4X65E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x65E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x65E02
4DV2E 1NZ0A 4DR6I 4KQVA 4LFAI 3C4TA 5LMUE 2GS8A 1HNWE 4GKKI 1QU6A 3QT5A 4JI7I 4X66E 2N3HA 4FWHA 1FJGE 3PYDA 2L3JA 2UUBE 1U2RA 2F4VI 4DR7E 3WU3A 4DR1E 1N0UA 4JI2I 4JYAI 2VQFI 1XMQE 3K17A 4LFCI 1B62A 2E5LI 2AJ4A 2B3TB 2L2MA 1NHJA 1Z0WA 4X62I 2MDRA 2F4VE 2UXDI 1Z5BA 1XNQI 2DEJA 1KIJA 4JI3E 1H72C 1HNWI 3ADIA 2LTRA 4DV3E 2LRSA 2HHHE 1IBKI 4LF5I 4DU7A 4DUZI 4AQYI 1YYOA 2XEXA 3ZZ0A 1UEKA 1T4OA 2ZITA 4GKJE 3M6AA 1N36E 4DR3I 4JI3I 1BKNA 1HNZI 3J81Q 4M2ZA 2DEIA 4FWDA 4DR5I 3J7AG 4JI6E 1HR0E 2NUGA 2BM0A 1IBME 2J7KA 2HK2A 4Z7CA 1UILA 1H7SA 1Z0VA 3PYGA 3LNUA 3QT6A 1OJ4A 4FWGA 2VF3A 3VYYA 5FLXC 2N3GA 1GQEA 4GKKE 4JI6I 3ADJA 4K0KE 2LUPB 1X48A 4YHHE 4ED4A 2OI2A 1KVKA 5IT9Q 1Z0CA 3PYFA 2UU9I 2EZ6A 1QZRA 4DV0E 1N33E 2ZM6I 4JI8E 3V5RA 4RPFA 4M1KA 3WU5A 2VQEE 2HKEA 4DR2E 1MU5A 3B82A 1WHNA 2E1RA 3JAMC 4GKJI 3OTOE 4DPYA 2BM1A 4LF8I 3J80Q 2YT4A 4USKA 4DV3I 4JI8I 2UXCI 1IBLE 4DV1E 4X64E 4B3TI 4DV5I 2UU9E 4NXNI 2LJHA 1FWKA 1N34E 3LPSA 5LL6R 2EFGA 1K47A 4DR1I 3K1JA 2L33A 5LMNE 4K0KI 1FJGI 4DV6E 4P52A 4HACB 5GMDA 2VQFE 4LF6I 1ZM3A 2V8PA 2JY9A 3H4LA 4WUCA 5CFFE 4DR7I 5BR8I 1Z5CA 1YYWA 4DR6E 2Q2EB 4DV2I 2UUBI 2LTSA 4LF9I 1O0WA 4YY3I 4JI7E 4B3ME 1N32I 1IBMI 4LFAE 3CWVA 4PRXA 1ZXMA 4JI5I 3ADGA 4LFBI 1WUUA 4HACA 2HKJA 4JI1E 5IWAE 4I3HA 1N36I 3LLHA 4HYMA 4DR4E 5A2QC 2V34A 2RS6A 1H73A 3Q1QA 4AQYE 4LF5E 2HHHI 4MYUA 1ZM9A 2UXCE 2DMYA 2ZBKB 3T1HI 1STUA 2DB2A 4LF8E 3ZKBA 1RQ0A 3LTOA 1XNRE 1B63A 2B7TA 1XNQE 5A2QQ 4JG4A 5IWAI 1KKHA 4LF4I 2UUCE 1ZM2A 3GONA 3ZM7A 4JI4E 4JYAE 4JI2E 4DPWA 1YYKA 1J5EI 1I94I 1XHKA 4JI1I 3T1YI 1NHIA 3PYEA 4X66I 4NXMI 1DI2A 3ADLA 1Z59A 5BR8E 5LMUI 2A2CA 1YZ9A 1EI1A 2JVAA 4OOGC 1H7UA 1PIEA 4MYTA 3J81C 4XTJA 1HNXI 3T1YE 4LF9E 4B3SE 1RREA 2KHXA 4LF7E 2X36A 4B3RI 3ZKDA 4X8WA 4PRVA 1S16A 3ZZUA 1N34I 1T4NA 2CPNA 4B3TE 4X64I 4DR5E 4ZVIA 5FLXQ 2UXBI 2L3CA 1XNRI 3V2UC 4DV4I 4JV5E 4EMDA 1FWLA 5GMEA 4DV5E 1VISA 4JI0E 4DV1I 3J80C 2NUFA 1IBKE 4PU9A 2LBSB 2V2ZA 4DV0I 2HK3A 1UHZA 4DXLA 4M30A 1PVGA 3C4BA 2LJPA 4OX9E 1FI4A 1A6FA 1ELOA 4DPTA 2VQEI 3J7Yp 2WW4A 4YHHI 1I94E 4LFBE 3QT7A 1D6TA 2UUAI 1PKPA 3D4JA 2E5LE 2B7VA 2UUCI 1FKAE 4YY3E 1Z5AA 1N0VC 2NUEA 4UTGA 2V2VA 3HULA 2UXBE 1ZBTA 4JI0I 4DV6I 1HR0I 1S4EA 1Z0EA 4DV7I 4URLA 4JV5I 1Z0TA 2V2QA 1J26A 4KHPE 2HFSA 2BV3A 4UT4A 3B78A 2HFUA 4FN5A 4HY1A 4NXNE 1XMOI 1IBLI 4DUZE 1Z0BA 5L3JA 2A2DA 5IT9C 2RSMA 1RC7A 4DPXA 4DR2I 4X65E 2R3VA 1ZXNA 4DUYE 3P1XA 1KTVA 1RR9A 2UXDE 2ZM6E 1N33I 4X62E 4USMA 2IHR1 4FW9A 4LF6E 2UUAE 4JI4I 3WU6A 4NXME 1XMQI 4DPUA 4WFTA 3F0NA 4WUBA 5LMNI 2L2NA 4OX9I 1J5EE 4DU8A 1FNMA 1EA6A 1ZM4A 1Z0GA 4LFCE 2LUQA 1NHHA 4R1FA 4LF4E 1X49A 1DARA 3T1HE 2X7IA 2R42A 3ZZTA 3QT8A 2RS7A 4DV4E 3JAMQ 4DUYI 2NA2A 4X65I 1H74A 2CZ9A 4HXZA 3OTOI 1EKZA 4Z7YA 2RTXA 3J7AM 2NPFA 4WYQB 3HTXA 1X47A 4P7AA 2L2KB 4JI5E 1XMOE 1T4LB 1HNZE 1MG7A 4DR4I 1WHQA 3VYXA 4WUDA 4DR3E 4KHPI 4B3RE 1N32E 3WU4A 4LF7I 1MX0A 4B3SI 2DIXA 4B3MI 1HNXE 3B8HA 4DKKA 4DV7E
chains in the Genus database with same CATH superfamily
4BMJA 4DV2E 1NZ0A 1R6LA 4DR6I 2PO1A 4KQVA 4LFAI 1HK7A 1Y4UA 3C4TA 1EH7A 2EJ4A 5LMUE 2GS8A 4GQUA 1HNWE 4GKKI 1QU6A 1UDQA 4Q28A 3ZOQB 1A1JA 1BBOA 3QT5A 4JI7I 2YU5A 2N3HA 4X66E 4FWHA 4BC7A 1FJGE 2EM6A 3PYDA 2BA0G 2L3JA 4MU3A 2JEBB 2EN6A 2UUBE 2EE8A 5K36F 4GEQB 2YTDA 1U2RA 4WPYA 1TF6A 4DR7E 2GPIA 2F4VI 3WU3A 2GQ0A 4DR1E 5KL7A 3P76A 2EPPA 1N0UA 5K36C 4JI2I 5EKWA 4IFDD 4JYAI 2YSOA 2VQFI 1XMQE 3K17A 2YU8A 1B62A 4LFCI 2E5LI 3HPSA 2AJ4A 1GZ6A 2B3TB 4O4KA 2L2MA 2WNRB 2JOXA 4FW6A 1NHJA 2WBSA 1Z0WA 4X62I 2MDRA 2F4VE 1X5WA 1WJPA 2UXDI 1Z5BA 3PS3A 2WCC3 2DEJA 1XNQI 5A6BA 5ADZA 1A1IA 4DPUA 4OO1D 2LT7A 1KIJA 3U1KA 4JI3E 1H72C 1G2DC 2EMBA 3HXLA 1BBGA 1HNWI 3ADIA 2LTRA 3U1YA 2NN6B 4BBYA 4DV3E 2LRSA 2BA0D 2HHHE 4WXDA 4OO1A 4DU7A 1IBKI 4O43A 1RMDA 3M99B 2EN3A 3EPLA 4DUZI 5TSEA 1YYOA 1P47A 4AQYI 2XEXA 3ZZ0A 1UEKA 1T4OA 2LCEA 4GKJE 2ZITA 3M6AA 1IQOA 2I9IA 1N36E 2RQLA 4DR3I 4OO1E 5KL5A 4JI3I 2JP9A 2GO4A 2EL4A 1BKNA 1X6EA 4MU4A 3J81Q 1HNZI 4RH8A 4M2ZA 4O5GA 2DEIA 5JEAE 2LV2A 4FWDA 4P78A 5A6BD 4DR5I 2EPOA 3M7ND 2PO0A 3J7AG 4JI6E 1HR0E 2NUGA 2BM0A 2ELYA 1IBME 2J7KA 2HK2A 4BA1A 4Z7CA 1UILA 2ODRD 