1OJ4A

Ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
283
structure length
283
Chain Sequence
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of Isoprenoids: Crystal Structure of 4-Diphosphocytidyl-2C-Methyl-D-Erythritol Kinase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE
total genus 85
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2003-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1oj4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1oj4A01
2V2QA 4X65E 4YHHI 4DR7E 3HULA 2BM1A 4JI4I 1HNZI 2HHHI 4FWGA 3J7AG 2VF3A 4DV1I 3LPSA 4MYTA 1PVGA 1NZ0A 1FKAE 2J7KA 4DU8A 2UUAE 4LFBE 1NHJA 3T1HE 4GKKI 1PIEA 3M6AA 4KQVA 2HKEA 2NPFA 4X66E 1H74A 3F0NA 2BM0A 3ZZTA 4HACB 5FLXQ 2UXDE 4NXME 2UXBE 1H72C 1IBME 4DR6E 4I3HA 1Z59A 4PRVA 4JI6I 2ZM6I 3T1YE 3PYDA 4Z7CA 4LF6I 1H7SA 4DR5E 3OTOE 4DV4I 1KTVA 1KKHA 4URLA 4FN5A 4X66I 4HY1A 1ELOA 4MYUA 4LFAE 4DV5E 1XHKA 3ZZ0A 4LF4I 4B3RE 2UXDI 4DR3E 2E1RA 2UXBI 4DPTA 5IWAI 2Q2EB 4JV5I 1MG7A 5A2QQ 1N34I 4X62E 4X62I 1FWKA 2A2CA 4UT4A 1Z0TA 4DR4E 3PYGA 4LF5E 1XNRE 4EMDA 4LF8I 1VISA 4JI3E 2ZM6E 4JI0E 4JI0I 4DV1E 4B3RI 4AQYE 4AQYI 1MX0A 1PKPA 4JV5E 1U2RA 2DEIA 3B8HA 5L3JA 2OI2A 4RPFA 1Z0VA 3B82A 4DV5I 1KVKA 1ZM9A 3LNUA 4LF4E 1RREA 4NXMI 1EI1A 5IWAE 2X7IA 1XMQE 4FWDA 2HFUA 1XMQI 2WW4A 4B3TI 4LF8E 4JI6E 4JI3I 5BR8I 1N34E 3T1YI 3PYFA 4PRXA 5LMNE 5GMEA 3JAMQ 1N33I 2LJPA 4WUCA 3J7AM 4DR4I 4DV4E 3QT8A 1J5EE 4XTJA 1S4EA 2V34A 4WUDA 1N32E 1N32I 1Z0EA 4LF7E 2ZITA 4LFCI 1Z5AA 3WU6A 3ZZUA 2CZ9A 1ZXNA 3LTOA 4B3TE 2GS8A 3H4LA 4DUZI 1BKNA 1Z0BA 4DR1I 4UTGA 2BV3A 1HR0E 2X36A 2DEJA 2HK2A 5LMNI 3WU4A 3ZM7A 4DR2E 1N33E 1ZXMA 4DPWA 1NHHA 3QT7A 1J5EI 1IBLE 1IBLI 4LF5I 1XNRI 1MU5A 4P52A 5LMUE 4GKJI 4GKJE 2VQEI 1XMOE 4USMA 1XMOI 2A2DA 5BR8E 4JI8E 4Z7YA 4DPUA 1FJGE 3V2UC 1RR9A 1Z0WA 1EA6A 2F4VI 3ZKBA 4DUZE 1I94I 4K0KE 4B3SE 4JI5E 4B3SI 4JI1E 4DR2I 4FW9A 4NXNI 4LF7I 3D4JA 3GONA 4DPYA 2HK3A 1N0UA 1KIJA 1FWLA 4JI8I 2AJ4A 1S16A 4HACA 4DUYI 3PYEA 1A6FA 3JAMC 4ZVIA 5LL6R 4JI7E 3QT6A 2V2ZA 5FLXC 2VQFI 4DV3I 1I94E 2UXCI 5A2QC 2R42A 3J81Q 1HNWI 4YY3I 1HNWE 5LMUI 1D6TA 1WUUA 2VQEE 1OJ4A 4LF9I 1QZRA 4WUBA 4NXNE 1B63A 4LFCE 4HXZA 4JI2I 4JI2E 2F4VE 4DR1E 3J81C 4JI5I 1HR0I 1N36I 4JI1I 1N36E 3WU5A 4OX9I 4JI7I 4KHPE 3ZKDA 2UXCE 1B62A 4LF9E 1ZM4A 3QT5A 4M1KA 4DV2E 4ED4A 1H73A 1FJGI 5IT9Q 4JYAI 4R1FA 2R3VA 2V2VA 3J80C 2UUBI 2VQFE 4LFBI 3K1JA 2E5LI 2UUCE 4K0KI 1XNQI 4B3MI 3B78A 4B3ME 4YY3E 1N0VC 1K47A 1Z0GA 4KHPI 4USKA 1H7UA 1Z5BA 4DPXA 1Z5CA 4YHHE 4DR7I 1NHIA 4FWHA 1HNZE 2HHHE 3K17A 3V5RA 4DV6I 4DV6E 4DUYE 4DV0I 4DU7A 4DV3E 2XEXA 3OTOI 4JG4A 4DR5I 1ZM2A 4DV7E 3T1HI 4GKKE 1IBKE 2UU9E 1IBKI 2UU9I 1HNXE 1DARA 1HNXI 4LFAI 4PU9A 4JI4E 5IT9C 2HFSA 3CWVA 1FNMA 4DV2I 3J80Q 4HYMA 4DR3I 3WU3A 4P7AA 4X64E 1IBMI 4X64I 4JYAE 4DR6I 1ZM3A 2UUAI 2UUBE 1FI4A 2ZBKB 2E5LE 2UUCI 3Q1QA 1XNQE 2HKJA 2EFGA 2V8PA 4OX9E 4DV0E 4DXLA 4LF6E 1Z0CA 1UEKA 5GMDA 4X65I 4DV7I
chains in the Genus database with same CATH superfamily
1Y00A 2PO0B 4WBFA 1NSAA 2OUGA 3GYXB 1Q95G 3MI7X 4RW9B 3P4UB 5EL9A 1NPPA 4LRFA 4ANCA 4O3RA 2B5JB 3CTRA 5K20B 3I55S 1RYSA 3MURP 3TP2A 1YSJA 1UCNA 2EK6A 1WEZA 3JSBA 2XO7A 1WNEA 1ZTTA 1HNZI 2HHHI 1HI0P 1GXLA 2QMWA 3N6MA 2DNMA 4WXOA 3IR6B 4I7FA 4Y3CA 4DR1F 4IFDD 2RDJA 4FW3A 2DH7A 1DHMA 1WHXA 3K89A 4NOHA 1T94A 4MYTA 4OLOA 3SDEB 3ZZOA 3W1YC 2J7WA 1R3NA 4URQU 3WBZA 1JXEA 4I56A 1WI8A 1FKAE 1LNQA 1ZS6A 1GMWA 2J7KA 3DFEA 4L76A 4PG6A 4DU8A 4O3QA 5KFCA 3QZ7A 4WP8A 2UUAE 3BDPA 2E5LF 2OP5A 5E3AA 1NHJA 2K7JA 3W66A 2NSCA 3G6XA 5HLFB 3T1HE 1Z2ZA 3FSIA 3TJ8A 3RBZA 5IWAJ 1HHSA 2BABA 5D77A 3VAIA 3S01A 3PM9A 1N48A 3M6AA 2NPFA 1QSSA 4ZVEA 1MU2B 1DTTA 4JI3F 3F0NA 1XQIA 1X4EA 1FVSA 3PR4A 3M85G 2UVVA 3DRSB 5C7PA 4DS4A 3CGIA 4ZJQA 3EPIA 5I3UB 2KM8C 3HXMA 1F3VA 2G0IA 3J80Y 4DUZJ 2P9CA 1H72C 3DYAB 3ZZPA 4A8XA 4RNMA 2MGZB 3UN5A 1Q16B 2PGCA 3PKMA 4LCFA 2CQBA 4H4KA 3CDEA 5B0GA 1Z59A 3W7BA 1KSPA 1X4GA 5B0DA 5B09A 2NN6B 2BR0A 1SI9A 2MSSA 1EZZB 2K2PA 1HFEL 2W4CA 2D7SA 3P5TL 5IZHA 5CABA 4CLKA 3CC7S 1JNRB 2Z30B 3Q8VA 3CCZA 3GIRA 3FCWA 1ZA1B 3BB5A 3PX6A 4OI0A 1QVFR 2AKWB 2JEBB 4KAIA 3LGNA 4U95A 3OL6A 1M1KT 1HNZF 2HHHF 4W90B 2PO1A 1OMSA 2H3EB 3SSSA 1JLEA 1H38A 1U26A 2POKA 4ZVQB 2RHSB 5ETVA 1U0HA 4JI0J 4LF6I 2WOMA 1JLBB 3MMAA 2WTFA 4A8WA 2QA2A 3KUEA 4IZJD 1IKXB 2KXFA 2E1PA 1S9EB 1TL5A 1O6XA 2G2YA 2Q6BA 2ZWPA 3CB4A 4QWAA 2FDNA 3CXCR 4DV6J 2DR8A 3JQMA 2RF2B 2RMLA 4EYIB 4FN5A 2OJ3A 4DPOA 2OLWA 3IR7B 3I87A 4J90A 4RKUC 2F9JA 1R6LA 4XDDA 4AYBD 4IFDC 1WOPA 4FKYA 3GJRB 5AT1B 4DL0C 1SQFA 5KFBA 4BDPA 4LFAE 4P74A 3P76A 1W2IA 2MZ1A 1VQ7S 1SJ1A 2FZGB 2CVEA 4Y2IA 3D6TB 4LF4I 5FD1A 1IKWB 2CUYA 4QW9A 3OSNA 3VQTA 2E1RA 4DV1E 1OYDA 2MKCA 3FQKA 3HHLC 4KB7A 4L72B 3LAMA 5IWAI 1J5EF 1S9GA 2NXEA 2Q2EB 2CNNB 4EK2A 4ECYA 4K50A 1WDTA 1X9MA 1LK7A 1NCLA 1WELA 3CWJA 2YY3A 3MDFA 1MG7A 1NM2A 1RP5A 1LKZA 2AE8A 4PPZA 1IR0A 1SXLA 1EB0A 1TL3B 4HI2A 5H9FK 1S59A 4PYAA 2ZC3A 1G7CB 3N5FA 4CTAA 4G65A 3T41A 1JMTA 2BOAA 4BC7A 3TW0A 3HHLB 4EO6A 4N5SA 2UUCJ 4LFCJ 3QGHA 2X1GA 4FZVA 3RBXA 4U3BA 2PNLA 3QNWB 2XWYA 1Z0TA 1F3FA 2V8HA 1FVQA 1YZ7A 3KJQB 5L1LA 2HAIA 2XLKA 2XB2D 3Q22A 2HBZB 4UY85 4FF2A 1EAYC 3BJYA 5KTQA 2YKMB 3E3XA 2LMIA 3CJQA 2VPWB 4X65J 1FKOA 4JI4J 1EQMA 4JYAF 1B7YB 2IRYA 3OR2B 1N5YA 3AJDA 2ZM6E 5JEAF 1FE0A 2B51A 3GSIA 4F4ZA 4FWGA 4JI0I 1XEZA 1CJKA 5KFYA 3KYLA 4U8VA 2ZHBA 2NYIA 1OWXA 2DNPA 3BKFA 2OFGX 4YB5A 3VZIA 2OH2A 4B3RI 3C15A 4B3MF 1NNDA 1U1RA 4DCPB 2EVZA 4YB1P 3Q8PB 1HD0A 1UWBB 2PC6A 5I3PA 1UA0A 2BDPA 2YKNA 5K8OA 1MX0A 4ETXA 1GQEA 4JV5E 2ZH2A 3MOJB 4ALZA 1L3TA 5IS2A 3GSDA 4EWTA 2NN6C 1RT4A 2DEIA 9RUBA 2BRLA 2N7CA 4A8SA 2JVRA 9ATCB 2W9CB 4DR6J 3H98A 2WNRB 2BQUA 3B8HA 4ZPTR 1YJVA 1RT1A 1NZAA 3T6BA 2R9LA 1H2UX 1HBOB 1PYSB 2GHPA 2PMZD 3C3LA 3CJ4A 3IRXA 4GRSA 4AIDA 1RXOB 1KVKA 2Z0GA 4KC5A 1LWFA 1ZM9A 2J76E 2UV8A 4EEYA 5D4OA 4K4SA 1WKJA 1B3TA 2I9SA 2XTJP 4USTA 2GVZA 3NGUA 3PEJA 4NLUA 4X66J 4DDFA 5KFFA 4WZQA 1M5KC 3GG0A 1NH7A 3LPYA 2X7IA 4PQAA 1QUVA 5C24B 4FWDA 4I2QA 1U25A 1CLFA 5DRKA 4P75A 3CCTA 4BA2A 3OTBA 1Q78A 4FYWB 3HT0A 2CJXB 4F4YA 1N34E 3HJVA 4NE9C 3T1YI 3OHAA 1GX6A 2F40A 3PYFA 3QWPA 4EFAC 4FNHA 3IBWA 1I3OB 3DLEA 4PRXA 1KLNA 3QFWA 3QPIA 4LF9J 4IS9A 4G1QB 4ZP9A 2LQ5A 3ILJA 1FKAF 4CO4A 4J9PA 1BXNA 1FFSB 1IKWA 1Z4UA 2GX8A 2VDIA 4LF5F 1XNRF 4OKGA 2BW7A 3A12A 3J7AM 1Q5VA 1QE1B 3QJJA 4B9MA 1OY9A 3QT8A 4KH1B 3ZO7A 2VOOA 3FJ2A 4F3OA 2Q66A 4GKKF 1Y4UA 4LUBA 4RBUA 5HVFA 5GADU 3TAMA 4W98A 4HHHA 3GIMA 1TK0A 4CNZA 4OJ3A 3UR0A 1OYSA 3SV3A 2E29A 3WZ0A 1OSDA 2AD9A 1IBMF 2MY8A 4ZPCA 3KDOA 3M32B 2DHGA 1HQ2A 1RT5B 4FYYB 1MLAA 4KBIA 2KVQE 4NRUA 1N8RT 1VI7A 4ECTA 4J5OA 