4X65E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x65E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x65E02
2HK3A 1OJ4A 1XNRI 5LL6R 1DARA 1PKPA 3B8HA 4GKKI 3J7Yp 3LNUA 4JV5I 1ZM2A 4DV2I 3P1XA 2RSMA 2ZM6E 1A6FA 3JAMQ 4JI4E 1STUA 2DIXA 2DEIA 4JYAE 4X64E 1IBLE 4LF5E 3PYEA 4PRVA 2L2KB 2ZM6I 1HNXI 4DV6I 4B3RE 3PYFA 1H73A 3WU3A 4DR3E 4JI6I 4Z7CA 4X64I 4WUDA 4LF5I 4X8WA 4LF9E 2X36A 2RS6A 4M2ZA 2HKJA 1X47A 1N36E 4DR5E 1XMOE 2J7KA 2NA2A 1UILA 2A2DA 1BKNA 1N0VC 4GKJE 2HFSA 4FN5A 4DV4I 4JI3E 3LLHA 3J80C 2E5LE 4HXZA 4DR4E 1Z0GA 4DPXA 1H74A 4X62E 3J81Q 3WU5A 2E1RA 1Z0WA 1J5EI 2E5LI 4DR4I 2EFGA 2L3CA 2HFUA 4JI1I 2LUQA 4ZVIA 1Z0EA 4X62I 1H7SA 3PYGA 3J7AG 4JI5I 1WHQA 4DR7I 4DR2I 2GS8A 2HKEA 2LTRA 1J26A 1K47A 2BV3A 4URLA 3ZZUA 3WU4A 2DEJA 1HNZI 4YY3E 4DV0E 3H4LA 4DPTA 4JI7E 2HK2A 1GQEA 1S4EA 2WW4A 4UTGA 4JI8E 3ZM7A 3WU6A 1HR0I 4YY3I 3V5RA 1Z0VA 1XNRE 4JV5E 4DV2E 2V8PA 3QT5A 4JI7I 2B7TA 4FWGA 4HY1A 4DV7I 2VQEE 3ZZTA 4LFCI 4DV5I 4PRXA 5LMNE 1YZ9A 3C4TA 1HNXE 1NHIA 4DV6E 2NPFA 4LF7I 3ADIA 1N0UA 4JI6E 1T4LB 4DU7A 2V2QA 1FKAE 2RTXA 2VQEI 1YYWA 2UU9I 5LMNI 1PIEA 1Z0CA 1NHJA 4FWHA 2HHHI 1QU6A 2UXCI 4PU9A 4DV1I 3B82A 4KHPE 4DV4E 1N33I 1H72C 1IBKE 4JI2I 3GONA 1HNWI 1ZM9A 3T1HI 4DUYE 5IT9C 2ZBKB 5GMDA 2LRSA 4DPUA 2NUFA 4KHPI 3QT8A 2UUBI 1IBKI 1J5EE 4R1FA 4OX9I 4JI1E 4K0KI 4DUYI 1RC7A 3J7AM 4NXNE 3ADJA 1T4NA 3CWVA 4KQVA 4I3HA 1D6TA 1NHHA 4YHHI 3K1JA 2X7IA 4B3TI 1RQ0A 1B63A 2AJ4A 4JI5E 4EMDA 4DR7E 4NXNI 1I94I 4DR2E 2NUEA 1QZRA 2CZ9A 2DMYA 4JI0I 4LF8I 3M6AA 1DI2A 3HTXA 2VF3A 1RREA 4LF6I 1HNZE 2LJPA 1XHKA 1UEKA 3D4JA 4B3SE 1MG7A 1KVKA 4WUBA 2KHXA 1FWLA 3B78A 2VQFE 4B3MI 1XMQI 1YYKA 4LF4I 4P7AA 1HR0E 4B3SI 3C4BA 1Z0TA 2R3VA 4M30A 2L3JA 2VQFI 5BR8I 1WHNA 4DV7E 4P52A 1N34I 5IT9Q 1ZM4A 3HULA 1Z5CA 4LFCE 4DV5E 2CPNA 4OOGC 3VYXA 2BM0A 4DV3I 2B3TB 4DPYA 4HACB 1FJGI 4LF7E 3PYDA 2LJHA 2B7VA 4HACA 4LFAE 5IWAI 2NUGA 2IHR1 3ZKDA 2F4VE 2L2MA 2V34A 1VISA 2UU9E 4M1KA 2L33A 2UUAE 4X66I 3LPSA 2HHHE 1FNMA 5LMUI 4LFAI 4DR6I 2UXCE 4DV1E 2UXBI 3T1YE 2F4VI 1ZXNA 1UHZA 4NXMI 1N33E 2UUAI 4JI2E 1HNWE 4DPWA 3T1HE 4LFBI 5A2QC 1B62A 1XNQI 2XEXA 1N32I 1MU5A 2RS7A 2MDRA 2JY9A 1PVGA 2N3GA 4X65I 3T1YI 4USMA 2UUBE 2EZ6A 4AQYI 1WUUA 4OX9E 4JG4A 5GMEA 3LTOA 4K0KE 3ZKBA 3K17A 4YHHE 4JI4I 4B3TE 1YYOA 4DXLA 5FLXQ 4JYAI 1EA6A 1IBLI 4Z7YA 2L2NA 1I94E 1U2RA 4MYTA 4B3RI 4DR3I 4LF8E 2LTSA 4JI0E 4LF9I 4LF6E 4WYQB 1T4OA 2A2CA 3ADLA 1N36I 4DR5I 1XMOI 4XTJA 2UUCE 3ZZ0A 4GKJI 2V2VA 1S16A 1KIJA 4B3ME 1XMQE 4JI3I 4LF4E 2Q2EB 4RPFA 3JAMC 2DB2A 1EKZA 3Q1QA 1FWKA 3OTOE 3QT7A 4WFTA 2LUPB 1RR9A 4HYMA 2UUCI 5CFFE 1IBME 2R42A 1MX0A 4FW9A 5BR8E 1NZ0A 1EI1A 4DUZE 5A2QQ 5L3JA 1N34E 2BM1A 1KTVA 1ELOA 1ZBTA 3OTOI 5FLXC 4DV3E 2UXDE 1IBMI 1X49A 1FJGE 4ED4A 2YT4A 3ADGA 1KKHA 3V2UC 4FWDA 4DUZI 5IWAE 3VYYA 1Z59A 2UXDI 1X48A 1FI4A 1O0WA 4DU8A 4X66E 4DR1E 5LMUE 4DR6E 2V2ZA 1Z0BA 3F0NA 4MYUA 3QT6A 2UXBE 4UT4A 2JVAA 1Z5AA 4NXME 4USKA 3J81C 4DV0I 4DR1I 4LFBE 1H7UA 4GKKE 1XNQE 1ZXMA 4WUCA 1N32E 2LBSB 1Z5BA 2ZITA 1ZM3A 2N3HA 4JI8I 3J80Q 4X65E 4DKKA 4AQYE 2OI2A
chains in the Genus database with same CATH superfamily
