1OJ4A

Ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
283
structure length
283
Chain Sequence
b'MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE
publication title Biosynthesis of Isoprenoids: Crystal Structure of 4-Diphosphocytidyl-2C-Methyl-D-Erythritol Kinase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 85
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2003-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1oj4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1oj4A01
3V2UC 1EA6A 4GKKI 4USMA 4JI8I 4JI3I 3WU5A 4LF7E 2DEJA 1FJGI 1A6FA 3T1HI 1FWLA 3M6AA 2ZITA 3GONA 2X36A 4DV7E 4ZVIA 4JI5I 2UUCI 4DV1E 5IWAE 1OJ4A 1ZM2A 4DV1I 4LFAE 4HYMA 4R1FA 1MG7A 1XNQI 1MU5A 2NPFA 3QT8A 4JI7E 4JI7I 4OX9E 4DV5E 2HKEA 3V5RA 1ZXNA 4DR6E 4JV5E 4LF8E 2V8PA 4GKJE 2UUBE 1HNXE 4LF4I 4X65E 4LF5I 4FWGA 4DV2I 1N33E 3OTOI 1Z0EA 4DU8A 4DUZI 3ZKDA 2HK2A 2HHHI 4B3RI 4HACA 4KHPI 4X62E 4X62I 1XMOE 3WU4A 4MYTA 1FNMA 1XMQE 2LJPA 1IBMI 1I94I 5BR8I 1Z0CA 4JI4I 2R3VA 2E5LI 1NZ0A 4K0KI 4JYAI 1N34I 4NXME 4DR7I 2ZBKB 1N32E 1N32I 2R42A 3ZZUA 2BM0A 1Z0VA 3F0NA 4DR5E 4FN5A 4LF6E 1NHJA 4XTJA 2F4VI 2HK3A 1HNZI 4MYUA 1H7SA 3J7AG 4LF9E 4LF9I 3WU3A 3QT7A 4LFBI 1HR0I 4UTGA 4X66E 5LL6R 4DV6E 5IT9C 4FWDA 4EMDA 1HNWE 4LF7I 2VQFE 1N0VC 2ZM6E 1FI4A 1H74A 1Z0TA 1N36E 4DV7I 1J5EE 4DV0E 1Z5BA 1QZRA 5IWAI 4DUYE 4LFAI 4X64E 4DR1E 4DV3E 3B78A 4DV4E 4OX9I 4DV5I 5IT9Q 4DR6I 2UU9E 4JV5I 4LF8I 4P52A 4JI1E 2V34A 1ZM9A 1FWKA 4GKJI 2UUBI 4B3TE 1HNXI 1Z0BA 4LFCE 4X65I 4P7AA 5A2QC 3ZZTA 2BV3A 1N33I 1DARA 4DU7A 2V2ZA 4DPTA 4DPYA 2VQEE 3B82A 1XMOI 3ZZ0A 2UXBE 3PYFA 2UXBI 1B62A 2UXCE 2UUAE 1XMQI 3QT5A 4JI2E 1PVGA 2A2DA 4PRXA 1Z5CA 2HKJA 4NXMI 1ZXMA 3JAMC 2UXDE 2A2CA 4USKA 2BM1A 4DR3E 1Z0GA 4M1KA 4JI6E 1IBLE 1B63A 4KQVA 4URLA 4DR5I 4LF6I 1S16A 1D6TA 1H7UA 5GMEA 4FWHA 5LMUE 4YHHE 4YHHI 4B3ME 4B3MI 1H72C 1XNRE 3JAMQ 5L3JA 1Z5AA 1ZM4A 2CZ9A 3T1YE 4Z7CA 3K1JA 4AQYE 4X66I 3D4JA 3J7AM 1IBKE 1Z0WA 4DV6I 2X7IA 4NXNE 4ED4A 1HNWI 4B3SE 2VQFI 4JI0E 3J80C 2ZM6I 2VF3A 3PYDA 4DR4E 1RR9A 3LPSA 5LMNE 1N36I 1J5EI 4GKKE 4DPXA 4DV0I 1NHHA 1UEKA 2AJ4A 3CWVA 4JI8E 4DUYI 4JI3E 1FJGE 4X64I 1EI1A 4DR1I 4DV3I 3T1HE 4DV4I 2Q2EB 2EFGA 4FW9A 1N0UA 1ZM3A 1WUUA 2UU9I 3J80Q 4JI5E 2V2QA 4JI1I 2UUCE 4B3TI 1KTVA 1XNQE 4DPUA 1VISA 4LFCI 5FLXC 2GS8A 3PYGA 2J7KA 3J81C 1MX0A 5GMDA 1PIEA 2VQEI 3PYEA 4DR2E 4DR2I 1KVKA 4PU9A 1XHKA 4LF4E 3Q1QA 2UXCI 2UUAI 4LF5E 4DV2E 1KIJA 3OTOE 1S4EA 4YY3E 4YY3I 2XEXA 4DUZE 4JI2I 4B3RE 2HHHE 5FLXQ 4KHPE 5A2QQ 1H73A 3WU6A 3J81Q 3HULA 1PKPA 3B8HA 3ZM7A 1NHIA 2UXDI 1IBME 4DR3I 4JI6I 4JG4A 4WUBA 1RREA 1IBLI 4DPWA 1I94E 5BR8E 4WUCA 1ELOA 3LNUA 4JI4E 2E5LE 4UT4A 4K0KE 4JYAE 1N34E 5LMUI 1FKAE 4DR7E 2HFUA 3QT6A 2OI2A 1XNRI 4WUDA 2E1RA 4DXLA 4HACB 4HXZA 3H4LA 3T1YI 2F4VE 4AQYI 1HNZE 1Z59A 1IBKI 2V2VA 3ZKBA 4NXNI 4PRVA 4RPFA 4B3SI 4Z7YA 4HY1A 2DEIA 4JI0I 4I3HA 1KKHA 3K17A 4LFBE 1BKNA 1U2RA 3LTOA 2HFSA 1HR0E 4DR4I 2WW4A 1K47A 5LMNI
chains in the Genus database with same CATH superfamily
1RHYA 3CNQP 3M8PA 1DTTA 2CUYA 4PUOA 4ANDA 4LMZA 2C2KB 1SV5B 4DCOB 3N5FA 4CM0A 2R2TA 2PE8A 3H1CA 2BJ8A 3NEKA 4AUKA 1NCLA 2X36A 2D74B 1VFJA 2ERRA 4K5RA 4CI0B 2OTJS 1S12A 3R27A 3CF5Q 3PW0A 4PWUA 3T5HA 4HYMA 3TP2A 1XNQI 3GILA 3QT8A 5KFKA 5AXKA 4C11B 3FRZA 3GFZA 1GXUA 2RRBA 3AQOA 4NPOA 3O44A 2ZH8A 1C0UB 1RU2A 4LF5I 1T94A 4V19J 2O1TA 1W2IA 3IGNA 2B4VA 2DGVA 1BWVA 4DR7J 2GVDB 4IOBA 3ZKDA 2MB0B 4QR0A 4ELTA 3UR3C 3HKZD 2B4UA 3MMAB 2MQNA 2KG1A 5J1EB 4XPEA 2CNKB 4MYTA 1FNMA 3PS3A 2B4OA 1VQ6S 2XLIA 4USHA 1UCNA 4NXNJ 3NZKA 2Z2LA 2EI5A 5B0GA 1TK8A 3S7RA 4DR7I 2ZBKB 1Q81T 5KT4A 3ONQA 4LFCF 3GG0A 3BQ0A 1RTDB 2W8LA 1IQZA 4DR5E 2Y1RI 3MFIA 4IG0A 3J7AG 3G96A 1RCXB 2VIHA 3MTJA 4ED0A 4PWDB 3G86A 4TYAA 1RB0A 1VK8A 2E1AA 3CJ5A 1FDBA 3G6YA 2CPHA 1KRPA 2F1FA 5I42B 5IS2A 1N52B 2F8MA 5D0EA 1AYEA 1QTMA 1SJRA 4PAAA 4RBUA 4A47A 1RBLA 4WYLA 1WG1A 4RUBA 1GEHA 2WSCC 3U02A 5C25A 3OR2A 4Q5VA 2MGZB 4N77A 3L7ZA 2FY8A 5DM6Q 1DLOB 1ZM9A 1EETA 4LFCE 4P7AA 5A2QC 4JI0F 2OELA 4CYUB 4DPTA 4RBTA 3M32B 4J90A 1R0CB 4IDKB 3KLGB 3HHLC 1X9WA 1CQMA 3C16A 2V0NA 1ZPVA 2FC9A 4JI8F 2OTLS 1TVRA 3MEDA 4I1TA 4ES2A 2IBKA 2NN6D 1HNZJ 1KONA 3TJAA 3RBXA 2E7VA 4R5PB 2C2ZB 1S9FA 2OPPB 1NJYA 3MAAA 1CBKA 1Y0HA 1HYSA 4OX7A 1BHNA 3K5PA 4GVBB 4A46A 5THWA 4WYWA 4P2MA 2YWGA 4NASA 4ZCMA 2WBRA 1RLDA 1P6TA 2PEBA 2BW2A 2Z5BA 4LT6A 4YEAA 1NDCA 2L3MA 3OTOF 3J7YU 3JAMQ 3QJPA 3UN2A 1FCAA 3K7RA 4ZN1A 3GQCA 2PIIA 2L9NA 1A0OB 3RB3A 2IDLA 1RWMB 2KL8A 4JI0E 1M1GA 2ZHOA 2E5HA 3G87A 9RUBA 2K8GA 1U09A 4TQSA 4K59A 2AD9A 3ZXWA 2RHQB 2ZH5A 1O0PA 3W2WA 3V6KA 3CDBA 4U7CA 4JI8E 1NK7A 2CAJA 2RDJA 1WC5A 2H3EB 2V2QA 1RTIB 2RH3A 3BGUA 2XCAA 3I5AA 1D9DA 1HR0F 1RHMB 1JKHB 1Q1KA 3FC9A 4NBQA 1ITPA 3FQKA 1HNWF 2DNGA 4DPOA 1LWFB 3OTOE 2M8DB 3BO2A 4YY3E 3NKYA 2NXEA 3Q8SB 4LCGA 2M2BA 2R8GA 1HI1A 1RWUA 2GIFA 1SIZA 5B7WA 3G8SA 3HFKA 1WOSA 2E44A 4RW6B 1E6VA 1L3SA 1KHVA 2U1AA 4JV5F 4PQAA 1FKAE 3LPEA 2HNYA 2F9JA 5MAOA 3GJTB 4DUTA 3MM9B 4EEYA 4HXZA 1AXQA 2KYZA 3THTA 2UXBF 5GAHI 3HKMA 2MY8A 2X1GA 4ZVRB 3NP5A 1D8YA 5C2GA 5DDOC 5L9XA 4RLEA 3BO4A 4ZOSA 2DGWA 1U2RA 3V6HA 1LWXA 1HR0E 5ETTA 3QJLA 2VU5A 2DHAA 3BDPA 3JQKA 5J2QB 1CULA 2M88A 1UWAA 1UW9A 4YR0A 3K8VA 2W9AA 3W60A 1RT1B 1KEKA 1U1RA 3M8SA 4MU1A 3A8EA 3IGVA 8RUCA 4UF4A 1TL3B 2ABYA 1XNRF 3SIPB 3H42A 2HKEA 3OL8A 1VQLS 2VZ9A 3BPSP 1BE4A 4JV5E 2C2OB 3P5BP 4ZN3A 4X65E 3HZEA 4B3SF 2VQFF 1XERA 3PIPQ 2W4CA 2KH9A 4I56A 4NA2A 4DHVA 1RKIA 3EM1A 1S1XA 1PJ6A 5DGBA 2CADA 3GIKA 2UVUA 2JRSA 1NK9A 1RSCA 1AA1B 4RW7B 4AQYJ 1QTNB 2CG4A 3KMSA 1U1MA 4NXME 1Y10A 1F5BA 2FQQB 3MM7A 1GX6A 2BJ7A 1KTQA 1RHKB 4Y28C 4ZVUB 1ZZFA 2AGOA 1EHWA 2C3YA 3BN7A 3ILOA 1HLWA 1JXVA 4O44A 2BA0D 2AP6A 2Q6CA 5HBMA 2HQFA 1YJ9S 1YITS 3QMQA 4UUWA 4ECWA 2J6UA 2OKQA 2BRKA 5KG5A 4PQUA 4LVOP 4E0DA 2IOPA 2C3UA 2JVOA 2DIVA 1F3VA 4KGVB 5LL6R 4JI7J 3HFZB 2CVIA 3C14A 4EMDA 3EXCX 4JI6F 2JL9A 2VQFE 2NR0A 1Y11A 2C38A 3VHQA 4LF8J 3X1LB 4JI4F 1VQKS 4JYAF 2DCLA 3KHLA 5HLFB 3OJSA 4ZCIA 1FT8A 5EX3A 2APOA 3OTCA 3IR7B 2WK4A 4N8NA 1JLEA 3RW6A 4C8KA 5D0HA 3KK2A 5E3RA 5EN1A 3T1YF 3PV8A 4ZPBA 1B70B 4P52A 4LF8I 4ITSA 5EHHA 2AEJA 3Q8RB 3ZZTA 3OHBA 4UOGA 1K44A 4OI0A 2IYIA 3DD6A 3M30B 2DHHA 4AXJA 4KAIA 4GKKF 1RT6B 2O1VA 1JNZB 1W26A 4WFBQ 3NS5A 4UUXA 1IKWB 4QNKA 4LF9J 2HKJA 3QSIA 4ID8A 1FD8A 1JB0C 1TP7A 4OYXA 2UXDE 1NRKA 4JI6E 3DCAA 3PHTA 1RHUB 1B63A 1YIJS 2KFNA 1LWCA 3O2IA 4J37A 5CYJA 3C16B 1UEUA 4IZJD 4RBVA 5DG7A 4J9UE 3HZGA 1UFLA 2XNQA 1VJWA 5C42A 5AJ3F 4OI3A 4PXEA 4EO8A 1IJEB 3MXHP 3DOLB 2HVDA 5D6GA 5KFVA 1RCOB 5IWAJ 3T1YE 4EWTA 1YGYA 4OZ5A 4F2RA 4CNYA 3J7AN 1XMQF 4MQYA 4YB6A 3DU5A 2UV8G 