4LF7E 5J2NB 4DUTA 4DV7F 2CQPA 1CJVB 2FY8A 3UQSA 3M7VA 1IBCB 4NZ0A 2RILA 5HVHA 2ABYA 3FCHA 1PILA 4WFBQ 2BE2A 3UE2A 1TKDA 1CS4A 2AX1A 2FD2A 2YX4A 2EI5A 5ETOA 3V4MA 2ZUGA 3IM9A 1Y60A 2KHDA 4B3TE 3BR8A 2IESA 3TZXA 1RT2A 1A9NB 4DUZI 3M8WA 4CLWA 1OYEA 4DV2F 1QTNB 5BYQA 5M2UA 4JOUA 2DNGA 4C8LA 2HVDA 4QWEA 1TR0A 3GG1A 3OXGA 4UTGA 3UPFA 3KK1B 1PBUA 4C11B 3CJ3A 1U7LA 2V4JB 5L9NA 2X36A 1CQNA 2DEJA 2VPXB 2YPZA 3JTOA 3ULHA 4WIQA 4U8YA 1CJKB 3D0HE 1N32J 1R6YA 5ETKA 2AP6A 1VQNS 2EEYA 4HDHA 4DPWA 2VA3A 2FJAB 1NHHA 5FLXY 4OZ5A 1UWAA 1RUSA 1NDKA 4OJGA 4OZLA 3N28A 4QYRA 5D0EA 4YR0A 3HKMA 4ISAA 1IBLI 2RU3A 4CO2A 2J9DE 1SL2A 1OY8A 3R27A 2KFNA 5F8JA 2WVBA 2PEHA 1NAQA 3AODA 4F3QA 2GVDA 4KGZB 2QL7B 3TZYA 3JYTB 3VAHA 4DR7F 1U0SA 2CQ0A 3BS9A 4ZHRA 5HLFA 4C2MA 1YWXA 3SEOA 5RUBA 4RNFA 3G8SA 2A2DA 1Q86T 5IC4B 4Y2KA 2Y1RI 4B9NA 3FBBA 4RNHA 3MFHA 2RQCA 3RAMA 3P3DA 4PWDB 1G1XA 2VQFF 1Y3KA 2CQIA 3A8EA 2LXFA 2WVEA 2DT9A 4O4RA 3WX4A 3SDEA 3W62A 3BGLA 4PWWA 1XK8A 2BANB 4OV6A 4ZITA 2QIFA 4DQQA 1S0NA 4I2PA 3MR7A 4LFCF 4P2MA 4WE1B 4DUZE 1NJIT 5CZXA 4NYOA 1AZSB 2GO3A 3JSMB 1LXJA 1TL7A 2O5DA 3I9ZA 5J1EA 2YKQA 3DLGB 3K5OA 3KJVA 5DG7A 4B3OA 4B3SE 3G6VA 3O5TB 2CWXA 4NLXA 4QIFA 3H20A 3CPWR 3WC2A 2KJVA 1LFPA 4DMZA 4K4XA 1URNA 3HO1A 3M85D 2BA0G 4FW9A 2RNEA 3AH6A 3CCWA 8AT1B 2KU7A 4NXNI 1U24A 3MECB 3KNAA 2M4MA 2QJ3A 3CJSA 4KGVB 1HWIA 1TL1B 3C6TA 3OTEA 2GQQA 5LSOA 5JEAC 3TEHB 3D4JA 2X3GA 5F8GA 1YJWS 2G2OA 2CAJA 3GONA 1GXUA 1YBUA 1SKRA 1HHTP 4ED0A 3EWGA 1D8ZA 3BGRA 4KIAA 4DR1I 3UCUP 3MUVP 2J5AA 1S9EA 2D74B 1N0UA 3SQGA 3PACA 1IBLF 1N56A 1X5OA 3E01B 3UN3A 2K8GA 1J5EE 3D6HB 2BKPA 1F0XA 3NNHA 2Z56B 3TJAA 3HLUA 4JI8I 1S1WA 4JV0A 2WP8A 3DC2A 4USVA 5B0FA 2IMWP 1UZHA 2YQ3A 3T1HJ 2CPXA 3GPAA 2R7VA 5BYRA 4DUYI 3QIDA 2A3JA 3DXSX 2ZH1A 2VG5B 4TY8B 5E2QA 2KVIA 1X0PA 2XZTB 2BE7D 2HSEB 4M5MA 2V0NA 2X51A 3TVYA 1RT1B 1SB6A 2ROEA 4WFNQ 2C28A 3Q2TC 1RWNB 2KT2A 2ERRA 1NKCA 2HHXA 3P3CA 4QNJA 2AX0A 4HL9A 2VQFI 3W60A 1LW0B 1HARA 2QYGA 2ZVIA 3CIZA 2ZUAA 2FC8A 3MEGB 2VG6A 3ISND 5D78A 1UDOA 1EARA 2BRKA 4HDGA 3U1YA 2RJZA 4MMOA 1TKZA 2I6WA 2VQEE 3I0RB 1OJ4A 3AD8C 5E3CA 2MQQA 2W9AA 4ED2A 3NCRA 2F5GA 2C3OA 3Q1QA 1UWBA 1Y0HA 3ISNC 1E6VA 2QMXA 1RTJB 1S1TB 5ETNA 5FLXU 1OSCA 1H6KX 1TP7A 1NH8A 3OXLA 4MIAA 5J2MB 3J81U 1VGYA 4ERDA 1GH8A 2G1DA 1X4DA 2GO4A 5DDQC 4YDXA 3ENVA 3MMBA 4LFCE 1UFKA 2QZ8A 2WCXA 4RBVA 2W7PA 3KJFB 4DQSA 1N6QB 4QU6A 3MF5A 1VRQC 3OD2A 2BQRA 1RTDB 2DNQA 2RSQA 4OZNA 1M5SA 4F0KA 2MLZA 1DURA 3PJXA 1OY6A 5BXIA 4J9RA 1KQGB 2DGWA 1T11A 1TKTB 4OV1A 3J7YU 4N8NA 2A1BA 2BYCA 2ZH5A 2PO0A 4LBHA 2DYAA 4HEA9 2XCAA 2GC8A 4P71A 2FVQA 5HROA 1NPRA 2VL1A 4OYOA 2JFKA 2VH7A 3C6UB 3DMJB 2HVZA 4X4VA 4WU2A 2JLFA 3V81B 3ZNUA 4LF4J 4X2BA 4YB7A 1NDLA 4O4GA 5H9EJ 3A8KA 1T05A 3Q8YA 2XI3A 4FNIA 3TOQA 4QWDA 4DUYF 2DR5A 4MU4A 1OO0B 1VRUA 5KG4A 3I6PA 3LP0B 2W8LA 3PFOA 3DHXA 1HWLA 4NZ6A 3T9ZA 3L7OA 2GQCA 2GZOA 3EM1A 5GMKa 1BD6A 3QIPB 4M63A 3KMSA 4FF1A 4ED3A 5LT5A 2MQPA 2GMJA 1YTYA 1ZM4A 3EPGA 3K5NA 3OTOJ 5HBMB 3LANA 4R25A 3JSMA 1NK9A 1SKWA 4CP5A 2DHHA 2XULA 4U7UK 2ZOMA 1ZZFA 3OFEA 5A2QU 2CNOB 2I8EA 4E0DA 4DV2E 4LF5J 1FK9B 1RKIA 1XNRJ 3MTKA 2IPOB 4FYVB 5HSPA 5KFKA 4U67Q 3DRYA 3R2CJ 3KLEB 4FBTA 1T7PA 4DR4J 2B9XA 3LW5C 1RQ0A 1Z1ZA 2FIUA 4QR1A 1KVIA 3GMEA 5DRRA 2V2VA 2NUUG 1RHUB 2P8IA 2RF2A 3R3TA 2VQFE 4DWIA 2IBOA 1SUQB 5LMUE 4HH0A 4NA3A 2Y0SD 3IBFB 4OYZA 4Y2CA 2ZWOA 1VLYA 1RGVA 4B3ME 4RNOA 2FHJD 1S1VA 2MJNA 3EZOA 4K7QA 4ZJLA 1Y4ZB 4ED8A 4IFVA 4WK3A 1N34J 2GJ2A 2HLTA 2QN6B 1ICEB 3UHMA 1IKVA 1FNOA 4EYHB 2DY9A 3M6WA 1RE1B 4IH5A 4ZLJA 2V8GA 1C1BB 1MMLA 2JC1A 4ZCLA 3CC2S 2UVWA 1YJ9S 3AA9A 2ZDPA 1H2TZ 1R8AA 1XBWA 2OPRB 5KT3A 3I4PA 3GMGA 4FF3A 2EG1A 3I31A 3ICLA 1YGYA 4EZ6A 1Z5CA 1WG4A 2E9TA 1WSVA 3L4BC 3RJMB 3CJ0A 2W01A 2B0GA 3MEGA 2G13A 1YRUA 3H4DA 2FVPA 1M5VC 2Y3YA 3BGRB 3J7Z5 3H42A 2HRUA 4EBEA 2O1TA 1FCAA 1SC1B 3J81Y 3GV7B 2DPJA 2XSJA 3GR0A 2HYIB 1ZA2B 3MM7B 2MKJA 1U1LA 3ILLA 1JLAB 4IZKB 1JJ2R 1BGXT 1Q53A 4CQ1A 2JEGA 4DV6E 3N9UC 3U1LA 4CH7A 2DNRA 1S1XA 4YP3A 3M8RA 1NK4A 4WTYA 4LF4F 1KNZA 5B7WA 4LF7F 1RAAB 2WP8B 3UR3C 4YS2A 4ZIWA 2XZWA 4DSEA 2ACMA 3TUZC 2HRYA 4NLTA 4AXIA 2FTRA 4DV3E 2WBRA 1T9YA 3KJVB 3KLFB 1SL1A 4OJHA 1U6FA 2ROGA 3UVJB 1HNXF 1QSLA 1FJ7A 5JXSA 5ELWA 3T1HI 4DR7J 2HWHA 3LALA 1YHQS 4QOTA 2BR2B 5KFNA 1Q81T 3UCZP 2CPFA 2RRAA 4NMXA 3TAMB 3PRVA 3VVUA 5AXMA 2RQKA 3PCOB 1FKPB 5DNLA 3OW2R 2XG8A 1VMBA 3OXFA 2RD5C 1GTEA 2HFSA 2YNFA 4O44B 3J7A1 5IT9C 2GQ2A 2Z2MA 1NB7A 2OSRA 2XS5A 2ASJA 4B9SA 4DEZA 5DLGA 5D6GA 2VBZA 4HYMA 4HLBA 2WVDA 4X64E 1NUEA 2UXCF 1WC5A 2BJ3A 1TL7B 3IAS9 3TVKA 1N33F 4N47A 2PE8A 1L3SA 1S99A 4BLGA 1JJCB 3VVTA 1KLMA 4OL8A 1OYPA 4O3SA 2AGOA 4PYDA 1XNQE 3PJ9A 3DU6A 3MM6A 3BREA 3I56S 3CUNA 2HKJA 2EKNA 3D7SB 3FC9A 1YRXA 2V8PA 3NMAA 5DNXA 2UXBJ 2BJDA 4USHA 3I0SA 2NXCA 2IBKA 3IS9B 2KFYA 1MMNA 1N4LA 4C8KA 4Q2MA 4TNOA 3B4TA 2DY1A 3VHQA 4MFBA 5F8HA 2KB2A 3W5YA 3MD3A 3HVTA 1F5CA 2LFVA 2QA1A 2F3JA 1F9FA 3CDAA 3DRRA 4GO5X 5D0RA 3GCMA 1GAOA 3HZEA 4KV8B 4YHHI 2BBEA 4M5GA 3BH6B 4DLGA 4MKAA 2W9BA 3A3NB 4IO1A 3TUIC 4UQTA 3GU0A 1UEVA 8ATCB 4B3OB 3M9MB 2IY5B 3QAUA 4LQ9A 3GIIA 1RB0A 4X65F 4GVBB 3CULA 2ATCB 1QSYA 3PFEA 4CIOA 4KGKA 2AMCB 3EDQB 2UUTA 2LQ8A 3THTA 3DRPB 5ETTA 3SCIE 5KG2A 1JKHA 1X4FA 2HNZA 2Q6CA 3UCGA 2O66A 2JE6A 2J7UA 3O2IA 3LPSA 3DLKB 4DV1I 1Y5NB 2QTWA 1RTHB 1LWFB 3CDIA 3DRXA 1U8SA 4YQWA 2JEAB 3C15B 2V67A 2RQMA 4PWDA 4OZ2A 1U49A 2CQGA 1LOUA 4PXCA 2HPUA 4USWA 2GIRA 4WFAQ 3QATA 3T3FA 3RBDA 3S7RA 4IRKA 4JI8J 5KG5A 3P3EA 3OTDA 1LFWA 1MROA 3IO1A 4C8MA 2IIHA 5EX3A 1PGZA 3I9V9 2VU5A 1RHQB 2CYYA 1PIEA 1YIJS 1HBNB 4KQVA 1RBAA 1R7IA 1TKXA 3Q8QB 1ITPA 2RIJA 2OTLS 2C38B 4U3DA 3MD1A 5HANA 1CJVA 1NJYA 3AOCA 2C37B 3VQSA 2L9DA 4FKXA 1WORA 3DLEB 3M8SA 3NAHA 3NBPA 3ZTRA 2D41A 4DV5J 4K0KJ 2HNDB 2DHXA 5CYJA 4F36A 4IH6A 2UXDJ 2J9EA 4DX7A 4USUA 5SUHA 3D2WA 2CPIA 2H9ZA 3U7JA 3PRYA 4KO0A 3VAKA 4DLEA 4ILMA 4C11A 1TL3A 3C16B 2VKZG 3CJ5A 5CAAA 2OD6A 1IVZA 1Y5LB 4ZA1A 6FD1A 2ZM6I 5ETSA 5KFSA 3JAMY 1VIOA 1MWYA 1CJTA 3GJQB 3OL9A 1E6YA 3W9IA 2IRXA 3GFXA 2ZC4A 1RABB 3KK3A 5CXTA 3NL0A 3T1YE 2RKIB 3KOAA 4JI2F 1P42A 2FZCB 3CDWA 1R31A 5LMNF 2PT0A 2HHQA 2Y8YA 1U2CA 3DNCA 4OX6A 3OV7A 5J2NA 2NN6F 4LRAA 3PV8A 2IA6A 4ZVRB 3U1MA 1K44A 2C3PA 1X9SA 3A4TA 2I5JB 5K36A 2JRSA 4JI7J 2WB4A 4ELUA 1KKHA 5F9LA 2PO2A 3HSZA 4NLDA 2ASDA 4FBUA 1MN9A 2FJWA 2KJWA 1UZDA 4MU1A 2HURA 4DQRA 4UY8T 1UPMB 4HY1A 3CE8A 1NJXA 4QU7A 1A7GE 1FERA 3PHTA 5M2PA 1VBXA 2W1BA 3AD7C 3TNVA 3E51A 3ZZ0A 1D9AA 2F4FA 4ECZA 1SJ4P 1M5PC 2ZNYA 2C39B 2UXDI 5KT7A 3I82A 4IDKB 1UW9A 2PO1B 4ECQA 4TU8A 4M5NA 2JEFA 3KMQA 2MHEA 5A6PA 4X4OA 3H25A 3G87A 1SKSA 2B9EA 4Q7AA 4DOZA 