR7E 3PYDA 4ED4A 3WU3A 1PVGA 4JI0I 4DR3E 4PRXA 4JYAE 2VF3A 1WUUA 4X64I 2HK2A 4MYUA 1XMQE 4HXZA 4HYMA 4JG4A 3J7AG 3OTOI 1XNQI 4JI1E 3WU4A 1FI4A 1KTVA 1NHHA 1XNQE 2HKJA 4LF6E 1KIJA 1H7SA 1H73A 5A2QQ 4Z7CA 4LFCE 2BM1A 2UUAE 1N34E 4JYAI 4ZVIA 4DUZE 4UT4A 4LF9I 2NPFA 4P7AA 4JI5I 2V2VA 4LFBI 3M6AA 2V2QA 4DV2I 1IBKI 4DV1I 3JAMQ 1KVKA 4AQYE 2WW4A 1FNMA 4JI7I 4FW9A 1QZRA 1RR9A 1Z0EA 4DUZI 4DPWA 1H74A 4FN5A 4DV7I 1N34I 2UUAI 4B3SI
chains in the Genus database with same CATH superfamily
5KFYA 2V50A 1HNVA 3L95X 1HARA 1TQLA 4WK1A 1U1KA 4Y2CA 2A3JA 1LWCA 5D0HA 4YR0A 3OJUA 3CJTA 3CWVA 3ITHB 3PR4A 4LFAF 1RBOB 3V6KA 1WC5A 1QAYA 2WBRA 3H5UA 2YX7A 3LO3A 2O1PA 5CZXA 1CC8A 1GK8A 4I2QA 1WNEA 2EXUA 5LXYA 4HH1A 4ISAA 2UXBI 5EWFA 2YQ1A 4LCGA 1RWXB 2EG1A 4IKAA 4I2QB 3BKFA 2JEAB 1LOUA 5ADZA 2J5AA 1T3OA 5JVHQ 1B99A 1R8BA 1SUQB 3EICA 3FEXB 4GKJE 3A3NB 5HJXA 2RJZA 3R5DA 2VFRA 1UKUA 3Q8UA 4M5GA 5DDQC 3EPIA 1Z0WA 1S97A 3ZZPA 3G8QA 3UNGC 1VRTA 1HNVB 1S4FA 2BX6A 2AT1B 2AEJA 3DRRB 3MUVP 3IXQA 2D9PA 3KLIB 2F8HA 2KFZA 3DU5A 2BABA 1KWMA 5LSRA 2OPSA 4DR5J 1ZTWA 2YKNB 2GAGC 2OFHX 3R1LA 4OZJA 1B4SA 1JMTA 1RT3A 2AJ2A 3MTKA 2FJDB 5L8RC 4CO1A 3AHPA 4CQ1A 4YUDA 3V6DB 4F25A 4JI7J 1U7LA 4DCJB 1WEZA 3MCOA 2GO4A 1N5YA 3FVYA 3GSIA 2VOPA 2PNLA 1T9VA 4NLYA 2FLLA 2OTJS 1GAOA 2FGOA 5JEAC 5LMNI 1R8PA 1NDLA 2DXEA 4DCOB 1HD1A 3MXHP 4FYVB 1R0CB 1RAOA 1NJWA 3MR6A 4MIWA 1LV5A 5D3GA 4QYZK 4K0KJ 2AW0A 2WHOA 2V63A 4OYPA 3IRWP 1U8WA 2LQJA 3AA8A 1MWZA 4ECSA 4DSKA 2VG5B 2RU3A 4K0KI 2JNJA 3O6QA 4F02A 3UW1A 2KDOA 3KLHB 1XK8A 2CQPA 4J9LA 1TP7A 3K58A 4YY3E 3C16A 1NPRA 4FYWB 4RX6A 3H5YA 1YK9A 1HNZI 2E9ZA 1YIJS 1IKXA 3SDEA 2CWXA 3CCVS 1DFDA 1H98A 1UPPA 4TYAA 2VICA 3R7NB 2FJWA 3U1MA 1WG1A 4CTAA 2R7WA 2EFNA 1S48A 1UCNA 1FKAE 1XMOI 2C2MB 5DDRC 1HBUA 2OPRB 1G2EA 1RTJA 1P42A 1RA7A 2DGSA 3V4IB 4B3TI 4X4VA 3R27A 1Z2LA 4M8LA 1RT5A 2RQMA 4OYOA 3CCRS 1PYOB 1RWPB 5ETPA 1EKRA 1FX2A 1HBOB 1KONA 1GFWB 1K44A 1NAQA 2RHQB 3A3OB 3KWMA 3NWGA 1YHQS 4CRJA 3LPSA 4AIDA 3WC2A 1WEYA 3CCLS 1U1RA 5KFNA 2BYCA 2GFFA 5CYMA 4L3KA 5JEAE 1WF0A 1ZM2A 4YHHJ 1BQMA 1QD1A 3O8WA 3QSYB 1FWPA 2RS2A 2O1VA 3TYTA 3OFHA 1JLEB 1UFWA 4Y00A 4WU3A 2BJ3A 1VK8A 2NN6A 1JLBA 2BZ2A 3J7YU 1FRXA 4LCHA 4OI6A 4TNOA 1X60A 5F3TA 5F8LA 5C0XE 3D68A 4HI1A 1SVDA 5GMKa 3CCUS 3GFHA 1REGX 4B9UA 1R89A 1FRMA 2V8VA 2WONB 2KH9A 3K59A 1XMOJ 2AYGA 2BACA 2IC3A 2W2NP 4KV8B 2DT9A 2YNGB 4I64A 2HNDB 1FKPB 1RHRB 2B51A 2YXLA 1F2HA 3IRXA 2IAJB 1ZPVA 4J9SA 4IFDC 1CJTB 1FDNA 1ULRA 2J8SA 2XMWA 2RKIA 1X4HA 4DL4A 1Q86T 4DV3I 1N33I 4DWIA 2YH0A 4FDFA 1U1LA 1BGXT 1F3VA 4HYKA 5IT9Q 2CQ1A 2R3VA 4DN9A 2IYGA 3A8EA 5K36B 1E3PA 3CCWA 4PPDA 4DR4I 4V1Ak 3IO1A 4R25A 4B9LA 1NB7A 1XR5A 1D3WA 2HK3A 2FUG9 3VV2B 1T8EA 4CO2A 1NSQA 3PO5A 4CCHA 3W62A 1NHUA 3F73A 1QM9A 1XMOF 4K8RA 1S0OA 2V9WA 4AL7A 2PNZB 1KKHA 2BJ9A 2ZHOA 3L09A 5K36F 4U7UK 4OHZA 1UDNA 5T7LA 1VIXA 4CLUA 2GVZA 3HJVA 2HHHF 3JSMB 2B0GA 2DCUB 4DFKA 5G0RB 1T0TV 2FC8A 3AJ1A 3BN4A 3NMRA 1FDBA 3IR7B 4DQSA 3GIMA 3D1QA 2Y1RI 4NLGA 3K5MA 3FMWA 1OYRA 3P3DA 2Q43A 3D6FB 4I1TA 1TVRA 1VQSA 3CCTA 4OX8A 1V3RA 1QDUB 3TP2A 4HDHA 5JEAF 2AGQA 1KOHA 1UTAA 4LF5E 2AJ4A 3THPA 1IBLF 1Q53A 3TARA 4DR6J 4K50A 1M1GA 2JVRA 3T5KA 2AE8A 2EC2A 1OSDA 4P75A 3B8HA 4FWGA 2HAIA 1N6QB 1IKWA 1VQ9S 4KQZA 2W2QP 1RAEB 4JI5E 3NXZA 1XHKA 2ZHAA 2DY1A 2YWHA 4CYUB 4X66I 3KG4A 6FDRA 1B0TA 2U1AA 4UOCA 4YEAA 1J5OA 2LKZA 2GJ2A 1N5TA 2WOMA 4PXBA 1BKNA 3LP0A 3DM2A 3OQ2A 3NS7B 4PXDA 4P2MA 3CDIA 2RSQA 1QVGR 4ALZA 1GX5A 1S9EA 5IWAF 5IC6B 1NZAA 2G1HA 2HVZA 4TLQA 4DSEA 2F4VF 1SC6A 4MFBB 2LXUA 2MY7A 2XEXA 3DGPB 1V3SA 3EWGA 3MEDA 3GIRA 5D4OA 2D3OR 5K8MA 4JI2I 3Q23A 4K4XA 4U7UD 4NCGA 4DDFA 2OPPB 4DR2J 4DSJA 4AFFA 1PAUB 4WE1B 2CZVC 4NPOA 2J0WA 3BYRA 3CGIA 2NN6D 1T9WA 2C3UA 4AD6A 5L1IA 4ELTA 1R6LA 1TZ0A 2V6AA 2BA1G 1YG0A 1KP6A 3HHLC 1RHJB 3M2RA 3MM8A 4F4KA 1D6TA 3BBCA 2W7OA 1B7YB 2XZTB 2V8DA 5GVQA 5J2PB 4JI6I 3SSRA 5GAGU 2BQUA 4NCBA 4IFDE 1J5EF 4KHPJ 4LFAI 3M30A 3QGGA 1KS2A 1HNXJ 1W7WA 3GSDA 1CSJA 4EI2A 4EBEA 4JI5J 3CJ3A 1XMQI 1Z1ZA 5F8IA 2D1CA 4OMFG 1U2CA 2MXYA 3IGVA 4CP5A 2DEJA 4ZIVA 2KXNB 4XPCA 2CIMA 2EKNA 2Z30B 3MF5A 2MKSA 3PM9A 4B3TF 4OZ3A 2QT7A 1IVZA 4DV7J 3OXFA 2NN6F 1AUSL 4L3NA 4Z37A 2MPUA 1FK9B 4RBTA 1J5EE 2R8GA 1Z59A 4OO1D 1KHVA 3NBPB 4QR2A 1U1NA 1FJ7A 2ZBIA 1V5VA 4FS2A 1BUXA 3R8YA 2HHUA 3M32B 2B8QA 4LF9E 3QRQA 4FWHA 4Z7YA 5FD1A 1VFJA 3L7PA 2C37A 2MTLA 5ETKA 1IKYB 4OV6A 4OJGA 5E41A 4ID5A 2MLXA 3T19A 2MQOA 3BSOA 4K4YA 4NXMI 1K73T 2IOQA 4OI4A 2CQBA 3QAEA 5DS7A 2MB0B 1RLCL 1HMVA 2OGUA 3I31A 5IFMA 4RBUA 1JLAB 2X1BA 2ZOFA 5HBMA 4IFDD 1XXEA 3Q86A 1M1HA 4GKJF 8ATCB 1S0NA 5J1EB 4NXNJ 3U27A 2IRXA 1WHXA 3K1JA 2IVYA 2A2CA 2BM0A 2JDJA 4F7VA 3PX4A 1R0AA 3K0JA 1FDDA 1RT6A 2CZ9A 2DHSA 4LRBA 1S1WB 3TEGA 1AYEA 5SUHA 4OFZA 1U1PA 4LJMA 3CF5Q 1U48A 1TKTB 2BW7A 2VQFJ 3PW0A 4FW7A 1X4CA 3GPAA 2DBBA 2UXBE 3K5PA 4PUOA 3G6YA 5IT9Y 1YX2A 2HAFA 5DZ7A 3TOQA 3AB2B 2XM3A 1YTYA 1HLWA 1EA6A 2NSCA 3HF5A 2YWWA 4DV3J 3TVKA 3MPWA 1K1QA 3C14B 3Q8YA 1F5CA 1TL3A 2W25A 2BKOA 3PRDA 4K2XA 4OI3A 3BKUA 1HHQA 4BDPA 3P6YC 1GMWA 5EX3A 2HS3A 3BREA 1IKVA 5KT4A 1UWBA 3ENWA 1HD0A 1W26A 2OPQB 1WG4A 1JJ2R 2NN6C 5C0XA 3GCWP 4DR5I 3N6MA 5ITHA 3M7ND 5THWA 4AQYF 1I6JA 4ECRA 3HKMA 1FWKA 4N3OA 4ZCIA 3S6EA 4LF4I 4LBPA 1W2IA 3WDOA 4HR2A 4ZN1A 1QSYA 2HHHE 4GC7A 1NZ0A 1Z5BA 3GFZA 4TY8A 5F0WA 1NNDA 1PBUA 2IJRA 2QG9B 3H90A 3GIIA 2UXCJ 4NXNE 3SQGB 5A2QU 1RTDA 3OXLA 1AZSA 4MYTA 2PO4A 3A4TA 4RW4B 2W2MP 3SIPB 5F9NA 4FWDA 4Q0BA 1IBLI 4Y6IA 2MKIA 4UY8T 2BEFA 2IHR1 4G6VB 4DUYF 1FD2A 3VTIA 3CCMS 1S59A 5KFCA 1CS4B 3EE3A 3ZXWA 2HWIA 1GNKA 4ANDA 4LF8J 4ZJLA 4LMZA 2GVDB 2HFSA 1HBNB 2GMJA 3HSZA 4QWBA 3MM6A 4ZK7M 4AL5A 5KFJA 1TL1B 2AIRB 1SQEA 2D7SA 3A1YG 4KKOB 4Y28C 2JVOA 4ES2A 1T9YA 2AGPA 1ZXNA 4DR6E 1YQHA 2PE8A 3QIPA 4PQUB 1RQ0A 2FVCA 2KXHA 2CXEA 3TX0A 4WKYA 3O2IA 3V2UC 3NLCA 3N6LA 2IBOA 4I4BA 4PKDB 3PKMA 2E66A 3HO1A 1KBRA 5JEAA 1JJCB 2UXCI 1WC6A 2W9AA 2G2YA 1SQGA 3ET6B 1PKPA 4DR2I 2PD1A 3P5TL 3I55S 2DNMA 4PWDA 4RNHA 3W5ZA 3WX4A 2RRNA 3GJSB 2VQFI 2YNHA 1AA1B 1SL1A 3MEKA 2YNFB 3PRVA 3PVXA 2LVWA 3IMQJ 3SFGA 4LF6F 3EDQB 1QY7A 2R7VA 1T9TA 4DV4F 4M5JA 4B9NA 1FE0A 4E0DA 3U1KA 1C4CA 3H42A 3ZZ0A 4MKAA 2QO3A 5HQLA 1FF2A 2OUGA 3ISZA 3W9JA 1FRJA 4WFXA 3VVUA 5AXMA 3D3BJ 2C38B 1VQPS 2DNHA 2IOPA 3RW7A 4LF4F 2KN4A 2B5JB 2EK6A 2HNZB 4USHA 1J5EI 2YNHB 