2PRTA 4OKGA 2HK3A 2DLKA 2EM2A 1OJ4A 1XNRI 5LL6R 2K4VA 2WBTA 1DARA 1PKPA 3B8HA 1QNTA 4GKKI 1NEIA 4FK5C 3J7Yp 2HC5A 2E72A 3LNUA 4JV5I 1ZM2A 4DV2I 2YU8A 4DMIA 4OO1E 3P1XA 2RSMA 4M0VA 2VRDA 2EN8A 2ZM6E 1A6FA 4TUIA 2NN6B 4OZEA 4R03A 4JI4E 1STUA 2DIXA 3AV0A 3JAMQ 1VI7A 2DEIA 1OYPA 2EPXA 4O4KA 4U3BA 5K36E 4JYAE 3P3CA 4X64E 1IBLE 4LOMA 4LF5E 1UDSA 1Y6ZA 4ZYEA 5AC5A 2PNMA 4P78A 2CG9A 3PYEA 3JTZA 4IZJD 4PRVA 3PS1A 1KYQA 4BC7A 2EM8A 2L2KB 2J7JA 2ZM6I 1HNXI 4DV6I 4FW5A 4B3RE 3BF2A 4R2EA 4ZYHA 3PYFA 1TF6A 1H73A 3WU3A 4RHBB 3EPJA 4DR3E 3IWBA 4JI6I 4IFDF 2LJUA 2JYAA 5A6AA 2VE7C 5FWKA 3PS2A 2EN3A 4F9CB 5EKWA 3NZKA 4WUDA 4Z7CA 4X64I 4LF5I 4IFDB 4X8WA 4LF9E 4R2AA 2X36A 2RS6A 4M2ZA 2EQ1A 2HKJA 2LT7A 1AH5A 1X47A 2EQ0A 4IFDD 1USUA 4IFDA 1N36E 4DR5E 1XMOE 2J7KA 2NA2A 2IOPA 1UILA 2ENAA 3KWRA 1L4SA 5ELWA 1ZAAC 2A2DA 1BKNA 1N3GA 2EMBA 1N0VC 1ZR9A 4GKJE 2HFSA 4FN5A 2V87A 3OMLA 4DV4I 2EQ3A 4JI3E 1T38A 2EMIA 1OYRA 3FIGA 3LLHA 2LO3A 3J80C 2E5LE 4HXZA 4DR4E 1Z0GA 4OO1F 4DPXA 1H74A 1RHYA 4WPYA 2EPKX 2V89A 3IWDA 5K36F 4WXDA 4X62E 3J81Q 5AASA 3WU5A 2YTQA 2L92A 1E3HA 3EPKA 2E1RA 4OO1D 3KZYA 4WX9A 1Z0WA 1J5EI 2E5LI 4OO1A 4DR4I 1R6MA 1EH8A 5KL7A 3BBGA 2L3CA 2EFGA 2HFUA 4JI1I 4BA1A 2YSPA 1PJTA 2EMAA 2YWQA 3MSWA 5JEAC 2LUQA 1A1IA 1XXEA 3K85A 2GQ0A 2YTNA 3HPZA 5F3WA 2FTXB 4ZVIA 1BB8A 1Y4SA 2O3ZA 4X62I 4R2DA 2JXPA 2KONA 2MC6A 1H7SA 2WP8B 3F6HA 3PYGA 1P47A 3J7AG 2GO3A 4JI5I 1WHQA 4DR7I 5K36C 3K6QA 2EM9A 4WSPA 2AE8A 2WP8A 4DR2I 2CT1A 1WRJA 2VESA 1EH7A 2WZOA 2GS8A 4IS1C 2HKEA 2ADRA 2LTRA 2F1DA 2OI2A 4MU1A 3MHHC 4F9BB 1J26A 1K47A 5AE3A 1OYSA 2BV3A 4URLA 3ZZUA 3WU4A 2CTDA 2DEJA 1HNZI 1GZ6A 4J8ZA 4LU9A 1YHCA 2EOSA 2M9AA 4YY3E 4F6MA 2ODRD 2CSHA 4DV0E 2L6MA 2BR2B 3H4LA 4DPTA 4JI7E 2HK2A 1GQEA 1S4EA 2WW4A 1UDQA 3TQMA 3P3EA 4UTGA 4JI8E 1G2DC 3PS3A 2EPRA 4LCFA 2EPCA 2BR2A 3ZM7A 3WU6A 2EN1A 1Y60A 1DGCA 1HR0I 1Y4UA 2J65A 2WBSA 2JP9A 1Z0VA 3V5RA 4YY3I 1T39A 1PJQA 4HEIA 2ENHA 1LLMC 1XNRE 4L8NA 2RPCA 1DQ3A 4JV5E 4DV2E 2V8PA 3QT5A 4JI7I 4NHRA 2YZTA 5KL2A 4KZSA 3HKMA 2WNRA 2B7TA 5EL9A 4FWGA 4BA2A 4HY1A 3IWCA 4DV7I 2A25A 5JEAE 2YRKA 2VQEE 4LFCI 3ZZTA 4DV5I 2WCC3 3HPSA 2B9DA 3AUZA 4PRXA 2PO2B 5LMNE 1YZ9A 2E1MA 2EMLA 3C4TA 4R8OA 1HNXE 1YFHA 1NHIA 4DV6E 5DNLA 2YPNA 2NPFA 1MEYC 1SFEA 3ADIA 4LF7I 1N0UA 1YUJA 4JI6E 3GLLA 2LVHA 4IZJB 1T4LB 2RSIA 4BHCA 3UK3C 5DNXA 4DU7A 3J7AM 2PO2A 2EMCA 2V2QA 1USVA 1YSAC 2EN6A 1FKAE 2RTXA 2Q8UA 2EORA 5DNYA 5C0XE 2VQEI 5KL4A 2RQLA 4RH8A 1YYWA 2Z5CB 2UU9I 1Y5YA 5LMNI 2GPIA 3M99B 4IZJA 3THOB 1PIEA 1Z0CA 1NHJA 4FWHA 2HHHI 1QU6A 2Z5CA 2UXCI 4PU9A 2L8TA 4DV1I 1Z1BA 3B82A 4BMJA 4KHPE 4P7DA 5KL5A 4DV4E 1N33I 1UDOA 1H72C 1IBKE 1BBOA 4JI2I 3GONA 4GQUA 1HNWI 2WBUA 1ZM9A 4R2CA 3T1HI 2JE6B 2YTEA 4DUYE 5IT9C 2O1VA 2LMZA 2ZBKB 5GMDA 2LRSA 2EPOA 1UN6B 4DPUA 2N8XA 4FW6A 4ISAA 2EPUA 2NUFA 2EOZA 4KHPI 2EPLX 4F6NA 2BA1D 2JE6A 3QT8A 5JEAF 3DJWA 2UUBI 3KZZA 2NN6C 1IBKI 2JPAA 3C6MA 2HGHA 1J5EE 3RMPA 4R1FA 4OX9I 4F54A 3CDIA 2YTJA 4JI1E 2EMWA 4K0KI 3H09A 4DUYI 1RC7A 4R2RA 2GLIA 4NXNE 2Z5BB 3ADJA 1T4NA 3CWVA 3L7ZB 2ENCA 4KQVA 4I3HA 3GCMA 1NHHA 5JEAD 4LCGA 2EMYA 4YHHI 3U1YA 3K1JA 2YTPA 4OO1B 2V85A 5AE2A 2EMXA 2X7IA 4BA1B 1BBGA 4B3TI 5A6BD 1RQ0A 2JR1A 2EN4A 1B63A 2Z5BA 3L7ZA 5K36B 1GTKA 3JU0A 2AJ4A 4GEQB 2JEBB 2O1TA 4JI5E 4EMDA 4DR7E 4NXNI 4AIMA 4X9JA 1I94I 5K36D 4DR2E 4IJDA 1UDNA 5K36A 4R2QA 2NUEA 2C38B 2BA0D 5DROA 5IXMB 1QZRA 4MU0A 2CZ9A 2DMYA 4JI0I 2JEBA 2FV4B 4LF8I 2V8QB 1ZBQA 4FW3A 3M6AA 1DI2A 3HTXA 