2J9EA 3R2DJ 4B3OA 2SXLA 2OHDA 3TAQA 2VF3A 2E5LF 4M5HA 3EPGA 1S6QB 4GKKE 5AXMA 3T9ZA 2E1PA 2M0GB 4NMLA 2FLNA 5IT9Y 2HZAA 4J9PA 3N79A 2X51A 4PG7A 4KH0B 3AOBA 3CD7A 1U1QA 1LFWA 4Q8EA 4PXDA 3DRPB 4OJGA 1U8WA 3CIZA 5KFXA 2XTJP 3K85A 3W2WB 2VQEI 2AJQA 4J9NA 2VC0A 4FYXB 3PYEA 3Q23A 2VFSA 4KT0C 5KFGA 5JJBA 2VJVA 3RB4A 5IM0A 4ZCKA 3SQOP 3ZNJ1 4QYZK 1U0HA 4YY3I 4C97A 4DOZA 2WBMA 2ZJQQ 1F60B 4UY8T 3VAMA 5C7PA 3B6BA 3KK1A 3ISND 4IYQA 5DG9A 4RW8B 4DL6A 4WK3A 5F3TA 5HVFA 1S0MA 1DQ9A 4PKDB 2E5LE 3K5NA 3H8YA 2RF2A 2VC1A 1BGXT 2GHVC 4F0MA 3I6PA 3MOZA 2BXJA 3C6UB 3ILJA 2BDPA 3AQPA 4L75A 2YWEA 4B9TA 3L7UA 2QLFB 4L73A 3H5SA 2WCXA 1FJGJ 2HWHA 4EFAC 5J2MA 2J5AA 1KLNA 2AIRB 1R31A 3HO1A 3ETOA 4PG4A 3CDWA 3BR9A 3AOAA 1IBCB 4NLOA 4PXCA 2OFGX 4CLSA 3VWSA 1YWXA 1LXJA 2LYVA 3CDIA 3G82B 1YJWS 4J9LA 1FJGI 2C2MB 3G8TA 3DRYA 3CD5A 2GMHA 4LF6F 2EG1A 1WJ9A 1WG5A 1IWAA 4LRDA 3TAPA 3KLFA 3JAMU 1TFWA 3MMCB 4NL5A 4EZ6A 3KHGA 3QWUA 4OJ3A 4I2QA 4GC7A 1L3KA 3PDNA 4OYOA 1KHWA 3PR5B 3ZZYA 3GE9A 3DLJA 3BQ2A 2EBEA 4UOHA 1P8GA 2B9EA 1PYTA 3SFUA 2W2MP 2ZZNA 2Z8QA 2DRDA 4HL9A 4C98A 1GX5A 2DXFA 1Z0CA 1S7IA 3M4XA 2FJAB 1VHIA 2CYYA 3FQLA 4QOTA 3PS2A 4W90B 1NO8A 4O0NA 2C39A 2J8AA 1N5TA 4DQRA 2ZH7A 1H0HB 2LXUA 1U25A 5BXIA 4LF6E 1S1XB 3AOCA 1VRTA 2NXJA 4TQRA 2D9OA 4USUA 3PG9A 1RU1A 4I7FA 3CJKB 3WU3A 1SC4B 1S76D 1PYOB 5AT1B 1B7FA 1UDQA 3RZAA 3SDEA 2BMBA 2FIUA 1BQXA 4MMOA 2KRBA 5HBMB 5I4MA 3MUVP 2RKIB 3IWNC 3MCMA 1Z0TA 2AKWB 4OI6A 2DHSA 2FGOA 4KV8B 2ASLA 1RTJB 1FE4A 1RT4B 2VG6B 4HI2A 4C8ZA 4XDCA 3JTPA 1WD6A 4PR6A 4CLYA 4X84A 2E9ZA 1UVKA 3PX6A 1KC8T 3KK3B 2ACMA 1NSPA 4PEOA 1R6MA 1EP4A 1RT2A 3MM5A 1NZAA 1NDPA 1RWVB 2B8QA 3QGHA 1XWLA 4OO1F 3TX0A 1B62A 1T7PA 3Q6MA 2JEGA 2UUAE 3R5GA 2NN6E 1RHJB 2V9WA 1JLEB 2JE6B 2D1CA 5DZ6A 4DV7F 3GR0A 1UA1A 4N7TA 1U1KA 4QIVA 3MECB 2PO0A 4K2XA 4DMZA 1XXEA 2P9GA 4R0JA 1BQNA 3RRHA 4HTJA 2XZDB 5CXTA 3W5YA 1WELA 3SCKE 4IZKB 5CA5A 2J9CA 2V4JA 3VAJA 4R0EA 2KKHA 1SCJB 1K0VA 4MFBA 2DR5A 3KLHB 4KHPF 2CWXA 4H4KA 1IR1A 1M5SA 3VVTA 3K1JA 1URNA 2VFUA 5CQGA 1R3NA 2ZKTA 3CCMS 2VV5A 4DR6J 1X4HA 3HDSA 5C2CA 1BD6A 2CVEA 2LEAA 5CD4H 2UUBJ 4WP8A 4PG6A 3IC1A 2CPDA 2JC1A 1N32F 4JI3E 2PC6A 4EBDA 1XMOJ 3MOJB 2LLZA 3T1HE 3ENWA 1WC3A 3P96A 2H5JB 2E9RX 2ADBA 3BJYA 3DOKB 2VPZB 4Q45A 1PBUA 2DNKA 1GNKA 5F8MA 2MZTA 3H5XA 1C0TB 1VQSA 5JEAD 3Q8UA 3HHNB 3CE8A 5KFNA 1YG0A 4NCGB 4ICLB 2MYFA 4USVA 4LFBF 1JNRB 1OMSA 4OZ2A 3NG8A 3LQVA 1QJHA 4OYZA 1U26A 3DLGB 3V4IB 2M3DA 2XYPB 3D0IE 2OAUA 2XYHB 1G3OA 3GYGA 2DGXA 2QRRA 3LH2S 3H40A 4KHPE 1UW4A 2MZQA 2Z2YB 3HULA 4LIRA 2ZOMA 3MD3A 1JLBB 1N54B 2BE2B 3A8KA 1C1BA 4DL7A 2JEBA 5KFRA 2BOPA 3MM6B 1NJXA 2ZH6A 4W92B 1HNXF 2WHOA 3FMWA 3FZBA 1OIAA 3EZOA 3HLUA 2V94A 3SV4A 4MKBA 2OH2A 4FYYB 2ASDA 2J0WA 2ZKUA 3DXBA 1VQ4S 3W7BA 4U3DA 2IY5B 4HY1A 2VBWA 3IS9A 3LF0A 4LFBE 2UUCJ 1RADB 4QIEA 2BANA 3P8BB 4B3TJ 5HATA 5LMNI 4C3LA 2GHWA 2R7RA 3OVAA 4DQPA 4O3PA 1QUPA 2ROPA 3PR4A 3HSZA 3ILIA 2RDDA 1X4DA 1A6FA 5K8OA 4DR2J 2FD2A 4WE1B 3TUJC 4B17A 1RKJA 1G6BA 2UUCI 4B3MF 1REGX 2R2UA 4AT1B 2HHHJ 4DDFA 1FTRA 2F4FA 1F0XA 1G2EA 1ZS6A 1IXKA 2Y3YA 1S1UB 3UCUP 1U7LA 4NEYA 1HNXE 1GT8A 3IRXA 5KG0A 2CA9A 3MPYA 2HHHI 3M2VA 4DR4F 4HACA 2L41A 4X62E 2J7UA 2MY7A 5LSRA 5AE3A 3SBMA 4ECYA 1VLYA 2F4VJ 1PC5A 2R3VA 2RDIA 3WC0A 2HQGA 1N48A 1UPPA 3CCLS 4CLZA 3GFYA 3UNGC 2ZZMA 2CPJA 5HANA 1FK9B 2IA6A 2RQCA 3BS9A 2FZCB 4CTAA 3VGSA 3CT9A 3CDJA 2F4VI 2ZDOA 4LSZB 4OYBA 4NZ0A 1UZHA 4Q0BA 1S6OA 3DRRB 2BZ2A 4RW4B 1HNVB 2NN6A 1X5TA 3TOQA 2H4YB 1Y5LB 5HK4A 3RG6A 3RJMB 1G7CB 2F40A 1JLAA 3L95X 1LW0B 3BBCA 2PA8D 1Q79A 1I94F 3DLKA 4OIXA 3UW1A 1IM4A 1PJ7A 2FVCA 4G1IA 2R7QA 1T03B 3FSXA 1GFWB 4ISAA 1S9GB 4H4MB 4ED5A 2FY1A 2PEHA 3U27A 4IFYB 1NNDA 1HFEL 1YBAA 2YQ3A 3ELHA 2DJWA 2R7XA 1HHSA 3SXLA 2KU7A 4CNZA 2RVJA 2NS1B 4PCQA 2CPIA 2XNRA 5K8NA 1F5CA 3SQGA 4D3HA 1HPZB 1S77D 4Y00A 2MZJA 3QBCA 4ZLPA 1J5OB 4BWMA 4BLGA 5C0XF 1EP4B 4CH0S 3R5JB 2RU9A 3T6BA 3N01A 2AJ2A 3MM5B 1NBEB 1SB6A 4IS9A 3KJVA 2NREA 5C24A 4GC6A 5KAKA 5LMUE 3MPVA 2MKSA 5IC6B 7FDRA 2R7VA 4YHHE 2LQBA 1T02A 2E5GA 3PKYA 4WFAQ 3OHAA 4QW9A 2RS8A 4URGA 1HK7A 1SJFA 2R4FA 4BBYA 3IM9A 2XMAA 1FDNA 2LKZA 3T41A 4DV4J 4DV6I 2XMJA 1NDLA 1WC0A 4ECSA 3HKWA 1P9QC 2FUG9 4EYIB 1Z2LA 5CYMB 2B9YA 4FW5A 1EX8A 2G0CA 1X9MA 2BR2A 2QL9B 3T5JA 3AH6A 2B6AB 2V4JB 2WTFA 1NHHA 1RP5A 3IWLA 1CQNA 1HBOA 1CJVB 1IKVB 2ZHBA 2ZJPQ 4DV4I 2ATLA 3O3LA 1TZ0A 2M8HA 4V19X 1P27B 3MZIA 4WF9Q 1K1SA 2KN4A 5IZHA 4G6VB 2WW8A 1SKRA 1KLMA 3PJXA 3PXGa 4J9RA 2GQQA 3HI9A 1MN7A 1E6YB 1A7GE 2VJUA 1KVKA 5B0AA 1XHKA 3CJQA 2OLWA 2K1RA 1S4EA 1X4AA 1S97A 1D3WA 2FC8A 2DRAA 2V50A 4TXSA 5FLXQ 5A2QQ 1KN6A 4ECZA 4IOAQ 2H54B 1UVIA 3FJ2A 2HMIB 4LFAF 3FNNA 3GCXP 3B4TA 4N41A 1IBME 2DXEA 3DGVA 2CKWA 5BR8E 4WP3A 4XK8C 1TKXB 4FW3A 1U2FA 1M90T 2HFUA 1FRLA 3HHEA 2OI2A 1UFKA 1IM6A 2XMKA 1QSLA 2W24A 5BJRA 4IR1A 2HQIA 2ZH3A 4FS2A 4Y6IA 1SVDA 1U49A 2V6AA 3ICLA 1MNEA 2PSZA 1Y5IB 5DJBA 4BC7A 4LFCJ 2YKNA 3V2UC 4K2JA 5D4OA 2IJFA 3MF5A 2V8GA 2KM8B 2LEBA 1N5SA 2JWNA 3OQ2A 3V6DB 2WAQD 4KO0A 4HHUA 3MEGA 1RWWB 1UVMA 3H5UA 5FD1A 1X4EA 4BS2A 2G1DA 4LFAE 3OUYB 2ROGA 1KVJA 2A6OA 2YNIB 3V5RA 4KY3A 3OXGA 2ZC3A 4AQYF 3QRRA 1IBKF 4RX6A 4OZEA 4LF4I 1SH2A 5D3GA 1TR0A 4CWBA 2ZNZA 3D0GE 1JLQA 2HQDA 4X62I 4G3IA 1HL6A 1VBZA 1NH7A 4KPYA 1VRUB 1NJZA 1U4BA 1PGZA 3CULA 4DR1F 3SSQA 5CZXA 2WB1D 2Z0GA 1QAJA 2HBQB 4F50A 4JI0J 3C3LA 2LXIA 3CVKA 3IRXB 3K8WA 5ETVA 1S72S 3EE3A 4AIDA 1EKSA 2BM0A 5KOWA 1YJ7A 4FN5A 3W3SA 3M2UB 2AX0A 2EFQA 3FBBA 5KFEA 4JI8J 2BJEA 4L72B 1QM9A 1VGYA 4ZVFA 3EZ5A 1ULRA 2CJ9A 3EMTA 1RHRB 3R1HA 4ZVTB 2ZOFA 3CCUS 3WIVA 5LJ5Y 4DL4A 2YKMB 2WONB 1DQ8A 3VZIA 4X4OA 4DR3F 4J9MA 3BSNA 1LK7A 2VKZG 5B0EA 2YNGA 2QLBB 1N36E 1KBRA 4ANEA 4IZJA 4IKAA 3OTOJ 3CB4A 2HG4A 3W63A 1S6UA 1Y5YA 1WTBA 4DR1E 5J2NA 1YX2A 5HP1B 5HO4A 4V1Ak 1WC4A 2V34A 2IHR1 1V5IB 2L48A 2OMLA 3DLKB 1N33I 4NLRA 4DL3A 3R7BB 3ZTOA 1PJ5A 2R7WA 1IR2A 3HD1A 1V3ZA 3I0SA 1TU0B 3TA1A 2CQCA 4CLKA 1MWQA 3FRYA 3NGUA 4Q7AA 1WOPA 1PSDA 2HPUA 3BSAA 1WDTA 3HMJG 2KDOA 3PFOA 5GADI 4DR3E 3V6JA 1HR0J 2XMWA 3BB5A 5BYSA 3LP1B 1NJWA 4OO1B 3LP0A 5GMEA 3ZZRA 2K7KA 1NPRA 4FWHA 1FNOA 4H4KC 4YHHI 1OYEA 3QPIA 2DNRA 3EGNA 3QO9B 5ETOA 3H98A 5KT6A 3DRSB 3D4JA 2PO2B 4AYBD 1RQ0A 2GO3A 4DI6A 1HNWI 4P73A 4PG5A 5C24B 4JV5J 1LW2B 4LREA 3SSSA 5K8PA 2YNHB 4K7QA 1RHQB 2QEXS 4DPXA 2ZH2A 2NXNA 4XO0A 2AV5A 5D0RA 2Z2MA 4NLQA 2OEJA 2C37A 2AHOB 3K58A 1QDUB 4QU6A 4KFBA 2UXBJ 2JT2A 2QA2A 5KOXA 4DZDA 3W66A 2UU9I 3OW2R 3I9V9 4ALZA 4ED2A 5K36D 2Z56B 4HYKA 4NXMJ 5SZTA 4YFUA 3L3CA 4ANCA 3OR1A 3WC2A 5KT5A 2FJBB 1Q7LB 5M2RA 2MLXA 2ZM6F 2DVIA 2HHSA 4OV6A 4XIUA 1XNRJ 2XO7A 2W9BA 5BYRA 1NHIA 2MKYA 3I5BA 