5A6JA 1H7SA 1Z0VA 2CTDA 4BC9A 4F2JC 3PYGA 2JEAA 3LNUA 3EPKA 4IJDA 1PDAA 3F6GA 3QT6A 2YPNA 2EMIA 5AASA 4U3BA 2EOIA 2J65A 5C0XA 1OJ4A 4R2AA 2VF3A 4FWGA 3P3GA 3VYYA 5FLXC 2N3GA 2MKNA 1GQEA 4GKKE 5DNLA 2JE6B 4F9BB 2EQ1A 4N4RB 4JI6I 2V83A 3ADJA 4K0KE 2LUPB 1X48A 2JOBA 2DRPA 4YHHE 1F2IG 1ZBQA 4ED4A 2YRKA 2H36X 2MC6A 2OI2A 4BA1B 3THNA 4MQYA 2K4VA 4R2QA 4NHRA 1KVKA 4NZVA 2AE8A 5IT9Q 1JK1A 1Z0CA 2BR2B 3PYFA 2UU9I 2EZ6A 1QZRA 3HJCA 4DV0E 4R2RA 3ECRA 1N33E 2ZM6I 4JI8E 3V5RA 2NABA 1A1KA 4RPFA 4WSPA 1Y4SA 2EMWA 4M1KA 3WU5A 4ZYGA 2VQEE 2HKEA 4DR2E 2C37A 2NN6D 2VESA 2C37B 1MU5A 3B82A 1P42A 1WHNA 3JAMC 2E1RA 3NZKA 2HC5A 3OTOE 4GKJI 2EN4A 4IZJD 5JEAD 4DPYA 3BBGA 2BM1A 4R2SA 2HJJA 2LJUA 4LF8I 3J80Q 4OO1B 2YT4A 3EQ1A 4USKA 4DV3I 2F1DA 4JI8I 4KZSA 1IBLE 2NN6A 4F9AB 4WSGA 4DV1E 4X64E 5FWKA 3IWCA 2Z5EA 4DV5I 4B3TI 2UU9E 4OO1C 4NXNI 2EPRA 2EM4A 4MU1A 2LJHA 2EOJA 1FWKA 2JXPA 1N34E 3LPSA 5LL6R 3VK6A 2NN6E 2O1UA 4GZNC 2EFGA 5KL6A 3CDIA 2DMIA 4R2CA 1K47A 4DR1I 5DRPA 2Z5BB 5ELWA 1QNTA 1OYSA 3K1JA 2L33A 1AH5A 1EH6A 5LMNE 4K0KI 1FJGI 2JE6A 4DV6E 4P52A 2VRDA 3HQ1A 4J8ZA 4HACB 2L8TA 2ENCA 5GMDA 2VQFE 4LF6I 3BGHA 1ZM3A 2V8PA 2JY9A 5AC4A 3H4LA 4WUCA 5CFFE 4DR7I 5BR8I 1Z5CA 1YYWA 4DR6E 2FTXB 4F6MA 1MGTA 2EM7A 2Q2EB 4DV2I 2UUBI 1SR9A 2LTSA 3DJWA 2CVEA 1YUIA 4LF9I 3L7ZA 4R2PA 1E3HA 1O0WA 2YRMA 4JI7E 3P06A 4YY3I 3RMPA 4B3ME 4M9VC 1A1LA 5C0XD 1N32I 1IBMI 2PNZA 4IFDA 2O3ZA 3FIGA 4WX9A 2EPAA 3IWDA 2GO3A 4LOMA 4LFAE 2PO0B 3CWVA 2YTIA 4O24A 4PRXA 1ZXMA 3QG5C 4JI5I 1A1FA 3ADGA 4LFBI 2EQ0A 3KZYA 2WP8B 2EOHA 2EPLX 1WUUA 2HKJA 4HACA 2EPMX 4OZEA 4JI1E 2HGHA 2C38A 1GTKA 3MSWA 5IWAE 1NCSA 5DRRA 4I3HA 4J3DA 1DQ3A 2L92A 3EPJA 1YHCA 1N36I 3LLHA 5AE1A 5DNXA 5C0XE 4HYMA 4DR4E 5A2QC 5DRQA 1YSAC 3C6MA 2V34A 2RS6A 1H73A 2VF1A 1ZU1A 3Q1QA 2Z5CB 4AQYE 4BHBA 4LF5E 2HHHI 2MKDA 4P7DA 3PS2A 1ZR9A 4MYUA 1OYRA 1YUJA 2EPCA 4QNJA 1ZM9A 2UXCE 2DMYA 2JWOA 2ODRC 1STUA 2ZBKB 3T1HI 5LLQA 2DB2A 2ELZA 3C6KA 4LF8E 4FW3A 3ZKBA 4LF5I 1RQ0A 1JK2A 4FW7A 3LTOA 1XNRE 1B63A 4BA2A 2EM2A 2B7TA 2LVHA 5EL9A 1XNQE 2CGEA 5DROA 2NN6F 4RHBB 3MHHC 5A2QQ 4JG4A 5IWAI 1A1HA 2NN6C 1KKHA 4LF4I 2DGCA 2UUCE 2DLQA 4N3OA 4BCAA 2EMGA 1ZM2A 2ENAA 1UBDC 5A6KA 3GONA 2EOSA 3ZM7A 4JI4E 3P3CA 4JYAE 2EMHA 2EPUA 4BHCA 3F6HA 2GLIA 4JI2E 1UDNA 4DPWA 1YFHA 1YYKA 2EOXA 1J5EI 1I94I 1XHKA 1SFEA 2RPCA 1UDOA 4JI1I 2V88A 3T1YI 1NHIA 3PYEA 4X66I 4NXMI 2YTJA 1DI2A 1KJKA 3P3EA 3ADLA 1Z59A 2B9DA 5BR8E 1NEIA 2EN8A 5LMUI 2A2CA 1YZ9A 1EI1A 5K36B 2JVAA 4OOGC 2JT2A 1H7UA 2DLKA 3J81C 1PIEA 4MYTA 2EM9A 2Q8UA 4TUIA 2EPZA 2M4IA 4XTJA 2EMYA 3T1YE 4F54A 4LF9E 1HNXI 2IOPA 4B3SE 4M0VA 1RREA 2KHXA 4LF7E 1N3GA 2O1WA 2X36A 1USVA 2V86A 4BS9A 4B3RI 5A69A 4LCGA 4WXCA 4IFDF 3ZKDA 3THOB 2Z5BA 4X8WA 1IQSA 5AE2A 4PRVA 3AUZA 2PO2A 5JEAF 2UXCI 1S16A 3ZZUA 2WP8A 5C0XF 1N34I 4IZKA 4ZYDA 2YZTA 1KYQA 1T4NA 3H1CA 5C0XC 2CPNA 1TF3A 3OMLA 4B3TE 5A6AA 3HKMA 4DR5E 4ZVIA 4HTGA 4X64I 2PO1B 2M7QA 1UDSA 2WBUA 5FLXQ 2EORA 2BA1D 2UXBI 2WNRA 3JTZA 2C39B 2L3CA 2JR1A 1XNRI 3GCMA 1B69A 3V2UC 4DV4I 4R03A 4JV5E 2EL6A 4AM3A 2EOFA 2WBTA 4U3DA 4EMDA 1FWLA 5GMEA 2YTFA 4DV5E 1VISA 4JI0E 4DV1I 3J80C 4IZJB 2EPNA 3BF2A 2NUFA 1IBKE 2M9AA 4PU9A 2LBSB 3CDJA 3HPZA 2EM5A 1YPNA 2V2ZA 4BA2B 4DV0I 3K6QA 2HK3A 1UHZA 4DXLA 4M30A 1PVGA 3C4BA 2LJPA 3K85A 5JEAC 2FV4B 4OX9E 1FI4A 3MHSC 1A6FA 1ELOA 4OO1F 2DSYA 2E72A 4DPTA 2VQEI 2BR2A 1USUA 3J7Yp 4R2DA 2LE2A 5JEAA 2YTOA 1EH8A 2LMZA 2WW4A 2PNZB 1I94E 4LFBE 3QT7A 2D9HA 4YHHI 1D6TA 3Q6NA 2UUAI 1PKPA 3VHTB 4L5NC 1VI7A 3PS1A 5AE3A 4MLQA 4F9CB 4ZYHA 3D4JA 2E5LE 3KWRA 4FW5A 3LMLA 2B7VA 2UUCI 1FKAE 4YY3E 5AC5A 2C38B 2YWQA 1Z5AA 4IS1C 1N0VC 4MU0A 5K36D 4ISAA 2K7IA 2O1TA 2NUEA 4ZYEA 2EN1A 5T6JA 4UTGA 2V2VA 2MC5A 5IXMB 3HULA 2G7HA 2VE7C 2F8BA 1MEYC 2UXBE 1UN6B 2V85A 1PJTA 2YTEA 4IS9A 4QNKA 3JU0A 4IFDE 4IFDC 5K36A 1ZBTA 2EOQA 4JI0I 4DV6I 1Z1BA 1HR0I 2EN2A 1S4EA 2CT1A 3TQMA 2C39A 2YTPA 1Z0EA 4DV7I 4URLA 4JV5I 3Q6MA 5K36E 2EN7A 1Z0TA 2V2QA 2EPXA 1A1GA 5KL4A 2EWLA 5JEAB 3M85G 1J26A 4R2EA 4KHPE 2BBGA 2HFSA 3L00A 2BV3A 2EMAA 4UT4A 2BB8A 2IESA 2EOZA 4KWYA 2HFUA 4NXNE 3B78A 4FN5A 4HY1A 1XMOI 2EM0A 1Y5YA 2EOOA 1IBLI 1PJQA 4DUZE 1BB8A 4OKGA 1T38A 1X3CA 3GMEA 2ENHA 1Z0BA 2MDGA 3H09A 5DNYA 1TN9A 5L3JA 2A2DA 2LO3A 2JEAB 5IT9C 2IOQA 1Y60A 4F6NA 4LTYA 4I8OA 