2VF3A 1RREA 4LF6I 1HNZE 2MKNA 1P42A 3HQ1A 3ZOQB 4BS9A 3EQ1A 2C38A 2GO4A 2LJPA 1YPNA 1XHKA 1UEKA 3D4JA 4FW4A 2DLQA 4B3SE 5C0XC 1MG7A 2GHFA 1EH6A 1KVKA 2EM3A 3UHMA 1IMUA 2EOOA 4WUBA 2KHXA 4BBYA 3QG5C 2EMFA 1X6FA 4WSGA 1B69A 3L00A 1FWLA 3B78A 2VQFE 4QNKA 4B3MI 1XMQI 1YYKA 5IV8B 4LF4I 4P7AA 2FGGA 1HR0E 1IQOA 4B3SI 3C4BA 2NABA 4WXCA 4BHBA 5ADZA 1Z0TA 2O1WA 2PNZB 4MDTA 1HK7A 2MDGA 2BBGA 5KL3A 2EOFA 4M30A 2NN6E 2R3VA 2L3JA 2H36X 2VQFI 5DRPA 5BR8I 5A6KA 1WHNA 2EMZA 4O43A 4MLVA 4DV7E 2JOBA 2PNZA 4P52A 3BGHA 1N34I 2V88A 3MHSC 2WNRB 4BA2B 1ZM4A 5IT9Q 2IESA 1Z5CA 4LFCE 4DV5E 2CPNA 3HULA 4OOGC 2BA1G 3VYXA 4QNJA 2BM0A 4DV3I 2B3TB 3P3GA 4DPYA 4HACB 2C39B 4NBQA 4R2PA 1F2IG 1FJGI 3LMLA 4IS9A 3M85D 4LF7E 4M9VC 2PNLA 2G7HA 1SR9A 3KRNA 3PYDA 2LJHA 2B7VA 2I9IA 1RMDA 4HACA 4LFAE 2C39A 5T6JA 4IFDE 5IWAI 2NUGA 2EWLA 2KOUA 3CDJA 2IHR1 3ZKDA 4Q35B 4F9AB 4TUGA 2L2MA 2F4VE 2V34A 2YTIA 1VISA 2UU9E 3Q6MA 2PO1A 2EOQA 4M1KA 2L33A 2V86A 4KWYA 2UUAE 2DMIA 4X66I 3LPSA 2HHHE 2EE8A 1FNMA 2EOMA 4LCHA 5LMUI 4LFAI 5DRQA 4DR6I 2UXCE 2C37B 2ELYA 4DV1E 1A1LA 2BA0G 2UXBI 3T1YE 2F4VI 2VF1A 1ZXNA 1UHZA 4NXMI 1N33E 2UUAI 4JI2E 1HNWE 4DPWA 3C6KA 2C37A 3T1HE 4LFBI 2NN6F 5A2QC 4F2JC 1B62A 1XNQI 1A1JA 2XEXA 1N32I 2EPPA 1MU5A 2RS7A 2MDRA 2JY9A 5TSEA 1PVGA 2N3GA 5AC4A 4X65I 3T1YI 4USMA 2EMGA 2EPZA 2UUBE 2EZ6A 3H1CA 4AQYI 4AIDA 1WUUA 2NN6D 2MC5A 4OX9E 2NN6A 4JG4A 1R6LA 5GMEA 3LTOA 4K0KE 3ZKBA 3K17A 4MLQA 4N4RB 2LE2A 4LTYA 2V83A 2EPAA 4O5GA 4YHHE 4FW7A 4JI4I 4MQYA 1D6TA 1YUIA 3P06A 4B3TE 1YYOA 2YU5A 1UBDC 4DXLA 5FLXQ 4JYAI 1EA6A 1IBLI 5JEAB 2MKDA 4MU4A 2JT2A 4J3DA 4Z7YA 2R76A 4AM3A 2EM6A 2L2NA 2HJJA 2YRMA 1I94E 2ELZA 1U2RA 2EPMX 4MYTA 2D9HA 3M7NG 4B3RI 5JEAA 2F8BA 5A6JA 4DR3I 1IQSA 2LTSA 4JI0E 4LF8E 2EM7A 2EN2A 5C0XF 5A6BA 4R2SA 5KL6A 2YTGA 1E3PA 3M85G 4LF6E 4LF9I 5C0XB 1WJPA 4WYQB 1NCSA 1T4OA 3EPLA 2EJ4A 3VHTB 2A2CA 1A1KA 2CGEA 1MGTA 2JOXA 3ADLA 4IFDC 2JEAB 2EOEA 5C0XD 3BIDA 4NZVA 1N36I 3U1KA 4DR5I 5C0XA 1XMOI 1YH8A 2R1FA 4XTJA 1WXRA 2EMHA 1A1GA 1AAYA 2YSOA 2UUCE 3DD6A 2EN7A 3M7ND 3Q6NA 3ZZ0A 2JEAA 4GKJI 3EPHA 1S16A 2O1UA 2V2VA 1JK2A 1KIJA 4B3ME 1XMQE 4JI3I 4LF4E 2Q2EB 1G2FC 4RPFA 3JAMC 2YTFA 2DB2A 1EKZA 4MU3A 3Q1QA 1FWKA 2EPNA 3THNA 3OTOE 3QT7A 4WFTA 1KJKA 2LUPB 1RR9A 4HYMA 2UUCI 2YTOA 5CFFE 1IBME 2R42A 1MX0A 2LCEA 4FW9A 2DRPA 3B4TA 2M7QA 5BR8E 5LLQA 4BC9A 4ZYDA 1X3CA 2DSYA 1NZ0A 1EI1A 2PO0B 4OO1C 4DUZE 3HJCA 5A2QQ 5AE1A 1N34E 5L3JA 2BM1A 1KTVA 1ELOA 1ZBTA 3OTOI 5FLXC 4N3OA 4DV3E 2EL5A 2PO0A 1X6EA 3F6GA 2UXDE 1IBMI 4ZYGA 1X49A 1FJGE 2M4IA 2EP3A 4ED4A 4LPFA 2YT4A 1TN9A 3ADGA 1KKHA 3V2UC 4FWDA 2EM0A 2IERA 4DUZI 2EOIA 2EM5A 3DF6A 2JWOA 5IWAE 3VYYA 1Z59A 3ECRA 2CVEA 4I8OA 4GZNC 1TF3A 2UXDI 1X48A 1FI4A 2EL4A 1O0WA 2YTDA 4DU8A 4X66E 4DR1E 3GMEA 2M1SA 1ZU1A 3HXLA 1PJSA 2EOXA 2PO1B 4U3DA 2BB8A 2EL6A 5LMUE 4DR6E 2V2ZA 2IOQA 2EMKA 4Q28A 2I13A 1Z0BA 3F0NA 4MYUA 1JK1A 3QT6A 2UXBE 1A1FA 5DRRA 2YRHA 2K7IA 4UT4A 2JVAA 1Z5AA 1X6HA 4NXME 4USKA 1X5WA 2EOYA 2ODRC 3J81C 2EM4A 4O24A 2Z5EA 3P76A 4BCAA 4IZKB 4DV0I 2LV2A 4DR1I 4LFBE 2DGCA 1H7UA 3PRYA 4GKKE 1XNQE 1A1HA 1ZXMA 4WUCA 1N32E 2LBSB 1Z5BA 2ZITA 1ZM3A 2N3HA 4HTGA 1PDAA 2EOHA 4JI8I 3VK6A 3J80Q 4IZKA 4X65E 4DKKA 5A69A 4AQYE 2EOJA 4L5NC 1Z0EA
chains in the Genus database with same CATH topology