3X1LB 3VHQA 5FLXY 2DXDA 4PWDB 5HMZA 4JI1J 3QPIA 4TU7A 3M9NB 5CXTA 2HHVA 5KFUA 3D1HA 2ZBCA 5DJBA 4HT7A 4KFBB 1VQ7S 3BPSP 5JEAB 1UEVA 2UZAA 2WNRB 2P8IA 3PHTA 1FJGF 1ZZFA 2PMWA 4DUYI 4ILMA 4IH5A 5KG0A 1HYSB 4JV0A 1A6LA 2UV8G 2HHXA 3Q6NA 3MM6B 3K5LA 4A8OA 1TK0A 4JI6E 2GVDA 4ED8A 3D1OA 1R8CA 2FGCA 2GQCA 2ZM6J 1N4LA 1HI0P 4DL3A 2NZ4A 2FZCB 1CS4A 2PFFB 5J2MA 1E3HA 2B8PA 2BRLA 2XWYA 2F8MA 1NPKA 1A0OB 4DV4I 4WUCA 2HRTA 4JI1I 4Q0BB 3TZZA 1JLQB 2A6MA 5GAEU 4XIUA 1AZSB 4RW4A 4QWAA 2VHGA 1RTDB 4E8UA 4DUTA 2VFUA 2GMLA 4XTTA 2ZHBA 4F0HA 4Q8EA 2VQFF 3SCKE 4UOFA 3BBBA 2HBRB 2DCLA 1Q8LA 1WC0A 5HQMA 3QBCA 1IQZA 3B78A 1HW8A 2MMYA 3QT8A 5LSLA 4A8SA 3N5BA 4FNHA 4RZRA 5EDWA 2MKKA 2HWHA 1NXIA 2DGOA 2DYAA 3TZYA 2DR7A 4ZPCA 2UUBJ 5C0XB 1U2RA 1UWBB 3BQ0A 5E3AA 2XCAA 1K8AT 1XNQF 1IKVB 1NKEA 4AM3A 2QTWA 3BGFA 1M5VC 1QLNA 2YPYA 3IBWA 2DNZA 4R0JA 3ICLA 2BR2A 1TL3B 2ZH8A 3GYNA 3M6WA 5KTQA 4JV5J 3RB0A 5DRKA 5LOQA 2VQFE 3JSBA 4I7FB 3UD4P 1IBKE 2HBYB 3K8WA 1DJ0A 1FRLA 2P9EA 3DYAB 3SMZA 4CLPA 4ECXA 4LF5I 1TKTA 4X4RA 3PFOA 1BWVA 2XMMA 5HROB 1S1WA 3AJ2A 1E6YA 1LWFA 1RT6B 4DR5F 2UUBE 4M5LA 1LW2B 2BOPA 5B0CA 3C8YA 3G87A 1RHKB 4H54A 4ZMMA 2FIUA 5DDPC 1WOOA 3TA0A 3BEGB 4LF9F 3PYEA 2Z5EA 2UU9J 4LFAE 2KJVA 5DZ6A 4DR7E 4DR1F 2C37B 2J9DE 3SI8A 1HMVB 2BE7D 4ED4A 4JI5F 2V8HA 4ECTA 3MEEB 5LXRA 1PVGA 3I96A 4NLDA 1JKHB 1HNXF 2E9TA 4PG6A 4ID5B 3PJWA 3ZZZA 3HJCA 4G1QB 4P71A 3DFEA 1FFGB 1CG2A 1NSAA 1Q8KA 1S6QA 2VF3A 2VFVA 3LGNA 3R5CA 4M5IA 3HFKA 2JZ5A 1WHWA 2HK2A 2XTJP 3NEKA 3HFVA 4OYXA 3M32A 4RLEA 5IOLA 2VIHA 3NRBA 4DZDA 2GHWA 4BS2A 3DXSX 3OTDA 3AB4B 2IDEA 4K4UA 3NBPA 4HXZA 4DOZA 3KLVA 4Y0FA 4KT0C 3QMQA 1FK9A 1WDTA 4DLEA 8RUCA 2HHWA 1USUA 1ZBTA 2ZBRA 1F2GA 4JG4A 4PWUA 4EWTA 2H3EB 3HVTA 2XI2A 2CJBA 2R9LA 3N9UC 2WSCC 3RUBL 1F5AA 1XNQI 3ILOA 4NMLA 4C3LA 5LM7E 4F4XA 3QQCD 4I69A 2E9RX 3TZXA 1XNQE 4C11B 3P06A 2H4WB 1Q8BA 3MEGA 1G4CA 2KM8B 1P9YA 1KIJA 4WFBQ 3T6JA 3E2EA 2DXFA 1H73A 3DOMA 1H7SA 5A2QQ 4CZCA 3O44A 3MM8B 4K4SA 3MPVA 4LFBJ 4GVLA 3FJ2A 1TV6A 3OJSA 4LF5F 3OD2A 1SIZA 4B9VA 2QMWA 2BANB 3GIJA 4J9NA 5ETQA 5DM7Q 3VWSA 3CULA 4JYAI 1X31C 5A6PA 4O0IA 5HQ8A 3PTWA 4UT4A 1OS5A 3QLHA 4ZLJA 4DR6F 1NJXA 2M52A 2OPPA 4YP3A 3PX6A 5F8HA 4HI2A 3ZZYA 5D6GA 3MR5A 3SQOP 2UVVA 1N48A 6FD1A 4P7AA 4MFBA 2VBYA 2NXCA 4ECQA 4MAKA 5KT5A 1NUEA 4GVBB 1CEZA 1KLMA 4EO8A 1RAHB 2VPYB 3M9MB 2JHEA 1WF1A 1F9HA 2DNQA 2HRYA 4ZVTB 4W90B 3C3LA 3M6AA 1GQEA 2GIQA 2WOMB 3FSXA 1ZS6A 2OEJA 3B6BA 5A6WA 2L9WA 4Q43A 1D9DA 4OHWA 2EWHA 2C3PA 2HNYA 2IM0A 3OW2R 5JJBA 2M5YA 2QYGA 1IBKI 2XSJB 4K7QA 4ZOSA 2FHJA 2IBKA 5KAKA 2YX1A 1IKWB 3EXYA 1KVKA 3JAMQ 3BSCA 3VF0B 4Q5VA 1A7GE 2WW4A 4KBIA 2ATLA 3OTEA 2KZZA 2QJ3A 1T05B 5HK4A 4DPOA 2WSFC 2C2NA 3DKDA 3PKYA 3W8GA 2WW8A 3NGSA 3G6XA 2PSZA 2UUAI 4Z2XA 1L5UA 1B0VA 1G6BA 4ELUA 2GMHA 3DLEA 4PWWA 5E0OA 4K0KF 4LFCI 2R8KA 3W7BA 1YRTA 2FJEB 3G9CA 3IC1A 5T7LB 1GMWD 2R2UA 3R1HA 2DNLA 3D0HE 5HMXA 3TAQA 4DL0C 4MK9A 4YY3F 2PNZA 1EQ0A 3MM9B 3M8ZA 3DOLA 1OPIA 2RU9A 5I42A 2E1RA 1CQNA 2POKA 3OL8A 2PNMA 1R8AA 3A12A 4DV1J 1D8YA 3VZIA 2IRYA 5HVGA 1TAUA 1YH8A 3JQJA 4DV4E 2CQGA 2P2CB 3SSQA 2UVUA 5K36A 2GHVC 5B0EA 4NLQA 4OYBA 2ZKTA 4W4MA 3DLBA 4C97A 4LF9J 1CJTA 2E7XA 2MZQA 4FVCA 4WYLA 3NL0A 3U7JA 1RWOB 3ZTSA 2Y0BB 1FKPA 2HNDA 2YNGA 3I32A 4KY3A 4KV8A 4R1FA 2OLWA 2YQ3A 1AROP 4DR3I 1UMJA 1IM4A 2XHWA 3RTVA 3TO8A 5AJ3J 1HW9A 3FGVA 2AKWB 3OHAA 2M2BA 4QW9A 1EB0A 1Y5IB 2JOQA 3W66A 2XC9A 1SIWB 2EI5A 3BBFA 1S0MA 3RR8A 2B9EA 1NU4A 3CIZA 2K7JA 4ZVRB 2NN6B 1U0HA 1S1TA 1JLEA 2W4PA 2VUGA 1X5SA 3HHLD 3JTNA 4JI7F 4RNMA 3HDSA 1QAXA 5HO4A 5A2QY 3SV3A 3GZ7A 3VGTA 3HZGA 5HP1A 2EW9A 1P27B 1RWMB 2ZDOA 3CD5A 1YLXA 1M0SA 1RHQB 1U0SA 2GO9A 4DR1J 1ZZNA 3DU6A 4LFCF 1OQ6A 5ETTA 4MMOA 4DV1E 5CD4H 2VODA 3M6XA 3V4IA 1VJWA 4DU8A 2OPRA 2JL9A 2XBPA 4UQTA 3T5JA 1F60B 2ZBPA 4C3KA 1ZA2B 2MGZB 2XLJA 1YRUA 4K4ZA 2V69A 1KVJA 2CG9A 2M7SA 1WC1A 2Q3PA 2ZUGA 4M1KA 4TY9A 1E6VB 4PR6A 5CYJA 1VBXA 4JI4I 4GKKE 2WSEC 1YZ6A 1IKXB 1ACMB 1IR0A 3CVKA 4Q2MA 2LECA 1B63A 2BA0G 5E3QA 1BWEA 4U67Q 4Q8FA 1EI1A 4J7CA 4CI0B 1VISA 4B3MF 2MSTA 3C6TA 2VC1A 1DURA 2ABYA 1LEOA 4ID8A 4RUAA 4UZBA 3KLHA 3MR2A 5JVGQ 4IO1A 4EUVA 5KFIA 5HN0A 3MMAB 3HULA 3OV7A 2XHCA 4CO5A 1D9AA 2I0XA 5I3UB 4DR3F 5L46A 3LP2B 3T1YF 2CNLB 3SXLA 4TQRA 1JWWA 1UVKA 3SSSA 3BGUA 3Q8VA 2ADBA 1FRIA 2VBXA 1LFPA 2A10A 2KB2A 4Q2LA 1RWWB 3KJVB 2VQEF 4DFPA 1N5YB 4B3OB 2YTCA 5LMUE 1BMQB 1EX8A 3OR2B 5E33A 5EWEA 1DARA 4K59A 4OIXA 2LQ9A 2B4VA 3FK4A 2VQEJ 2OPSB 5HVFA 3D67A 2MQMA 2AD9A 4DJBA 3T1HJ 2PA8D 2G0IA 2VG7A 3DRRA 4USJC 4DV2F 2XB2D 3R2CJ 5CQGA 1VRTB 2E7WA 4A47A 3MOJB 4LCFA 2WTFA 2XZDB 1SC4B 3IWXA 3HX9A 1F9FA 4B9MA 1RI7A 4V19J 1M90T 4AT1B 3FDSA 5BJRA 1SUQA 3H2VE 3BF4A 4FNIA 3HM9A 1FTRA 3MPDA 2Q6CA 5BYQA 2XY6A 5FLXQ 2VL1A 3D66A 3KTQA 3RG6A 4WUDA 4X64E 4B3SE 2JEAA 5EL9A 4C7QA 4U6PA 3NAIA 4KSEB 2DGWA 1MMDA 1X5OA 2YKMA 5DLGA 2AJ0A 4JI4F 4F0MA 4KE5A 3CMES 1S0VA 1Y00A 5AJ3F 1GH8A 3NOGA 2EG2A 2LP4A 1WWHA 2RRBA 3ITHA 3IWLA 4HACB 2CNKB 1LWCB 1H6KX 2P5VA 2PFDA 1HNZE 1RTIB 4KGZB 2UUTA 5C42B 5KFPA 4ECWA 1DTTA 4YY3I 3LPYA 1FFSB 1HIYA 3CDEA 4ED3A 2F9DA 3CD0A 2JEJA 4F4WA 3NS6A 2ZNZA 4IO9Q 2V8PA 1DLOA 2HZAA 1HWIA 1XMQF 3OL9A 3GLLA 3R5GA 1F0XA 4CNZA 3I0RB 2LQ5A 4KO0B 3ULHA 4EFAC 3HP6A 2AQ4A 4LF6J 4ZN3A 2ZD1A 3DGVA 3JTOA 3LOUA 2BKPA 2C3YA 2QX0A 3VCDA 2XG8A 4P10A 3CMAS 1VQKS 1BXNA 3RAQA 3OVBA 2OEMA 5C25B 5C0XF 3P3EA 2A0FB 3J81C 3IS9B 3EMTA 3DCAA 1VK3A 4RNFA 4MH8A 2C39A 1V6HA 2CAJA 3KUGA 4Y2KA 4TU8A 2QGFB 4WTYA 3H25A 2ZZMA 3PRYA 5B09A 2E44A 3OR1A 3G96A 4JI2E 1YJWS 5KT3A 2J7KA 1K0TA 4LBHA 3FSYA 1QE1A 3UR3C 3W63A 4B3SJ 2GS8A 3CJSA 3DD6A 2A1BA 3BGRA 1TKXB 1SL2A 3FQKA 5K8NA 5F41A 4LF8F 3NMAA 2K7KA 4QYZJ 2P9CA 3KLEA 1K1SA 2RNEA 1WC3A 3Q24A 2J6UA 4OKGA 1S1UA 1IWGA 1ZAXA 4AL6A 4OJ3A 4ECYA 1Y0HA 4GKJI 4ZP6A 3Q2TC 1JXEA 5HLFB 1FKAF 2UUCJ 4FYDA 1VC0A 4A8XA 2CJKA 4ERDA 4EBCA 2R7OA 1RREA 2ALYB 2PO1A 3RJMB 2YKAA 3UN3A 2KT2A 1TL7A 5L9NA 3MCSA 4K2JA 3BPDA 2APOA 4KGXB 4ZVFA 3W5YA 5KT2A 1JLFB 3C6UB 2FLNA 3KLGA 1WG5A 3P5BP 1M5KC 4NLXA 1BHNA 2H5EA 5F0UA 4BHQA 4X62E 3AXKA 1EETB 4M5MA 1M1KT 2J9DA 4YFUA 1NK9A 2NUUG 5HJYA 3LH2S 4B9TA 1RWUA 1OY6A 2WVEA 5I3PA 4FYXB 2DKOB 2N7YA 1T9UA 2BXJA 3WU5A 4H4MA 5J2NB 1NJZA 3M2UA 4P2FA 3UCGA 5C2CA 2LMIA 5D8HB 1S6PA 4OO1C 1YJVA 2AMCB 4DPUA 2Z2MA 4XDDA 1BQNA 2Y3YA 3RB6A 3CJ0A 1C0UA 4LSLB 2BVZA 