1OJ4A

Ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
283
structure length
283
Chain Sequence
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE
publication title Biosynthesis of Isoprenoids: Crystal Structure of 4-Diphosphocytidyl-2C-Methyl-D-Erythritol Kinase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 85
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2003-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1oj4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1oj4A01
2ZITA 4B3MI 2NPFA 4P52A 5IWAE 1FNMA 1IBME 2A2DA 4X62E 1DARA 1Z5CA 5LMNE 5L3JA 3LTOA 1ZM3A 4JI1E 4LFCE 1NHHA 3PYFA 3B82A 5A2QC 4DV6I 3T1YE 2UU9E 4XTJA 5LMUI 1H7UA 1J5EI 2E5LI 1ZXNA 4YHHE 1XNQI 4OX9I 4KHPI 2VQFE 4B3TI 1N34E 2UUBE 4DV2I 4B3SE 4AQYE 2HK2A 4DR1I 4B3RE 3JAMC 3B78A 2UXDE 3WU6A 4USMA 2HFUA 5A2QQ 1H7SA 4JYAE 1ZM9A 2UUCI 3PYEA 1NHIA 3Q1QA 3PYGA 1PVGA 2UXBI 1N0UA 4LFCI 4DPTA 4JI1I 1IBKE 4DV5E 2ZM6I 1Z0BA 1Z0VA 3T1YI 4JI7E 3M6AA 1FWKA 4ED4A 2UU9I 2DEJA 4DV6E 1H73A 1Z0WA 4LFBI 3B8HA 3QT8A 2V2ZA 4YHHI 4RPFA 4FW9A 2F4VI 5LMUE 2Q2EB 3K1JA 4B3SI 4AQYI 2BV3A 1J5EE 1H74A 1XNQE 4OX9E 2UXCE 4KHPE 1H72C 4B3TE 4X66E 2OI2A 4DV0I 4LF6E 4LF9E 1WUUA 4DV2E 2UXDI 4ZVIA 3WU4A 4HACB 4DXLA 2R3VA 4JV5E 3ZM7A 4JI6I 2V8PA 4GKJI 2E1RA 4JI2E 3PYDA 1QZRA 1KTVA 4WUDA 4DV3I 4DV1I 2UUCE 1IBKI 4DV5I 1RREA 5GMEA 5LL6R 4UTGA 2UXBE 4JI7I 4DR2I 3OTOI 2ZM6E 3QT6A 2ZBKB 2HKEA 4X65I 1S16A 1FJGI 1Z59A 3HULA 2J7KA 3J7AM 4LFBE 1BKNA 1N32I 2DEIA 4DPUA 3ZZ0A 2UXCI 1Z5AA 2F4VE 1XHKA 3V2UC 4X66I 4LF6I 4LF9I 2EFGA 2V2VA 3ZKDA 3WU5A 1XMOI 1HR0E 4JI5I 4DUYI 3J80C 4Z7YA 1A6FA 4JV5I 4DR7I 1XMQI 1ELOA 1U2RA 4DV0E 1KKHA 1I94I 4JI2I 1Z0EA 4DR6E 2HK3A 2BM1A 4JI6E 4GKJE 1MG7A 2GS8A 1K47A 4JI0I 4DV7E 2HHHI 4K0KI 1VISA 4LF4I 1ZM2A 1KIJA 3WU3A 4DR5E 1FI4A 4DV3E 1PKPA 2WW4A 4DV1E 3LPSA 1N33I 3J80Q 4PRXA 3ZZUA 4DR3E 4WUBA 2A2CA 4FWGA 4NXME 4DR2E 3OTOE 4DPYA 4X65E 3ZZTA 1FJGE 2HKJA 3GONA 3D4JA 2HFSA 4MYTA 4PU9A 5BR8I 1FWLA 4DUZI 1HR0I 2VQEI 1N32E 1ZXMA 4I3HA 2UUAE 1ZM4A 1OJ4A 4HY1A 1XMOE 4JI5E 4DUYE 4P7AA 4DR6I 4DR7E 4MYUA 1XMQE 1B63A 2LJPA 4JI8E 1FKAE 1I94E 4X64I 1S4EA 1HNXI 2AJ4A 4DV4E 4DV7I 3J81C 1HNZI 1NZ0A 1NHJA 4FN5A 4DR5I 3ZKBA 4JI0E 4LF7I 4FWDA 2HHHE 4NXNI 4K0KE 1B62A 4LF4E 4LFAI 1XNRI 3T1HI 4HACA 2X7IA 4DR3I 4KQVA 2VF3A 1N33E 2CZ9A 4JI3I 4NXMI 4JI4I 4R1FA 3H4LA 1PIEA 4DR4E 3J81Q 1RR9A 5BR8E 1EA6A 4Z7CA 4DUZE 2UUAI 4UT4A 2VQEE 1MU5A 4DPXA 1N36I 4YY3E 4JI8I 3QT7A 1Z5BA 4PRVA 4DV4I 2X36A 1N0VC 4GKKI 4EMDA 1IBLI 4LF5E 1MX0A 4X64E 1HNXE 1HNZE 1Z0CA 2XEXA 4DU8A 4LF8E 1HNWI 4HXZA 4LF7E 4NXNE 4LFAE 1EI1A 1XNRE 3T1HE 5GMDA 3K17A 4WUCA 1UEKA 5IWAI 4JI3E 4USKA 4URLA 4JI4E 1IBMI 4DR4I 4B3ME 4X62I 3LNUA 3F0NA 5LMNI 5FLXC 5IT9C 3J7AG 3JAMQ 4YY3I 2V2QA 1N36E 3V5RA 3QT5A 2VQFI 1N34I 4LF5I 2UUBI 4DPWA 2BM0A 4HYMA 4JG4A 4M1KA 2E5LE 4B3RI 4GKKE 1IBLE 4FWHA 1D6TA 2R42A 3CWVA 4LF8I 5FLXQ 4DR1E 5IT9Q 1Z0GA 4JYAI 1HNWE 1KVKA 2V34A 4DU7A 1Z0TA
chains in the Genus database with same CATH superfamily
5KFJA 2YX4A 1D1UA 4F26A 4NE9C 4WP9A 1VGYA 4DV3J 4DV1J 2H4WB 4BDPA 2CKWA 4Y2KA 3UNGC 4DPOA 4EO6A 2LQBA 2DCLA 2AYEA 3CCQS 1RT6A 1NB2A 2C28A 1T3NA 5DETA 5LMUJ 2LU2A 4CM2A 2UUBE 3UD5A 4FW3A 3MF5A 2E9TA 2C3UA 3I5BA 2GMLA 4AL6A 1P27B 4FNIA 1JLQA 2W9CB 3NMRA 4RNNA 4GVBB 4X84A 1FEEA 1FRMA 4IH5A 2BQ3A 4N3OA 3BBBA 2HIQA 5ETNA 4M8LA 1P1TA 3NP5A 4IFDA 2LQ9A 1Y11A 1Z0BA 3PO4A 3QJPA 2KXFA 3MM7B 2OPPA 1ZPVA 3G6YA 2YKNB 1RWNB 1SJQA 5GADU 1H74A 1V3ZA 2HQFA 1JLBA 2ZNYA 4Y34A 4KHRA 4ZVIA 2HBYB 2UVUA 2DGSA 2MGZB 2E1RA 2XO7A 4P9SA 5F8LA 3M8QB 4L3NA 4J9OA 1SPBP 4IRDA 1G3OA 1HNXJ 3G71S 4O44B 2ASLA 1FJCA 3GG1A 4ECYA 2XULA 3M30A 3MPVA 1RGVA 1SI9A 2F8HA 1FDBA 2EVZA 3NGUA 4OIXA 1OO0B 2AJ0A 3H7HB 1KN6A 3RBDA 1HR0E 2Z0GA 1N5VA 1S1TA 2RQMA 4CP5A 2ZDPA 5LJ3Y 2Z5EA 1A6FA 1UEUA 2RILA 5G0RB 4DSIA 2O1PA 3U02A 2BJEA 9RUBA 1YZ6A 3CJRA 3N28A 4M5HA 4H4MA 2MZ1A 4P2SA 2CJBA 1F5BA 1RACB 1T9YA 2C42A 2WW4A 5C0XC 2V63A 4P10A 2CAJA 2B43A 3J7A1 3W9JA 5J2PB 1VJQA 2UVRA 3ITHB 1S6PA 3MEGB 2C3MA 2R2RA 2CPXA 3ENVA 5C25B 1AFJA 3OVBA 5F9NA 4Q5VA 4MYTA 3RTVA 5K36D 3Q89A 4DR4J 2KDOA 1U2CA 2H54B 4ECQA 4UY8T 5J2QB 2JEJA 3WX4A 4J9MA 4KAIA 2RB7A 2CPYA 3MMBB 4B3TF 3QATA 4YY3J 4PUOB 4QW8A 5KFIA 2XZWA 1IWGA 3P6YC 1Y00A 2ZUGA 1TV6B 2CQHA 3CC4S 2RDIA 1YBAA 3MUMP 3DLEA 2R7SA 3K2YA 4B3RJ 2GIFA 1FERA 1SKUB 1NCLA 2JWNA 2P9CA 1BC6A 1YRTA 3A12A 3IG1B 3ILIA 3CJSA 1VQOS 1QE1B 3DLGB 4K4UA 3DHXA 2W2OP 4CO3A 2CQDA 2OPQA 3VALA 2FZCB 2F5GA 4DS5A 2RAQA 5KG6A 2V50A 1S1TB 4RBTA 4UT4A 1FWPA 3M8PA 3SMZA 2J0QD 4QNJA 4LRBA 3KK3B 3W3SA 4WCEQ 1V5IB 4KGKA 1ITPA 2R7TA 5KFKA 4YB7A 4MQYA 1YJ7A 2C37A 2CRLA 4LF5E 4PRFA 4DR6F 4C98A 2XI3A 2RF2B 3QGPA 2BJ7A 3GU0A 1RTHA 4DU8A 4LF8E 4FVMA 1FXLA 3LP0A 5J1EA 5EGYA 2ZH4A 3JS9A 5DGAA 1WC0A 3CTRA 2GW8A 3MECA 4IR9A 2HSEB 3OLBA 4HYKA 2X1BA 3QZ7A 1XWLA 4DR2F 3OTOF 2RT3A 3TX0A 4UQGA 2WOMA 1UW4A 3CSKA 2XBPA 1R6MA 1JLAB 2YX7A 2HQIA 4A4JA 2UVVA 2BKNA 4LF6F 4LCHA 3KHGA 3I0RA 4EI2A 1U02A 4JV5F 2RU3A 1FKAF 1JJHA 4ZPWR 5EX0A 1N5QA 1B4SA 3T3FA 2HFZA 3MMAB 3DOLA 1S6UA 4R8UA 3VV2B 4LRFA 3P76A 4OO1E 2P2CB 3JXOA 2E1PA 5I3QA 2F8EX 1UDQA 4WZMA 3Q23A 2HWTA 2OPQB 4CLKA 2BE2B 1RTZA 1N6QA 2W4DA 1N5TA 1B7FA 3W60A 1KWMA 2I1RA 5L3JA 2IBKA 2V69A 3EXCX 1CQMA 3T5KA 5H9FK 2W7OA 1SH3A 3I55S 4QW9A 4WKYA 1RWOB 2H48B 3UVJB 3C6TB 2F63A 4PEOA 2JNJA 5GAHU 1EB0A 4OX9I 4KHPI 4DL6A 2EC2A 5K14A 1RTHB 2WVDA 3LP0B 5J1EB 4DUYJ 5HQ8A 1S6QA 1HHSA 1Q1KA 5K8PA 3MAAA 4P2MA 4CLZA 2OGUA 2FYXA 4I2PA 2AGOA 5FJ4A 2RKIB 3DXBA 2JEIA 2XCPA 1WKJA 1VC0A 1A0OB 5AJ3F 2VDHA 4USIA 2OTLS 4ZVTB 5KFPA 5B0FA 1Z0WA 1VBXA 2YX1A 4DS4A 5FLXY 1IKVB 3CC7S 1R6LA 5FWKA 4OX9E 4KHPE 3D66A 1FRKA 5CCLA 3NMAA 3D28A 3E2EA 1IQTA 1HWUA 1DLOA 1YJVA 3ZTPA 1WUUA 1T03A 4ZK7M 2X3DA 3WU4A 1O51A 4I64A 5KT7A 1TZ0A 2I2YA 4JI6I 4CH7A 4CO4A 3BYRA 4FKYA 2R8GA 1RI7A 2BOAA 4WUDA 3O8WA 2VFUA 2XS5A 4XPCA 5D0EA 3UN2A 2KXHA 4DR5J 5FLXU 1IBKI 4O3NA 1DTQA 5IWAF 2VFSA 3OTCA 1A6LA 3VGUA 1XN9A 1HI0P 3CCLS 4EBCA 1VIXA 2L48A 3D3CJ 2R8HA 3TZXA 5IV3A 3J7AM 3J7AN 3B54A 4DEZA 4OYPA 1NK9A 1OPIA 3CCJS 5K14B 4NPOA 5ELWA 2IA6A 2IFXA 2UUAJ 2DH9A 1S6QB 1X9WA 1KKHA 2MZTA 1I94I 3MOJB 1C1CA 4NWBA 4BS2A 3NG8A 3THPA 1YJNS 4JI6E 3DLKA 4KYZA 4CDIA 1F5AA 1T9TA 3ADAC 3FJ2A 4OL8A 2YNFA 2QO3A 4RW8A 1U7LA 3HMJG 3W2VB 2XLKA 1VBYA 4RWXA 1U1QA 3CJ0A 3JTNA 2CJKA 2HHPA 2AHOB 3MM9A 2B4PA 2FLNA 4X4TA 2K3IA 2HFSA 1RWUA 2VQEI 2IYIA 1B0TA 4DCJB 3NZKA 4FW7A 1T03B 1ZM4A 3TR5A 2M3DA 4RW6B 1IM4A 1J5EF 1LV5A 1HQEA 1WJ9A 2F65A 3H4DA 1I94E 3OVAA 1E6YA 1R0CB 3HFVA 3TI0A 2H51B 4FN5A 4PXEA 3HP6A 5L9XA 5T7LB 2XCAA 1MN7A 4DSFA 5KT6A 2CDRB 2XYPB 4DR3I 4LF7J 3R97A 