2HK3A 1OJ4A 1XNRI 5LL6R 2K4VA 1DARA 1PKPA 3B8HA 4GKKI 3J7Yp 3LNUA 4JV5I 1ZM2A 4DV2I 4DMIA 3P1XA 2RSMA 4M0VA 2ZM6E 1A6FA 4TUIA 4R03A 4JI4E 1STUA 2DIXA 3AV0A 3JAMQ 2DEIA 4JYAE 4X64E 1IBLE 4LF5E 1Y6ZA 2PNMA 4P78A 2CG9A 3PYEA 3JTZA 4IZJD 4PRVA 4BC7A 2L2KB 2ZM6I 1HNXI 4DV6I 4B3RE 3PYFA 1H73A 3WU3A 4DR3E 4JI6I 3IWBA 5FWKA 2VE7C 4Z7CA 4F9CB 4X64I 4WUDA 4LF5I 4X8WA 4LF9E 2X36A 2RS6A 4M2ZA 2HKJA 1X47A 1USUA 1N36E 4DR5E 1XMOE 2J7KA 2NA2A 2IOPA 1UILA 3KWRA 2A2DA 1BKNA 1N0VC 4GKJE 2HFSA 4FN5A 2V87A 3OMLA 4DV4I 4JI3E 3FIGA 3LLHA 3J80C 2E5LE 4HXZA 4DR4E 1Z0GA 4DPXA 1H74A 4WPYA 2V89A 3IWDA 4X62E 3J81Q 5AASA 3WU5A 2L92A 2E1RA 1Z0WA 1J5EI 2E5LI 4DR4I 2EFGA 2L3CA 2HFUA 4JI1I 3MSWA 2LUQA 3K85A 2GQ0A 3HPZA 5F3WA 2FTXB 4ZVIA 1Y4SA 4X62I 1H7SA 2MC6A 2KONA 3F6HA 3PYGA 3J7AG 4JI5I 1WHQA 4DR7I 3K6QA 4WSPA 4DR2I 2WZOA 2GS8A 2OI2A 2HKEA 2LTRA 4F9BB 1J26A 1K47A 5AE3A 2BV3A 4URLA 3ZZUA 3WU4A 2DEJA 1HNZI 1GZ6A 4J8ZA 4LU9A 4YY3E 2ODRD 4DV0E 2L6MA 3H4LA 4DPTA 4JI7E 2HK2A 1GQEA 1S4EA 2WW4A 4UTGA 4JI8E 3ZM7A 3WU6A 1HR0I 1Y4UA 4YY3I 3V5RA 1Z0VA 1XNRE 4L8NA 1DQ3A 4JV5E 4DV2E 2V8PA 3QT5A 4JI7I 2YZTA 4KZSA 2B7TA 4FWGA 4HY1A 3IWCA 4DV7I 2VQEE 3ZZTA 4LFCI 4DV5I 3HPSA 2B9DA 3AUZA 4PRXA 5LMNE 1YZ9A 2E1MA 3C4TA 4R8OA 1HNXE 1NHIA 4DV6E 2NPFA 4LF7I 3ADIA 1N0UA 4JI6E 4IZJB 1T4LB 4DU7A 2V2QA 1USVA 1FKAE 2RTXA 2VQEI 5DNYA 1YYWA 2Z5CB 2UU9I 5LMNI 4IZJA 1PIEA 1Z0CA 1NHJA 4FWHA 2HHHI 1QU6A 2Z5CA 2UXCI 4PU9A 2L8TA 4DV1I 3B82A 4BMJA 4KHPE 4P7DA 4DV4E 1N33I 1H72C 1IBKE 4JI2I 3GONA 1HNWI 1ZM9A 3T1HI 4DUYE 5IT9C 2O1VA 2LMZA 2ZBKB 5GMDA 2LRSA 4DPUA 2NUFA 4KHPI 3QT8A 3DJWA 2UUBI 1IBKI 1J5EE 3RMPA 4R1FA 4OX9I 4F54A 4JI1E 4K0KI 3H09A 4DUYI 1RC7A 3J7AM 4NXNE 2Z5BB 3ADJA 1T4NA 3CWVA 4KQVA 4I3HA 1D6TA 1NHHA 4YHHI 3K1JA 2V85A 5AE2A 2X7IA 4B3TI 1RQ0A 2JR1A 1B63A 2Z5BA 3JU0A 2AJ4A 4GEQB 2O1TA 4JI5E 4EMDA 4DR7E 4NXNI 1I94I 4DR2E 2NUEA 1QZRA 2CZ9A 2DMYA 4JI0I 4LF8I 2FV4B 2V8QB 1ZBQA 3M6AA 1DI2A 3HTXA 2VF3A 1RREA 4LF6I 1HNZE 3HQ1A 3ZOQB 4BS9A 2LJPA 1XHKA 1UEKA 3D4JA 4B3SE 1MG7A 1KVKA 4WUBA 2KHXA 4BBYA 1FWLA 3B78A 2VQFE 4B3MI 1XMQI 1YYKA 4LF4I 4P7AA 2FGGA 1HR0E 4B3SI 3C4BA 5ADZA 2O1WA 1Z0TA 1HK7A 2R3VA 4M30A 2L3JA 2H36X 2VQFI 5BR8I 1WHNA 4DV7E 2JOBA 4P52A 1N34I 2V88A 5IT9Q 1ZM4A 3HULA 1Z5CA 4LFCE 4DV5E 2CPNA 4OOGC 3VYXA 2BM0A 4DV3I 2B3TB 4DPYA 4HACB 1FJGI 3LMLA 4LF7E 2PNLA 2G7HA 1SR9A 3PYDA 2LJHA 2B7VA 4HACA 4LFAE 5T6JA 5IWAI 2NUGA 2EWLA 2KOUA 2IHR1 3ZKDA 4F9AB 2F4VE 2L2MA 4TUGA 2V34A 1VISA 2UU9E 3Q6MA 4M1KA 2L33A 2V86A 2UUAE 4X66I 3LPSA 2HHHE 1FNMA 5LMUI 4LFAI 4DR6I 2UXCE 4DV1E 2UXBI 3T1YE 2F4VI 2VF1A 1ZXNA 1UHZA 4NXMI 1N33E 2UUAI 4JI2E 1HNWE 4DPWA 3T1HE 4LFBI 5A2QC 1B62A 1XNQI 2XEXA 1N32I 1MU5A 2RS7A 2MDRA 2JY9A 1PVGA 2N3GA 4X65I 3T1YI 4USMA 2UUBE 2EZ6A 4AQYI 1WUUA 2MC5A 4OX9E 4JG4A 5GMEA 3LTOA 4K0KE 3ZKBA 3K17A 4LTYA 2LE2A 2V83A 4YHHE 4JI4I 3P06A 4B3TE 1YYOA 4DXLA 5FLXQ 4JYAI 1EA6A 1IBLI 4Z7YA 2L2NA 1I94E 1U2RA 4MYTA 4B3RI 2F8BA 4DR3I 4LF8E 2LTSA 4JI0E 4LF9I 4LF6E 4WYQB 1T4OA 2A2CA 2CGEA 2JOXA 3ADLA 1N36I 4DR5I 1XMOI 4XTJA 1WXRA 2UUCE 3Q6NA 3ZZ0A 4GKJI 1S16A 2O1UA 2V2VA 1KIJA 4B3ME 1XMQE 4JI3I 4LF4E 2Q2EB 4RPFA 3JAMC 2DB2A 1EKZA 3Q1QA 1FWKA 3OTOE 3QT7A 4WFTA 2LUPB 1RR9A 4HYMA 2UUCI 5CFFE 1IBME 2R42A 1MX0A 4FW9A 2M7QA 5BR8E 4BC9A 2DSYA 1NZ0A 1EI1A 4DUZE 3HJCA 