4LCFA 2FGGA 2R76A 2RSMA 3BIDA 1RC7A 3KRNA 2BA1G 3M85D 5F3WA 4DPXA 4X65E 1YH8A 3DD6A 4DR2I 2R3VA 2R1FA 1ZXNA 4DUYE 4FW4A 3P1XA 2O1VA 5KL2A 1KTVA 1RR9A 1DGCA 1E3PA 4AIDA 4IFDB 2PRTA 2UXDE 1XXEA 2ZM6E 1LLMC 1N33I 2EPKX 2A25A 2YTNA 4X62E 4TUGA 4IZKB 4USMA 2IHR1 2IERA 4FW9A 3DF6A 4LF6E 2UUAE 4JI4I 2V8QB 1AAYA 4Q35B 3WU6A 2EMCA 4NXME 2YSPA 4MLVA 4MDTA 1XMQI 2EP3A 2L6MA 4WFTA 2EM3A 3EPHA 3F0NA 2I13A 2J7JA 1PJSA 4WUBA 1L4SA 5LMNI 2L2NA 4DMIA 1WRJA 4LCHA 3UK3C 4OX9I 2EOEA 1J5EE 4DU8A 1G2FC 1FNMA 1IMUA 3GLLA 2EOMA 2JPAA 1EA6A 3AV0A 4X9JA 2EMXA 1X6FA 5IV8B 1ZM4A 1Z0GA 2EQ3A 2ADRA 4LFCE 2LUQA 1NHHA 2N8XA 4R1FA 2EOYA 4LF4E 1X49A 1DARA 2EMLA 3T1HE 1ZAAC 3IWBA 2CG9A 2R42A 1R6MA 2X7IA 4LPFA 3ZZTA 3QT8A 2JYAA 2YRHA 2RS7A 1RHYA 3B4TA 4DV4E 3JAMQ 4DUYI 3L7ZB 2NA2A 2EM8A 2PNMA 4X65I 1H74A 2CZ9A 4HXZA 3OTOI 1EKZA 2EL5A 2CSHA 3KZZA 5KL3A 2PNLA 1X6HA 2RTXA 4Z7YA 3J7AM 2NPFA 2E1MA 4WYQB 2Z5CA 3M7NG 2M1SA 1T39A 3HTXA 2PO2B 1X47A 4AIMA 2RSIA 2YTGA 2KONA 4IZJA 4P7AA 2L2KB 4JI5E 1WXRA 2KOUA 2GHFA 1XMOE 1T4LB 1HNZE 1MG7A 4NBQA 2EMFA 4DR4I 1WHQA 3VYXA 2EMZA 3UHMA 4WUDA 1OYPA 4DR3E 4KHPI 4B3RE 2V87A 4L8NA 1N32E 2JEBA 2V89A 2WZOA 3PRYA 1MX0A 3WU4A 4B3SI 2DIXA 4R8OA 4B3MI 4LF7I 2EMKA 2YTQA 1HNXE 5C0XB 3B8HA 4DKKA 1Y6ZA 4LU9A 4FK5C 4DV7E 4HEIA
chains in the Genus database with same CATH topology
4BMJA 4DV2E 1NZ0A 4DR6I 4KQVA 4LFAI 1HK7A 1Y4UA 3C4TA 5LMUE 2GS8A 1HNWE 4GKKI 1QU6A 4Q28A 3ZOQB 3QT5A 4JI7I 4X66E 2N3HA 4FWHA 4BC7A 1FJGE 3PYDA 2L3JA 2UUBE 4GEQB 1U2RA 4WPYA 2F4VI 4DR7E 3WU3A 2GQ0A 4DR1E 1N0UA 4JI2I 4JYAI 2VQFI 1XMQE 3K17A 4LFCI 1B62A 2E5LI 3HPSA 2AJ4A 1GZ6A 2B3TB 2L2MA 2JOXA 1NHJA 1Z0WA 4X62I 2MDRA 2F4VE 2UXDI 1Z5BA 1XNQI 2DEJA 5ADZA 1KIJA 4JI3E 1H72C 3HXLA 1HNWI 3ADIA 2LTRA 4BBYA 4DV3E 2LRSA 2HHHE 1IBKI 4LF5I 4DU7A 4DUZI 4AQYI 1YYOA 2XEXA 3ZZ0A 1UEKA 1T4OA 2ZITA 4GKJE 3M6AA 1N36E 4DR3I 4JI3I 1BKNA 1HNZI 3J81Q 4M2ZA 2DEIA 4FWDA 4P78A 4DR5I 3J7AG 4JI6E 1HR0E 2NUGA 2BM0A 1IBME 2J7KA 2HK2A 4Z7CA 1UILA 2ODRD 1H7SA 1Z0VA 3PYGA 4BC9A 3LNUA 3F6GA 3QT6A 5AASA 1OJ4A 4FWGA 2VF3A 3VYYA 5FLXC 2N3GA 1GQEA 4GKKE 4F9BB 4JI6I 4K0KE 2V83A 3ADJA 2LUPB 1X48A 2JOBA 4YHHE 4ED4A 1ZBQA 2H36X 2MC6A 2OI2A 2K4VA 1KVKA 5IT9Q 1Z0CA 3PYFA 2UU9I 2EZ6A 1QZRA 3HJCA 4DV0E 1N33E 2ZM6I 4JI8E 3V5RA 4RPFA 4WSPA 1Y4SA 4M1KA 3WU5A 2VQEE 2HKEA 4DR2E 1MU5A 3B82A 1WHNA 3JAMC 2E1RA 4GKJI 3OTOE 4IZJD 4DPYA 2BM1A 4LF8I 3J80Q 2YT4A 4USKA 4DV3I 4JI8I 2UXCI 4KZSA 1IBLE 4F9AB 4DV1E 4X64E 5FWKA 3IWCA 2Z5EA 4DV5I 4B3TI 2UU9E 4NXNI 2LJHA 1FWKA 1N34E 3LPSA 5LL6R 3VK6A 2O1UA 2EFGA 1K47A 4DR1I 2Z5BB 3K1JA 2L33A 5LMNE 4K0KI 1FJGI 4DV6E 4P52A 3HQ1A 4J8ZA 4HACB 2L8TA 5GMDA 2VQFE 4LF6I 1ZM3A 2V8PA 2JY9A 3H4LA 4WUCA 5CFFE 4DR7I 5BR8I 1Z5CA 1YYWA 4DR6E 2FTXB 2Q2EB 4DV2I 2UUBI 1SR9A 2LTSA 3DJWA 4LF9I 1O0WA 3P06A 4JI7E 4YY3I 3RMPA 4B3ME 1N32I 1IBMI 3FIGA 3IWDA 4LFAE 3CWVA 4PRXA 1ZXMA 4JI5I 3ADGA 4LFBI 1WUUA 4HACA 2HKJA 4JI1E 3MSWA 5IWAE 4I3HA 1DQ3A 2L92A 1N36I 3LLHA 5AE1A 4HYMA 4DR4E 5A2QC 2V34A 2RS6A 1H73A 2VF1A 3Q1QA 2Z5CB 4AQYE 4LF5E 2HHHI 4P7DA 4MYUA 1ZM9A 2UXCE 2DMYA 2JWOA 2ODRC 1STUA 2ZBKB 3T1HI 2DB2A 4LF8E 3ZKBA 1RQ0A 3LTOA 1XNRE 1B63A 2B7TA 1XNQE 2CGEA 5A2QQ 4JG4A 5IWAI 1KKHA 4LF4I 2UUCE 4N3OA 4BCAA 1ZM2A 3GONA 3ZM7A 4JI4E 4JYAE 4JI2E 3F6HA 4DPWA 1YYKA 1J5EI 1I94I 1XHKA 4JI1I 2V88A 3T1YI 1NHIA 3PYEA 4X66I 4NXMI 1DI2A 3ADLA 1Z59A 2B9DA 5BR8E 5LMUI 2A2CA 1YZ9A 1EI1A 2JVAA 4OOGC 1H7UA 3J81C 1PIEA 4MYTA 4TUIA 2M4IA 4XTJA 1HNXI 3T1YE 4F54A 4LF9E 2IOPA 4B3SE 4M0VA 1RREA 2KHXA 4LF7E 2O1WA 2X36A 1USVA 2V86A 4BS9A 4B3RI 3ZKDA 2Z5BA 4X8WA 4PRVA 5AE2A 3AUZA 1S16A 3ZZUA 1N34I 4IZKA 2YZTA 1T4NA 2CPNA 3OMLA 4B3TE 4X64I 4DR5E 4ZVIA 2M7QA 5FLXQ 2UXBI 3JTZA 2L3CA 2JR1A 1XNRI 3V2UC 4DV4I 4R03A 4JV5E 4EMDA 1FWLA 5GMEA 4DV5E 1VISA 4JI0E 4DV1I 3J80C 4IZJB 2NUFA 1IBKE 4PU9A 2LBSB 3HPZA 2V2ZA 4DV0I 3K6QA 2HK3A 1UHZA 4DXLA 4M30A 1PVGA 3C4BA 2LJPA 3K85A 2FV4B 4OX9E 1FI4A 1A6FA 1ELOA 2DSYA 4DPTA 2VQEI 1USUA 3J7Yp 2LE2A 2WW4A 2LMZA 4YHHI 1I94E 4LFBE 3QT7A 1D6TA 3Q6NA 2UUAI 1PKPA 4L5NC 5AE3A 4F9CB 3D4JA 2E5LE 3KWRA 3LMLA 2B7VA 2UUCI 1FKAE 4YY3E 1Z5AA 1N0VC 2O1TA 2NUEA 5T6JA 4UTGA 2V2VA 2MC5A 3HULA 2G7HA 2VE7C 2F8BA 2UXBE 2V85A 3JU0A 1ZBTA 4JI0I 4DV6I 1HR0I 1S4EA 1Z0EA 4DV7I 4URLA 4JV5I 3Q6MA 1Z0TA 