1OJ4A

Ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
283
structure length
283
Chain Sequence
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE
publication title Biosynthesis of Isoprenoids: Crystal Structure of 4-Diphosphocytidyl-2C-Methyl-D-Erythritol Kinase
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2003-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1oj4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1oj4A01
4GKKE 1ZM2A 4DV3I 1MG7A 1IBME 1D6TA 2BM1A 5IWAE 3JAMQ 2CZ9A 2HFSA 1XMQI 4I3HA 2F4VE 1Z0WA 1H74A 4DR1E 5LMNE 1B62A 4R1FA 3ZKBA 4DR4E 2HKEA 1NZ0A 4NXNE 4DV2I 4M1KA 2UUCE 4LFCI 5GMDA 4RPFA 3F0NA 1U2RA 1KKHA 3OTOI 1FJGE 1ZM9A 1PKPA 4FWDA 4X64E 1Z5BA 2HHHE 2EFGA 2Q2EB 1N32I 1Z0BA 2A2DA 4JI3E 4DR3E 4JI2E 2UUAE 1IBLI 4DR6I 4MYUA 1DARA 3ZZTA 4PRXA 4DV6I 3J7AM 4LF8I 4ED4A 3GONA 3CWVA 1N34I 2E5LI 1S16A 1RR9A 4LF6I 1VISA 1FKAE 4LFCE 1ELOA 4GKJE 4LF4E 4LF7I 4AQYI 3T1HI 4JI6I 3LTOA 3OTOE 4JI1I 1H7UA 4LF5E 5IT9C 1N32E 5FLXQ 1H72C 3K17A 3QT7A 1Z0EA 1ZM4A 2UUBE 4X66I 1N36I 2UXDE 2BV3A 3JAMC 4XTJA 3H4LA 4DV6E 1HNWI 1FWKA 3J80Q 4MYTA 2UXBI 5BR8I 5LMUI 4DR5I 1Z5CA 1HR0E 1N34E 2ZBKB 1Z0GA 2E5LE 1ZXMA 4DV1E 4JI4I 4OX9I 4JV5E 2GS8A 4PU9A 2V2ZA 4DU7A 2VQFE 3T1HE 1K47A 3J7AG 1FI4A 4ZVIA 2R3VA 3ZZUA 4FW9A 2V34A 1N0UA 1XNRE 4X66E 4LF9I 2VQEE 2UU9I 1HNZI 1BKNA 1HNWE 3V5RA 4LFAI 1NHJA 1B63A 1I94I 1RREA 2UXBE 4K0KI 5BR8E 1XNQE 3Q1QA 1NHIA 1KIJA 4OX9E 3QT6A 4NXMI 1PIEA 4DR2E 3J81Q 4DV7I 1EI1A 4DV3E 3LPSA 1H73A 3B78A 4HACB 3ZZ0A 1MU5A 1FWLA 5FLXC 1IBKI 1XMQE 2X36A 3T1YI 2OI2A 1A6FA 4LF9E 3B8HA 4UTGA 2UU9E 1HNZE 1KTVA 1KVKA 3J80C 1I94E 4DV2E 4K0KE 2HFUA 1Z0VA 1NHHA 1HNXI 2DEIA 4PRVA 4KHPI 3WU5A 4NXME 1XMOI 4JI7I 4B3TI 3WU4A 4DV5I 4X62I 2VF3A 1IBLE 4DR6E 4HYMA 4HACA 4WUBA 4UT4A 4LF8E 1ZM3A 4GKKI 2AJ4A 2A2CA 4DUYI 4B3MI 4DUZI 1N0VC 4FWHA 1XHKA 4LF6E 4DV0I 4DV4I 5LMNI 3QT5A 4P52A 1QZRA 4JYAI 4DR4I 4LF7E 2XEXA 1Z0CA 4AQYE 4P7AA 3PYEA 4JI6E 3WU6A 4NXNI 4YHHI 4KHPE 4JI1E 2ZITA 1XMOE 3QT8A 2LJPA 4B3TE 4DV5E 4X62E 5A2QQ 4WUCA 3B82A 3J81C 1FJGI 1N36E 4X64I 4USKA 3PYGA 5L3JA 4JI2I 4HY1A 1Z59A 1Z5AA 2UXCI 4Z7CA 1J5EI 4DUYE 4B3ME 4DPUA 4DU8A 3WU3A 5LMUE 4DR5E 4DUZE 2V2VA 5LL6R 3K1JA 4EMDA 4JI8I 4WUDA 2HKJA 1MX0A 2ZM6I 4DV0E 4DV4E 4JI4E 2WW4A 4JYAE 4HXZA 5GMEA 4B3RI 4DPXA 4YHHE 1UEKA 4GKJI 4LF4I 4JI0I 1OJ4A 2V8PA 4LF5I 4JI5I 4URLA 2UUBI 4DPTA 4LFAE 2UXDI 2UXCE 4B3SI 1J5EE 2NPFA 2HK3A 1EA6A 3ZKDA 2J7KA 4JI8E 2V2QA 2X7IA 1N33I 2ZM6E 1S4EA 4YY3I 4DXLA 1HR0I 3PYFA 3D4JA 4B3RE 4DV1I 4DV7E 4JV5I 4Z7YA 4LFBI 4X65I 4FWGA 1IBKE 2E1RA 2VQFI 4DR7I 4DPYA 4JI0E 2BM0A 5A2QC 3T1YE 1FNMA 3M6AA 1IBMI 5IWAI 4JG4A 1H7SA 1XNRI 3V2UC 4JI5E 1ZXNA 2R42A 2F4VI 3LNUA 4B3SE 2VQEI 4DR1I 3PYDA 1WUUA 3HULA 1HNXE 1Z0TA 1N33E 4YY3E 1XNQI 4DPWA 2UUCI 3ZM7A 4JI7E 1PVGA 2HK2A 2DEJA 4USMA 5IT9Q 4LFBE 2HHHI 4X65E 4FN5A 4DR7E 4KQVA 4JI3I 4DR3I 2UUAI 4DR2I
chains in the Genus database with same CATH superfamily
2P6SA 3QQCD 4OX6A 5IWAE 3JAMQ 2E5LJ 1N5TA 1F9HA 1TUGB 2W9BB 1WF2A 1FRXA 4PR6A 5ETQA 2JC0A 3I56S 4JI1J 1NZ0A 1O5JA 3BQ1A 1UDNA 3W5XA 3MI7X 3CUNA 2YWFA 4Y28C 4OJGA 1PKPA 4EGLA 2EFGA 2R7VA 3OSPA 1HBOA 4DR3E 1Q8IA 2M52A 3RB3A 2BDPA 1S1XA 4F2SA 2W2PP 2UVVA 4B17A 1VBZA 3O3LA 3F44A 5EX3A 3TZWA 4QYZJ 4ZCLA 1X4GA 4ECSA 4S0MA 3DOKA 2QYGA 2WSCC 1RWVB 5F9NA 4A48A 2VIHA 4BBYA 1EAYC 4X4RA 1HQEB 3R5DA 4LF5E 5T7LB 1NSQA 1H2VZ 2IERA 4F3QA 4MKYA 2AHOB 3HVWA 4OJ1A 3OL8A 4ZVHA 1R43A 2ZJRQ 1U0HB 4PPDA 4KPYA 3U1NA 4NXMJ 1X0PA 2CQCA 2W2QP 2X1BA 3HKWA 4O3PA 3E51A 2V4QA 1TKXB 1Z2LA 4ECVA 2RDJA 3L7UA 1FF2A 1TTHB 1EHWA 2GS8A 2GAHC 4USVA 3AJ1A 4P2XA 2YTCA 3H20A 1K47A 3DHWC 3A13A 2YKPA 4J9OA 3MWBA 2X1AA 1UZDA 1UVNA 2I5JA 4X66E 2YQ0A 2JWNA 4LF9I 1PSDA 4WP3A 3LOUA 3NGUA 3G6YA 3MD3A 4KT0C 1R8BA 4J90A 1I94I 3M7VA 4NLSA 1T8EA 4K0KI 3CE8A 2NN6E 3IRWP 3G82A 1WHWA 4OO1F 3AJ2A 4IUFA 4DUYJ 1EI1A 1T02A 1W7WA 2DNMA 1IBKI 3R97A 4LSNA 2E7XA 3HVTA 4DV0J 2EPIA 2WVFA 3J7YI 2ACMA 3MEGA 3JYTB 2CG4A 1KONA 4ATNA 2B9YA 3SSSA 4ZDNA 1B99A 4P71A 4YHHJ 2F40A 2VPZB 3H0PA 2F9DA 5ETMA 4DV2E 3IAM9 1QUPA 3I55S 1DQ9A 4X64J 4IH7A 2HWTA 3CO0P 2B0GA 4LRBA 1EP4B 5C5JA 1CSJA 1FEHA 3UCGA 1HD1A 2CQ1A 5J2MA 4ES2A 4X4UA 2D74B 2HNDB 2ZJPQ 2QL7B 1QY7A 1Y5NB 2NUHA 2RRNA 3KJFB 3D0IE 1XHKA 4DV4I 4JV1A 4F04B 4DLGA 2ZNZA 3LH2S 4FYXB 5K9FA 4QPXA 4ECUA 3RB0A 1OY8A 4JI6E 4NLRA 3BKTA 1N5YB 1WC6A 2DGUA 3M2RA 3IAS9 1RHQB 2GHWA 1KLMB 1CVJA 1RHRB 2HGNA 3RGIA 1Y7PA 4JYAF 3D7SB 3PYGA 4WP8A 4IS9A 1GTHA 1TVRA 1U2FA 4LBPA 2KHDA 4DU8A 5LMUE 2V2VA 5E0OA 2HKJA 2ZM6I 3W9JA 3AD7C 3ZTRA 4FF3A 2C3OA 4LFAF 2RKIA 4CWBA 2XNQA 3M2VA 4CLWA 2K7JA 3HVAA 2WZ1A 1OJ4A 1TKZA 4LF5I 3BYRA 1VYAA 1T94A 3WX4A 4X4QA 1U1QA 3MOJB 3PW4A 4AXIA 5J2PA 1AB8A 2UXCE 3N79A 5HI7A 5I42B 2H51B 4IG3B 3CDIA 1RTZA 2O3ZA 2BEFA 1RAAB 2CJ9A 4A46A 3OQ2A 5K36B 3HHLB 4JI2J 4QWBA 2NPIA 3T9NA 4M5NA 3WX8A 4K2XA 2IRYA 4LREA 3CCTA 1CJVB 3MMBA 3H8YA 1FERA 3AB2B 5H9EJ 4JG4A 3BO3A 3DRYA 3CC4S 1F60B 3K59A 2WK4A 4FNHA 3MR3A 1WACA 4HDHA 1WSVA 3P3DA 4KIAA 1ZZNA 2IBOA 1ZA1B 3PZPA 2CZVC 4YY3E 3DLHA 2KJVA 1YG0A 1DY3A 4GC7A 1IBLJ 3D1OA 4NCGA 5IQ6A 2F1FA 3R6LB 4LVNP 1HLWA 4LFBE 2VFTA 1KOHA 2BA0G 4ZVFA 1EETA 3LGMA 1RBAA 4TVAB 3EPGA 2HS0A 3GFYA 2PA3A 4QIVA 2IYGA 2DVIA 2NS1B 1RISA 4EO8A 4DV2I 4O3NA 3MEEB 1IQTA 3M1VA 4AD6A 1YRTA 1RT3A 1TK8A 4LFCI 8AT1B 4RW6B 2Y1IA 2PFFB 4IZJB 3PX6A 3AY0A 2IM3A 1Z5BA 3D28A 1N32I 4NLUA 3PIPQ 1UW4A 4OI1A 5H1SV 3SV4A 2NXCA 2KYXA 2AE8A 4BWMA 2BJ7A 2RUGA 2YNGB 1FKAF 4FF4A 3KUHA 2CIMA 3ZNJ1 2B8PA 2DYAA 4OO1A 5DS7A 4GMKA 2CAJA 3G8QA 3CCZA 2KL8A 3AQOA 2IDLA 2GIRA 5A8KA 3K7RA 2BJ9A 3ZZRA 2W2OP 1RAGB 1P42A 4JI6I 3F73A 4DL5A 4MU4A 2HVIA 1FJ7A 3G8SA 1MN7A 3RW7A 3UDEA 3BDEA 4DF4A 1IQZA 3T5JA 1MMDA 3R7SB 4P6QA 4KKOA 1HNWI 1FWKA 3SCJE 2MQLA 1S6QA 2V2KA 5LMUI 3LA0A 2MY7A 2E5LE 3FVYA 2YKOA 1B7YB 4FYDA 2VQEF 2IVFB 3BEGB 4ZITA 1JKHA 4ZCIA 2BJDA 3RR8A 4OYOA 2CWKA 3R27A 3TYTA 3H5SA 1DZ5A 3LALA 1JLBB 1KWMA 5CAAA 1CULB 2UVWA 1B63A 4B3TJ 1WC0A 1FXDA 5DJBA 3LANA 3QT6A 3SQGA 2CNLB 4LPFA 2ILYA 1PIEA 4HVZA 1SH3A 2HHPA 3ISNC 4ID8A 4B3MJ 5HQ8A 2QYCA 2OPRA 2BA1D 1FWLA 4X84A 2JEFA 3PW2A 2W9BA 4RW9B 3ILOA 4UTGA 1Q8KA 3FMWA 3HFZB 1KVKA 1V3RA 3RBZA 2HFZA 3UWTA 4OZ2A 5T14A 2JX2A 1S6PB 5HP1A 3H2UB 1TQLA 1TUVA 4LF8F 2K3IA 4A8XA 4NXME 4NCBA 3WU4A 4DV5I 4A8KA 4C8ZA 4H4MB 2W9CA 4DR6E 2RUSA 3PJXA 3DXSX 3TR5A 4BA2B 2C37B 4HACA 3AH6A 3KLIB 3GPAA 2KH9A 3DI6B 1QE1A 2VODA 2MGZB 1HWJA 2R8HA 1JWWA 3OJSA 2KRBA 1UFWA 3QRPA 4C0HA 3QZ7A 3JXOA 4YB6A 1F0XA 1F6TA 3WU6A 4DR5F 4PXBA 5T7LA 3K57A 3ZTQA 2DNYA 1HWIA 1OQ6A 8RUCA 4Q45A 3HSGA 1F9FA 4H4KC 1U0HA 3HZGA 4DUYE 4IFDE 2LXIA 2BJEA 