5A2QQ 5AE1A 1N34E 5L3JA 2BM1A 1KTVA 1ELOA 1ZBTA 3OTOI 5FLXC 4N3OA 4DV3E 2UXDE 3F6GA 1IBMI 1X49A 1FJGE 2M4IA 4ED4A 2YT4A 3ADGA 1KKHA 3V2UC 4FWDA 4DUZI 3DF6A 5IWAE 2JWOA 3VYYA 1Z59A 4I8OA 2UXDI 1X48A 1FI4A 1O0WA 4DU8A 4X66E 4DR1E 2M1SA 3HXLA 5LMUE 4DR6E 2V2ZA 2IOQA 4Q28A 1Z0BA 3F0NA 4MYUA 3QT6A 2UXBE 4UT4A 2JVAA 1Z5AA 4NXME 4USKA 2ODRC 3J81C 2Z5EA 4IZKB 4BCAA 4DV0I 4DR1I 4LFBE 1H7UA 3PRYA 4GKKE 1XNQE 1ZXMA 4WUCA 1N32E 2LBSB 1Z5BA 2ZITA 1ZM3A 2N3HA 4JI8I 3VK6A 3J80Q 4IZKA 4X65E 4DKKA 4AQYE 4L5NC 1Z0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK3 A;  1OJ4 A;  1XNR I;  5LL6 R;  1DAR A;  1PKP A;  3B8H A;  4GKK I;  3J7Y p;  3LNU A;  4JV5 I;  1ZM2 A;  4DV2 I;  3P1X A;  2RSM A;  2ZM6 E;  1A6F A;  3JAM Q;  4JI4 E;  1STU A;  2DIX A;  2DEI A;  4JYA E;  4X64 E;  1IBL E;  4LF5 E;  3PYE A;  4PRV A;  2L2K B;  2ZM6 I;  1HNX I;  4DV6 I;  4B3R E;  3PYF A;  1H73 A;  3WU3 A;  4DR3 E;  4JI6 I;  4Z7C A;  4X64 I;  4WUD A;  4LF5 I;  4X8W A;  4LF9 E;  2X36 A;  2RS6 A;  4M2Z A;  2HKJ A;  1X47 A;  1N36 E;  4DR5 E;  1XMO E;  2J7K A;  2NA2 A;  1UIL A;  2A2D A;  1BKN A;  1N0V C;  4GKJ E;  2HFS A;  4FN5 A;  4DV4 I;  4JI3 E;  3LLH A;  3J80 C;  2E5L E;  4HXZ A;  4DR4 E;  1Z0G A;  4DPX A;  1H74 A;  4X62 E;  3J81 Q;  3WU5 A;  2E1R A;  1Z0W A;  1J5E I;  2E5L I;  4DR4 I;  2EFG A;  2L3C A;  2HFU A;  4JI1 I;  2LUQ A;  4ZVI A;  1Z0E A;  4X62 I;  1H7S A;  3PYG A;  3J7A G;  4JI5 I;  1WHQ A;  4DR7 I;  4DR2 I;  2GS8 A;  2HKE A;  2LTR A;  1J26 A;  1K47 A;  2BV3 A;  4URL A;  3ZZU A;  3WU4 A;  2DEJ A;  1HNZ I;  4YY3 E;  4DV0 E;  3H4L A;  4DPT A;  4JI7 E;  2HK2 A;  1GQE A;  1S4E A;  2WW4 A;  4UTG A;  4JI8 E;  3ZM7 A;  3WU6 A;  1HR0 I;  4YY3 I;  3V5R A;  1Z0V A;  1XNR E;  4JV5 E;  4DV2 E;  2V8P A;  3QT5 A;  4JI7 I;  2B7T A;  4FWG A;  4HY1 A;  4DV7 I;  2VQE E;  3ZZT A;  4LFC I;  4DV5 I;  4PRX A;  5LMN E;  1YZ9 A;  3C4T A;  1HNX E;  1NHI A;  4DV6 E;  2NPF A;  4LF7 I;  3ADI A;  1N0U A;  4JI6 E;  1T4L B;  4DU7 A;  2V2Q A;  1FKA E;  2RTX A;  2VQE I;  1YYW A;  2UU9 I;  5LMN I;  1PIE A;  1Z0C A;  1NHJ A;  4FWH A;  2HHH I;  1QU6 A;  2UXC I;  4PU9 A;  4DV1 I;  3B82 A;  4KHP E;  4DV4 E;  1N33 I;  1H72 C;  1IBK E;  4JI2 I;  3GON A;  1HNW I;  1ZM9 A;  3T1H I;  4DUY E;  5IT9 C;  2ZBK B;  5GMD A;  2LRS A;  4DPU A;  2NUF A;  4KHP I;  3QT8 A;  2UUB I;  1IBK I;  1J5E E;  4R1F A;  4OX9 I;  4JI1 E;  4K0K I;  4DUY I;  1RC7 A;  3J7A M;  4NXN E;  3ADJ A;  1T4N A;  3CWV A;  4KQV A;  4I3H A;  1D6T A;  1NHH A;  4YHH I;  3K1J A;  2X7I A;  4B3T I;  1RQ0 A;  1B63 A;  2AJ4 A;  4JI5 E;  4EMD A;  4DR7 E;  4NXN I;  1I94 I;  4DR2 E;  2NUE A;  1QZR A;  2CZ9 A;  2DMY A;  4JI0 I;  4LF8 I;  3M6A A;  1DI2 A;  3HTX A;  2VF3 A;  1RRE A;  4LF6 I;  1HNZ E;  2LJP A;  1XHK A;  1UEK A;  3D4J A;  4B3S E;  1MG7 A;  1KVK A;  4WUB A;  2KHX A;  1FWL A;  3B78 A;  2VQF E;  4B3M I;  1XMQ I;  1YYK A;  4LF4 I;  4P7A A;  1HR0 E;  4B3S I;  3C4B A;  1Z0T A;  2R3V A;  4M30 A;  2L3J A;  2VQF I;  5BR8 I;  1WHN A;  4DV7 E;  4P52 A;  1N34 I;  5IT9 Q;  1ZM4 A;  3HUL A;  1Z5C A;  4LFC E;  4DV5 E;  2CPN A;  4OOG C;  3VYX A;  2BM0 A;  4DV3 I;  2B3T B;  4DPY A;  4HAC B;  1FJG I;  4LF7 E;  3PYD A;  2LJH A;  2B7V A;  4HAC A;  4LFA E;  5IWA I;  2NUG A;  2IHR 1;  3ZKD A;  2F4V E;  2L2M A;  2V34 A;  