4HR2A 5E3RA 4YR3A 3PX0A 4JV5I 5IOLA 2NS1B 2XSJB 2JEAA 4ANEA 2OKQA 3ET6B 3DOMB 4DF4A 2QC3A 3TAPA 3V6HA 1BMQB 1FXDA 2OSQA 1MNEA 2V6AA 5GAHU 3QGGA 4DV3F 2FY1A 3NGRA 4X62E 4X62I 5L39A 1FD2A 3KHHA 2E5LJ 5JEAA 3MMAB 5C5JA 3QO9A 4P2SA 3K58A 3K59A 5LMUF 2XI2A 1RBOB 3DCAA 2GVZB 4DR2F 3JB9k 1BQMB 5KG3A 5H9EK 3R8YA 2LQ9A 4CTAB 4DR3F 2V4JA 1NK0A 2QLFB 1RLDA 2FPHX 4DR4E 4ETZA 4YN3B 3DOKA 4ANDA 2FVRA 2B8PA 2D3UA 1S0VA 4IFDB 3QLHA 2ZD1B 2MPUA 4RU9A 1HW9A 3VWSA 3X3UA 3FMBA 4F0MA 1RWMB 1TL4A 1VIXA 2IM3A 3DRRB 2COLA 2D69A 3SXLA 3MR2A 2ZZNA 2E5GA 3LP2A 1TQLA 2W4PA 4JP8A 1VISA 3GFZA 4WJBA 1SV5A 4ZPAA 2JFDA 4CNYA 3RB6A 1LWXA 4FYXB 2FQQB 4MK7A 4MU3A 4Y28C 4UOGA 1BQNA 2G9OA 3DGPB 4EUVA 5BR8J 4ZVOB 2BUNA 3AT1B 1GMUA 3NWGA 4MKBA 5I42A 1RT3A 3IAM9 1HYSB 3PS2A 1HBMB 3SBMA 2FUG9 4P7TA 2R2SA 3WIVA 2NSBA 2C1EB 5KAKA 4BA1A 1NSKL 3DKDA 1N5TA 4C0BA 3OVBA 2YNHB 1H7XA 1Y11A 1MU2A 3D6FB 1GFWB 3IWXA 2UUCF 1GEHA 1XMOF 2BJ9A 3HD1A 3CCLS 2V8DA 5L9XA 1Q7LB 2XHWA 3HM9A 2W2PP 3ZTSA 2DK2A 1D0EA 2JEJA 2YQ1A 2E7WA 2WOMB 1R0CB 5HMZA 1WC4A 2QLJB 3CMAS 3KUGA 4B02A 2PMHA 1TUWA 3CO9A 1KQKA 3W63A 5L3JA 2OI2A 3BBCA 1YJRA 4QIEA 1VRUB 4RPFA 2MQNA 4CLSA 2Z8QA 2LDIA 3CT9A 3SYZA 1SL0A 4G3IA 4YR2A 3HX9A 1Y4SA 4F3MA 1M5HA 2QRRA 1RREA 1HWUA 4LF4E 4IR9A 3W2VB 2FLNA 1AUDA 4EBCA 4ZMMA 1WG5A 2HFNA 1C4AA 3M30B 2MKKA 2HFUA 1CQMA 3JTNA 2WW4A 2FLLA 4ZCKA 3VGTA 2I5JA 5K36B 1UVIA 1E3HA 4L3KA 1ZOTA 3VGSA 1RHJB 5D3GB 3KK2B 2ZBQA 3KLIA 3LWLA 2VFTA 4KFBA 2DCUB 3H4BA 2APOA 5IQ6A 4EBDA 3EGVA 4IFDF 4AIMA 2EKYA 3DRSA 1MW7A 3BEGB 5GMEA 2EW9A 2WHOA 1Y9OA 2XMKA 2KO1A 3OQ2A 4IZKA 3KJNB 1N33I 3H5UA 1WG1A 2OGUA 1K73T 4U7UD 3W61A 3H2VE 4B9TA 2Z4PA 5AXKA 1S72S 3G8QA 2CADA 4DV4E 3OLBA 1VQ9S 2UVRA 2H65B 3N0VA 1J5OB 3M2UA 4NX9A 3RW7A 1UKUA 4Q5VA 3CD6S 2UXCJ 3S1TA 4LVOP 5C0XF 1YX2A 2P9GA 1FD8A 3I5BA 2OEKA 1RT6A 5H9FJ 4J9LA 2V34A 5L46A 4WUDA 4JI3J 3M2UB 4TLQA 4LREA 2A6OA 1JNZB 2HRTA 5LM7E 5HJYA 2KYZA 1N32E 2J0SD 2BE9B 1YK9A 1IN0A 2UXBF 2GFFA 2IYGA 2Q79A 1Z5AA 3PDNA 4K8RA 3WU6A 2B43A 3VTIA 3D54A 3PW7A 5L38A 1RTZA 1RTJA 1S1TA 3CMQA 1EKRA 3R5AA 4J9OA 1RAJA 2MQ8A 4DV0F 2VONA 1S7IA 1AFIA 1S1WB 1JJHA 2FJDB 3P96A 4NCGA 4ZVHA 4HHJA 2YKPA 4KV8A 4K4YA 3SIPB 5KG6A 4F25A 1WD6A 4FXWA 2CNKB 1N5VA 1RHRB 2VODA 4ZS6A 3OTOF 3OUYA 3QWUA 3KLGA 5ETQA 5M2RA 1RU2A 3EGWB 3L7ZA 3M7ND 4JI5J 2VJUA 4WF9Q 2JVOA 2GA7A 2N7YA 4O3PA 3TA2A 4LOMA 1D09B 2DB1A 3WU4A 1FK9A 1UPPA 2HNZB 3AJ2A 2HGNA 3MFIA 2Z58B 1B7FA 2PSZA 3FRYA 1R6MA 5HROB 2FHKA 3MM6B 1X4HA 4ZP6A 5HK4A 3TA0A 5KG7A 3NGKA 1OQ3A 1I94J 1IBLE 2B5JA 5HAOA 3M1VA 4LF5I 2CXEA 5F0WA 1HKAA 4AXJA 3KK2A 4DFJA 2AU0A 1U1NA 4P52A 1YH8A 3DLHA 4QW8A 4OX7A 3CJKB 3CEDA 4OJ1A 4USMA 4LR7A 2PI5A 3GLLA 3LH2S 4P2FA 2KRRA 3WC0A 1NHUA 2ZJRQ 2V5HG 1JK9B 3H0PA 1SQEA 2P2CB 4Z7YA 3MMJA 4C9DA 3OL7A 2XY6A 4OYWA 4DQIA 4V1Ak 3A8IA 1FJGE 3V2UC 4H4MB 4LIRA 3MR3A 2XMJA 1VQ8S 2PA8D 4FF4A 5CYQB 4AM3A 5I42B 1HYSA 1RR9A 4IKAA 1H2VZ 3ZTQA 1EA6A 4N76A 5CH7B 3ZKBA 3CW2C 3R5GA 1XTZA 1I94I 1TELA 1HQUB 2JHEA 2MKIA 3ZZRA 3J81C 4RUAA 3QSIA 3RU0A 3MHYA 2GVDB 5G0RA 5DDOC 3JYTA 1AB8A 4QIWD 4OHYA 3UD4P 4WE1A 3R7SB 4DUZF 2J6UA 4NRTA 4ZPDA 4F67A 2ZBIA 1BE4A 3RB0A 5AE3A 1NPKA 1RWWB 2PFDA 2VG5A 4A48A 5DQHA 2B7CB 1NKEA 4C3MA 4ID5A 1FRHA 4OZ3A 4ZP8A 4LJMA 4HYKA 2HHSA 4UOCA 2HFZA 1IQZA 1X4CA 4DN9A 2HNYB 2ZEJA 1NJZA 2BA0D 5KFQA 4DR6F 1NEEA 3H5XA 5DG8A 3QYYA 3OTCA 1KIJA 5A6WA 1UVKA 3MZIA 3IMQJ 1IKYB 1FWLA 1QUPA 3CIMA 2AJ4A 3N6LA 5CYMA 4EO8A 2KT3A 4Q45A 2UXDF 5C0XB 4P72A 3G4SS 1DQ8A 2CJQA 4KGXB 3AFGA 1S16A 4IZJA 3T5KA 2PNMA 1RTIB 2KKHA 1P9QC 5KFLA 1AT1B 4CLFA 3T1YJ 1VQ4S 3A1YG 1DY3A 4JI6F 3OJSA 2VZ9A 4LIWA 2KZMA 2C39A 4ZVIA 2O1PA 4HT5A 3DDNA 4RUBA 1H3DA 4OYIA 5KFGA 4ED5A 3I5CA 3QT6A 5FLXC 2IAJB 1VC0A 2UXCI 1Z2LA 3DM2A 5J2PA 2NREA 1YBAA 1RT5A 2MXYA 3M8QA 1WHWA 2RHQB 2MDAA 4H54A 2C2NA 4B3TF 1C1CB 4EGLA 2C2RA 2YWKA 4MH8A 1H98A 3ET6A 1WUUA 3W2VA 4N41A 2YXLA 3V6KA 1EETB 1J5EJ 1FJGF 2NN6E 4WUBA 1CS4B 4NXNE 4ICLB 4Y0FA 3AOBA 2DBBA 4I67A 1PJ7A 3UDVA 2DNLA 2LXIA 4ZK7M 3HF5A 2DGXA 2X1BA 3ONQA 3U02A 3J81j 4J91A 4TY8A 2KHCA 1PC4A 2PDAA 5GAEU 3BQ0A 2V69A 4HKQA 1TVRA 4LCGA 4OIXA 4WIIA 4KPYA 5AJ3J 2Z5CA 4KHPE 1IBKF 2QEXS 1P1LA 1CJTB 2O67A 2XMTA 3KLIB 2UU9F 4TN2A 5F41A 5ETRA 4DR1E 4OX9E 1MSWD 1B4SA 1R43A 1Q8LA 3W9HA 1U6ZA 4BBYA 3TA1A 4DV4F 4GKJF 1RA6A 4ZKAA 4JI5I 2JH3A 4A4JA 1R8PA 1Q8KA 4ZJOA 5IV3A 1N36E 2MKYA 2AIRB 1USUA 1NJWA 1JLCB 3NG8A 2CJ9A 4I4BA 3ZTPA 2NXNA 4NLGA 3US5A 1YG0A 2DH9A 4ES2A 3NS6A 2MY7A 2CRLA 2H5IB 3D1HA 2EK1A 4KPCA 4JI7I 2VESA 2UXCE 3K5LA 1WEYA 2CPEA 3IRXB 2NR0A 3MMCB 3FRZA 2R2TA 4M95A 2F65A 5LMUJ 1HI8A 4OI2A 4B08A 4DV2J 2R7XA 4MAKA 3M8PB 4YHHF 1HBNA 4CT8A 4KJIA 3FK4A 3JTPA 4DV6F 3OT9A 3BSAA 1C0TA 5HATA 1RT7A 3TO8A 4WYLA 3W65A 5K5MA 4J9MA 1JXLA 2HS0A 1KBRA 1Y10A 2BJEA 2K3IA 4QBUA 2CJKA 2OPQA 2HGLA 2YKNB 3MCOA 1H73A 4I1TA 1T02A 4NL5A 3I96A 1TV6B 4OI3A 2KT5A 4GO7X 3H7HB 3M4XA 3R7BB 4Q2LA 3NBPB 4WFYA 2RVJA 5K9FA 3HHKA 4P73A 2MTLA 1PG5B 2R2UA 3VAJA 3NXZA 4FS1A 5JEAD 2JDJA 2QL5B 4R1FA 2DXEA 4U7CA 3AD9C 3D6MB 4IFYA 3UDCA 4K4ZA 1YJNS 2XMWA 3FBEA 2ZE2B 1U1QA 6FDRA 2XS2A 2MKHA 4B3TJ 4LFBI 2E5LI 2UUCE 4K0KI 1N5YB 1XNQI 2D3OR 3B78A 4RW6A 4NXMF 2W2NP 1LV5A 4YY3E 3AXKA 3NKYA 4UW2A 5BJRA 3HPOA 1SH3A 1N0VC 2F8EX 2FHMA 3D1OA 2YNHA 5DDPC 3UI3A 2F8MA 2W25A 4OI4A 2K7KA 2XMUA 2VFRA 2KM8B 2K1RB 4J9QA 4DSIA 3BGFA 4JI2J 1KN6A 2OPSA 1HPZA 1Z0GA 4LFBE 4KHPI 4UUXA 1ROFA 1RKJA 1M1GA 3KG0A 3N01A 5CCLA 2WONB 3PO5A 2DXFA 1BQNB 4L6V3 3SCLE 4DPXA 4I69A 4BA2B 1FFGB 4DR7I 1SV5B 5DLFA 1J5OA 3RYLA 1FX2A 4AL6A 2R2RA 4NXNJ 2DO4A 2C3YA 1FX4A 1SCJB 4P10A 3VR1A 5C2GA 4ECRA 4LFBJ 3Q6MA 1VRTA 2XWXA 4DQPA 1JLFA 2AJ1A 1HNWF 4LRBA 5KT6A 3GYNA 4YDDB 3V5RA 1TL1A 2Q1LA 3C6TB 1FHTA 3K2YA 3KG1A 3MECA 4OHVA 4ECWA 3CCUS 3OSPA 5ETPA 1WI6A 3EVWA 4TY9A 1QAYA 2WVFA 3Q24A 2GJIA 5A8WB 1PC5A 4RWWA 3P8BB 4B9UA 2JZ5A 2HFVA 3K8VA 2J8SA 3NCQA 4FPRA 4LFAJ 4LF8J 4Y00A 1FKPA 4OZ1A 2VJVA 4YHHJ 2O1VA 1IBKI 2YH0A 4X4QA 2CIMA 2MYFA 4I2PB 2UU9I 2CVIA 1RACB 1HNXE 4DX6A 3KHLA 4H4KC 3NS5A 2PO4A 4KQZA 5KFOA 2AYBA 2L9WA 3LGMA 4LQ3A 4PU9A 3GFYA 3HHDA 3CWVA 2B4PA 4AE5A 4Q8EA 5C0XE 5EGYA 2DGVA 2V9KA 2VPZB 2LQBA 1U0HB 4E2FB 3J80Q 2GJFA 1NMEB 1AFJA 3EGNA 4IG0B 1D1UA 3HDSA 4OYAA 3WU3A 4DR3I 3KUHA 3DGVA 1XC9A 4ZN3A 3P5BP 2IRUA 1QLNA 1BHNA 3T9NA 2LQJA 3FEZA 3ZXWA 5E41A 1NHKL 3DHWC 1E6YB 4BS2A 2ZE2A 3MEKA 4C8YA 1Q8BA 2IM1A 1BC6A 5JEAE 4IFDA 2GO9A 3HHLD 1SJ3P 1NU4A 2CQ2A 4TXSA 5DQGA 3A3PB 1S6PB 3G71S 2V9WA 4I2QB 2G0JA 1JLBA 3LAKA 3TZWA 2KFZA 2FZKB 2XYGB 3BKTA 4GVLA 3O1LA 4J37A 3KHGA 3SV4A 1T03A 2F4VJ 2OELA 1NRKA 2IDLA 1VBZA 2C2EA 4H4OB 3P3GA 2NXUA 3UFCX 1YI2S 3PS1A 1Z0CA 2GMLA 3M6XA 3BSOA 