3MM6A 3RB6A 2VL1A 4J37A 4IQMA 2ZH4A 4B9SA 5MLCV 3W62A 2EWHA 4JI8I 1MX0A 4DV0E 4MFBA 4LCFA 1N88A 3HSJA 1C4AA 3D67A 3JTOA 1BLUA 3MM8A 1LNQA 4YHHE 1VQYA 2ZC3A 1NB2A 5A8RA 3AA9A 2KT2A 4CO2A 4DR1J 1MNEA 3RTVA 1JJ4A 4LSZB 1FD8A 3M8YA 4ED1A 2L41A 3S1TA 3R7BB 1URRA 3Q8UA 1D9AA 2E5IA 2XULA 2E1CA 3FGVA 1JLEA 4ZPTR 2VKZG 3SYZA 3DOMB 4OHXA 3Q6NA 4DXLA 2GMHA 3PYFA 4D3GA 2CVIA 2RILA 2C2EA 4DS4A 2UZAA 4C4WA 2QFIA 4M5IA 1FXLA 3BGRA 1SC1B 1U48A 3I0RB 2W2MP 2F63A 4WFZA 2X3GA 5F8MA 3CCVS 3JYTA 1H7SA 4OJ3A 1DTTB 5HQLA 3MUMP 3C6TB 5BYSA 3CO9A 2QV6A 4I2PB 2HRYA 4DX8H 4X65F 3EVMA 3K5LA 4FF1A 1HNXE 3RZAA 1IBMF 2CGEA 3R5GA 2V8DA 3BSNA 1YJTA 5DRRA 3PHTA 4P7VA 1IUJA 2ZKUA 4JI3I 3CWJA 4ED6A 2W8LA 4NE9C 4ECZA 5SUHA 4I3HA 1V5IB 3BV8A 3CCRS 3MCOA 1GAOA 4ID5B 1FTRA 4OZEA 3OVAA 2DGXA 3W8GA 2HAFA 1ZETA 2NYIA 5J1EB 3VAMA 4RPFA 4ZP9A 3NOCA 3Q8YA 4O23A 3MMJA 3FDSA 4QPTA 4JI2E 5HO4A 1RU1A 4DR6I 3GG0A 3IMQJ 5T41A 4DL6A 2DNGA 4Q7AA 1RWWB 5DETA 2R8GA 1VK8A 3P6YC 1M1GA 4WTYA 4LT6A 2QG9B 1WKKA 3OUYB 2BJ1A 3PKMA 3RB4A 1C1CA 2FD2A 3EICA 3A8JA 3MUVP 4WKYA 2RU9A 1SJ4P 3G6ES 2IA6A 3H4BA 1RAEB 1T05B 2FZCB 5HQMA 3DDKA 4X4VA 4O4GB 2K8GA 3QMQA 4WZQA 1YQHA 1RCOB 1NNDA 2YNHB 2MXYA 2OSQA 4WFNQ 1TMMA 3N5FA 1VR6A 1HWUA 1N8RT 1EARA 2K3KA 3NY0A 5KT6A 4HL9A 1S9EB 5F8IA 2NREA 1TR0A 2UXBF 1MU2B 2UUCF 5E33A 5I3UB 5EDWA 4AM3A 5J2QB 1MN9A 2AJQA 3DLEB 1S76D 1M5VC 2HVEA 2QEXS 3OSNA 2Q79A 1QM9A 1U1PA 1S6UA 4RW7A 2ADBA 5HMXA 4DFJA 3TX8A 5KG1A 5C0XB 3LP2B 4ECRA 3I5AA 2ZH8A 4NASA 5KG4A 2V6AA 3UD3P 2JOQA 2Y9HA 4RU9A 2AJFE 3DGPA 4OYZA 4PXEA 1VK3A 1H73A 3GCXP 3EYZA 3EGVA 2V63A 4ZLNA 2PI5A 3IP0A 3D3CJ 1VJQA 3D5MA 1KTVA 2DCUB 4H54A 3EE3A 5GAEI 1LW0A 4HI2A 5IT0A 2QMUB 5D8HB 4DSEA 1NHHA 2GO3A 1HNXI 4IZJA 2ACYA 1NK8A 4B9MA 3WU5A 3GWCA 1OSCA 2RHQB 4P2SA 3M8PB 2XSJA 1DQAA 5ADZA 2EXUA 2EG1A 3D2WA 4K4YA 3KJVA 4DI6A 1ZM3A 2OGUA 2JL9A 5M2UA 3TA0A 3P76A 5E3PA 3RRKA 4Q8EA 4LF6E 1N36F 4QBUA 1Q16B 4DSIA 2ZVIA 1NBEB 4DEZA 1HFEL 4JI0J 1S72S 3PYEA 2VFRA 3EVOA 1R3NA 3TAPA 4GRSA 3FJ2A 3QT8A 1R0CB 4B3TE 2VBYA 4F67A 1JJHA 3RBXA 1OIAA 3CW2C 1Q79A 5AT1B 3DRRA 5EX0A 4JI2I 2Y3YA 3IBFB 4NA2A 1DJ0A 1GMWA 2M5YA 4B3ME 4BLGA 3WIUA 5CD4A 1CPZA 5I3QA 3CXCR 5B0DA 5KFSA 3JSMB 3HHDA 3HT0A 2MKJA 3VQSA 5KFVA 2IBKA 2AZ1A 4PWDB 2YPYA 4UW2A 1UEKA 3LP0B 5HROA 2QIFA 5DQHA 1E3PA 2JLFA 3NWGA 3PEHA 4J9PA 2CPJA 4ZVEA 4DN0A 4ZVQB 3HPOA 3OPKA 4E2FB 3OBIA 4LIWA 1FFGB 4JI5I 2ZHOA 4B3RF 2AJ2A 1RA6A 3KLFA 1ICEB 4YR3A 2Z5EA 3GR0A 2Z56B 1R0BG 3A4TA 1TK0A 2MKYA 4UY85 3KXDA 2MKIA 2C3MA 4DV7E 3KHHA 2L48A 2DH8A 2V8VA 4J5OA 3VZHA 1N33F 5A2QC 3OHBA 2B43A 4V1Ak 1J5OA 4YDDB 1ZXNA 2R42A 4PRFA 5K14A 2Q3PA 4TKTA 3IR6B 4Q0BA 1T11A 3KJQB 2JRSA 5KFXA 1IKYA 4QIGA 2KHCA 2HHVA 4OIXA 2CPXA 1LXNA 4DPWA 3LO3A 3G6VA 1GMVA 2B51A 2OPQB 3JS9A 4RNOA 3EXCX 1FRHA 3C8YA 3U27A 3VALA 4LR7A 2HAIA 3BPDA 2Z4PA 4LF8J 3T1AA 4Q43A 2ZH5A 4CH7A 2J8AA 4B9LA 4OI3A 4Z37A 1Z0WA 5EWFA 4DR1E 2IFXA 2HHHF 2EVZA 2VQFJ 1NJXA 3CD5A 2Z57B 3DRSA 4NXNE 1K44A 4Q44A 3M9OB 5D4PA 4QU6A 1S99A 1KKHA 3PW7A 2CPYA 4ZJLA 1CQMA 2Q2EB 5C0XF 1LK5A 4DF8A 1D8ZA 3IS9B 4DR5J 1S0VA 3MFHA 2RS2A 1YDLA 2E9RX 3W66A 1B7FA 4DQQA 2I9SA 2HHTA 4K4WA 1N5SA 3GG1A 4LF6I 2VU5A 3D68A 2CQPA 4NLOA 2EK6A 3BGLA 1PC4A 1B0VA 3GSDA 2G1HA 4OLPA 2QN6B 4Y2CA 1H7UA 2JEJA 2XBPA 1X4AA 3TOQA 3KDNA 4FW7A 4IRCA 5D0HA 4JV5F 2ZDOA 3P5TL 2L9NA 3BB5A 2Z5BA 4CLSA 4XTJA 4Y0FA 3ZZOA 1WC3A 5JEAC 5DGBA 3NGSA 2DO0A 4GQUA 3DOMA 2RVJA 2FJVA 5FLXU 3W9HA 4OX9I 2VKRA 4X4TA 1YZ6A 4X4PA 3UHMA 2XLJA 2RQCA 5ETKA 3FBEA 4MKAA 2K2PA 3OHAA 2IVYA 1HBMA 2WHOA 3I0RA 1P27B 3IBWA 3MAQA 3O1LA 3C6TA 4PQUA 5DG8A 2H1YA 4ZPCA 3NGTA 1UJ5A 2IDEA 4I2PA 2E1MC 2QLXA 3NGDA 3DU6A 4PG8A 4NYOA 4QU7A 2M4MA 1X5OA 4AIDA 5C24A 1M5HA 5CYJA 2WP8A 3MMCA 1XMOJ 4B3OA 4X62J 1HL6A 2J6UA 2HIYA 3QLHA 1KIJA 4A8SA 2J0XA 2XYGB 4NEZA 3M6XA 3TJ9A 4DV7I 1VQ4S 5F8JA 3B78A 1HYSB 2J65A 3MECA 1RTHB 2IMOA 1S4FA 4WE1A 2HBYB 2HBZB 2YX4A 2IJFA 4ID5A 1HARA 5DGAA 3BKUA 3R5AA 1MROB 5IFMA 3W1YC 3W64A 4ECYA 3J80C 3QIPB 2C2MB 1HHTP 1JQGA 5KOWA 2HHXA 4FYYB 3KK3A 1A7GE 4ZP6A 4RNNA 2VF3A 3CD6S 3VAKA 5DDOC 3DGVA 2VPYB 1SC3B 1NPKA 5FLXY 4O3OA 4TLQA 2C3UA 2QLFB 1UKUA 4KHPF 4UOGA 1OPIA 3G96A 2LDIA 2CQGA 4R25A 1NRKA 1TMJA 3OD2A 2NN6B 1VRTB 1WEXA 1SC4B 2RF2A 4KBIA 1X4FA 2OD6A 4NXNI 5EWGA 4ZHRB 5DDPC 4TU7A 2VA2A 1WOOA 3W3SA 4RBTA 3ZNUA 2QA2A 4A47A 1NHKL 3FBFA 3J81C 3DM2B 2QSWA 3DU5A 1HI0P 3KKFA 3FQLA 1UPMB 1O6XA 5F9LA 1Q78A 1F5CA 5E3CA 3VAHA 2EFQA 4P75A 3CJ4A 2VJVA 4ZIWA 3KMSA 3MPVA 3CCLS 3ENQA 4WIQA 1OY9A 4LF9F 4WPAA 1SL1A 1RT5B 2XMMA 1WJ9A 1X4CA 1LFWA 1CEZA 1S9EA 4ES1A 1B0PA 4NEYA 1I94F 2B6AA 3L3CA 3P49B 4WYLA 5L9XA 2ZJQQ 4NZ6A 2AMCB 1YRXA 3A8IA 5L1LA 1UWAA 4CLPA 3S01A 4ICLA 2PO0A 2D3OR 4URLA 1Q8BA 3DMJA 1L3SA 3K8VA 2UUCJ 3U7JA 5HN0A 2AYEA 4PZVA 1IBKF 3OR2A 3M9NB 4KQZA 1UL3A 2VBXA 3PY8A 3SZ2A 5E3QA 2UUAJ 2A3JA 4ZS6A 4RWXA 2HYIB 2CPFA 3HI9A 1UEVA 4J9LA 4ZVOB 2BXJA 3E3XA 4CNZA 2RD5C 4JI0E 5KFJA 5HAOA 1FRMA 1S9FA 2EKNA 2HVZA 4M5MA 3VHQA 4ZP8A 4LF4J 4URQU 2X1FA 2H48B 3TAQA 1WD6A 5KT4A 1IKWA 3MCMA 4IDKB 4JI7E 3A8EA 4GVBA 2HK2A 1BMQB 5JEAD 3GQCA 1BQNA 5F8GA 4WFXA 2MQQA 3G86A 3NCPA 4PWWA 3KLEB 4DFKA 1IKVB 3MPYA 3THPA 4DN9A 5LMNE 1B62A 1QLNA 4MK7A 2ASYA 4DR3F 1QTMA 1CG2A 2GJFA 5G0RB 4AE5A 2W4DA 1BWVA 1FESA 2OAUA 4J3DA 1H7XA 3CDJA 1CS4B 1Z0BA 3C14B 1UPPA 2MQNA 4RWWA 2VHGA 3GYXB 1UDSA 1KSPA 1Y10A 3OVSA 3DLGB 2LA6A 4LF5F 3T9ZA 3TRGA 2IOQA 2XMVA 2MSTA 1RKJA 5F3TA 1VI7A 1AZSB 1F3FA 3BF4A 3LP0A 2VPXB 3T1HI 1UMJA 3TP2A 3P96A 2CJAA 1XJWB 1ZM4A 2KZMA 4H4OA 4FYWB 4J9UE 2JEAA 1WHXA 5JUMA 2ATCB 5KFUA 2H9ZA 2YNIB 1H3DA 5BR8I 4D3HA 2YQ1A 1RB0A 2ZBKB 2DHAA 2RJZA 4X66F 2YBVA 4M5DB 2KRRA 4FYVB 2J9DE 5K36E 3OLAA 2AYBA 2VQFE 4A4JA 2UV8G 4NWBA 3ZZUA 1AT1B 3FBCA 4NRUA 2WBMA 5KFDA 4N77A 2NN6F 1P1TA 4NLVA 3WHIA 2NSCA 4KFBA 2FQQB 1IN0A 3T5LA 4IR9A 4F0MA 1HNZI 2V5HG 1UDQA 1AUDA 4DZ6A 5KFGA 3Q8VA 1IJFB 3CSKA 2CJBA 4FW3A 4QR1A 4DL4A 4YR2A 4OO1D 2GZOA 2X3DA 5L1KA 5H9FK 4NBQA 2OPQA 3C3LA 4BA1A 3PR5B 3G2XA 2LXFA 2DNKA 4DR2E 4DV2F 1ZPWX 4OX8A 4FS2A 4LFCF 3QFHA 3GV8B 4M5KA 3FEZA 3OL9A 3KLHB 2G4BA 3EM1A 5A76A 3TWZA 3CC7S 1N32F 4L75A 2WRMA 3Q24A 4KTQA 3KK1A 4QW9A 1UFLA 3HLUA 4I67A 1T7PA 4O0NA 2MZRA 2OEJA 4JI7I 1WC5A 2GJIA 4IOAQ 3GYGA 2YNFB 3F56A 3MR2A 3AXMA 1VMBA 2JH3A 1HMVA 1G4CA 4YN3B 4LRCA 4JI6F 1RTJA 3EGNA 4ENOA 2ZOFA 3D6TB 5CYQA 3PCOB 2V50A 1W26A 3ITHB 4RNMA 2BKNA 4ECTA 1U49A 2XS2A 4YMEA 1Q86T 5HLFB 5LMNI 2MZQA 4C0BA 4DX7A 4O3SA 4C8NA 3LPEA 1WKLA 1X31C 2ZH2A 5LMUF 5D78A 2KFNA 1H6KX 2J6SA 1XMOE 4PG5A 2YKNB 2DGTA 4X62E 4DQRA 3OFFA 1U6BA 4FVMA 3RJMB 2ZZMA 3PEJA 2PNZB 3OL6A 1WC1A 1J5EI 4RO0A 3DHXA 1K1SA 4JV5J 2EG2A 3KHGA 