1F6TA 3KFWX 2FVQA 3GV5B 4JG4A 4WUBA 3M9NB 4DV5F 4WUCA 3AFGA 4OZ0A 2KM8C 2VOOA 4PXBA 4TN2A 1N34E 1IKYB 4NI2A 3DOMB 3MPWA 4B3SJ 3BH7B 3HVAA 2VQFJ 3NAHA 2DH9A 4QZVB 3P76A 2MMYA 5GAHU 4FPRA 5HSPA 1XNRI 3AD9C 4ECQA 5J1NA 4G1QB 2VHGA 3FBFA 4KJIA 5D78A 1KQGB 2C28A 3H4LA 2N3OA 1XTZA 1REVA 1SUQB 2HFNA 4NZ6A 1VCTA 3ZKBA 4PRVA 1TAUA 2QMWA 4WIQA 1D9FA 4MIBA 4B3SI 2IRYA 4JI2F 1KKHA 2W01A 2BYCA 4ZP7A 3FVYA 1RK8A 2D41A 2JFDA 3VALA 2DR7A 1G4CA 2QTWA 2G0JA 4KKOB 2KFYA 2DEJA 3JYTA 1RE1B 5E3AA 1FO1A 1EB0A 2J65A 2ZHAA 4LBHA 3GONA 3W9IA 1R0AB 4MDTA 1NSAA 3E51A 3M8YA 5IT0A 2XULA 4DV1E 1OJ4A 3ET6A 2VBXA 3JSMB 4Y2AA 3MMBA 1UDSA 2IERA 3CD6S 2WOMA 5HN0A 3RYLA 4DV5E 3CGIA 1QVFR 4EGLA 1SIWB 1RAHB 4FXVA 3UVJA 4JI6J 1QD1A 4WCEQ 3GV7B 1B99A 1T0TV 4QWAA 2OSRA 4C8OA 4JI4J 4B08A 4JYAJ 4DFPA 1U1OA 4ATNA 3UFCX 3BKUA 4F36A 3M1VB 2C3OA 4GMKA 5A8RA 3M6UA 4NWBA 4DL0C 3OVBA 1AB8A 5K20B 1Z1ZA 4DV3F 3OXLA 3T1YJ 3M7NG 2IC3A 2DISA 5F8IA 4JI4I 5A8WA 4K0KI 2YWWA 4JYAI 4M5LA 2HNDA 2KXNB 1C1CA 1GQEA 1U47A 3EVOA 3ZZUA 4CT9A 4B9UA 1V3RA 5K14A 4ECUA 2DGOA 3EYZA 4GKKJ 1LFPA 2NN6C 2HNZA 3MM8A 2HGMA 2VOPA 1U0SA 2OD6A 4ECRA 1SH3A 3WZ0A 5ETNA 1WHVA 2B56A 1VJQA 3NCPA 3QT7A 4B3RF 3NNHA 3CSKA 5ETRA 3FEZA 4LBPA 2PMWA 2AX1A 4QPTA 1XR6A 2YX7A 2ZFHA 2I1RA 2WP8B 4FWDA 1IBLF 2JEAA 1J2VA 1N0VC 2GIQA 4KGZB 1S0OA 3Q86A 1FI4A 5AJ3J 3VV2B 2HHUA 3UHMA 1S4FA 4DUYE 5ADZA 4F02A 5G4DA 3N4WA 4RL1A 4DV3E 5CYQB 5IXUA 4DS5A 2ZD1B 3NMAA 2YWHA 5DRRA 1UWBB 5F8NA 3I55S 4JI1E 4M5DA 3OSNA 5HQ8A 3I56S 4DJBA 4JV2A 4QBUA 2JLFA 4GKJI 2YY3A 1K1QA 1Z0BA 5J1PA 2E5LJ 3A8JA 2VG5A 5KFWA 1Y3JA 3EGWB 4Q43A 4DPYA 3KUGA 3IG1B 1O51A 1ZBTA 4Q8FA 1KFSA 4A8FA 2XHWA 4OYAA 1HMVA 1XMQI 1D0EA 4LF7F 3O6QA 2W4PA 2FDNA 3PO5A 4P74A 1KP6A 2YKAA 2QSFA 2F9DA 2V67A 5JEAA 1RT3B 4KH1B 4USKA 2CGEA 3RBDA 2KYXA 3KKFA 1IBLE 1TKZB 4KQVA 2NZCA 1MROA 5J2PA 2KJVA 3C66A 3C2PA 4CO3A 4C3MA 4QYZJ 4FP9A 4EU0A 1YKWA 4X4RA 1USVA 1RJJA 2GJFA 3WX8A 4X4VA 1SC1B 3KJFB 4LVNP 2R2RA 1X4GA 4U7UD 4P7VA 2IM2A 3NWGA 3C6TA 2EKYA 4HDGA 5B0FA 1T9XA 3R6GB 5C0XB 4X66I 1U1NA 1TL1B 2ILZA 1F9HA 4ZJQA 3SCIE 4ZPWR 2AZ3A 3PM9A 1CS4A 3KHRA 2IYGA 1J5EI 3DFEA 2L08A 2WSEC 3A12A 4P6QA 4DV0I 1HWKA 2AJ4A 4IG3B 3F41A 3QWPA 4OZNA 4C0HA 1NAQA 3M85D 4F25A 1TK0A 3NBPA 1N0UA 1WUUA 2R9LA 2JEJA 1UDOA 4I2PA 2KXHA 2RQKA 1XNQE 2G4BA 4LRFA 2J7KA 3I0RB 1U6FA 4J9QA 1I5OB 3DC2A 2V8HA 1RAAB 2AF6A 3KUEA 2UXCI 4TLQA 4LF5E 2V68A 3EWGA 4LF6J 5E0OA 1KIJA 3GU0A 3ITHB 5EUHA 1WORA 2A3JA 2I5JB 5FLXY 5A2QY 3FEXB 3S1TA 1HBNB 2XSJB 3MFHA 3CDAA 4BA1A 4ECTA 2QMXA 1F3FA 4FF3A 3LNUA 4I6AA 5A8KA 4QIFA 3D28A 1RT5A 1NK0A 2GQCA 4DR7E 3WHIA 4WU2A 2QZ8A 3CCES 2BRLA 3M8WA 2XWYA 2CQIA 3PS1A 2IM3A 4U8YA 4QPXA 2PT0A 2PNZB 4C4WA 3U1NA 3TUIC 1FEEA 3NGKA 4ETZA 1NU4A 3OT9A 3DMJB 4P71A 4NI2B 4JV1A 2BKOA 1R0BG 2DO4A 4AL7A 2UV8A 2GCFA 2EG2A 1M5HA 4AIMA 1KDNA 3OLBA 2G2OA 4ZLLA 4RW9B 3EVMA 5E3QA 2C3MA 1HBUB 3VCDA 4U6PA 1UVJA 2UUAJ 4JI5I 3OSPA 4XAKA 1F2HA 3FCVA 4DV1I 4R1FA 4L76A 1DBDA 1FX2A 5D8HB 1SJQA 5M2PA 3BM7A 1SC3B 1S1WA 4MAKA 1OQ3A 4I0WA 2CXEA 7AT1B 2IRXA 3KLIA 1HQUB 4DV2I 3MPDA 4DUZI 4CP5A 3TO8A 2X3DA 3R5CA 1HBMA 1IUJA 1P1LA 2ZBPA 3FMBA 1FRJA 2F7VA 3IFEA 4ED6A 4LR9A 4QIWD 1GMUA 4RR5A 1NK5A 1WEXA 4BA2A 3HJVA 4QYRA 3UVJB 1UPMB 2E1MC 1S0VA 1F5AA 3QYYA 3E01B 4FF4A 1CJTA 2K06A 4TY8A 1SKSA 3TAMA 1RTHB 1NHJA 1QE1A 5F9LA 2XS5A 2W4DA 3FBCA 1CC8A 2QGFB 3HHLB 4DV7J 3VAHA 2ZBQA 4KTQA 2X1FA 3HVTA 4HKQA 1NK4A 4IH6A 4NLYA 2VKRA 2R8JA 3WQPA 1PILA 4J9KA 2PI4A 1MMNA 4I69A 2ZE2A 1GXTA 5CCLA 1MSWD 3DGPA 3M9OB 4CLUA 3ZC4A 4F4AA 3DN9A 4DV7I 3R6LB 2MHNA 4IFVA 3GLLA 1Z5BA 3HJFA 4W98A 3GIIA 1W25A 3VAKA 4KHPJ 2MZRA 2XY7A 4OX9I 2N7YA 2AT1B 5IT9Q 3CEDA 1LWEA 1YRUA 4ZLNA 2HFVA 3EDQB 1O6XA 2WVCA 3LALA 2YQ1A 2JEAB 2A10A 1FVQA 2CQ2A 4WJBA 1Y4ZB 4P75A 2MQQA 4NLSA 2M4MA 1N32J 4OZJA 3P5TL 3G9CA 1RAEB 4NYOA 5KFLA 4DZ6A 3CO0P 1K9MT 2YQ0A 1R8CA 2J0QD 1OY8A 4QQBA 2V63A 3G8QA 1XEZA 1Z5CA 2GGPA 3MHYA 4LRBA 2CWKA 3JAMC 5K36F 5L8RC 4LFBJ 1WF1A 1BC6A 2PI5A 1S79A 5G0RA 4DG1A 1OQ6A 2BUNA 3GYNA 4PABA 1HWIA 4J7CA 3S01A 3Q2SC 1DAXA 1JLFA 1E3PA 4IUFA 4E98A 3ISNC 4TU7A 1JLCB 4Y34A 1AZSB 5F41A 4ZPVR 1KVIA 1FKOA 4Y2CA 5L3JA 3NGTA 2I9SA 3HF5A 3NS7B 2V2KA 2LA4A 2OP5A 2VASA 1Y4UA 4C0BA 2X7IA 2PO1B 2HLUA 1BQMB 3TYTA 3RTVA 3GTYX 1HQEB 1W7WA 1HW9A 4LRCA 1AUDA 1HNXJ 2RS2A 3VQTA 1AT1B 2B3TB 3DI6B 4OHYA 3NGRA 3UD5A 4N47A 1NMEB 2RIJA 2W2NP 2P5VA 3FDSA 4X64I 5I3UA 2YNFB 4QU7A 4DR5F 2EFGA 4KIAA 1VBYA 1FFSB 2QT7A 1ZM3A 5DDRC 2BQ3A 2QE5A 3VQSA 4XTTA 5K36E 2CZ4A 1S1VA 3JB9k 4LIWA 5KG3A 2IOQA 1NHVA 3R3TA 1PCAA 4YS2A 1V9OA 2MKKA 4IO9Q 2W9CB 3MCOA 3Q1QA 5A76A 3UCGA 4ZHRB 1YJVA 2HIQA 1MWZA 4NLTA 4TU8A 1QVGR 4EZ9A 4RNOA 2COLA 4B3MJ 4TLRA 4DF4A 1Q8IA 2DPIA 3TEHB 3TJ8A 3BGRB 4J5OA 4NOHA 3CJ0A 5K9FA 5BYQA 1YSJA 3IMQJ 1FKPA 1CG2A 2OPRA 2RQ4A 3BSCA 3I4HX 3CJ4A 1N8RT 4MIAA 1VQPS 1R8PA 3C19A 4DR4J 1KS2A 2F8HA 2GFFA 3AHPA 5L9NA 5HMZA 1TL7B 1ZA2B 4U3BA 3KXDA 5KFUA 2KZZA 2BEFA 4NXNI 1MU2A 2AMCB 3QAEA 2AZ1A 2HFSA 4DR4I 2LP4A 1HQ2A 4U96A 2FHKA 2FHOB 2LEPA 1TKTA 3UDVA 1Z2ZA 1T05A 2A1BA 2BQUA 9ATCB 4O4GA 2ZJRQ 4O3RA 2DXDA 4DQSA 2LQ9A 3LAKA 2FJDB 2CJYB 1RWKB 4JI7E 3EZUA 1VBKA 4IH5A 3E2EA 2RJZA 1VS3A 1FERA 2Q6BA 1YRTA 2YH0A 5H9FJ 4LF8E 2V8PA 4G1PA 1DTQA 1I94J 3CMAS 3TX8A 2GVZA 3KDOA 3LP2A 2QA1A 1Z0EA 4F4XA 3DDKA 2NZ4A 4DLEA 2Z5CA 3DLEA 1HNIA 2IVYA 3C15A 4A8KA 4TNOA 3O5TB 4XPCA 2QSWA 5GAEU 3QIDA 1I94I 1VQMS 1CJUB 2LVWA 3BH6B 3JXOA 3WDOA 1B64A 3D66A 2DB1A 1BY9A 1O8BA 2V5HG 3F0NA 2OEKA 2VQEF 3HVRA 3KWMA 5RUBA 5ETQA 5L1JA 1HNZI 4LF9E 2KJWA 2FJVA 1QSSA 3B4DA 2WRMA 4YY3F 2XI2A 4ECVA 3LPYA 1IKXB 3SCJE 1RDRA 1CVJA 1SJ4P 3QLHA 3PRBA 2MSSA 5KT2A 2IPOB 1FFGB 5AE1A 1RT7B 3UNYA 2W25A 1JLGA 1WTFA 5L39A 2ZC4A 2L9WA 5DRQA 1FKAF 1ROFA 4CQ1A 2KT5A 1T3NA 5E3PA 2LU2A 2IAJA 1N5YA 1FRKA 1AFIA 2OPSB 1WC1A 3BO3A 4OJHA 2QN6B 2FVSA 1GTHA 2W2QP 2QFJA 4X4NA 2M52A 5HROA 2M5YA 3G2XA 2X1BA 5DQIA 4A8WA 2LCWA 3P4UB 3P45B 2VQEE 3LGHA 4K4ZA 1KOOA 4R8UB 2HIYA 2D3OR 4B9NA 4Y3CA 1RAJA 2LMIA 3OBIA 1EJ7L 2MEWA 5GVQA 4A8SA 2C2RA 1TKDA 4UQGA 1S6PA 4WTOB 2Z57B 2V8DA 3WIUA 2XG8A 3UR0A 2DRBA 2A2CA 2DY9A 1E3HA 1UVLA 3KOAA 4KPCA 4M1KA 5K36A 1NSKL 3DM2A 4ID5B 2J6SA 4YP3A 4RUCA 2YX4A 3ZZPA 1D6TA 4N76A 1S5ZA 2HGLA 3H90A 2ASJA 3W2VB 3MEEB 5A6PA 2OD4A 2IIHA 1RTZA 2FJXA 2OPQA 4N56A 4X65F 5E2QA 4X4SA 4YB7A 4FYDA 3QSYB 1CSJA 3PFEA 4M5IA 4YDDB 4Z7CA 4LFAJ 1U45A 4HT7A 1S10A 3M8QA 1S59A 5DDQC 4EI2A 1TV6B 4C3KA 2P9EA 3PJWA 1RR9A 4NXMF 1Q86T 3LANA 3TZYA 1R89A 4LSNB 1N6QB 5HVGA 4UY85 3FFIB 1FJGE 2UVWA 1EI1A 3KG0A 3TQEA 3J80Q 5A0YA 1NSQA 2HRYA 3AXMA 2J7WA 1VISA 1FWPA 2MZ1A 4JP8A 5CH7B 3RAQA 4KGXB 3QZ8A 4CDIA 3CW2C 1U1LA 1MN9A 1EQMA 