4C4WA 5KFTA 1T0TV 3GWCA 3SFUA 4I6WA 4ZP7A 3ZNJ1 1RHKB 5GMDA 4ED6A 4A8QA 1FJGJ 3FVYA 4X65E 1V3ZA 2M70A 3FEYB 3KKFA 4XDCA 4B3RJ 1RYRA 1FJCA 1RT2B 4DR7E 2HW3A 3G2XA 1YKWA 3M6UA 1WC1A 2QFIA 3M05A 3T6JA 2EWHA 3Q86A 4IOBA 4OQJA 4Y2AA 4CYUB 2V4QA 2BM1A 3IGNA 3MPUB 1FDAA 2M88A 4MJKA 3R7NB 4IRDA 4JI4I 3TAQA 1U45A 4C8OA 4V19J 1N5SA 2HG4A 5FDLA 4OI1A 2D3O1 2VF3A 4LR8A 4CO3A 1FNXH 4NI2B 3QJLA 1JXVA 5D0GA 3D67A 5THWA 3E2EA 1HW8A 1SJQA 4N3OA 3H8YA 4DFKA 1PVGA 3GZ7A 4FP9A 2K1RA 2AJ2A 2ALYB 3R6GB 2CWKA 3NZKA 3OJUA 1IWGA 4AL5A 4FW7A 4J9VA 4LSNB 4F2SA 1B0PA 2CKWA 3MAAA 1VBYA 2FGOA 1VQ5S 4PRFA 4M5LA 3M6VA 3W64A 2BA1D 3HP6A 1KEKA 4GKKI 1FF2A 1XNRI 1XMOJ 4OYPA 2X1AA 2MZQA 2W9BB 2Z5EA 2QYCA 2QE5A 1W7WA 1VK8A 2LEPA 1BLUA 5C0XC 3TEGA 4X66E 2YWEA 1H74A 2BM0A 4HHUA 2NN6D 4DCOB 2LVWA 2DKOB 5DETA 2NLWA 2XY7A 3NOCA 4ILRA 1HQEB 3N4WA 2EFNA 4NEYA 3SFGA 3GJSB 4FDFA 4HACB 5A0YB 5KOXA 1CPZA 5CHCB 5E3QA 5FLXQ 3DLKA 4F4KA 1S4FA 4D3HA 3IS9A 2WNRA 2CQDA 2PMWA 4X4UA 4NMLA 1OS5A 1U1MA 2NN6A 2YTCA 3M9OB 4DHVA 1IBME 4F0HA 4I3HA 1RT7B 3M8QB 2DGUA 2XCPA 1NLKL 2YBVA 4MU0A 4JI6I 2KI2A 4UZBA 4C3KA 3OPKA 4CM0A 1WTFA 5F8LA 2OIHA 3HFZB 5B0AA 4K4UA 4Y6IA 1JLEB 1S48A 1RSCA 4LF6F 1DQ9A 2LYVA 2VBXA 1ZETA 1U48A 3IGVA 1UVJA 4AUKA 2XGPA 3PYDA 3KWMA 5KFRA 2ZM6F 4DSLA 3R2DJ 4ZIVA 4MK9A 3C14A 1IKYA 5CYMB 4X4RA 3A13A 1VC6A 2AF6A 4PR6A 3FBFA 1AUSL 1H7SA 2C2MB 2HQIA 2MQMA 4DV4I 4RW6B 3U1NA 4ECUA 4DR5E 5LSRA 5AJ3F 1BQXA 4C8NA 2LXUA 1MN7A 1YJ7A 5A8RA 1NK5A 2QX0A 2WONA 4L73A 1F9HA 2EXUA 4Y65A 3ZC4A 1X8DA 1ELOA 1U47A 3GCXP 4MYUA 4U9RA 1M5OC 1FDBA 2AT1B 5J2PB 4CO1A 4DV5E 2B4VA 3NY0A 3JSRA 2DHAA 1R8HA 1WC3A 1X4BA 2VC0A 1N6QA 2WRMA 2NPIA 4YB6A 4ILLA 2AWZA 4B3RE 3KG4A 2V68A 1UMJA 3CCJS 1QAXA 4D3GA 1PJ6A 3NNAA 1TUGB 5F8IA 2Q43A 2ZVSA 2RUGA 3AAWB 3HD2A 4Y34A 4ZPWR 4DPTA 3J7AN 4F8RA 3CDBA 2NUHA 1IR1A 3P6YC 2EFQA 3AOAA 5HO4A 2R7QA 5IC6B 4RW9A 5DQIA 3X1LB 2AYGA 2BR2A 3CJTA 3SQGB 1N34I 4RZRA 1Y7PA 1BY9A 3EX7B 2C22A 2J65A 1FWKA 2VD3A 5HVGA 3BO3A 2C3MA 2PN6A 2RU9A 4ED7A 3HJCA 3TX8A 1VQMS 1B0VA 1AROP 2OPQB 4WFXA 2BA9A 3EZ5A 4C6AA 2XY5A 2OPPB 1RWUA 4LF9F 1TTHB 4RW8A 1S1XB 1NB2A 3KLHB 4ENOA 4JI5F 5F8NA 1XNQF 1FKOB 4X64F 3CCES 2VQEJ 1U02A 1UETA 4Z37A 4ZLNA 1UEUA 1OQ6A 2PD1A 3WHIA 1RWKB 2GIFA 5AXNA 1NK6A 1Q0NA 4PQUA 3MR5A 1U6BA 2QMUB 4LF5E 1N5QA 1XNRE 1JLGA 2BZ2A 2I38A 3B54A 2OMOA 4URSA 4ES1A 1GTHA 3FSYA 1RAOA 3HT3A 1HQUA 1Q4RA 1VJWA 2O01C 2AGQA 1IWAA 2P9EA 4W4MA 1DAXA 2B3TB 5EX0A 2ZKUA 2W8KA 2CNLB 4DV0J 2RRNA 4LF2A 1FJEB 1HNZJ 4DV7J 2ILYA 2YNFB 2BOPA 2HHHJ 3MEEB 2LEBA 3R5DA 5A2QY 3OR1B 1E3PA 4WP9A 4AQYE 2JLEA 2OMLA 4OHWA 1LW2A 1V9OA 5GVQA 3OUYB 1PKPA 4MIBA 2HZAA 3LP1B 2CG8A 1RWXB 2YPYA 3M8ZA 4RX6A 2DRBA 1FRIA 2XGQA 4RNNA 2XLIA 1D9DA 1JX4A 4A8FA 1TFWA 1Z0VA 1GT8A 2M3DA 4FW4A 1NKBA 2AEMA 1QDUB 3WQPA 4PG8A 3DDIA 4HTIA 3RRGA 3DU5A 1Q5YA 4PABA 5KT2A 2HHWA 1XMOI 2PEBA 5K8MA 3BM7A 5KOWA 2N3OA 3B82A 4FW5A 4C98A 4TYBA 5JMNA 3KLEA 2QGFB 3FGVA 3W9JA 3MR6A 3R6LB 1KONA 4J9SA 2GV1A 4Q0BB 1JWWA 2JEBA 1FESA 2XMMA 3KFWX 3HFVA 2AW0A 3L7UA 2H4YB 3PRBA 4Y2MA 3RUBL 5L1IA 1HL6A 3ELHA 2E7XA 3DMJA 2QLWA 2AV5A 3T5HA 2OAUA 1L3UA 1EI1A 5KFZA 1XMQE 1YZ6A 4HTJA 5T7LA 3RBEA 5ADZA 1IKXA 4LF8E 4JI6E 4A46A 4G1IA 5LL6R 1FXRA 5LSLA 1NK8A 2J9CA 1H7WA 2ZD1A 4KHMA 3H1CA 4NLOA 5BR8I 3GB0A 1BUXA 2HBYB 4LVNP 2Y1JA 2MZSA 1K0TA 3CVKA 1JQGA 3HCXA 3L3CA 4A8MP 2KTQA 2BVZA 1SKUB 1C1BA 1S12A 4QQBA 5C42A 4JV2A 2KZZA 4IZJB 2VQFJ 4RW8B 4DFPA 2CPYA 4ZVUB 2CDRB 2WAQD 2Z57B 3DI6B 2QT7A 3C6UA 1GNKA 3D66A 4RR5A 3T1YF 4DR4I 5G0RB 3EDRB 1B64A 1BWEA 4F7VA 3NP5A 1EQ0A 4P2XA 1XMBA 4OO1B 4OO1D 1CSJA 4XTJA 2CPDA 2HQFA 1F9EB 3AB2B 2CG9A 3M30A 4QCLA 2N3LA 3CCMS 4KTQA 5KFUA 4PG7A 1PBAA 1S4EA 3PIOQ 3RAQA 1QD1A 3MPDA 3MM8B 3MGJA 4DUYJ 3EE3A 3K5MA 2DIVA 3DXBA 5H1SV 2BE2B 5C25B 3TQ1A 1N32I 3UDEA 1Z0EA 3CD0A 3F56A 1LWEA 1WF1A 2ZITA 2LEAA 1IKVB 4NEZA 1WKLA 5C0XD 4RO0A 2F4VF 3HK2A 4GKJE 2A10A 5HMYA 4C8ZA 3M7NG 1RAEB 5HBMA 5BR8E 2BEFA 3PW2A 1ZXNA 1SH2A 2KH9A 2CJBA 2RB7A 1DBDA 2DRAA 5E3PA 2J0QD 5HJXA 3CJKA 2GS8A 1PO6A 3S6EA 3H4LA 2NZCA 2IHR1 2WB1D 1JLQA 1SC4B 1TKZB 4LBPA 1KRPA 1R0AB 2E9ZA 4PQUB 1Z0BA 4P6QA 3LUYA 4F4AA 1LW2B 5CYQA 2XLJA 4DR5F 1SBRA 3H59A 1W25A 2R7OA 4WXWA 2IM0A 4Z2XA 1SIZA 4LRDA 4O4GB 4CH0S 4CO0A 3CMES 5LMNI 1GMWD 4ITSA 1ACMB 3W2WB 4EZ9A 4M5JA 4DCJB 2QFJA 2IYIA 5B0EA 3UWTA 5EWFA 4R5PA 1ZXMA 1NDPA 2RKIA 2WSCC 3M2RA 2GCFA 1J5EI 3MAQA 2IJRA 2P5VA 1HNIA 4OYBA 2AGPA 4MKYA 1UTAA 3A8JA 3AA8A 3VAFA 3TI0A 1MU5A 1KC8T 4GKJI 1VRTB 4CLLA 4NCGB 1U1KA 3F44A 2XHCA 1XMOE 2H54B 4DL4A 2ZDOA 4DV3J 3LWMA 2DISA 4UOHA 3SCJE 1YJTA 4S0MA 2CGEA 1X0FA 5IFMA 5K14A 4AFFA 1BQMA 1TUVA 2B9YA 1X4AA 3V81A 2H5EA 4B3RF 4KYZA 4JI8E 4O0NA 2LU2A 2BANA 3TX0A 3FDSA 1XWLA 3QO9B 2ZM6J 4DPUA 3NCPA 3QSYB 4BA1B 4ZPBA 1NO8A 3NGSA 2R4FA 2OPSB 3UW1A 1E6VB 4F50A 3RR8A 1B0TA 2YNGB 4WU3A 3KK1A 2DR9A 4KRWA 1UA1A 2VA2A 1P1TA 2QO3A 2ZKTA 2G2ZA 2E66A 5HL7Q 2BJ1A 3DLBA 3CCQS 1N54B 1ZAWA 2BKNA 4UQGA 2E5JA 4XPEA 4LFBF 5KG1A 4K0KE 3ITHB 4NXNF 4UUWA 4JI5E 3PNIA 4K5SA 4NLVA 1VQOS 4DZDA 3D68A 3QAEA 3HHNB 3MAAB 3G8TA 1CEZA 3IN5A 2VQEI 1AXQA 2FJEB 3MM5B 1FTRA 3PRDA 4YEAA 3AJ1A 4HH1A 5BR8F 2E9RX 1SVDA 5DROA 2RT3A 4X62J 4LF7I 1RTHA 4I0WA 4DV0E 1HBMA 4F2RA 2ADCA 1REGX 4PKDB 4JV1A 3NAIA 4DSJA 1KQSR 2BKOA 2CG4A 5D3GA 4QYZK 2ZBCA 4ED1A 1VQ6S 2ADBA 2HK3A 3CDUA 2DHSA 2A0FB 1S6PA 3M9NB 2W2QP 1F2GA 4RBTA 3VV2B 5B0BA 4N77A 4EI2A 2OTJS 1VFJA 1SJRA 3IRWP 1HWKA 3Q23A 2PFFB 4DN0A 3OFFA 3POTB 1XR7A 2DNOA 4UZCA 4MK8A 5HP1B 3GILA 4DV5F 1T9VA 2Z2YB 4PZVA 3SZ2A 4I6YA 5AXLA 3TYTA 1SPBP 1OIAA 1HI1A 3PYEA 2KYXA 4IG0A 3BYPA 2XQCA 4DV1J 2J6TA 3JAMC 4IOAQ 1PYTA 4BWMA 2GIQA 3FCVA 1S9FA 3PS3A 4OHXA 4I6AA 4KH0B 2X3DA 5B0CA 2V2ZA 3PTWA 4DV3I 1P8GA 1LQ9A 4DL6A 4DJBA 1WOSA 1X5TA 4KO0B 5A2QC 1QY7A 3MM9B 2R42A 3J81Q 1HNWI 2CJAA 1HNWE 5LMUI 3MCSA 1D6TA 2XM3A 4ZCMA 3OFGA 3CCSS 3UD3P 1I94F 3IWNC 4JBCA 2B6AA 4LF9I 1VQYA 2FB0A 1Q79A 2VV5A 2CDQA 4PPDA 1MMDA 2VICA 3IP0A 1K9MT 1WHYA 4KKOA 3MPWA 2KG1A 2GW8A 3MEDB 2DTJA 1G6BA 4LR9A 3G6ES 1P27B 3PW4A 2ATLA 2DR6A 4PXEA 2XS7A 4C7QA 3K5PA 4KKOB 1S1UA 2GAHC 4HXZA 3LP2B 4X4SA 5DM6Q 4Q43A 2XC9A 2ZH8A 5L1KA 1T3OA 5J1PA 2JNJA 2HQDA 1EP4B 2EC2A 4FYDA 2IOQA 4JI2E 1KFDA 5LXYA 2F4VE 2XYHB 3PJWA 1IJEB 3GQCA 1TK5A 1RDRA 1NK7A 3TWZA 1VJQA 5KFEA 2IJNA 5D15A 4DBQA 3HSGA 2HMIB 5LJ3Y 1UVNA 4JI4F 2WSFC 2W2OP 5KFIA 2DRDA 3U27A 3S8SA 2CQ4A 3FFIA 1N36I 1HR0I 3AHPA 2V50A 2PIIA 1S0MA 3OVAA 2YH1A 1VYAA 2MKSA 4NI2A 4QZVB 5EDWA 3WU5A 1S97A 4OX9I 2IERA 5D4PA 3THVA 1DQAA 4WKRA 3RAXA 4KHRA 1RA7A 1YBTA 3FFIB 1S57A 4JB8B 1R6VA 2EG2A 2FHJA 3FZ2A 3HSDA 3AXMA 3BSCA 4NYPA 3GV5B 3NMRA 5HQMA 2C37A 1WHVA 3DOMA 1KDNA 2A18A 