3UDEA 3QGIA 5THWA 2PNLA 2FJAB 2LXIA 3KJQB 1RR9A 1ICEB 1ZS6A 4F7VA 3TZZA 2VQEE 2QLWA 1I51B 1N36I 2RE1A 1RKJA 1VCTA 1CJTA 3U1MA 3VWSA 2CNKB 4A8YA 4B9SA 4AQYF 3LP1B 2JEFA 1TVRB 1XBWA 3DLKB 4URSA 1D3WA 2LVWA 4YDXA 3CJTA 1EETA 4JV1A 1MWQA 2E5LJ 2LYVA 2HWIA 3BR9A 2VG6A 2BE9B 4NLQA 3HZEA 3HHKA 4DR1J 3IO1A 3I4HX 4RR5A 4Q43A 4FP9A 2BANB 1Q5YA 2V4JB 1UEKA 3M8RA 4I67A 4B3ME 1NJYA 4X62I 4K4XA 1RT4A 4DSLA 3M7VA 5FDLA 2NZCA 1UJ6A 1F9HA 3KTQA 1HQEB 4CO5A 1TL3A 3SCKE 3EPGA 1N36E 1DHMA 1SV5A 4X66F 5MLCV 5C0XE 3QQCD 2ZUAA 2K7KA 4U7UD 4IRKA 1X5TA 4YHHJ 1BXNA 5DM7Q 3MURP 3ET6A 4NI2A 4NLDA 3EGWB 1WC4A 3LA0A 2QGFB 1NZ8A 4LVOP 1IKXA 2E66A 2LDYA 1FDAA 3K5MA 1Z0TA 1YKWA 4JYAJ 1RWWB 1ZTWA 3IWNC 2KG1A 4OJ3A 1OQ6A 2DXEA 4MAKA 4X62E 2XG8A 2XLIA 2LQJA 2HBQB 4J91A 2NSBA 2FHKA 2ASJA 3DGPB 3P3DA 1JLGA 2ZC3A 3D0IE 2JE6B 4JI7J 4RBUA 5LMUI 3BGUA 3OR2A 4B9MA 3NWGA 2OTJS 1XNQI 1KLMA 2FTRA 4B3SE 1PG5B 2VG6B 3NCQA 2CQ2A 2AZ1A 3RBEA 3BGFA 2LA6A 1JK9B 3Q1QA 5A8WA 3PYGA 3K89A 1U0HA 3KKFA 3PRDA 4ZVPB 4FS1A 5FDLB 1WACA 3A8EA 1GNKA 3W8GA 3CNQP 4DQRA 2QN6B 1VK3A 3NLCA 4QCLA 4OZNA 5E3PA 3CW2C 5LMUE 2Y1RI 3K1JA 4JBCA 1VHIA 2YTCA 4ETZA 1XNQE 4HT5A 1H72C 1NH8A 2ZE2B 3IFEA 3LPEA 2UXDI 3T9NA 5EX3A 2F8MA 4GKKF 1UCNA 4Q7AA 5BYQA 3W5YA 4R0EA 2PO0A 4MH8A 5EKWA 4K4VA 4MIWA 2OUGA 1Y5YA 4DV7J 1U49A 5KFXA 2AX0A 3GMEA 3BF4A 3H90A 2Q79A 2VD3A 1ZBTA 2IOPA 1RREA 2KHCA 1VQKS 1JJCB 4X65I 3GYGA 4NXMJ 2M7SA 1L3VA 4HKQA 3KUEA 1HNVA 4DX7A 4DPUA 4ECRA 1KLMB 3W63A 3GILA 1X4BA 3ZXWA 1PYOB 1LW0B 3SV4A 2WK4A 1YJUA 2E44A 2JVOA 4K4SA 3SDEB 2JEGA 3UR0A 3US5A 2DYAA 4JI8J 3PX4A 5HVFA 1MG7A 4G1QA 1MLAA 3D5MA 4DV4J 2WNRB 1K47A 4M5MA 5KT3A 3CCTA 4I56A 2Y1JA 1U0HB 2QV6A 2QLXA 1N88A 3F56A 2MJUA 4HHHA 1N33I 2BDPA 4ZIVA 2J76E 1HNWJ 1KSPA 3H40A 1FRLA 3G87A 4J9PA 2XB2D 3GIMA 3GSIA 1IBKF 2V2KA 4Y2CA 2DK2A 2YQ0A 4X65E 3PCOB 3U1LA 2Y8WA 2R8KA 3KHHA 1IBCB 1BQNB 4DV6F 1K0TA 1LNQA 1TMMA 1NSQA 3HKZD 2MY8A 4WFBQ 2KFZA 2L41A 4TLQA 5MAOA 5LT5A 4FBTA 3AA8A 1VQ9S 1KS2A 4UOHA 4KHMA 5CZVA 4OQJA 1SKRA 5BJRA 4TU9A 1NHJA 3P96A 4IRCA 3UO0A 2G2ZA 2O1VA 4ID5A 3MTJA 4XDDA 2V8VA 4LFAI 1XNRI 5A76A 4HACA 3TRGA 1SQEA 1CJKA 1UDSA 3W62A 4IH7A 2JOQA 5HMXA 3KG0A 2UUCF 4I4BA 1N33E 3OSNA 4R1FA 4PXBA 3M8ZA 1LWEA 1HNVB 3ENAA 2YQ1A 3I87A 1UVKA 4DR4E 4KTQA 3MD1A 4QWEA 1VRTA 5KFVA 4A8OA 5KFWA 3R7BB 3FDSA 1RHMB 3H5XA 4CYUA 1S10A 4YY3E 5K36C 2FGOA 1KD1T 1TKTB 3OL9A 1VRUB 4TY9A 3HI9A 4IDKA 1NAQA 3EJMA 4KGMA 2JFKA 1P42A 4YR0A 3EZOA 1AB8A 3Q86A 3BQ1A 1WG5A 4LFAE 1WDDA 4WTYA 2HAIA 5DS7A 1XNRE 4PKDB 1T05B 2HHXA 3QPIA 1T7PA 2GZOA 4O3RA 1QDUB 1GMWD 4WZQA 1G4CA 2H65B 3BGRA 1TP7A 3UCUP 3PW2A 4DR3F 5KFRA 2XI2A 3OXFA 4H4KA 1M0SA 1FJGF 2DGVA 1A9NB 3R5CA 1QVFR 1Q7YT 3MPDA 2MQQA 3RJMB 2VA2A 4AUKA 1NJXA 2VOPA 1MROA 3SSQA 4CH1A 3PW4A 1NPPA 3C3LA 3HVTB 1N32F 4IFYB 4AFFA 5KFDA 2WP8A 4Q45A 2BZ2A 2CPJA 1BMQB 1N56A 1HNIA 4ZP8A 4JI5F 2AEFA 5ITHA 4DPWA 2DNLA 2IVYA 4BCAA 1XMQF 1N34J 2YNHA 3DRYA 2DR9A 1JLCB 3VAGA 4IFVA 3WHIA 4GKJJ 3DOKB 2WZ1A 2HBRB 2EFVA 3OR1B 1FRHA 1KNZA 2ZBQA 1TKDA 1WKLA 1B70B 4DDFA 4OO1B 1YG0A 4FNHA 3M85D 5F8JA 1TK0A 3N79A 3PIOQ 3W66A 3VAFA 1SJ4P 4A8FA 2XTJP 1SUQB 2BA0D 1EQ0A 3FSIA 1RCOB 3JTOA 1L3UA 4N56A 3HT3A 4QYZJ 4IDKB 5JEAB 2IJFA 4OI2A 3PHEA 4WBFA 3U7JA 1VQSA 3M32B 5DDQC 2CPIA 2ZH3A 1GXUA 2AX1A 1VBZA 1S77D 2O67A 1JLEB 4JI3F 3OUYB 4DPTA 4MIBA 1U4BA 2HZCA 5DG7A 4XIUA 3TVYA 3Q83A 3RRGA 2B6AA 2PA8D 3LQVA 2GQCA 2C2KB 2XGPA 1VLOA 1TFYA 2YNHB 2KRBA 1CULA 4RW9B 3BN7A 2NXUA 2DGOA 2GMJA 2DHXA 3ZM7A 2YWEA 5GAGI 2BXJA 2IM3A 4OLOA 3VZIA 5J2MA 2AZ3A 4DL0C 1F2GA 3OT9A 3POTB 1BGXT 1RAGB 2NXNA 3HDSA 1QSSA 2VPWB 3G9CA 4DV5I 1WOPA 2VIHA 5LL6R 1UEVA 1IM6A 1IBMF 3QT6A 2ASDA 3PRBA 5ETOA 2GC8A 2QEXS 3C6UA 3RW7A 3MCOA 2E7WA 2K3KA 3BPDA 4PXDA 3QIPA 1FESA 2HNYB 1ROFA 3ZKDA 1XERA 3SCLE 1GX6A 4M5KA 1M5SA 1S9EA 5GAEI 3HVAA 3KDNA 1ZM2A 1XJWB 3CMQA 2MKKA 4DR5E 3PV8A 1VJWA 1HW9A 3HVWA 5F8NA 2O3ZA 2B6AB 1REVB 3CGIA 2Z2LA 2HQCA 1N5YA 4QIVA 4TVAB 5IT9Y 2GIRA 1NK5A 3ZNJ1 2KT2A 2RRBA 2UUAE 3M8WA 1KEKA 4U7CA 3NAHA 5KFOA 4RW4B 2DGWA 4OZ2A 1B63A 2C2DA 3NEKA 3HKWA 3FUYA 2B9XA 2F40A 4ZOSA 1U09A 1UVJA 4LF7I 2KYZA 4TY8A 5KG2A 3CJ5A 1V3SA 2LLZA 3T6JA 4Q2MA 3SFGA 5IT9U 3OHBA 1Y4UA 1NBEB 3R7NB 4BA1A 2W4CA 3CO0P 2PEHA 4PQAA 1Q16B 5FD1A 3UNYA 1KTQA 2XNQA 2HHQA 4USWA 2EKNA 4KJIA 4CLWA 2H5EA 3AJDA 2VONA 2HURA 4WPAA 4LFBF 1JJ2R 1MU5A 4YR2A 4DPXA 4RW7A 1NPKA 4ED2A 1X4DA 3QT7A 4IO1A 4OHXA 2DCUB 2Z4PA 2ZKUA 3UCGA 1MX0A 1SB6A 5HROA 1D09B 1S48A 3M6XA 1Z2LA 3QNWB 4QNKA 3TAPA 3N0VA 4LF7E 2FHOB 4GQUA 3CD5A 3R1LA 1NB7A 1LK5A 3VGVA 3H42A 2LKZA 4C8OA 2AD9A 1WTFA 1X4AA 2PO1A 1Y0HA 3QSIA 2W7AA 1Q8LA 2C3OA 2MZRA 1Q4RA 1XMBA 4PQUA 4IG3B 3KLGB 2ILZA 3CJKA 1M5VC 4WE1A 3FMWA 3L7ZA 2NR0A 2KI2A 4ISAA 2KVQE 2M52A 3JYTA 5KFBA 2CG4A 2E5LE 4K4WA 1SBRA 3H2LA 2CGEA 5C0XB 4TU8A 4DR1E 4NA1A 2GJ2A 3M4XA 3N4WA 4JYAI 2YQ3A 1HBOA 2WONA 1RBOB 2NPFA 1JIHA 4V19J 1UETA 5F41A 4ATNA 5K8NA 3N9UC 5DDRC 3U27A 3VQTA 3O5TB 3BREA 3K7RA 1P8GA 4MU3A 4OHVA 4CRJA 3C46A 2GHVC 2MMYA 3C19A 1YSJA 2ILYA 1TMJA 1TL1A 5KFLA 2BBEA 1HR0F 3CJQA 1TL7A 2P8IA 2D7SA 4DL3A 4YHHE 3OJUA 2YKMB 3HF5A 3EPIA 4LQ3A 2HK2A 2PE8A 1VQ8S 2UXCJ 3RYLA 2KT3A 4M63A 2Z58B 2VC0A 2IJNA 3EVOA 4J7CA 3M8YA 2ROPA 2H5JB 4JYAE 3PACA 2CG9A 2BJ8A 4QPXA 3KLIA 1U2FA 4ED0A 4NXNF 4IFDD 4ZKAA 2PO1B 1ZM9A 1QAYA 5K36E 4OYXA 2WW8A 1SC6A 4LF4J 3GG0A 3PVXA 2EC0A 2AJ1A 2CVIA 1KHWA 1IR0A 4XDCA 4QWCA 2L9DA 4JI7E 3QMQA 4UOFA 3CO9A 4FYXB 4F4KA 3KLHA 2O1TA 1LFPA 4FF4A 4N41A 2AJFE 2NSCA 3C2PA 2FHMA 5BR8J 4U3DA 1UJ4A 2R2UA 3D1HA 1ZAVA 2R8IA 2R3VA 2BACA 3I0SB 2FJXA 2VV5A 2ZWOA 2ZZTA 4DR6J 3VZHA 1B3TA 1JXLA 1KTVA 2C2ZB 3A1YG 3A8JA 1OYPA 1PCAA 3KLVA 4JUZA 2Y8YA 1AT1B 3TANA 2KN4A 2MSTA 3KNGA 5LMNF 4DR2J 3IA0A 3HHDA 3B6BA 1SJFA 3TZYA 3J7YU 2JZ5A 2LMIA 3VVTA 2E7VA 1V3RA 3BYPA 5B0DA 1YZ7A 2B0GA 1ELOA 1U26A 4JI2I 3N6LA 4EYHB 1X4CA 4CH0S 2CWKA 3HJCA 4LF8F 2GS8A 4M5DB 1B7YB 4DV7E 3ISNC 1K8AT 2HHHI 1KIJA 4AM3A 3CJ2A 3I31A 3MHYA 3DD6A 4ES1A 2IAJB 4EBDA 5AE2A 3RRHA 4ZPCA 4QIGA 4K4ZA 4DV5F 4NXME 3IXQA 4MK9A 1USUA 1GT8A 2MQOA 1AYEA 2EPIA 4KV8B 3GE9A 1Q8IA 2GO4A 1ZXMA 3FKBA 4EFAC 1J27A 1PYTA 1FHTA 4NZ6A 5IM0A 3A3NB 3LW5C 2EKYA 3FNNA 1R6YA 1SXLA 2VG5A 1WSVA 4JI8E 3T5LA 4DG1A 1F1BB 4FPIA 5HATA 1X60A 4NBQA 4DV4E 2RU9A 3HM9A 3KJNB 5D4OA 3CIMA 3BN4A 3GV5B 3TAMB 3D0HE 4OO1F 3KLFB 4FWDA 2HHHE 2WSFC 3T1HI 4AD6A 1GMVA 2I9SA 3TA1A 3HHLA 3ZZRA 1YITS 1IKWA 3NY0A 2UXBF 2JC1A 3DRPA 4HVZA 2ZM6F 3Q8RB 2R7UA 2ACMA 2GVZA 4IQMA 3WIUA 2XSJB 5JEAF 1FFSB 4MKYA 4EZ9A 1YGYA 2JLFA 2CQGA 3SSRA 1NKBA 5KOXA 1MSWD 1RUSA 5DQHA 4NCGA 4PRVA 3ZO7A 3SCJE 5D4NA 1CEZA 2OPSB 1KFSA 1VIOA 2ADCA 3VHQA 3E01A 1H3DA 3AOBA 