2W9BA 1RISA 1UPMB 3QT5A 1DBDA 2EBEA 3KDNA 4AYBD 5H9FK 2WP8B 4AQYI 1VYAA 1RT2B 1Y4ZB 2Z2LA 4EK2A 2MYFA 2QLFB 1RHUB 3KRNA 4RWXA 4ILLA 2PO0A 2DISA 2QL5B 2V9KA 3MM7B 2QLBB 3DRPB 1UDQA 3ZC4A 4MU4A 4EBDA 4KH0B 3RYLA 3F56A 1URNA 2F3JA 2H1YA 2X1GA 1SI9A 2AEFA 3T1YI 1H2TZ 1ZXMA 4FXWA 4NXNF 4AUKA 4IG0A 3FSIA 3MZIA 1KLNA 3ZZTA 3ZNJ1 1CQMA 1CULA 5J2QB 2OI2A 5HVHA 1U1OA 3KNGA 2J0QD 4NI2B 4LF8E 4ZVOB 1S99A 2I1RA 3OFFA 4NYPA 1ZYQA 4F8RA 4KHPF 1H3DA 1VRQC 2KXFA 1RABB 4F26A 4IZKA 2LFVA 3ZTRA 1PJ6A 3VR1A 4OHXA 5K8OA 2IY5B 4E98A 3OLBA 4JI8I 1S5ZA 4DEZA 4B3OA 4GKKF 1MX0A 3RGIA 4PRVA 1XQIA 3M8PB 1T03A 5BYSA 3BB5A 2VONA 3AD8C 2BW2A 1Q7LB 2DO0A 4N56A 4DR2F 2AJQA 2B4OA 2F7VA 1N5QA 3OVAA 4NLVA 3K2YA 4F04B 2V4JB 4Y2MA 2CQ4A 3BDPA 4ZP7A 2XY5A 2BA0D 2ZBKB 2KM8C 3OUYA 3L3CA 2J0SD 1MROB 2F4VJ 1LFWA 3NKYA 4C6AA 2RDJA 1G7CB 4X2BA 4LF6I 1SJRA 1NEEA 2EC0A 3CDBA 4CH1A 3PW7A 1PILA 2W24A 2HPUA 4CO3A 5CYQA 3CPWR 3TQ1A 3KDOA 3MD1A 5M2RA 4DF4A 4HY1A 5AE2A 4PAAA 5DQIA 5GAEI 3D4JA 3MFHA 2MZJA 2GQQA 5IT4A 4LRCA 4ED1A 3DLGB 2ZZNA 2ZZTA 3H59A 1N0UA 5KFHA 2J7WA 2ILZA 4OX9E 1REVB 2VKZG 4DX7A 5EN1A 1RT4A 3T5LA 3ISNC 4MU3A 4RNNA 1CJVA 3D54A 3DRSB 3OFEA 1PO6A 5DM6Q 2I2YA 4FW4A 4DG1B 1SBRA 2AYMA 4QIFA 5KFMA 2E7VA 3JYTB 4ZS6A 1RT1A 2IA0A 5H1SV 5K20B 1S16A 1JLCB 2CYYA 1S1XA 2RS8A 2UV8A 3GP9A 3NCPA 4HT5A 1F1BB 1T95A 2BKNA 2YNIB 3MAHA 4JI3J 3CDJA 8AT1B 5KFOA 1APSA 4L76A 5SZTA 4FW5A 2GO3A 3FCWA 1XNRI 2ZOGA 3I87A 5C2GA 1Y3JA 4JI8F 2KFYA 1DTQB 5IM0B 3V6JA 4A8MP 4A8KA 3H2LA 5IWAI 2W01A 4CLYA 3NWRA 1FO1A 1P8GA 1WEXA 2DH7A 3N0VA 4YDDB 1LWXA 2RD5C 3J81U 3EDRB 3BYPA 5KFRA 2MKCA 3Q83A 1HHTP 4IOCQ 1B70B 1QTNB 2FJAB 1FT8A 1UL3A 2XULA 3QFWA 3DLJA 5HANA 3THTA 2HQGA 4CLSA 4YMEA 4FF1A 3QFHA 4RU9A 4M5HA 4B08A 5F8MA 3ZKBA 3L7OA 4EYHB 1RTHA 4OZ0A 5KG7A 1FESA 4RW6B 4F50A 2BJDA 3MAAB 1RCOB 3QO9B 4LUBA 3FKBA 1UJ5A 4DSFA 2V2KA 4U7CA 2LEPA 2WRMA 4DV0I 1R6VA 2NR0A 5KOXA 1PJ7A 2DNRA 2KG1A 1R27B 1TK8A 3I0SA 2BJEA 3IAS9 1BQXA 2EK1A 4O3RA 1UVJA 1N32I 3CT9A 4K4WA 4P73A 1TL5A 1F3FA 1CJUB 2WK4A 2E5LE 3QGIA 2GJFA 1WC4A 3TEHB 1U1MA 5MLCV 2XGPA 3J7ZT 4DI6A 1H7XA 3W65A 5C24A 2W9CA 1R43A 1UJ4A 3SCIE 2LXFA 3PACA 4DPTA 3VAMA 4RW7A 4N8NA 3GLJA 1PIEA 3UDCA 5FDLA 5FLXC 1HNIB 3I5BA 1EP4A 4ZDNA 4P52A 1SJQA 5A8RB 3QT7A 1I94E 3HVAA 4DV2J 1T9XA 3UN2A 4GO7X 4TN2A 2W7PA 1W2BR 2HHHJ 4M5KA 3ONQA 4Q44A 4R8UB 2DRAA 2NYIA 1BD6A 3BV8A 3ETOA 3IR6B 3JTPA 1RYRA 4IFDA 1XTZA 2YWKA 2VA3A 2OO4A 3M8YA 1P9QC 1RT7B 1O51A 3LNUA 2BA1D 1RDRA 2CQ3A 4KHPI 1HQ2A 2J6TA 2JRSA 3PO4A 2DPIA 5DG8A 1SPBP 2BUNA 2GC8A 2KO1A 3E01B 4USVA 4ICLB 3TVZA 4OHYA 4W98A 2JEIA 1UVMA 1IJEB 2KRRA 4O4RA 3P45B 4H4OA 3US5A 3QZ8A 2EPIA 3PY8A 4DUYE 3HKZD 2M9KA 2I9SA 2NS1B 3QWUA 4IFYB 4JI4E 2QA2A 5HAOA 4QIWD 4LF5J 4PG8A 1S9FA 3QJLA 4KPYA 4URSA 4WUBA 4RUBA 4OV1A 4EEYA 5FWKA 1SJ1A 2FD2A 4CLWA 1FXDA 4F3OA 3M1VA 1KRPA 4MK8A 1V5IB 2B56A 4LSNA 1FWLA 3OSNA 3CCJS 2K2PA 5DNXA 4WP3A 3GYGA 2JEBA 2HWTA 4BA2B 4IG3A 3C66A 4ZJQA 4DV2E 2EKYA 2HKEA 2XYGB 3H0PA 2MQLA 4EO6A 5MAOA 5HL7Q 4FS1A 2RT3A 2VJUA 3ZTPA 2QEXS 3R6GB 2RUSA 1YJ9S 3CIMA 4JYAF 1KFSA 3TI0A 3BGOP 6AT1B 4OYMA 2KG0A 3MM5A 5ETNA 3MECB 5KFZA 2KI2A 3QRPA 4UZCA 4JV5E 2HMIA 3MMBB 2GIRA 4ZHRB 5HATA 1S1VB 1S9GB 5B0DA 4U8YA 4C8LA 2F1FA 3CCQS 4DSLA 3FRYA 4DR3E 1AXQA 1HBMA 3MWBA 1RU1A 3SFUA 4NX9A 1WUUA 2VDHA 3IR5B 2K1RA 4RW8A 1SKUB 2JH3A 1Q8IA 2DNYA 2V0NA 3GU0A 3UE2A 4C98A 2UUBF 1KQGB 5CCMA 4X4PA 2VG6B 3GJTB 3DLKB 1MWQA 1LW0A 1HI1A 3FBBA 2ZOMA 5L39A 5HI7A 1GX6A 3D5MA 1HPZA 1RTZA 2MLYA 1SV5B 2H48B 2R8HA 3B4DA 5FLXU 3JQKA 1Q0NA 2VPZB 2JLFA 2SXLA 1IM6A 5KT7A 2M8DB 3QGPA 1WF2A 4BWJA 1EJ7L 3HHLA 1RKIA 1OSCA 3TUZC 1GMVA 2C42A 3FEZA 5LJ5Y 3AFGA 2PDAA 1C1BA 5EUHA 1MN7A 3CMQA 2DR9A 2RE1A 1VI7A 1OIAA 3G8TA 3EGNA 1TUVA 2DNGA 2HSEB 4KB7A 5D77A 1L3UA 2XMAA 3DLLQ 4DUZI 4DQQA 4GC6A 4Z7CA 5CHCB 4LFCE 2IMWP 1SJ4P 3D0GE 2BM1A 3PRBA 1MNEA 3E3XA 4M5DB 1U25A 4NMXA 4YY3J 2UUAE 3AY0A 4O3SA 1UDOA 4IZJA 4ZVIA 2HQDA 4ZLNA 3ENAA 3ILJA 1XNQJ 4WKRA 3BH7B 3UCZP 1SCJB 2EFQA 2NUHA 2XNQA 4F3QA 5A0YA 1GT8A 3DI6A 1CJKA 1Z4UA 3H40A 1FVSA 3OBIA 2OD4A 3T9ZA 3D6TB 3KG1A 3A8JA 4NEZA 4JI0F 5FJ4A 1JLGA 4P9SA 2NXJA 2QA1A 3JS9A 1HHSA 4WF9Q 1L3VA 4YOEA 1LNQA 4P7VA 1KQFB 1WOSA 2AWZA 4R0EA 3W2WB 2E5IA 5K14B 3JB9k 1S76D 2RF2B 3W2VB 5DO2A 3Q1QA 1GEHA 2VFSA 3AOAA 3HSJA 3PS1A 4ZP9A 3P49B 1KNZA 1IN0A 2YVSA 3VVTA 3POTB 3CB4A 5BR8E 2KVQE 3DHWC 4HTJA 3CCZA 4WBFA 3FFIB 1TKZB 1NK7A 2UXDF 2ACYA 1RHMB 5JXSA 3VGUA 9RUBA 1DQ9A 1FEHA 3KLFB 2HQFA 4MIAA 2JE6A 4JI2J 1J27A 1FNMA 1N52B 3CJ8A 3NGRA 3D6MB 4ZJOA 5DGAA 1U1QA 4JI7I 3EVWA 1QZRA 1RR9A 1HQUB 2N4DA 4DV7I 2C2DA 3DDKA 4EGLA 4RWWA 1I94J 4B3TJ 1B64A 4O44A 2Z5CB 2R2TA 3UHMA 2KYZA 2MHEA 1YSJA 2K8GA 3FCVA 2XMKA 3HHNB 5F8GA 3KYLA 1RADB 1SXLA 1ITPA 4R5PB 4QBUA 2DGQA 2GCFA 2HGMA 3L7ZA 1HK7A 4X65E 2EBGA 2MLZA 3UI3A 1HNWI 3FMBA 2MQ8A 2YWEA 4MJKA 1HQEB 1S12A 2ZH4A 4YHHE 2XS5A 1XNRF 1FERA 1NHVA 3TAMB 3V6HA 4NZ6A 4P2SA 3K7RA 2GQ2A 2LDYA 4G1IA 4BA1B 1O5JA 4I6AA 5E3RA 3GQCA 3FBCA 4BCAA 5LMNJ 2Q79A 1JNZB 3TAMA 1XN9A 4CO4A 2R42A 4PG7A 1FRKA 1VBZA 3PW2A 3DLHA 1HNWJ 2BRKA 5L1JA 3BJYA 4AXIA 4ITSA 5E2QA 2OELA 1TMMA 4ZKAA 4R5PA 4ED2A 4KQVA 1U6ZA 4B3MI 2PN6A 1LXNA 1NB2A 4J9VA 3V81A 4DU7A 2ASJA 3K85A 4DPYA 1NSKL 3ZKDA 5DNLA 1QUPA 2WB4A 5D4PA 1RE1B 2CQHA 2V4RA 2Z5CA 4MDTA 2DR6A 1G3OA 3TA1A 2CQDA 3UDVA 5CAAA 1N36J 4LPFA 5CZVA 3PW5A 5A8KB 3M8QA 4DV4J 4DR1I 2JE6B 1UP1A 3KLFA 1Q95G 3LW5C 1NDKA 2CQIA 2FTRA 2PGCA 3GCMA 1TKZA 3PEJA 3OXGA 4P2XA 4URLA 4X65J 4NXMJ 3MMCA 4N47A 3S01A 4ZLLA 4JI8E 3TA2A 1NJIT 1BC6A 2UUBI 1HWJA 2CG8A 1LK7A 5K14A 2PC6A 3W2WA 4D3GA 4QWCA 1EIYB 5BR8F 1M5PC 2HQIA 2ZH5A 1NKCA 1Q81T 1VOMA 2ZE2A 4G65A 2X1AA 1XNRE 4DX6A 1GXLA 3F0NA 4WIIA 2E29A 1WI6A 2EVZA 1KFDA 3T41A 4DUZJ 4RKUC 1I5OB 1PC5A 2CPHA 1NDCA 2IFXA 2QE5A 2VFTA 2X3GA 1NLKL 3BM7A 2B3TB 3I5AA 3MHYA 3THVA 4ZVUB 4J91A 3OTOJ 1GTEA 3T1YE 3CC4S 3R5JB 1I3OB 1NSPA 9ATCB 3EUNA 1LWEB 2WCXA 1X0PA 2Z0GA 2DITA 4HVZA 5DQGA 1X9WA 3C46A 3HD1A 1N36F 2E5LF 2F4FA 4ZPTR 1R6MA 4ED5A 3DMJA 1N5SA 2GX8A 2K3IA 2CPEA 2G1DA 3JSRA 3EZOA 4USMA 3UD3P 4QWDA 1NMEB 3A13A 1OY9A 4NEYA 1IBMI 3CTRA 2UXDE 1WKKA 2HS0A 4DLGA 5DG7A 1RAIB 1N33J 5F3ZA 4JI0J 1YBUA 4F4YA 1VQ5S 2LQ8A 4Y2IA 1U49A 1MWYA 2R7QA 3IG1A 5AXLA 2ZJPQ 1S6UA 1MU2B 5IZHA 1HNXE 5HSPA 1PJ5A 3VGVA 2O1UA 4S0MA 3UCUP 5M2PA 1JXLA 2WB1D 1SV5A 3OT9A 1IBMJ 