1JLFB 1WTBA 2VBYA 4YY3J 4JI7F 4DL2A 1A6LA 2DIUA 5D4NA 2W9CA 1HNVB 2L08A 3ITHA 3T5JA 4NLYA 4LF9E 2MEWA 2QLXA 5FIIA 4L74A 3KNGA 1REVA 4OZ0A 1KWMA 2M8DB 3T1AA 2R7UA 3E8OA 3I0SB 4ED4A 4ES3A 2EFVA 3UN2A 2ASLA 2J6SA 1J27A 3WDOA 1B63A 1WDDA 4QPXA 6AT1B 2E5IA 4E98A 4J3DA 1FJGI 5F3ZA 1O0PA 2H5JB 3HI9A 2RE1A 4HI1A 3CJ8A 3TUJC 5IT9Q 3D28A 1FE4A 1ZAVA 1SH0A 2RDIA 2R3VA 4I7FB 1PKUA 3WX8A 5A8RB 5IT9U 1XIQA 3LPEA 4J9KA 4XIUA 3MM9A 4B17A 3K1JA 2BW2A 4R0EA 1ZBTA 3BO4A 1N36J 1TFYA 4C0OC 1KQFB 3VCDA 1IBMJ 2GGPA 4J9UE 3H90A 1V5IB 2O1UA 4IRCA 1CVJA 1UVMA 3A3OB 1FRMA 2RH3A 3ILOA 2YVSA 3O3LA 4BHQA 5E5NA 5SZTA 3K0JA 2C38A 1UFWA 2IMOA 2R8KA 3J80U 4NLQA 5HP1A 3NGDA 2ZJPQ 3IXQA 3ETMA 3KXDA 4NLSA 1TV6A 4USKA 2XMVA 4JI0F 2DR7A 1NHVA 2GHWA 4OMFG 3LO3A 4YMEA 1S77D 1KOOA 1HMVB 1PCAA 1VR6A 3RG6A 4LMZA 2AJQA 1F2HA 1T9TA 1RWPB 2LLZA 3TANA 4YHHE 4JI1J 2N4CA 3LGHA 3P45B 4KHPF 5GAHI 1NHIA 2V2KA 4OO1C 2D9PA 3LF0A 2DITA 1QM9A 1RJJA 4M94A 3MUTP 3K8WA 4RLEA 2PNZB 4IO9Q 4PAAA 3GFHA 3VGVA 4NLPA 1EP4A 1FEHA 3BDEA 3ETOA 1WF0A 2QSFA 2VHGA 3M2RB 1K8AT 2P6TA 4DV6I 2E7VA 2VFSA 4LCHA 4DUYE 2GHVC 4DV0I 2PA3A 3POTA 3G9CA 2DXDA 1HA1A 4FXVA 4N7TA 4R0JA 5L1JA 2FLPA 5K36E 1T9UA 3TQEA 4OO1F 3FQLA 3OBIA 2XSFA 1IJFB 1S0OA 4WZMA 3C16A 4CLYA 3CDJA 2UV8G 4PG5A 1ZM2A 1R8CA 3W8GA 3G96A 4NXMI 4GKKE 2C2KB 2OEJA 4YY3F 4F02A 1IBKE 2UU9E 2NYHA 4KE5A 4ZOSA 4O3NA 1R0AA 1JLQB 3PW0A 1IXKA 2OPRA 4PWUA 3TVZA 4CO5A 3RB3A 1HNXI 1KS2A 4IR1A 1TVRB 3Q8RB 2XNQA 3ZFVA 2V8VA 3TUPA 1FNMA 4XAKA 2OFHX 2IA0A 3HVWA 5KFJA 2RRBA 2F63A 2B8QA 3L7PA 4PEOA 3KLVA 4LSLA 1X7VA 2DGOA 3L09A 3G82A 3RZAA 4KGMA 2HIYA 2XNRA 5K36C 4GVBA 4ATNA 4O44A 1PAEX 3D5MA 2CPZA 5C25A 5F8MA 2PI4A 4FS2A 2A6MA 1RAHB 5ETMA 1KFSA 1JLAA 1RT4B 4CWBA 4IH7A 1L3VA 1CBKA 1ZM3A 4C3LA 5EUHA 2B7BB 1VS3A 1RT6B 2FC9A 2K06A 2YKMA 4FVMA 1C1CA 1FI4A 1X31C 1D8YA 2ZBKB 3Q0AA 2E5LE 2LKZA 2UUCI 1HK7A 4RW7A 3T5LA 1QAJA 3VZHA 4JYAJ 4IFDE 5K36D 4OO1A 2LP4A 4R8UA 2VUGA 4X62F 1LEOA 4AD6A 3FSXA 3R5JB 2CQHA 1XR6A 3SSRA 2ZOGA 1USVA 2YKOA 2DH8A 3I32A 1OPZA 2ZBPA 1S5ZA 3BV8A 4DXLA 3BQ1A 2R8JA 2GAGC 1APSA 2D3ZA 3P06A 1P6TA 1UEKA 1VQKS 4QR2A 4ZVTB 4OX8A 1S76D 3EICA 1LWCA 8RUCA 2V2QA 2MZJA 3M8PA 2XO6A 2QA4G 3K85A 3E01A 3HULA 2IVFB 3ZZZA 4CI0B 3R5BA 1KTQA 4K5RA 3LP0A 4F04B 4XPCA 3G6YA 3CJRA 4AQYJ 4RU2A 2JL9A 4DV4J 1S1UB 3QGIA 3HHEA 4J9NA 1TZ0A 1VK3A 2HNYA 3LOUA 3R5CA 4TLRA 2FJBB 3SMZA 1RCXB 2MGZA 1F6TA 2F1FA 2ZH6A 2L9NA 3R97A 2DGTA 2QSWA 2YWHA 4YUDA 4DI6A 3PO4A 4V19X 5E33A 3QMQA 1QJHA 2WVCA 1EIYB 4Q0BA 2HAFA 5DGAA 1LK5A 4CM2A 3RW6A 1EX8A 3MAHA 3O6QA 3IA0A 1RK8A 4ECVA 1ZZNA 4LF6J 1NZ0A 1OYRA 2DNZA 2HQ3A 2AYEA 1WJ9A 4LSZB 3QRPA 3ENWA 2MB0B 3J7ZT 2E1CA 2W7OA 4NXMJ 2D9OA 1RWOB 1CULB 2E1MC 1UJ5A 2BXJA 5J2QA 2UP1A 2Z5CB 1Q82T 4ECXA 4KY3A 3JAMQ 1NBEB 2HKEA 3TZZA 4TQSA 5KFWA 5D0HA 1GK8A 5DZ7A 4JUZA 3MMBB 2M2BA 2B4UA 2OO4A 1PYOB 1U8WA 1X5PA 2SXLA 3ZZTA 1RAIB 3N6NA 3UD5A 5FJ4A 4GC7A 5C42B 2AJFE 2HBQB 2HS4A 4H4MA 4WYWA 1NSQA 4RW4A 3V6DA 4FPIA 2ZZTA 4ZCIA 2DD8S 5KT5A 2UXDE 4NXME 3ZTOA 1WC0A 2UXBE 1M1HA 5EHHA 1RI7A 2U2FA 3PKYA 3W8PA 1I5OB 5T41A 4DR6E 1KD1T 2QL9B 2C42A 1FDDA 3UVJA 3BR9A 5LJ5Y 3KLFA 2QA4S 4PRVA 3EZUA 3Q89A 3H5SA 1YLXA 3FEXB 1Y3JA 1IQTA 5I3QA 2MZRA 4USJC 3HKWA 3M1VB 4PUOA 3KRNA 2B4OA 5K8PA 1RHMB 2Q3PA 4IYQA 3KHRA 3PIPQ 2XYPB 4NA1A 4NZ7A 5IV4A 3BO2A 2VPYB 5IT4A 2R8GA 3QRQA 4IQXA 1UDQA 3M8YA 2DGQA 4Z7CA 3QZ8A 4IFVB 3F41A 1LWEB 2VFVA 2AZ3A 2WBMA 1IM4A 3JSYA 1S6OA 3BZQA 4MIWA 4NASA 1XMQF 1KTVA 3OTOE 2DCLA 3T1HF 1B70B 2CQ3A 1ZYQA 4K59A 3J7AG 2VC1A 5HN0A 1DRZA 2ALZA 4ECSA 2YWGA 1WF2A 2AYMA 1TMJA 1TKTA 2FHOB 4IFYB 4A47A 2ZH9A 3GYGA 1W2BR 4GMKA 1SJFA 2VOPA 2EBEA 4X66I 4BWJA 5I3UA 1V3RA 2VG6B 4P9SA 2VQEF 2ROPA 3HZGA 4OZJA 2HEKA 1XHKA 4F4XA 5DO2A 2EC0A 2Z5BA 1HHQA 1N32F 1EJ7L 4A8KA 2CJYB 1DLOA 4OO1E 1X60A 3WIUA 3PR5B 4DR4F 4DR3E 2UXBI 5J2MA 2HLUA 2OEMA 3CCRS 1UJ6A 2QG9B 2FVSA 5CQGA 1K1QA 4ZN1A 1O8BA 2W4DA 2CFXA 1KP6A 5J1EB 3PX4A 1SUQA 3J7YI 1G3OA 5KT4A 2PNZA 3FZBA 3QIPA 2KDOA 3PHEA 1IM6A 1HNIB 5A2QQ 3Q83A 4OI6A 2LA4A 2N4DA 4CLZA 2JC0A 2L48A 1KOHA 3IM8A 4MTPA 2EFOA 1LW0A 2ZH7A 2VASA 1XERA 2FLOA 2YNIB 1XMQJ 4DR3J 1ZH5A 4K2XA 2A2CA 2CQCA 4CT9A 2F1DA 2UUBJ 3IFEA 3HJFA 1FRJA 4UT4A 1UDNA 2EFPA 3KTQA 4J7CA 2YNIA 3PG9A 4M5IA 4CLPA 3GCWP 1HD1A 2H48B 3AQPA 1YDLA 2W7AA 1IUJA 1DTQA 4CDIA 1U4BA 4JI1F 1CJUA 3CO0P 5LOQA 2HHUA 3PYGA 3DD6A 1H0HB 3TRGA 5HMWA 5DG9A 2UUAF 3IWLA 4OX9F 4EMDA 2DPIA 1LWCB 5GADI 3UDLA 5C2CA 3OVSA 3DLGA 3GE9A 4FW6A 4LF8I 2UVUA 4ZLLA 3BBBA 4JI3E 2W2MP 3DN9A 4ER8A 4QWCA 2HVEA 2M9KA 2IC3B 4N8OA 2N82B 4ELVA 1FEEA 4JI0E 1EKSA 2HWIA 2K3KA 4DL3A 4DG1A 3W3SA 3HFKA 2OHDA 4ICLA 2LA6A 2CA9A 2Y0BB 4OHZA 4URGA 3PZPA 3R1LA 1HR0J 1EETA 4OLPA 3UO0A 5JVHQ 4AQYI 1YJUA 3GLJA 4KR0B 4HVZA 4QWBA 4DS5A 2WZ1A 1U2RA 2R7WA 3C46A 4X4TA 2ZNZA 3MPYA 2DO0A 5JVGQ 4U96A 3MWBA 4I64A 1AA1B 3DOLA 1KHVA 1R27B 2BMBA 4FVCA 2XZDB 3EXYA 3IBCB 1AZSA 1JLGB 4NPOA 4WK1A 3R9LA 4CYUA 4YFUA 2LECA 2MQLA 4LSLB 2P6SA 2MLXA 3MOZA 2LU1A 2HZCA 4DV5I 4F4WA 1U09A 3AB4B 2AJ0A 4IG3B 3OFHA 3TJ9A 7AT1B 2YWFA 4WCEQ 3Q8SB 4DV1F 5MAOA 3C2PA 3HVRA 5KFVA 3LNUA 3IG1B 4LPFA 3Q8UA 3EVOA 1SIWB 3L95X 5IM0A 1NXIA 1VQPS 5A76A 1VHFA 1ZPWX 5IWAE 3HKZD 1UW4A 4B3SJ 3O8WA 1XMQI 3C19A 4B3TI 4RW7B 2DVIA 2B56A 4NBQA 1HBUB 4JI3I 2C2OB 1HWJA 2MMYA 3HVAA 4DL7A 3V4IB 2Y9HA 1MWZA 4ZDNA 4DZ6A 3BQ2A 3N79A 5LL6d 5F9NA 1NZ8A 1TK8A 4YOEA 2O1WA 4LF8F 4QIGA 3VF0B 2MLYA 1PAUB 2ASYA 1CG2A 5A0YA 3VGUA 2JWNA 3GTYX 3ZZYA 5AE2A 2R8IA 1YHCA 5DRPA 3U1KA 2M7SA 4KFBB 5KFHA 1O51A 1C4CA 2VFUA 3BN7A 1I1GA 3T19A 4ELTA 1RHYA 3H40A 3MEDA 4UF4A 2LJPA 2I2YA 1T95A 4WUCA 1T9WA 5HQLA 5E7OB 3BGOP 2G0CA 2RUSA 3JS9A 2KXNB 3M32A 1FTCA 4AQYF 1JJ4A 4NCAA 2O3DA 4X4NA 3GR1A 3CNQP 3D3BJ 5ITHA 2YKAA 3LP1A 1RADB 1ZPVA 2OD4A 1ULRA 3BH7B 3IC1A 5G4DA 5CD4H 4CZCA 5K36F 1HIYA 4K4VA 1S9GB 2M5YA 2WK4A 2H51B 5KFPA 3PEHA 4I68A 4Q44A 1VLOA 4AT1B 4M5DB 4NCBA 2NCKL 4LFCI 2Y1IA 4G1QA 3NRBA 3VAMA 1I51B 1RBLA 2M0GB 4LF1A 3ZZUA 3H5YA 1L3KA 2IVYA 3ISZA 2CZ9A 3B4MA 4P7VA 1PSDA 3LTOA 2DNNA 3BKUA 3SI8A 4B9LA 4LFAF 5LMNE 1S79A 2KL8A 1BKNA 1RAGB 4U6PA 5J1NA 1G2EA 4B9VA 4MDTA 1FRKA 1SQGA 2IJFA 1WSRA 2BV3A 4K0KF 3KLHA 4QYZJ 1HR0E 1G4CA 3CD7A 2IVMA 2HVHA 2LDYA 2HK2A 4H4OA 4QIVA 3ZM7A 4DR2E 1KR4A 1N33E 1MWQA 1WKKA 3B6BA 3DGPA 3GP9A 1F5BA 2AHOB 3ADAC 1REVB 1HNWJ 4JYAE 1FDNA 3DLLQ 5JEAB 1RZMA 4R8UB 3OR2A 2DNHA 4DX8H 4ZHRB 3QT7A 3OL8A 2C3UA 2VG7A 1F60B 1N88A 1ZAXA 3DLJA 1C2PA 1TAUA 4MQYA 2JX2A 1T3NA 3MXHP 4JV5F 4JI8F 1PJ5A 3Q2SC 1FRLA 3N5BA 1HBUA 3DOKB 2Y8WA 1CC8A 2Z2ZA 3DOLB 1WEXA 5L8RC 5A8KA 5C24A 2RQ4A 3C66A 1FRXA 1N52B 2B9WA 2WSEC 3D1QA 2ZHAA 4URLA 4LRCA 4O23A 3RRKA 1BWVA 1T03B 