3MMJA 3R5AA 2RD5C 3M8PB 1DTTB 3GFHA 4PUOB 3RU0A 3POTA 3P3DA 5F8HA 4ED8A 4LSLA 2GZOA 2DNPA 4QWCA 2H5EA 4WK1A 5EWFA 1GH8A 3B8HA 4UW2A 1X7VA 4B9VA 3NRBA 5IT9U 4HH0A 4LR8A 4DPWA 1T9VA 2J0XA 1IBKJ 3HVWA 3U1MA 1H38A 5LSLA 2F63A 3BGLA 4A4JA 2O67A 1GMVA 4CO0A 1Y60A 1NPKA 3EGZA 3PTWA 4F0HA 1OSDA 4I6YA 5L1KA 2HS0A 3X3UA 4FKXA 3W8GA 1HWUA 3N9UC 2VESA 4AQYI 1WC6A 1IBKI 4DR1J 4NLGA 3D54A 4H4OA 5F3ZA 2V2VA 1DURA 1HARA 1XR7A 4QW8A 3V81A 1NUEA 4RPFA 1TUVA 2CNLB 2JNJA 2ZUAA 1D09B 2VL1A 2M9KA 1KNZA 1UTAA 3DYAA 2UXDF 1RGVA 1X60A 1S9EA 4MKAA 2P8IA 2ZBIA 1TL4A 3IAS9 2FJEB 3M6AA 1XBWA 3DNCA 2NUUG 4IG0B 5CABA 2RRAA 3N5BA 2PNMA 1QAYA 4O23A 3RAXA 3NOCA 4K4TA 1ZM2A 1JXEA 1QAIA 4JI7I 1Q53A 4TY9A 4F2SA 2VG7A 3M2RA 2BQRA 5T7LA 5DRPA 2HEKA 2LQ5A 5EDWA 4DR3J 1OYDA 3HD2A 2MTLA 2RSQA 4WWSA 1LOUA 2E7WA 3R9LA 3NAIA 5FDLA 3VGTA 5K5MA 1M5OC 5C25B 2J0SD 3OR2B 4A8YA 3LUYA 1CJKA 3KG4A 2VUGA 3LGMA 2NYIA 2YKPA 5D4PA 3L7ZB 3GFXA 2MJUA 1ZTTA 2O1UA 5KFFA 1EETB 4RNHA 3KLEA 2UZAA 3I82A 3LP2B 4NCAA 1Y5NB 4RNMA 1SV5A 3GLJA 1Z0VA 2VICA 4KRWA 3SFGA 4QIGA 1H7SA 1R43A 2E7XA 3R97A 4LF9I 1TVRB 3MEDB 4IQMA 2KB2A 1OO0B 4ZVPB 4C11A 1RXOB 2XY6A 3MAAB 2OGUA 4O4RA 3JSRA 1ZTWA 3PACA 1M1HA 1HYSB 4B9SA 4KQZA 2VODA 1C0UA 6FD1A 2AW0A 3DKDA 4EBEA 2GVDA 4C7QA 3SCLE 4ED7A 4AL6A 2Z5BB 1WKLA 2HZCA 1FRIA 5IWAI 2DR6A 3MMAA 5J1EA 3D6FB 2B7BB 4F26A 4YB1P 3IP0A 2HFZA 3N6MA 1JJHA 2DTJA 1FWKA 4PRFA 2XS7A 3I31A 4AL5A 3H2VE 2HHXA 2AYMA 1RTDA 3IR6B 4FXDA 5LMNF 1I1GA 2HQCA 5B0BA 1B0PA 1AROP 2A2DA 4PWDA 2CJQA 2JEFA 4FF1A 3D3CJ 2BABA 5I42A 4UOCA 1YJNS 3BKTA 3GIJA 3IBCB 1FRMA 2HHPA 2GHPA 3H20A 2O1PA 1RWOB 3EJMA 2JZ5A 3R5DA 3VR1A 1D9AA 1UFWA 2ZM6J 3W9JA 1HI8A 2RU3A 1YLXA 1X5OA 2ZBCA 3AD8C 2MGZA 1R6VA 1ZM4A 3CCTA 3K57A 2QA4S 1Z0WA 4PZVA 4DV5J 1DLOA 5K36B 1E6VB 1RBOB 3CJRA 4FZVA 4CYUA 3OVSA 2Y9HA 2Y8WA 2ZM6I 2HS3A 3M32A 2LFVA 4CH1A 4IDKA 3IAM9 5LMNE 3KLGA 1XQIA 2Y8YA 2HNYB 1URRA 5FJ4A 1UEKA 4WIIA 1RZMA 2UUWA 4MIWA 4O3NA 1WSVA 2BR0A 3CJSA 4AXIA 1MW7A 3DLLQ 2IA0A 1Y3KA 4R5PA 2CDRB 2UUCE 4QJVA 4JI2J 2OPPA 2MKJA 2GS8A 2MQMA 4EYHB 1VRQC 1PIEA 4GVBA 1DRZA 2CPFA 5HMYA 1CULB 2QMUB 4DR2E 5D4LA 2MSTA 4NRUA 3TARA 4K4XA 3TZXA 1OS5A 1WEYA 5KFQA 1RUSA 5LT5A 3N6NA 2GAHC 4JI2I 1YZ6A 2HHHE 1TUGB 3KG1A 2W1BA 3WU6A 3J81Q 3ZM7A 4FNIA 3VGUA 2QJ3A 3WX4A 2DNQA 2CQ1A 2V69A 3MAHA 3G6VA 2DNOA 4O0IA 1I3OB 1WHXA 4DX7A 1B0VA 3NL0A 4K50A 3MTKA 1VQNS 2I6WA 2MZSA 2F4VE 1R27B 1NB2A 3W5ZA 3BYPA 5H9EK 4DV3J 1V3SA 2UUAF 1RTIA 2R7TA 5HL7Q 2NN6F 4I3HA 3PO4A 3AB4B 2BA0G 2FHMA 2WW4A 2K3KA 2Q43A 4J3DA 3MM7B 1JKHA 3TJ9A 4O44B 2ACYA 2EC0A 1TAQA 1LWFA 2PA3A 2Y0BB 4OI1A 1XMBA 3Q89A 1RACB 1N5VA 4B3RJ 4QNJA 1XR5A 2DNMA 4PQUB 2PMHA 1PG5B 3Q0AA 3AJDA 4RW6A 5F0WA 3TI0A 5LL6d 3DYAB 5E41A 3WBZA 1KWMA 1IBLJ 3C14B 2AWZA 2C38B 3I87A 4DU8A 1XN9A 4B3RI 3MM9A 1PAUB 4NE9C 2XHCA 3NS6A 1RA7A 2DNNA 3M6VA 3JSBA 4JI3F 3AB2B 1DY3A 3GWCA 1HD1A 2QIFA 3T1HF 4WZQA 2LECA 3KK2B 1OY9A 3GSIA 5CCMA 2W7OA 1R6LA 1TK5A 5J2QA 3UN3A 3TR5A 3JTNA 2P6TA 2AGQA 2Y1JA 1RT1A 2B7CB 5KFHA 3LGNA 4LF7J 1TL3A 2HHVA 4F0KA 4Q44A 1WHYA 2H9ZA 3HHDA 5L46A 2HVIA 4O3OA 3Q2TC 4UTGA 4OQJA 1XNQJ 2LDYA 1FA0A 1VK3A 4YQWA 4DV6E 4BWJA 5FWKA 2FHJD 4LF7I 2JX2A 4KE5A 2Z2ZA 1LWCB 4ZJOA 2D9PA 3OXFA 4ECXA 2B43A 5ETPA 3HPOA 3ULHA 3NNAA 3DHWC 4LF5J 1NK8A 4F3OA 5C42B 2CNNB 2ZH4A 3TWZA 2JLGA 1Q8BA 4DV4E 3SEOA 5K8MA 1N88A 4ZCLA 4RW7A 3D1OA 4DR6I 5EWEA 4A48A 4J91A 2AEMA 1B7YB 3OD2A 2KG0A 3CWJA 2CPYA 4MKYA 4NRTA 2FLPA 1RBAA 2UUBI 1VQOS 2DHGA 3P6YC 4B3OB 1RWPB 1GMWD 1Q82T 4WFYA 3OJUA 1Y00A 4YUDA 1XMOI 3ZZ0A 1WOOA 1J27A 2NXUA 1ZAVA 5KFMA 4RNNA 3MAQA 3A3OB 3CCZA 3PIOQ 5K36C 1S1TA 4MTPA 5EWGA 4NX9A 1PKUA 1EKRA 3D6MB 2RQMA 4OZ1A 4RKUC 1H7UA 5SUHA 1VQ7S 4FW4A 5HLFA 4F4WA 3N28A 5IM0B 4LF4F 1U1PA 4ZKAA 2JVRA 1M0SA 1U0HB 4NYZA 1ZZNA 3DXSX 4X62F 3VF0B 4TKTA 1FJCA 3KK1B 3CXCR 5F0UA 5KG7A 4ZA1A 2EW9A 2QL5B 3K59A 4NEZA 1BWEA 3R7SB 1ZAXA 2RF2B 1DZ5A 4OYWA 3PEJA 1M1KT 4AFFA 4U67Q 1C2PA 3M30A 3UD4P 1RT6A 1NH8A 1VOMA 4K4SA 2XO6A 3FCWA 2XLKA 3BZQA 1YHCA 3FK4A 3JQJA 2DK2A 1IKWA 4U95A 3ZZOA 2I38A 4MK7A 1JX4A 1MLAA 3G71S 4ERDA 3J80Y 2AYEA 5T14A 4J9VA 2MKIA 5J2MB 1OSCA 3UO0A 2JC0A 4M5GA 5HQMA 4B3TI 5ELWA 5FLXC 2HHQA 4DCJB 3QGGA 3MCSA 4DR2I 1OPIA 1L5UA 2XGQA 4LF4E 3G4SS 3E3XA 3GMGA 3KLVA 3AY0A 3HXMA 2EFOA 2VB6A 3DOLA 3AA8A 3KLFB 2IESA 3F73A 1FFWB 4IRCA 2IM0A 2RB7A 4I2QB 2ZEJA 2HWTA 3ILLA 3TW0A 5ETLA 1S6QA 3AD7C 4DCPB 1APSA 1SXLA 2DH7A 1N33F 3B54A 4ZJLA 1JJ4A 4FW6A 4IQXA 4IRDA 1OY6A 3AA9A 3Q8QB 5E5NA 1N5QA 2YX1A 1L3VA 4C6AA 3DRPA 2XWXA 2DEIA 2MHEA 3K17A 3GV8B 2OEMA 3LTOA 2DR8A 3CCWA 1SL2A 4OO1D 4WXWA 3K5OA 2HSEB 5H9FK 2C39B 2CJAA 2O5DA 5IV3A 3IM8A 3VAIA 2ZBRA 2ZITA 2XY5A 5IC4B 2AQ4A 4NLUA 3AAWB 1VRTB 1NB7A 5LMUF 1KD1T 1XIQA 2EEYA 1RABB 4YHHF 3L9ZA 1T11A 4I7FB 1MU5A 4RW8A 2N4CA 4ZPAA 5HI7A 3D67A 3CCVS 1ZXNA 2NCKL 3SDEB 2DYAA 2HVZA 5DS7A 3CO9A 2HBZB 2Z30B 2WVEA 2UUTA 4OYIA 4NMXA 5KFPA 1N33E 3C6UA 1VLOA 2GMJA 3OFGA 2F65A 4X2BA 1Q0NA 3I4PA 3BR8A 2EXUA 3P06A 3HSJA 5E33A 2PO4A 2UU9F 1RT2B 3CC4S 3MWBA 2W8KA 2B5JA 3G82A 4LCFA 1N4LA 3BV8A 3CMQA 1BMQB 2ZVSA 4ZVGA 3PW2A 3MMCA 4NLXA 1N56A 3J81U 3OL7A 4WBFA 2C1EB 1WF0A 2R7OA 1WG4A 2FPHX 2CG8A 2Q66A 4N5SA 3G6ES 5DM7Q 1IBMF 1HNWE 3E8OA 2W2OP 2PO0B 2D3UA 2MKCA 3FZ2A 5BR8F 1BQNB 2YWFA 4Z37A 3QJJA 1FNXH 4FBTA 2YKQA 1U8SA 2IDEA 1QZRA 1FJEB 1Y4SA 1TUWA 2AEFA 3AXKA 2Q79A 2VDIA 4MFBB 2GAGC 2BVZA 3PHEA 4AE5A 1T9TA 4E2FB 3RBZA 3KNGA 1AFJA 4JBCA 1RYSA 2FZKB 3Q6NA 2UU9E 1YQHA 4KB7A 3K89A 1S57A 2G9OA 2HBYB 4FYVB 3UE2A 2MQPA 2V4QA 5IOLA 3P49B 3H5YA 3SYZA 2UXBE 2YXLA 4DR5J 2QL7B 3FSIA 2OFHX 3QT5A 5IV4A 3GJSB 3CJKA 4BDPA 4RNFA 4JV0A 1U24A 1WACA 2KRRA 1WKJA 2W2PP 4HHJA 5HJXA 4OJ1A 1M5VC 4LR7A 3SMZA 4URLA 4DR5I 1S16A 3J7A1 4HH1A 4F4ZA 2DITA 2RKIA 4AM3A 5DROA 5LXRA 4ES1A 4J9OA 3OFFA 4KV8A 1FHTA 1RTJA 2HAFA 1RT4A 4OHWA 1S1TB 2A18A 2VG6A 1XNRE 2YBVA 3IR5B 3O1LA 3RRGA 4WPAA 4QWBA 4DFJA 3PY8A 4NA1A 3KK3A 3HHKA 3I32A 1FE0A 3QATA 1JXLA 4B3SE 1C1BB 4OHXA 1Z4UA 2HURA 2JEBB 3TVKA 4WXOA 1SKUB 1UP1A 2KT3A 1FD2A 1RI7A 4K0KF 2LU1A 4IOCQ 2CFXA 4WP9A 2EPIA 6AT1B 2GIRA 2E5IA 3H2LA 4ZPDA 1X31C 3HK2A 2VA3A 1FRHA 5U47A 1RWNB 1VR6A 2JE6A 4LJMA 1P42A 2O01C 1T3OA 4CLWA 4EUVA 3M6WA 3AT1B 1KTVA 4PYDA 2OJ3A 4MU0A 4LFCI 3IS9B 3J81j 1OYPA 4OYMA 4M5KA 3TNVA 5GMDA 3MECA 1M5PC 4FVMA 2BANB 1FRXA 1DHMA 2QFIA 4PU9A 2N3LA 4IZKA 3TEGA 4ZIWA 1CLFA 4PYAA 2E5JA 3N0VA 3J81Y 1N36F 5D15A 3KLHA 5L1LA 1PKPA 1FEHA 4DSKA 1L3TA 3MR2A 4A8OA 1GXLA 1ELOA 3VTIA 4JI4E 1S49A 4M63A 4K0KE 4JYAE 3HJCA 2FJWA 4DSIA 3ZTPA 4FYWB 4L6V3 3NCQA 4FVCA 4P10A 4ZP6A 4GKJF 5JMNA 4QCLA 1KFDA 1UJ5A 3M2VB 4DXLA 3AJ2A 4HACB 3UDLA 4P72A 2VD3A 3DOKA 4ELVA 3GR1A 