1X4DA 1TL1B 2IVMA 2ZWPA 3Q6MA 1AUSL 2VZ9A 2ZUGA 2R2RA 2MTLA 3PR4A 2GV1A 4DSFA 1HKAA 1CC8A 1RT4B 4CTAB 1FNXH 1RCXB 3M8QB 4CO1A 4BDPA 4CM0A 2GQQA 4PG7A 3QO9B 3UN3A 2E7VA 2LQ5A 4ZPDA 2AKWB 2BQUA 4OYAA 4QOTA 1T95A 4CM2A 1RWOB 5ETTA 5JVHQ 2V2QA 3CJ5A 2XCPA 2MZTA 5K36C 2O1PA 3HHLC 4I7FB 2HS4A 2EW9A 1DTQA 2N7YA 2H5JB 4HH1A 1Y11A 2UVRA 2MZJA 3IO1A 4GC6A 4QJVA 2E1RA 5KT3A 2VQFI 3R5JB 4IRDA 2RS8A 4YY3F 1HD0A 1RTHA 3U1YA 3FZ2A 3H98A 1JLCA 3DLKB 1FD2A 1RTDB 3LUYA 4IFDB 4LFBF 1FJCA 2LXUA 3QIPA 1RHJB 1Y00A 1U4BA 4TY9A 5K8OA 3D6HB 5CZXA 1Q5YA 4EBDA 3WC2A 1EQ0A 4JOUA 2BUNA 1HNVB 2GVDB 4DR2I 2VDIA 3OXFA 1V5VA 2BE7D 2HNZB 3F41A 1E6YB 1VQ6S 4CO4A 1VRUA 1X7VA 2R7WA 2YH1A 4NLWA 2CQHA 1FKPB 4PKDB 4ELUA 4U3BA 4P73A 2I6WA 4EYIB 2UUCE 5CYMA 6FD1A 3RBEA 3JAMU 4E0DA 3FSYA 2WW8A 3HT3A 3IRXA 2PEBA 1REVA 2UUAE 3QIDA 3HD2A 3PIOQ 2NYHA 4USTA 2PMWA 2LEPA 1F5AA 2Z30B 2IOPA 5ETNA 1QDUB 1YJ7A 3MM9B 4C48A 5AJ3F 1N34I 1RT5A 2B4UA 3FFIA 2XGQA 4G3IA 2OH2A 4LF4E 2ALYB 4LF9J 4LMZA 3QNWB 1I94J 2XMTA 4K0KJ 2VPWB 4ZVTB 1MWQA 1B0TA 4ANDA 2BV3A 4R5PB 3VQTA 4PG6A 4OZLA 2MSSA 4YQWA 4GO7X 2Y0BB 4HTJA 4OZ0A 5CQGA 1HBNA 3C16A 2DPJA 1U2CA 1IBKJ 3HHNB 5KG0A 1RZMA 5DLFA 2YY3A 3MAHA 1FI4A 4WU3A 4A8WA 3BGUA 2RQKA 1PJ5A 2F65A 4ZVRB 2DY1A 4ITSA 2UUTA 3TARA 5DQIA 1JLAA 2XLIA 4WJBA 3JAMY 5KT7A 1JNZB 1YZ7A 1NHUA 1NHJA 2XS5A 3MR5A 1BUXA 3BN7A 4QIFA 2N4DA 4F7VA 1F3VA 3Q1QA 1DLOA 4TLRA 2GFFA 4IDKA 2H4WB 1E6VB 1LXJA 4MT1A 3KUEA 5D4OA 3NGRA 1R0AB 4DMZA 2QGFB 4JI4J 4DV4J 3SV3A 1DFDA 3Q8PB 2JJ4D 3MAAB 1BQMB 4NXMF 4PEOA 4ZPAA 4DR6F 2E1AA 4TY8A 3ZFVA 4IFVA 3ZXWA 1TV6A 3NKYA 5G0RA 2HHWA 2A10A 1TU0B 1KP6A 3E2EA 4KAIA 3DDIA 4NMXA 2DEIA 3KHLA 2BE2A 1CQNA 2DNLA 4TXSA 5B0FA 6AT1B 5KFOA 4NZ7A 1KHVA 3HHLD 3BS9A 1N56A 2OEKA 3AB4B 2V4JA 2ZM6J 3I0SB 5BYRA 5GAGI 1S1TB 4DUZI 2PIIA 2MJUA 2KDOA 3KMQA 5L1JA 2PT0A 5DRKA 1RKIA 3K5OA 1LWFA 4IG0B 1WSRA 3OFGA 5KFAA 2ZH7A 3SCIE 4PG4A 3NNAA 1NCLA 3J7YU 1AFJA 3SDEB 4IFDF 4I56A 2WSEC 2PFDA 3MEKA 1SQEA 5A2QQ 2HGMA 3HSDA 2X51A 3B82A 2KG0A 1YIJS 2DIVA 2QLJB 1WKJA 3TANA 4YHHF 2W2NP 4IFYA 4ZPWR 1NXIA 3UFCX 4OYMA 5KFIA 1JJ2R 3VAJA 5AE2A 3VV2B 4GKKJ 5F0UA 1TUWA 4ILRA 2XI2A 4O44B 4LF4I 4IZJD 1LV5A 3CJKB 1NSKL 4H4KA 2AWZA 4B3SI 2NPFA 3H90A 2I1RA 2CWXA 1FRKA 2YWWA 1AW0A 4FPIA 4KH0B 2R4FA 3RYLA 2JT2A 3OTDA 4OQJA 5C0XE 3SCKE 3O2IA 1U1OA 4LCHA 3MPUB 1YHCA 2FVSA 2CFXA 5B0GA 4NLTA 1G3OA 2F5GA 2O1WA 3O6QA 1HNXF 2Z2ZA 1FX2A 1ZS6A 5KAKA 4GVLA 3MM7B 3O44A 2WNRA 2IAJB 4ZCKA 4DV2J 1ZAWA 1R8HA 1FKOB 3C6UB 4LFCJ 3IWXA 4QWAA 3GP9A 1PKUA 4KE5A 1WUUA 1Z0TA 3QRQA 4Y3CA 1N32J 2RDDA 3EZOA 4ZIVA 3UDLA 1RWKB 1C0UA 2E5GA 2ASJA 2DEJA 4OMFG 2FVPA 2YNFA 5KFQA 1ZA2B 2JE6B 4Y34A 1JK9B 3M32B 1HR0J 1TZ0A 3T3FA 4I69A 2QRRA 2QL9B 3ITHA 4F4AA 2XY6A 2KXFA 3I96A 5FDLB 5C7PA 2DT9A 2W4PA 2MKSA 5M2PA 3QBCA 3V81B 4JI2F 3A1YG 4UF4A 5HVHA 3U1MA 3H40A 3L7ZB 1JLGB 1F5BA 3GILA 3OTOI 1RP5A 3J7Z5 1AA1B 5EL9A 4HHUA 1T03A 2MQ8A 1HNWJ 3QWUA 2XI3A 4OHVA 2GGPB 1SVDA 1TP7A 1S6OA 4CH1A 1IWAA 3GIMA 2KFZA 1NK9A 2HGLA 3TUPA 1WG1A 4JI5F 4DX5A 3IGNA 4OZ1A 4CNYA 3LTOA 2MLYA 1VFJA 1NZAA 3GSIA 5AXNA 5C42B 3QT7A 2ZBIA 2ZBPA 2GIQA 2DNZA 4NMLA 3KFWX 4KRWA 2C28A 3J80Q 2HFOA 4MYTA 5KFZA 2V8GA 1RT2A 4LOMA 2QC3A 4NLYA 4K5SA 2OPPA 4IYQA 4ED5A 1QTNB 4HI1A 2M9KA 1LWCB 2KXNB 5HATA 1RHYA 3BN4A 5J1PA 1PJ6A 4A8QA 3W2VB 2V34A 2QFJA 2LQ8A 1K8AT 1KD1T 4I6AA 3M7NG 3D6FB 5DRPA 3UN5A 4IFDA 2HNYB 5F8HA 4FKXA 1ZPVA 1RWNB 1YJNS 5F0WA 4ZVUB 5C0XC 4DV5J 3UCZP 2DXEA 2FJEB 2PO2B 3AA8A 5CCMA 4DWIA 3V4IB 2D41A 2BA0D 1M5OC 1NSPA 4QYZK 2Z5CB 4I2QB 3J81Q 3CVKA 1CLFA 1VIXA 3M9MB 1GX5A 2COLA 5GMKa 1MU5A 3TA2A 3M85D 5IOLA 1E6YA 1T3OA 4LF9E 2AGPA 2A6OA 4XO0A 3VTIA 1I94E 1VQPS 4K0KE 5BXIA 4G1PA 2BABA 4UZCA 4P74A 5D3GA 3NNHA 1T9UA 4RUAA 3MXHP 3K0JA 3MTKA 4PRVA 3MOZA 3VAIA 2OEMA 2J0WA 1RHKB 2MY8A 1AXQA 2RRBA 3C66A 5L8RC 4LF6F 3PW0A 1UVLA 4OYPA 3E01B 3QRRA 5CCLA 3H59A 2XO7A 4JI8J 3OTBA 4W4MA 4LSLB 3JQMA 4ED0A 1KS2A 3HFVA 4CDIA 3LWMA 2KXHA 3EVWA 4BWJA 3GB0A 4WP9A 3MM9A 3CCJS 1FVQA 1KC8T 1NDKA 3BGFA 4XIUA 2ADCA 4JYAI 4F36A 4Y65A 2XEXA 3MEDB 1Z0CA 4L3NA 4AQYE 1NUEA 1KFDA 1DBDA 2QA4G 1S1VB 4B3MF 4WWSA 4MIBA 4ZVSB 2J7WA 2IM1A 2XGPA 4ZVGA 1WTFA 4MMOA 4OX9F 1Q4RA 3IGVA 1HQUB 1HPZB 1KFSA 1PC5A 2YQ3A 4WF9Q 2B4OA 3QGHA 4EO6A 2WONB 4DG1B 1UWBA 2BA9A 2MQOA 2JLEA 4JI4E 4DV4E 3GU0A 2HQDA 2B4PA 3TW0A 2PEHA 3DRPA 1RQ0A 1QSLA 1LW2A 3BKFA 4RW8A 2FHKA 2ZH9A 4KSEB 2C22A 2FY1A 4OKGA 2CQ3A 3UD4P 2DITA 3OVBA 1FX4A 4XPEA 2QMWA 1NK4A 2Q1LA 3N6MA 5HVGA 1T9YA 1Q95G 4DV7F 3H42A 5LXRA 2WVBA 3PV8A 1L3VA 1MWZA 2GQCA 2CYYA 2ZM6E 2WB4A 2B5JA 3BSOA 4JI3J 3TUJC 4UQGA 2FZGB 3M6UA 3I9V9 3D4JA 3MZIA 4WU2A 3TI0A 1VBYA 3PS2A 3CJRA 2BM0A 2H54B 2KI2A 2VG6B 4CYUB 1FNMA 5K8MA 2Y1RI 5HMYA 3V2UC 2F4VI 3HHEA 4EBEA 2C2OB 4O0IA 3T5KA 1YBAA 4IOBA 3DYAA 4LRAA 3EGZA 2DTJA 1URNA 2R2SA 1C1BA 1FEEA 2FGOA 4DR6J 2MKCA 3OW2R 2MB0B 4DR1F 1D8YA 3IWLA 4KV8B 5U47A 4KGMA 4NXNF 2IMWP 3V4MA 4GKKE 1JLQA 3Q22A 2DO4A 3ONQA 1Q0NA 3UVJA 1XTZA 2CJQA 4ZJQA 4R1FA 3BBBA 4IG0A 3KDOA 2DR7A 3EJMA 1NHVA 4A8YA 2YX7A 1RE1B 2EI5A 2PSZA 2A2DA 2VG7A 3GMEA 4HKQA 2C2RA 1R6LA 1SKWA 1G6BA 3FEXB 3CJTA 5DO2A 1NJWA 4TU9A 1OWXA 2HQFA 2VH7A 4KH1B 3D0HE 1CJUA 3SXLA 2CKWA 1JB0C 3CWVA 2IC3B 2IYIA 4OJHA 5JMNA 3ZZZA 4HYKA 5H9EK 3VGVA 2CJYB 2LECA 3KJNB 1QD1A 4LFCE 4J9SA 1VLOA 3CMES 4AQYI 3CDAA 1X5SA 1PILA 4P7TA 1VHIA 3NNCA 5IT9C 1N32E 1SJQA 1Y3JA 1N52B 3PS3A 2EK1A 1MMNA 4J9MA 1E3HA 2UXDE 5A8WB 4K4TA 1RA7A 4UZBA 4NLDA 4J9VA 3QJJA 5ELWA 3T19A 4DQSA 2PGCA 1HR0E 3QGPA 4C3KA 5AE3A 4DV1E 4JI4I 4DL3A 1CJTB 2E44A 1X4BA 3EDQB 3DN9A 4RX6A 5AXLA 1MSWD 2RIJA 3J7AG 4UOFA 3R6GB 2O1VA 1U1MA 4HEA9 2G0JA 2IA0A 1N0UA 1U1NA 5DM6Q 2IAJA 2PMHA 2G2ZA 2VFSA 2ERRA 1HNXJ 2DJWA 3M2UB 3JSBA 1HNWE 3UDCA 3R2DJ 3DLJA 3UO0A 3Q8RB 4DCOB 2YKMA 1X9MA 4QIEA 5JEAA 3PJWA 3W5ZA 3GR1A 3BM7A 3HD1A 3Q83A 3FKBA 4KHMA 3FEYB 3VZIA 3Q8SB 2JVOA 2GO8A 1LWEB 3CDWA 1NEEA 5IC4B 2RNEA 1UFKA 2CZ4A 3M32A 3K8WA 1RTIA 1U1LA 2HLTA 2KO1A 4NOHA 2OTLS 2NSBA 1TFWA 1UVKA 1HNIB 3GFHA 1XQIA 3V81A 2WB1D 4ED7A 4ZP7A 3JB9k 4FXDA 5AXKA 5IC6B 3L7ZA 1RAHB 4OLOA 5KG5A 3GE9A 2XM3A 3H2VE 3FSXA 5KFFA 1KQGB 2UVUA 2N3LA 1S1WB 4R8UB 2XWYA 4KYZA 4GKKI 5L39A 2DHSA 2A2CA 3FRZA 2PE8A 5IM0B 1OO0B 2NN6C 1JLFB 1T9TA 3JSRA 1TL4A 1PYSB 1PYOB 5D0RA 1LFPA 2ROEA 3HXMA 1RYSA 5BR8F 2ZITA 4JI5J 1QUVA 1TKTA 3CPWR 4DV5E 3N01A 5GAEU 4U7CA 3L9ZA 5C2GA 4Y2IA 2ZHBA 4QWEA 2CNOB 5C25B 3KG4A 1UZHA 3M8RA 4B9UA 4CCHA 3MHYA 1Z59A 2NXEA 1C0TA 3WU3A 1VJWA 1TL3A 2AW0A 1ULRA 3DRXA 3K1JA 3MCNA 4WUDA 1SV5B 4OV1A 1RT6B 2WW4A 4DL0C 2RDIA 2PA8D 1SQFA 1HNZF 4OHYA 4DPXA 4OX7A 3RG6A 1YSJA 4LBHA 3VGSA 2LMIA 3I87A 2GVZA 3FUYA 4Y2MA 3KK2B 