4GC6A 2F7VA 3NS7B 1Q1KA 3HHLA 5KFDA 4DSFA 5LMNJ 2FJVA 4O3OA 4EU0A 2QV6A 3QGPA 5CZVA 5DZ6A 2J0XA 2J9DA 2BX6A 1WACA 4IG3A 1UFLA 1XJWB 1S6QA 4DG1B 3BN4A 2DNKA 4M5KA 4DSKA 4QPTA 3R1HA 2EPIA 3RR7A 3G86A 1Z0WA 2F4VI 2XBPA 2CZVC 3I5AA 1C0UA 4XK8C 3QQCD 4BC9A 2D1CA 5IQQA 2PO2B 1C0TB 4CH1A 3TARA 4KHPJ 2FJXA 3Q6NA 2R7RA 4B3SI 1NSPA 4CRJA 5HMXA 4XO0A 1QE1A 1S49A 3K57A 2JT2A 4JI1E 3M2VA 1MROB 4IDKA 3P49B 3BYRA 1U2FA 4M5DA 4BCAA 4DR2I 1CJUB 2IM2A 1O5JA 1RAFB 3MMCA 1RCOB 1OPIA 1RISA 2MHNA 3HVTB 3EUNA 2I1RA 4CLUA 3KK3B 5IT0A 2M52A 3B4DA 1FWPA 2G4BA 2IOPA 5CCMA 5K8NA 2BJ8A 1JLCA 4DPYA 3DRPA 4TKTA 4TU7A 5DM7Q 2JEIA 3PXGa 1DJ0A 2E1AA 3EYZA 3BSNA 5AE1A 3BPSP 3K7RA 3CC4S 2X1FA 3JAMU 2HQCA 1D3WA 4L75A 4RUHA 3SQOP 1XN9A 1WOOA 5DRQA 3HMJG 3ENAA 1HMVA 1N36F 3OTOI 3FMWA 5BYSA 3DDKA 4RL1A 2GNKA 2C2ZB 1YITS 3THPA 2EBGA 1HPZB 2M8HA 4HACA 1XR5A 4RJVA 4K4WA 4GKKJ 1HQEA 2HIQA 2NQPA 2MQOA 4MFBB 1FXLA 3ILIA 2RAQA 1A6FA 3VAGA 2Y1LB 4MKVA 3D0GE 2DGSA 4L3NA 5DS7A 4ZVPB 5KG0A 5B08A 4X66F 4W92B 4GKJJ 2ILZA 1JIHA 2UZAA 3M2VB 3MUMP 4JI7E 2I0XA 2GGPB 3FKBA 1K1SA 4ID8A 2GO8A 4LBIA 1N34F 1I94E 1FT8A 1YVFA 3UNGC 3EMTA 1R8BA 1HNXJ 1K0VA 4LSNA 4YY3I 1SC3B 1KLMB 3IR5B 4Q8FA 1GX5A 1VQSA 2JJ4D 4PXDA 1D9FA 2RS8A 5IWAF 5IXUA 1QZRA 2HNDA 5EKWA 2HBRB 4B3SF 1UVLA 3EGZA 1IR2A 1RT3B 2JSXA 2J0WA 3SCKE 5GAEI 5HQ8A 2DJWA 3EXCX 4M5HA 5LXRA 2BQ3A 3MM5A 2W24A 1HBOA 3MCMA 5A8WA 2HHVA 2UUBF 1V3SA 5FDLB 3RGIA 5DGBA 2Z5BB 5A8KB 4A8YA 2HS3A 2QLBB 4X4PA 1WC6A 4K4TA 1TMMA 3RRHA 3OHBA 1QTMA 4JI2I 1QAIA 4RWXA 3MM7A 2HGMA 1C0UB 4DR1J 1Y5IB 5DDRC 3QLHB 4WPAA 3V4IA 2C2DA 4OX9J 2DNYA 4X84A 4TQRA 1VQLS 4C48A 2UUAJ 1ZTWA 1YQHA 3I4HX 2JOQA 3BPDA 4ZVFA 1S6QB 2VBWA 4JI6J 3OLAA 4LF7J 2ZZMA 1VHIA 1SC6A 2HWTA 2KG0A 3CCVS 1XNQJ 4TU9A 5I4MA 1GMVA 4TVAB 1Q8IA 2BACA 2IAJA 4A8OA 3VALA 4JI1I 5CA5A 4ZVGA 2E5HA 2JE6B 1JKHB 1NDCA 4KT0C 4OYMA 5IM0B 2ZOFA 5T14A 2NZ4A 3IG1A 4RUCA 4E8UA 2L41A 4K2JA 1S10A 1HR0F 5FWKA 1V6HA 2GQ0A 1A0OB 4NLRA 3QFHA 5KFAA 1U1OA 3ZKDA 1F1BB 2KXHA 1HNVA 2E44A 2VKRA 4DF8A 3C8YA 2RS2A 2MSTA 1TAQA 4PG4A 1X5SA 1B62A 1HLWA 3H2UB 2BA1G 2HVIA 5D8HB 2GMHA 1UP1A 3MCNA 1RLCL 1DTQB 1S1VB 4ZVSB 2VG7B 2G1HA 4ZPVR 3F73A 4HT7A 3AQOA 1VC5A 3QT5A 5D4LA 4DR5J 1CULA 2R8HA 2Z2LA 3PY8A 4M1KA 5ETLA 3EVMA 2H4WB 2AEJA 3DYAA 2R7TA 1IBKJ 4DFMA 3O44A 2UU9J 3W2WA 1N33J 2AQ4A 3TR5A 4WWSA 2O3ZA 2YNGA 3D3CJ 3KDNA 4ID5B 4RW4B 3V6DB 5IT9Y 5F3TA 4JYAI 2J8AA 2HMIA 1WWHA 1S6UA 2AEFA 4DX5A 7FDRA 3FUYA 4O0IA 2ZJQQ 3PW5A 5F0UA 4F26A 3D9BA 1AW0A 1KVJA 3J80C 2UUBI 4PCQA 3GIKA 2CZ4A 1B99A 3NEKA 1QVGR 5CD4A 3QBCA 4B3MI 2HFOA 5J2QB 4NLWA 2FVCA 2ACYA 2MZTA 3NLCA 1DFDA 5JUMA 2F8HA 5KFXA 3PVXA 4GQUA 1GXTA 3AY0A 4PXBA 4WFZA 1K47A 2KN4A 3JQJA 3MTJA 3H2LA 5GAGU 5JJBA 3GIJA 3CF5Q 3RB4A 1RTIA 2RDDA 3OR1A 2U1AA 4B3MJ 3MEEA 4CLTA 1L5UA 3ENQA 2ZFHA 3MM8A 2B6AB 2OPPA 1H7UA 2HHPA 1Z5BA 1FA0A 4IOCQ 2CPHA 1TU0B 7FD1A 3GV8B 1LXNA 3L7ZB 4WTOB 4X64J 3LA0A 2FGCA 1T9XA 3DM2B 3KLGB 1T8EA 4FWHA 4AL7A 3L9ZA 5MLCV 1HNZE 1UDSA 2HHHE 2YWWA 1FO1A 3JXOA 3GJTB 3K17A 4QR0A 1VDHA 5KFMA 3CJ2A 4WKYA 2AZ1A 2ZHOA 3BF4A 2VB6A 2YQ0A 4KSEB 5E0OA 1DZ5A 4M8LA 3FNNA 5GAGI 2VIHA 1RU1A 3G82B 5EN1A 1M90T 1DLOB 2IFXA 4PUOB 4XTTA 3LQVA 2V94A 4DU7A 1Y6ZA 4C0HA 1TKXB 2XEXA 3V6JA 3CD5A 1XXEA 4JG4A 4DR5I 4LT6A 4ZLPA 3QJPA 4DV7E 1EHWA 4USIA 4G1PA 2L3MA 4OFZA 3I0RA 4TYAA 2V4RA 1F5AA 1VCTA 1UL3A 4N56A 1X9WA 3NNCA 4G6VB 1FFWB 2ZH3A 1IBLJ 1DARA 2HZVA 3CSKA 1M0SA 3SSQA 4C97A 1R0BG 4LFAI 4JI4E 1RTDA 3NGTA 4UOFA 4DV2I 1Q7YT 4FXDA 3BBFA 3DI6A 2H1YA 3C14B 4WP3A 1DTTB 2LCWA 4DR2J 1U1PA 1UJ4A 2BJ7A 5K14B 2CPJA 4NA2A 3W5ZA 2ZH4A 4P7AA 1W26A 2ZBRA 3NWRA 1P9YA 1IBMI 3UNYA 3RTVA 1V5VA 2V63A 3FBCA 5U47A 1CC7A 4X64I 2IDEA 4DR6I 3HSJA 5EWEA 3JQKA 2HHTA 2UUAI 2XMAA 2UUBE 5C0XA 2NXJA 3D0IE 1J2VA 1UAWA 2CQ1A 4IUFA 4JV5J 2HQGA 2F9DA 4IQMA 5EWGA 4QNKA 1S7HA 3MPVA 1R89A 1Y5YA 1AYEA 4MT1A 2FYXA 4DL5A 1T05B 5T7LB 4NWBA 1VBKA 2VDHA 3NOGA 4R5PB 2MJUA 1YRTA 3EJMA 2KRBA 1URRA 2EFGA 5HI7A 1KHWA 2YX7A 2UUWA 4CCHA 2R7SA 2WW8A 4OYXA 4NYZA 2IC3A 5DJBA 3QRRA 4LF6E 1JB0C 1VOMA 1I6JA 4QJVA 4OZEA 3W5XA 2YX1A 1RWVB 3BGUA 2JLGA 4X65I 4DV7I
chains in the Genus database with same CATH topology
2V2QA 4X65E 4YHHI 4DR7E 3HULA 2BM1A 4JI4I 1HNZI 2HHHI 4FWGA 3J7AG 2VF3A 4DV1I 3LPSA 4MYTA 1PVGA 1NZ0A 1FKAE 2J7KA 4DU8A 2UUAE 4LFBE 1NHJA 2Z5CB 3T1HE 4GKKI 1PIEA 3M6AA 4KQVA 2HKEA 2Z5EA 2NPFA 4X66E 1H74A 3F0NA 2BM0A 3ZZTA 4HACB 5FLXQ 2UXDE 4NXME 2UXBE 1H72C 1IBME 3PRYA 4DR6E 4I3HA 1Z59A 4PRVA 4JI6I 2ZM6I 3T1YE 3PYDA 4Z7CA 4LF6I 1H7SA 4DR5E 3OTOE 4DV4I 1KTVA 4IZJD 1KKHA 4URLA 4FN5A 4X66I 4HY1A 1ELOA 4MYUA 4LFAE 4DV5E 1XHKA 3ZZ0A 2Z5BA 4LF4I 4B3RE 2UXDI 4DR3E 2E1RA 2UXBI 4DPTA 5IWAI 2Q2EB 4JV5I 1MG7A 5A2QQ 1N34I 4X62E 4X62I 1FWKA 3HJCA 2A2CA 2PNLA 4UT4A 1Z0TA 4DR4E 3PYGA 4LF5E 1XNRE 4EMDA 4LF8I 1VISA 4JI3E 2ZM6E 4JI0E 4JI0I 4DV1E 4B3RI 4N3OA 4AQYE 4AQYI 1MX0A 1PKPA 4JV5E 1U2RA 2DEIA 3B8HA 5L3JA 2OI2A 4RPFA 1Z0VA 3B82A 4DV5I 1KVKA 3K85A 1ZM9A 1Y4SA 3LNUA 4LF4E 1RREA 4NXMI 1EI1A 5IWAE 2X7IA 1XMQE 4FWDA 2HFUA 1XMQI 2WW4A 4B3TI 4LF8E 4JI6E 4JI3I 5BR8I 1N34E 3T1YI 2O1WA 3PYFA 4PRXA 5LMNE 5GMEA 4IZJB 3JAMQ 4IZKA 1N33I 2LJPA 4WUCA 3J7AM 4DR4I 4DV4E 3QT8A 1J5EE 1Y4UA 4XTJA 2CG9A 1S4EA 2V34A 4WUDA 1N32E 1N32I 1Z0EA 4LF7E 2ZITA 4LFCI 1Z5AA 3WU6A 3ZZUA 2CZ9A 1ZXNA 3LTOA 4B3TE 2GS8A 3H4LA 4DUZI 1BKNA 1Z0BA 4DR1I 4UTGA 2BV3A 1HR0E 2X36A 2DEJA 2HK2A 5LMNI 3WU4A 3ZM7A 4DR2E 1N33E 1ZXMA 4DPWA 1NHHA 3QT7A 1J5EI 1IBLE 1IBLI 4LF5I 1XNRI 1MU5A 4P52A 5LMUE 4GKJI 4GKJE 2VQEI 1XMOE 4USMA 1XMOI 2CGEA 2A2DA 5BR8E 4JI8E 4Z7YA 4DPUA 1FJGE 3V2UC 1RR9A 1Z0WA 1EA6A 2F4VI 3ZKBA 4DUZE 1I94I 3Q6NA 4K0KE 4B3SE 4JI5E 4B3SI 4JI1E 4DR2I 4FW9A 4NXNI 4LF7I 3D4JA 2IOPA 3GONA 4DPYA 2HK3A 1N0UA 1KIJA 1FWLA 4JI8I 2AJ4A 1S16A 4IZJA 4HACA 2PNMA 4DUYI 3PYEA 1A6FA 3JAMC 4ZVIA 5LL6R 4JI7E 3QT6A 2V2ZA 5FLXC 2VQFI 4DV3I 1I94E 2UXCI 5A2QC 2R42A 3J81Q 1HNWI 4YY3I 1HNWE 5LMUI 1D6TA 1WUUA 2VQEE 1OJ4A 4LF9I 1QZRA 4WUBA 4NXNE 1B63A 4LFCE 2Z5BB 4HXZA 4JI2I 2Z5CA 2IOQA 4JI2E 2F4VE 4DR1E 3J81C 4JI5I 1HR0I 1N36I 4JI1I 1N36E 1USUA 3WU5A 4OX9I 5FWKA 4JI7I 2GQ0A 4KHPE 3ZKDA 2UXCE 1B62A 4LF9E 1ZM4A 3QT5A 4M1KA 4DV2E 4ED4A 1H73A 1FJGI 5IT9Q 4JYAI 4R1FA 2R3VA 2V2VA 3J80C 2UUBI 2VQFE 4LFBI 3K1JA 2E5LI 2UUCE 4K0KI 1XNQI 4B3MI 3B78A 4B3ME 4YY3E 2O1UA 1N0VC 1K47A 1Z0GA 4KHPI 4USKA 1H7UA 1Z5BA 4DPXA 1Z5CA 4YHHE 4DR7I 1NHIA 4FWHA 3Q6MA 2O1TA 1HNZE 2HHHE 3K17A 3V5RA 4IZKB 4DV6I 4DV6E 4DUYE 4DV0I 1Y6ZA 4DU7A 4DV3E 2XEXA 3OTOI 4JG4A 4DR5I 1ZM2A 4DV7E 3T1HI 4GKKE 1IBKE 2UU9E 2O1VA 1IBKI 2UU9I 1HNXE 1DARA 1HNXI 4LFAI 4PU9A 4JI4E 5IT9C 2HFSA 3CWVA 1FNMA 4DV2I 3J80Q 4HYMA 4DR3I 