1C0TA 3H0PA 1LKZA 2ZDPA 4HT5A 3GCMA 5FIIA 4JI0I 4NCGA 3RBEA 4ICLA 2QO3A 2HYIB 2VPWB 4GQUA 4KC5A 1FXLA 4USMA 2CQHA 3QGIA 4JI8I 5B09A 2QC3A 2VQEJ 4IFDD 3DLGA 1K8AT 3V4IA 2AU0A 1FWLA 4CTAB 3EICA 1F9EB 2FLOA 3Q8VA 4Q0BB 5D0GA 5C0XD 4YY3J 2V8VA 1JLBA 1H98A 2BE2A 2E29A 2NN6B 2WNRA 2YVSA 4OMFG 3TA2A 1VMBA 4DBQA 1RAOA 1JLAB 3D7SB 3MM6A 1XJWB 4X66F 2BOAA 2XZWA 3S8SA 4GKJE 4LRAA 4FWGA 3I9ZA 1YHQS 3OTOI 3OTEA 4U8VA 4NCBA 4KHMA 1VI7A 1J5EF 4ZVHA 4DV0F 2GQ2A 4RU9A 3RR7A 4R25A 4ETXA 1XMQE 2EVZA 5KFIA 2KHDA 4OLPA 1H2TZ 2WVDA 2XMTA 1RLCL 2KZMA 3P3EA 2DH8A 2QYGA 1X4CA 5JEAF 4PPZA 4DQIA 2DKOB 1ZH5A 4K4UA 4K4VA 3KHHA 2ZH1A 3QFWA 1EAYC 2FVRA 4YOEA 5GAGI 4LOMA 1ZETA 2Q1LA 3SQGB 4ED3A 2JEIA 4GVLA 3ENAA 5KG4A 2EFVA 2RAQA 4WE1A 1HIYA 2UXCF 2DPJA 2CZVC 3UD3P 2XI3A 2ALZA 1IQTA 4DL5A 1HR0I 3LO3A 4X66E 5I3PA 3RRKA 1NXIA 5IT4A 2BKPA 2B5JB 4M5JA 4K4YA 1S1UA 3MUTP 3KJVB 1VC5A 2XM3A 3BBBA 4M8LA 4Z2XA 2IRUA 1N34F 3K0JA 1J5EE 4X65J 3H25A 4DV0E 5HJYA 2B8PA 1RISA 2Z4PA 2K2PA 4ZDNA 4YB5A 1DQAA 3DDIA 4OYPA 2DNHA 4MU3A 3TA0A 5JEAE 2BJ9A 4JV5I 5F8GA 1X4BA 2XQCA 5DLGA 3TQ1A 3ENQA 4X65I 4JB8B 4KHRA 3FUYA 3HSDA 2BR2B 3HT0A 2WVBA 3OLAA 1FK9A 2M7SA 4C8LA 4QWDA 1QY7A 4CT8A 2UXBI 1Q95G 4C0OC 5KFCA 1HBOB 1HD0A 2UXCE 2XMMA 3DRRA 4UOFA 1VIOA 4RW4A 3JTOA 5MLCV 1HNVA 4PRXA 1NZ8A 5KFDA 3B4MA 3SI8A 5EX0A 4JI5F 4NXMI 3Q83A 5ETSA 4DV1F 3KJNB 2IVMA 4UZCA 1KLMB 1LW0A 1V6HA 3FEYB 2ALYB 3GJRB 5F8LA 2U2FA 1LK5A 5HMXA 2DNYA 3C46A 2J76E 2HVEA 3RB6A 4C8NA 2BX6A 1KQSR 3TZWA 1T03A 2K1RB 4DV2F 1S9GA 1IVZA 4H4MA 3G6XA 4DUZF 1Z5AA 7FD1A 4MT1A 4IFYA 4WFXA 1PBAA 2DNLA 2CQGA 2AJ1A 4ED4A 2VQFI 2H4WB 3HP6A 2GO4A 1LEOA 3PYDA 4DSFA 4KGKA 3MI7X 4ED1A 1HPZA 4I4BA 3DU6A 1W2BR 3HHLD 2KVIA 4FW9A 1ZYQA 1Q5YA 4DX5A 4NLPA 1J5OA 4JI5E 3PX0A 5ETMA 1R8BA 3EVWA 4K4WA 3W64A 4C2MA 2PN6A 1H2UX 2C2DA 3ZNUA 2K3IA 5I3QA 2UXDJ 2JOQA 3P3GA 2YKNB 2VONA 3IN5A 1RAFB 2FB0A 4NLWA 5F8JA 4HHHA 3VVUA 3TZZA 4CO4A 3R8YA 4DV2E 1Q16B 4KO0B 2M70A 4DUZE 3W1YC 3MEGB 2GO8A 4MKVA 2I2YA 2UXDI 4DUYF 4JI6I 4OX9F 3J7Z5 3D6HB 2VBYA 5CYMA 3D68A 3RUBL 4Y2IA 3V4MA 3NWRA 2DR9A 4USTA 3MEKA 3IA0A 1UJ4A 2MPUA 4JI1F 4CO2A 1ZAWA 2B6AA 2NUHA 5D3GB 4P2FA 1PO6A 4P2XA 3JAMY 1UZDA 4QR2A 1JLQB 1CJVA 1IKVA 2KT2A 1SQFA 2XMUA 3T1YI 3T3FA 2LA6A 1Z59A 5EGYA 2KI2A 3Q22A 5F9NA 8AT1B 5FLXU 5A2QU 1YTYA 3PKMA 2E1CA 4OLOA 4OO1E 3D1QA 4OV1A 1R7IA 1HI0P 2E9TA 4GKKI 3IWXA 2HWIA 1E6YA 5AE2A 4F8RA 1M5KC 2IMWP 1RAIB 4WZMA 1SBRA 4HR2A 5KFYA 2POKA 4HLBA 3TVZA 4DV7E 5JVGQ 2I0XA 3MDFA 1WNEA 2HMIA 4F4YA 4OX9E 2EFPA 1AW0A 1TKXA 1VQYA 2Y0SD 1LV5A 4CM2A 4RWXA 4Y65A 3OV7A 2FHJA 3UWTA 2YNGB 3A4TA 3CJ8A 4IZJB 1CEZA 4RUHA 1HKAA 3MGJA 4O3SA 2WNRB 2UVVA 5CAAA 5J2NB 1KQKA 4X64F 4CIOA 4MK8A 3NNCA 1EQ0A 2E5LI 3R2CJ 4TVAB 1YK9A 1N32E 1YH8A 1WI6A 4OKGA 4M95A 2XS2A 1UDNA 1XNQF 5KG6A 2DY1A 3NGSA 4DS4A 2OUGA 5LMNJ 1GMWA 2C22A 3PRVA 5IQ6A 5DETA 1WI8A 3TVYA 3V6DA 2FVPA 2XC9A 2BBEA 4LF5F 3I0SB 3GZ7A 3OUYA 4YDXA 4M5MA 2RUSA 3W9HA 2YNIA 1P1TA 5EKWA 3FCHA 1X0PA 2CPEA 5IT9C 1R8AA 3GSDA 1B0TA 3LP0B 2NLWA 1H74A 4DF8A 4DR7F 2H48B 4UQTA 2RMLA 1VRUA 4I6WA 3DLHA 4X64E 3B78A 2YKOA 3HFVA 5IQQA 3BREA 3CUNA 2KVQE 3CCQS 5C5JA 4NXNF 1TFYA 2IM1A 2Y1LB 2GJIA 2HBRB 1S99A 1SH0A 1FX4A 4X4PA 3SV3A 3M2UA 3PYFA 2BW7A 4USJC 1ZPWX 2WSFC 3FKBA 3QGPA 2C37B 3BEGB 4DFMA 4KFBB 1SPBP 1PVGA 4WU3A 2C2EA 1Y6ZA 4I68A 4GO7X 1ZXMA 3RGIA 5E7OB 5GAEI 1OYSA 2YKMA 2IJNA 2MLZA 2GQ0A 1SQGA 2WONA 4L74A 1T95A 3BF4A 2GNKA 5KG1A 2C3PA 4LF6I 2PFDA 3OR1B 1NM2A 3HSGA 3BGOP 2QLJB 2DGQA 3CCJS 4B3ME 2PFFB 5EL9A 2FYXA 2DIUA 4DFKA 1D1UA 2ADCA 2MJNA 5CZVA 5HP1A 1NEEA 3ETMA 2W9BB 3CJTA 1BLUA 1GAOA 3QZ7A 3J7YI 3U7JA 3ENVA 4H54A 2R7SA 2KXFA 4FKYA 2VH7A 5D4NA 4NXNE 1Q4RA 4GRSA 3CCRS 1WF2A 3L09A 2VFRA 4DR4E 4IO1A 2RNEA 1FF2A 1X0FA 2CQ0A 3J7ZT 3R5BA 2NQPA 2JDJA 4CLFA 4OFZA 1X8DA 1TL5A 2OIHA 1ZOTA 5KFOA 5H9EJ 1REVB 2KFZA 1UJ6A 1HNZF 2P6SA 3QQCD 2CDQA 2JH3A 4Q2LA 4DPUA 2IJRA 1L3UA 3IBFB 5A6WA 3PNIA 4LUBA 3AJ1A 3RB0A 1MX0A 3A3NB 3Q8PB 3LP1A 4OO1A 3BBFA 4A8QA 4IFDF 5AXLA 2DBBA 3EX7B 2UUAI 3RAMA 4F7VA 3JYTB 4I64A 3QO9A 2XSFA 5H1SV 1H73A 3W5XA 2VPXB 2G2YA 4ILLA 3DRSA 3ET6B 2PO2A 3MMBB 2WOMB 4FNHA 1RREA 1I94E 3UPFA 1HWLA 3NY0A 1LW2A 4DV6J 3FSYA 1USUA 2CPXA 2EC2A 4CO5A 3H7HB 2YNHA 3JQMA 2YPZA 4ILMA 3F44A 3AODA 3QT6A 4LF1A 4WUDA 5KFJA 5ETKA 1SKWA 3EXYA 2H5IB 5A8RB 3PCOB 4JI3J 2D7SA 5B0DA 2GA7A 1HNZE 4FXWA 3T1HJ 3VGVA 2IC3B 2XLJA 2Z58B 1RWXB 3KTQA 1QUVA 5A8WB 1BKNA 2HNDB 4ZVOB 2BA1G 3HT3A 1C1CB 3US5A 2P2CB 3HX9A 5DQHA 1EA6A 2FLLA 1QLNA 4IFDE 1P9YA 4JI3I 3WU5A 5K14B 4IRKA 3OL6A 4S0MA 3T1HI 2HNZB 2LDIA 3M7VA 4DQQA 4RU2A 3MM8B 2MQOA 5E3CA 1I6JA 5C0XE 3K5LA 2QYCA 3H2UB 4F4KA 3LAMA 1SJ1A 4NLVA 1R8HA 1MG7A 1YVFA 2NPFA 4A8MP 2Y1IA 5KFTA 3PW7A 1HHQA 2C42A 1IKYA 5AXNA 3DOMA 3NCRA 4C8YA 3VAGA 4LCHA 3I5CA 1CPZA 3BPDA 3M8ZA 4G1QA 2ROEA 2HK2A 4URQU 1U6BA 4KHPI 3CC7S 2A6MA 4DSLA 3CMES 1SUQA 1YI2S 4X4QA 2LJPA 2NPIA 3N6LA 2F3JA 4EBCA 2FTRA 1XK8A 3P3CA 4DLGA 2GJ2A 4M5DB 4USWA 2RRNA 2QLXA 1N32I 5KTQA 2YH1A 1UETA 2VG5B 3TRGA 4BC9A 4KKOA 4NA3A 3O8WA 3PVXA 1JWWA 1BXNA 4U9RA 1JMTA 3EUNA 4ZVEA 3W65A 2UP1A 4MH8A 4XTJA 1FVSA 1R0AA 1U02A 2BKNA 1HMVB 5CHCB 4F3MA 2AGPA 3OPKA 3D6TB 4CO1A 4QWEA 3JSMA 4LFBI 2BA9A 4USIA 2AYBA 1FDDA 1KOHA 1MMDA 5JEAB 1VIXA 1JK9B 4ELUA 2NYHA 3NLCA 2F1DA 2JLEA 3CDEA 2XZTB 1MROB 5J2PB 2MLYA 2G2ZA 2HHWA 2HHTA 1BUXA 4WFZA 2B0GA 2BACA 4LF4J 3M1VA 1NLKL 5JUMA 4YN3B 2HQ3A 3KJQB 3OFEA 4X62J 2G0IA 3C6TB 4D3GA 4P9SA 3F56A 4FDFA 1VQ5S 4B9LA 2PMZD 2J9DE 1KQFB 1ZA1B 3KDNA 2CQDA 1MWYA 1HNXI 5M2UA 1JJ2R 3M7ND 2WZ1A 4XDDA 4ZITA 2BV3A 1CS4B 1WDDA 2JHEA 3M85G 2NXCA 3DHXA 4N8OA 3PZPA 2D69A 3OFHA 1IN0A 5D77A 2KTQA 3THVA 2XYGB 4EK2A 3NBPB 1FDAA 1B3TA 3Q8YA 2QA4G 1SI9A 4HVZA 1SJ3P 4I2PB 3D0HE 4CH7A 4YMEA 3GIRA 5LSOA 4DWIA 2BM1A 3QRPA 2WP8A 4OHVA 2N7CA 4JI7F 1QAXA 3BGFA 1UL3A 3L7PA 3UN5A 4LF8F 2MDAA 1UAWA 3BKFA 4DN0A 1K73T 4B3MI 3PEHA 3H4BA 5LOQA 5CYQA 2EK1A 2ZD1A 2R7UA 3QIPA 4TU9A 4AQYE 1IBKE 4BA1B 1UWBA 5DRKA 1NPPA 2XB2D 1NKBA 3MD1A 4Y2MA 2NSCA 2MXYA 3CTRA 3M6XA 3J80C 1UKUA 4AD6A 5A8KB 1RT5B 5HQLA 2RT3A 1VHFA 3IG1A 5JVHQ 1OPZA 3W8PA 1N33J 2HW3A 2EKNA 3CWVA 1NK6A 3GIMA 4ZVSB 4FF2A 4OZLA 1R6YA 1QSYA 2EFNA 2NSBA 3MR3A 3LW5C 2JSXA 2BE9B 4TYBA 4LF9F 4K8RA 4C48A 1RT3A 3BQ1A 1C4AA 3CJ3A 4CLTA 2MKHA 2RHSB 1JQGA 1F9FA 1TKZA 3A1YG 4BCAA 2LQ8A 1SQEA 4O3QA 4IFDA 2DCUB 5LMUJ 1F2GA 2XEXA 4YHHJ 4DEZA 2C2NA 2CJBA 4RWWA 3CDUA 4NZ7A 1C4CA 2ATCB 3CC2S 5C0XA 5IWAF 3PW4A 1TL1A 3K2YA 3VZHA 2XCPA 3SZ2A 4ZIVA 2FGCA 1WWHA 1S1WB 3ZTQA 5DNXA 5LMUI 1YBTA 1HNWJ 3D3BJ 2R8HA 3MPUB 4LQ3A 3KLIB 2VDHA 4FPIA 1TTHB 3ZO7A 2YPYA 4IG3A 2X3GA 4HI1A 1HA1A 4FW7A 3LWMA 2E1RA 4WTYA 3GMEA 