3V6KA 1Y6ZA 2UXDI 3CMAS 4QWDA 1EA6A 1SKSA 3K58A 1LK7A 4JI0F 1H0HB 3Q23A 4JI8E 2PO2A 2MLXA 4G1QB 2I0XA 2KZZA 1YJ9S 1HR0I 3MM5A 2ZE2A 3U02A 1RUSA 4DV1I 2Z5CA 3CT9A 4RKUC 4X65I 3B4TA 3CIMA 1VQSA 4M5GA 1B4SA 1Y4UA 2CVEA 1R7IA 1IBMI 1FVSA 1X5TA 4JI7F 4LCGA 3NEKA 5KTQA 4C11A 1V3SA 5LOQA 4U96A 1Y5LB 2VC0A 3NS7B 2WTFA 4EEYA 2W01A 3AD8C 1OYDA 3FCWA 2GQ0A 1NO8A 1F9EB 3M30B 1Y4SA 4OYXA 2XMJA 4PYDA 5LMNF 1YHQS 1HBOB 4FN5A 1XN9A 3TJAA 4TNOA 2E9ZA 3CDUA 3GYNA 2WVCA 3WDOA 2FZKB 1S1XB 3BDPA 3MD1A 4LF6J 2ZKTA 1SBRA 4U8VA 4UUWA 1QAJA 3A8KA 1BWEA 4TN2A 2YKQA 3FMBA 3DOKB 2IM0A 3BBFA 1I3OB 3WQPA 4J91A 2YPZA 3W5YA 1J5EF 3CULA 1YK9A 2DR6A 3A3OB 4OFZA 4WK1A 4CP5A 1ZM9A 2WOMB 2RQ4A 1GXUA 4ZMMA 4JI3E 1HQUA 1HPZA 2IESA 1YWXA 2H3EB 3HSZA 3IR5B 1X8DA 3N6NA 5KT2A 4DV6I 4OX9J 3J7AM 4DG1A 2GCFA 1I51B 1GK8A 3QFWA 4AYBD 2AEMA 5KFNA 1L3KA 2DPIA 1PJ7A 4EYHB 2G13A 2JZ5A 4QWCA 1F2HA 2IPOB 4U7UK 2I5JB 2D3ZA 2UUBE 4AFFA 4U3DA 3MFIA 2OSRA 4K8RA 5CD4H 5K36F 3ENAA 2C2KB 2VQFF 4E98A 3TO8A 4TU8A 1AYEA 3DOLB 3ELHA 2XMAA 3W63A 2UXBI 4USJC 2QL5B 4DV7J 4N76A 2OMOA 4IQXA 4B9TA 1ZXMA 1D1UA 3FZBA 1SH0A 1VQ5S 3C2PA 3MDFA 3R5CA 4PU9A 1SIWB 2GIFA 3BREA 2DHXA 2DK2A 2NN6D 2P5VA 2A6MA 3IBCB 1HQEA 2A0FB 1SL2A 1U26A 2J8SA 2VG6A 4LSNB 3OR1B 4CYUA 3MEGB 1NPPA 5FIIA 2LU2A 2W4CA 5F41A 2UU9I 3CDEA 3ENWA 4IH6A 2CXEA 4DR2F 3KG0A 1EQMA 4YR0A 1DQ8A 5AE1A 1NZ8A 1TKXA 2MDAA 2ALZA 4HT5A 3BZQA 3W65A 3EWGA 4DZDA 3EZUA 1YGYA 4MIWA 5DG9A 2VONA 2PN6A 2HBQB 4R0JA 4KV8A 5J2MB 2PO1B 4DV3E 4QZVB 1QVGR 4F4XA 3CDBA 2VV5A 1HI8A 1NJZA 5IZHA 4C6AA 4DSJA 3J7AN 2RT3A 2R7QA 3R3TA 1NK5A 3ADAC 4NXNJ 1YRUA 3KYLA 4WFBQ 1K0VA 1P9QC 1FDBA 1NLKL 1WHVA 3E8OA 3SFGA 5EWEA 2AJ1A 3M2RB 3GLLA 2O67A 4OL8A 3Q2SC 2VD3A 2Y8YA 2EBGA 5IQQA 1C4CA 2IY5B 3ZTSA 1TVRB 3CIZA 5GAHU 2LEBA 2MZSA 4L72B 1XMOF 2CPEA 4RJVA 4X62F 3GJRB 2YH0A 1Q7LB 2EFPA 4K4VA 1O8BA 2BKOA 5L46A 2KM8B 2GO9A 4LF7E 3T1YJ 4P7AA 3M2VB 3P5BP 1EJ7L 1YKWA 4DL2A 1EP4A 2LQBA 1N6QB 2LA4A 2CPZA 5J2PB 3AOBA 2YXLA 3CCMS 2HNDA 3N9UC 1FNOA 2DR8A 5KFMA 3W9IA 4CT9A 1S1UB 2C3YA 4ILLA 2CDRB 5GMEA 4B3RI 3AD9C 4NRTA 1N5YA 3EX7B 4CLFA 2MJNA 3BH7B 4WCEQ 3RAXA 1M5PC 4ERDA 3GCMA 1M5KC 4YOEA 3H5XA 4K59A 2GX8A 1EKSA 1RAIB 1KLMA 1JNRB 3NG8A 2XY7A 2GO4A 2UUBI 2OFHX 3EPIA 2YX1A 7AT1B 5D4NA 3TVZA 1UVMA 4PCQA 3ISND 3NCRA 1FJGJ 1S10A 3PTWA 1YJRA 3B4MA 5KFBA 3IR7B 1X60A 2DH7A 1N33I 2WVEA 2LKZA 1RU2A 2HURA 2XO6A 4NCGB 3MMAB 4DHVA 4CO0A 1ZZFA 1LWEA 4PXDA 4LJMA 4JV0A 4OI0A 4IR1A 2B4VA 1U09A 2DHHA 4QR2A 4RUBA 5IV4A 5HANA 4JI5E 4IFDC 2VBWA 2GJ2A 4NLPA 4WZMA 1VLYA 4ILMA 1NAQA 5I42A 3M1VB 1RT3B 2B3TB 4IG3A 2J9DA 5K36A 3HHLA 4F8RA 1RHMB 1NDLA 4KJIA 5ITHA 2HHHI 5EGYA 2CG9A 3KNGA 3QGGA 4HLBA 4DV3I 4HH0A 3PRYA 1CJVA 3RRHA 2WBRA 4OO1B 1WF0A 2ZH3A 3V6DB 5KFYA 2YVSA 3THVA 1O51A 5IM0A 2CUYA 3PO5A 5HVFA 2P9CA 2XYHB 2EC2A 3X1LB 3T1HJ 1JLFA 4DR4E 2UUAF 5A8KB 1HA1A 4F4YA 1GTEA 3CCSS 4R0EA 1U02A 1WWHA 2FUG9 1VC0A 1BC6A 4QNKA 2JVRA 3FCVA 4LF1A 1U7LA 5BR8J 4L6V3 4G6VB 1WG4A 4L76A 3KUGA 2BJ8A 2J6TA 4KKOB 4M95A 3GIKA 3HF5A 3BQ2A 4LF4F 4CLYA 3QSIA 2AYGA 2CJKA 4ED4A 1S6QB 4ER8A 3B54A 2P8IA 1RT6A 1GXTA 2ZBCA 2FDNA 1OYSA 4B3SF 4EBCA 1JKHB 3MEEA 2RAQA 4GKJE 1JIHA 4LF7I 4RW6A 1OYEA 1HNZJ 2ZNYA 1FE4A 2QE5A 1Z0EA 2DR5A 1WOSA 3GFXA 2YNGA 2LFVA 2LU1A 4LRFA 3VVUA 3B4DA 3ICLA 2R8KA 1Z5CA 1L3TA 1WTBA 1IM6A 2KU7A 3SQGB 2DNQA 2K7KA 2OPRB 4EWTA 5KFRA 1RI7A 1S49A 2ZDPA 2DISA 4ZCMA 1Z4UA 4CIOA 5IXUA 1YBUA 2FJDB 4I0WA 3PRVA 3K5PA 3QGIA 2ROPA 3S8SA 3D54A 4C3LA 1RREA 5HP1B 2V4RA 4JI7J 4WYWA 3NP5A 4RZRA 1NHIA 1S12A 4OX9E 3M30A 2D69A 2W9CB 5LJ3Y 4JUZA 4HHHA 1IXKA 4CLUA 5DM7Q 3R8YA 1Q7YT 2XWXA 4DPOA 3UE2A 4HACB 4TYAA 1XMQE 5LMNJ 3OTOF 2X36A 1S48A 3VGTA 2BQRA 4ZVPB 4P2MA 1QE1B 1UCNA 3AXKA 3B8HA 2FVQA 1JLBA 1RSCA 2CADA 3GV7B 1CULA 4CI0B 2WAQD 1GT8A 1HHQA 1JX4A 4KHPI 4M94A 2WOMA 1J5EJ 4CH0S 1FXRA 2XTJP 1CJKB 4I6WA 4DFPA 1R6MA 4FKYA 1VRQC 2G0IA 2DNPA 4HYMA 2GMJA 1LWXA 2W9AA 1S0OA 1VC5A 3MM6B 2XS7A 3NS6A 2VICA 4RW9A 5DNXA 2FJWA 4MFBB 2OELA 3HX9A 2E5JA 1RWUA 4P52A 3HKZD 3MM8B 4IFDD 4OZ5A 4DR4I 1S6PA 1B3TA 5EHHA 1K1QA 1FTCA 5A8RB 2NCKL 5KFWA 5HL7Q 1YI2S 1H38A 1FT8A 1Q5VA 4OYIA 1QAXA 4G65A 1X5PA 2DBBA 4H4MA 2HEKA 2XZTB 3TQEA 4HY1A 4BA2A 2C37A 3WIVA 4NI2B 4Z7CA 3L09A 3KLIA 3DOLA 3DI6A 1JLEB 3MPDA 2MGZA 3FK4A 1SXLA 1IR0A 1BXNA 4ZK7M 1HW9A 3OXLA 4N8NA 4U6PA 1JXVA 3M4XA 4GKJI 4ELTA 3BGRB 4OYWA 5FWKA 1M5SA 3OR1A 1KQSR 3N28A 2O01C 3EGWB 5GADI 2BYCA 3R2CJ 4AL5A 2MKKA 2B9EA 1RBOB 3I4PA 4ZLLA 2AZ3A 2RQMA 2FB0A 5DG7A 4F3OA 2FLPA 2V0NA 4DL7A 3N6LA 1XIQA 3DDNA 4DR2J 3PNIA 4N47A 4J7CA 1LOUA 1BQXA 3PHEA 4X4OA 2PO1A 2J9EA 2EFNA 3LP1B 2AF6A 4DR7I 4DPYA 4BC9A 3G8TA 4C8MA 2VUGA 3T1YE 6FDRA 5IWAI 4O3RA 1SJFA 4ES3A 1U6FA 5B0BA 2MHEA 2XC9A 2AV5A 3U1LA 5E7OB 2B7CB 2FHJD 1PVGA 2DD8S 3NGKA 3I4HX 5IT9Q 4NA3A 5L9NA 5I4MA 3X3UA 4DR3I 4DPTA 2GW8A 1RT7B 1WI6A 3TUZC 1NSAA 1N34J 2BM1A 2CZ9A 3CD0A 4KGZB 2W7OA 3KNAA 3HZEA 1SJRA 1XMQI 2PO4A 1DTTA 4Z2XA 1VBKA 2B56A 3T6JA 1DAXA 4URGA 7FDRA 4Q8FA 4QR0A 1C1CB 4PPZA 5BJRA 4X2BA 1XNRJ 3N4WA 1SPBP 4HR2A 4QYRA 1RADB 5GMDA 5KG6A 3F0NA 2HFVA 1VOMA 3H5UA 1FJGE 5GAHI 1R6VA 2P2CB 2VJUA 3VVTA 1N6QA 1GFWB 1D9DA 3CNQP 2Q43A 4PRXA 1JJCB 2RH3A 2OPSB 3RW6A 5B09A 1S1UA 3MPWA 1TAQA 1WDTA 1RWXB 1ROFA 1SI9A 5DZ7A 1ELOA 3HCXA 5J1EA 5F8LA 1R8AA 2DR9A 3HO1A 4MQYA 3SEOA 2DNRA 2EC0A 1MLAA 2ABYA 1H72C 1RT1B 3R9LA 2CPHA 5SZTA 2DRBA 5CA5A 4X66I 3PXGa 2CNKB 3GFZA 2F8MA 4QW8A 4C9DA 2O1UA 1LKZA 4F0HA 2YWEA 4RW7B 4UOCA 1J27A 3JQJA 1NDPA 3OUYA 2HVDA 4ED3A 2F4VF 3MMAA 4U9RA 2MPUA 2OHDA 2DRDA 2RHSB 3PX4A 3DGPB 4LUBA 4DSKA 4W98A 3T1HE 2VASA 3SMZA 4LR9A 4P2FA 3BYPA 3QZ8A 3M85G 3EUNA 1TK5A 2BR0A 1T05A 4XK8C 1LW0B 4O4GA 3HFKA 5BR8E 1XNQE 2YNHA 3P3GA 2JNJA 4WK3A 5E41A 4JV2A 3JTNA 4MDTA 3TVYA 2CQ4A 2AGQA 4AUKA 2XSJB 2V8HA 3BSCA 4DUZJ 4K0KF 2V94A 1OMSA 1MU2A 2XQCA 3N5BA 3KJVB 1Q1KA 5I3UA 3MUTP 3V6DA 2N4CA 5EUHA 5J2QA 3T1YI 2DH9A 1PAEX 1H2UX 2C3PA 3HMJG 2P9EA 1U45A 1HNZE 3DLEA 3GJSB 4KGKA 1RHUB 2XCAA 2V69A 1NJYA 3H7HB 5JJBA 2ZH6A 5C0XA 3ZTOA 3LP2A 1RK8A 1REGX 2CDQA 1CBKA 1ZBTA 3SIPB 3ZC4A 4ALZA 3PS1A 3BBCA 2ILZA 3J7A1 4USWA 1XMBA 3DRRB 2N3OA 4DOZA 1I6JA 3BR8A 5C2CA 4AQYF 3NAIA 4F4WA 4A8FA 2J0SD 2R7UA 3NXZA 3OLBA 2AT1B 2DNNA 4X4NA 5ETLA 3FBBA 1N0VC 1IVZA 1V3ZA 3CCUS 1QZRA 4WFYA 4XPCA 3KLGB 4CLLA 2FC9A 4WBFA 3DCAA 5HROB 4AIMA 4JI1E 2Z2MA 4FBUA 1H7WA 3ZZPA 2HIQA 5HSPA 4B3SJ 4JI4F 4DV4F 1FJGI 3M8PA 1RJJA 4ELVA 3L4BC 4CLZA 2XHWA 3H2LA 2HPUA 4FDFA 2UXCI 3KLFB 2ATLA 3I82A 2VOPA 4EMDA 2V68A 1VIOA 3UDVA 1BE4A 5A2QU 2GA7A 4ZA1A 7FD1A 1I1GA 1AFIA 1P8GA 2LLZA 5GAGU 2WSFC 4FP9A 2ZOMA 2ZM6F 2Z58B 4M63A 4F4KA 5K8PA 2H5EA 2NQPA 4N7TA 1VHFA 