5KFKA 1GXUA 1HPZB 5T14A 3LAKA 2Z8QA 1UZDA 2R2RA 4FW6A 4Y65A 4CM0A 1YBAA 2Z2ZA 2N4CA 3MI7X 3C15B 1X4AA 3DOKA 1QSSA 3CC7S 4DQPA 4USTA 5C7PA 2K1RB 4RW8B 1VQ6S 2UUCI 2BJ1A 3CSKA 3H2UB 5JUMA 1V9OA 1YRXA 4P74A 3T1YJ 3OTOE 3VAFA 4I6YA 1SB6A 4CO0A 2MZ1A 4ER8A 2ZH3A 1IBKF 3H5XA 1KHWA 4B02A 4YHHI 1I94I 2A2DA 1UFLA 1RUSA 4HHJA 1HNWE 1Y9OA 3DC2A 3MMBA 2H4YB 4QIEA 3SEOA 2CG4A 3KK2A 3GV7B 3MECA 1IBKJ 3UR0A 2HMIB 4MKYA 1JB0C 1U6BA 5D4NA 2XY7A 3HLUA 1PCAA 4DV7F 1XWLA 4PYAA 4A4JA 2CJAA 2RQCA 4MQYA 4O3PA 4ED7A 2JJ4D 1SL0A 3IWNC 4KJIA 2NCKL 4O23A 3PYFA 4ZVEA 4RUHA 4QWEA 3LWMA 2E5LI 4JI0E 4PYDA 1Y4SA 3IM9A 1N32E 5U47A 2R7UA 4FPIA 3EZ5A 4BA2A 1VGYA 1VLYA 2G13A 3TVYA 4JP8A 1PBAA 3GJRB 1VR6A 3GFXA 1NH8A 4URGA 2YH1A 3NGUA 4YN3B 1ZM9A 1IBMF 3GILA 4A8FA 3HHKA 4DN0A 5C5JA 3ZTQA 4DL5A 2ZITA 2BQ3A 2FVPA 2RQ4A 4X64J 5AE1A 1RAGB 2LXIA 3ENQA 2GJIA 4DXLA 2DY9A 2LU2A 3EPGA 3VAHA 4WFAQ 3PZPA 2JC1A 5KG2A 3KK1A 1QSLA 4PRFA 4LQ3A 2QRRA 1DQAA 2MEWA 4QR0A 4IUFA 1U09A 2W2PP 4DV0J 1VQNS 4B3RJ 3LA0A 3JXOA 4C9DA 2CZ4A 4JV2A 1YJ7A 1UA0A 2BA9A 3AH6A 4B3MJ 3ISND 4A46A 3TUJC 3Q6MA 2C3MA 4LF7I 1NHJA 1RBLA 2ZH9A 1EARA 4NYOA 1WDDA 4KH1B 4K0KE 2PO2A 1RT7A 1FJGE 1UVNA 4X84A 2F8EX 3AT1B 4JUZA 3MUTP 2R7SA 2PIIA 4H4KA 2KFNA 1NHIA 1Y5YA 5K9FA 4OYWA 1Z0TA 3CJ4A 2HG4A 1IBLE 3OTBA 3CNQP 1TR0A 4IFVA 2W2OP 4NA3A 3EGWB 3T1AA 4NXNI 1A6FA 3G82A 4FYYB 4UY85 4IR9A 5EWGA 4L75A 4PG5A 5LL6R 2BDPA 1H7UA 3GR1A 1TFYA 1EP4B 5A8RA 1RKJA 1XJWB 4LF4E 3EVMA 2HQ3A 5FDLB 2RH3A 2O1WA 1N36E 3MCMA 4W92B 4RW7B 3ZNUA 4BC7A 3ZM7A 3KHRA 3MDFA 1MU5A 3AAWB 2W9CB 5C24B 5K36E 3BN7A 2GGPB 4GMKA 3Q0AA 4C8OA 5G4DA 3M2VA 5CA5A 1EAYC 4TYBA 1CJUA 1XEZA 2E5HA 3MUMP 2QL7B 3JAMY 1N54B 4X65I 5KOWA 1SH2A 1ZM4A 5IV3A 3W61A 4RO0A 3QGHA 5KFAA 2N3LA 5A8WA 1NPPA 2F1DA 2RAQA 3QO9A 2NXEA 4IRCA 4TKTA 3MAAA 2CPXA 4DBQA 1YJTA 1B62A 4RW6A 3TUIC 3UFCX 2CQ2A 3MOZA 1NRKA 2RVJA 3IA0A 2OKQA 4NLTA 4J37A 1IUJA 2AX0A 3RBZA 2FZGB 4HDGA 4JI4J 2J9CA 2DNPA 4ETZA 4LF7F 4NZ7A 3OPKA 4DS5A 2RRAA 3UWTA 3KHHA 3J7YI 2FLPA 3U1YA 2MQPA 4X62F 4E2FB 4KHRA 5E3CA 4QU6A 4G3IA 1XERA 4FXDA 4JV5I 3UQSA 4QR1A 4YB5A 2J6SA 1X7VA 1RGVA 4J90A 1RLDA 4I2PA 3M85D 2FC9A 2ASLA 4UTGA 4KRWA 1CBKA 2Z5BB 3DN9A 1DAXA 1DTQA 1ZM3A 2EFPA 5LT5A 2O01C 5IM0A 3OL6A 3HMJG 2VQEI 3PX0A 1FX4A 1SKWA 2ZM6I 1Y10A 3I4PA 1XMQE 5GAGI 2KT3A 1X8DA 4CH7A 1UWAA 3R5BA 3UVJB 2PI4A 2AGOA 3MURP 1AB8A 4NYZA 1JXVA 2LQBA 2YNIA 3PNIA 2B4UA 5GADU 2DHHA 2Y0SD 1Z0CA 2KJWA 4DV5I 2C1EB 3RRKA 5KFXA 3ZZUA 1RT1B 4DV6I 2MZTA 5AT1B 2CDQA 3GV5B 3JYTA 4L72B 2NZCA 2E1CA 2FVRA 3R2DJ 4NRTA 4CLLA 3DDNA 4YHHF 2QLJB 3B82A 3GCXP 3I9ZA 2BE2B 3FEYB 1RT4B 4C3MA 1REVA 2DH8A 2ZDPA 3KHLA 3GG0A 1QAJA 3PIOQ 2VH7A 1W25A 3VQSA 4IOAQ 3O1LA 1U2FA 3AD7C 1KQKA 1K47A 1UAWA 1HWKA 4L6V3 5D15A 1PGZA 1FJEB 3RR7A 3IFEA 3N28A 2HZCA 1D09B 2D74B 2VOOA 2D9OA 4DV6E 1MMNA 2DGUA 2PEHA 4I68A 2COLA 3SV4A 4ECVA 4YB1P 4ZCMA 4OZ2A 1S7IA 4OO1A 4JI6J 2ZFHA 3H7HB 1MROA 1Y5NB 1YKWA 2M88A 5ETRA 3BQ2A 4K4TA 2VBZA 4JI3F 3WZ0A 4N41A 2CQ0A 2V4JA 1RJJA 2ZC4A 1UW9A 1ZPWX 2AYEA 3K17A 3R9LA 1GTHA 3SBMA 4WCEQ 1XR7A 2B6AB 4ENOA 2FZKB 3I82A 3P96A 4X4OA 1UEUA 2XMUA 2Y1LB 3SYZA 4IQXA 1I1GA 4PCQA 1H72C 1RSCA 2L3MA 1EKSA 4KC5A 4NASA 1T03B 3LP1B 4B3RF 1CC7A 4KHMA 2Z2YB 4LBIA 4OZEA 1LK5A 2HRUA 4WP8A 2HBZB 2CFXA 1C1CA 3HVRA 2R7RA 4OYAA 2BV3A 2L9NA 3PS3A 1UZHA 2BJ8A 2LCWA 1Q5YA 2LLZA 1PYTA 4X64F 2ZM6F 1VRUB 5KFSA 1HR0E 2XZWA 2HVHA 5K36D 2PI5A 4ZPWR 3D2WA 3M7NG 1X4EA 3K5NA 2DH9A 5KFEA 3HCXA 2HLTA 4PU9A 4DV0E 3PXGa 2IERA 3PFEA 1UETA 4M95A 1YJUA 1CULB 3K8VA 3I6PA 1KOOA 1H2VZ 4YB7A 4IG0B 5B0FA 3HVWA 4X4SA 2B9WA 2G0JA 2CVIA 3QIDA 4UOHA 2QSFA 1VBYA 3TAPA 3CJKB 1RB0A 3FBEA 1C0TA 4IDKB 3J7Z5 4LF8I 2I5JB 4LRAA 3P8BB 2M70A 4EMDA 3MM7A 2VB6A 2Q1LA 3KK3B 1D0EA 2PO0B 2JLGA 2GW8A 4O4GB 1O6XA 4EZ9A 2ZM6E 1FKOA 2C2ZB 3OTCA 1IBLJ 1Z5AA 2VQEE 4RW9A 2FY1A 3ETMA 1C0UB 4LSLA 2IVFB 2OSQA 1BQNB 2Z56B 3GIKA 3J80Y 3ADAC 3HD2A 3MCNA 4PABA 3NGDA 4FF4A 5ETSA 3W60A 1A9NB 3P76A 3HZEA 3HSDA 3MPUB 4Y3CA 3M2UB 2CQCA 2W1BA 4LFAJ 4H4MB 4OO1E 4KR0B 4RW9B 4DR7J 2CWKA 4URQU 5D0EA 3SZ2A 5IS2A 1FKOB 4DR4E 1S7HA 4O4GA 2W4CA 3MFIA 4WFZA 1S10A 3KK3A 4CLTA 1L3SA 5RUBA 2ZVSA 4JV1A 1VHFA 2CPZA 2DO4A 2XO6A 1WOPA 2I5JA 2U2FA 2CPJA 3CDWA 5KG3A 1C0TB 4IDKA 3WIUA 2MKYA 1JNRB 4LT6A 3CJKA 1Q79A 3VGSA 4JYAJ 4DV3E 4B3RI 1ZA1B 3KJFB 3CDAA 1RU2A 3MD3A 4NE9C 3PHEA 3KXDA 4CLZA 4WPAA 1YVFA 4HLBA 4ZITA 2ASDA 1NK4A 1AFIA 2CGEA 1JIHA 3T1HE 4LF7J 1DHMA 1N33E 2ATCB 1FD8A 3HFZB 5L1LA 5HLFA 2YQ0A 1S49A 3I4HX 1Y7PA 4KAIA 4JOUA 1KSPA 3H4LA 2IIHA 2QSWA 3CO9A 4CT8A 1SJFA 4TQSA 5B08A 1S1UB 1VRUA 1WKJA 1FVQA 3AA9A 4KGKA 4L73A 1QAIA 1Z2ZA 2CDRB 3EJMA 3VQTA 4C2MA 4OLPA 4ZPAA 1M5SA 1C1CB 1XIQA 2VJVA 2E5LJ 4LRDA 5IC4B 3R6LB 4EYIB 2O5DA 2H51B 4HKQA 3N5FA 1URRA 3EGVA 2BR0A 3HHDA 3LP1A 5IV4A 2UXCE 3D7SB 3V5RA 2B6AA 1RYSA 4BBYA 2Y8YA 2D69A 3W9HA 1FHTA 1WTBA 1OJ4A 4WWSA 4DV5F 3HI9A 5C25A 3MR3A 4DL7A 2V34A 4OO1B 1I51B 3K5OA 2HGNA 2CKWA 3T3FA 2GNKA 2F9JA 3AD9C 3BSAA 2W8LA 2ZD1B 1XMOE 5DROA 4OLOA 2E1PA 1R7IA 4X4TA 1VQ8S 4IZJB 4DF8A 1L3TA 4M63A 1DLOB 2FVSA 2CJQA 4I6WA 2UXBF 3QYYA 1WHVA 2GO8A 2O1TA 4OI2A 3QNWB 3L7UA 4J5OA 4EU0A 4LF7E 2H65B 2XMJA 5BYRA 3GV8B 1TUWA 3GONA 4P7TA 1DTTB 2HFOA 1RTIA 4ZVGA 5C42A 3LTOA 2BE2A 3QSIA 4AIMA 4HACA 4IRKA 2RDDA 4F3MA 3CD6S 2F4VE 3CEDA 2V67A 2HLUA 3T6BA 1OYPA 4QU7A 2XMTA 2GHPA 2BJ7A 2XNRA 2YKMB 4K4VA 2OEKA 4MU1A 4HL9A 1UA1A 2ZUAA 1WSRA 1PKUA 2QLWA 2QZ8A 5E7OB 3RRGA 3I9V9 3UVJA 1RCXB 2ZNYA 2ZH2A 3PJ9A 4ZVSB 2ACMA 3C2PA 1YHCA 2XYHB 2DJWA 1OMSA 4JI0I 2NLWA 1L3KA 2G9OA 2J7UA 2Z5BA 2J9EA 5FIIA 1RACB 2VG7B 5LMNF 4CNYA 4I2PB 2MDAA 2HHPA 2FDNA 5ETMA 3QWPA 2XLKA 4MYUA 1Q16B 3VALA 4QNKA 2JFDA 3DI6B 7AT1B 2KYXA 2BMBA 1RAFB 2JLEA 2LU1A 2ROGA 3OR2A 4PXCA 4WIQA 5D0GA 4B17A 4C8YA 4C8MA 4UW2A 4ZCLA 2XO7A 3W64A 4HYMA 4KYZA 4KTQA 3QZ7A 3KJVA 3GFYA 2MKJA 4LR8A 1KR4A 2MHNA 2OAUA 1T11A 1R6YA 2NPIA 2QLXA 3OTOI 2HHTA 1HWUA 4Q45A 5KG4A 2DD8S 2WZ1A 3LP2A 4YR3A 4JI1E 3WU4A 1NHHA 1KTVA 2VPWB 1U4BA 3KKFA 3MMAA 1USVA 3NAHA 1FNOA 5A8WB 4MU0A 2Z4PA 4QW8A 2ZJRQ 2NXNA 3J80U 4CDIA 2GAHC 3R7BB 3ZZRA 2KHCA 3C6TB 2IA6A 2UUWA 2IMOA 1JQGA 2IJNA 4KIAA 4U9RA 2YWGA 2V4QA 2UXBJ 3CE8A 2WNRA 1HNWF 3ENVA 3M2VB 4C8NA 2KHDA 3GJQB 2GV1A 2JC0A 4ILRA 4IH6A 1LKZA 1U02A 2GGPA 1E6VA 4DHVA 5B0GA 2AU0A 2HZVA 4U95A 4N5SA 2UXCF 3ZO7A 4DV5J 2YWFA 4OZ5A 3TJ9A 