1C0TA 4LR8A 2W8LA 2J7UA 3CWJA 1NO8A 1WSRA 4RWWA 4A8WA 1DFDA 5LL6d 1HBMA 4TLRA 3T1HE 3W9IA 2XLJA 4QU7A 1RB0A 1RT3A 2VKRA 1KVJA 3ETOA 4QWAA 2MDAA 2IVMA 1WEZA 2YPYA 4ZPVR 4ED7A 3IBWA 5IM0B 3JAMQ 2VPXB 2GQ0A 3PX0A 3HD2A 1AZSB 2BR2B 2K06A 1U0SA 1V9OA 5C42A 5LOQA 4X4NA 2XMJA 5CABA 2BJ3A 1N34I 2NN6A 1NM2A 5JVGQ 2JEAB 1R43A 1R8AA 1M90T 4URQU 2LXFA 1D6TA 4J9LA 3W64A 4FYVB 3WC2A 4ZN1A 1KVKA 1TAUA 2MLYA 4NLTA 1RT1B 3ELHA 5D0RA 1KOOA 3A3OB 3CCUS 2CQ3A 2PO2A 2GVZB 2M88A 3TP2A 2B5JB 1AW0A 3R1HA 4W98A 4ECTA 4KY3A 2EXUA 3NGRA 1PC4A 4LREA 4DUZF 3KJVB 2DH7A 4RUCA 3CMES 3MM5A 1H7UA 3ZNUA 2CQPA 3P3GA 2V9KA 1K0VA 1N34E 5DRPA 2DKOB 2HHVA 5HL7Q 3I5CA 1J5EJ 4LBIA 5I3UA 3NNAA 4L74A 3C15A 2W24A 3FBFA 2PFFB 5E0OA 2KHDA 1VC6A 4F3QA 3EVWA 5HJYA 2DH8A 5D77A 2PNZA 2GIQA 4QWDA 3CDEA 4IUFA 4I6AA 4F50A 1NPRA 1YBTA 2CYYA 4I7FB 4JI4F 4JI1I 2OELA 1SIWB 2G0IA 1FA0A 1WKKA 1Q79A 3S8SA 2CUYA 3R27A 5C42B 2UUWA 2NS1B 3BSOA 1SC3B 2OPRA 3QLHA 1NK7A 3PKYA 4CO1A 4DV0I 1KRPA 1RK8A 1VQ4S 4RL1A 3Q8PB 4NLOA 1IBLF 2V0NA 3OLAA 3J7ZT 5I3PA 3C14A 1QZRA 2GQ2A 1CJVB 1HI8A 5HVHA 3FZBA 2FJBB 2ZJPQ 2BW2A 2OP5A 5DG9A 2VFVA 3D6MB 2MQLA 5ETQA 2B9WA 2YNIA 1F0XA 1VYAA 2U1AA 4YP3A 1RTDB 3I82A 1IR2A 2IMOA 2BYCA 3Q8QB 1CS4B 1KBRA 5M2UA 2IM2A 2J7KA 2DNYA 3TW0A 5DNLA 1IUJA 1RE1B 2N3LA 2BX6A 4LF9I 2EFGA 1XMOI 5D3GB 2UV8G 5C7PA 2VQFF 2HQDA 1K1QA 4DV0E 4RJVA 3M2RA 3BJYA 3GWCA 4CLSA 3V4IB 3D67A 2PNZB 1VOMA 4WFZA 2O1WA 2W25A 2EK1A 4PZVA 3WU3A 2VUGA 1NDPA 4DX5A 2CJQA 2CJ9A 4B3MF 5KAKA 3VAMA 3PFEA 2PNMA 5KFHA 4M5NA 4DPYA 3VAKA 5F0UA 3GONA 1X9MA 1ZZNA 5KFGA 4OV1A 4C8LA 2HWHA 4HI1A 2A6OA 5AE3A 5C0XF 3KYLA 2R8JA 7FD1A 5DG8A 1TFWA 1XMOE 1BWVA 4DV2F 4OHYA 1SQGA 4DFPA 1RT2A 2QMWA 4ZVEA 4B3OB 5HAOA 1R31A 2VPZB 2MQNA 4E2FB 4Z37A 4A8QA 3GR1A 2NYIA 3NL0A 4M5IA 4CLYA 3AB4B 2WBMA 1F6TA 2X1FA 3NCPA 1HQ2A 3WQPA 1NSPA 1UDOA 2RD5C 1HWIA 1MMNA 2ZH7A 1RWKB 1V6HA 3K58A 1QAIA 1FO1A 1QD1A 2FPHX 1H0HB 1LWFA 2F4VF 4B3SF 1UZDA 4J9VA 2BJ1A 1F9EB 1M5HA 3KLEA 4C8MA 4EMDA 5IT4A 3K5OA 1TKXA 4WXWA 2CJXB 3M6WA 4OX9J 3DRSA 1EIYB 4MT1A 2JLEA 3MM8A 5I42B 3RB0A 4CQ1A 1EJ7L 2QL5B 4DV3F 5H9EK 4DV1F 5KT4A 3N5FA 1YJWS 1WELA 2IYGA 3BDEA 5HBMB 3MMCA 4OZ3A 2XZTB 1R27B 2PI5A 5FLXC 1F60B 1FKPB 1EX8A 4H4OB 4UOGA 1RISA 5HP1A 1REGX 2W9BA 1BY9A 1HWLA 4LRDA 2AJ2A 4CLFA 4ZIWA 1C2PA 2DGUA 3AB2B 4O4RA 4QBUA 2C38A 2D9PA 4RZRA 2KG0A 5HVGA 2MZQA 1AUSL 3TEGA 4TU7A 1Z0GA 5KFFA 1OY8A 3PS3A 2RUGA 3FCHA 1S59A 2XQCA 3AT1B 4JI6J 1O0PA 4E98A 2ZD1A 5LSLA 4DL7A 1R0AB 2FD2A 2BJDA 2XMMA 5IXUA 5GADI 1XR5A 4M5GA 3SCIE 2Z5CA 1IBKJ 2C39B 3B82A 4F4ZA 3ETMA 1T94A 2MZSA 4IO9Q 4KFBA 3MZIA 2Z2YB 3FBEA 1FE4A 2WTFA 3CPWR 4F02A 1ZXNA 1BWEA 4B3TI 1HHQA 2DD8S 1ZA2B 3CEDA 4FF3A 3P3CA 1RTIB 3MM8B 4ZLJA 2O5DA 3PXGa 1N5SA 3CCRS 1HNXF 2GAHC 4ZLLA 3H5YA 4P74A 2B3TB 1I94J 2P6SA 4NZ0A 3EXYA 1H98A 1X4GA 3GIIA 3GMGA 1U1NA 4I6YA 2D3OR 5LM7E 4LFCI 3QSYB 1KHVA 4BA2B 5K36B 4C9DA 3FVYA 2UU9I 2DEJA 2FIUA 4EZ6A 3DFEA 4FW9A 4FPRA 4ECSA 3IMQJ 2UXCE 1JLFA 3I4PA 4B3TE 3AAWB 3LH2S 2AYMA 4ZPTR 4OZLA 2F7VA 2DNHA 5A6WA 2V8PA 2YWKA 3TJ8A 2VZ9A 1LFWA 1YJTA 1YLXA 4N77A 2HMIB 1IKYB 3HJVA 1U48A 2IY5B 3X1LB 4PWDB 3M6VA 3R3TA 1RXOB 4DR4F 4Y2AA 4IFDC 4DR2I 3OTOI 4TKTA 4DR3J 2XWXA 3ICLA 5KFTA 4S0MA 2IBOA 2NQPA 2RJZA 3RAMA 4CWBA 3FCWA 1FJGJ 5L1LA 3EVMA 4YY3F 2ZZNA 4LF6I 5F8GA 2FLOA 4YN3B 5D15A 4JV5I 3JSYA 2R7VA 3MUTP 3K5NA 3KMQA 4ZP6A 4B3RF 1N36J 4DR6E 1WI8A 3RRKA 1R8CA 4F67A 3BKTA 3A8KA 4OLPA 1R8BA 4F0HA 3M8SA 2HGNA 3I6PA 3EGNA 3CCES 2VDIA 2X1GA 2E5HA 2LEPA 4ANDA 2ZH2A 2DNGA 3KDOA 2XC9A 2DY9A 2K7JA 4DR2E 3OTOE 2N7YA 5CAAA 5D0HA 2HLUA 2W9CA 1HMVB 4R0JA 4X62J 4OYIA 1UTAA 3BZQA 1RP5A 3MM7A 4NLRA 3JQMA 2VC1A 2XY5A 3AODA 4C0HA 1SJ3P 4ER8A 4QIEA 1FKAE 4PXCA 2KZMA 2YKNA 2XS2A 3FQKA 3PJXA 1Q5VA 2ZH6A 3OBIA 2WB1D 2GGPA 3BSAA 1M1GA 2J0SD 1NDKA 4CCHA 4O3PA 3B4TA 3DU5A 2DY1A 3AD7C 1W25A 3RG6A 2MGZA 2ATLA 1GXTA 3EE3A 3M8QA 3L95X 4WK1A 3UWTA 2GMHA 1N52B 3H4LA 2KJWA 3UE2A 4O44A 2Y3YA 2KKHA 2B7BB 4Z7CA 4NLSA 2NCKL 2P9GA 2CPDA 3VGTA 3KK1B 3MEEB 3MR7A 2R7OA 1HPZB 2A0FB 2MXYA 2OEKA 4KB7A 3D6HB 2HFVA 3FZ2A 4QZVB 5LXYA 3ZTSA 1D8YA 1XNQJ 3I9ZA 4W4MA 2E1MC 1MU2A 1NEEA 1FT8A 3TQ1A 5G0RA 2CFXA 2W2QP 2BEFA 4HTIA 4UZBA 5IWAI 3LGHA 1VDHA 5IQ6A 2NN6F 3M7ND 3U1KA 3TX8A 3NRBA 3EUNA 5GAHI 2WHOA 1FDNA 1IR1A 2J9DE 5CD4A 1S12A 4WYLA 1NK6A 5HLFA 5J2PA 5CXTA 3ITHA 3K85A 1UVLA 4WIIA 2IDLA 1QLNA 3GJRB 3UN3A 3MEGA 2YBVA 5C25A 2UVWA 2KH9A 4DUYF 1SCJB 1HQUB 4DR7F 2GGPB 4HYMA 2QG9B 4M1KA 4ZJLA 3OL7A 3A13A 4Y28C 1PBUA 1KLNA 1KDNA 1Q82T 2FJVA 5J2QA 5FLXQ 4A8KA 5A0YA 4BC9A 2HFNA 4LT6A 3MMBA 2UXDJ 4PUOA 4JI0F 3SZ2A 3AD9C 4K0KF 1QVGR 1TV6A 4O4GB 1CSJA 1G2EA 5IWAE 4WWSA 1U6FA 2HRUA 1W7WA 3W1YC 5JXSA 2WCXA 2A2DA 1RT7B 4DOZA 5F0WA 3RGIA 1QTMA 2WVFA 1X4HA 3CMAS 3JTPA 2HAFA 5CZXA 1W2IA 3IG1A 4OI6A 1QE1A 2DXFA 3CULA 2LEAA 3DLGA 1S1WB 5IFMA 3I56S 2HRTA 4U8VA 4X65J 1R7IA 1GTHA 1J5EI 3AOCA 1NMEB 4RKUC 3U1YA 4LSLB 5DRKA 3ZTOA 4OI3A 4MKBA 6FD1A 1MU2B 1WI6A 5IC4B 3KK3A 1S76D 1SL2A 4Y0FA 3FEZA 4DR5F 4KRWA 3PM9A 3SXLA 1NNDA 2HVZA 3R7SB 1XIQA 3K5LA 3MEDB 2KFYA 3VR1A 5LJ5Y 3MAQA 2RF2A 2BA1D 2N4DA 1N0UA 2ZBCA 1T9UA 5HLFB 3MMJA 1NDLA 4OYBA 3T1YI 1N33J 2XYHB 4JP8A 1YRXA 1FWKA 1NK4A 2XNRA 3R5AA 2IERA 2V2ZA 3MCNA 2EBGA 3TZWA 2EK6A 2NLWA 4LFBJ 5HN0A 2XMKA 4ILLA 4AQYI 1HFEL 3GIJA 2KL8A 1J5EE 2LQ5A 4OYAA 1ACMB 2BA9A 2ZH1A 8AT1B 2E1AA 1JLAA 4B08A 4TNOA 5A0YB 3HKMA 5KTQA 3UD4P 2IRXA 2AYBA 3DNCA 1OS5A 3BQ0A 3BKFA 2KO1A 4M95A 1EP4B 3HCXA 4DSEA 2A1BA 4LBHA 5J1PA 2CIMA 5CA5A 3MTKA 2QYCA 1JX4A 1Y4ZB 4A8MP 4ZVFA 4C48A 3MMAA 5GMEA 4I6WA 2RSQA 3DRXA 3HSDA 2MKHA 4LFAJ 3HO1A 1W2BR 5J2NB 1XNRJ 4NLYA 5CYMB 2KM8C 1ZZFA 1I5OB 4LFCF 3DM2B 2BE2A 2F4FA 1LW2A 3BO3A 2EWHA 3E8OA 3PDNA 2UU9F 4X66I 1R8PA 2V2VA 2DITA 3DI6B 4Z7YA 4TN2A 2HGMA 1S9GB 2Y0BB 5KFUA 5EDWA 3LGNA 2AU0A 1S72S 1VQNS 3PRVA 4C8NA 3UVJA 1RHYA 3C6TA 4M94A 1LK7A 2JRSA 2W01A 4IOAQ 1GQEA 1FK9A 4FF2A 2N3OA 2AGQA 3ENQA 3LPSA 3IR5B 1UPPA 3ZZUA 2DHSA 2QSFA 3I96A 2PT0A 2B4VA 1L5UA 4EGLA 5IS2A 4ID8A 2RKIA 4USUA 2HKJA 2MSSA 2XMAA 2FLLA 1RWXB 2PA3A 5CYQA 4OKGA 1FWLA 2MPUA 1KC8T 2RIJA 3IWLA 3AD8C 2XM3A 5DZ7A 3KFWX 4WKRA 4MKVA 4P7AA 3SQGB 4LRCA 3UPFA 1SVDA 3GCXP 3IS9B 1IKVA 1XR6A 1PO6A 3FQLA 1WC3A 3QRRA 1B62A 4OX7A 1J5OA 3OFHA 4HHUA 4NXNJ 4ZVQB 3SQOP 5ETLA 4Q2LA 3OFFA 1SJRA 4OX6A 4EEYA 1YTYA 2O1UA 1LW2B 5LSOA 1PBAA 2OD4A 3NOCA 4NYZA 1NH7A 1QM9A 4WU2A 2V9WA 2Z5BB 1NSKL 1Q8KA 3PIPQ 1DQ9A 4I2QB 2C1EB 4RUBA 4GKKI 4IFDE 1N54B 1FK9B 2OEMA 4P6QA 2IJRA 2XEXA 4LPFA 4K7QA 3MR3A 3DN9A 2ZBRA 2JEBB 1DQ8A 5L39A 5KFCA 1HLWA 1U8WA 3K8WA 4QR0A 4F3MA 5CYQB 3LNUA 3UFCX 3NNHA 3W2VA 4I68A 3D6FB 2OIHA 3E51A 4G3IA 5E33A 1Q81T 2CQ0A 