4OZ3A 5DGAA 4HEA9 1HBMB 4QR1A 5DDPC 3HCXA 1NHUA 2HRTA 5DG8A 4EO6A 1VBXA 3KUHA 2OMOA 6FDRA 4ZP8A 3BN4A 2UU9J 4BA2B 3MR6A 3TUPA 3I0RA 1DFDA 1X9SA 2IBOA 4MK9A 2VA2A 1CJTB 2CJXB 4TY8B 2W7AA 3MR7A 4Y2KA 3TAMB 2BJ3A 2CRLA 4KR0B 5KG2A 3PRYA 1QE1B 4ZPCA 3ITHA 2I5JA 3M9MB 3A8IA 4PG8A 3BSOA 3ISZA 2HLTA 1HBNA 2XSJA 5KFZA 5IWAE 4U7UK 1RAGB 3HVTB 2BJDA 3UCZP 1HW8A 1IBMJ 4CZCA 1XC9A 1TMJA 3SSRA 4LQ9A 5BR8J 3CD0A 2ZE2B 3DGPB 4IH7A 2ZZTA 2XGPA 4E8UA 5DQGA 2B9WA 4IFVB 4F67A 3UI3A 2CJKA 4JUZA 2PNZA 1T8EA 3WU4A 5JEAC 1IBMI 1FJGF 2ZNYA 3A13A 1LWEB 1OYRA 5BR8I 2D3ZA 1SC6A 3QFHA 2PNLA 3DMJA 1WEZA 2CPZA 2J9DA 3OL9A 3CPWR 2N82B 2FZGB 1X5PA 3KRNA 4ILRA 3NGDA 1NHKL 4RW9A 1S48A 3QAUA 1HBUA 4MYUA 5GMKa 1FESA 2A0FB 3UQSA 2GGPB 3KMQA 3GP9A 4IR9A 1Q7YT 5IFMA 3M05A 1HWJA 5G0RB 4DG1B 1HQUA 1VYAA 1EIYB 2ZM6E 4WFNQ 1O5JA 1YRXA 1FXRA 3DLBA 2KHCA 5DO2A 3UDEA 1JLFB 4LFAI 1FKOB 3T9NA 2D3O1 3THPA 3UDCA 1UEVA 1NKEA 1YJTA 2OO4A 2KO1A 2RILA 3OTBA 3E01A 4K0KJ 4CRJA 4DU7A 2V2ZA 4N3OA 1RTHA 1MMLA 2H1YA 2X1AA 1U2CA 1H7XA 1RA6A 5I3UB 3JS9A 3T5KA 1OWXA 2AJ0A 4JI2E 3HHLA 5HMWA 2ZWPA 1YJRA 4W4MA 1FXDA 2GX8A 1NKCA 5LM7E 1S1VB 1Z0GA 2IVFB 1ACMB 3D9BA 2BA1D 1IWGA 2F8EX 2PDAA 1U48A 2N4DA 2HVHA 3OTDA 3CCSS 1H72C 3Q24A 1VC0A 4P2SA 1N36J 3D1HA 2UVRA 1K0TA 1IR0A 4ENOA 2DD8S 5B0CA 1H2VZ 3H59A 1Q5VA 2H65B 1FKPB 2O66A 2OPRB 1TELA 2G13A 1UA0A 2HS4A 2VFVA 1S0NA 4GKJJ 3LPSA 1N36I 1FTCA 4M94A 3L7OA 1ICEB 4OX6A 2DGTA 1PYSB 1UVNA 3I96A 3NOGA 4DR1I 2R8IA 2CQ3A 1H3DA 5T41A 3QIPB 4GO5X 3GPAA 3NXZA 4PPDA 1XMQJ 3K5MA 4OO1C 2VBZA 4RZRA 4LPFA 1MU2B 1F1BB 2ZVIA 3PYGA 4K5SA 3J81C 4RJVA 2DGUA 3VAFA 2O3DA 1V5VA 1TKTB 1T05B 1TQLA 2F5GA 4O4GB 4DX8H 1JLCA 2DHXA 1AZSA 4B3RE 2HGNA 3KYLA 1VQ8S 3GJQB 1S7HA 4MJKA 3TUZC 4DR3I 2PO1A 1T9WA 1BQMA 4DSJA 4NYPA 4X66J 3MCNA 4DR6F 1HQEA 4UT4A 1GK8A 3MURP 2ASYA 4B02A 1DTQB 3H4DA 5KFBA 5DLFA 3DI6A 4F3QA 4IFDB 2UUBF 2GVZB 4C9DA 3W62A 2ILYA 1J5EJ 2Z5CB 3DLEB 1HNIB 4DV0J 2YNFA 3C15B 1XMOF 1EZZB 5KFAA 3T1AA 1WKKA 4HDHA 1VDHA 3CJ2A 3M8RA 4URSA 2Q3PA 3T5LA 2K7JA 1Y7PA 2V9KA 5LXYA 1K47A 3IRWP 2IFXA 2XBPA 1RYRA 2ZUGA 4G65A 1KR4A 2W9CA 4CLPA 2LXFA 3BYRA 3A3PB 2MQ8A 4LF7E 2GV1A 4ZHRA 4OI4A 2RUGA 3QRQA 2L9DA 4F04B 2CG9A 4LBIA 2UXCJ 4ZVIA 3ZTRA 5DNLA 4HTIA 3BGRA 4X4TA 1PAEX 8ATCB 2AYGA 3GYXB 3IBWA 3EGVA 3ADAC 4DR6E 1I51B 4KBIA 3QLHB 4RUAA 3TANA 3LOUA 2RE1A 4L3KA 4YR3A 1JLGB 2UUBE 4JOUA 4Q2MA 2BJ1A 1N34J 3PW5A 5KT3A 1LXNA 2VFTA 3U1LA 3R7NB 4DX6A 2QG9B 2PGCA 4ZVQB 1XMOE 3D2WA 1TL7A 3LWLA 1A9NB 2IAJB 1N5YB 1Q78A 2R2SA 4ZS6A 2JFKA 4ZMMA 1SL0A 2CQ4A 4X4UA 5GADU 3ZZZA 4DN9A 1B4SA 1NZ0A 5ITHA 3QNWB 5GAGU 1N34I 2DT9A 2UUCF 5HROB 4B9MA 4OL8A 2R42A 4B3TF 1HHTP 1H7WA 2W7PA 2E66A 5CD4A 1DJ0A 1LNQA 4OX8A 1EARA 2HK3A 4DR2F 4ES3A 5KT7A 1Q8LA 4ZP9A 2BE7D 4JI5J 2HHHF 1S6PB 4DV1J 4A8XA 3DRXA 1NDKA 2EWHA 3PRDA 2ZWOA 2CQBA 2R8KA 4Y0FA 3DM2B 2DGSA 2O3ZA 4YR2A 3RR8A 4I67A 5KFSA 5DZ7A 2WB4A 2JJ4D 4OI2A 4DV2J 2OPQB 1TMMA 3GG1A 4C8MA 4DUZJ 5JXSA 5L38A 1KSPA 4DV5I 1Y9OA 4ZPTR 2F4VF 1CJUA 2H51B 4CCHA 2DNZA 2B9XA 3M8QB 1GTEA 2HZVA 4B3TE 4UZBA 1DARA 2J8SA 2EK6A 4NLDA 2G1HA 3HM9A 1IJFB 1G1XA 2HAIA 3B82A 4P7TA 4ER8A 3EPIA 1NJIT 2J6TA 2CIMA 1X4FA 3U1YA 2O1WA 2PD1A 2AE8A 5HAOA 3KNAA 2QX0A 3LA0A 5A0YB 4DSEA 1IKXA 1VC6A 1A6LA 2YWKA 4MU4A 3MR5A 2OSQA 1YJUA 3FGVA 1RT7A 5L1IA 2V4RA 2EBGA 2GO9A 2MQLA 2GC8A 3POTB 3PX4A 3R1LA 1U6ZA 5B08A 3T6JA 2CNOB 4LSLB 1CC7A 2QV6A 4BHQA 3S6EA 3FBEA 3ZTSA 1WHWA 2OPSA 3IXQA 3NMRA 2CZ9A 3DDNA 3D5MA 4DUYJ 1YDLA 2Z5EA 3J7AM 4KYZA 2XMVA 3EDRB 3U1KA 4OX9J 4KGMA 2IMOA 4ZK7M 3ZFVA 4M5NA 1AUSL 2GMLA 4JI1J 4LF2A 1SL1A 2HFOA 3MUMP 1D8ZA 3JSYA 4R8UA 1T9UA 3C8YA 4DUYI 3BDEA 4KSEB 4DV3I 1YZ7A 2Q2EB 3GB0A 1JIHA 2WVFA 2ZOGA 4H4OB 4CLLA 2YTCA 4JI1I 3V81B 1Q8KA 2LQJA 4IFDC 4FBUA 3T19A 3PJ9A 4ID5A 3RW7A 1S9EB 3W2VA 3MEEA 4DV6F 5C0XC 5HVHA 2B4PA 1YBUA 2B51A 3W61A 2GW8A 1H6KX 4DL2A 2QLWA 1LQ9A 4PWWA 4RO0A 3GCWP 2I8EA 1IBLI 4WKRA 2VG7B 3M2RB 1WSRA 4DV4F 1X5SA 2VPYB 3J80U 3IO1A 1JJCB 5T7LB 1VQ9S 2DO0A 2HRUA 4ZLJA 1UMJA 1PC4A 1TV6A 2AJFE 1FJ7A 3CIMA 4WKYA 4J9SA 5FDLB 4OHZA 2P9CA 4LSNA 1N6QA 3FFIA 3L4BC 5LJ3Y 2ZH9A 1CJKB 4X64J 1T9YA 4FS1A 4L3NA 4Z7YA 2CQPA 3KLEB
chains in the Genus database with same CATH topology
3V2UC 1EA6A 4GKKI 4USMA 4JI8I 4JI3I 3WU5A 4LF7E 2DEJA 1FJGI 3PRYA 1A6FA 3T1HI 1FWLA 3M6AA 2ZITA 3GONA 2X36A 2CG9A 4DV7E 2PNMA 4ZVIA 4JI5I 2UUCI 4DV1E 5IWAE 1OJ4A 1ZM2A 4DV1I 4LFAE 4HYMA 4R1FA 1MG7A 1XNQI 1MU5A 2NPFA 3QT8A 4JI7E 4JI7I 4OX9E 4DV5E 2HKEA 3V5RA 1ZXNA 4DR6E 4JV5E 4LF8E 2V8PA 4GKJE 2UUBE 1HNXE 4LF4I 4X65E 4LF5I 4FWGA 4DV2I 2O1TA 1N33E 3OTOI 1Z0EA 4DU8A 4DUZI 3ZKDA 2HK2A 2HHHI 4B3RI 4IZJB 2Z5CA 4HACA 4KHPI 4X62E 4X62I 1XMOE 3WU4A 4MYTA 1FNMA 1XMQE 2LJPA 1IBMI 3P06A 1I94I 5BR8I 1Z0CA 4JI4I 2R3VA 2PNLA 2E5LI 1NZ0A 4K0KI 4JYAI 1N34I 4NXME 2O1UA 4DR7I 2ZBKB 1N32E 1N32I 2R42A 3ZZUA 2BM0A 1Z0VA 3F0NA 4DR5E 4FN5A 4LF6E 1NHJA 4XTJA 2F4VI 2HK3A 1HNZI 4MYUA 1H7SA 3J7AG 4LF9E 4LF9I 3WU3A 3QT7A 4LFBI 1HR0I 4UTGA 2IOPA 4X66E 5LL6R 4DV6E 5IT9C 4FWDA 4EMDA 1HNWE 5FWKA 4LF7I 2VQFE 1N0VC 2ZM6E 1FI4A 1H74A 1Z0TA 1N36E 4DV7I 4IZJA 1J5EE 4DV0E 1Z5BA 2Z5BB 1QZRA 1Y4SA 5IWAI 4DUYE 4LFAI 4X64E 4DR1E 4DV3E 3B78A 4DV4E 4OX9I 4DV5I 5IT9Q 4DR6I 3Q6NA 2UU9E 4JV5I 4LF8I 4P52A 4JI1E 2V34A 1ZM9A 1FWKA 4GKJI 2UUBI 4B3TE 1HNXI 1Z0BA 4LFCE 4X65I 4P7AA 5A2QC 3ZZTA 2BV3A 1N33I 1DARA 4DU7A 2V2ZA 4DPTA 4N3OA 4DPYA 2VQEE 3B82A 1XMOI 3ZZ0A 2UXBE 3PYFA 2UXBI 1B62A 2O1VA 3Q6MA 2UXCE 2UUAE 1XMQI 3QT5A 4JI2E 1PVGA 2O1WA 2A2DA 4PRXA 1Z5CA 1Y6ZA 2HKJA 4NXMI 1ZXMA 3JAMC 2UXDE 2A2CA 4USKA 2CGEA 2GQ0A 2BM1A 4DR3E 1Z0GA 4M1KA 4JI6E 1IBLE 1B63A 4KQVA 4URLA 4DR5I 4LF6I 1S16A 1D6TA 1H7UA 5GMEA 4FWHA 5LMUE 4IZJD 4YHHE 4YHHI 4IZKB 4B3ME 4B3MI 2Z5BA 1USVA 1H72C 1HK7A 1XNRE 3JAMQ 5L3JA 1Z5AA 1ZM4A 2CZ9A 3T1YE 4Z7CA 4AQYE 3K1JA 4X66I 1Y4UA 3D4JA 2Z5EA 3J7AM 1IBKE 1Z0WA 4DV6I 2X7IA 4NXNE 4ED4A 1HNWI 4B3SE 2VQFI 4JI0E 3J80C 2ZM6I 2VF3A 3PYDA 4DR4E 1RR9A 3LPSA 5LMNE 1N36I 1J5EI 4GKKE 4DPXA 4DV0I 1NHHA 1UEKA 2AJ4A 3CWVA 4JI8E 4DUYI 4JI3E 1FJGE 4X64I 1EI1A 4DR1I 4DV3I 3T1HE 4DV4I 2Q2EB 2EFGA 4FW9A 1N0UA 1ZM3A 1WUUA 2UU9I 3J80Q 4JI5E 2V2QA 4JI1I 2UUCE 4B3TI 1KTVA 1XNQE 4DPUA 1VISA 4LFCI 5FLXC 2GS8A 3PYGA 2J7KA 3J81C 1MX0A 5GMDA 1PIEA 2IOQA 3K85A 2VQEI 3PYEA 4DR2E 4DR2I 1KVKA 4PU9A 1XHKA 4LF4E 3Q1QA 4IZKA 2UXCI 2UUAI 4LF5E 4DV2E 1KIJA 3OTOE 1S4EA 4YY3E 4YY3I 2XEXA 4DUZE 4JI2I 4B3RE 2HHHE 5FLXQ 4KHPE 5A2QQ 1H73A 3WU6A 3J81Q 3HULA 1PKPA 3B8HA 3ZM7A 1NHIA 2UXDI 1IBME 4DR3I 4JI6I 4JG4A 4WUBA 1RREA 1IBLI 4DPWA 1I94E 5BR8E 4WUCA 1ELOA 3LNUA 4JI4E 2E5LE 4UT4A 4K0KE 4JYAE 1N34E 1USUA 3HJCA 5LMUI 1FKAE 4DR7E 2HFUA 3QT6A 2OI2A 