1VIS A;  2UU9 E;  4M1K A;  2L33 A;  2UUA E;  4X66 I;  3LPS A;  2HHH E;  1FNM A;  5LMU I;  4LFA I;  4DR6 I;  2UXC E;  4DV1 E;  2UXB I;  3T1Y E;  2F4V I;  1ZXN A;  1UHZ A;  4NXM I;  1N33 E;  2UUA I;  4JI2 E;  1HNW E;  4DPW A;  3T1H E;  4LFB I;  5A2Q C;  1B62 A;  1XNQ I;  2XEX A;  1N32 I;  1MU5 A;  2RS7 A;  2MDR A;  2JY9 A;  1PVG A;  2N3G A;  4X65 I;  3T1Y I;  4USM A;  2UUB E;  2EZ6 A;  4AQY I;  1WUU A;  4OX9 E;  4JG4 A;  5GME A;  3LTO A;  4K0K E;  3ZKB A;  3K17 A;  4YHH E;  4JI4 I;  4B3T E;  1YYO A;  4DXL A;  5FLX Q;  4JYA I;  1EA6 A;  1IBL I;  4Z7Y A;  2L2N A;  1I94 E;  1U2R A;  4MYT A;  4B3R I;  4DR3 I;  4LF8 E;  2LTS A;  4JI0 E;  4LF9 I;  4LF6 E;  4WYQ B;  1T4O A;  2A2C A;  3ADL A;  1N36 I;  4DR5 I;  1XMO I;  4XTJ A;  2UUC E;  3ZZ0 A;  4GKJ I;  2V2V A;  1S16 A;  1KIJ A;  4B3M E;  1XMQ E;  4JI3 I;  4LF4 E;  2Q2E B;  4RPF A;  3JAM C;  2DB2 A;  1EKZ A;  3Q1Q A;  1FWK A;  3OTO E;  3QT7 A;  4WFT A;  2LUP B;  1RR9 A;  4HYM A;  2UUC I;  5CFF E;  1IBM E;  2R42 A;  1MX0 A;  4FW9 A;  5BR8 E;  1NZ0 A;  1EI1 A;  4DUZ E;  5A2Q Q;  5L3J A;  1N34 E;  2BM1 A;  1KTV A;  1ELO A;  1ZBT A;  3OTO I;  5FLX C;  4DV3 E;  2UXD E;  1IBM I;  1X49 A;  1FJG E;  4ED4 A;  2YT4 A;  3ADG A;  1KKH A;  3V2U C;  4FWD A;  4DUZ I;  5IWA E;  3VYY A;  1Z59 A;  2UXD I;  1X48 A;  1FI4 A;  1O0W A;  4DU8 A;  4X66 E;  4DR1 E;  5LMU E;  4DR6 E;  2V2Z A;  1Z0B A;  3F0N A;  4MYU A;  3QT6 A;  2UXB E;  4UT4 A;  2JVA A;  1Z5A A;  4NXM E;  4USK A;  3J81 C;  4DV0 I;  4DR1 I;  4LFB E;  1H7U A;  4GKK E;  1XNQ E;  1ZXM A;  4WUC A;  1N32 E;  2LBS B;  1Z5B A;  2ZIT A;  1ZM3 A;  2N3H A;  4JI8 I;  3J80 Q;  4X65 E;  4DKK A;  4AQY E;  2OI2 A; 
#chains in the Genus database with same CATH topology
 2PRT A;  4OKG A;  2HK3 A;  2DLK A;  2EM2 A;  1OJ4 A;  1XNR I;  5LL6 R;  2K4V A;  2WBT A;  1DAR A;  1PKP A;  3B8H A;  1QNT A;  4GKK I;  1NEI A;  4FK5 C;  3J7Y p;  2HC5 A;  2E72 A;  3LNU A;  4JV5 I;  1ZM2 A;  4DV2 I;  2YU8 A;  4DMI A;  4OO1 E;  3P1X A;  2RSM A;  4M0V A;  2VRD A;  2EN8 A;  2ZM6 E;  1A6F A;  4TUI A;  2NN6 B;  4OZE A;  4R03 A;  4JI4 E;  1STU A;  2DIX A;  3AV0 A;  3JAM Q;  1VI7 A;  2DEI A;  1OYP A;  2EPX A;  4O4K A;  4U3B A;  5K36 E;  4JYA E;  3P3C A;  4X64 E;  1IBL E;  4LOM A;  4LF5 E;  1UDS A;  1Y6Z A;  4ZYE A;  5AC5 A;  2PNM A;  4P78 A;  2CG9 A;  3PYE A;  3JTZ A;  4IZJ D;  4PRV A;  3PS1 A;  1KYQ A;  4BC7 A;  2EM8 A;  2L2K B;  2J7J A;  2ZM6 I;  1HNX I;  4DV6 I;  4FW5 A;  4B3R E;  3BF2 A;  4R2E A;  4ZYH A;  3PYF A;  1TF6 A;  1H73 A;  3WU3 A;  4RHB B;  3EPJ A;  4DR3 E;  3IWB A;  4JI6 I;  4IFD F;  2LJU A;  2JYA A;  5A6A A;  2VE7 C;  5FWK A;  3PS2 A;  2EN3 A;  4F9C B;  5EKW A;  3NZK A;  4WUD A;  4Z7C A;  4X64 I;  4LF5 I;  4IFD B;  4X8W A;  4LF9 E;  4R2A A;  2X36 A;  2RS6 A;  4M2Z A;  2EQ1 A;  2HKJ A;  2LT7 A;  1AH5 A;  1X47 A;  2EQ0 A;  4IFD D;  1USU A;  4IFD A;  1N36 E;  4DR5 E;  1XMO E;  2J7K A;  2NA2 A;  2IOP A;  1UIL A;  2ENA A;  3KWR A;  1L4S A;  5ELW A;  1ZAA C;  2A2D A;  1BKN A;  1N3G A;  2EMB A;  1N0V C;  1ZR9 A;  4GKJ E;  2HFS A;  4FN5 A;  2V87 A;  3OML A;  4DV4 I;  2EQ3 A;  4JI3 E;  1T38 A;  2EMI A;  1OYR A;  3FIG A;  3LLH A;  2LO3 A;  3J80 C;  2E5L E;  4HXZ A;  4DR4 E;  1Z0G A;  4OO1 F;  4DPX A;  1H74 A;  1RHY A;  4WPY A;  2EPK X;  