4OZEA 4UUXA 2BVZA 3O6QA 2IRUA 1FRJA 2RUSA 2X3GA 4MIAA 5D6GA 2MZJA 1RZMA 4GKKE 3OXGA 2QLJB 2QSWA 3M2UB 1S1VB 2CQ1A 3EWGA 2HNDB 4KGXB 1VQ5S 4RW6A 3KRNA 1J5OB 4CT8A 2HG4A 1X31C 4J9RA 2BOPA 1S1UB 1XTZA 2FJWA 2J6UA 2DRDA 3GCMA 1RAFB 2Q66A 4B9UA 2K1RB 1BQMA 1UKUA 2GFFA 5T7LA 4PPDA 2MTLA 3I9V9 1NXIA 4DV5J 5C24B 4DV6I 2R7WA 2LQ8A 4E0DA 5BXIA 3T41A 3GQCA 4C3LA 2DO0A 2MEWA 4K4TA 1E6VA 4I0WA 3RBZA 5IC6B 4C97A 1LWCB 2F9DA 2FHJA 4ZITA 3CCWA 4I1TA 2E9RX 3OVSA 4K50A 4X64F 1VQMS 4DV7F 5IT0A 3LP1A 4PYDA 4RNFA 1TVRA 2ABYA 1XXEA 4RNMA 1T02A 2GAGC 1YQHA 5CH7B 2UUCI 4F8RA 2M9KA 4NXMF 1IBKE 4C11B 4ZVHA 2UXBJ 3KOAA 2BANA 4ZLPA 3N6NA 2V4JA 1HBUA 3V6DB 4DV6E 5ETPA 3QT8A 3BQ2A 2MKCA 1S4FA 1TELA 4L3KA 3EGZA 3DC2A 4JI8F 2V4QA 2R7QA 2QA4G 2OHDA 1J2VA 4DV4F 4DXLA 3JSBA 1FRIA 4PG4A 4O0NA 3NAIA 2V68A 2ACYA 2RRAA 4OZ1A 3LOUA 1HNWF 4MMOA 3C16B 1BQMB 3Q22A 4FZVA 4NCAA 3R5BA 4G1IA 2UUCE 3NOGA 3DRRA 2HVDA 3K8VA 1SC4B 4J9QA 1RLCL 2GHPA 4NLWA 4LR9A 2QYGA 3DMJB 2E5IA 1FJGI 4R25A 3H8YA 3M1VB 3OTBA 3ILLA 3T1YF 1E6VB 1N32I 5E3RA 1DURA 1ZOTA 2COLA 3ZZ0A 1C1BB 2RDJA 3D1QA 4YB1P 4USTA 1UAWA 4JI5I 2DTJA 5A8RA 4B9VA 2G2YA 3DGPA 3H98A 1XMQI 2V8DA 1X0FA 2JE6A 4N8OA 1R0BG 3NCRA 1Y60A 4ECUA 2AYGA 1HHTP 2VBYA 1WORA 1VISA 4IKAA 4ED1A 2ZOGA 3JAMY 2NYHA 4EO8A 5KFNA 4L73A 2OMOA 4YB5A 3DU6A 3PW0A 1JQGA 4R5PB 4CO0A 3GP9A 2ZFHA 4DR3E 1HBUB 1RA6A 1XQIA 1G7CB 3GSDA 4A8XA 4V19X 4IOCQ 1FJGE 3PHTA 2HHWA 3G82B 2OKQA 1X0PA 2BKPA 1N32E 1SC1B 2J0XA 2U2FA 2OFHX 3AQPA 2LU1A 3ZZZA 4JV0A 4IZJD 4N8NA 4MDTA 4JI5E 3JAMU 3QFHA 1OWXA 2W9AA 1XMQE 2W2MP 5E3AA 4DQQA 4KQZA 5DDOC 2CQIA 2VPYB 1TL4A 4DUTA 4EUVA 2DR5A 3HHLD 2B9YA 4GO7X 2IESA 4E8UA 2OMLA 2ZE2A 3DRRB 1RQ0A 5E7OB 2ZOFA 1VQLS 1X7VA 4Q8EA 2YVSA 1RSCA 3DGVA 2YY3A 2VKZG 4JI3I 3BS9A 2YWHA 1C0UB 4JI4J 2Q6BA 2WB4A 4XPEA 2EW9A 4DFKA 2MQ8A 5A8RB 1QSLA 1LKZA 2G0CA 1U25A 1AUDA 2HNZB 4UF4A 2FVCA 4Y2IA 1GX5A 5E5NA 3TUJC 2MJNA 3PS2A 2R7XA 4U95A 2HBZB 2WVEA 2GJIA 3N5BA 5T14A 1LW0A 4GKJF 5E2QA 5GVQA 3M85G 4NLUA 5KG0A 3QO9A 4RBVA 2HHTA 5EUHA 3SDEA 4K4YA 1OSCA 3O3LA 3OL6A 3GJTB 2LEBA 4ES2A 5K5MA 2BA0G 4USKA 4JI3E 3VAJA 2WNRA 1RDRA 1IBMI 3EDRB 3UD3P 3D1OA 4FF1A 4LSZB 3J7Z5 2VOOA 1HIYA 1FVQA 3DLJA 3GFYA 3M9OB 1R89A 2UP1A 2C2EA 1HYSB 3DHWC 4GC6A 1H2TZ 3OL8A 3PZPA 4IZKB 2QLBB 4ZVSB 1YX2A 2BRKA 2DHAA 1JKHB 1BQNA 1S7HA 3KUGA 4OI4A 1HBNB 5SZTA 1VFJA 1NZAA 5D0GA 2HS4A 1T0TV 3SI8A 2XSFA 3ISND 2R42A 3UCZP 3ZC4A 5JEAC 4G1PA 3DDKA 4ICLB 1TUGB 4K2XA 3RR7A 1GXLA 2YKAA 4BHQA 3IR6B 4KIAA 2MY7A 2YH1A 1IBME 2DNMA 1KQGB 4B02A 2R2TA 1B99A 2QX0A 1WHXA 2VICA 4H4KC 2D3O1 3LTOA 3AJ2A 1ZM3A 1KFDA 4LMZA 4QQBA 2I5JB 4Q8FA 1Z2ZA 1PJ7A 2AGPA 5ETSA 5BYRA 1WC1A 4EYIB 2N7CA 4OJ1A 4HI2A 1FTRA 4Q0BA 4Y3CA 3WC0A 2E1CA 3AOAA 4K5SA 4FKXA 2VG7B 1P6TA 3QO9B 4AIDA 1U1RA 3VQSA 3B78A 2UXDE 1HNZF 3EYZA 4OHWA 3GIRA 5H9FJ 2DGQA 3VGSA 3BGOP 4JI2J 3IRXA 2XHCA 1TKZA 1TKTA 3R8YA 2GQQA 3Q8UA 4AIMA 1VRUA 2RS2A 2D74B 4NOHA 5KFAA 2HHHJ 1PVGA 3GJSB 1X5OA 4WK3A 2DNKA 3T1AA 2AEJA 1T05A 3Q8YA 4ED4A 1VQ7S 4LFBI 1H2UX 4F4AA 1X9SA 4RPFA 3RU0A 2DPIA 3F73A 5EWGA 3TA0A 4DMZA 2UZAA 5DRQA 2OI2A 2PO4A 5IQQA 3GZ7A 2PEBA 4O3OA 3HVTA 4IFYA 2AQ4A 5JVHQ 4DCPB 3K57A 3S7RA 2BUNA 2AMCB 2J9EA 1N8RT 1KQKA 3GV8B 3PEJA 2JT2A 1DRZA 4FXVA 5ETTA 4ALZA 4ITSA 3L3CA 1HWKA 5JMNA 1JLCA 5HQLA 2RH3A 4B9NA 3T1HJ 2VASA 2PN6A 3LPYA 3DOKA 2F9JA 4QR1A 3OR1A 3MFHA 4LFBE 4Q0BB 2DEIA 4OO1A 4WXOA 1KR4A 3VTIA 3KK2A 1XHKA 3WU5A 3F41A 3J80C 1BUXA 4PPZA 5IOLA 1U45A 4HT7A 5LXRA 4IH6A 1SUQA 2NREA 3NS7B 1XR7A 3GCWP 3K0JA 1Z0EA 4QJVA 4YOEA 2PMZD 3IRXB 1TKZB 2ZBPA 4FXDA 3GFZA 2AF6A 5JEAA 2CPFA 5DJBA 2FVPA 1PKPA 3PNIA 4YMEA 1MWYA 3M32A 4C4WA 1HWJA 3HFKA 3ZTQA 4YR3A 2QMXA 3DOMB 4J5OA 2ZNZA 3MCMA 1S0NA 1MW7A 1KP6A 4IOBA 2SXLA 1JLEA 1HR0I 3OUYA 4K59A 3OFEA 1RTJB 2FLPA 3QJLA 4KKOB 3IM8A 4HY1A 1RT5B 4LIRA 4D3GA 2C2NA 2LJPA 2KB2A 3BV8A 3IAM9 3I32A 4HEA9 2F3JA 1ZH5A 2QE5A 3ZKBA 4RW9A 2IHR1 4NXNI 2VJUA 5DZ6A 2O01C 1UW9A 2L3MA 2DISA 2PMHA 1MWZA 3POTA 2HFOA 2XY6A 1RT6B 3KK2B 3BSCA 4UW2A 2FZGB 3CVKA 4PWWA 1LXJA 3WIVA 2YWFA 2B4UA 4LCFA 1IN0A 4G65A 1Z5BA 4DN9A 4NCBA 3MR2A 5KFEA 1JLQB 4L75A 2HNYA 3G86A 6AT1B 2FVSA 4H54A 1CPZA 3OD2A 4KE5A 4NX9A 4DLGA 4IFDB 1WEYA 4FXWA 4NXNE 4LCGA 3JB9k 4FYDA 2FVRA 3Q8SB 1YVFA 4F4YA 2OPPB 2CPEA 3C66A 2DR8A 4NLPA 3F0NA 1G1XA 1SL1A 5LMNI 2JHEA 3ILOA 4AL7A 3GLJA 3JSRA 4XO0A 1IXKA 1JLBB 2Z2ZA 4UQTA 4JI1J 4F4WA 1REVA 3PRYA 2APOA 2UXCF 3W8PA 4LF5I 4RLEA 5J1NA 3FSXA 2QJ3A 3G2XA 4LF8I 4ZA1A 2JX2A 5U47A 1OSDA 2QLFB 4UUWA 4DV0J 4RW4A 5HSPA 3M30B 3D2WA 2DGXA 4LF4F 5DROA 3QAEA 2CPZA 5CD4H 2V4RA 4ZPBA 3G8TA 2QFIA 5B09A 5HMZA 4NRTA 2QA2A 1S7IA 2DO4A 5LMNE 3PYFA 2M8HA 5A2QC 5BR8F 4ZCKA 5E41A 3RB4A 3RB3A 3R6LB 4WIQA 1FKOA 4H4MB 1Y7PA 4L76A 2HIYA 4WFNQ 2RS8A 1B0PA 4LF9J 1XMOJ 2FGCA 1SQFA 4HLBA 1S6PB 2L9WA 4ES3A 4B9TA 3CD0A 2JLGA 3SSSA 1PAUB 1NHIA 1B0VA 3MR5A 1RHUB 4NYOA 1VQ6S 5HMWA 2UXBI 3J7YI 1DBDA 2DIVA 4MU4A 2J6SA 4DV5E 4X4RA 2ZM6I 2E5JA 1FDDA 2VFTA 5DRRA 4ZMMA 3M6AA 3P06A 5B0GA 3H1CA 5AT1B 2JFDA 2FDNA 4GVLA 3Q2SC 2ROGA 2OSRA 2BMBA 5DLGA 2HZVA 3MWBA 1UP1A 3DLEB 4IG3A 3KLGA 2HPUA 3NGSA 1Z1ZA 2VFRA 4HTJA 2DNPA 4OI1A 2G2OA 4DL4A 1SKWA 2JH3A 3ULHA 3HX9A 4X4PA 1OPZA 1U24A 3W65A 2XZDB 4X4SA 3G8QA 5C0XA 1FX4A 3Q2TC 3I5AA 2YKQA 6FDRA 4YUDA 2HLTA 3R6GB 2UXBE 3M8PB 2ZM6E 1RHKB 2DHHA 2ZBKB 4FYYB 4DLEA 2Y0SD 5JEAE 2OO4A 2WBRA 3HVRA 1FKOB 1UVNA 4LRAA 1D8ZA 2C37B 5T41A 1QTNB 3CCSS 3S1TA 2E7XA 3PO5A 3H20A 4EWTA 5RUBA 5G4DA 4OFZA 4ECXA 2VH7A 2CJYB 4YFUA 1Y4SA 1K9MT 2LFVA 2VA3A 2UUBF 2XHWA 4DR7J 3CUNA 2DNZA 1Q86T 2OAUA 2DT9A 3MECB 3EICA 2YKMA 4YEAA 1F3FA 4JI0J 4DQIA 4K0KJ 4ZJQA 2WAQD 2WOMB 2IC3A 5B7WA 1Y9OA 3ILJA 5B0AA 3J80Q 4PRXA 2DNQA 2AP6A 3T5JA 2LECA 4ELTA 2N4CA 5KFZA 4FWGA 2XO6A 3OTEA 4AYBD 3I0RB 2E5GA 2E29A 4DUZI 3QIDA 1L3SA 2ZH8A 3TWZA 3DOLB 3S01A 4WJBA 4R8UB 4IG0A 5M2PA 3J81C 5BYSA 4DHVA 1T9XA 1YBUA 1NZ0A 4TYAA 3R2CJ 1VMBA 1O8BA 2GO3A 1I1GA 4WYWA 1N6QB 4OZJA 3KHRA 2HHSA 3D9BA 1WF1A 4C8YA 1WOSA 2H9ZA 3I0SA 3SV3A 2VF3A 2Y1LB 4JI4I 3VF0B 1OYDA 4EK2A 2YPZA 3CXCR 2EFOA 3CDIA 2EG2A 2MKJA 3MUVP 4NMXA 4DUZE 1RU1A 2RVJA 1FD8A 2FY1A 2EFQA 1KVIA 3HZGA 2Z57B 4TQRA 2OJ3A 2L08A 1ZA1B 3L7UA 2HYIB 3MPWA 1Z4UA 1NJZA 3DCAA 1EAYC 3MAAB 3KG1A 5FIIA 1IBLI 4I2PB 3EZUA 4V1Ak 1B64A 4B3TJ 3AXMA 2BR0A 4DQSA 2YNGA 2IC3B 4WFXA 4XTTA 5K20B 4HXZA 4FW6A 3UR3C 1WHYA 2NUUG 2KM8B 4UY85 2XMTA 4ANCA 1AXQA 2Q43A 3HHLC 4OYOA 4M5DA 2Z2MA 4URLA 4JI4E 3OTDA 3H5SA 1WC6A 1RWMB 2YH0A 1RHRB 2IAJA 2D69A 3J7AG 1C4CA 1DLOB 3JQKA 4LFCJ 2AE8A 1NLKL 5GMKa 2BE7D 3VCDA 3V5RA 2D1CA 4IG0B 1CQNA 2UU9J 3QT5A 2VQFI 4PYAA 4KV8A 4M5LA 2VJVA 2PSZA 1FJ7A 2KJVA 1IBLE 2JJ4D 5IV4A 3FCVA 3CWVA 