2CJ9A 3WQPA 2MGZA 3BO4A 3LANA 1IR2A 4DV0F 2AEMA 1F5BA 3KNAA 2HW3A 1NO8A 2GQ0A 1SKSA 1FJCA 3F41A 3P3CA 2DHXA 2YKQA 4NOHA 4F4ZA 1VCTA 1N32F 1Z0GA 3GTYX 3IP0A 2V2VA 3UPFA 2NREA 4ANCA 3MAQA 3G82B 1AW0A 1TFWA 2DNOA 1B0PA 4IFVB 5LMUF 4WZMA 7FD1A 4N7TA 4CIOA 1U45A 3SCLE 2AZ3A 1LXJA 2AJ1A 2HEKA 3AOCA 5HP1B 3T9NA 4LFBI 5EGYA 5DQHA 2V2QA 2KT5A 1D1UA 3MTJA 1HL6A 3BSNA 3S7RA 4ZVHA 4ETXA 2PO2B 2FHKA 1QVFR 1VBKA 1S6OA 2E1MC 2ZJQQ 4ECUA 1KVIA 1S1TB 1U0HB 4DV3F 1VQ4S 1N33F 1FFWB 1OYEA 3VAJA 3I5CA 4L74A 1OYDA 2LA6A 3TJAA 4NRUA 3OTOF 2CA9A 3CJRA 2F40A 4WXWA 1N8RT 4C8KA 1Z0EA 4FW9A 2P9GA 2C2OB 2MJUA 4NLOA 5DETA 4DPWA 3M4XA 3KK1B 1H74A 2FJBB 4FPRA 3DXBA 4FN5A 2QMUB 4OX6A 4LREA 5HMYA 3M8RA 1N34I 2FQQB 3PCOB 3EGZA 4FKXA 4QOTA 4DFMA 5JMNA 3M85G 3UD5A 4A48A 5BR8I 4CM2A 4B3SI 4O3NA 4GKJJ 4XTJA 2LEAA 3BDEA 3H5SA 4IYQA 2XS2A 3TR5A 4DR7F 4NBQA 2FVQA 5IT0A 2R4FA 2MKHA 1NHKL 1J5EJ 1DZ5A 2C2KB 1RBAA 3L4BC 2DRBA 3DRYA 3RAXA 2LJPA 2DTJA 2RB7A 3IBFB 4Y2AA 2XWXA 1YGYA 2HURA 4U96A 5KFWA 5I42B 5B7WA 1VQMS 2ADCA 4WZQA 4X4NA 5L3JA 3NCQA 3DOLB 3RBEA 1N56A 4F2SA 3MM9A 1Y11A 4QZVB 4DX5A 5C0XC 2ZEJA 2JEGA 4YS2A 3B4MA 2UU9I 4LIWA 2XLIA 1N36I 3NOCA 3ELHA 3KK2B 1ZAWA 3CUNA 1B7FA 1CPZA 5LMUI 2AYBA 2PEBA 4B9SA 4J9RA 2O3ZA 2AF6A 4LVOP 3DLEB 4WXOA 4X66F 1HR0F 1BY9A 2C2EA 2MQNA 4X4QA 3KJQB 4ED6A 1HNZJ 1VC6A 3FBFA 2R7XA 5GAHI 2YY3A 2B43A 3C15A 3DOKB 3LGHA 3R5AA 4YB6A 1CVJA 3W3SA 3PIPQ 4UUXA 2CADA 1T05A 1MSWD 1Y4UA 4JYAE 1WI8A 2DR8A 3DDIA 2QYCA 5DDOC 4DV1F 3EYZA 2XS7A 2V5HG 2QMXA 5IXUA 2XSJA 1D8ZA 3P3GA 4IS9A 1MU2A 1MW7A 1O0PA 2HNYB 5H9EJ 4DUZF 3IG1B 2Y8WA 3HHEA 1RP5A 3UO0A 1N34F 3WHIA 3Q8SB 5HMWA 2ROPA 3SCJE 1S72S 2Q66A 3FC9A 3W8PA 2UUCF 2A6OA 4NLWA 3RBXA 3OL7A 5JEAD 4ZPVR 1KLMB 4FW3A 2LYVA 4GVBA 4OZ1A 4OL8A 1RAJA 2DIUA 5H9EK 5D78A 3RAMA 5KFGA 1N88A 4NL5A 2ZWPA 2XGQA 1I94F 4DR7I 4MKVA 3DMJB 4JI6F 3R7SB 4X65F 1R31A 3FUYA 1U26A 2B7BB 1EHWA 3LWLA 3H4DA 2DVIA 2HYIB 1F6TA 5IWAJ 1LWEA 3O3LA 1ROFA 2VBWA 3QLHB 4JI2F 2H54B 3JAMU 4NXME 3GWCA 2H5JB 2M4MA 2C3OA 3M6VA 1X5PA 3TRGA 1SH3A 3Q89A 1NKBA 1WORA 5ETLA 3G4SS 3CC2S 3J7AG 4UOGA 1XC9A 1Q7YT 1NDPA 2BANA 1ZAVA 4PQAA 3Q8QB 1DRZA 1TV6B 1D9FA 4LQ9A 4NA2A 1NK8A 5DG9A 2DIVA 2D41A 3DOMB 5KG5A 1WACA 1HKAA 2DNNA 2ZE2B 1RWKB 2JX2A 4RUCA 2HBQB 1HR0I 3D3CJ 2PT0A 4FXVA 2YX4A 2RQKA 3MEGB 4C11A 4MIBA 4UF4A 1Y60A 3J7AM 4BLGA 5GAHU 2QC3A 2N3OA 1XMQJ 2MY8A 2VD3A 4HHHA 3MMJA 3MMCB 5GMEA 4F67A 4YR2A 3IN5A 2WVDA 1MLAA 4CWBA 3KOAA 1RZMA 3QJJA 4DV6J 5CD4A 1TAQA 3BR8A 3HVTB 3L9ZA 2RIJA 4FVMA 4NLRA 3TJ8A 2B4PA 3BS9A 2LEBA 1ICEB 3M8QB 5A8KA 2J65A 2N7CA 4OHVA 1QJHA 3LALA 4TLRA 5A76A 2H5IB 2HGLA 1WHYA 1UEKA 2P6SA 4CH0S 5CCLA 4J9KA 1VJQA 1TKDA 3HKWA 4LFBF 5KFDA 4NZ0A 1N5VA 1Q5VA 3OFGA 2HVIA 1S6QB 2LDIA 1TELA 2CUYA 3D0IE 3M8WA 4G1QA 3ILIA 3UNYA 3HJFA 4A8WA 3V81B 4QPTA 2VC0A 1JKHA 2E5GA 5KG6A 4D3HA 3MEEA 5AE3A 2UXDI 1AT1B 1IBME 2ERRA 2XSFA 2IVMA 3AQPA 5J1NA 1ELOA 1P1LA 3N01A 4WP9A 3Q2SC 4N8OA 1PG5B 3NGTA 2RUGA 5DRQA 4PG4A 4CLFA 4EZ6A 1IXKA 1LW2A 4FZVA 4BA1A 2F63A 1E6YB 1LWFB 2C28A 4MK7A 5HROA 4IOBA 2KTQA 4WK3A 1HQEA 4QYRA 4X66E 1KTQA 2IPOB 3DYAA 3KJNB 3PG9A 3R3TA 2XI3A 3O5TB 2DPJA 3E51A 2QIFA 1OYSA 2D3UA 4I7FA 3L7ZB 4N76A 1JJ4A 3MPYA 3BH6B 1C2PA 2XMVA 4LSZB 4F0KA 1ZETA 2OIHA 1S77D 4K5SA 4MKBA 2HHSA 2BR2B 2NYHA 4M94A 1FEEA 2CPYA 2OP5A 1X4FA 2DEIA 2RHSB 3CJQA 1Q1KA 4O44B 2EFOA 3CO0P 2W8KA 4DR3J 2UVRA 1HQUA 4KGMA 5DRPA 2FPHX 2OMOA 4WU2A 1GMUA 3N6NA 1NK5A 3S1TA 3N4WA 2UU9F 4NA1A 4V19X 4UQGA 2C2RA 2O3DA 4LOMA 3BR9A 3VZHA 3VAIA 1R0BG 2CRLA 1T02A 3FFIA 3QT6A 5D0RA 2R8IA 1UDSA 4GQUA 2FHMA 2X51A 3POTA 4DR2E 4DR1E 1OQ3A 5DGBA 4YQWA 2AV5A 2OFGX 3CXCR 3W2VA 2RF2A 2OJ3A 3R97A 1PYSB 3DHXA 4PZVA 2Y9HA 1IBCB 2XQCA 2IM1A 3FCHA 3B4TA 1JLQA 2WVBA 1CLFA 1JX4A 2KZMA 1X9MA 1Z0BA 1JLGB 3HT3A 1Y5LB 4B3ME 5J2MB 1RWVB 4X66J 1X5TA 5ELWA 3OHBA 1CJKB 4KHPE 5A0YB 4LFCJ 2I6WA 3WBZA 2L08A 3H20A 3MR7A 2L48A 1VMBA 4LF1A 3M8SA 1QTMA 1HYSA 1PAEX 2OMLA 1TMJA 1X4BA 1TL4A 3C19A 4OJHA 4F4AA 4P6QA 5K5MA 2IESA 4M5DA 2RILA 3W5XA 4KFBA 3TNVA 4X4UA 2IDLA 1K9MT 4QCLA 4WTOB 3GB0A 1SKRA 2K06A 4FKYA 1XR6A 3NNHA 2HHHI 1MG7A 5CH7B 2O66A 1IJFB 1JJHA 4KGVB 1UFKA 4NLUA 3H1CA 3J81Q 2R7TA 3ZTOA 3EM1A 2B5JA 1C1BB 2HNZA 2JSXA 1SC1B 1X0FA 4DR5E 2ZH6A 3PJXA 2UU9E 5LMUJ 2KL8A 4G1PA 5IWAE 2IYIA 2C38A 3HHLB 1PSDA 2YKOA 3IM8A 4OQJA 3OVSA 4JI5I 3N79A 1QUVA 5I3QA 1VS3A 4DPXA 3ZFVA 4DFJA 1H7WA 4JBCA 3MGJA 2HFNA 4K5RA 2XCPA 1AUDA 2PA3A 2JT2A 4JI7E 3JAMC 4A8YA 1FJGI 1NH7A 2ZH7A 2YNFA 4ZA1A 3KHGA 3TUPA 1NK0A 1LW0B 3CJ5A 3CW2C 1OO0B 3DLKA 3JQMA 4ELVA 5IQ6A 2DB1A 1OWXA 2VG6A 2N82B 2VDIA 1KC8T 2X1FA 3RW6A 3ET6A 5KG1A 4AE5A 2PMHA 3D6HB 3NY0A 4BC9A 3QJPA 3PS2A 1HBMB 5LSOA 4ATNA 2Z58B 4XK8C 4JI1F 1IWAA 4OYZA 3GYXB 4ZCKA 3PR5B 3D28A 1TUGB 3AODA 3JSYA 3PDNA 2AX1A 1MN9A 4HHUA 1TK5A 2F4VI 3QIPB 1S1VA 1S9GA 1X4DA 3FZBA 2ZC3A 5IQQA 3CJ2A 4PQUA 4OO1F 4KKOA 5IT9C 3WIVA 1G1XA 2FY8A 1TL1A 4TVAB 4ZHRA 4ZPBA 2I38A 3T5HA 3HSGA 3MM5B 1HBNA 2MSSA 4GO5X 3TWZA 4J3DA 1EQMA 4RNOA 1S79A 4PPZA 4LF2A 1O8BA 4RU2A 3I56S 3B54A 1NJYA 4DV6F 4LFBE 1U24A 2ZVIA 2J76E 1VQOS 2FYXA 5LMNE 3GG1A 4IG3B 3SQGA 2KVIA 2B9YA 2JEBB 1RXOB 4USWA 4ZIWA 3G6ES 1YDLA 4LSNB 2AZ1A 4TY8B 2BQRA 3BGLA 3M1VB 2G0CA 1YBTA 3U1LA 3S8SA 2V94A 2QV6A 3EXCX 3J7AN 2NQPA 3LGMA 3NS5A 4I0WA 4JI8J 1BLUA 1KQSR 4ZP8A 2ZKUA 1U8SA 2L41A 1RWNB 2NSBA 2B7CB 3NZKA 3W1YC 4IFYA 4J9UE 2OPQA 3Q22A 2UUCE 4FF2A 3G6VA 3OSPA 2JWNA 3W9IA 4H4OB 3TANA 2DNKA 4RBVA 1HA1A 4ZLPA 2VESA 4OX9I 1R3NA 3DRXA 1ZOTA 4GRSA 4ICLA 4LRFA 3E01A 4RR5A 4DUYJ 2QFIA 4DL6A 4U3DA 4USKA 3C14A 5I3UA 2CNOB 2UVWA 4LVNP 5BR8J 2GA7A 4I3HA 1N0VC 1M5OC 1M5HA 2CJYB 2X7IA 4C0OC 5CABA 2R2SA 2OH2A 2BE9B 2KU7A 5EHHA 3GMGA 4PUOB 2CJXB 3WC0A 2J8AA 3PV8A 1SC3B 4PEOA 3RB3A 1HNXI 1OPZA 4IFDB 3LUYA 4NXMF 2G4BA 4Y34A 2MZRA 4R8UA 4C4WA 1K0VA 2EFGA 4O3OA 3UDEA 1PC4A 2FJVA 1NCLA 3J81j 1XMBA 1Q4RA 1KDNA 2F65A 1SH0A 2OHDA 2FHOB 4LIRA 1WELA 1R0AB 1FXRA 4HEA9 1S57A 1VLOA 1WD6A 2HVDA 2MZSA 1FRHA 3AXMA 5J1EA 3A8IA 4J9MA 1B3TA 1HNIA 1VDHA 4JB8B 5KFBA 4WFYA 2D3O1 5HBMB 1JLAA 3FZ2A 2FHJD 2HVEA 2WVCA 3A3PB 3LPEA 1ZH5A 1NBEB 2CPFA 2DGTA 1Y6ZA 1IKYA 2GZOA 3FQLA 1EZZB 3NGKA 1FNXH 5J1PA 4UUWA 1LQ9A 4P72A 1WTFA 4HH0A 5GADI 1NK6A 2JFKA 4ED0A 2HHQA 2VU5A 3I0SB 2ALZA 1HR0J 2Q2EB 3AQOA 4FBUA 2AJFE 2V2ZA 1R8HA 1KD1T 5F8NA 3A8KA 5EX0A 3CCES 1S4EA 4J9QA 5ETOA 