3WU3A 4P7AA 4X64E 1IBMI 4X64I 4JYAE 4DR6I 1ZM3A 2UUAI 2UUBE 1FI4A 2ZBKB 2E5LE 2UUCI 3Q1QA 1XNQE 1HK7A 2HKJA 2EFGA 2V8PA 4OX9E 4DV0E 1USVA 4DXLA 4LF6E 1Z0CA 3P06A 1UEKA 5GMDA 4X65I 4DV7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2Q A;  4X65 E;  4YHH I;  4DR7 E;  3HUL A;  2BM1 A;  4JI4 I;  1HNZ I;  2HHH I;  4FWG A;  3J7A G;  2VF3 A;  4DV1 I;  3LPS A;  4MYT A;  1PVG A;  1NZ0 A;  1FKA E;  2J7K A;  4DU8 A;  2UUA E;  4LFB E;  1NHJ A;  3T1H E;  4GKK I;  1PIE A;  3M6A A;  4KQV A;  2HKE A;  2NPF A;  4X66 E;  1H74 A;  3F0N A;  2BM0 A;  3ZZT A;  4HAC B;  5FLX Q;  2UXD E;  4NXM E;  2UXB E;  1H72 C;  1IBM E;  4DR6 E;  4I3H A;  1Z59 A;  4PRV A;  4JI6 I;  2ZM6 I;  3T1Y E;  3PYD A;  4Z7C A;  4LF6 I;  1H7S A;  4DR5 E;  3OTO E;  4DV4 I;  1KTV A;  1KKH A;  4URL A;  4FN5 A;  4X66 I;  4HY1 A;  1ELO A;  4MYU A;  4LFA E;  4DV5 E;  1XHK A;  3ZZ0 A;  4LF4 I;  4B3R E;  2UXD I;  4DR3 E;  2E1R A;  2UXB I;  4DPT A;  5IWA I;  2Q2E B;  4JV5 I;  1MG7 A;  5A2Q Q;  1N34 I;  4X62 E;  4X62 I;  1FWK A;  2A2C A;  4UT4 A;  1Z0T A;  4DR4 E;  3PYG A;  4LF5 E;  1XNR E;  4EMD A;  4LF8 I;  1VIS A;  4JI3 E;  2ZM6 E;  4JI0 E;  4JI0 I;  4DV1 E;  4B3R I;  4AQY E;  4AQY I;  1MX0 A;  1PKP A;  4JV5 E;  1U2R A;  2DEI A;  3B8H A;  5L3J A;  2OI2 A;  4RPF A;  1Z0V A;  3B82 A;  4DV5 I;  1KVK A;  1ZM9 A;  3LNU A;  4LF4 E;  1RRE A;  4NXM I;  1EI1 A;  5IWA E;  2X7I A;  1XMQ E;  4FWD A;  2HFU A;  1XMQ I;  2WW4 A;  4B3T I;  4LF8 E;  4JI6 E;  4JI3 I;  5BR8 I;  1N34 E;  3T1Y I;  3PYF A;  4PRX A;  5LMN E;  5GME A;  3JAM Q;  1N33 I;  2LJP A;  4WUC A;  3J7A M;  4DR4 I;  4DV4 E;  3QT8 A;  1J5E E;  4XTJ A;  1S4E A;  2V34 A;  4WUD A;  1N32 E;  1N32 I;  1Z0E A;  4LF7 E;  2ZIT A;  4LFC I;  1Z5A A;  3WU6 A;  3ZZU A;  2CZ9 A;  1ZXN A;  3LTO A;  4B3T E;  2GS8 A;  3H4L A;  4DUZ I;  1BKN A;  1Z0B A;  4DR1 I;  4UTG A;  2BV3 A;  1HR0 E;  2X36 A;  2DEJ A;  2HK2 A;  5LMN I;  3WU4 A;  3ZM7 A;  4DR2 E;  1N33 E;  1ZXM A;  4DPW A;  1NHH A;  3QT7 A;  1J5E I;  1IBL E;  1IBL I;  4LF5 I;  1XNR I;  1MU5 A;  4P52 A;  5LMU E;  4GKJ I;  4GKJ E;  2VQE I;  1XMO E;  4USM A;  1XMO I;  2A2D A;  5BR8 E;  4JI8 E;  4Z7Y A;  4DPU A;  1FJG E;  3V2U C;  1RR9 A;  1Z0W A;  1EA6 A;  2F4V I;  3ZKB A;  4DUZ E;  1I94 I;  4K0K E;  4B3S E;  4JI5 E;  4B3S I;  4JI1 E;  4DR2 I;  4FW9 A;  4NXN I;  4LF7 I;  3D4J A;  3GON A;  4DPY A;  2HK3 A;  1N0U A;  1KIJ A;  1FWL A;  4JI8 I;  2AJ4 A;  1S16 A;  4HAC A;  4DUY I;  3PYE A;  1A6F A;  3JAM C;  4ZVI A;  5LL6 R;  4JI7 E;  3QT6 A;  2V2Z A;  5FLX C;  2VQF I;  4DV3 I;  1I94 E;  2UXC I;  5A2Q C;  2R42 A;  3J81 Q;  1HNW I;  4YY3 I;  1HNW E;  5LMU I;  1D6T A;  1WUU A;  2VQE E;  1OJ4 A;  4LF9 I;  1QZR A;  4WUB A;  4NXN E;  1B63 A;  4LFC E;  4HXZ A;  4JI2 I;  4JI2 E;  2F4V E;  4DR1 E;  3J81 C;  4JI5 I;  1HR0 I;  1N36 I;  4JI1 I;  1N36 E;  3WU5 A;  4OX9 I;  4JI7 I;  4KHP E;  3ZKD A;  2UXC E;  1B62 A;  4LF9 E;  1ZM4 A;  3QT5 A;  4M1K A;  4DV2 E;  4ED4 A;  1H73 A;  1FJG I;  5IT9 Q;  4JYA I;  4R1F A;  2R3V A;  2V2V A;  3J80 C;  2UUB I;  2VQF E;  4LFB I;  3K1J A;  2E5L I;  2UUC E;  4K0K I;  1XNQ I;  4B3M I;  3B78 A;  4B3M E;  4YY3 E;  1N0V C;  1K47 A;  1Z0G A;  4KHP I;  4USK A;  1H7U A;  1Z5B A;  4DPX A;  1Z5C A;  4YHH E;  4DR7 I;  1NHI A;  4FWH A;  1HNZ E;  2HHH E;  3K17 A;  3V5R A;  4DV6 I;  4DV6 E;  4DUY E;  4DV0 I;  4DU7 A;  4DV3 E;  2XEX A;  3OTO I;  4JG4 A;  4DR5 I;  1ZM2 A;  4DV7 E;  3T1H I;  4GKK E;  1IBK E;  2UU9 E;  1IBK I;  2UU9 I;  1HNX E;  1DAR A;  1HNX I;  4LFA I;  4PU9 A;  4JI4 E;  5IT9 C;  2HFS A;  3CWV A;  1FNM A;  4DV2 I;  3J80 Q;  4HYM A;  4DR3 I;  3WU3 A;  4P7A A;  4X64 E;  1IBM I;  4X64 I;  4JYA E;  4DR6 I;  1ZM3 A;  2UUA I;  2UUB E;  1FI4 A;  2ZBK B;  2E5L E;  2UUC I;  3Q1Q A;  1XNQ E;  2HKJ A;  2EFG A;  2V8P A;  4OX9 E;  4DV0 E;  4DXL A;  4LF6 E;  1Z0C A;  1UEK A;  5GMD A;  4X65 I;  4DV7 I; 
#chains in the Genus database with same CATH topology
 1Y00 A;  2PO0 B;  4WBF A;  1NSA A;  2OUG A;  3GYX B;  1Q95 G;  3MI7 X;  4RW9 B;  3P4U B;  5EL9 A;  1NPP A;  4LRF A;  4ANC A;  4O3R A;  2B5J B;  3CTR A;  5K20 B;  3I55 S;  1RYS A;  3MUR P;  3TP2 A;  1YSJ A;  1UCN A;  2EK6 A;  1WEZ A;  3JSB A;  2XO7 A;  1WNE A;  1ZTT A;  1HNZ I;  2HHH I;  1HI0 P;  1GXL A;  2QMW A;  3N6M A;  2DNM A;  4WXO A;  3IR6 B;  4I7F A;  4Y3C A;  4DR1 F;  4IFD D;  2RDJ A;  4FW3 A;  2DH7 A;  1DHM A;  1WHX A;  3K89 A;  4NOH A;  1T94 A;  4MYT A;  4OLO A;  3SDE B;  3ZZO A;  3W1Y C;  2J7W A;  1R3N A;  4URQ U;  3WBZ A;  1JXE A;  4I56 A;  1WI8 A;  1FKA E;  1LNQ A;  1ZS6 A;  1GMW A;  2J7K A;  3DFE A;  4L76 A;  4PG6 A;  4DU8 A;  4O3Q A;  5KFC A;  3QZ7 A;  4WP8 A;  2UUA E;  3BDP A;  2E5L F;  2OP5 A;  5E3A A;  1NHJ A;  2K7J A;  3W66 A;  2NSC A;  3G6X A;  5HLF B;  3T1H E;  1Z2Z A;  3FSI A;  3TJ8 A;  3RBZ A;  5IWA J;  1HHS A;  2BAB A;  5D77 A;  3VAI A;  3S01 A;  3PM9 A;  1N48 A;  3M6A A;  2NPF A;  1QSS A;  4ZVE A;  1MU2 B;  1DTT A;  4JI3 F;  3F0N A;  1XQI A;  1X4E A;  1FVS A;  3PR4 A;  3M85 G;  2UVV A;  3DRS B;  5C7P A;  4DS4 A;  3CGI A;  4ZJQ A;  3EPI A;  5I3U B;  2KM8 C;  3HXM A;  1F3V A;  2G0I A;  3J80 Y;  4DUZ J;  2P9C A;  1H72 C;  3DYA B;  3ZZP A;  4A8X A;  4RNM A;  2MGZ B;  3UN5 A;  1Q16 B;  2PGC A;  3PKM A;  4LCF A;  2CQB A;  4H4K A;  3CDE A;  5B0G A;  1Z59 A;  3W7B A;  1KSP A;  1X4G A;  5B0D A;  5B09 A;  2NN6 B;  2BR0 A;  1SI9 A;  2MSS A;  1EZZ B;  2K2P A;  1HFE L;  2W4C A;  2D7S A;  3P5T L;  5IZH A;  5CAB A;  4CLK A;  3CC7 S;  1JNR B;  2Z30 B;  3Q8V A;  3CCZ A;  3GIR A;  3FCW A;  1ZA1 B;  3BB5 A;  3PX6 A;  4OI0 A;  1QVF R;  2AKW B;  2JEB B;  4KAI A;  3LGN A;  4U95 A;  3OL6 A;  1M1K T;  1HNZ F;  2HHH F;  4W90 B;  2PO1 A;  1OMS A;  2H3E B;  3SSS A;  1JLE A;  1H38 A;  1U26 A;  2POK A;  4ZVQ B;  2RHS B;  5ETV A;  1U0H A;  4JI0 J;  4LF6 I;  2WOM A;  1JLB B;  3MMA A;  2WTF A;  4A8W A;  2QA2 A;  3KUE A;  4IZJ D;  1IKX B;  2KXF A;  2E1P A;  1S9E B;  1TL5 A;  1O6X A;  2G2Y A;  2Q6B A;  2ZWP A;  3CB4 A;  4QWA A;  2FDN A;  3CXC R;  4DV6 J;  2DR8 A;  3JQM A;  2RF2 B;  2RML A;  4EYI B;  4FN5 A;  2OJ3 A;  4DPO A;  2OLW A;  3IR7 B;  3I87 A;  4J90 A;  4RKU C;  2F9J A;  1R6L A;  4XDD A;  4AYB D;  4IFD C;  1WOP A;  4FKY A;  3GJR B;  5AT1 B;  4DL0 C;  1SQF A;  5KFB A;  4BDP A;  4LFA E;  4P74 A;  3P76 A;  1W2I A;  2MZ1 A;  1VQ7 S;  1SJ1 A;  2FZG B;  2CVE A;  4Y2I A;  3D6T B;  4LF4 I;  5FD1 A;  1IKW B;  2CUY A;  4QW9 A;  3OSN A;  3VQT A;  2E1R A;  4DV1 E;  1OYD A;  2MKC A;  3FQK A;  3HHL C;  4KB7 A;  4L72 B;  3LAM A;  5IWA I;  1J5E F;  1S9G A;  2NXE A;  2Q2E B;  2CNN B;  4EK2 A;  4ECY A;  4K50 A;  