2V2QA 2EWLA 1J26A 4KHPE 2HFSA 2BV3A 4UT4A 3B78A 2HFUA 4FN5A 4HY1A 4NXNE 1XMOI 1IBLI 4DUZE 1Z0BA 3H09A 5DNYA 5L3JA 2A2DA 5IT9C 2IOQA 4LTYA 4I8OA 2FGGA 2RSMA 1RC7A 5F3WA 4DPXA 4X65E 4DR2I 2R3VA 1ZXNA 4DUYE 3P1XA 2O1VA 1KTVA 1RR9A 2UXDE 2ZM6E 1N33I 4TUGA 4X62E 4USMA 4IZKB 2IHR1 4FW9A 3DF6A 4LF6E 2UUAE 4JI4I 2V8QB 3WU6A 4NXME 1XMQI 4DPUA 2L6MA 4WFTA 3F0NA 4WUBA 5LMNI 2L2NA 4DMIA 4OX9I 1J5EE 4DU8A 1FNMA 1EA6A 3AV0A 1ZM4A 1Z0GA 4LFCE 2LUQA 1NHHA 4R1FA 4LF4E 1X49A 1DARA 3T1HE 2X7IA 3IWBA 2CG9A 2R42A 3ZZTA 3QT8A 2RS7A 4DV4E 3JAMQ 4DUYI 2NA2A 2PNMA 4X65I 1H74A 2CZ9A 4HXZA 3OTOI 1EKZA 2PNLA 4Z7YA 2RTXA 3J7AM 2NPFA 2E1MA 4WYQB 2Z5CA 2M1SA 3HTXA 1X47A 2KONA 4IZJA 4P7AA 4JI5E 2L2KB 1WXRA 2KOUA 1XMOE 1T4LB 1MG7A 1HNZE 4DR4I 1WHQA 3VYXA 4WUDA 4DR3E 4KHPI 4B3RE 2V87A 4L8NA 1N32E 2V89A 2WZOA 3PRYA 1MX0A 3WU4A 4B3SI 2DIXA 4R8OA 4B3MI 4LF7I 1HNXE 3B8HA 4DKKA 1Y6ZA 4LU9A 4DV7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 E;  1NZ0 A;  4DR6 I;  4KQV A;  4LFA I;  3C4T A;  5LMU E;  2GS8 A;  1HNW E;  4GKK I;  1QU6 A;  3QT5 A;  4JI7 I;  4X66 E;  2N3H A;  4FWH A;  1FJG E;  3PYD A;  2L3J A;  2UUB E;  1U2R A;  2F4V I;  4DR7 E;  3WU3 A;  4DR1 E;  1N0U A;  4JI2 I;  4JYA I;  2VQF I;  1XMQ E;  3K17 A;  4LFC I;  1B62 A;  2E5L I;  2AJ4 A;  2B3T B;  2L2M A;  1NHJ A;  1Z0W A;  4X62 I;  2MDR A;  2F4V E;  2UXD I;  1Z5B A;  1XNQ I;  2DEJ A;  1KIJ A;  4JI3 E;  1H72 C;  1HNW I;  3ADI A;  2LTR A;  4DV3 E;  2LRS A;  2HHH E;  1IBK I;  4LF5 I;  4DU7 A;  4DUZ I;  4AQY I;  1YYO A;  2XEX A;  3ZZ0 A;  1UEK A;  1T4O A;  2ZIT A;  4GKJ E;  3M6A A;  1N36 E;  4DR3 I;  4JI3 I;  1BKN A;  1HNZ I;  3J81 Q;  4M2Z A;  2DEI A;  4FWD A;  4DR5 I;  3J7A G;  4JI6 E;  1HR0 E;  2NUG A;  2BM0 A;  1IBM E;  2J7K A;  2HK2 A;  4Z7C A;  1UIL A;  1H7S A;  1Z0V A;  3PYG A;  3LNU A;  3QT6 A;  1OJ4 A;  4FWG A;  2VF3 A;  3VYY A;  5FLX C;  2N3G A;  1GQE A;  4GKK E;  4JI6 I;  3ADJ A;  4K0K E;  2LUP B;  1X48 A;  4YHH E;  4ED4 A;  2OI2 A;  1KVK A;  5IT9 Q;  1Z0C A;  3PYF A;  2UU9 I;  2EZ6 A;  1QZR A;  4DV0 E;  1N33 E;  2ZM6 I;  4JI8 E;  3V5R A;  4RPF A;  4M1K A;  3WU5 A;  2VQE E;  2HKE A;  4DR2 E;  1MU5 A;  3B82 A;  1WHN A;  2E1R A;  3JAM C;  4GKJ I;  3OTO E;  4DPY A;  2BM1 A;  4LF8 I;  3J80 Q;  2YT4 A;  4USK A;  4DV3 I;  4JI8 I;  2UXC I;  1IBL E;  4DV1 E;  4X64 E;  4B3T I;  4DV5 I;  2UU9 E;  4NXN I;  2LJH A;  1FWK A;  1N34 E;  3LPS A;  5LL6 R;  2EFG A;  1K47 A;  4DR1 I;  3K1J A;  2L33 A;  5LMN E;  4K0K I;  1FJG I;  4DV6 E;  4P52 A;  4HAC B;  5GMD A;  2VQF E;  4LF6 I;  1ZM3 A;  2V8P A;  2JY9 A;  3H4L A;  4WUC A;  5CFF E;  4DR7 I;  5BR8 I;  1Z5C A;  1YYW A;  4DR6 E;  2Q2E B;  4DV2 I;  2UUB I;  2LTS A;  4LF9 I;  1O0W A;  4YY3 I;  4JI7 E;  4B3M E;  1N32 I;  1IBM I;  4LFA E;  3CWV A;  4PRX A;  1ZXM A;  4JI5 I;  3ADG A;  4LFB I;  1WUU A;  4HAC A;  2HKJ A;  4JI1 E;  5IWA E;  4I3H A;  1N36 I;  3LLH A;  4HYM A;  4DR4 E;  5A2Q C;  2V34 A;  2RS6 A;  1H73 A;  3Q1Q A;  4AQY E;  4LF5 E;  2HHH I;  4MYU A;  1ZM9 A;  2UXC E;  2DMY A;  2ZBK B;  3T1H I;  1STU A;  2DB2 A;  4LF8 E;  3ZKB A;  1RQ0 A;  3LTO A;  1XNR E;  1B63 A;  2B7T A;  1XNQ E;  5A2Q Q;  4JG4 A;  5IWA I;  1KKH A;  4LF4 I;  2UUC E;  1ZM2 A;  3GON A;  3ZM7 A;  4JI4 E;  4JYA E;  4JI2 E;  4DPW A;  1YYK A;  1J5E I;  1I94 I;  1XHK A;  4JI1 I;  3T1Y I;  1NHI A;  3PYE A;  4X66 I;  4NXM I;  1DI2 A;  3ADL A;  1Z59 A;  5BR8 E;  5LMU I;  2A2C A;  1YZ9 A;  1EI1 A;  2JVA A;  4OOG C;  1H7U A;  1PIE A;  4MYT A;  3J81 C;  4XTJ A;  1HNX I;  3T1Y E;  4LF9 E;  4B3S E;  1RRE A;  2KHX A;  4LF7 E;  2X36 A;  4B3R I;  3ZKD A;  4X8W A;  4PRV A;  1S16 A;  3ZZU A;  1N34 I;  1T4N A;  2CPN A;  4B3T E;  4X64 I;  4DR5 E;  4ZVI A;  5FLX Q;  2UXB I;  2L3C A;  1XNR I;  3V2U C;  4DV4 I;  4JV5 E;  4EMD A;  1FWL A;  5GME A;  4DV5 E;  1VIS A;  4JI0 E;  4DV1 I;  3J80 C;  2NUF A;  1IBK E;  4PU9 A;  2LBS B;  2V2Z A;  4DV0 I;  2HK3 A;  1UHZ A;  4DXL A;  4M30 A;  1PVG A;  3C4B A;  2LJP A;  4OX9 E;  1FI4 A;  1A6F A;  1ELO A;  4DPT A;  2VQE I;  3J7Y p;  2WW4 A;  4YHH I;  1I94 E;  4LFB E;  3QT7 A;  1D6T A;  2UUA I;  1PKP A;  3D4J A;  2E5L E;  2B7V A;  2UUC I;  1FKA E;  4YY3 E;  1Z5A A;  1N0V C;  2NUE A;  4UTG A;  2V2V A;  3HUL A;  2UXB E;  1ZBT A;  4JI0 I;  4DV6 I;  