2V89 A;  3IWD A;  5K36 F;  4WXD A;  4X62 E;  3J81 Q;  5AAS A;  3WU5 A;  2YTQ A;  2L92 A;  1E3H A;  3EPK A;  2E1R A;  4OO1 D;  3KZY A;  4WX9 A;  1Z0W A;  1J5E I;  2E5L I;  4OO1 A;  4DR4 I;  1R6M A;  1EH8 A;  5KL7 A;  3BBG A;  2L3C A;  2EFG A;  2HFU A;  4JI1 I;  4BA1 A;  2YSP A;  1PJT A;  2EMA A;  2YWQ A;  3MSW A;  5JEA C;  2LUQ A;  1A1I A;  1XXE A;  3K85 A;  2GQ0 A;  2YTN A;  3HPZ A;  5F3W A;  2FTX B;  4ZVI A;  1BB8 A;  1Y4S A;  2O3Z A;  4X62 I;  4R2D A;  2JXP A;  2KON A;  2MC6 A;  1H7S A;  2WP8 B;  3F6H A;  3PYG A;  1P47 A;  3J7A G;  2GO3 A;  4JI5 I;  1WHQ A;  4DR7 I;  5K36 C;  3K6Q A;  2EM9 A;  4WSP A;  2AE8 A;  2WP8 A;  4DR2 I;  2CT1 A;  1WRJ A;  2VES A;  1EH7 A;  2WZO A;  2GS8 A;  4IS1 C;  2HKE A;  2ADR A;  2LTR A;  2F1D A;  2OI2 A;  4MU1 A;  3MHH C;  4F9B B;  1J26 A;  1K47 A;  5AE3 A;  1OYS A;  2BV3 A;  4URL A;  3ZZU A;  3WU4 A;  2CTD A;  2DEJ A;  1HNZ I;  1GZ6 A;  4J8Z A;  4LU9 A;  1YHC A;  2EOS A;  2M9A A;  4YY3 E;  4F6M A;  2ODR D;  2CSH A;  4DV0 E;  2L6M A;  2BR2 B;  3H4L A;  4DPT A;  4JI7 E;  2HK2 A;  1GQE A;  1S4E A;  2WW4 A;  1UDQ A;  3TQM A;  3P3E A;  4UTG A;  4JI8 E;  1G2D C;  3PS3 A;  2EPR A;  4LCF A;  2EPC A;  2BR2 A;  3ZM7 A;  3WU6 A;  2EN1 A;  1Y60 A;  1DGC A;  1HR0 I;  1Y4U A;  2J65 A;  2WBS A;  2JP9 A;  1Z0V A;  3V5R A;  4YY3 I;  1T39 A;  1PJQ A;  4HEI A;  2ENH A;  1LLM C;  1XNR E;  4L8N A;  2RPC A;  1DQ3 A;  4JV5 E;  4DV2 E;  2V8P A;  3QT5 A;  4JI7 I;  4NHR A;  2YZT A;  5KL2 A;  4KZS A;  3HKM A;  2WNR A;  2B7T A;  5EL9 A;  4FWG A;  4BA2 A;  4HY1 A;  3IWC A;  4DV7 I;  2A25 A;  5JEA E;  2YRK A;  2VQE E;  4LFC I;  3ZZT A;  4DV5 I;  2WCC 3;  3HPS A;  2B9D A;  3AUZ A;  4PRX A;  2PO2 B;  5LMN E;  1YZ9 A;  2E1M A;  2EML A;  3C4T A;  4R8O A;  1HNX E;  1YFH A;  1NHI A;  4DV6 E;  5DNL A;  2YPN A;  2NPF A;  1MEY C;  1SFE A;  3ADI A;  4LF7 I;  1N0U A;  1YUJ A;  4JI6 E;  3GLL A;  2LVH A;  4IZJ B;  1T4L B;  2RSI A;  4BHC A;  3UK3 C;  5DNX A;  4DU7 A;  3J7A M;  2PO2 A;  2EMC A;  2V2Q A;  1USV A;  1YSA C;  2EN6 A;  1FKA E;  2RTX A;  2Q8U A;  2EOR A;  5DNY A;  5C0X E;  2VQE I;  5KL4 A;  2RQL A;  4RH8 A;  1YYW A;  2Z5C B;  2UU9 I;  1Y5Y A;  5LMN I;  2GPI A;  3M99 B;  4IZJ A;  3THO B;  1PIE A;  1Z0C A;  1NHJ A;  4FWH A;  2HHH I;  1QU6 A;  2Z5C A;  2UXC I;  4PU9 A;  2L8T A;  4DV1 I;  1Z1B A;  3B82 A;  4BMJ A;  4KHP E;  4P7D A;  5KL5 A;  4DV4 E;  1N33 I;  1UDO A;  1H72 C;  1IBK E;  1BBO A;  4JI2 I;  3GON A;  4GQU A;  1HNW I;  2WBU A;  1ZM9 A;  4R2C A;  3T1H I;  2JE6 B;  2YTE A;  4DUY E;  5IT9 C;  2O1V A;  2LMZ A;  2ZBK B;  5GMD A;  2LRS A;  2EPO A;  1UN6 B;  4DPU A;  2N8X A;  4FW6 A;  4ISA A;  2EPU A;  2NUF A;  2EOZ A;  4KHP I;  2EPL X;  4F6N A;  2BA1 D;  2JE6 A;  3QT8 A;  5JEA F;  3DJW A;  2UUB I;  3KZZ A;  2NN6 C;  1IBK I;  2JPA A;  3C6M A;  2HGH A;  1J5E E;  3RMP A;  4R1F A;  4OX9 I;  4F54 A;  3CDI A;  2YTJ A;  4JI1 E;  2EMW A;  4K0K I;  3H09 A;  4DUY I;  1RC7 A;  4R2R A;  2GLI A;  4NXN E;  2Z5B B;  3ADJ A;  1T4N A;  3CWV A;  3L7Z B;  2ENC A;  4KQV A;  4I3H A;  3GCM A;  1NHH A;  5JEA D;  4LCG A;  2EMY A;  4YHH I;  3U1Y A;  3K1J A;  2YTP A;  4OO1 B;  2V85 A;  5AE2 A;  2EMX A;  2X7I A;  4BA1 B;  1BBG A;  4B3T I;  5A6B D;  1RQ0 A;  2JR1 A;  2EN4 A;  1B63 A;  2Z5B A;  3L7Z A;  5K36 B;  