1XNRI 4WUDA 2E1RA 4DXLA 2Z5CB 4HACB 4HXZA 3H4LA 3T1YI 2F4VE 4AQYI 1HNZE 1Z59A 1IBKI 2V2VA 3ZKBA 4NXNI 4PRVA 4RPFA 4B3SI 4Z7YA 4HY1A 2DEIA 4JI0I 4I3HA 1KKHA 3K17A 4LFBE 1BKNA 1U2RA 3LTOA 2HFSA 1HR0E 4DR4I 2WW4A 1K47A 5LMNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2U C;  1EA6 A;  4GKK I;  4USM A;  4JI8 I;  4JI3 I;  3WU5 A;  4LF7 E;  2DEJ A;  1FJG I;  1A6F A;  3T1H I;  1FWL A;  3M6A A;  2ZIT A;  3GON A;  2X36 A;  4DV7 E;  4ZVI A;  4JI5 I;  2UUC I;  4DV1 E;  5IWA E;  1OJ4 A;  1ZM2 A;  4DV1 I;  4LFA E;  4HYM A;  4R1F A;  1MG7 A;  1XNQ I;  1MU5 A;  2NPF A;  3QT8 A;  4JI7 E;  4JI7 I;  4OX9 E;  4DV5 E;  2HKE A;  3V5R A;  1ZXN A;  4DR6 E;  4JV5 E;  4LF8 E;  2V8P A;  4GKJ E;  2UUB E;  1HNX E;  4LF4 I;  4X65 E;  4LF5 I;  4FWG A;  4DV2 I;  1N33 E;  3OTO I;  1Z0E A;  4DU8 A;  4DUZ I;  3ZKD A;  2HK2 A;  2HHH I;  4B3R I;  4HAC A;  4KHP I;  4X62 E;  4X62 I;  1XMO E;  3WU4 A;  4MYT A;  1FNM A;  1XMQ E;  2LJP A;  1IBM I;  1I94 I;  5BR8 I;  1Z0C A;  4JI4 I;  2R3V A;  2E5L I;  1NZ0 A;  4K0K I;  4JYA I;  1N34 I;  4NXM E;  4DR7 I;  2ZBK B;  1N32 E;  1N32 I;  2R42 A;  3ZZU A;  2BM0 A;  1Z0V A;  3F0N A;  4DR5 E;  4FN5 A;  4LF6 E;  1NHJ A;  4XTJ A;  2F4V I;  2HK3 A;  1HNZ I;  4MYU A;  1H7S A;  3J7A G;  4LF9 E;  4LF9 I;  3WU3 A;  3QT7 A;  4LFB I;  1HR0 I;  4UTG A;  4X66 E;  5LL6 R;  4DV6 E;  5IT9 C;  4FWD A;  4EMD A;  1HNW E;  4LF7 I;  2VQF E;  1N0V C;  2ZM6 E;  1FI4 A;  1H74 A;  1Z0T A;  1N36 E;  4DV7 I;  1J5E E;  4DV0 E;  1Z5B A;  1QZR A;  5IWA I;  4DUY E;  4LFA I;  4X64 E;  4DR1 E;  4DV3 E;  3B78 A;  4DV4 E;  4OX9 I;  4DV5 I;  5IT9 Q;  4DR6 I;  2UU9 E;  4JV5 I;  4LF8 I;  4P52 A;  4JI1 E;  2V34 A;  1ZM9 A;  1FWK A;  4GKJ I;  2UUB I;  4B3T E;  1HNX I;  1Z0B A;  4LFC E;  4X65 I;  4P7A A;  5A2Q C;  3ZZT A;  2BV3 A;  1N33 I;  1DAR A;  4DU7 A;  2V2Z A;  4DPT A;  4DPY A;  2VQE E;  3B82 A;  1XMO I;  3ZZ0 A;  2UXB E;  3PYF A;  2UXB I;  1B62 A;  2UXC E;  2UUA E;  1XMQ I;  3QT5 A;  4JI2 E;  1PVG A;  2A2D A;  4PRX A;  1Z5C A;  2HKJ A;  4NXM I;  1ZXM A;  3JAM C;  2UXD E;  2A2C A;  4USK A;  2BM1 A;  4DR3 E;  1Z0G A;  4M1K A;  4JI6 E;  1IBL E;  1B63 A;  4KQV A;  4URL A;  4DR5 I;  4LF6 I;  1S16 A;  1D6T A;  1H7U A;  5GME A;  4FWH A;  5LMU E;  4YHH E;  4YHH I;  4B3M E;  4B3M I;  1H72 C;  1XNR E;  3JAM Q;  5L3J A;  1Z5A A;  1ZM4 A;  2CZ9 A;  3T1Y E;  4Z7C A;  3K1J A;  4AQY E;  4X66 I;  3D4J A;  3J7A M;  1IBK E;  1Z0W A;  4DV6 I;  2X7I A;  4NXN E;  4ED4 A;  1HNW I;  4B3S E;  2VQF I;  4JI0 E;  3J80 C;  2ZM6 I;  2VF3 A;  3PYD A;  4DR4 E;  1RR9 A;  3LPS A;  5LMN E;  1N36 I;  1J5E I;  4GKK E;  4DPX A;  4DV0 I;  1NHH A;  1UEK A;  2AJ4 A;  3CWV A;  4JI8 E;  4DUY I;  4JI3 E;  1FJG E;  4X64 I;  1EI1 A;  4DR1 I;  4DV3 I;  3T1H E;  4DV4 I;  2Q2E B;  2EFG A;  4FW9 A;  1N0U A;  1ZM3 A;  1WUU A;  2UU9 I;  3J80 Q;  4JI5 E;  2V2Q A;  4JI1 I;  2UUC E;  4B3T I;  1KTV A;  1XNQ E;  4DPU A;  1VIS A;  4LFC I;  5FLX C;  2GS8 A;  3PYG A;  2J7K A;  3J81 C;  1MX0 A;  5GMD A;  1PIE A;  2VQE I;  3PYE A;  4DR2 E;  4DR2 I;  1KVK A;  4PU9 A;  1XHK A;  4LF4 E;  3Q1Q A;  2UXC I;  2UUA I;  4LF5 E;  4DV2 E;  1KIJ A;  3OTO E;  1S4E A;  4YY3 E;  4YY3 I;  2XEX A;  4DUZ E;  4JI2 I;  4B3R E;  2HHH E;  5FLX Q;  4KHP E;  5A2Q Q;  1H73 A;  3WU6 A;  3J81 Q;  3HUL A;  1PKP A;  3B8H A;  3ZM7 A;  1NHI A;  2UXD I;  1IBM E;  4DR3 I;  4JI6 I;  4JG4 A;  4WUB A;  1RRE A;  1IBL I;  4DPW A;  1I94 E;  5BR8 E;  4WUC A;  1ELO A;  3LNU A;  4JI4 E;  2E5L E;  4UT4 A;  4K0K E;  4JYA E;  1N34 E;  5LMU I;  1FKA E;  4DR7 E;  2HFU A;  3QT6 A;  2OI2 A;  1XNR I;  4WUD A;  2E1R A;  4DXL A;  4HAC B;  4HXZ A;  3H4L A;  3T1Y I;  2F4V E;  4AQY I;  1HNZ E;  1Z59 A;  1IBK I;  2V2V A;  3ZKB A;  4NXN I;  4PRV A;  4RPF A;  4B3S I;  4Z7Y A;  4HY1 A;  2DEI A;  4JI0 I;  4I3H A;  1KKH A;  3K17 A;  4LFB E;  1BKN A;  1U2R A;  3LTO A;  2HFS A;  1HR0 E;  4DR4 I;  2WW4 A;  1K47 A;  5LMN I; 
#chains in the Genus database with same CATH topology
 1RHY A;  3CNQ P;  3M8P A;  1DTT A;  2CUY A;  4PUO A;  4AND A;  4LMZ A;  2C2K B;  1SV5 B;  4DCO B;  3N5F A;  4CM0 A;  2R2T A;  2PE8 A;  3H1C A;  2BJ8 A;  3NEK A;  4AUK A;  1NCL A;  2X36 A;  2D74 B;  1VFJ A;  2ERR A;  4K5R A;  4CI0 B;  2OTJ S;  1S12 A;  3R27 A;  3CF5 Q;  3PW0 A;  4PWU A;  3T5H A;  4HYM A;  3TP2 A;  1XNQ I;  3GIL A;  3QT8 A;  5KFK A;  5AXK A;  4C11 B;  3FRZ A;  3GFZ A;  1GXU A;  2RRB A;  3AQO A;  4NPO A;  3O44 A;  2ZH8 A;  1C0U B;  1RU2 A;  4LF5 I;  1T94 A;  4V19 J;  2O1T A;  1W2I A;  3IGN A;  2B4V A;  2DGV A;  1BWV A;  4DR7 J;  2GVD B;  4IOB A;  3ZKD A;  2MB0 B;  4QR0 A;  4ELT A;  3UR3 C;  3HKZ D;  2B4U A;  3MMA B;  2MQN A;  2KG1 A;  5J1E B;  4XPE A;  2CNK B;  4MYT A;  1FNM A;  3PS3 A;  2B4O A;  1VQ6 S;  2XLI A;  4USH A;  1UCN A;  4NXN J;  3NZK A;  2Z2L A;  2EI5 A;  5B0G A;  1TK8 A;  3S7R A;  4DR7 I;  2ZBK B;  1Q81 T;  5KT4 A;  3ONQ A;  4LFC F;  3GG0 A;  3BQ0 A;  1RTD B;  2W8L A;  1IQZ A;  4DR5 E;  2Y1R I;  3MFI A;  4IG0 A;  3J7A G;  3G96 A;  1RCX B;  2VIH A;  3MTJ A;  4ED0 A;  4PWD B;  3G86 A;  4TYA A;  1RB0 A;  1VK8 A;  2E1A A;  3CJ5 A;  1FDB A;  3G6Y A;  2CPH A;  1KRP A;  2F1F A;  5I42 B;  5IS2 A;  1N52 B;  2F8M A;  5D0E A;  1AYE A;  1QTM A;  1SJR A;  4PAA A;  4RBU A;  4A47 A;  1RBL A;  4WYL A;  1WG1 A;  4RUB A;  1GEH A;  2WSC C;  3U02 A;  5C25 A;  3OR2 A;  4Q5V A;  2MGZ B;  4N77 A;  3L7Z A;  2FY8 A;  5DM6 Q;  1DLO B;  1ZM9 A;  1EET A;  4LFC E;  4P7A A;  5A2Q C;  4JI0 F;  2OEL A;  4CYU B;  4DPT A;  4RBT A;  3M32 B;  4J90 A;  1R0C B;  4IDK B;  3KLG B;  3HHL C;  1X9W A;  1CQM A;  3C16 A;  2V0N A;  1ZPV A;  2FC9 A;  4JI8 F;  2OTL S;  1TVR A;  3MED A;  4I1T A;  4ES2 A;  2IBK A;  2NN6 D;  1HNZ J;  1KON A;  3TJA A;  3RBX A;  2E7V A;  4R5P B;  2C2Z B;  1S9F A;  2OPP B;  1NJY A;  3MAA A;  1CBK A;  1Y0H A;  1HYS A;  4OX7 A;  1BHN A;  3K5P A;  4GVB B;  4A46 A;  5THW A;  4WYW A;  4P2M A;  2YWG A;  4NAS A;  4ZCM A;  2WBR A;  1RLD A;  1P6T A;  2PEB A;  2BW2 A;  2Z5B A;  4LT6 A;  4YEA A;  1NDC A;  2L3M A;  3OTO F;  3J7Y U;  3JAM Q;  3QJP A;  3UN2 A;  1FCA A;  3K7R A;  4ZN1 A;  3GQC A;  2PII A;  2L9N A;  1A0O B;  3RB3 A;  2IDL A;  1RWM B;  2KL8 A;  4JI0 E;  1M1G A;  2ZHO A;  2E5H A;  3G87 A;  9RUB A;  2K8G A;  1U09 A;  4TQS A;  4K59 A;  2AD9 A;  3ZXW A;  2RHQ B;  2ZH5 A;  1O0P A;  3W2W A;  3V6K A;  3CDB A;  4U7C A;  4JI8 E;  1NK7 A;  2CAJ A;  2RDJ A;  1WC5 A;  2H3E B;  2V2Q A;  1RTI B;  2RH3 A;  3BGU A;  2XCA A;  3I5A A;  1D9D A;  1HR0 F;  1RHM B;  1JKH B;  1Q1K A;  3FC9 A;  4NBQ A;  1ITP A;  3FQK A;  1HNW F;  2DNG A;  4DPO A;  1LWF B;  3OTO E;  2M8D