4P7VA 2G1DA 1NHVA 2ZC4A 2HQ3A 1DTQB 1TUWA 4TQSA 4PWUA 3G8SA 4DU7A 1E3HA 4F0KA 1FRXA 4B3MI 5EHHA 1QSYA 4QYZK 4ZCIA 3TAMA 1YH8A 3KLFA 3TOQA 4K8RA 1VBKA 1RAIB 1U6BA 3V6HA 4CNYA 5HJXA 4DX6A 3QAUA 1C1CB 3OTOJ 3M9NB 2DGTA 1X5PA 2VQFE 2NN6C 5I4MA 2XSJA 2YNFB 4DV2I 4RW8B 3L7OA 2YNGB 4LF6J 4LF5F 2LA4A 3IBCB 3MFIA 2IDEA 1EHWA 3WU6A 1LXNA 4JV5J 3MM9B 5A2QQ 2MYFA 2M8DB 3QGGA 2OPSA 2DBBA 2IPOB 5LSRA 4X4VA 1WF2A 3HJFA 1FD2A 3GFHA 4J3DA 2X1AA 5HO4A 2CZVC 4C3MA 3DLLQ 1UFKA 1RAEB 1HL6A 4PR6A 4OJHA 3V6JA 3P3EA 1E6YB 4YQWA 2F4VI 2BQRA 4K5RA 2DJWA 2Q2EB 4B3SI 1VLYA 2I38A 5DGBA 3LGMA 4DV2E 4F3OA 4DFJA 1AZSA 2BR2A 3G96A 4KT0C 4JI2E 2MB0B 3U1NA 1V5VA 4C2MA 2JEAA 4U7UK 4DV3I 4DV1I 1T9WA 4W92B 2V94A 1JJ4A 2AJQA 1YJRA 2AW0A 1TAQA 2J6TA 2KXNB 2G1HA 2W2PP 1M1HA 4NEZA 2ZH9A 1RT1A 2FB0A 1CJTB 3TA2A 1FNXH 5B0CA 2ZZMA 2ROEA 2XY7A 1BKNA 5AJ3J 1KONA 2B5JA 4HDGA 4YB6A 1EETB 2F4VE 4JB8B 3DKDA 4KH0B 2C22A 4NA2A 4CIOA 3HD1A 2ZH5A 4IFDF 3KJVA 2DNOA 4OJGA 4RNHA 2FJEB 3MGJA 3JQJA 4ED3A 3RUBL 1F9FA 3N6MA 4QWBA 1Q0NA 1JNRB 1QY7A 4Z2XA 3EM1A 3TARA 1RT4B 1NJWA 4DV3E 4DV1E 5F9LA 1WHVA 4AXJA 1GEHA 3RAQA 4LBPA 4U67Q 1TL3B 4P73A 4ZVRB 1SV5B 4TXSA 4DF4A 4X4UA 5IWAJ 2M4MA 1JWWA 3ZFVA 4I7FA 1RWPB 5ETVA 3ET6B 4LR7A 4NI2B 3R2DJ 1S1XA 2ZWPA 1M5KC 1S99A 2C2RA 3MOZA 4OX9F 3LAMA 4KHPF 1U47A 1TUVA 3MAHA 1IKXB 2ZHAA 1NSAA 1HA1A 4HL9A 1HNXI 2AJ4A 1R8HA 4NA3A 2R7RA 3D0GE 3TJ9A 3BB5A 4X64J 2I0XA 4U8YA 3QFWA 2D3UA 4CTAA 1TK5A 2BKOA 2X7IA 1NKCA 1RJJA 2YKOA 2MLZA 4QPTA 1H7WA 1JLGB 1CJVA 1HD1A 2UV8A 3T5HA 1H6KX 3T19A 3OR2B 2CWXA 3J81Q 3FBCA 4RU2A 2CNOB 3FMBA 1BE4A 1RTDA 4N47A 1T3OA 4KH1B 2PFDA 1CS4A 3TUPA 1RHJB 2H3EB 3AJ1A 1Y3KA 4LOMA 3CDUA 1N0VC 2JSXA 2QA1A 1ZETA 2GHWA 2MKSA 1HNXE 3AXKA 5B0BA 4JI6F 4DFMA 5D3GA 5C5JA 5A8WB 2J7WA 4U9RA 2Y9HA 3V4IA 2C3YA 3PW5A 1MMLA 4YDDB 4WUCA 5KG7A 2CVEA 5D8HB 4OI0A 4DR4I 5F8MA 2Z30B 5C2GA 1YK9A 4LJMA 5HQMA 4AE5A 4KBIA 1S1XB 4OYWA 2K8GA 2IOQA 2GCFA 4YY3I 1S0OA 3DDIA 4EBEA 3T1YJ 1Y5LB 2PO0B 3BH7B 1NKEA 3KG4A 1GK8A 2XS7A 4B3RI 1I94F 4CTAB 3TAQA 4FBUA 3M9MB 1OY6A 4AQYJ 1RYRA 2KYXA 1DAXA 5EN1A 4F04B 3CIZA 4F2RA 2RQKA 4KGVB 4ANEA 4NLVA 4B3OA 2RDDA 1HARA 2BRLA 2L9NA 2HVEA 4CNZA 4QU6A 1DARA 3NWRA 1RCXB 1VQPS 3BKUA 4JI1E 4DN0A 3AY0A 3HHEA 3MPYA 1PJ5A 4PABA 2FHJD 2IRYA 5HANA 1D9DA 4DX8H 2VBZA 2VQEF 3AHPA 3FRYA 4CT9A 4ZP9A 3QGHA 3NGDA 2PD1A 3LO3A 2O3DA 4G1QB 4PAAA 2GNKA 2ZHBA 3CCMS 4W90B 4F25A 3BSNA 4B3RE 3CE8A 4X66J 1CBKA 1X8DA 3D3BJ 3R9LA 4NLXA 2RMLA 4ECVA 4NL5A 1P9QC 4ED6A 1XK8A 4AL5A 5KG5A 2W2NP 1K44A 4X2BA 4Y2MA 1FF2A 1VR6A 2Y1IA 3W5ZA 1UFLA 1M5PC 4P2XA 1RAAB 3TJAA 3K5PA 1P1LA 1X4FA 4IYQA 5I42A 9ATCB 3HLUA 3BO2A 4LF1A 1VC5A 3FC9A 3DLBA 4O0IA 8ATCB 1DQAA 5KFQA 5HBMA 4P75A 1FKPA 1N36F 4H4OA 2PC6A 2YXLA 1VQYA 4LF9E 4ID5B 4HACB 1CJKB 2KVIA 2W4PA 5F8IA 1K73T 4ED8A 4DBQA 2MHNA 3EZ5A 2IM0A 4QYRA 1LWEB 1NDCA 1OIAA 3BR8A 2AIRB 1FX2A 1VRTB 4UTGA 4PG6A 3BBFA 4CYUB 4X62F 4AT1B 4CLLA 3LF0A 3FFIA 4CLTA 1R0AA 3AQOA 2R9LA 4RU9A 5K8OA 2LP4A 5AXKA 1Z5AA 1USVA 4DUYI 1NU4A 1GMUA 2C39A 4ETXA 4DR7I 3RW6A 1XEZA 2FUG9 3MXHP 4ZN3A 3OFGA 3UN5A 5KG1A 2XMVA 3KUHA 2J0WA 3PX6A 1YIJS 4JI0I 3BGRB 4GKKJ 4K0KI 1T8EA 3FSYA 1RTIA 3DDNA 1U6ZA 4U3BA 1FXRA 2EFNA 2H1YA 2NN6E 1RLDA 1VK8A 3R5DA 2HQGA 1MROB 1UPMB 5B08A 4XAKA 1QUPA 5DQGA 2DVIA 2WP8B 1TTHB 2KT5A 1LQ9A 1HNIB 4PU9A 1MNEA 3CC2S 4MK8A 4XK8C 1M1KT 3GIKA 1RU2A 3BEGB 4F0MA 5LMUF 2A18A 4BA2A 5K36A 1OJ4A 1RABB 2FVQA 1SKSA 4DUYE 4L6V3 1JB0C 2MHEA 1XNQF 1TL5A 1OMSA 4DR7E 2FQQB 3TEHB 4IFVB 3AFGA 2WSCC 1UMJA 2O66A 1K1SA 1UL3A 4DR5I 3M7NG 2BW7A 1OYRA 2J8SA 4P2FA 1IWAA 1HNZJ 4JI0E 4OMFG 4K0KE 2LDIA 3M6UA 4KQVA 1VI7A 3FFIB 4L72B 1Q7LB 1GFWB 4ZPDA 2HMIA 3IM9A 3S6EA 4ZJOA 5EWFA 1IKYA 2G9OA 2IVFB 4N76A 4MFBA 4B17A 1AA1B 4PWDA 1N48A 2UUAI 2V67A 1C4AA 2M0GB 3IGVA 2BJ9A 4JV2A 3IWXA 4DV6J 3L09A 4OX8A 2G0JA 2JVRA 1PAEX 2DXDA 4KPYA 2UXDF 4X4OA 1Q95G 2EBEA 1EZZB 3IP0A 1BQXA 3G6VA 4F2SA 3UW1A 2HHUA 4IR1A 2CQBA 3MM6A 1EI1A 2X51A 5M2RA 3UDCA 1Y5NB 2DRBA 3RZAA 1RBAA 2FJDB 2XMUA 1I6JA 3L4BC 3IBFB 4HR2A 2UUCJ 2AWZA 1WHWA 1CULB 3RBXA 3W5XA 4X65F 1AROP 5HK4A 3D6TB 1Y10A 2J8AA 2VODA 3BBCA 2D9OA 1WF0A 2C2OB 5J2MB 3PJWA 4BBYA 1HMVA 2H5IB 4OHZA 4JG4A 2C3PA 3UDLA 4FWHA 2JDJA 3HSZA 3WBZA 2BA1G 3QWUA 3QBCA 3OPKA 1DZ5A 1GTEA 1L3TA 4NRUA 5ETMA 1WD6A 1H2VZ 1S0VA 1OYSA 2ZITA 3C6UB 2OEJA 3LANA 2GV1A 1N33F 4MFBB 5KOWA 4MK7A 1Q8BA 1U1KA 7AT1B 3QIPB 1S97A 4DWIA 5AXNA 1NHUA 4LFCE 1S79A 4URGA 4WU3A 2H4YB 4ZHRA 3CD7A 1S9EB 2UU9E 1GAOA 7FDRA 4DL2A 3TYTA 2E5LI 2BABA 1NJIT 3O2IA 1N32J 1RAJA 3EMTA 1H38A 4A48A 4DR1I 4C0BA 2QMUB 3OHAA 3JAMC 1PJ6A 2PDAA 3KK1A 4JI5J 1QAJA 3MEEA 3MM6B 3CF5Q 2PIIA 1HPZA 4UOCA 2KZZA 2HFUA 1XMQJ 3EX7B 3UI3A 4ERDA 1NK8A 1LWXA 2OLWA 4MKAA 4WF9Q 4LFAF 1XNRF 3PYEA 1N5YB 5DDPC 3HT0A 4HH1A 2NXCA 3UDVA 3FBBA 3FEYB 4YS2A 3NNCA 3PFOA 2XMWA 1L3KA 4MU0A 2W8KA 4O23A 2GA7A 3THTA 4D3HA 4YHHI 2MQPA 1T95A 4CO2A 4LF6E 4TY8B 2HRYA 2DIUA 4JV5E 2CA9A 5JUMA 2G4BA 2POKA 1Y3JA 2ATCB 4BA1B 2OFGX 3BPSP 5C2CA 1HQUA 2VBXA 1U1MA 3CDWA 3QRPA 2AV5A 4USVA 1WDTA 4GRSA 1YJ9S 2XGQA 1RAHB 1IVZA 4JI7I 2M2BA 4ZHRB 1URRA 4OO1D 4RW7B 2ADBA 3LALA 1CC7A 4C8ZA 4IQXA 2CXEA 4JI3J 1PILA 3CDAA 3VVUA 3HPOA 4O4GA 2BQUA 2DR7A 3V81A 4ZVOB 3NBPA 4GMKA 1RT7A 1SH2A 3KNAA 5HROB 3HXMA 3V2UC 2DRAA 1IJFB 4ZP7A 2A3JA 1O5JA 2HS3A 5JEAD 3IC1A 1S1WA 4NMLA 2HK3A 2BM1A 3AA9A 3WX8A 2DNRA 4ELUA 3LAKA 4EU0A 4CM0A 4LSLA 1D9FA 2ZJRQ 2FY8A 4PQUB 4QOTA 5GAGU 3PEHA 2B4OA 3CJKB 1KQFB 3WDOA 3Q6NA 4WE1B 2ERRA 3L7ZB 1UVMA 2PGCA 1T11A 3MEDA 1U1OA 5ETRA 3JYTB 1IBMJ 2MLXA 4I3HA 3GB0A 1FFGB 4DF8A 1HBOB 1PYSB 2P6TA 3HFZB 4X64I 4DV7I 2WONB 1HKAA 1HK7A 1GH8A 3B4DA 2NPIA 1RHQB 2AKWB 4TYBA 4KC5A 2WRMA 5H1SV 3SYZA 4PCQA 2YWGA 3IN5A 1FCAA 5DNXA 5GAEU 2CZ9A 4PG8A 4NXMI 1TL1B 4DCOB 1EP4A 4ED5A 3V81B 4BWJA 1TL7B 4HH0A 1X5SA 1ZAXA 1PIEA 3NBPB 4JOUA 1NUEA 3MD3A 2P5VA 4KR0B 1WG1A 2WVCA 5J2NA 1RADB 4ILMA 5CYMA 2HZAA 4JI8I 1I3OB 3DM2A 1UJ5A 5KFSA 4DV4I 4ZVUB 3KLIB 4X64E 3PR4A 2ZKTA 4NYPA 2CNNB 3DI6A 4LSNA 3FGVA 5CCMA 4RUAA 2CG8A 1S9GA 5AXMA 1HNWI 5KT2A 1WTBA 3TUIC 2QRRA 2NXJA 3PR5B 4ELVA 3HHNB 3K17A 2B56A 3KLHB 4U96A 1IJEB 4ZS6A 3GYNA 2GJFA 2DHGA 1ZAWA 2QL7B 3ONQA 2V6AA 3DXSX 1RYSA 4WTOB 3W61A 2J65A 1H7XA 1SJ1A 2UUAF 3NXZA 5H9EJ 3IAS9 4NEYA 1URNA 2HVIA 4IZJA 5L9NA 2UUBJ 4HHJA 2E9ZA 3G4SS 4WP8A 3SQGA 3NGKA 4O3SA 2ALYB 4GC7A 3MEKA 3SFUA 4USJC 1HNWE 2ALZA 3TNVA 3PJ9A 5KT5A 3IS9A 4CI0B 2KTQA 1QUVA 3ZZYA 2MQMA 4I69A 1FNMA 4X4QA 2HW3A 2J5AA 3H0PA 2OD6A 2G13A 2QL9B 3E3XA 3LUYA 3J81j 3BM7A 1NHHA 3TVKA 3V4MA 4P7TA 5JJBA 2B7CB 3T1YE 5CHCB 2KU7A 3WZ0A 4XTJA 3Q8VA 5EL9A 3A4TA 4FS2A 1FXDA 2MKIA 1JXEA 4C6AA 3IGNA 4AQYE 4LSNB 3J80Y 2VB6A 