1HR0 I;  1S4E A;  1Z0E A;  4DV7 I;  4URL A;  4JV5 I;  1Z0T A;  2V2Q A;  1J26 A;  4KHP E;  2HFS A;  2BV3 A;  4UT4 A;  3B78 A;  2HFU A;  4FN5 A;  4HY1 A;  4NXN E;  1XMO I;  1IBL I;  4DUZ E;  1Z0B A;  5L3J A;  2A2D A;  5IT9 C;  2RSM A;  1RC7 A;  4DPX A;  4DR2 I;  4X65 E;  2R3V A;  1ZXN A;  4DUY E;  3P1X A;  1KTV A;  1RR9 A;  2UXD E;  2ZM6 E;  1N33 I;  4X62 E;  4USM A;  2IHR 1;  4FW9 A;  4LF6 E;  2UUA E;  4JI4 I;  3WU6 A;  4NXM E;  1XMQ I;  4DPU A;  4WFT A;  3F0N A;  4WUB A;  5LMN I;  2L2N A;  4OX9 I;  1J5E E;  4DU8 A;  1FNM A;  1EA6 A;  1ZM4 A;  1Z0G A;  4LFC E;  2LUQ A;  1NHH A;  4R1F A;  4LF4 E;  1X49 A;  1DAR A;  3T1H E;  2X7I A;  2R42 A;  3ZZT A;  3QT8 A;  2RS7 A;  4DV4 E;  3JAM Q;  4DUY I;  2NA2 A;  4X65 I;  1H74 A;  2CZ9 A;  4HXZ A;  3OTO I;  1EKZ A;  4Z7Y A;  2RTX A;  3J7A M;  2NPF A;  4WYQ B;  3HTX A;  1X47 A;  4P7A A;  2L2K B;  4JI5 E;  1XMO E;  1T4L B;  1HNZ E;  1MG7 A;  4DR4 I;  1WHQ A;  3VYX A;  4WUD A;  4DR3 E;  4KHP I;  4B3R E;  1N32 E;  3WU4 A;  4LF7 I;  1MX0 A;  4B3S I;  2DIX A;  4B3M I;  1HNX E;  3B8H A;  4DKK A;  4DV7 E; 
#chains in the Genus database with same CATH topology
 4BMJ A;  4DV2 E;  1NZ0 A;  1R6L A;  4DR6 I;  2PO1 A;  4KQV A;  4LFA I;  1HK7 A;  1Y4U A;  3C4T A;  1EH7 A;  2EJ4 A;  5LMU E;  2GS8 A;  4GQU A;  1HNW E;  4GKK I;  1QU6 A;  1UDQ A;  4Q28 A;  3ZOQ B;  1A1J A;  1BBO A;  3QT5 A;  4JI7 I;  2YU5 A;  2N3H A;  4X66 E;  4FWH A;  4BC7 A;  1FJG E;  2EM6 A;  3PYD A;  2BA0 G;  2L3J A;  4MU3 A;  2JEB B;  2EN6 A;  2UUB E;  2EE8 A;  5K36 F;  4GEQ B;  2YTD A;  1U2R A;  4WPY A;  1TF6 A;  4DR7 E;  2GPI A;  2F4V I;  3WU3 A;  2GQ0 A;  4DR1 E;  5KL7 A;  3P76 A;  2EPP A;  1N0U A;  5K36 C;  4JI2 I;  5EKW A;  4IFD D;  4JYA I;  2YSO A;  2VQF I;  1XMQ E;  3K17 A;  2YU8 A;  1B62 A;  4LFC I;  2E5L I;  3HPS A;  2AJ4 A;  1GZ6 A;  2B3T B;  4O4K A;  2L2M A;  2WNR B;  2JOX A;  4FW6 A;  1NHJ A;  2WBS A;  1Z0W A;  4X62 I;  2MDR A;  2F4V E;  1X5W A;  1WJP A;  2UXD I;  1Z5B A;  3PS3 A;  2WCC 3;  2DEJ A;  1XNQ I;  5A6B A;  5ADZ A;  1A1I A;  4DPU A;  4OO1 D;  2LT7 A;  1KIJ A;  3U1K A;  4JI3 E;  1H72 C;  1G2D C;  2EMB A;  3HXL A;  1BBG A;  1HNW I;  3ADI A;  2LTR A;  3U1Y A;  2NN6 B;  4BBY A;  4DV3 E;  2LRS A;  2BA0 D;  2HHH E;  4WXD A;  4OO1 A;  4DU7 A;  1IBK I;  4O43 A;  1RMD A;  3M99 B;  2EN3 A;  3EPL A;  4DUZ I;  5TSE A;  1YYO A;  1P47 A;  4AQY I;  2XEX A;  3ZZ0 A;  1UEK A;  1T4O A;  2LCE A;  4GKJ E;  2ZIT A;  3M6A A;  1IQO A;  2I9I A;  1N36 E;  2RQL A;  4DR3 I;  4OO1 E;  5KL5 A;  4JI3 I;  2JP9 A;  2GO4 A;  2EL4 A;  1BKN A;  1X6E A;  4MU4 A;  3J81 Q;  1HNZ I;  4RH8 A;  4M2Z A;  4O5G A;  2DEI A;  5JEA E;  2LV2 A;  4FWD A;  4P78 A;  5A6B D;  4DR5 I;  2EPO A;  3M7N D;  2PO0 A;  3J7A G;  4JI6 E;  1HR0 E;  2NUG A;  2BM0 A;  2ELY A;  1IBM E;  2J7K A;  2HK2 A;  4BA1 A;  4Z7C A;  1UIL A;  2ODR D;  5A6J A;  1H7S A;  1Z0V A;  2CTD A;  4BC9 A;  4F2J C;  3PYG A;  2JEA A;  3LNU A;  3EPK A;  4IJD A;  1PDA A;  3F6G A;  3QT6 A;  2YPN A;  2EMI A;  5AAS A;  4U3B A;  2EOI A;  2J65 A;  5C0X A;  1OJ4 A;  4R2A A;  2VF3 A;  4FWG A;  3P3G A;  3VYY A;  5FLX C;  2N3G A;  2MKN A;  1GQE A;  4GKK E;  5DNL A;  2JE6 B;  4F9B B;  2EQ1 A;  4N4R B;  4JI6 I;  2V83 A;  3ADJ A;  4K0K E;  2LUP B;  1X48 A;  2JOB A;  2DRP A;  4YHH E;  1F2I G;  1ZBQ A;  4ED4 A;  2YRK A;  2H36 X;  2MC6 A;  2OI2 A;  4BA1 B;  3THN A;  4MQY A;  2K4V A;  4R2Q A;  4NHR A;  1KVK A;  4NZV A;  2AE8 A;  5IT9 Q;  1JK1 A;  1Z0C A;  2BR2 B;  3PYF A;  2UU9 I;  2EZ6 A;  1QZR A;  3HJC A;  4DV0 E;  4R2R A;  3ECR A;  1N33 E;  2ZM6 I;  4JI8 E;  3V5R A;  2NAB A;  1A1K A;  4RPF A;  4WSP A;  1Y4S A;  2EMW A;  4M1K A;  3WU5 A;  4ZYG A;  2VQE E;  2HKE A;  4DR2 E;  2C37 A;  2NN6 D;  2VES A;  2C37 B;  1MU5 A;  3B82 A;  1P42 A;  1WHN A;  3JAM C;  2E1R A;  3NZK A;  2HC5 A;  3OTO E;  4GKJ I;  2EN4 A;  4IZJ D;  5JEA D;  4DPY A;  3BBG A;  2BM1 A;  4R2S A;  2HJJ A;  2LJU A;  4LF8 I;  3J80 Q;  4OO1 B;  2YT4 A;  3EQ1 A;  4USK A;  4DV3 I;  2F1D A;  4JI8 I;  4KZS A;  1IBL E;  2NN6 A;  4F9A B;  4WSG A;  4DV1 E;  4X64 E;  5FWK A;  3IWC A;  2Z5E A;  4DV5 I;  4B3T I;  2UU9 E;  4OO1 C;  4NXN I;  2EPR A;  2EM4 A;  4MU1 A;  2LJH A;  2EOJ A;  1FWK A;  2JXP A;  1N34 E;  3LPS A;  5LL6 R;  3VK6 A;  