1WDT A;  1X9M A;  1LK7 A;  1NCL A;  1WEL A;  3CWJ A;  2YY3 A;  3MDF A;  1MG7 A;  1NM2 A;  1RP5 A;  1LKZ A;  2AE8 A;  4PPZ A;  1IR0 A;  1SXL A;  1EB0 A;  1TL3 B;  4HI2 A;  5H9F K;  1S59 A;  4PYA A;  2ZC3 A;  1G7C B;  3N5F A;  4CTA A;  4G65 A;  3T41 A;  1JMT A;  2BOA A;  4BC7 A;  3TW0 A;  3HHL B;  4EO6 A;  4N5S A;  2UUC J;  4LFC J;  3QGH A;  2X1G A;  4FZV A;  3RBX A;  4U3B A;  2PNL A;  3QNW B;  2XWY A;  1Z0T A;  1F3F A;  2V8H A;  1FVQ A;  1YZ7 A;  3KJQ B;  5L1L A;  2HAI A;  2XLK A;  2XB2 D;  3Q22 A;  2HBZ B;  4UY8 5;  4FF2 A;  1EAY C;  3BJY A;  5KTQ A;  2YKM B;  3E3X A;  2LMI A;  3CJQ A;  2VPW B;  4X65 J;  1FKO A;  4JI4 J;  1EQM A;  4JYA F;  1B7Y B;  2IRY A;  3OR2 B;  1N5Y A;  3AJD A;  2ZM6 E;  5JEA F;  1FE0 A;  2B51 A;  3GSI A;  4F4Z A;  4FWG A;  4JI0 I;  1XEZ A;  1CJK A;  5KFY A;  3KYL A;  4U8V A;  2ZHB A;  2NYI A;  1OWX A;  2DNP A;  3BKF A;  2OFG X;  4YB5 A;  3VZI A;  2OH2 A;  4B3R I;  3C15 A;  4B3M F;  1NND A;  1U1R A;  4DCP B;  2EVZ A;  4YB1 P;  3Q8P B;  1HD0 A;  1UWB B;  2PC6 A;  5I3P A;  1UA0 A;  2BDP A;  2YKN A;  5K8O A;  1MX0 A;  4ETX A;  1GQE A;  4JV5 E;  2ZH2 A;  3MOJ B;  4ALZ A;  1L3T A;  5IS2 A;  3GSD A;  4EWT A;  2NN6 C;  1RT4 A;  2DEI A;  9RUB A;  2BRL A;  2N7C A;  4A8S A;  2JVR A;  9ATC B;  2W9C B;  4DR6 J;  3H98 A;  2WNR B;  2BQU A;  3B8H A;  4ZPT R;  1YJV A;  1RT1 A;  1NZA A;  3T6B A;  2R9L A;  1H2U X;  1HBO B;  1PYS B;  2GHP A;  2PMZ D;  3C3L A;  3CJ4 A;  3IRX A;  4GRS A;  4AID A;  1RXO B;  1KVK A;  2Z0G A;  4KC5 A;  1LWF A;  1ZM9 A;  2J76 E;  2UV8 A;  4EEY A;  5D4O A;  4K4S A;  1WKJ A;  1B3T A;  2I9S A;  2XTJ P;  4UST A;  2GVZ A;  3NGU A;  3PEJ A;  4NLU A;  4X66 J;  4DDF A;  5KFF A;  4WZQ A;  1M5K C;  3GG0 A;  1NH7 A;  3LPY A;  2X7I A;  4PQA A;  1QUV A;  5C24 B;  4FWD A;  4I2Q A;  1U25 A;  1CLF A;  5DRK A;  4P75 A;  3CCT A;  4BA2 A;  3OTB A;  1Q78 A;  4FYW B;  3HT0 A;  2CJX B;  4F4Y A;  1N34 E;  3HJV A;  4NE9 C;  3T1Y I;  3OHA A;  1GX6 A;  2F40 A;  3PYF A;  3QWP A;  4EFA C;  4FNH A;  3IBW A;  1I3O B;  3DLE A;  4PRX A;  1KLN A;  3QFW A;  3QPI A;  4LF9 J;  4IS9 A;  4G1Q B;  4ZP9 A;  2LQ5 A;  3ILJ A;  1FKA F;  4CO4 A;  4J9P A;  1BXN A;  1FFS B;  1IKW A;  1Z4U A;  2GX8 A;  2VDI A;  4LF5 F;  1XNR F;  4OKG A;  2BW7 A;  3A12 A;  3J7A M;  1Q5V A;  1QE1 B;  3QJJ A;  4B9M A;  1OY9 A;  3QT8 A;  4KH1 B;  3ZO7 A;  2VOO A;  3FJ2 A;  4F3O A;  2Q66 A;  4GKK F;  1Y4U A;  4LUB A;  4RBU A;  5HVF A;  5GAD U;  3TAM A;  4W98 A;  4HHH A;  3GIM A;  1TK0 A;  4CNZ A;  4OJ3 A;  3UR0 A;  1OYS A;  3SV3 A;  2E29 A;  3WZ0 A;  1OSD A;  2AD9 A;  1IBM F;  2MY8 A;  4ZPC A;  3KDO A;  3M32 B;  2DHG A;  1HQ2 A;  1RT5 B;  4FYY B;  1MLA A;  4KBI A;  2KVQ E;  4NRU A;  1N8R T;  1VI7 A;  4ECT A;  4J5O A;  4LF7 E;  5J2N B;  4DUT A;  4DV7 F;  2CQP A;  1CJV B;  2FY8 A;  3UQS A;  3M7V A;  1IBC B;  4NZ0 A;  2RIL A;  5HVH A;  2ABY A;  3FCH A;  1PIL A;  4WFB Q;  2BE2 A;  3UE2 A;  1TKD A;  1CS4 A;  2AX1 A;  2FD2 A;  2YX4 A;  2EI5 A;  5ETO A;  3V4M A;  2ZUG A;  3IM9 A;  1Y60 A;  2KHD A;  4B3T E;  3BR8 A;  2IES A;  3TZX A;  1RT2 A;  1A9N B;  4DUZ I;  3M8W A;  4CLW A;  1OYE A;  4DV2 F;  1QTN B;  5BYQ A;  5M2U A;  4JOU A;  2DNG A;  4C8L A;  2HVD A;  4QWE A;  1TR0 A;  3GG1 A;  3OXG A;  4UTG A;  3UPF A;  3KK1 B;  1PBU A;  4C11 B;  3CJ3 A;  1U7L A;  2V4J B;  5L9N A;  2X36 A;  1CQN A;  2DEJ A;  2VPX B;  2YPZ A;  3JTO A;  3ULH A;  4WIQ A;  4U8Y A;  1CJK B;  3D0H E;  1N32 J;  1R6Y A;  5ETK A;  2AP6 A;  1VQN S;  2EEY A;  4HDH A;  4DPW A;  2VA3 A;  2FJA B;  1NHH A;  5FLX Y;  4OZ5 A;  1UWA A;  1RUS A;  1NDK A;  4OJG A;  4OZL A;  3N28 A;  4QYR A;  5D0E A;  4YR0 A;  3HKM A;  4ISA A;  1IBL I;  2RU3 A;  4CO2 A;  2J9D E;  1SL2 A;  1OY8 A;  3R27 A;  2KFN A;  5F8J A;  2WVB A;  2PEH A;  1NAQ A;  3AOD A;  4F3Q A;  2GVD A;  4KGZ B;  2QL7 B;  3TZY A;  3JYT B;  3VAH A;  4DR7 F;  1U0S A;  2CQ0 A;  3BS9 A;  4ZHR A;  5HLF A;  4C2M A;  1YWX A;  3SEO A;  5RUB A;  4RNF A;  3G8S A;  2A2D A;  1Q86 T;  5IC4 B;  4Y2K A;  2Y1R I;  4B9N A;  3FBB A;  4RNH A;  3MFH A;  2RQC A;  3RAM A;  3P3D A;  4PWD B;  1G1X A;  2VQF F;  1Y3K A;  2CQI A;  3A8E A;  2LXF A;  2WVE A;  2DT9 A;  4O4R A;  3WX4 A;  3SDE A;  3W62 A;  3BGL A;  4PWW A;  1XK8 A;  2BAN B;  4OV6 A;  4ZIT A;  2QIF A;  4DQQ A;  1S0N A;  4I2P A;  3MR7 A;  4LFC F;  4P2M A;  4WE1 B;  4DUZ E;  1NJI T;  5CZX A;  4NYO A;  1AZS B;  2GO3 A;  3JSM B;  1LXJ A;  1TL7 A;  2O5D A;  3I9Z A;  5J1E A;  2YKQ A;  3DLG B;  3K5O A;  3KJV A;  5DG7 A;  4B3O A;  4B3S E;  3G6V A;  3O5T B;  2CWX A;  4NLX A;  4QIF A;  3H20 A;  3CPW R;  3WC2 A;  2KJV A;  1LFP A;  4DMZ A;  4K4X A;  1URN A;  3HO1 A;  3M85 D;  2BA0 G;  4FW9 A;  2RNE A;  3AH6 A;  3CCW A;  8AT1 B;  2KU7 A;  4NXN I;  1U24 A;  3MEC B;  3KNA A;  2M4M A;  2QJ3 A;  3CJS A;  4KGV B;  1HWI A;  1TL1 B;  3C6T A;  3OTE A;  2GQQ A;  5LSO A;  5JEA C;  3TEH B;  3D4J A;  2X3G A;  5F8G A;  1YJW S;  2G2O A;  2CAJ A;  3GON A;  1GXU A;  1YBU A;  1SKR A;  1HHT P;  4ED0 A;  3EWG A;  1D8Z A;  3BGR A;  4KIA A;  4DR1 I;  3UCU P;  3MUV P;  2J5A A;  1S9E A;  2D74 B;  1N0U A;  3SQG A;  3PAC A;  1IBL F;  1N56 A;  1X5O A;  3E01 B;  3UN3 A;  2K8G A;  1J5E E;  3D6H B;  2BKP A;  1F0X A;  3NNH A;  2Z56 B;  3TJA A;  3HLU A;  4JI8 I;  1S1W A;  4JV0 A;  2WP8 A;  3DC2 A;  4USV A;  5B0F A;  2IMW P;  1UZH A;  2YQ3 A;  3T1H J;  2CPX A;  3GPA A;  2R7V A;  5BYR A;  4DUY I;  3QID A;  2A3J A;  3DXS X;  2ZH1 A;  2VG5 B;  4TY8 B;  5E2Q A;  2KVI A;  1X0P A;  2XZT B;  2BE7 D;  2HSE B;  4M5M A;  2V0N A;  2X51 A;  3TVY A;  1RT1 B;  1SB6 A;  2ROE A;  4WFN Q;  2C28 A;  3Q2T C;  1RWN B;  2KT2 A;  2ERR A;  1NKC A;  2HHX A;  3P3C A;  4QNJ A;  2AX0 A;  4HL9 A;  2VQF I;  3W60 A;  1LW0 B;  1HAR A;  2QYG A;  2ZVI A;  3CIZ A;  2ZUA A;  2FC8 A;  3MEG B;  2VG6 A;  3ISN D;  5D78 A;  1UDO A;  1EAR A;  2BRK A;  4HDG A;  3U1Y A;  2RJZ A;  4MMO A;  1TKZ A;  2I6W A;  2VQE E;  3I0R B;  1OJ4 A;  3AD8 C;  5E3C A;  2MQQ A;  2W9A A;  4ED2 A;  3NCR A;  2F5G A;  2C3O A;  3Q1Q A;  1UWB A;  1Y0H A;  3ISN C;  1E6V A;  2QMX A;  1RTJ B;  1S1T B;  5ETN A;  5FLX U;  1OSC A;  1H6K X;  1TP7 A;  1NH8 A;  3OXL A;  4MIA A;  5J2M B;  3J81 U;  1VGY A;  4ERD A;  1GH8 A;  2G1D A;  1X4D A;  2GO4 A;  5DDQ C;  4YDX A;  3ENV A;  3MMB A;  4LFC E;  1UFK A;  2QZ8 A;  2WCX A;  4RBV A;  2W7P A;  3KJF B;  4DQS A;  1N6Q B;  4QU6 A;  3MF5 A;  1VRQ C;  3OD2 A;  2BQR A;  1RTD B;  2DNQ A;  2RSQ A;  4OZN A;  1M5S A;  4F0K A;  2MLZ A;  1DUR A;  3PJX A;  1OY6 A;  5BXI A;  4J9R A;  1KQG B;  2DGW A;  1T11 A;  1TKT B;  4OV1 A;  3J7Y U;  4N8N A;  2A1B A;  2BYC A;  2ZH5 A;  2P