1OYEA 2ZJQQ 4DL5A 2Z5BA 1UZHA 4I2QA 1H7SA 2C2MB 2RQCA 4LF7F 3C8YA 4BLGA 2ZVIA 1U8SA 5F3ZA 2HS0A 3A3PB 1F2HA 3TVZA 2W1BA 4FYWB 2JEBA 3TQEA 4ZDNA 3ZZOA 1Z0VA 3A8IA 3J80U 1G6BA 1NRKA 2ASYA 3W7BA 2Q3PA 2HGLA 3B8HA 2VG5B 2W7PA 2CQ4A 3SBMA 4DG1B 3EGVA 4IZJB 4CLPA 1S6OA 1IQZA 1WG4A 2CDQA 3BDPA 1APSA 4X66E 1HR0J 3OJSA 2E5LF 4DSKA 3R5JB 4N7TA 1U1LA 5IZHA 4GKJI 1TQLA 5C0XD 4OZ0A 3HHLB 3PYDA 4DR1F 4NLGA 1IKWB 1KOHA 1FE0A 1HW8A 3DRPB 2CNLB 3HK2A 3CCVS 2IA0A 3M2UA 1S1VA 3CCZA 2HNDA 2UUTA 5L1KA 4A8SA 2OH2A 1S9FA 3T6BA 3H4BA 4PG5A 1S1UA 4C3KA 2D3ZA 1UA1A 2RNEA 1S16A 1S49A 4NCGB 1Z59A 5B0EA 3W9HA 8RUCA 3P45B 2QT7A 4BC7A 2K1RA 2M70A 3E01B 2CPHA 2VESA 1C0TB 2VU5A 5C24A 1OY9A 4YHHF 2QZ8A 1HBMB 3R5GA 3TO8A 4FVCA 2OSQA 1CC8A 1SH0A 3KXDA 4GKJE 1R3NA 4LQ9A 3P49B 1RT3B 1LWCA 3GR0A 4DJBA 3PKMA 4F36A 4JYAF 3VAIA 1FI4A 5K9FA 2V8GA 3RR8A 1PGZA 2I8EA 2RHQB 4FDFA 1WWHA 5K36F 1DY3A 2B9EA 4OYMA 3GJQB 3RB6A 4Y6IA 3ZZTA 3D4JA 3D54A 4JI7F 5DLFA 4KO0A 2NN6B 1U1PA 3FK4A 2M5YA 3EDQB 1ZYQA 5LMNJ 4C11A 4MTPA 4J9NA 2NZ4A 3V6DA 5AE1A 3CB4A 1HNZI 5AXLA 2WSEC 1BLUA 3TUZC 2QC3A 4LF5J 2PO2B 2K2PA 4HDHA 2CJAA 4RNOA 5ETKA 4ZLNA 4J9KA 1MMDA 2Z56B 3PS1A 3Q6MA 4LF8J 2DB1A 3HSJA 3ZTRA 2DR6A 3QJJA 3GFXA 4Q44A 3V6KA 4ZCMA 2FC9A 1YI2S 1UFWA 4ZCLA 2I6WA 3MM5B 3C16A 1YWXA 3MCSA 3N01A 2V8HA 3OW2R 3THVA 4P72A 2HVHA 4LIWA 2ZDOA 5I3UB 3L9ZA 5A2QY 4J90A 4U6PA 3C15B 1RAOA 3DMJA 5DM6Q 4GO5X 2EFPA 2AT1B 3M1VA 4A46A 4J37A 2P9EA 1FJEB 2X36A 5A8KA 2IMWP 3P5BP 3M05A 4DZ6A 1C1BA 3LWMA 1HNZE 1WNEA 1SIZA 4ECZA 3D7SB 4WFYA 3DYAA 1XC9A 4B9LA 5GMDA 3MDFA 1BD6A 2PI4A 5A2QU 4DQPA 2EG1A 3H59A 3F44A 4KO0B 2FC8A 5A6PA 2OPRB 2F1DA 3QLHB 2V5HG 4WFAQ 4RO0A 4NASA 5IT9C 1GMWA 2ZOMA 2PMWA 4R5PA 1EARA 2ZVSA 4C8KA 3CJ8A 2ZM6J 3OV7A 4ECWA 2EI5A 2GO9A 5D4LA 3C14B 5CYJA 1NHKL 5DQIA 3G82A 1BHNA 1RA7A 4JI2F 4ZVGA 4J9UE 3NGTA 1TU0B 1NK0A 3MPUB 3QZ8A 3CDBA 1O6XA 1RBLA 5KG3A 3JSMA 3W2WA 2YNIB 3BO4A 3MR6A 2V34A 1QJHA 1UA0A 2HHHF 5EWEA 2FZKB 4KGZB 1N4LA 1UWBA 1AFIA 4P52A 4N5SA 5E3CA 3OSPA 2GO8A 1QAXA 3G6XA 1UVIA 5L1JA 1Z5CA 2RRNA 4C0OC 5L38A 2F1FA 2LCWA 3M2RB 2VBWA 3DLHA 1JMTA 3GPAA 1C0UA 3CDJA 4K2JA 5F3TA 5A8KB 1PC5A 4M5JA 1S0MA 1WC5A 2ZEJA 4KPCA 1T9VA 4LVNP 1PSDA 2CZ4A 4IS9A 1F5CA 4KHPJ 3AH6A 2HNZA 3DYAB 2QA4S 1D9AA 3HSGA 4ENOA 1UWAA 1S5ZA 3LP2A 3MI7X 5CQGA 4USMA 4OYZA 3X3UA 4QIWD 2Z8QA 3NKYA 1YHQS 1VS3A 4BWMA 3NS6A 4DI6A 2QFJA 3P4UB 3T1HF 1FTCA 3GYXB 3GLLA 2NUHA 1M5OC 3PTWA 3PW7A 1MN9A 1KQSR 3O44A 1UDNA 3M2VA 4UZCA 1E3PA 2Q6CA 1H73A 3CT9A 5KFYA 2B8QA 1D0EA 1RT2B 5HMYA 2BV3A 2A10A 3OQ2A 3SEOA 4DUZJ 3PG9A 2GX8A 3JSMB 3W2WB 3Q0AA 1HYSA 2J9DA 5DO2A 4CLUA 1WEXA 2GVDA 4IZKA 4AXIA 1UWBB 3J81Y 1TR0A 1Q78A 3QRQA 1ZTTA 1JKHA 1DJ0A 1HBNA 2JL9A 4FW4A 1VRQC 2EEYA 2HEKA 5F8HA 4PG7A 4ICLA 4USHA 2RHSB 1JXVA 4O3QA 1DTTA 1VHFA 1LWFB 2HKEA 3P5TL 1EQMA 2XYGB 3HULA 3KLEB 1RWVB 1ULRA 3H25A 5L46A 1TKXB 2UXCI 3J81U 4QIFA 3DRSB 2B51A 2I5JA 4FW5A 3PY8A 1U2RA 2IM1A 1N34F 2J9CA 4NZ7A 3LP2B 1X4EA 2CADA 1YDLA 1Y6ZA 2A6MA 3FEXB 3P8BB 1IBLJ 4LF4I 3MMCB 4MJKA 3BGLA 2VG7A 2DNNA 5HP1B 3B4MA 3IR7B 5KFMA 1HI1A 2W9BB 3M2VB 2R2SA 4WUBA 2A2CA 2YWWA 4G6VB 5SUHA 2N82B 3GV7B 3G6ES 5BR8I 1F3VA 3QWPA 4OZ5A 2C38B 4OO1C 4DSJA 1W26A 2NN6D 2VQEJ 1YHCA 5D4PA 4DR6I 1Q53A 5HI7A 2GVDB 4MYUA 5ADZA 2KFNA 5L8RC 4LF2A 1S4EA 1ZPWX 2ZD1B 5L1IA 4CZCA 3KMSA 2VQFJ 3T9ZA 5KG4A 1FEHA 4F4XA 3FRZA 3CJ3A 1FNOA 4Y00A 1CLFA 2MKYA 4LF4E 1LEOA 3QYYA 4A47A 2Z5CB 3Q24A 1CJUA 1DTTB 1S57A 3ENWA 2D41A 4KFBB 3RAXA 3ZZPA 2IIHA 4J9SA 3OXLA 4JI1F 1SL0A 1EKSA 2CQCA 4B3MJ 4MU1A 1Y5IB 5BR8E 1EA6A 1JNZB 3CD6S 1A7GE 5K8MA 4C7QA 3VAHA 4DV0F 1HD0A 2VL1A 2XWYA 3SIPB 3UHMA 2JC0A 2B8PA 2ZBIA 3GTYX 2VHGA 1FFWB 4WP3A 1Z0CA 2KRRA 2AEMA 2WVBA 4DV2J 4QR2A 4RUHA 3O1LA 4LUBA 3IRWP 1WOOA 3KWMA 3KJFB 4OV6A 1R6VA 4ZPAA 3H5UA 5E3QA 2DPJA 1OQ3A 2QIFA 3BH6B 1FVSA 4KSEB 4GVBA 3ISZA 2R4FA 1RKIA 2ZHOA 1JLFB 2NXEA 2RQ4A 5D78A 2Q1LA 1YRUA 1LOUA 3KHLA 2V2QA 3DOMA 4P71A 1CVJA 1P9YA 3D68A 4LF9F 1XMOF 2UUBI 3K59A 1TK8A 2BM0A 1CG2A 3LWLA 2QTWA 2F4VJ 1RTJA 1EKRA 4B3SJ 4DZDA 4ILRA 4KKOA 4RX6A 3H2VE 4Y65A 1RT5A 1PKUA 5IT9Q 1CJUB 2LXUA 3H2UB 3CJ4A 2YKPA 3UQSA 3L7PA 3NS5A
chains in the Genus database with same CATH topology
2ZITA 4B3MI 2NPFA 4P52A 5IWAE 1FNMA 1IBME 2A2DA 4X62E 1DARA 1Z5CA 5LMNE 5L3JA 3LTOA 2Z5CA 1ZM3A 4JI1E 4LFCE 1NHHA 3PYFA 3B82A 5A2QC 4DV6I 3T1YE 2UU9E 4XTJA 5LMUI 1H7UA 1J5EI 2E5LI 1ZXNA 4YHHE 1XNQI 4OX9I 4KHPI 2VQFE 4B3TI 1N34E 2UUBE 4DV2I 4B3SE 4AQYE 2HK2A 4DR1I 4B3RE 2Z5BA 3JAMC 3B78A 2UXDE 3WU6A 4USMA 2HFUA 5A2QQ 1H7SA 4JYAE 2CG9A 1ZM9A 2UUCI 3PYEA 1NHIA 3Q1QA 3PYGA 1PVGA 2UXBI 1N0UA 4N3OA 4DPTA 4LFCI 4JI1I 1IBKE 4DV5E 2ZM6I 1Z0BA 1Z0VA 3T1YI 4JI7E 3M6AA 1FWKA 4ED4A 2UU9I 2DEJA 3P06A 4DV6E 1H73A 1Z0WA 4LFBI 3B8HA 3QT8A 2O1TA 2V2ZA 4YHHI 4RPFA 4FW9A 4IZJB 2F4VI 5LMUE 2Q2EB 5FWKA 3K1JA 4B3SI 4AQYI 2BV3A 1J5EE 1H74A 1XNQE 4OX9E 2UXCE 4KHPE 1H72C 4B3TE 4X66E 2OI2A 4DV0I 4LF6E 4LF9E 1WUUA 4DV2E 2UXDI 4ZVIA 3WU4A 4HACB 4DXLA 2R3VA 4JV5E 3ZM7A 4JI6I 2V8PA 4GKJI 2E1RA 4JI2E 4IZKA 3PYDA 1QZRA 1KTVA 4WUDA 4DV3I 4DV1I 2UUCE 1IBKI 4DV5I 2IOPA 1RREA 5GMEA 5LL6R 4UTGA 2UXBE 4JI7I 4DR2I 3OTOI 2ZM6E 3QT6A 2ZBKB 2HKEA 4X65I 1S16A 1FJGI 1Z59A 3HULA 2J7KA 3J7AM 4LFBE 1BKNA 1N32I 2DEIA 4DPUA 3ZZ0A 2UXCI 1Z5AA 2F4VE 1XHKA 3V2UC 4X66I 4LF6I 4LF9I 2EFGA 2V2VA 3ZKDA 3WU5A 1XMOI 1HR0E 1USVA 4DUYI 4JI5I 3J80C 4Z7YA 1Y4SA 2Z5EA 1A6FA 4JV5I 4DR7I 1XMQI 1ELOA 1U2RA 4DV0E 1KKHA 1I94I 4JI2I 1Y6ZA 1Z0EA 4DR6E 2HK3A 2O1WA 2BM1A 4JI6E 4GKJE 3HJCA 1MG7A 2GS8A 1K47A 4JI0I 4DV7E 2HHHI 4K0KI 1VISA 4LF4I 1ZM2A 1KIJA 3WU3A 4DR5E 1FI4A 4DV3E 1PKPA 2WW4A 4DV1E 3LPSA 1N33I 3J80Q 4PRXA 3ZZUA 4DR3E 3Q6NA 2PNMA 4WUBA 2A2CA 4FWGA 4NXME 4DR2E 3OTOE 1USUA 4DPYA 4X65E 3ZZTA 1FJGE 2HKJA 3GONA 3D4JA 2HFSA 4MYTA 4PU9A 5BR8I 1FWLA 4DUZI 1HR0I 2VQEI 1N32E 1ZXMA 4I3HA 4IZJD 2UUAE 1ZM4A 1OJ4A 4HY1A 1XMOE 4JI5E 4DUYE 4P7AA 4DR6I 4DR7E 4MYUA 1XMQE 1B63A 2LJPA 4JI8E 1FKAE 1I94E 4X64I 1S4EA 1HNXI 2AJ4A 4DV4E 4DV7I 3J81C 1HNZI 1HK7A 1NZ0A 1NHJA 4FN5A 4DR5I 3ZKBA 2O1VA 4JI0E 4LF7I 4FWDA 2HHHE 4NXNI 4K0KE 1B62A 4LF4E 4LFAI 1XNRI 3Q6MA 3T1HI 4HACA 2X7IA 2Z5CB 4DR3I 4KQVA 1Y4UA 2VF3A 1N33E 2PNLA 2CZ9A 4JI3I 4NXMI 4JI4I 4R1FA 3H4LA 2O1UA 1PIEA 4DR4E 3J81Q 1RR9A 5BR8E 1EA6A 4Z7CA 4DUZE 2UUAI 4UT4A 2VQEE 1MU5A 2Z5BB 4DPXA 1N36I 4YY3E 4JI8I 3QT7A 1Z5BA 4PRVA 4DV4I 2X36A 1N0VC 4GKKI 4EMDA 1IBLI 4LF5E 1MX0A 4X64E 1HNXE 1HNZE 1Z0CA 2XEXA 4DU8A 4LF8E 1HNWI 4HXZA 4LF7E 4NXNE 4LFAE 1EI1A 1XNRE 3T1HE 5GMDA 3K17A 4WUCA 1UEKA 5IWAI 4JI3E 4USKA 4URLA 4JI4E 1IBMI 4DR4I 4B3ME 4X62I 3LNUA 3F0NA 5LMNI 5FLXC 5IT9C 3J7AG 3JAMQ 3K85A 2GQ0A 2IOQA 4YY3I 