B;  3BO2 A;  4YY3 E;  3NKY A;  2NXE A;  3Q8S B;  4LCG A;  2M2B A;  2R8G A;  1HI1 A;  1RWU A;  2GIF A;  1SIZ A;  5B7W A;  3G8S A;  3HFK A;  1WOS A;  2E44 A;  4RW6 B;  1E6V A;  1L3S A;  1KHV A;  2U1A A;  4JV5 F;  4PQA A;  1FKA E;  3LPE A;  2HNY A;  2F9J A;  5MAO A;  3GJT B;  4DUT A;  3MM9 B;  4EEY A;  4HXZ A;  1AXQ A;  2KYZ A;  3THT A;  2UXB F;  5GAH I;  3HKM A;  2MY8 A;  2X1G A;  4ZVR B;  3NP5 A;  1D8Y A;  5C2G A;  5DDO C;  5L9X A;  4RLE A;  3BO4 A;  4ZOS A;  2DGW A;  1U2R A;  3V6H A;  1LWX A;  1HR0 E;  5ETT A;  3QJL A;  2VU5 A;  2DHA A;  3BDP A;  3JQK A;  5J2Q B;  1CUL A;  2M88 A;  1UWA A;  1UW9 A;  4YR0 A;  3K8V A;  2W9A A;  3W60 A;  1RT1 B;  1KEK A;  1U1R A;  3M8S A;  4MU1 A;  3A8E A;  3IGV A;  8RUC A;  4UF4 A;  1TL3 B;  2ABY A;  1XNR F;  3SIP B;  3H42 A;  2HKE A;  3OL8 A;  1VQL S;  2VZ9 A;  3BPS P;  1BE4 A;  4JV5 E;  2C2O B;  3P5B P;  4ZN3 A;  4X65 E;  3HZE A;  4B3S F;  2VQF F;  1XER A;  3PIP Q;  2W4C A;  2KH9 A;  4I56 A;  4NA2 A;  4DHV A;  1RKI A;  3EM1 A;  1S1X A;  1PJ6 A;  5DGB A;  2CAD A;  3GIK A;  2UVU A;  2JRS A;  1NK9 A;  1RSC A;  1AA1 B;  4RW7 B;  4AQY J;  1QTN B;  2CG4 A;  3KMS A;  1U1M A;  4NXM E;  1Y10 A;  1F5B A;  2FQQ B;  3MM7 A;  1GX6 A;  2BJ7 A;  1KTQ A;  1RHK B;  4Y28 C;  4ZVU B;  1ZZF A;  2AGO A;  1EHW A;  2C3Y A;  3BN7 A;  3ILO A;  1HLW A;  1JXV A;  4O44 A;  2BA0 D;  2AP6 A;  2Q6C A;  5HBM A;  2HQF A;  1YJ9 S;  1YIT S;  3QMQ A;  4UUW A;  4ECW A;  2J6U A;  2OKQ A;  2BRK A;  5KG5 A;  4PQU A;  4LVO P;  4E0D A;  2IOP A;  2C3U A;  2JVO A;  2DIV A;  1F3V A;  4KGV B;  5LL6 R;  4JI7 J;  3HFZ B;  2CVI A;  3C14 A;  4EMD A;  3EXC X;  4JI6 F;  2JL9 A;  2VQF E;  2NR0 A;  1Y11 A;  2C38 A;  3VHQ A;  4LF8 J;  3X1L B;  4JI4 F;  1VQK S;  4JYA F;  2DCL A;  3KHL A;  5HLF B;  3OJS A;  4ZCI A;  1FT8 A;  5EX3 A;  2APO A;  3OTC A;  3IR7 B;  2WK4 A;  4N8N A;  1JLE A;  3RW6 A;  4C8K A;  5D0H A;  3KK2 A;  5E3R A;  5EN1 A;  3T1Y F;  3PV8 A;  4ZPB A;  1B70 B;  4P52 A;  4LF8 I;  4ITS A;  5EHH A;  2AEJ A;  3Q8R B;  3ZZT A;  3OHB A;  4UOG A;  1K44 A;  4OI0 A;  2IYI A;  3DD6 A;  3M30 B;  2DHH A;  4AXJ A;  4KAI A;  4GKK F;  1RT6 B;  2O1V A;  1JNZ B;  1W26 A;  4WFB Q;  3NS5 A;  4UUX A;  1IKW B;  4QNK A;  4LF9 J;  2HKJ A;  3QSI A;  4ID8 A;  1FD8 A;  1JB0 C;  1TP7 A;  4OYX A;  2UXD E;  1NRK A;  4JI6 E;  3DCA A;  3PHT A;  1RHU B;  1B63 A;  1YIJ S;  2KFN A;  1LWC A;  3O2I A;  4J37 A;  5CYJ A;  3C16 B;  1UEU A;  4IZJ D;  4RBV A;  5DG7 A;  4J9U E;  3HZG A;  1UFL A;  2XNQ A;  1VJW A;  5C42 A;  5AJ3 F;  4OI3 A;  4PXE A;  4EO8 A;  1IJE B;  3MXH P;  3DOL B;  2HVD A;  5D6G A;  5KFV A;  1RCO B;  5IWA J;  3T1Y E;  4EWT A;  1YGY A;  4OZ5 A;  4F2R A;  4CNY A;  3J7A N;  1XMQ F;  4MQY A;  4YB6 A;  3DU5 A;  2UV8 G;  2J9E A;  3R2D J;  4B3O A;  2SXL A;  2OHD A;  3TAQ A;  2VF3 A;  2E5L F;  4M5H A;  3EPG A;  1S6Q B;  4GKK E;  5AXM A;  3T9Z A;  2E1P A;  2M0G B;  4NML A;  2FLN A;  5IT9 Y;  2HZA A;  4J9P A;  3N79 A;  2X51 A;  4PG7 A;  4KH0 B;  3AOB A;  3CD7 A;  1U1Q A;  1LFW A;  4Q8E A;  4PXD A;  3DRP B;  4OJG A;  1U8W A;  3CIZ A;  5KFX A;  2XTJ P;  3K85 A;  3W2W B;  2VQE I;  2AJQ A;  4J9N A;  2VC0 A;  4FYX B;  3PYE A;  3Q23 A;  2VFS A;  4KT0 C;  5KFG A;  5JJB A;  2VJV A;  3RB4 A;  5IM0 A;  4ZCK A;  3SQO P;  3ZNJ 1;  4QYZ K;  1U0H A;  4YY3 I;  4C97 A;  4DOZ A;  2WBM A;  2ZJQ Q;  1F60 B;  4UY8 T;  3VAM A;  5C7P A;  3B6B A;  3KK1 A;  3ISN D;  4IYQ A;  5DG9 A;  4RW8 B;  4DL6 A;  4WK3 A;  5F3T A;  5HVF A;  1S0M A;  1DQ9 A;  4PKD B;  2E5L E;  3K5N A;  3H8Y A;  2RF2 A;  2VC1 A;  1BGX T;  2GHV C;  4F0M A;  3I6P A;  3MOZ A;  2BXJ A;  3C6U B;  3ILJ A;  2BDP A;  3AQP A;  4L75 A;  2YWE A;  4B9T A;  3L7U A;  2QLF B;  4L73 A;  3H5S A;  2WCX A;  1FJG J;  2HWH A;  4EFA C;  5J2M A;  2J5A A;  1KLN A;  2AIR B;  1R31 A;  3HO1 A;  3ETO A;  4PG4 A;  3CDW A;  3BR9 A;  3AOA A;  1IBC B;  4NLO A;  4PXC A;  2OFG X;  4CLS A;  3VWS A;  1YWX A;  1LXJ A;  2LYV A;  3CDI A;  3G82 B;  1YJW S;  4J9L A;  1FJG I;  2C2M B;  3G8T A;  3DRY A;  3CD5 A;  2GMH A;  4LF6 F;  2EG1 A;  1WJ9 A;  1WG5 A;  1IWA A;  4LRD A;  3TAP A;  3KLF A;  3JAM U;  1TFW A;  3MMC B;  4NL5 A;  4EZ6 A;  3KHG A;  3QWU A;  4OJ3 A;  4I2Q A;  4GC7 A;  1L3K A;  3PDN A;  4OYO A;  1KHW A;  3PR5 B;  3ZZY A;  3GE9 A;  3DLJ A;  3BQ2 A;  2EBE A;  4UOH A;  1P8G A;  2B9E A;  1PYT A;  3SFU A;  2W2M P;  2ZZN A;  2Z8Q A;  2DRD A;  4HL9 A;  4C98 A;  1GX5 A;  2DXF A;  1Z0C A;  1S7I A;  3M4X A;  2FJA B;  1VHI A;  2CYY A;  3FQL A;  4QOT A;  3PS2 A;  4W90 B;  1NO8 A;  4O0N A;  2C39 A;  2J8A A;  1N5T A;  4DQR A;  2ZH7 A;  1H0H B;  2LXU A;  1U25 A;  5BXI A;  4LF6 E;  1S1X B;  3AOC A;  1VRT A;  2NXJ A;  4TQR A;  2D9O A;  4USU A;  3PG9 A;  1RU1 A;  4I7F A;  3CJK B;  3WU3 A;  1SC4 B;  1S76 D;  1PYO B;  5AT1 B;  1B7F A;  1UDQ A;  3RZA A;  3SDE A;  2BMB A;  2FIU A;  1BQX A;  4MMO A;  2KRB A;  5HBM B;  5I4M A;  3MUV P;  2RKI B;  3IWN C;  3MCM A;  1Z0T A;  2AKW B;  4OI6 A;  2DHS A;  2FGO A;  4KV8 B;  2ASL A;  1RTJ B;  1FE4 A;  1RT4 B;  2VG6 B;  4HI2 A;  4C8Z A;  4XDC A;  3JTP A;  1WD6 A;  4PR6 A;  4CLY A;  4X84 A;  2E9Z A;  1UVK A;  3PX6 A;  1KC8 T;  3KK3 B;  2ACM A;  1NSP A;  4PEO A;  1R6M A;  1EP4 A;  1RT2 A;  3MM5 A;  1NZA A;  1NDP A;  1RWV B;  2B8Q A;  3QGH A;  1XWL A;  4OO1 F;  3TX0 A;  1B62 A;  1T7P A;  3Q6M A;  2JEG A;  2UUA E;  3R5G A;  2NN6 E;  1RHJ B;  2V9W A;  1JLE B;  2JE6 B;  2D1C A;  5DZ6 A;  4DV7 F;  3GR0 A;  1UA1 A;  4N7T A;  1U1K A;  4QIV A;  3MEC B;  2PO0 A;  4K2X A;  4DMZ A;  1XXE A;  2P9G A;  4R0J A;  1BQN A;  3RRH A;  4HTJ A;  2XZD B;  5CXT A;  3W5Y A;  1WEL A;  3SCK E;  4IZK B;  5CA5 A;  2J9C A;  2V4J A;  3VAJ A;  4R0E A;  2KKH A;  1SCJ B;  1K0V A;  4MFB A;  2DR5 A;  3KLH B;  4KHP F;  2CWX A;  4H4K A;  1IR1 A;  1M5S A;  3VVT A;  3K1J A;  1URN A;  2VFU A;  5CQG A;  1R3N A;  2ZKT A;  3CCM S;  2VV5 A;  4DR6 J;  1X4H A;  3HDS A;  5C2C A;  1BD6 A;  2CVE A;  2LEA A;  5CD4 H;  2UUB J;  4WP8 A;  4PG6 A;  3IC1 A;  2CPD A;  2JC1 A;  1N32 F;  4JI3 E;  2PC6 A;  4EBD A;  1XMO J;  3MOJ B;  2LLZ A;  3T1H E;  3ENW A;  1WC3 A;  3P96 A;  2H5J B;  2E9R X;  2ADB A;  3BJY A;  3DOK B;  2VPZ B;  4Q45 A;  1PBU A;  2DNK A;  1GNK A;  5F8M A;  2MZT A;  3H5X A;  1C0T B;  1VQS A;  5JEA D;  3Q8U A;  3HHN B;  3CE8 A;  5KFN A;  1YG0 A;  4NCG B;  4ICL B;  2MYF A;  4USV A;  4LFB F;  1JNR B;  1OMS A;  4OZ2 A;  3NG8 A;  3LQV A;  1QJH A;  4OYZ A;  1U26 A;  3DLG B;  3V4I B;  2M3D A;  2XYP B;  3D0I E;  2OAU A;  2XYH B;  1G3O A;  3GYG A;  2DGX A;  2QRR A;  3LH2 S;  3H40 A;  4KHP E;  1UW4 A;  2MZQ A;  2Z2Y B;  3HUL A;  4LIR A;  2ZOM A