1J5OB 2AEJA 5K14B 4Q0BB 5BYQA 3GLJA 5ETPA 1J5EE 3AOAA 1IKYB 2CQDA 3ZKDA 4OZNA 5CHCB 4RL1A 3HP6A 4YY3I 3TJ8A 2ROGA 2BOPA 3EDRB 3JSMA 1H98A 3MCSA 4PWDA 3CCES 4DCJB 4LFBI 2HS3A 3TEHB 3UPFA 4I1TA 1A9NB 2U2FA 3HJVA 1IWGA 5F8NA 3K89A 1O0PA 4ANEA 1QJHA 2J7UA 3AFGA 5M2RA 2MZ1A 2V9KA 1DRZA 4ZJOA 3DRSB 3OTOJ 4ANCA 4C2MA 3HULA 2KG1A 4NA1A 4GKKF 4NPOA 1XNQI 1KTQA 1D09B 3RU0A 2VC1A 3ZM7A 4Q2MA 1GMUA 5CH7B 4AL6A 1GEHA 1CJKA 3NWRA 3M8SA 5A2QY 4KQVA 3VF0B 4PXCA 1S5ZA 2P9GA 2MEWA 2GHPA 4DLEA 4EUVA 4JBCA 1HBUB 3D1HA 2M70A 3ZKBA 3BJYA 3L7PA 1RWMB 1SH2A 3K5MA 1G1XA 2KKHA 2AGOA 1GXLA 5LXYA 2LP4A 4X64E 2IIHA 4CQ1A 2PMZD 2A18A 2Z5BB 3P4UB 4U7UD 4NI2A 5EKWA 1KDNA 3RUBL 4URSA 2ZZTA 5KG3A 3NOGA 3DLLQ 2ZD1B 4DQIA 2OJ3A 2FLOA 4ZLPA 1USUA 2E5LI 4HTIA 3TZXA 2UXDF 2JDJA 3PRBA 4ZPVR 3UD5A 4B08A 2QZ8A 1HBMB 1UW9A 4JI1I 4F50A 2XMUA 1G7CB 3M6WA 2PNMA 3P06A 1KVIA 1HR0F 4J9KA 4PQUB 2BACA 4DV1F 2B7BB 3IS9A 2FLLA 3OV7A 2FYXA 3GJTB 2L08A 2OO4A 2R9LA 3H1CA 4MKBA 5CABA 5C24B 2WP8B 1EZZB 3MMCB 4K50A 4DCPB 4B3OB 1UVIA 3QLHB 4BHQA 1N34E 2C38B 1VCTA 1ITPA 3MR7A 2C2ZB 1S79A 2BANB 1JXEA 5KFCA 2AX1A 4HT7A 1HNWF 3LP1A 2R3VA 5D0EA 1UDOA 2FHMA 5JXSA 1VQOS 4IO1A 3ET6B 3J80U 3MECB 4LF2A 1XNRE 1Z1ZA 4ECWA 1PYTA 4WE1B 4OYBA 3T6BA 3TZZA 3M8WA 3G87A 3W61A 2B9WA 3KHRA 2BX6A 2OD4A 3KWMA 3ETMA 4C8YA 4ZN1A 3I31A 3UW1A 5KFEA 4F2RA 3KK3B 1KQFB 1G2EA 3NLCA 1UAWA 5KT5A 2XY5A 3QYYA 4NXMI 2UP1A 3LGHA 4MAKA 3I9ZA 1RT7A 3GTYX 4XDDA 5FLXC 2DNHA 4NZ0A 1M1KT 4I4BA 5J2NB 2OI2A 4JYAJ 4EI2A 2NXJA 4GO5X 3OXGA 4I68A 3SCLE 2ZBQA 1X9WA 1B64A 3J81U 2RF2B 4DV6F 1R8PA 1HI1A 1RAOA 3W2WB 5LSRA 4LFAJ 4A8MP 1IBLE 1ZAVA 4N8OA 4WXOA 1VC6A 3CCWA 4RR5A 1HYSA 4Q5VA 2VB6A 2OPSA 4DUYI 3N0VA 1RAFB 4DV5F 1OS5A 3J80Y 4ZPBA 2CQ2A 4DV0I 1VQMS 1KNZA 3QT5A 4IKAA 1MROA 1QVFR 4F26A 2B6AB 3MURP 4YHHI 2J5AA 3AHPA 1NH8A 2VG5B 4OZ3A 4EZ6A 4FS1A 3M8ZA 1YJWS 1YBTA 2XYPB 1RT1A 4WUCA 4PWUA 2RSQA 3GCWP 4FW6A 5DLGA 4X64I 3P8BB 4ICLB 2PO0B 3DMJB 5L3JA 2APOA 2FTRA 2VBZA 3AJDA 1SKRA 3OR2B 4DUZE 5LL6R 1SJ3P 1D3WA 2K06A 1WHYA 3AT1B 2HZVA 2DXDA 2NN6A 2UU9F 1VRTA 1UP1A 1XERA 2M88A 2G1DA 3L95X 4C0OC 2FC8A 4ZHRA 3M7ND 2F4VJ 2X1GA 2OLWA 4JI8F 3J81Y 3OTEA 2V8PA 3NMRA 3DM2A 2ZC4A 2E1PA 5LSOA 4OZJA 3IG1B 5KFLA 2L9DA 5A6PA 4CO3A 4AL7A 3T5HA 3TEGA 2AYMA 4ECXA 2OFGX 1IKWB 2N7CA 4GVBB 2JLGA 2OUGA 3LWLA 2BOAA 4Z7YA 1BQNB 3O5TB 3DKDA 3KOAA 4ED8A 9ATCB 3B6BA 1XNRI 1HWLA 3V6JA 3UR3C 3PO4A 1EKRA 3LNUA 4B3SE 2AJ0A 2FHOB 3W7BA 3HKMA 2DGWA 4M8LA 2OIHA 4PYAA 2JHEA 4FW5A 5E3AA 5K8NA 4FBTA 4HHJA 1N5QA 3CJ0A 2R8JA 3ZZYA 4F0KA 1QAYA 4WKRA 2KB2A 1FCAA 1S77D 3SQOP 4USHA 2W24A 3FRYA 1U1KA 3ILLA 1D6TA 4YB7A 2BA1G 3AQPA 5HMZA 2W8KA 3W8PA 4LBIA 3BR9A 2HQ3A 4AQYJ 4JI3F 5I3PA 1BY9A 5JEAE 3P3CA 3KLGA 4M1KA 3J7ZT 5K5MA 1U2RA 1VQ7S 2VQEJ 3S6EA 4AXJA 4H4OB 1S7HA 1IBLI 3UN2A 3LGNA 2JEAB 4LQ9A 3DLBA 4KR0B 5KOXA 2HHSA 4F4ZA 3UR0A 5DDQC 1EX8A 2U1AA 3KLEA 1IKVA 1UA1A 1PG5B 2BRKA 4DBQA 2MQMA 2AP6A 2BW2A 1FHTA 1VQ8S 1T9WA 3JQKA 2HVHA 3CJQA 1QSSA 2VDHA 5K20B 2UUBF 1VISA 2CPIA 2L3MA 4K4UA 2DGVA 2HWIA 5KG2A 3HM9A 3OTOE 4G1IA 4DSLA 3THTA 2CPDA 1CS4A 2HMIB 5IT4A 1P1LA 3C14A 4KFBB 4YP3A 5K36D 2ASLA 1UA0A 3IM8A 1FJEB 3H4LA 1HW8A 4K2JA 2O1TA 1C2PA 3GJQB 3TA1A 2MQPA 3DLGA 4DFMA 3ULHA 2PNLA 1IBCB 1RAJA 2BE9B 4BA1B 2HFNA 4CO5A 2XNRA 1AZSA 5MAOA 4ZVIA 2R2TA 2JSXA 3VR1A 4FW9A 3QAUA 3J81j 2JFKA 3CJ8A 2YWGA 1ZH5A 3CTRA 1EIYB 2D3UA 3KK1B 1USVA 4DQPA 4K4SA 1BKNA 4C8KA 2CA9A 2M8HA 1I5OB 2FVRA 4DV3F 2IRXA 2YNIA 1IKXB 4RBUA 3HJFA 1FA0A 2FJXA 3SSQA 3DC2A 1XC9A 5KFHA 4M5DA 1S59A 4FF2A 3I32A 2CQIA 4MK8A 4J9RA 2ZZNA 3R7NB 1HMVB 2B9XA 3FSIA 3CC2S 1RTJB 1JXLA 1FRIA 4RUCA 1IJEB 5CYQB 1KLNA 2VESA 1HBUA 4OI2A 1PO6A 4OO1E 3EMTA 4BCAA 4MU1A 1YLXA 3IWNC 4QCLA 4F02A 1XBWA 1YH8A 3CJSA 3H5YA 4MU3A 3C15B 4M5LA 3DXBA 1KEKA 2J76E 1K73T 1HIYA 3K2YA 1ZTTA 1N5VA 4B3TI 3CD7A 4B9VA 4KGVB 4Y2AA 3KLVA 2FPHX 2HRTA 4LF7F 3KLHA 4B3MI 1S9GB 3LW5C 4Y6IA 2ZD1A 2POKA 4N56A 2KM8C 5B0CA 1TAUA 4Y00A 4JB8B 2K1RB 2UXDJ 3Q0AA 4F25A 1Q53A 1GH8A 3H4DA 3BQ0A 2QJ3A 5B0AA 2H4YB 4DV1J 4N41A 4X65J 1DTQB 2C38A 5HLFA 4K5RA 4JYAE 2Z0GA 3BGOP 4L73A 1VDHA 3ENVA 2BANA 4M5HA 4QIWD 1IBMJ 3IM9A 1QSYA 5E3RA 5E2QA 3ET6A 4A8OA 1U47A 2YKNA 5A0YB 2QMXA 1WG5A 1X9SA 4YB5A 1JLCB 4IOCQ 5DZ6A 2PNZA 2G2YA 4LFAE 2MHNA 2R8IA 1A6LA 4RU2A 1ACMB 4C3MA 1OSDA 2J7KA 1ZYQA 4CRJA 1S4EA 2VOOA 1XXEA 3M6VA 4NL5A 4NYZA 3V6HA 3TX0A 2RE1A 1NK6A 1TL1A 1T9VA 3UQSA 2ZVSA 3T41A 4IO9Q 1RGVA 4K4ZA 1RT4A 3ILJA 3MTJA 5J2NA 3PX0A 4CTAA 5A6WA 3ZO7A 3M8QA 1J2VA 1VRUB 3BO2A 2NZCA 4DR1I 2KFYA 3QO9A 3NCQA 4C98A 3PYDA 2JEBB 5CYMB 5ETRA 1FO1A 3W2WA 4I7FA 3A12A 4K7QA 3HHKA 3IRXB 4DV6J 4IZKB 1REVB 1SJ1A 4DR4F 1RLCL 1M1HA 3PACA 2UUWA 1MG7A 4OO1C 4LR8A 2L9WA 4MTPA 2QX0A 3NAHA 3DLKA 2F4VE 1KVJA 1SC6A 1RTDA 2YKAA 2RB7A 2HLUA 1N4LA 1D0EA 1VGYA 3FFIB 4YB1P 3AODA 2OMLA 1RDRA 1ZOTA 2VG5A 2VFUA 1WNEA 2QLBB 4FWDA 4PAAA 4UOHA 1H2TZ 1TKDA 2R7TA 4QQBA 5HBMB 2NLWA 1UVJA 1HNVA 2UXBJ 4UQTA 2GVDA 3JTPA 4MYUA 4GKJF 2Y8WA 2HNZA 4U8YA 1FDAA 3LPYA 4FXWA 4FVCA 4RW4B 2UV8A 1HHSA 2BW7A 1HBNB 3NRBA 3C16B 1FKPA 1FKAE 2EEYA 4ED2A 1U1RA 1NK0A 1VBXA 2UU9J 2HQIA 2EKYA 1JLAB 2ZOGA 1XR6A 2HHQA 4WTOB 3IG1A 3QJLA 2ZHAA 3TQ1A 3MF5A 4W90B 1MW7A 3WBZA 3JAMC 2R7RA 4DR7F 2C39B 5KFKA 5IWAF 2E66A 1DLOB 3ILIA 2Y0SD 4C97A 3ISZA 3OFHA 1UJ4A 2QLWA 2RRAA 2V9WA 1PBAA 2DHGA 4DU7A 1PCAA 2FVCA 2R7XA 2O3DA 2CG8A 2DGQA 2C2NA 1PAUB 1EB0A 4KO0B 2IHR1 1KBRA 4B9NA 2VQEE 3AAWB 1W25A 3M05A 4ZOSA 1NKBA 4TY8B 4R5PA 3V5RA 4IFVB 4LFAI 1TV6B 3BSAA 2FHJA 4N3OA 3D6MB 1XMQF 1N36J 2BE2B 2DRAA 2BZ2A 1SQGA 3LAKA 3VGUA 2F8HA 4WXWA 3OT9A 4L3KA 2V4JB 3PFOA 3P45B 5JVGQ 3IFEA 1NMEB 4DJBA 2J0QD 1NJIT 3C46A 3A3PB 3FNNA 1LWFB 5D4LA 3QSYB 2DXFA 3TVKA 1Z0VA 4BS2A 3LQVA 3BPSP 1XR7A 3UI3A 2CQBA 2OKQA 1E6VA 2YWKA 4YUDA 2NXNA 5B7WA 2R2UA 4Y2KA 1R0AA 5J1NA 2KVIA 4J9QA 4IFYB 2JFDA 4LF8E 1S97A 1UETA 3BH6B 4NCAA 4PUOB 2E5HA 3MAAA 4B3RJ 1BQMA 5D15A 5LSLA 3Q8QB 2Z2LA 3RAMA 5D0GA 2QA1A 2DNOA 2Q66A 4C8LA 3CB4A 1Y60A 4ZLJA 2UUBJ 1SL0A 2LJPA 2F9JA 3D3BJ 1Y0HA 5FD1A 2HMIA 5LM7E 4O4RA 4USKA 2AIRB 1N33J 2DB1A 2M7SA 3LAMA 2CRLA 3I0SA 1KHWA 4DR5E 2AEFA 2MMYA 2HQCA 2XHCA 1S1TA 3MR6A 3WZ0A 4NLQA 4LVOP 1YX2A 1WORA 4KHRA 1V6HA 1P9YA 1NM2A 1MWYA 2KTQA 2LEAA 3SFUA 3RAQA 2GNKA 3SDEA 1Q8LA 2XG8A 3RR7A 4JI0I 2RMLA 2F4FA 5C0XD 2EBEA 2WNRB 4CLTA 1SUQB 4WFAQ 1KR4A 3TUIC 1S57A 3RRGA 1NDCA 2YWHA 2HK3A 5DROA 3PJ9A 3G9CA 1IKXA 2HHHJ 3T1YF 2W7AA 1UJ6A 1C0UB 3U1KA 4DV3J 1SB6A 1NB7A 2NXUA 2GHVC 3GMGA 4FWGA 3GIIA 4O44A 2BJ3A 3QJPA 4ZKAA 1IR2A 3GIRA 4LRDA 3CJKA 2VQEI 4C7QA 3OFEA 2OTJS 2D3O1 4RUHA 3C15A 2HG4A 1TL7B 3IXQA 4PABA 3POTB 1GX6A 3TAMB 3NMAA 3HJCA 1T03B 2HBRB 