3PRYA 2V2QA 1N36E 3V5RA 4IZKB 3QT5A 2VQFI 1N34I 4LF5I 2UUBI 4IZJA 4DPWA 2BM0A 4HYMA 4JG4A 4M1KA 2E5LE 4B3RI 4GKKE 1IBLE 2CGEA 4FWHA 1D6TA 2R42A 3CWVA 4LF8I 5FLXQ 4DR1E 5IT9Q 1Z0GA 4JYAI 1HNWE 1KVKA 2V34A 4DU7A 1Z0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIT A;  4B3M I;  2NPF A;  4P52 A;  5IWA E;  1FNM A;  1IBM E;  2A2D A;  4X62 E;  1DAR A;  1Z5C A;  5LMN E;  5L3J A;  3LTO A;  1ZM3 A;  4JI1 E;  4LFC E;  1NHH A;  3PYF A;  3B82 A;  5A2Q C;  4DV6 I;  3T1Y E;  2UU9 E;  4XTJ A;  5LMU I;  1H7U A;  1J5E I;  2E5L I;  1ZXN A;  4YHH E;  1XNQ I;  4OX9 I;  4KHP I;  2VQF E;  4B3T I;  1N34 E;  2UUB E;  4DV2 I;  4B3S E;  4AQY E;  2HK2 A;  4DR1 I;  4B3R E;  3JAM C;  3B78 A;  2UXD E;  3WU6 A;  4USM A;  2HFU A;  5A2Q Q;  1H7S A;  4JYA E;  1ZM9 A;  2UUC I;  3PYE A;  1NHI A;  3Q1Q A;  3PYG A;  1PVG A;  2UXB I;  1N0U A;  4LFC I;  4DPT A;  4JI1 I;  1IBK E;  4DV5 E;  2ZM6 I;  1Z0B A;  1Z0V A;  3T1Y I;  4JI7 E;  3M6A A;  1FWK A;  4ED4 A;  2UU9 I;  2DEJ A;  4DV6 E;  1H73 A;  1Z0W A;  4LFB I;  3B8H A;  3QT8 A;  2V2Z A;  4YHH I;  4RPF A;  4FW9 A;  2F4V I;  5LMU E;  2Q2E B;  3K1J A;  4B3S I;  4AQY I;  2BV3 A;  1J5E E;  1H74 A;  1XNQ E;  4OX9 E;  2UXC E;  4KHP E;  1H72 C;  4B3T E;  4X66 E;  2OI2 A;  4DV0 I;  4LF6 E;  4LF9 E;  1WUU A;  4DV2 E;  2UXD I;  4ZVI A;  3WU4 A;  4HAC B;  4DXL A;  2R3V A;  4JV5 E;  3ZM7 A;  4JI6 I;  2V8P A;  4GKJ I;  2E1R A;  4JI2 E;  3PYD A;  1QZR A;  1KTV A;  4WUD A;  4DV3 I;  4DV1 I;  2UUC E;  1IBK I;  4DV5 I;  1RRE A;  5GME A;  5LL6 R;  4UTG A;  2UXB E;  4JI7 I;  4DR2 I;  3OTO I;  2ZM6 E;  3QT6 A;  2ZBK B;  2HKE A;  4X65 I;  1S16 A;  1FJG I;  1Z59 A;  3HUL A;  2J7K A;  3J7A M;  4LFB E;  1BKN A;  1N32 I;  2DEI A;  4DPU A;  3ZZ0 A;  2UXC I;  1Z5A A;  2F4V E;  1XHK A;  3V2U C;  4X66 I;  4LF6 I;  4LF9 I;  2EFG A;  2V2V A;  3ZKD A;  3WU5 A;  1XMO I;  1HR0 E;  4JI5 I;  4DUY I;  3J80 C;  4Z7Y A;  1A6F A;  4JV5 I;  4DR7 I;  1XMQ I;  1ELO A;  1U2R A;  4DV0 E;  1KKH A;  1I94 I;  4JI2 I;  1Z0E A;  4DR6 E;  2HK3 A;  2BM1 A;  4JI6 E;  4GKJ E;  1MG7 A;  2GS8 A;  1K47 A;  4JI0 I;  4DV7 E;  2HHH I;  4K0K I;  1VIS A;  4LF4 I;  1ZM2 A;  1KIJ A;  3WU3 A;  4DR5 E;  1FI4 A;  4DV3 E;  1PKP A;  2WW4 A;  4DV1 E;  3LPS A;  1N33 I;  3J80 Q;  4PRX A;  3ZZU A;  4DR3 E;  4WUB A;  2A2C A;  4FWG A;  4NXM E;  4DR2 E;  3OTO E;  4DPY A;  4X65 E;  3ZZT A;  1FJG E;  2HKJ A;  3GON A;  3D4J A;  2HFS A;  4MYT A;  4PU9 A;  5BR8 I;  1FWL A;  4DUZ I;  1HR0 I;  2VQE I;  1N32 E;  1ZXM A;  4I3H A;  2UUA E;  1ZM4 A;  1OJ4 A;  4HY1 A;  1XMO E;  4JI5 E;  4DUY E;  4P7A A;  4DR6 I;  4DR7 E;  4MYU A;  1XMQ E;  1B63 A;  2LJP A;  4JI8 E;  1FKA E;  1I94 E;  4X64 I;  1S4E A;  1HNX I;  2AJ4 A;  4DV4 E;  4DV7 I;  3J81 C;  1HNZ I;  1NZ0 A;  1NHJ A;  4FN5 A;  4DR5 I;  3ZKB A;  4JI0 E;  4LF7 I;  4FWD A;  2HHH E;  4NXN I;  4K0K E;  1B62 A;  4LF4 E;  4LFA I;  1XNR I;  3T1H I;  4HAC A;  2X7I A;  4DR3 I;  4KQV A;  2VF3 A;  1N33 E;  2CZ9 A;  4JI3 I;  4NXM I;  4JI4 I;  4R1F A;  3H4L A;  1PIE A;  4DR4 E;  3J81 Q;  1RR9 A;  5BR8 E;  1EA6 A;  4Z7C A;  4DUZ E;  2UUA I;  4UT4 A;  2VQE E;  1MU5 A;  4DPX A;  1N36 I;  4YY3 E;  4JI8 I;  3QT7 A;  1Z5B A;  4PRV A;  4DV4 I;  2X36 A;  1N0V C;  4GKK I;  4EMD A;  1IBL I;  4LF5 E;  1MX0 A;  4X64 E;  1HNX E;  1HNZ E;  1Z0C A;  2XEX A;  4DU8 A;  4LF8 E;  1HNW I;  4HXZ A;  4LF7 E;  4NXN E;  4LFA E;  1EI1 A;  1XNR E;  3T1H E;  5GMD A;  3K17 A;  4WUC A;  1UEK A;  5IWA I;  4JI3 E;  4USK A;  4URL A;  4JI4 E;  1IBM I;  4DR4 I;  4B3M E;  4X62 I;  3LNU A;  3F0N A;  5LMN I;  5FLX C;  5IT9 C;  3J7A G;  3JAM Q;  4YY3 I;  2V2Q A;  1N36 E;  3V5R A;  3QT5 A;  2VQF I;  1N34 I;  4LF5 I;  2UUB I;  4DPW A;  2BM0 A;  4HYM A;  4JG4 A;  4M1K A;  2E5L E;  4B3R I;  4GKK E;  1IBL E;  4FWH A;  1D6T A;  2R42 A;  3CWV A;  4LF8 I;  5FLX Q;  4DR1 E;  5IT9 Q;  1Z0G A;  4JYA I;  1HNW E;  1KVK A;  2V34 A;  4DU7 A;  1Z0T A; 
#chains in the Genus database with same CATH topology
 5KFJ A;  2YX4 A;  1D1U A;  4F26 A;  4NE9 C;  4WP9 A;  1VGY A;  4DV3 J;  4DV1 J;  2H4W B;  4BDP A;  2CKW A;  4Y2K A;  3UNG C;  4DPO A;  4EO6 A;  2LQB A;  2DCL A;  2AYE A;  3CCQ S;  1RT6 A;  1NB2 A;  2C28 A;  1T3N A;  5DET A;  5LMU J;  2LU2 A;  4CM2 A;  2UUB E;  3UD5 A;  4FW3 A;  3MF5 A;  2E9T A;  2C3U A;  3I5B A;  2GML A;  4AL6 A;  1P27 B;  4FNI A;  1JLQ A;  2W9C B;  3NMR A;  4RNN A;  4GVB B;  4X84 A;  1FEE A;  1FRM A;  4IH5 A;  2BQ3 A;  4N3O A;  3BBB A;  2HIQ A;  5ETN A;  4M8L A;  1P1T A;  3NP5 A;  4IFD A;  2LQ9 A;  1Y11 A;  1Z0B A;  3PO4 A;  3QJP A;  2KXF A;  3MM7 B;  2OPP A;  1ZPV A;  3G6Y A;  2YKN B;  1RWN B;  1SJQ A;  5GAD U;  1H74 A;  1V3Z A;  2HQF A;  1JLB A;  2ZNY A;  4Y34 A;  4KHR A;  4ZVI A;  2HBY B;  2UVU A;  2DGS A;  2MGZ B;  2E1R A;  2XO7 A;  4P9S A;  5F8L A;  3M8Q B;  4L3N A;  4J9O A;  1SPB P;  4IRD A;  1G3O A;  1HNX J;  3G71 S;  4O44 B;  2ASL A;  1FJC A;  3GG1 A;  4ECY A;  2XUL A;  3M30 A;  3MPV A;  1RGV A;  1SI9 A;  2F8H A;  1FDB A;  2EVZ A;  3NGU A;  4OIX A;  1OO0 B;  2AJ0 A;  3H7H B;  1KN6 A;  3RBD A;  1HR0 E;  2Z0G A;  1N5V A;  1S1T A;  2RQM A;  4CP5 A;  2ZDP A;  5LJ3 Y;  2Z5E A;  1A6F A;  1UEU A;  2RIL A;  5G0R B;  4DSI A;  2O1P A;  3U02 A;  2BJE A;  9RUB A;  1YZ6 A;  3CJR A;  3N28 A;  4M5H A;  4H4M A;  2MZ1 A;  4P2S A;  2CJB A;  1F5B A;  1RAC B;  1T9Y A;  2C42 A;  2WW4 A;  5C0X C;  2V63 A;  4P10 A;  2CAJ A;  2B43 A;  3J7A 1;  3W9J A;  5J2P B;  1VJQ A;  2UVR A;  3ITH B;  1S6P A;  3MEG B;  2C3M A;  2R2R A;  2CPX A;  3ENV A;  5C25 B;  1AFJ A;  3OVB A;  5F9N A;  4Q5V A;  4MYT A;  3RTV A;  5K36 D;  3Q89 A;  4DR4 J;  2KDO A;  1U2C A;  2H54 B;  4ECQ A;  4UY8 T;  5J2Q B;  2JEJ A;  3WX4 A;  4J9M A;  4KAI A;  2RB7 A;  2CPY A;  3MMB B;  4B3T F;  3QAT A;  4YY3 J;  4PUO B;  4QW8 A;  5KFI A;  2XZW A;  1IWG A;  3P6Y C;  1Y00 A;  2ZUG A;  1TV6 B;  2CQH A;  3CC4 S;  2RDI A;  1YBA A;  3MUM P;  3DLE A;  2R7S A;  3K2Y A;  4B3R J;  2GIF A;  1FER A;  1SKU B;  1NCL A;  2JWN A;  2P9C A;  1BC6 A;  1YRT A;  3A12 A;  3IG1 B;  3ILI A;  3CJS A;  1VQO S;  1QE1 B;  3DLG B;  4K4U A;  3DHX A;  2W2O P;  4CO3 A;  2CQD A;  2OPQ A;  3VAL A;  2FZC B;  2F5G A;  4DS5 A;  2RAQ A;  5KG6 A;  2V50 A;  1S1T B;  4RBT A;  4UT4 A;  1FWP A;  3M8P A;  3SMZ A;  2J0Q D;  4QNJ A;  4LRB A;  3KK3 B;  3W3S A;  4WCE Q;  1V5I B;  4KGK A;  1ITP A;  2R7T A;  5KFK A;  4YB7 A;  4MQY A;  1YJ7 A;  2C37 A;  2CRL A;  4LF5 E;  4PRF A;  4DR6 F;  4C98 A;  2XI3 A;  2RF2 B;  3QGP A;  2BJ7 A;  3GU0 A;  1RTH A;  4DU8 A;  4LF8 E;  4FVM A;  1FXL A;  3LP0 A;  5J1E A;  5EGY A;  2ZH4 A;  3JS9 A;  5DGA A;  1WC0 A;  3CTR