2GIFA 1Z0VA 1RHYA 1HFEL 3NCRA 1H0HB 3HT0A 4Q7AA 1RTHB 4RL1A 3T1HF 1YI2S 4ECZA 3BZQA 1XBWA 2UP1A 2WVFA 1FDAA 2F5GA 4CT9A 1UVIA 5DRRA 3GR0A 4OX9F 1IQTA 2HFVA 3Q8PB 2DK2A 4USUA 4DZ6A 3H4BA 3KG0A 1YWXA 4DR6I 3M30B 2OTLS 4WJBA 4ES3A 3VAKA 2E5JA 5KFFA 2ASYA 1HWLA 2K3KA 5J2PA 2FLOA 4IZJD 3LQVA 1C4AA 4DX8H 5B0BA 3J80C 1P1TA 2L9DA 3FRZA 4F2RA 3M2RB 2DGXA 4AXJA 3RBDA 2EEYA 2ZH1A 3PW4A 1YJRA 3NNCA 3CD7A 2VZ9A 3IAM9 3WU6A 4AQYJ 4TU9A 4M5NA 3GMEA 4MTPA 5A2QC 2VPXB 4WE1A 4DR4J 2HS4A 1AFJA 4RJVA 2B9XA 4NCGB 4QIGA 3BQ1A 2X36A 4JV5F 4X62I 4DV5E 3AJDA 4TXSA 4LR9A 3MEDB 4FP9A 3DGPA 4USIA 1JLCA 1S1XB 5LL6d 3RB4A 1FTCA 4DMZA 1S9EB 3BKTA 4QPXA 1T3NA 3EZUA 4YDXA 4DG1A 2JEFA 4OX7A 2W4DA 3G86A 4IRDA 1VIOA 2C22A 3DM2B 3LP0B 1CJVB 3DRSA 1JK9B 3U1NA 3U02A 2UUAF 3V4MA 5E3PA 1J5OB 3J7A1 3EX7B 4PRXA 1N32J 2OSRA 1RK8A 4GKKJ 4O0NA 2A18A 2M8HA 3IBCB 3DLGA 4CYUA 3KMSA 1OY8A 5D4LA 3ZZOA 3NG8A 4FBTA 2VV5A 4IH7A 1RA6A 1N6QA 4F36A 2UUAJ 5CYQB 5KFLA 2MQQA 4OI0A 1IR1A 3T1HI 3DNCA 5GMDA 4PXEA 3Q8RB 3VAGA 4DV7E 3PYGA 3UDLA 1VQLS 4OX9J 1TVRB 3CWJA 4B3RE 2PMZD 4NLSA 2HIQA 2BOAA 2MJNA 3EVOA 3OUYB 4DQRA 2HFUA 2VASA 3K89A 1Q82T 3GE9A 1WKLA 1U6FA 3E8OA 4OZNA 3WX8A 5KT6A 2NN6E 2I8EA 5G0RA 3JSMA 4RPFA 1V3ZA 2GVZB 4DQIA 4B3TE 4GKKI 3ILLA 3M8PA 3H8YA 3CCSS 1SJ3P 3F44A 4JI3E 1FJGJ 1Z5CA 2CPIA 3IGNA 4XDCA 4DCPB 1RAAB 3X3UA 5L1KA 2Y1IA 1VC5A 2W7AA 4CLKA 5AXNA 5F9LA 3M9OB 1VQYA 5L38A 3TQEA 4JI3I 5F8JA 4IZKB 2WBMA 1U47A 4IFDF 1UVLA 1WSVA 5EKWA 2KKHA 2XYPB 4DL2A 2DHGA 3QRRA 2R8JA 2OD6A 4DSIA 4ANEA 4ZVPB 3PYDA 4NI2A 2QFJA 4NCAA 4LF4J 3WU3A 1WJ9A 1MMLA 4KPCA 5H9FJ 2RKIB 5J2QA 2FB0A 1DQ8A 1N34J 4H4KC 1GXTA 5C0XD 2IAJA 4DS4A 3J80Q 3IRXB 2EFVA 5K8PA 1HI8A 5ETVA 5KFTA 2Q6BA 4I56A 2P6TA 1TTHB 2IC3B 2ZWOA 4X64I 2HQCA 2M3DA 2NXUA 2WONA 3G71S 3DRPA 2ZBQA 5M2UA 3KUEA 3BO2A 1UW4A 2G2ZA 1Q78A 1NZ8A 2V8GA 2CVEA 3M7VA 4QJVA 4OI1A 1SQFA 3HPOA 2H9ZA 3M05A 3UN5A 3RU0A 1RT2A 3NP5A 5BXIA 3RZAA 5T41A 2IRUA 1JLBB 1X9SA 2WP8A 4LR7A 5B0AA 2W9BB 5KFQA 2IM3A 3AOBA 3RRHA 1HNZF 4A8QA 3OLAA 3G8SA 4U3BA 1S6PB 2LA4A 1YITS 1FXLA 1BQMB 2ILYA 5J2NA 2VKRA 4OZLA 4C48A 5CYMB 1FI4A 4QNJA 1FE4A 1YZ7A 2Z57B 5DLFA 1J2VA 1Y3KA 3TW0A 4ZVQB 1H38A 4HTIA 4NLPA 2HKJA 5L9XA 4FF3A 4LF6E 2Y1JA 1EETA 4B3SF 1FA0A 1HBOA 2WAQD 3TZWA 2KRBA 2DGVA 2M0GB 3LAMA 4QIVA 4QQBA 1RT5B 2D3ZA 3KLGB 3C6UA 1JLFA 1P6TA 2DRDA 1RTJB 2ROEA 1X4GA 1KEKA 1HBUB 5I4MA 3QATA 4N77A 3J81Y 1ZTTA 1TL7B 2G2OA 3D9BA 4XPEA 4U8VA 4CTAB 1XNRJ 2VA2A 2AP6A 3TX8A 4IR1A 3KMQA 1N34E 2PO1B 3QAUA 1NM2A 2CPDA 4DUZE 2QN6B 1T94A 1F9EB 3KUHA 5K36C 1KN6A 2J0XA 2FJXA 4LF9I 3SDEB 5IT9U 3LF0A 4ZPDA 2NPFA 5LJ3Y 3G2XA 4ES1A 1DY3A 3C16B 2YKPA 2HFZA 3KLEB 4OYIA 3HXMA 4IQMA 4OJ1A 5KFVA 4BWMA 2RDIA 2DHAA 1TKXA 3BGRB 2QA4S 2QA4G 3BO3A 2VG5A 1QE1B 3PEHA 5D3GB 7FDRA 3OR1B 2E1AA 2X3DA 3NNAA 1YJNS 3M6UA 2UXDJ 1VHIA 4I67A 5E5NA 4DV2I 4WYWA 1UJ6A 2CNNB 2O67A 2IM2A 5AXKA 2C39B 3CDUA 3K57A 4WFNQ 2YPZA 2DR5A 1T7PA 4C8ZA 3IS9A 2BBEA 4MT1A 4XAKA 4C0HA 4DV1I 2AHOB 2V68A 4AQYE 3V6DA 3P4UB 2YBVA 4X62J 2IJFA 1RT3B 1H2UX 4DR4F 2HIYA 2QL9B 4KO0A 3I0RA 4XO0A 1FCAA 2YKNA 3FNNA 4O3QA 1TU0B 4C0BA 4J9OA 2RMLA 3H98A 4J9PA 4NWBA 3KFWX 3KLIA 3HK2A 1BE4A
chains in the Genus database with same CATH topology
5BR8I 4LFCI 4XTJA 1HK7A 4X65E 3CWVA 1HNWI 4LF9E 4YHHE 2LJPA 4JI2I 2UXCI 2UXBI 2E1RA 2PNMA 5L3JA 2UU9I 4DV4E 2R42A 1N36I 4GKJE 1Z0WA 5LMUI 4KQVA 4B3MI 3K85A 4DU7A 4DPYA 4R1FA 2Z5CA 4DR3I 1Y4UA 4DR1I 4URLA 5LMNI 4JI8E 2UUBI 4K0KI 1XNRE 4DV1E 4DR7I 3F0NA 4YY3E 1HNZI 4DU8A 1Z0BA 1XNRI 4NXME 3T1YE 2CG9A 4M1KA 4JI4I 4GKKE 1FKAE 1XMOI 1B63A 4B3TI 1EI1A 4USMA 1VISA 1IBMI 2UXDE 1HR0I 3LPSA 3J7AM 3HULA 2O1VA 1ZM2A 5GMEA 1HNXE 2O1UA 5LMUE 1DARA 1UEKA 2UUCI 3J80Q 4DV6I 3OTOE 4DV3I 4YHHI 1N33I 2UXDI 1I94I 2A2DA 1IBME 5IT9Q 1HNWE 2R3VA 4X65I 1ELOA 5FLXQ 4DR4I 4B3SE 4X64E 4WUDA 2HK3A 2E5LI 3PYFA 1KKHA 4JI0E 4X66E 1Y4SA 1N32E 4HACB 1HNZE 4LFAI 1ZM9A 4YY3I 2ZITA 2DEIA 4DXLA 2V8PA 4LF8E 1Z0CA 5IWAE 4LF5E 2AJ4A 4IZJA 2X36A 3B8HA 4FWGA 3Q6MA 3J81C 3QT6A 4JI5E 4LF7I 1NHJA 1XHKA 4DR2E 4DR1E 3PRYA 4X66I 4K0KE 1FJGE 1BKNA 1NHIA 1Z0TA 2J7KA 1IBLE 2GS8A 4NXNI 1A6FA 2XEXA 4B3ME 5LL6R 1H7UA 4KHPE 4LF4E 4GKJI 1N36E 2O1WA 3ZM7A 1MU5A 1RREA 1D6TA 2HHHI 1MG7A 4X62E 4JI6I 1ZM4A 3J81Q 2UU9E 4DR5E 1XMQI 3WU5A 1B62A 2DEJA 4DPXA 4DPUA 1FJGI 3JAMC 4JI7E 3QT5A 4AQYI 1J5EE 1Z59A 4JV5I 4FWHA 4Z7YA 3T1YI 1ZXMA 4NXMI 4UTGA 2Z5BB 4DV5E 2F4VI 1ZM3A 2IOQA 3ZZTA 2VQEI 2OI2A 5IT9C 2ZM6I 3Q1QA 3K1JA 4IZKA 2A2CA 4DV5I 2BM0A 2F4VE 3ZZUA 2CZ9A 4LFBE 4JI8I 1MX0A 5LMNE 4PRVA 3B82A 1EA6A 2ZBKB 1K47A 4LF6I 4DV6E 2UUCE 4DR5I 4HY1A 4OX9I 4N3OA 1FWKA 3D4JA 4LF4I 3K17A 1Z5BA 4USKA 4I3HA 2HHHE 1N0UA 4OX9E 1N0VC 1NZ0A 2X7IA 1H72C 4NXNE 1HNXI 2UXBE 4JI2E 4MYTA 1IBLI 1Z0GA 4FWDA 2EFGA 1S16A 2BV3A 1HR0E 2HFSA 4PU9A 5BR8E 4DV0E 4DR6E 1ZXNA 3V2UC 1Y6ZA 4GKKI 5IWAI 4LF8I 4EMDA 1PKPA 4DR2I 2Q2EB 2VQFI 2V2ZA 2ZM6E 1Z5AA 2VQEE 1S4EA 1Z0VA 3ZKBA 3ZZ0A 2IOPA 4DR4E 4DV0I 4DR6I 1J5EI 4IZJD 1N32I 4DV3E 3J80C 1N33E 4B3RI 2E5LE 2CGEA 3WU6A 3T1HE 4DUYI 4DPTA 5A2QC 1PIEA 3Q6NA 5FLXC 3H4LA 4JI6E 4P52A 4X62I 3ZKDA 3QT7A 1I94E 4DV4I 4WUCA 4JI1I 2UXCE 3V5RA 3LNUA 4KHPI 3B78A 3QT8A 1OJ4A 2V34A 4DUYE 1XMOE 3T1HI 1U2RA 4IZJB 5GMDA 4JI4E 4DV7E 3PYGA 2O1TA 4B3RE 2HFUA 4WUBA 5FWKA 4LF7E 3GONA 4RPFA 2VQFE 3LTOA 1FWLA 1IBKE 4B3TE 4HACA 4JI3E 4DV2E 2HKEA 1Z5CA 4LF5I 2UUBE 4JI3I 4IZKB 4LFAE 3PYEA 2Z5EA 4JV5E 4DR7E 3PYDA 4ED4A 3WU3A 1PVGA 4JI0I 2Z5BA 3HJCA 4DR3E 4PRXA 4JYAE 2VF3A 1WUUA 2PNLA 4X64I 2HK2A 4MYUA 1XMQE 4HXZA 1USUA 4HYMA 4JG4A 3J7AG 3OTOI 1XNQI 4JI1E 3WU4A 1FI4A 1KTVA 1NHHA 1USVA 1XNQE 3P06A 2HKJA 4LF6E 1KIJA 1H7SA 1H73A 5A2QQ 4Z7CA 4LFCE 2BM1A 2UUAE 1N34E 4JYAI 4ZVIA 4DUZE 4UT4A 4LF9I 2GQ0A 2NPFA 4P7AA 4JI5I 2V2VA 4LFBI 3M6AA 2V2QA 4DV2I 1IBKI 4DV1I 3JAMQ 1KVKA 4AQYE 2WW4A 1FNMA 4JI7I 4FW9A 1QZRA 1RR9A 1Z0EA 4DUZI 4DPWA 1H74A 4FN5A 4DV7I 1N34I 2Z5CB 2UUAI 4B3SI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 I;  4LFC I;  4XTJ A;  4X65 E;  3CWV A;  1HNW I;  4LF9 E;  4YHH E;  2LJP A;  4JI2 I;  2UXC I;  2UXB I;  2E1R A;  5L3J A;  2UU9 I;  4DV4 E;  2R42 A;  1N36 I;  4GKJ E;  1Z0W A;  5LMU I;  4KQV A;  4B3M I;  4DU7 A;  4DPY A;  4R1F A;  4DR3 I;  4DR1 I;  4URL A;  5LMN I;  4JI8 E;  2UUB I;  4K0K I;  1XNR E;  4DV1 E;  4DR7 I;  3F0N A;  4YY3 E;  1HNZ I;  4DU8 