3FC9A 3TNVA 4ISAA 4X65E 2KN4A 2FY8A 1ZM2A 1IBME 2JEGA 3UCUP 3MM7A 1S9GA 1FJGF 3D0GE 1FKOA 3C6UA 4LF7J 1RACB 1KQKA 4OV6A 2HKEA 2UXCF 3D66A 4JP8A 2G9OA 1TL5A 1YTYA 2Y1LB 2K1RA 1U0SA 1U6ZA 4I6YA 2BR2B 2F8EX 3QPIA 5ETOA 4O3QA 2Q6BA 5EN1A 1B70B 1WOPA 2JE6A 3CJ3A 3NBPB 2W7PA 2NR0A 1DARA 3ZZTA 5H9FJ 3KG1A 1ZAXA 5F3ZA 3CCQS 3KTQA 2MYFA 4LF8I 2Q6CA 1KOOA 1RT2B 4M5JA 5FDLA 2OPPB 2F7VA 2C2DA 2QSFA 4N5SA 2EFOA 1S16A 1RR9A 4KB7A 4FW4A 1Q82T 2PDAA 3PG9A 1HWKA 2KT3A 2D9PA 4HDGA 4MKVA 1JLGA 5A0YA 4RNFA 1K0TA 1P6TA 5FLXQ 1R89A 3K17A 3I6PA 3I5CA 3K5NA 3UNGC 3A3NB 2GGPA 5DQGA 4DV6E 3T1HF 2DCLA 1GQEA 2HQGA 4J9NA 4DR5I 2DIUA 4EZ9A 5GVQA 2XMWA 2R7SA 2V2ZA 3GV5B 1YJUA 4MU0A 3FQKA 1VQKS 1XNQF 1OYRA 4DX6A 5C42A 3JSYA 1HQ2A 4L74A 1Y5IB 2DGOA 1S0NA 4KHPJ 2G0CA 1TFYA 3CJ2A 4DS5A 5D3GB 2UXBE 1FWPA 2HZAA 3CMQA 3TZYA 2JEBA 3OL7A 1FFSB 3NZKA 2Z8QA 3HDSA 3G6XA 4XTTA 2DY9A 1LWCA 4LIRA 2BMBA 4IZKA 3FCHA 1FK9B 5AXMA 2CQ0A 1FDNA 2XZWA 1PBUA 3LPSA 5RUBA 3ZZ0A 2E9TA 3W2VA 3D9BA 1BD6A 1LQ9A 2LCWA 1A6FA 3ZTPA 2IJRA 1KRPA 4DR4J 2HZCA 2UU9E 4WIIA 2HNYA 3C19A 4QNJA 2HFUA 1S0MA 2ZH1A 2BRLA 3G4SS 4RLEA 1XEZA 2ZWOA 2FGCA 2FIUA 4E8UA 2W1BA 3V4IA 1XMOI 1W2IA 1R27B 2E5LF 4X62I 5HBMA 4I2QA 1KN6A 2LQ9A 4YDXA 4JI1F 1UWBB 2O5DA 2BBEA 4RW4A 2BQ3A 5FJ4A 2O66A 3G71S 4FWHA 3QATA 5CXTA 4GKJJ 3CF5Q 3DRPB 2WVDA 4TQRA 3IC1A 1LW2B 2HHUA 1M0SA 4RW8B 3EZ5A 1X0FA 3PKYA 3Q86A 5IS2A 2OP5A 1N36E 2DGSA 1IR1A 2NZ4A 3E01A 5LJ5Y 1WEZA 1Y4ZB 4LSLA 1Z5AA 3HVRA 2D1CA 2C39A 2E29A 8ATCB 2R7OA 1NU4A 2B5JB 3SBMA 4YEAA 1Y9OA 2LYVA 1R8CA 2ZFHA 4DR7J 1SIZA 1NKEA 4I64A 3VWSA 3W60A 3MEDA 1PGZA 5IWAJ 1S1VA 1U25A 2AD9A 2D9OA 1SKUB 2A1BA 4OHZA 1NKCA 4RNHA 1BGXT 4KGXB 2HSEB 3QWPA 4KO0A 1F2GA 2SXLA 2DKOB 4U95A 2QT7A 4FPRA 5B0EA 4EK2A 3IN5A 4CZCA 3DYAB 9RUBA 3QAEA 1YJVA 2WONA 1N48A 2XLKA 1S7IA 2ASDA 2X7IA 1C1BB 1DURA 2WCXA 4DR3J 4FNIA 4EFAC 3CGIA 4B3RE 2P6TA 1XMQJ 4USIA 1OYPA 2IRUA 2QTWA 5LT5A 3R1HA 1JLQB 3SI8A 1RLDA 3UVJB 1L5UA 1T9XA 1BHNA 2G2OA 1SCJB 4RBVA 4YFUA 5IV3A 3SSRA 1WELA 1NPRA 3EXYA 4KY3A 3P3EA 4LF5J 1N33E 4CT8A 2XMKA 4DUYF 5GADU 3G82B 4KC5A 3I5BA 2UUCI 2KYZA 5D77A 5ETSA 2W25A 1F1BB 4DV0F 2GC8A 2M3DA 2QA4S 2I2YA 4X4SA 2VG7B 3DFEA 5L38A 4ETZA 4W92B 4P9SA 1NH7A 3ETOA 3GIJA 2UUAI 1X4HA 3HVTB 2M8DB 2HFSA 1TELA 2XZDB 1K9MT 4PUOA 1CJUB 3VAGA 3PVXA 1H74A 2PD1A 2LVWA 1OY6A 4X64F 2JEIA 2D7SA 3BO4A 5IT9U 2IJNA 2IM2A 5B08A 1RBLA 3R5BA 1T3NA 1T0TV 4X66J 2VA3A 3VAFA 1APSA 2HHHE 5HMWA 2CJXB 4OI6A 3O8WA 4OI4A 3UNYA 3R1LA 2H65B 3WC0A 2F1DA 4DUTA 4ECQA 2FJBB 3GONA 4XDCA 1A0OB 1Z2ZA 1WF1A 4YS2A 4IH5A 1NK7A 2Z2YB 4ETXA 1Q81T 1UEUA 1FRJA 2FJAB 5G4DA 4Q2LA 4IRKA 2ZEJA 2XB2D 2MLZA 1VQLS 5KG7A 2ZBRA 4LQ3A 3DD6A 1U8SA 4BC7A 1N34F 2V67A 3GZ7A 1SUQA 1N36I 4MK9A 1WI8A 2C1EB 2HWHA 3D1QA 2QO3A 1Y5YA 1Y3KA 1YVFA 4F3MA 2YKMB 1GMWD 5JEAB 1XNRF 2IC3A 1Z0GA 1RABB 4JV5E 1RXOB 1WDDA 3S7RA 2RKIB 2PI4A 5KFPA 1RWPB 5IT9Y 1W2BR 1RTIB 1TKZB 1MMLA 1HK7A 4FZVA 1WEYA 5A8WA 1QAIA 2E7WA 4XAKA 4JI6J 4CLKA 3HK2A 1OPZA 4NLXA 1FE0A 4P10A 4TQSA 1TL7A 1VS3A 1ZTWA 1L3UA 3POTA 3TAMA 4V19J 2C42A 1CJTA 3AOCA 1U8WA 1VQNS 3OTCA 1V9OA 5LMUJ 1RYRA 3MMBB 3DNCA 2M2BA 4DDFA 2F3JA 3NL0A 1IBLF 3M2UA 4MJKA 4EU0A 2BVZA 3CEDA 2PC6A 3IA0A 4UY8T 2MKHA 2AU0A 1TKTB 2BR2A 2KVQE 3H25A 2UXCJ 3MGJA 1GNKA 4U67Q 3NBPA 4KPCA 1EETB 1VQ9S 5LL6d 1C0TB 4WUBA 4MIAA 4UT4A 4PQAA 1UTAA 2AJ4A 5HJYA 3PM9A 1TL3B 2I8EA 1HNIA 5E5NA 4ZN3A 1LEOA 4NLGA 1IM4A 2LQJA 1JMTA 2RU3A 4OHWA 3PDNA 3L7OA 4KHPE 4DUZF 1OQ3A 2GVZB 1CC7A 2M0GB 2N82B 4YY3J 1FDDA 4MH8A 1M90T 3PRDA 1S1WA 4R8UA 4DPUA 1R6YA 5DNLA 1XWLA 3Q89A 5DRQA 1R31A 2CNNB 2GMLA 4LFBJ 4UUXA 4K4XA 3MM5B 2ZE2B 5D6GA 1AROP 1XR5A 2NUUG 2GAGC 3NS5A 4HXZA 1WC4A 2HW3A 4NX9A 2KJWA 3OJUA 1XK8A 5ETVA 2FLNA 2XSFA 2BKPA 2JC1A 4NYPA 4USUA 4C8OA 4C11B 5C25A 3PFEA 1XNQJ 5L1IA 5KFTA 1FRLA 3KRNA 4P72A 4V19X 3K85A 2HRUA 1SV5A 2AX0A 2LDYA 2AQ4A 3LF0A 2Y1JA 4JV5I 1FK9A 1IBKE 5THWA 1FFWB 3M6AA 2H5IB 1DHMA 2B8QA 2KT5A 2ZUAA 4B3TF 2GQ2A 3US5A 3VCDA 3KK2A 5DDRC 4AT1B 3PW5A 4TYBA 1U24A 5CZVA 2J9CA 5HJXA 3RBDA 1D9FA 4FXVA 5AJ3J 4B02A 5HK4A 2I38A 2VFVA 1N54B 4G1QA 2EFVA 1X4EA 4USMA 1YITS 3Q2TC 4DR7E 5JEAF
chains in the Genus database with same CATH topology
4GKKE 1ZM2A 4DV3I 1MG7A 3PRYA 1IBME 1D6TA 2BM1A 5IWAE 3JAMQ 2CZ9A 2HFSA 1XMQI 4I3HA 2F4VE 1Z0WA 1H74A 4DR1E 5LMNE 1B62A 4R1FA 3ZKBA 4DR4E 2HKEA 1NZ0A 4NXNE 4DV2I 4M1KA 2UUCE 4LFCI 4IZJB 5GMDA 4RPFA 3F0NA 1U2RA 1KKHA 3OTOI 1FJGE 1ZM9A 1PKPA 4FWDA 4X64E 1Z5BA 2HHHE 2EFGA 2Q2EB 1N32I 1Z0BA 2A2DA 4JI3E 4DR3E 4JI2E 2UUAE 1IBLI 4DR6I 2Z5BB 4MYUA 1DARA 3ZZTA 4PRXA 4DV6I 3J7AM 2IOPA 4LF8I 4ED4A 3GONA 3CWVA 1N34I 1USUA 2E5LI 1S16A 1RR9A 2IOQA 4LF6I 1VISA 1FKAE 4LFCE 1ELOA 4GKJE 4LF4E 4LF7I 4AQYI 3T1HI 4JI6I 3LTOA 3OTOE 4JI1I 1H7UA 4LF5E 5IT9C 1N32E 3P06A 5FLXQ 2PNMA 1H72C 3K17A 3QT7A 1Z0EA 1ZM4A 2UUBE 4X66I 1N36I 2UXDE 2BV3A 2Z5BA 3JAMC 4XTJA 2O1UA 3H4LA 4DV6E 2O1TA 1HNWI 1FWKA 3J80Q 4MYTA 2UXBI 5BR8I 5LMUI 4DR5I 1Z5CA 1HR0E 1N34E 2ZBKB 1Z0GA 2PNLA 2E5LE 1ZXMA 4DV1E 4JI4I 4OX9I 4JV5E 2GS8A 4PU9A 2V2ZA 4DU7A 2VQFE 3T1HE 1K47A 3J7AG 1FI4A 4ZVIA 2R3VA 3ZZUA 4FW9A 2O1VA 2V34A 1N0UA 1XNRE 4X66E 1HK7A 4LF9I 2VQEE 2UU9I 1USVA 1HNZI 1BKNA 1HNWE 3V5RA 4LFAI 1NHJA 1B63A 1I94I 1RREA 2UXBE 4K0KI 5BR8E 4N3OA 1XNQE 3Q1QA 1NHIA 1KIJA 4OX9E 3QT6A 4NXMI 1PIEA 4IZKA 2Z5CB 4DR2E 3J81Q 4DV7I 1EI1A 4DV3E 3LPSA 1H73A 3B78A 4HACB 3ZZ0A 1MU5A 1FWLA 5FLXC 1IBKI 1XMQE 2UUAI 2X36A 3T1YI 2OI2A 1A6FA 4LF9E 3B8HA 4UTGA 2UU9E 1HNZE 1KTVA 1KVKA 3J80C 1I94E 4DV2E 4K0KE 2HFUA 1Z0VA 1NHHA 1HNXI 2DEIA 4IZJA 4PRVA 4KHPI 3WU5A 4NXME 1XMOI 4JI7I 4B3TI 3WU4A 4DV5I 4X62I 2VF3A 1IBLE 4DR6E 4HYMA 4HACA 4WUBA 4UT4A 4LF8E 1ZM3A 4GKKI 2AJ4A 2A2CA 4DUYI 4B3MI 4DUZI 1N0VC 4FWHA 1XHKA 4LF6E 4DV0I 4DV4I 5LMNI 3QT5A 4P52A 1QZRA 4JYAI 4DR4I 4LF7E 2XEXA 1Z0CA 4AQYE 4P7AA 3PYEA 4JI6E 3WU6A 4NXNI 4YHHI 4KHPE 4JI1E 2ZITA 1XMOE 3QT8A 2LJPA 4B3TE 4DV5E 4X62E 5A2QQ 4WUCA 3B82A 3J81C 1FJGI 1N36E 4X64I 4USKA 3PYGA 5L3JA 4JI2I 4HY1A 1Z59A 1Z5AA 2UXCI 4Z7CA 1J5EI 4DUYE 4B3ME 4DPUA 4DU8A 3WU3A 5LMUE 4DR5E 4DUZE 2V2VA 5LL6R 3K1JA 4EMDA 4JI8I 4WUDA 2HKJA 1MX0A 2ZM6I 4DV0E 4DV4E 4JI4E 2WW4A 4JYAE 3Q6MA 4HXZA 5GMEA 4B3RI 4DPXA 4YHHE 1UEKA 4GKJI 4LF4I 5FWKA 4JI0I 1OJ4A 2V8PA 4LF5I 4IZJD 4JI5I 1Y6ZA 4URLA 2UUBI 4LFAE 2UXDI 2UXCE 4B3SI 1J5EE 2NPFA 2HK3A 1EA6A 3ZKDA 2J7KA 4JI8E 2V2QA 2X7IA 2Z5EA 1N33I 2ZM6E 1S4EA 4YY3I 3K85A 3Q6NA 4DXLA 1HR0I 3PYFA 3D4JA 4B3RE 4DV1I 4DV7E 4JV5I 4Z7YA 2Z5CA 4LFBI 4X65I 4FWGA 1IBKE 2E1RA 2VQFI 4DR7I 4DPYA 2O1WA 4JI0E 2BM0A 5A2QC 1Y4UA 3T1YE 1FNMA 3M6AA 1IBMI 5IWAI 4JG4A 1H7SA 1XNRI 3V2UC 4JI5E 1ZXNA 2R42A 2F4VI 3LNUA 4B3SE 2VQEI 4DR1I 3PYDA 1WUUA 3HULA 1Z0TA 1HNXE 1N33E 4YY3E 1XNQI 2CGEA 4DPWA 2UUCI 2GQ0A 3ZM7A 4JI7E 1PVGA 2HK2A 1Y4SA 2DEJA 3HJCA 4USMA 5IT9Q 4LFBE 2HHHI 4IZKB 4X65E 4FN5A 4DR7E 2CG9A 4KQVA 4JI3I 4DR3I 4DPTA 4DR2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK E;  1ZM2 A;  4DV3 I;  1MG7 A;  1IBM E;  1D6T A;  2BM1 A;  5IWA E;  3JAM Q;  2CZ9 A;  2HFS A;  1XMQ I;  4I3H A;  2F4V E;  1Z0W A;  1H74 A;  4DR1 E;  5LMN E;  1B62 A;  4R1F A;  3ZKB A;  4DR4 E;  2HKE A;  1NZ0 A;  4NXN E;  4DV2 I;  4M1K A;  2UUC E;  4LFC I;  5GMD A;  4RPF A;  3F0N A;  1U2R A;  1KKH A;  3OTO I;  1FJG E;  1ZM9 A;  1PKP A;  4FWD A;  4X64 E;  1Z5B A;  2HHH E;  2EFG A;  2Q2E B;  1N32 I;  1Z0B A;  2A2D A;  4JI3 E;  4DR3 E;  4JI2 E;  2UUA E;  1IBL I;  4DR6 I;  4MYU A;  1DAR A;  3ZZT A;  4PRX A;  4DV6 I;  3J7A M;  4LF8 I;  4ED4 A;  3GON A;  3CWV A;  1N34 I;  2E5L I;  1S16 A;  1RR9 A;  4LF6 I;  1VIS A;  1FKA E;  4LFC E;  1ELO A;  4GKJ E;  4LF4 E;  4LF7 I;  4AQY I;  3T1H I;  4JI6 I;  3LTO A;  3OTO E;  4JI1 I;  1H7U A;  4LF5 E;  5IT9 C;  1N32 E;  5FLX Q;  1H72 C;  3K17 A;  3QT7 A;  1Z0E A;  1ZM4 A;  2UUB E;  4X66 I;  1N36 I;  2UXD E;  2BV3 A;  3JAM C;  4XTJ A;  3H4L A;  4DV6 E;  1HNW I;  1FWK A;  3J80 Q;  4MYT A;  2UXB I;  5BR8 I;  5LMU I;  4DR5 I;  1Z5C A;  1HR0 E;  1N34 E;  2ZBK B;  1Z0G A;  2E5L E;  1ZXM A;  4DV1 E;  4JI4 I;  4OX9 I;  4JV5 E;  2GS8 A;  4PU9 A;  2V2Z A;  4DU7 A;  2VQF E;  3T1H E;  1K47 A;  3J7A G;  1FI4 A;  4ZVI A;  2R3V A;  3ZZU A;  4FW9 A;  2V34 A;  1N0U A;  1XNR E;  4X66 E;  4LF9 I;  2VQE E;  2UU9 I;  1HNZ I;  1BKN A;  1HNW E;  3V5R A;  4LFA I;  1NHJ A;  1B63 A;  1I94 I;  1RRE A;  2UXB E;  4K0K I;  5BR8 E;  1XNQ E;  3Q1Q A;  1NHI A;  1KIJ A;  4OX9 E;  3QT6 A;  4NXM I;  1PIE A;  4DR2 E;  3J81 Q;  4DV7 I;  1EI1 A;  4DV3 E;  3LPS A;  1H73 A;  3B78 A;  4HAC B;  3ZZ0 A;  1MU5 A;  1FWL A;  5FLX C;  1IBK I;  1XMQ E;  2X36 A;  3T1Y I;  2OI2 A;  1A6F A;  4LF9 E;  3B8H A;  4UTG A;  2UU9 E;  1HNZ E;  1KTV A;  1KVK A;  3J80 C;  1I94 E;  4DV2 E;  4K0K E;  2HFU A;  1Z0V A;  1NHH A;  1HNX I;  2DEI A;  4PRV A;  4KHP I;  3WU5 A;  4NXM E;  1XMO I;  4JI7 I;  4B3T I;  3WU4 A;  4DV5 I;  4X62 I;  2VF3 A;  1IBL E;  4DR6 E;  4HYM A;  4HAC A;  4WUB A;  4UT4 A;  4LF8 E;  1ZM3 A;  4GKK I;  2AJ4 A;  2A2C A;  4DUY I;  4B3M I;  4DUZ I;  1N0V C;  4FWH A;  1XHK A;  4LF6 E;  4DV0 I;  4DV4 I;  5LMN I;  3QT5 A;  4P52 A;  1QZR A;  4JYA I;  4DR4 I;  4LF7 E;  2XEX A;  1Z0C A;  4AQY E;  4P7A A;  3PYE A;  4JI6 E;  3WU6 A;  4NXN I;  4YHH I;  4KHP E;  4JI1 E;  2ZIT A;  1XMO E;  3QT8 A;  2LJP A;  4B3T E;  4DV5 E;  4X62 E;  5A2Q Q;  4WUC A;  3B82 A;  3J81 C;  1FJG I;  1N36 E;  4X64 I;  4USK A;  3PYG A;  5L3J A;  4JI2 I;  4HY1 A;  1Z59 A;  1Z5A A;  2UXC I;  4Z7C A;  1J5E I;  4DUY E;  4B3M E;  4DPU A;  4DU8 A;  3WU3 A;  5LMU E;  4DR5 E;  4DUZ E;  2V2V A;  5LL6 R;  3K1J A;  4EMD A;  4JI8 I;  4WUD A;  2HKJ A;  1MX0 A;  2ZM6 I;  4DV0 E;  4DV4 E;  4JI4 E;  2WW4 A;  4JYA E;  4HXZ A;  5GME A;  4B3R I;  4DPX A;  4YHH E;  1UEK A;  4GKJ I;  4LF4 I;  4JI0 I;  1OJ4 A;  2V8P A;  4LF5 I;  4JI5 I;  4URL A;  2UUB I;  4DPT A;  4LFA E;  2UXD I;  2UXC E;  4B3S I;  1J5E E;  2NPF A;  2HK3 A;  1EA6 A;  3ZKD A;  2J7K A;  4JI8 E;  2V2Q A;  2X7I A;  1N33 I;  2ZM6 E;  1S4E A;  4YY3 I;  4DXL A;  1HR0 I;  3PYF A;  3D4J A;  4B3R E;  4DV1 I;  4DV7 E;  4JV5 I;  4Z7Y A;  4LFB I;  4X65 I;  4FWG A;  1IBK E;  2E1R A;  2VQF I;  4DR7 I;  4DPY A;  4JI0 E;  2BM0 A;  5A2Q C;  3T1Y E;  1FNM A;  3M6A A;  1IBM I;  5IWA I;  4JG4 A;  1H7S A;  1XNR I;  3V2U C;  4JI5 E;  1ZXN A;  2R42 A;  2F4V I;  3LNU A;  4B3S E;  2VQE I;  4DR1 I;  3PYD A;  1WUU A;  3HUL A;  1HNX E;  1Z0T A;  1N33 E;  4YY3 E;  1XNQ I;  4DPW A;  2UUC I;  3ZM7 A;  4JI7 E;  1PVG A;  2HK2 A;  2DEJ A;  4USM A;  5IT9 Q;  4LFB E;  2HHH I;  4X65 E;  4FN5 A;  4DR7 E;  4KQV A;  4JI3 I;  4DR3 I;  2UUA I;  4DR2 I; 
#chains in the Genus database with same CATH topology
 2P6S A;  3QQC D;  4OX6 A;  5IWA E;  3JAM Q;  2E5L J;  1N5T A;  1F9H A;  1TUG B;  2W9B B;  1WF2 A;  1FRX A;  4PR6 A;  5ETQ A;  2JC0 A;  3I56 S;  4JI1 J;  1NZ0 A;  1O5J A;  3BQ1 A;  1UDN A;  3W5X A;  3MI7 X;  3CUN A;  2YWF A;  4Y28 C;  4OJG A;  1PKP A;  4EGL A;  2EFG A;  2R7V A;  3OSP A;  1HBO A;  4DR3 E;  1Q8I A;  2M52 A;  3RB3 A;  2BDP A;  1S1X A;  4F2S A;  2W2P P;  2UVV A;  4B17 A;  1VBZ A;  3O3L A;  3F44 A;  5EX3 A;  3TZW A;  4QYZ J;  4ZCL A;  1X4G A;  4ECS A;  4S0M A;  3DOK A;  2QYG A;  2WSC C;  1RWV B;  5F9N A;  4A48 A;  2VIH A;  4BBY A;  1EAY C;  4X4R A;  1HQE B;  3R5D A;  4LF5 E;  5T7L B;  1NSQ A;  1H2V Z;  2IER A;  4F3Q A;  4MKY A;  2AHO B;  3HVW A;  4OJ1 A;  3OL8 A;  4ZVH A;  1R43 A;  2ZJR Q;  1U0H B;  4PPD A;  4KPY A;  3U1N A;  4NXM J;  1X0P A;  2CQC A;  2W2Q P;  2X1B A;  3HKW A;  4O3P A;  3E51 A;  2V4Q A;  1TKX B;  1Z2L A;  4ECV A;  2RDJ A;  3L7U A;  1FF2 A;  1TTH B;  1EHW A;  2GS8 A;  2GAH C;  4USV A;  3AJ1 A;  4P2X A;  2YTC A;  3H20 A;  1K47 A;  3DHW C;  3A13 A;  2YKP A;  4J9O A;  3MWB A;  2X1A A;  1UZD A;  1UVN A;  2I5J A;  4X66 E;  2YQ0 A;  2JWN A;  4LF9 I;  1PSD A;  4WP3 A;  3LOU A;  3NGU A;  3G6Y A;  3MD3 A;  4KT0 C;  1R8B A;  4J90 A;  1I94 I;  3M7V A;  4NLS A;  1T8E A;  4K0K I;  3CE8 A;  2NN6 E;  3IRW P;  3G82 A;  1WHW A;  4OO1 F;  3AJ2 A;  4IUF A;  4DUY J;  1EI1 A;  1T02 A;  1W7W A;  2DNM A;  1IBK I;  3R97 A;  4LSN A;  2E7X A;  3HVT A;  4DV0 J;  2EPI A;  2WVF A;  3J7Y I;  2ACM A;  3MEG A;  3JYT B;  2CG4 A;  1KON A;  4ATN A;  2B9Y A;  3SSS A;  4ZDN A;  1B99 A;  4P71 A;  4YHH J;  2F40 A;  2VPZ B;  3H0P A;  2F9D A;  5ETM A;  4DV2 E;  3IAM 9;  1QUP A;  3I55 S;  1DQ9 A;  4X64 J;  4IH7 A;  2HWT A;  3CO0 P;  2B0G A;  4LRB A;  1EP4 B;  5C5J A;  1CSJ A;  1FEH A;  3UCG A;  1HD1 A;  2CQ1 A;  5J2M A;  4ES2 A;  4X4U A;  2D74 B;  2HND B;  2ZJP Q;  2QL7 B;  1QY7 A;  1Y5N B;  2NUH A;  2RRN A;  3KJF B;  3D0I E;  1XHK A;  4DV4 I;  4JV1 A;  4F04 B;  4DLG A;  2ZNZ A;  3LH2 S;  4FYX B;  5K9F A;  4QPX A;  4ECU A;  3RB0 A;  1OY8 A;  4JI6 E;  4NLR A;  3BKT A;  1N5Y B;  1WC6 A;  2DGU A;  3M2R A;  3IAS 9;  1RHQ B;  2GHW A;  1KLM B;  1CVJ A;  1RHR B;  2HGN A;  3RGI A;  1Y7P A;  4JYA F;  3D7S B;  3PYG A;  4WP8 A;  4IS9 A;  1GTH A;  1TVR A;  1U2F A;  4LBP A;  2KHD A;  4DU8 A;  5LMU E;  2V2V A;  5E0O A;  2HKJ A;  2ZM6 I;  3W9J A;  3AD7 C;  3ZTR A;  4FF3 A;  2C3O A;  4LFA F;  2RKI A;  4CWB A;  2XNQ A;  3M2V A;  4CLW A;  2K7J A;  3HVA A;  2WZ1 A;  1OJ4 A;  1TKZ A;  4LF5 I;  3BYR A;  1VYA A;  1T94 A;  3WX4 A;  4X4Q A;  1U1Q A;  3MOJ B;  3PW4 A;  4AXI A;  5J2P A;  1AB8 