2NN6 E;  2O1U A;  4GZN C;  2EFG A;  5KL6 A;  3CDI A;  2DMI A;  4R2C A;  1K47 A;  4DR1 I;  5DRP A;  2Z5B B;  5ELW A;  1QNT A;  1OYS A;  3K1J A;  2L33 A;  1AH5 A;  1EH6 A;  5LMN E;  4K0K I;  1FJG I;  2JE6 A;  4DV6 E;  4P52 A;  2VRD A;  3HQ1 A;  4J8Z A;  4HAC B;  2L8T A;  2ENC A;  5GMD A;  2VQF E;  4LF6 I;  3BGH A;  1ZM3 A;  2V8P A;  2JY9 A;  5AC4 A;  3H4L A;  4WUC A;  5CFF E;  4DR7 I;  5BR8 I;  1Z5C A;  1YYW A;  4DR6 E;  2FTX B;  4F6M A;  1MGT A;  2EM7 A;  2Q2E B;  4DV2 I;  2UUB I;  1SR9 A;  2LTS A;  3DJW A;  2CVE A;  1YUI A;  4LF9 I;  3L7Z A;  4R2P A;  1E3H A;  1O0W A;  2YRM A;  4JI7 E;  3P06 A;  4YY3 I;  3RMP A;  4B3M E;  4M9V C;  1A1L A;  5C0X D;  1N32 I;  1IBM I;  2PNZ A;  4IFD A;  2O3Z A;  3FIG A;  4WX9 A;  2EPA A;  3IWD A;  2GO3 A;  4LOM A;  4LFA E;  2PO0 B;  3CWV A;  2YTI A;  4O24 A;  4PRX A;  1ZXM A;  3QG5 C;  4JI5 I;  1A1F A;  3ADG A;  4LFB I;  2EQ0 A;  3KZY A;  2WP8 B;  2EOH A;  2EPL X;  1WUU A;  2HKJ A;  4HAC A;  2EPM X;  4OZE A;  4JI1 E;  2HGH A;  2C38 A;  1GTK A;  3MSW A;  5IWA E;  1NCS A;  5DRR A;  4I3H A;  4J3D A;  1DQ3 A;  2L92 A;  3EPJ A;  1YHC A;  1N36 I;  3LLH A;  5AE1 A;  5DNX A;  5C0X E;  4HYM A;  4DR4 E;  5A2Q C;  5DRQ A;  1YSA C;  3C6M A;  2V34 A;  2RS6 A;  1H73 A;  2VF1 A;  1ZU1 A;  3Q1Q A;  2Z5C B;  4AQY E;  4BHB A;  4LF5 E;  2HHH I;  2MKD A;  4P7D A;  3PS2 A;  1ZR9 A;  4MYU A;  1OYR A;  1YUJ A;  2EPC A;  4QNJ A;  1ZM9 A;  2UXC E;  2DMY A;  2JWO A;  2ODR C;  1STU A;  2ZBK B;  3T1H I;  5LLQ A;  2DB2 A;  2ELZ A;  3C6K A;  4LF8 E;  4FW3 A;  3ZKB A;  4LF5 I;  1RQ0 A;  1JK2 A;  4FW7 A;  3LTO A;  1XNR E;  1B63 A;  4BA2 A;  2EM2 A;  2B7T A;  2LVH A;  5EL9 A;  1XNQ E;  2CGE A;  5DRO A;  2NN6 F;  4RHB B;  3MHH C;  5A2Q Q;  4JG4 A;  5IWA I;  1A1H A;  2NN6 C;  1KKH A;  4LF4 I;  2DGC A;  2UUC E;  2DLQ A;  4N3O A;  4BCA A;  2EMG A;  1ZM2 A;  2ENA A;  1UBD C;  5A6K A;  3GON A;  2EOS A;  3ZM7 A;  4JI4 E;  3P3C A;  4JYA E;  2EMH A;  2EPU A;  4BHC A;  3F6H A;  2GLI A;  4JI2 E;  1UDN A;  4DPW A;  1YFH A;  1YYK A;  2EOX A;  1J5E I;  1I94 I;  1XHK A;  1SFE A;  2RPC A;  1UDO A;  4JI1 I;  2V88 A;  3T1Y I;  1NHI A;  3PYE A;  4X66 I;  4NXM I;  2YTJ A;  1DI2 A;  1KJK A;  3P3E A;  3ADL A;  1Z59 A;  2B9D A;  5BR8 E;  1NEI A;  2EN8 A;  5LMU I;  2A2C A;  1YZ9 A;  1EI1 A;  5K36 B;  2JVA A;  4OOG C;  2JT2 A;  1H7U A;  2DLK A;  3J81 C;  1PIE A;  4MYT A;  2EM9 A;  2Q8U A;  4TUI A;  2EPZ A;  2M4I A;  4XTJ A;  2EMY A;  3T1Y E;  4F54 A;  4LF9 E;  1HNX I;  2IOP A;  4B3S E;  4M0V A;  1RRE A;  2KHX A;  4LF7 E;  1N3G A;  2O1W A;  2X36 A;  1USV A;  2V86 A;  4BS9 A;  4B3R I;  5A69 A;  4LCG A;  4WXC A;  4IFD F;  3ZKD A;  3THO B;  2Z5B A;  4X8W A;  1IQS A;  5AE2 A;  4PRV A;  3AUZ A;  2PO2 A;  5JEA F;  2UXC I;  1S16 A;  3ZZU A;  2WP8 A;  5C0X F;  1N34 I;  4IZK A;  4ZYD A;  2YZT A;  1KYQ A;  1T4N A;  3H1C A;  5C0X C;  2CPN A;  1TF3 A;  3OML A;  4B3T E;  5A6A A;  3HKM A;  4DR5 E;  4ZVI A;  4HTG A;  4X64 I;  2PO1 B;  2M7Q A;  1UDS A;  2WBU A;  5FLX Q;  2EOR A;  2BA1 D;  2UXB I;  2WNR A;  3JTZ A;  2C39 B;  2L3C A;  2JR1 A;  1XNR I;  3GCM A;  1B69 A;  3V2U C;  4DV4 I;  4R03 A;  4JV5 E;  2EL6 A;  4AM3 A;  2EOF A;  2WBT A;  4U3D A;  4EMD A;  1FWL A;  5GME A;  2YTF A;  4DV5 E;  1VIS A;  4JI0 E;  4DV1 I;  3J80 C;  4IZJ B;  2EPN A;  3BF2 A;  2NUF A;  1IBK E;  2M9A A;  4PU9 A;  2LBS B;  3CDJ A;  3HPZ A;  2EM5 A;  1YPN A;  2V2Z A;  4BA2 B;  4DV0 I;  3K6Q A;  2HK3 A;  1UHZ A;  4DXL A;  4M30 A;  1PVG A;  3C4B A;  2LJP A;  3K85 A;  5JEA C;  2FV4 B;  4OX9 E;  1FI4 A;  3MHS C;  1A6F A;  1ELO A;  4OO1 F;  2DSY A;  2E72 A;  4DPT A;  2VQE I;  2BR2 A;  1USU A;  3J7Y p;  4R2D A;  2LE2 A;  5JEA A;  2YTO A;  1EH8 A;  2LMZ A;  2WW4 A;  2PNZ B;  1I94 E;  4LFB E;  3QT7 A;  2D9H A;  4YHH I;  1D6T A;  3Q6N A;  2UUA I;  1PKP A;  3VHT B;  4L5N C;  1VI7 A;  3PS1 A;  5AE3 A;  4MLQ A;  4F9C B;  4ZYH A;  3D4J A;  2E5L E;  3KWR A;  4FW5 A;  3LML A;  2B7V A;  2UUC I;  1FKA E;  4YY3 E;  5AC5 A;  2C38 B;  2YWQ A;  1Z5A A;  4IS1 C;  1N0V C;  4MU0 A;  5K36 D;  4ISA A;  2K7I A;  2O1T A;  2NUE A;  4ZYE A;  2EN1 A;  5T6J A;  4UTG A;  2V2V A;  2MC5 A;  5IXM B;  3HUL A;  2G7H A;  2VE7 C;  2F8B A;  1MEY C;  2UXB E;  1UN6 B;  2V85 A;  1PJT A;  2YTE A;  4IS9 A;  