A;  1Z0B A;  1XNR I;  4NXM E;  3T1Y E;  4M1K A;  4JI4 I;  4GKK E;  1FKA E;  1XMO I;  1B63 A;  4B3T I;  1EI1 A;  4USM A;  1VIS A;  1IBM I;  2UXD E;  1HR0 I;  3LPS A;  3J7A M;  3HUL A;  1ZM2 A;  5GME A;  1HNX E;  5LMU E;  1DAR A;  1UEK A;  2UUC I;  3J80 Q;  4DV6 I;  3OTO E;  4DV3 I;  4YHH I;  1N33 I;  2UXD I;  1I94 I;  2A2D A;  1IBM E;  5IT9 Q;  1HNW E;  2R3V A;  4X65 I;  1ELO A;  5FLX Q;  4DR4 I;  4B3S E;  4X64 E;  4WUD A;  2HK3 A;  2E5L I;  3PYF A;  1KKH A;  4JI0 E;  4X66 E;  1N32 E;  4HAC B;  1HNZ E;  4LFA I;  1ZM9 A;  4YY3 I;  2ZIT A;  2DEI A;  4DXL A;  2V8P A;  4LF8 E;  1Z0C A;  5IWA E;  4LF5 E;  2AJ4 A;  2X36 A;  3B8H A;  4FWG A;  3J81 C;  3QT6 A;  4JI5 E;  4LF7 I;  1NHJ A;  1XHK A;  4DR2 E;  4DR1 E;  4X66 I;  4K0K E;  1FJG E;  1BKN A;  1NHI A;  1Z0T A;  2J7K A;  1IBL E;  2GS8 A;  4NXN I;  1A6F A;  2XEX A;  4B3M E;  5LL6 R;  1H7U A;  4KHP E;  4LF4 E;  4GKJ I;  1N36 E;  3ZM7 A;  1MU5 A;  1RRE A;  1D6T A;  2HHH I;  1MG7 A;  4X62 E;  4JI6 I;  1ZM4 A;  3J81 Q;  2UU9 E;  4DR5 E;  1XMQ I;  3WU5 A;  1B62 A;  2DEJ A;  4DPX A;  4DPU A;  1FJG I;  3JAM C;  4JI7 E;  3QT5 A;  4AQY I;  1J5E E;  1Z59 A;  4JV5 I;  4FWH A;  4Z7Y A;  3T1Y I;  1ZXM A;  4NXM I;  4UTG A;  4DV5 E;  2F4V I;  1ZM3 A;  3ZZT A;  2VQE I;  2OI2 A;  5IT9 C;  2ZM6 I;  3Q1Q A;  3K1J A;  2A2C A;  4DV5 I;  2BM0 A;  2F4V E;  3ZZU A;  2CZ9 A;  4LFB E;  4JI8 I;  1MX0 A;  5LMN E;  4PRV A;  3B82 A;  1EA6 A;  2ZBK B;  1K47 A;  4LF6 I;  4DV6 E;  2UUC E;  4DR5 I;  4HY1 A;  4OX9 I;  1FWK A;  3D4J A;  4LF4 I;  3K17 A;  1Z5B A;  4USK A;  4I3H A;  2HHH E;  1N0U A;  4OX9 E;  1N0V C;  1NZ0 A;  2X7I A;  1H72 C;  4NXN E;  1HNX I;  2UXB E;  4JI2 E;  4MYT A;  1IBL I;  1Z0G A;  4FWD A;  2EFG A;  1S16 A;  2BV3 A;  1HR0 E;  2HFS A;  4PU9 A;  5BR8 E;  4DV0 E;  4DR6 E;  1ZXN A;  3V2U C;  4GKK I;  5IWA I;  4LF8 I;  4EMD A;  1PKP A;  4DR2 I;  2Q2E B;  2VQF I;  2V2Z A;  2ZM6 E;  1Z5A A;  2VQE E;  1S4E A;  1Z0V A;  3ZKB A;  3ZZ0 A;  4DR4 E;  4DV0 I;  4DR6 I;  1J5E I;  1N32 I;  4DV3 E;  3J80 C;  1N33 E;  4B3R I;  2E5L E;  3WU6 A;  3T1H E;  4DUY I;  4DPT A;  5A2Q C;  1PIE A;  5FLX C;  3H4L A;  4JI6 E;  4P52 A;  4X62 I;  3ZKD A;  3QT7 A;  1I94 E;  4DV4 I;  4WUC A;  4JI1 I;  2UXC E;  3V5R A;  3LNU A;  4KHP I;  3B78 A;  3QT8 A;  1OJ4 A;  2V34 A;  4DUY E;  1XMO E;  3T1H I;  1U2R A;  5GMD A;  4JI4 E;  4DV7 E;  3PYG A;  4B3R E;  2HFU A;  4WUB A;  4LF7 E;  3GON A;  4RPF A;  2VQF E;  3LTO A;  1FWL A;  1IBK E;  4B3T E;  4HAC A;  4JI3 E;  4DV2 E;  2HKE A;  1Z5C A;  4LF5 I;  2UUB E;  4JI3 I;  4LFA E;  3PYE A;  4JV5 E;  4DR7 E;  3PYD A;  4ED4 A;  3WU3 A;  1PVG A;  4JI0 I;  4DR3 E;  4PRX A;  4JYA E;  2VF3 A;  1WUU A;  4X64 I;  2HK2 A;  4MYU A;  1XMQ E;  4HXZ A;  4HYM A;  4JG4 A;  3J7A G;  3OTO I;  1XNQ I;  4JI1 E;  3WU4 A;  1FI4 A;  1KTV A;  1NHH A;  1XNQ E;  2HKJ A;  4LF6 E;  1KIJ A;  1H7S A;  1H73 A;  5A2Q Q;  4Z7C A;  4LFC E;  2BM1 A;  2UUA E;  1N34 E;  4JYA I;  4ZVI A;  4DUZ E;  4UT4 A;  4LF9 I;  2NPF A;  4P7A A;  4JI5 I;  2V2V A;  4LFB I;  3M6A A;  2V2Q A;  4DV2 I;  1IBK I;  4DV1 I;  3JAM Q;  1KVK A;  4AQY E;  2WW4 A;  1FNM A;  4JI7 I;  4FW9 A;  1QZR A;  1RR9 A;  1Z0E A;  4DUZ I;  4DPW A;  1H74 A;  4FN5 A;  4DV7 I;  1N34 I;  2UUA I;  4B3S I; 
#chains in the Genus database with same CATH topology
 5KFY A;  2V50 A;  1HNV A;  3L95 X;  1HAR A;  1TQL A;  4WK1 A;  1U1K A;  4Y2C A;  2A3J A;  1LWC A;  5D0H A;  4YR0 A;  3OJU A;  3CJT A;  3CWV A;  3ITH B;  3PR4 A;  4LFA F;  1RBO B;  3V6K A;  1WC5 A;  1QAY A;  2WBR A;  3H5U A;  2YX7 A;  3LO3 A;  2O1P A;  5CZX A;  1CC8 A;  1GK8 A;  4I2Q A;  1WNE A;  2EXU A;  5LXY A;  4HH1 A;  4ISA A;  2UXB I;  5EWF A;  2YQ1 A;  4LCG A;  1RWX B;  2EG1 A;  4IKA A;  4I2Q B;  3BKF A;  2JEA B;  1LOU A;  5ADZ A;  2J5A A;  1T3O A;  5JVH Q;  1B99 A;  1R8B A;  1SUQ B;  3EIC A;  3FEX B;  4GKJ E;  3A3N B;  5HJX A;  2RJZ A;  3R5D A;  2VFR A;  1UKU A;  3Q8U A;  4M5G A;  5DDQ C;  3EPI A;  1Z0W A;  1S97 A;  3ZZP A;  3G8Q A;  3UNG C;  1VRT A;  1HNV B;  1S4F A;  2BX6 A;  2AT1 B;  2AEJ A;  3DRR B;  3MUV P;  3IXQ A;  2D9P A;  3KLI B;  2F8H A;  2KFZ A;  3DU5 A;  2BAB A;  1KWM A;  5LSR A;  2OPS A;  4DR5 J;  1ZTW A;  2YKN B;  2GAG C;  2OFH X;  3R1L A;  4OZJ A;  1B4S A;  1JMT A;  1RT3 A;  2AJ2 A;  3MTK A;  2FJD B;  5L8R C;  4CO1 A;  3AHP A;  4CQ1 A;  4YUD A;  3V6D B;  4F25 A;  4JI7 J;  1U7L A;  4DCJ B;  1WEZ A;  3MCO A;  2GO4 A;  1N5Y A;  3FVY A;  3GSI A;  2VOP A;  2PNL A;  1T9V A;  4NLY A;  2FLL A;  2OTJ S;  1GAO A;  2FGO A;  5JEA C;  5LMN I;  1R8P A;  1NDL A;  2DXE A;  4DCO B;  1HD1 A;  3MXH P;  4FYV B;  1R0C B;  1RAO A;  1NJW A;  3MR6 A;  4MIW A;  1LV5 A;  5D3G A;  4QYZ K;  4K0K J;  2AW0 A;  2WHO A;  2V63 A;  4OYP A;  3IRW P;  1U8W A;  2LQJ A;  3AA8 A;  1MWZ A;  4ECS A;  4DSK A;  2VG5 B;  2RU3 A;  4K0K I;  2JNJ A;  3O6Q A;  4F02 A;  3UW1 A;  2KDO A;  3KLH B;  1XK8 A;  2CQP A;  4J9L A;  1TP7 A;  3K58 A;  4YY3 E;  3C16 A;  1NPR A;  4FYW B;  4RX6 A;  3H5Y A;  1YK9 A;  1HNZ I;  2E9Z A;  1YIJ S;  1IKX A;  3SDE A;  2CWX A;  3CCV S;  1DFD A;  1H98 A;  1UPP A;  4TYA A;  2VIC A;  3R7N B;  2FJW A;  3U1M A;  1WG1 A;  4CTA A;  2R7W A;  2EFN A;  1S48 A;  1UCN A;  1FKA E;  1XMO I;  2C2M B;  5DDR C;  1HBU A;  2OPR B;  1G2E A;  1RTJ A;  1P42 A;  1RA7 A;  2DGS A;  3V4I B;  4B3T I;  4X4V A;  3R27 A;  1Z2L A;  4M8L A;  1RT5 A;  2RQM A;  4OYO A;  3CCR S;  1PYO B;  1RWP B;  5ETP A;  1EKR A;  1FX2 A;  1HBO B;  1KON A;  1GFW B;  1K44 A;  1NAQ A;  2RHQ B;  3A3O B;  3KWM A;  3NWG A;  1YHQ S;  4CRJ A;  3LPS A;  4AID A;  3WC2 A;  1WEY A;  3CCL S;  1U1R A;  5KFN A;  2BYC A;  2GFF A;  5CYM A;  4L3K A;  5JEA E;  1WF0 A;  1ZM2 A;  4YHH J;  1BQM A;  1QD1 A;  3O8W A;  3QSY B;  1FWP A;  2RS2 A;  2O1V A;  3TYT A;  3OFH A;  1JLE B;  1UFW A;  4Y00 A;  4WU3 A;  2BJ3 A;  1VK8 A;  2NN6 A;  1JLB A;  2BZ2 A;  3J7Y U;  1FRX A;  4LCH A;  4OI6 A;  4TNO A;  1X60 A;  5F3T A;  5F8L A;  5C0X E;  3D68 A;  4HI1 A;  1SVD A;  5GMK a;  3CCU S;  3GFH A;  1REG X;  4B9U A;  1R89 A;  1FRM A;  2V8V A;  2WON B;  2KH9 A;  3K59 A;  1XMO J;  2AYG A;  2BAC A;  2IC3 A;  2W2N P;  4KV8 B;  2DT9 A;  2YNG B;  4I64 A;  2HND B;  1FKP B;  1RHR B;  2B51 A;  2YXL A;  1F2H A;  3IRX A;  2IAJ B;  1ZPV A;  4J9S A;  4IFD C;  1CJT B;  1FDN A;  1ULR A;  