A;  2UXC E;  3N79 A;  5HI7 A;  5I42 B;  2H51 B;  4IG3 B;  3CDI A;  1RTZ A;  2O3Z A;  2BEF A;  1RAA B;  2CJ9 A;  4A46 A;  3OQ2 A;  5K36 B;  3HHL B;  4JI2 J;  4QWB A;  2NPI A;  3T9N A;  4M5N A;  3WX8 A;  4K2X A;  2IRY A;  4LRE A;  3CCT A;  1CJV B;  3MMB A;  3H8Y A;  1FER A;  3AB2 B;  5H9E J;  4JG4 A;  3BO3 A;  3DRY A;  3CC4 S;  1F60 B;  3K59 A;  2WK4 A;  4FNH A;  3MR3 A;  1WAC A;  4HDH A;  1WSV A;  3P3D A;  4KIA A;  1ZZN A;  2IBO A;  1ZA1 B;  3PZP A;  2CZV C;  4YY3 E;  3DLH A;  2KJV A;  1YG0 A;  1DY3 A;  4GC7 A;  1IBL J;  3D1O A;  4NCG A;  5IQ6 A;  2F1F A;  3R6L B;  4LVN P;  1HLW A;  4LFB E;  2VFT A;  1KOH A;  2BA0 G;  4ZVF A;  1EET A;  3LGM A;  1RBA A;  4TVA B;  3EPG A;  2HS0 A;  3GFY A;  2PA3 A;  4QIV A;  2IYG A;  2DVI A;  2NS1 B;  1RIS A;  4EO8 A;  4DV2 I;  4O3N A;  3MEE B;  1IQT A;  3M1V A;  4AD6 A;  1YRT A;  1RT3 A;  1TK8 A;  4LFC I;  8AT1 B;  4RW6 B;  2Y1I A;  2PFF B;  4IZJ B;  3PX6 A;  3AY0 A;  2IM3 A;  1Z5B A;  3D28 A;  1N32 I;  4NLU A;  3PIP Q;  1UW4 A;  4OI1 A;  5H1S V;  3SV4 A;  2NXC A;  2KYX A;  2AE8 A;  4BWM A;  2BJ7 A;  2RUG A;  2YNG B;  1FKA F;  4FF4 A;  3KUH A;  2CIM A;  3ZNJ 1;  2B8P A;  2DYA A;  4OO1 A;  5DS7 A;  4GMK A;  2CAJ A;  3G8Q A;  3CCZ A;  2KL8 A;  3AQO A;  2IDL A;  2GIR A;  5A8K A;  3K7R A;  2BJ9 A;  3ZZR A;  2W2O P;  1RAG B;  1P42 A;  4JI6 I;  3F73 A;  4DL5 A;  4MU4 A;  2HVI A;  1FJ7 A;  3G8S A;  1MN7 A;  3RW7 A;  3UDE A;  3BDE A;  4DF4 A;  1IQZ A;  3T5J A;  1MMD A;  3R7S B;  4P6Q A;  4KKO A;  1HNW I;  1FWK A;  3SCJ E;  2MQL A;  1S6Q A;  2V2K A;  5LMU I;  3LA0 A;  2MY7 A;  2E5L E;  3FVY A;  2YKO A;  1B7Y B;  4FYD A;  2VQE F;  2IVF B;  3BEG B;  4ZIT A;  1JKH A;  4ZCI A;  2BJD A;  3RR8 A;  4OYO A;  2CWK A;  3R27 A;  3TYT A;  3H5S A;  1DZ5 A;  3LAL A;  1JLB B;  1KWM A;  5CAA A;  1CUL B;  2UVW A;  1B63 A;  4B3T J;  1WC0 A;  1FXD A;  5DJB A;  3LAN A;  3QT6 A;  3SQG A;  2CNL B;  4LPF A;  2ILY A;  1PIE A;  4HVZ A;  1SH3 A;  2HHP A;  3ISN C;  4ID8 A;  4B3M J;  5HQ8 A;  2QYC A;  2OPR A;  2BA1 D;  1FWL A;  4X84 A;  2JEF A;  3PW2 A;  2W9B A;  4RW9 B;  3ILO A;  4UTG A;  1Q8K A;  3FMW A;  3HFZ B;  1KVK A;  1V3R A;  3RBZ A;  2HFZ A;  3UWT A;  4OZ2 A;  5T14 A;  2JX2 A;  1S6P B;  5HP1 A;  3H2U B;  1TQL A;  1TUV A;  4LF8 F;  2K3I A;  4A8X A;  4NXM E;  4NCB A;  3WU4 A;  4DV5 I;  4A8K A;  4C8Z A;  4H4M B;  2W9C A;  4DR6 E;  2RUS A;  3PJX A;  3DXS X;  3TR5 A;  4BA2 B;  2C37 B;  4HAC A;  3AH6 A;  3KLI B;  3GPA A;  2KH9 A;  3DI6 B;  1QE1 A;  2VOD A;  2MGZ B;  1HWJ A;  2R8H A;  1JWW A;  3OJS A;  2KRB A;  1UFW A;  3QRP A;  4C0H A;  3QZ7 A;  3JXO A;  4YB6 A;  1F0X A;  1F6T A;  3WU6 A;  4DR5 F;  4PXB A;  5T7L A;  3K57 A;  3ZTQ A;  2DNY A;  1HWI A;  1OQ6 A;  8RUC A;  4Q45 A;  3HSG A;  1F9F A;  4H4K C;  1U0H A;  3HZG A;  4DUY E;  4IFD E;  2LXI A;  2BJE A;  3MM6 A;  3RB6 A;  2VL1 A;  4J37 A;  4IQM A;  2ZH4 A;  4B9S A;  5MLC V;  3W62 A;  2EWH A;  4JI8 I;  1MX0 A;  4DV0 E;  4MFB A;  4LCF A;  1N88 A;  3HSJ A;  1C4A A;  3D67 A;  3JTO A;  1BLU A;  3MM8 A;  1LNQ A;  4YHH E;  1VQY A;  2ZC3 A;  1NB2 A;  5A8R A;  3AA9 A;  2KT2 A;  4CO2 A;  4DR1 J;  1MNE A;  3RTV A;  1JJ4 A;  4LSZ B;  1FD8 A;  3M8Y A;  4ED1 A;  2L41 A;  3S1T A;  3R7B B;  1URR A;  3Q8U A;  1D9A A;  2E5I A;  2XUL A;  2E1C A;  3FGV A;  1JLE A;  4ZPT R;  2VKZ G;  3SYZ A;  3DOM B;  4OHX A;  3Q6N A;  4DXL A;  2GMH A;  3PYF A;  4D3G A;  2CVI A;  2RIL A;  2C2E A;  4DS4 A;  2UZA A;  4C4W A;  2QFI A;  4M5I A;  1FXL A;  3BGR A;  1SC1 B;  1U48 A;  3I0R B;  2W2M P;  2F63 A;  4WFZ A;  2X3G A;  5F8M A;  3CCV S;  3JYT A;  1H7S A;  4OJ3 A;  1DTT B;  5HQL A;  3MUM P;  3C6T B;  5BYS A;  3CO9 A;  2QV6 A;  4I2P B;  2HRY A;  4DX8 H;  4X65 F;  3EVM A;  3K5L A;  4FF1 A;  1HNX E;  3RZA A;  1IBM F;  2CGE A;  3R5G A;  2V8D A;  3BSN A;  1YJT A;  5DRR A;  3PHT A;  4P7V A;  1IUJ A;  2ZKU A;  4JI3 I;  3CWJ A;  4ED6 A;  2W8L A;  4NE9 C;  4ECZ A;  5SUH A;  4I3H A;  1V5I B;  3BV8 A;  3CCR S;  3MCO A;  1GAO A;  4ID5 B;  1FTR A;  4OZE A;  3OVA A;  2DGX A;  3W8G A;  2HAF A;  1ZET A;  2NYI A;  5J1E B;  3VAM A;  4RPF A;  4ZP9 A;  3NOC A;  3Q8Y A;  4O23 A;  3MMJ A;  3FDS A;  4QPT A;  4JI2 E;  5HO4 A;  1RU1 A;  4DR6 I;  3GG0 A;  3IMQ J;  5T41 A;  4DL6 A;  2DNG A;  4Q7A A;  1RWW B;  5DET A;  2R8G A;  1VK8 A;  3P6Y C;  1M1G A;  4WTY A;  4LT6 A;  2QG9 B;  1WKK A;  3OUY B;  2BJ1 A;  3PKM A;  3RB4 A;  1C1C A;  2FD2 A;  3EIC A;  3A8J A;  3MUV P;  4WKY A;  2RU9 A;  1SJ4 P;  3G6E S;  2IA6 A;  3H4B A;  1RAE B;  1T05 B;  2FZC B;  5HQM A;  3DDK A;  4X4V A;  4O4G B;  2K8G A;  3QMQ A;  4WZQ A;  1YQH A;  1RCO B;  1NND A;  2YNH B;  2MXY A;  2OSQ A;  4WFN Q;  1TMM A;  3N5F A;  1VR6 A;  1HWU A;  1N8R T;  1EAR A;  2K3K A;  3NY0 A;  5KT6 A;  4HL9 A;  1S9E B;  5F8I A;  2NRE A;  1TR0 A;  2UXB F;  1MU2 B;  2UUC F;  5E33 A;  5I3U B;  5EDW A;  4AM3 A;  5J2Q B;  1MN9 A;  2AJQ A;  3DLE B;  1S76 D;  1M5V C;  2HVE A;  2QEX S;  3OSN A;  2Q79 A;  1QM9 A;  1U1P A;  1S6U A;  4RW7 A;  2ADB A;  5HMX A;  4DFJ A;  3TX8 A;  5KG1 A;  5C0X B;  3LP2 B;  4ECR A;  3I5A A;  2ZH8 A;  4NAS A;  5KG4 A;  2V6A A;  3UD3 P;  2JOQ A;  2Y9H A;  4RU9 A;  2AJF E;  3DGP A;  4OYZ A;  4PXE A;  1VK3 A;  1H73 A;  3GCX P;  3EYZ A;  3EGV A;  2V63 A;  4ZLN A;  2PI5 A;  3IP0 A;  3D3C J;  1VJQ A;  3D5M A;  1KTV A;  2DCU B;  4H54 A;  3EE3 A;  5GAE I;  1LW0 A;  4HI2 A;  5IT0 A;  2QMU B;  5D8H B;  4DSE A;  1NHH A;  2GO3 A;  1HNX I;  4IZJ A;  2ACY A;  1NK8 A;  4B9M A;  3WU5 A;  3GWC A;  1OSC A;  2RHQ B;  4P2S A;  3M8P B;  2XSJ A;  1DQA A;  5ADZ A;  2EXU A;  2EG1 A;  3D2W A;  4K4Y A;  3KJV A;  4DI6 A;  1ZM3 A;  2OGU A;  2JL9 A;  5M2U A;  3TA0 A;  3P76 A;  5E3P A;  3RRK A;  4Q8E A;  4LF6 E;  1N36 F;  4QBU A;  1Q16 B;  4DSI A;  2ZVI A;  1NBE B;  4DEZ A;  1HFE L;  4JI0 J;  1S72 S;  3PYE A;  2VFR A;  3EVO A;  1R3N A;  3TAP A;  4GRS A;  3FJ2 A;  3QT8 A;  1R0C B;  4B3T E;  2VBY A;  4F67 A;  1JJH A;  3RBX A;  1OIA A;  3CW2 C;  1Q79 A;  5AT1 B;  3DRR A;  5EX0 A;  4JI2 I;  2Y3Y A;  3IBF B;  4NA2 A;  1DJ0 A;  1GMW A;  2M5Y A;  4B3M E;  4BLG A;  3WIU A;  5CD4 A;  1CPZ A;  5I3Q A;  3CXC R;  5B0D A;  5KFS A;  3JSM B;  3HHD A;  3HT0 A;  2MKJ A;  3VQS A;  5KFV A;  2IBK A;  2AZ1 A;  4PWD B;  2YPY A;  4UW2 A;  1UEK A;  3LP0 B;  5HRO A;  2QIF A;  5DQH A;  1E3P A;  2JLF A;  3NWG A;  3PEH A;  4J9P A;  2CPJ A;  4ZVE A;  4DN0 A;  4ZVQ B;  3HPO A;  3OPK A;  4E2F B;  3OBI A;  4LIW A;  1FFG B;  4JI5 I;  2ZHO A;  4B3R F;  2AJ2 A;  1RA6 A;  3KLF A;  1ICE B;  4YR3 A;  2Z5E A;  3GR0 A;  2Z56 B;  1R0B G;  3A4T A;  1TK0 A;  2MKY A;  4UY8 5;  3KXD A;  2MKI A;