4QNK A;  3JU0 A;  4IFD E;  4IFD C;  5K36 A;  1ZBT A;  2EOQ A;  4JI0 I;  4DV6 I;  1Z1B A;  1HR0 I;  2EN2 A;  1S4E A;  2CT1 A;  3TQM A;  2C39 A;  2YTP A;  1Z0E A;  4DV7 I;  4URL A;  4JV5 I;  3Q6M A;  5K36 E;  2EN7 A;  1Z0T A;  2V2Q A;  2EPX A;  1A1G A;  5KL4 A;  2EWL A;  5JEA B;  3M85 G;  1J26 A;  4R2E A;  4KHP E;  2BBG A;  2HFS A;  3L00 A;  2BV3 A;  2EMA A;  4UT4 A;  2BB8 A;  2IES A;  2EOZ A;  4KWY A;  2HFU A;  4NXN E;  3B78 A;  4FN5 A;  4HY1 A;  1XMO I;  2EM0 A;  1Y5Y A;  2EOO A;  1IBL I;  1PJQ A;  4DUZ E;  1BB8 A;  4OKG A;  1T38 A;  1X3C A;  3GME A;  2ENH A;  1Z0B A;  2MDG A;  3H09 A;  5DNY A;  1TN9 A;  5L3J A;  2A2D A;  2LO3 A;  2JEA B;  5IT9 C;  2IOQ A;  1Y60 A;  4F6N A;  4LTY A;  4I8O A;  4LCF A;  2FGG A;  2R76 A;  2RSM A;  3BID A;  1RC7 A;  3KRN A;  2BA1 G;  3M85 D;  5F3W A;  4DPX A;  4X65 E;  1YH8 A;  3DD6 A;  4DR2 I;  2R3V A;  2R1F A;  1ZXN A;  4DUY E;  4FW4 A;  3P1X A;  2O1V A;  5KL2 A;  1KTV A;  1RR9 A;  1DGC A;  1E3P A;  4AID A;  4IFD B;  2PRT A;  2UXD E;  1XXE A;  2ZM6 E;  1LLM C;  1N33 I;  2EPK X;  2A25 A;  2YTN A;  4X62 E;  4TUG A;  4IZK B;  4USM A;  2IHR 1;  2IER A;  4FW9 A;  3DF6 A;  4LF6 E;  2UUA E;  4JI4 I;  2V8Q B;  1AAY A;  4Q35 B;  3WU6 A;  2EMC A;  4NXM E;  2YSP A;  4MLV A;  4MDT A;  1XMQ I;  2EP3 A;  2L6M A;  4WFT A;  2EM3 A;  3EPH A;  3F0N A;  2I13 A;  2J7J A;  1PJS A;  4WUB A;  1L4S A;  5LMN I;  2L2N A;  4DMI A;  1WRJ A;  4LCH A;  3UK3 C;  4OX9 I;  2EOE A;  1J5E E;  4DU8 A;  1G2F C;  1FNM A;  1IMU A;  3GLL A;  2EOM A;  2JPA A;  1EA6 A;  3AV0 A;  4X9J A;  2EMX A;  1X6F A;  5IV8 B;  1ZM4 A;  1Z0G A;  2EQ3 A;  2ADR A;  4LFC E;  2LUQ A;  1NHH A;  2N8X A;  4R1F A;  2EOY A;  4LF4 E;  1X49 A;  1DAR A;  2EML A;  3T1H E;  1ZAA C;  3IWB A;  2CG9 A;  2R42 A;  1R6M A;  2X7I A;  4LPF A;  3ZZT A;  3QT8 A;  2JYA A;  2YRH A;  2RS7 A;  1RHY A;  3B4T A;  4DV4 E;  3JAM Q;  4DUY I;  3L7Z B;  2NA2 A;  2EM8 A;  2PNM A;  4X65 I;  1H74 A;  2CZ9 A;  4HXZ A;  3OTO I;  1EKZ A;  2EL5 A;  2CSH A;  3KZZ A;  5KL3 A;  2PNL A;  1X6H A;  2RTX A;  4Z7Y A;  3J7A M;  2NPF A;  2E1M A;  4WYQ B;  2Z5C A;  3M7N G;  2M1S A;  1T39 A;  3HTX A;  2PO2 B;  1X47 A;  4AIM A;  2RSI A;  2YTG A;  2KON A;  4IZJ A;  4P7A A;  2L2K B;  4JI5 E;  1WXR A;  2KOU A;  2GHF A;  1XMO E;  1T4L B;  1HNZ E;  1MG7 A;  4NBQ A;  2EMF A;  4DR4 I;  1WHQ A;  3VYX A;  2EMZ A;  3UHM A;  4WUD A;  1OYP A;  4DR3 E;  4KHP I;  4B3R E;  2V87 A;  4L8N A;  1N32 E;  2JEB A;  2V89 A;  2WZO A;  3PRY A;  1MX0 A;  3WU4 A;  4B3S I;  2DIX A;  4R8O A;  4B3M I;  4LF7 I;  2EMK A;  2YTQ A;  1HNX E;  5C0X B;  3B8H A;  4DKK A;  1Y6Z A;  4LU9 A;  4FK5 C;  4DV7 E;  4HEI A; 
#chains in the Genus database with same CATH homology
 4BMJ A;  4DV2 E;  1NZ0 A;  4DR6 I;  4KQV A;  4LFA I;  1HK7 A;  1Y4U A;  3C4T A;  5LMU E;  2GS8 A;  1HNW E;  4GKK I;  1QU6 A;  4Q28 A;  3ZOQ B;  3QT5 A;  4JI7 I;  4X66 E;  2N3H A;  4FWH A;  4BC7 A;  1FJG E;  3PYD A;  2L3J A;  2UUB E;  4GEQ B;  1U2R A;  4WPY A;  2F4V I;  4DR7 E;  3WU3 A;  2GQ0 A;  4DR1 E;  1N0U A;  4JI2 I;  4JYA I;  2VQF I;  1XMQ E;  3K17 A;  4LFC I;  1B62 A;  2E5L I;  3HPS A;  2AJ4 A;  1GZ6 A;  2B3T B;  2L2M A;  2JOX A;  1NHJ A;  1Z0W A;  4X62 I;  2MDR A;  2F4V E;  2UXD I;  1Z5B A;  1XNQ I;  2DEJ A;  5ADZ A;  1KIJ A;  4JI3 E;  1H72 C;  3HXL A;  1HNW I;  3ADI A;  2LTR A;  4BBY A;  4DV3 E;  2LRS A;  2HHH E;  1IBK I;  4LF5 I;  4DU7 A;  4DUZ I;  4AQY I;  1YYO A;  2XEX A;  3ZZ0 A;  1UEK A;  1T4O A;  2ZIT A;  4GKJ E;  3M6A A;  1N36 E;  4DR3 I;  4JI3 I;  1BKN A;  1HNZ I;  3J81 Q;  4M2Z A;  2DEI A;  4FWD A;  4P78 A;  4DR5 I;  3J7A G;  4JI6 E;  1HR0 E;  2NUG A;  2BM0 A;  1IBM E;  2J7K A;  2HK2 A;  4Z7C A;  1UIL A;  2ODR D;  1H7S A;  1Z0V A;  3PYG A;  4BC9 A;  3LNU A;  3F6G A;  3QT6 A;  5AAS A;  1OJ4 A;  4FWG A;  2VF3 A;  3VYY A;  5FLX C;  2N3G A;  1GQE A;  4GKK E;  4F9B B;  4JI6 I;  4K0K E;  2V83 A;  3ADJ A;  2LUP B;  1X48 A;  2JOB A;  4YHH E;  4ED4 A;  1ZBQ A;  2H36 X;  2MC6 A;  2OI2 A;  2K4V A;  1KVK A;  5IT9 Q;  1Z0C A;  3PYF A;  2UU9 I;  2EZ6 A;  1QZR A;  3HJC A;  4DV0 E;  1N33 E;  2ZM6 I;  4JI8 E;  3V5R A;  4RPF A;  4WSP A;  1Y4S A;  4M1K A;  3WU5 A;  2VQE E;  2HKE A;  4DR2 E;  1MU5 A;  3B82 A;  1WHN A;  3JAM C;  2E1R A;  4GKJ I;  3OTO E;  4IZJ D;  4DPY A;  2BM1 A;  4LF8 I;  3J80 Q;  2YT4 A;  4USK A;  4DV3 I;  4JI8 I;  2UXC I;  4KZS A;  1IBL E;  4F9A B;  4DV1 E;  4X64 E;  5FWK A;  3IWC A;  2Z5E A;  4DV5 I;  4B3T I;  2UU9 E;  4NXN I;  2LJH A;  1FWK A;  1N34 E;  3LPS A;  5LL6 R;  3VK6 A;  2O1U A;  2EFG A;  1K47 A;  4DR1 I;  2Z5B B;  3K1J A;  2L33 A;  5LMN E;  4K0K I;  1FJG I;  4DV6 E;  4P52 A;  3HQ1 A;  4J8Z A;  4HAC B;  2L8T A;  5GMD A;  2VQF E;  4LF6 I;  1ZM3 A;  2V8P A;  2JY9 A;  3H4L A;  4WUC A;  5CFF E;  4DR7 I;  5BR8 I;  1Z5C A;  1YYW A;  4DR6 E;  2FTX B;  2Q2E B;  4DV2 I;  2UUB I;  1SR9 A;  2LTS A;  3DJW A;  4LF9 I;  1O0W A;  3P06 A;  4JI7 E;  4YY3 I;  3RMP A;  4B3M E;  1N32 I;  1IBM I;  3FIG A;  3IWD A;  4LFA E;  3CWV A;  4PRX A;  1ZXM A;  4JI5 I;  3ADG A;  4LFB I;  1WUU A;  4HAC A;  2HKJ A;  4JI1 E;  3MSW A;  5IWA E;  4I3H A;  1DQ3 A;  2L92 A;  1N36 I;  3LLH A;  5AE1 A;  4HYM A;  4DR4 E;  5A2Q C;  2V34 A;  2RS6 A;  1H73 A;  2VF1 A;  3Q1Q A;  2Z5C B;  4AQY E;  4LF5 E;  2HHH I;  4P7D A;  4MYU A;  1ZM9 A;  2UXC E;  2DMY A;  2JWO A;  2ODR C;  1STU A;  2ZBK B;  3T1H I;  2DB2 A;  4LF8 E;  3ZKB A;  1RQ0 A;  3LTO A;  1XNR E;  1B63 A;  2B7T A;  1XNQ E;  2CGE A;  5A2Q Q;  4JG4 A;  5IWA I;  1KKH A;  4LF4 I;  2UUC E;  4N3O A;  4BCA A;  1ZM2 A;  3GON A;  3ZM7 A;  4JI4 E;  4JYA E;  4JI2 E;  3F6H A;  4DPW A;  1YYK A;  1J5E I;  1I94 I;  1XHK A;  4JI1 I;  2V88 A;  3T1Y I;  1NHI A;  3PYE A;  4X66 I;  4NXM I;  1DI2 A;  3ADL A;  1Z59 A;  2B9D A;  5BR8 E;  5LMU I;  2A2C A;  1YZ9 A;  1EI1 A;  2JVA A;  4OOG C;  1H7U A;  3J81 C;  1PIE A;  4MYT A;  4TUI A;  2M4I A;  4XTJ A;  1HNX I;  3T1Y E;  4F54 A;  4LF9 E;  2IOP A;  4B3S E;  4M0V A;  1RRE A;  2KHX A;  4LF7 E;  2O1W A;  2X36 A;  1USV A;  2V86 A;  4BS9 A;  4B3R I;  3ZKD A;  2Z5B A;  4X8W A;  4PRV A;  5AE2 A;  3AUZ A;  1S16 A;  3ZZU A;  1N34 I;  4IZK A;  2YZT A;  1T4N A;  2CPN A;  3OML A;  4B3T E;  4X64 I;  4DR5 E;  4ZVI A;  2M7Q A;  5FLX Q;  2UXB I;  3JTZ A;  2L3C A;  2JR1 A;  1XNR I;  3V2U C;  4DV4 I;  4R03 A;  4JV5 E;  4EMD A;  1FWL A;  5GME A;  4DV5 E;  1VIS A;  4JI0 E;  4DV1 I;  3J80 C;  4IZJ B;  2NUF A;  1IBK E;  4PU9 A;  2LBS B;  3HPZ A;  2V2Z A;  4DV0 I;  3K6Q A;  2HK3 A;  1UHZ A;  4DXL A;  4M30 A;  1PVG A;  3C4B A;  2LJP A;  3K85 A;  2FV4 B;  4OX9 E;  1FI4 A;  1A6F A;  1ELO A;  2DSY A;  4DPT A;  2VQE I;  1USU A;  3J7Y p;  2LE2 A;  2WW4 A;  2LMZ A;  4YHH I;  1I94 E;  4LFB E;  3QT7 A;  1D6T A;  3Q6N A;  2UUA I;  1PKP A;  4L5N C;  5AE3 A;  4F9C B;  3D4J A;  2E5L E;  3KWR A;  3LML A;  2B7V A;  2UUC I;  1FKA E;  4YY3 E;  1Z5A A;  1N0V C;  2O1T A;  2NUE A;  5T6J A;  4UTG A;  2V2V A;  2MC5 A;  3HUL A;  2G7H A;  2VE7 C;  2F8B A;  2UXB E;  2V85 A;  3JU0 A;  1ZBT A;  4JI0 I;  4DV6 I;  1HR0 I;  1S4E A;  1Z0E A;  4DV7 I;  4URL A;  4JV5 I;  3Q6M A;  1Z0T A;  2V2Q A;  2EWL A;  1J26 A;  4KHP E;  2HFS A;  2BV3 A;  4UT4 A;  3B78 A;  2HFU A;  4FN5 A;  4HY1 A;  4NXN E;  1XMO I;  1IBL I;  4DUZ E;  1Z0B A;  3H09 A;  5DNY A;  5L3J A;  2A2D A;  5IT9 C;  2IOQ A;  4LTY A;  4I8O A;  2FGG A;  2RSM A;  1RC7 A;  5F3W A;  4DPX A;  4X65 E;  4DR2 I;  2R3V A;  1ZXN A;  4DUY E;  3P1X A;  2O1V A;  1KTV A;  1RR9 A;  2UXD E;  2ZM6 E;  1N33 I;  4TUG A;  4X62 E;  4USM A;  4IZK B;  2IHR 1;  4FW9 A;  3DF6 A;  4LF6 E;  2UUA E;  4JI4 I;  2V8Q B;  3WU6 A;  4NXM E;  1XMQ I;  4DPU A;  2L6M A;  4WFT A;  3F0N A;  4WUB A;  5LMN I;  2L2N A;  4DMI A;  4OX9 I;  1J5E E;  4DU8 A;  1FNM A;  1EA6 A;  3AV0 A;  1ZM4 A;  1Z0G A;  4LFC E;  2LUQ A;  1NHH A;  4R1F A;  4LF4 E;  1X49 A;  1DAR A;  3T1H E;  2X7I A;  3IWB A;  2CG9 A;  2R42 A;  3ZZT A;  3QT8 A;  2RS7 A;  4DV4 E;  3JAM Q;  4DUY I;  2NA2 A;  2PNM A;  4X65 I;  1H74 A;  2CZ9 A;  4HXZ A;  3OTO I;  1EKZ A;  2PNL A;  4Z7Y A;  2RTX A;  3J7A M;  2NPF A;  2E1M A;  4WYQ B;  2Z5C A;  2M1S A;  3HTX A;  1X47 A;  2KON A;  4IZJ A;  4P7A A;  4JI5 E;  2L2K B;  1WXR A;  2KOU A;  1XMO E;  1T4L B;  1MG7 A;  1HNZ E;  4DR4 I;  1WHQ A;  3VYX A;  4WUD A;  4DR3 E;  4KHP I;  4B3R E;  2V87 A;  4L8N A;  1N32 E;  2V89 A;  2WZO A;  3PRY A;  1MX0 A;  3WU4 A;  4B3S I;  2DIX A;  4R8O A;  4B3M I;  4LF7 I;  1HNX E;  3B8H A;  4DKK A;  1Y6Z A;  4LU9 A;  4DV7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...