2J8S A;  2XMW A;  2RKI A;  1X4H A;  4DL4 A;  1Q86 T;  4DV3 I;  1N33 I;  4DWI A;  2YH0 A;  4FDF A;  1U1L A;  1BGX T;  1F3V A;  4HYK A;  5IT9 Q;  2CQ1 A;  2R3V A;  4DN9 A;  2IYG A;  3A8E A;  5K36 B;  1E3P A;  3CCW A;  4PPD A;  4DR4 I;  4V1A k;  3IO1 A;  4R25 A;  4B9L A;  1NB7 A;  1XR5 A;  1D3W A;  2HK3 A;  2FUG 9;  3VV2 B;  1T8E A;  4CO2 A;  1NSQ A;  3PO5 A;  4CCH A;  3W62 A;  1NHU A;  3F73 A;  1QM9 A;  1XMO F;  4K8R A;  1S0O A;  2V9W A;  4AL7 A;  2PNZ B;  1KKH A;  2BJ9 A;  2ZHO A;  3L09 A;  5K36 F;  4U7U K;  4OHZ A;  1UDN A;  5T7L A;  1VIX A;  4CLU A;  2GVZ A;  3HJV A;  2HHH F;  3JSM B;  2B0G A;  2DCU B;  4DFK A;  5G0R B;  1T0T V;  2FC8 A;  3AJ1 A;  3BN4 A;  3NMR A;  1FDB A;  3IR7 B;  4DQS A;  3GIM A;  3D1Q A;  2Y1R I;  4NLG A;  3K5M A;  3FMW A;  1OYR A;  3P3D A;  2Q43 A;  3D6F B;  4I1T A;  1TVR A;  1VQS A;  3CCT A;  4OX8 A;  1V3R A;  1QDU B;  3TP2 A;  4HDH A;  5JEA F;  2AGQ A;  1KOH A;  1UTA A;  4LF5 E;  2AJ4 A;  3THP A;  1IBL F;  1Q53 A;  3TAR A;  4DR6 J;  4K50 A;  1M1G A;  2JVR A;  3T5K A;  2AE8 A;  2EC2 A;  1OSD A;  4P75 A;  3B8H A;  4FWG A;  2HAI A;  1N6Q B;  1IKW A;  1VQ9 S;  4KQZ A;  2W2Q P;  1RAE B;  4JI5 E;  3NXZ A;  1XHK A;  2ZHA A;  2DY1 A;  2YWH A;  4CYU B;  4X66 I;  3KG4 A;  6FDR A;  1B0T A;  2U1A A;  4UOC A;  4YEA A;  1J5O A;  2LKZ A;  2GJ2 A;  1N5T A;  2WOM A;  4PXB A;  1BKN A;  3LP0 A;  3DM2 A;  3OQ2 A;  3NS7 B;  4PXD A;  4P2M A;  3CDI A;  2RSQ A;  1QVG R;  4ALZ A;  1GX5 A;  1S9E A;  5IWA F;  5IC6 B;  1NZA A;  2G1H A;  2HVZ A;  4TLQ A;  4DSE A;  2F4V F;  1SC6 A;  4MFB B;  2LXU A;  2MY7 A;  2XEX A;  3DGP B;  1V3S A;  3EWG A;  3MED A;  3GIR A;  5D4O A;  2D3O R;  5K8M A;  4JI2 I;  3Q23 A;  4K4X A;  4U7U D;  4NCG A;  4DDF A;  2OPP B;  4DR2 J;  4DSJ A;  4AFF A;  1PAU B;  4WE1 B;  2CZV C;  4NPO A;  2J0W A;  3BYR A;  3CGI A;  2NN6 D;  1T9W A;  2C3U A;  4AD6 A;  5L1I A;  4ELT A;  1R6L A;  1TZ0 A;  2V6A A;  2BA1 G;  1YG0 A;  1KP6 A;  3HHL C;  1RHJ B;  3M2R A;  3MM8 A;  4F4K A;  1D6T A;  3BBC A;  2W7O A;  1B7Y B;  2XZT B;  2V8D A;  5GVQ A;  5J2P B;  4JI6 I;  3SSR A;  5GAG U;  2BQU A;  4NCB A;  4IFD E;  1J5E F;  4KHP J;  4LFA I;  3M30 A;  3QGG A;  1KS2 A;  1HNX J;  1W7W A;  3GSD A;  1CSJ A;  4EI2 A;  4EBE A;  4JI5 J;  3CJ3 A;  1XMQ I;  1Z1Z A;  5F8I A;  2D1C A;  4OMF G;  1U2C A;  2MXY A;  3IGV A;  4CP5 A;  2DEJ A;  4ZIV A;  2KXN B;  4XPC A;  2CIM A;  2EKN A;  2Z30 B;  3MF5 A;  2MKS A;  3PM9 A;  4B3T F;  4OZ3 A;  2QT7 A;  1IVZ A;  4DV7 J;  3OXF A;  2NN6 F;  1AUS L;  4L3N A;  4Z37 A;  2MPU A;  1FK9 B;  4RBT A;  1J5E E;  2R8G A;  1Z59 A;  4OO1 D;  1KHV A;  3NBP B;  4QR2 A;  1U1N A;  1FJ7 A;  2ZBI A;  1V5V A;  4FS2 A;  1BUX A;  3R8Y A;  2HHU A;  3M32 B;  2B8Q A;  4LF9 E;  3QRQ A;  4FWH A;  4Z7Y A;  5FD1 A;  1VFJ A;  3L7P A;  2C37 A;  2MTL A;  5ETK A;  1IKY B;  4OV6 A;  4OJG A;  5E41 A;  4ID5 A;  2MLX A;  3T19 A;  2MQO A;  3BSO A;  4K4Y A;  4NXM I;  1K73 T;  2IOQ A;  4OI4 A;  2CQB A;  3QAE A;  5DS7 A;  2MB0 B;  1RLC L;  1HMV A;  2OGU A;  3I31 A;  5IFM A;  4RBU A;  1JLA B;  2X1B A;  2ZOF A;  5HBM A;  4IFD D;  1XXE A;  3Q86 A;  1M1H A;  4GKJ F;  8ATC B;  1S0N A;  5J1E B;  4NXN J;  3U27 A;  2IRX A;  1WHX A;  3K1J A;  2IVY A;  2A2C A;  2BM0 A;  2JDJ A;  4F7V A;  3PX4 A;  1R0A A;  3K0J A;  1FDD A;  1RT6 A;  2CZ9 A;  2DHS A;  4LRB A;  1S1W B;  3TEG A;  1AYE A;  5SUH A;  4OFZ A;  1U1P A;  4LJM A;  3CF5 Q;  1U48 A;  1TKT B;  2BW7 A;  2VQF J;  3PW0 A;  4FW7 A;  1X4C A;  3GPA A;  2DBB A;  2UXB E;  3K5P A;  4PUO A;  3G6Y A;  5IT9 Y;  1YX2 A;  2HAF A;  5DZ7 A;  3TOQ A;  3AB2 B;  2XM3 A;  1YTY A;  1HLW A;  1EA6 A;  2NSC A;  3HF5 A;  2YWW A;  4DV3 J;  3TVK A;  3MPW A;  1K1Q A;  3C14 B;  3Q8Y A;  1F5C A;  1TL3 A;  2W25 A;  2BKO A;  3PRD A;  4K2X A;  4OI3 A;  3BKU A;  1HHQ A;  4BDP A;  3P6Y C;  1GMW A;  5EX3 A;  2HS3 A;  3BRE A;  1IKV A;  5KT4 A;  1UWB A;  3ENW A;  1HD0 A;  1W26 A;  2OPQ B;  1WG4 A;  1JJ2 R;  2NN6 C;  5C0X A;  3GCW P;  4DR5 I;  3N6M A;  5ITH A;  3M7N D;  5THW A;  4AQY F;  1I6J A;  4ECR A;  3HKM A;  1FWK A;  4N3O A;  4ZCI A;  3S6E A;  4LF4 I;  4LBP A;  1W2I A;  3WDO A;  4HR2 A;  4ZN1 A;  1QSY A;  2HHH E;  4GC7 A;  1NZ0 A;  1Z5B A;  3GFZ A;  4TY8 A;  5F0W A;  1NND A;  1PBU A;  2IJR A;  2QG9 B;  3H90 A;  3GII A;  2UXC J;  4NXN E;  3SQG B;  5A2Q U;  1RTD A;  3OXL A;  1AZS A;  4MYT A;  2PO4 A;  3A4T A;  4RW4 B;  2W2M P;  3SIP B;  5F9N A;  4FWD A;  4Q0B A;  1IBL I;  4Y6I A;  2MKI A;  4UY8 T;  2BEF A;  2IHR 1;  4G6V B;  4DUY F;  1FD2 A;  3VTI A;  3CCM S;  1S59 A;  5KFC A;  1CS4 B;  3EE3 A;  3ZXW A;  2HWI A;  1GNK A;  4AND A;  4LF8 J;  4ZJL A;  4LMZ A;  2GVD B;  2HFS A;  1HBN B;  2GMJ A;  3HSZ A;  4QWB A;  3MM6 A;  4ZK7 M;  4AL5 A;  5KFJ A;  1TL1 B;  2AIR B;  1SQE A;  2D7S A;  3A1Y G;  4KKO B;  4Y28 C;  2JVO A;  4ES2 A;  1T9Y A;  2AGP A;  1ZXN A;  4DR6 E;  1YQH A;  2PE8 A;  3QIP A;  4PQU B;  1RQ0 A;  2FVC A;  2KXH A;  2CXE A;  3TX0 A;  4WKY A;  3O2I A;  3V2U C;  3NLC A;  3N6L A;  2IBO A;  4I4B A;  4PKD B;  3PKM A;  2E66 A;  3HO1 A;  1KBR A;  5JEA A;  1JJC B;  2UXC I;  1WC6 A;  2W9A A;  2G2Y A;  1SQG A;  3ET6 B;  1PKP A;  4DR2 I;  2PD1 A;  3P5T L;  3I55 S;  2DNM A;  4PWD A;  4RNH A;  3W5Z A;  3WX4 A;  2RRN A;  3GJS B;  2VQF I;  2YNH A;  1AA1 B;  1SL1 A;  3MEK A;  2YNF B;  3PRV A;  3PVX A;  2LVW A;  3IMQ J;  3SFG A;  4LF6 F;  3EDQ B;  1QY7 A;  2R7V A;  1T9T A;  4DV4 F;  4M5J A;  4B9N A;  1FE0 A;  4E0D A;  3U1K A;  1C4C A;  3H42 A;  3ZZ0 A;  4MKA A;  2QO3 A;  5HQL A;  1FF2 A;  2OUG A;  3ISZ A;  3W9J A;  1FRJ A;  4WFX A;  3VVU A;  5AXM A;  3D3B J;  2C38 B;  1VQP S;  2DNH A;  2IOP A;  3RW7 A;  4LF4 F;  2KN4 A;  2B5J B;  2EK6 A;  2HNZ B;  4USH A;  1J5E I;  2YNH B;  3X1L B;  3VHQ A;  5FLX Y;  2DXD A;  4PWD B;  5HMZ A;  4JI1 J;  3QPI A;  4TU7 A;  3M9N B;  5CXT A;  2HHV A;  5KFU A;  3D1H A;  2ZBC A;  5DJB A;  4HT7 A;  4KFB B;  1VQ7 S;  3BPS P;  5JEA B;  1UEV A;  2UZA A;  2WNR B;  2P8I A;  3PHT A;  1FJG F;  1ZZF A;  2PMW A;  4DUY I;  4ILM A;  4IH5 A;  5KG0 A;  1HYS B;  4JV0 A;  1A6L A;  2UV8 G;  2HHX A;  3Q6N A;  3MM6 B;  3K5L A;  4A8O A;  1TK0 A;  4JI6 E;  2GVD A;  4ED8 A;  3D1O A;  1R8C A;  2FGC A;  2GQC A;  2ZM6 J;  1N4L A;  1HI0 P;  4DL3 A;  2NZ4 A;  2FZC B;  1CS4 A;  2PFF B;  5J2M A;  1E3H A;  2B8P A;  2B