A;  2GW8 A;  3MEC A;  4IR9 A;  2HSE B;  3OLB A;  4HYK A;  2X1B A;  3QZ7 A;  1XWL A;  4DR2 F;  3OTO F;  2RT3 A;  3TX0 A;  4UQG A;  2WOM A;  1UW4 A;  3CSK A;  2XBP A;  1R6M A;  1JLA B;  2YX7 A;  2HQI A;  4A4J A;  2UVV A;  2BKN A;  4LF6 F;  4LCH A;  3KHG A;  3I0R A;  4EI2 A;  1U02 A;  4JV5 F;  2RU3 A;  1FKA F;  1JJH A;  4ZPW R;  5EX0 A;  1N5Q A;  1B4S A;  3T3F A;  2HFZ A;  3MMA B;  3DOL A;  1S6U A;  4R8U A;  3VV2 B;  4LRF A;  3P76 A;  4OO1 E;  2P2C B;  3JXO A;  2E1P A;  5I3Q A;  2F8E X;  1UDQ A;  4WZM A;  3Q23 A;  2HWT A;  2OPQ B;  4CLK A;  2BE2 B;  1RTZ A;  1N6Q A;  2W4D A;  1N5T A;  1B7F A;  3W60 A;  1KWM A;  2I1R A;  5L3J A;  2IBK A;  2V69 A;  3EXC X;  1CQM A;  3T5K A;  5H9F K;  2W7O A;  1SH3 A;  3I55 S;  4QW9 A;  4WKY A;  1RWO B;  2H48 B;  3UVJ B;  3C6T B;  2F63 A;  4PEO A;  2JNJ A;  5GAH U;  1EB0 A;  4OX9 I;  4KHP I;  4DL6 A;  2EC2 A;  5K14 A;  1RTH B;  2WVD A;  3LP0 B;  5J1E B;  4DUY J;  5HQ8 A;  1S6Q A;  1HHS A;  1Q1K A;  5K8P A;  3MAA A;  4P2M A;  4CLZ A;  2OGU A;  2FYX A;  4I2P A;  2AGO A;  5FJ4 A;  2RKI B;  3DXB A;  2JEI A;  2XCP A;  1WKJ A;  1VC0 A;  1A0O B;  5AJ3 F;  2VDH A;  4USI A;  2OTL S;  4ZVT B;  5KFP A;  5B0F A;  1Z0W A;  1VBX A;  2YX1 A;  4DS4 A;  5FLX Y;  1IKV B;  3CC7 S;  1R6L A;  5FWK A;  4OX9 E;  4KHP E;  3D66 A;  1FRK A;  5CCL A;  3NMA A;  3D28 A;  3E2E A;  1IQT A;  1HWU A;  1DLO A;  1YJV A;  3ZTP A;  1WUU A;  1T03 A;  4ZK7 M;  2X3D A;  3WU4 A;  1O51 A;  4I64 A;  5KT7 A;  1TZ0 A;  2I2Y A;  4JI6 I;  4CH7 A;  4CO4 A;  3BYR A;  4FKY A;  2R8G A;  1RI7 A;  2BOA A;  4WUD A;  3O8W A;  2VFU A;  2XS5 A;  4XPC A;  5D0E A;  3UN2 A;  2KXH A;  4DR5 J;  5FLX U;  1IBK I;  4O3N A;  1DTQ A;  5IWA F;  2VFS A;  3OTC A;  1A6L A;  3VGU A;  1XN9 A;  1HI0 P;  3CCL S;  4EBC A;  1VIX A;  2L48 A;  3D3C J;  2R8H A;  3TZX A;  5IV3 A;  3J7A M;  3J7A N;  3B54 A;  4DEZ A;  4OYP A;  1NK9 A;  1OPI A;  3CCJ S;  5K14 B;  4NPO A;  5ELW A;  2IA6 A;  2IFX A;  2UUA J;  2DH9 A;  1S6Q B;  1X9W A;  1KKH A;  2MZT A;  1I94 I;  3MOJ B;  1C1C A;  4NWB A;  4BS2 A;  3NG8 A;  3THP A;  1YJN S;  4JI6 E;  3DLK A;  4KYZ A;  4CDI A;  1F5A A;  1T9T A;  3ADA C;  3FJ2 A;  4OL8 A;  2YNF A;  2QO3 A;  4RW8 A;  1U7L A;  3HMJ G;  3W2V B;  2XLK A;  1VBY A;  4RWX A;  1U1Q A;  3CJ0 A;  3JTN A;  2CJK A;  2HHP A;  2AHO B;  3MM9 A;  2B4P A;  2FLN A;  4X4T A;  2K3I A;  2HFS A;  1RWU A;  2VQE I;  2IYI A;  1B0T A;  4DCJ B;  3NZK A;  4FW7 A;  1T03 B;  1ZM4 A;  3TR5 A;  2M3D A;  4RW6 B;  1IM4 A;  1J5E F;  1LV5 A;  1HQE A;  1WJ9 A;  2F65 A;  3H4D A;  1I94 E;  3OVA A;  1E6Y A;  1R0C B;  3HFV A;  3TI0 A;  2H51 B;  4FN5 A;  4PXE A;  3HP6 A;  5L9X A;  5T7L B;  2XCA A;  1MN7 A;  4DSF A;  5KT6 A;  2CDR B;  2XYP B;  4DR3 I;  4LF7 J;  3R97 A;  3UDE A;  3QGI A;  5THW A;  2PNL A;  2FJA B;  2LXI A;  3KJQ B;  1RR9 A;  1ICE B;  1ZS6 A;  4F7V A;  3TZZ A;  2VQE E;  2QLW A;  1I51 B;  1N36 I;  2RE1 A;  1RKJ A;  1VCT A;  1CJT A;  3U1M A;  3VWS A;  2CNK B;  4A8Y A;  4B9S A;  4AQY F;  3LP1 B;  2JEF A;  1TVR B;  1XBW A;  3DLK B;  4URS A;  1D3W A;  2LVW A;  4YDX A;  3CJT A;  1EET A;  4JV1 A;  1MWQ A;  2E5L J;  2LYV A;  2HWI A;  3BR9 A;  2VG6 A;  2BE9 B;  4NLQ A;  3HZE A;  3HHK A;  4DR1 J;  3IO1 A;  3I4H X;  4RR5 A;  4Q43 A;  4FP9 A;  2BAN B;  1Q5Y A;  2V4J B;  1UEK A;  3M8R A;  4I67 A;  4B3M E;  1NJY A;  4X62 I;  4K4X A;  1RT4 A;  4DSL A;  3M7V A;  5FDL A;  2NZC A;  1UJ6 A;  1F9H A;  3KTQ A;  1HQE B;  4CO5 A;  1TL3 A;  3SCK E;  3EPG A;  1N36 E;  1DHM A;  1SV5 A;  4X66 F;  5MLC V;  5C0X E;  3QQC D;  2ZUA A;  2K7K A;  4U7U D;  4IRK A;  1X5T A;  4YHH J;  1BXN A;  5DM7 Q;  3MUR P;  3ET6 A;  4NI2 A;  4NLD A;  3EGW B;  1WC4 A;  3LA0 A;  2QGF B;  1NZ8 A;  4LVO P;  1IKX A;  2E66 A;  2LDY A;  1FDA A;  3K5M A;  1Z0T A;  1YKW A;  4JYA J;  1RWW B;  1ZTW A;  3IWN C;  2KG1 A;  4OJ3 A;  1OQ6 A;  2DXE A;  4MAK A;  4X62 E;  2XG8 A;  2XLI A;  2LQJ A;  2HBQ B;  4J91 A;  2NSB A;  2FHK A;  2ASJ A;  3DGP B;  3P3D A;  1JLG A;  2ZC3 A;  3D0I E;  2JE6 B;  4JI7 J;  4RBU A;  5LMU I;  3BGU A;  3OR2 A;  4B9M A;  3NWG A;  2OTJ S;  1XNQ I;  1KLM A;  2FTR A;  4B3S E;  1PG5 B;  2VG6 B;  3NCQ A;  2CQ2 A;  2AZ1 A;  3RBE A;  3BGF A;  2LA6 A;  1JK9 B;  3Q1Q A;  5A8W A;  3PYG A;  3K89 A;  1U0H A;  3KKF A;  3PRD A;  4ZVP B;  4FS1 A;  5FDL B;  1WAC A;  3A8E A;  1GNK A;  3W8G A;  3CNQ P;  4DQR A;  2QN6 B;  1VK3 A;  3NLC A;  4QCL A;  4OZN A;  5E3P A;  3CW2 C;  5LMU E;  2Y1R I;  3K1J A;  4JBC A;  1VHI A;  2YTC A;  4ETZ A;  1XNQ E;  4HT5 A;  1H72 C;  1NH8 A;  2ZE2 B;  3IFE A;  3LPE A;  2UXD I;  3T9N A;  5EX3 A;  2F8M A;  4GKK F;  1UCN A;  4Q7A A;  5BYQ A;  3W5Y A;  4R0E A;  2PO0 A;  4MH8 A;  5EKW A;  4K4V A;  4MIW A;  2OUG A;  1Y5Y A;  4DV7 J;  1U49 A;  5KFX A;  2AX0 A;  3GME A;  3BF4 A;  3H90 A;  2Q79 A;  2VD3 A;  1ZBT A;  2IOP A;  1RRE A;  2KHC A;  1VQK S;  1JJC B;  4X65 I;  3GYG A;  4NXM J;  2M7S A;  1L3V A;  4HKQ A;  3KUE A;  1HNV A;  4DX7 A;  4DPU A;  4ECR A;  1KLM B;  3W63 A;  3GIL A;  1X4B A;  3ZXW A;  1PYO B;  1LW0 B;  3SV4 A;  2WK4 A;  1YJU A;  2E44 A;  2JVO A;  4K4S A;  3SDE B;  2JEG A;  3UR0 A;  3US5 A;  2DYA A;  4JI8 J;  3PX4 A;  5HVF A;  1MG7 A;  4G1Q A;  1MLA A;  3D5M A;  4DV4 J;  2WNR B;  1K47 A;  4M5M A;  5KT3 A;  3CCT A;  4I56 A;  2Y1J A;  1U0H B;  2QV6 A;  2QLX A;  1N88 A;  3F56 A;  2MJU A;  4HHH A;  1N33 I;  2BDP A;  4ZIV A;  2J76 E;  1HNW J;  1KSP A;  3H40 A;  1FRL A;  3G87 A;  4J9P A;  2XB2 D;  3GIM A;  3GSI A;  1IBK F;  2V2K A;  4Y2C A;  2DK2 A;  2YQ0 A;  4X65 E;  3PCO B;  3U1L A;  2Y8W A;  2R8K A;  3KHH A;  1IBC B;  1BQN B;  4DV6 F;  1K0T A;  1LNQ A;  1TMM A;  1NSQ A;  3HKZ D;  2MY8 A;  4WFB Q;  2KFZ A;  2L41 A;  4TLQ A;  5MAO A;  5LT5 A;  4FBT A;  3AA8 A;  1VQ9 S;  1KS2 A;  4UOH A;  4KHM A;  5CZV A;  4OQJ A;  1SKR A;  5BJR A;  4TU9 A;  1NHJ A;  3P96 A;  4IRC A;  3UO0 A;  2G2Z A;  2O1V A;  4ID5 A;  3MTJ A;  4XDD A;  2V8V A;  4LFA I;  1XNR I;  5A76 A;  4HAC A;  3TRG A;  1SQE A;  1CJK A;  1UDS A;  3W62 A;  4IH7 A;  2JOQ A;  5HMX A;  3KG0 A;  2UUC F;  4I4B A;  1N33 E;  3OSN A;  4R1F A;  4PXB A;  3M8Z A;  1LWE A;  1HNV B;  3ENA A;  2YQ1 A;  3I87 A;  1UVK A;  4DR4 E;  4KTQ A;  3MD1 A;  4QWE A;  1VRT A;  5KFV A;  4A8O A;  5KFW A;  3R7B B;  3FDS A;  1RHM B;  3H5X A;  4CYU A;  1S10 A;  4YY3 E;  5K36 C;  2FGO A;  1KD1 T;  1TKT B;  3OL9 A;  1VRU B;  4TY9 A;  3HI9 A;  4IDK A;  1NAQ A;  3EJM A;  4KGM A;  2JFK A;  1P42 A;  4YR0 A;  3EZO A;  1AB8 A;  3Q86 A;  3BQ1 A;  1WG5 A;  4LFA E;  1WDD A;  4WTY A;  2HAI A;  5DS7 A;  1XNR E;  4PKD B;  1T05 B;  2HHX A;  3QPI A;  1T7P A;  2GZO A;  4O3R A;