1GTK A;  3JU0 A;  2AJ4 A;  4GEQ B;  2JEB B;  2O1T A;  4JI5 E;  4EMD A;  4DR7 E;  4NXN I;  4AIM A;  4X9J A;  1I94 I;  5K36 D;  4DR2 E;  4IJD A;  1UDN A;  5K36 A;  4R2Q A;  2NUE A;  2C38 B;  2BA0 D;  5DRO A;  5IXM B;  1QZR A;  4MU0 A;  2CZ9 A;  2DMY A;  4JI0 I;  2JEB A;  2FV4 B;  4LF8 I;  2V8Q B;  1ZBQ A;  4FW3 A;  3M6A A;  1DI2 A;  3HTX A;  2VF3 A;  1RRE A;  4LF6 I;  1HNZ E;  2MKN A;  1P42 A;  3HQ1 A;  3ZOQ B;  4BS9 A;  3EQ1 A;  2C38 A;  2GO4 A;  2LJP A;  1YPN A;  1XHK A;  1UEK A;  3D4J A;  4FW4 A;  2DLQ A;  4B3S E;  5C0X C;  1MG7 A;  2GHF A;  1EH6 A;  1KVK A;  2EM3 A;  3UHM A;  1IMU A;  2EOO A;  4WUB A;  2KHX A;  4BBY A;  3QG5 C;  2EMF A;  1X6F A;  4WSG A;  1B69 A;  3L00 A;  1FWL A;  3B78 A;  2VQF E;  4QNK A;  4B3M I;  1XMQ I;  1YYK A;  5IV8 B;  4LF4 I;  4P7A A;  2FGG A;  1HR0 E;  1IQO A;  4B3S I;  3C4B A;  2NAB A;  4WXC A;  4BHB A;  5ADZ A;  1Z0T A;  2O1W A;  2PNZ B;  4MDT A;  1HK7 A;  2MDG A;  2BBG A;  5KL3 A;  2EOF A;  4M30 A;  2NN6 E;  2R3V A;  2L3J A;  2H36 X;  2VQF I;  5DRP A;  5BR8 I;  5A6K A;  1WHN A;  2EMZ A;  4O43 A;  4MLV A;  4DV7 E;  2JOB A;  2PNZ A;  4P52 A;  3BGH A;  1N34 I;  2V88 A;  3MHS C;  2WNR B;  4BA2 B;  1ZM4 A;  5IT9 Q;  2IES A;  1Z5C A;  4LFC E;  4DV5 E;  2CPN A;  3HUL A;  4OOG C;  2BA1 G;  3VYX A;  4QNJ A;  2BM0 A;  4DV3 I;  2B3T B;  3P3G A;  4DPY A;  4HAC B;  2C39 B;  4NBQ A;  4R2P A;  1F2I G;  1FJG I;  3LML A;  4IS9 A;  3M85 D;  4LF7 E;  4M9V C;  2PNL A;  2G7H A;  1SR9 A;  3KRN A;  3PYD A;  2LJH A;  2B7V A;  2I9I A;  1RMD A;  4HAC A;  4LFA E;  2C39 A;  5T6J A;  4IFD E;  5IWA I;  2NUG A;  2EWL A;  2KOU A;  3CDJ A;  2IHR 1;  3ZKD A;  4Q35 B;  4F9A B;  4TUG A;  2L2M A;  2F4V E;  2V34 A;  2YTI A;  1VIS A;  2UU9 E;  3Q6M A;  2PO1 A;  2EOQ A;  4M1K A;  2L33 A;  2V86 A;  4KWY A;  2UUA E;  2DMI A;  4X66 I;  3LPS A;  2HHH E;  2EE8 A;  1FNM A;  2EOM A;  4LCH A;  5LMU I;  4LFA I;  5DRQ A;  4DR6 I;  2UXC E;  2C37 B;  2ELY A;  4DV1 E;  1A1L A;  2BA0 G;  2UXB I;  3T1Y E;  2F4V I;  2VF1 A;  1ZXN A;  1UHZ A;  4NXM I;  1N33 E;  2UUA I;  4JI2 E;  1HNW E;  4DPW A;  3C6K A;  2C37 A;  3T1H E;  4LFB I;  2NN6 F;  5A2Q C;  4F2J C;  1B62 A;  1XNQ I;  1A1J A;  2XEX A;  1N32 I;  2EPP A;  1MU5 A;  2RS7 A;  2MDR A;  2JY9 A;  5TSE A;  1PVG A;  2N3G A;  5AC4 A;  4X65 I;  3T1Y I;  4USM A;  2EMG A;  2EPZ A;  2UUB E;  2EZ6 A;  3H1C A;  4AQY I;  4AID A;  1WUU A;  2NN6 D;  2MC5 A;  4OX9 E;  2NN6 A;  4JG4 A;  1R6L A;  5GME A;  3LTO A;  4K0K E;  3ZKB A;  3K17 A;  4MLQ A;  4N4R B;  2LE2 A;  4LTY A;  2V83 A;  2EPA A;  4O5G A;  4YHH E;  4FW7 A;  4JI4 I;  4MQY A;  1D6T A;  1YUI A;  3P06 A;  4B3T E;  1YYO A;  2YU5 A;  1UBD C;  4DXL A;  5FLX Q;  4JYA I;  1EA6 A;  1IBL I;  5JEA B;  2MKD A;  4MU4 A;  2JT2 A;  4J3D A;  4Z7Y A;  2R76 A;  4AM3 A;  2EM6 A;  2L2N A;  2HJJ A;  2YRM A;  1I94 E;  2ELZ A;  1U2R A;  2EPM X;  4MYT A;  2D9H A;  3M7N G;  4B3R I;  5JEA A;  2F8B A;  5A6J A;  4DR3 I;  1IQS A;  2LTS A;  4JI0 E;  4LF8 E;  2EM7 A;  2EN2 A;  5C0X F;  5A6B A;  4R2S A;  5KL6 A;  2YTG A;  1E3P A;  3M85 G;  4LF6 E;  4LF9 I;  5C0X B;  1WJP A;  4WYQ B;  1NCS A;  1T4O A;  3EPL A;  2EJ4 A;  3VHT B;  2A2C A;  1A1K A;  2CGE A;  1MGT A;  2JOX A;  3ADL A;  4IFD C;  2JEA B;  2EOE A;  5C0X D;  3BID A;  4NZV A;  1N36 I;  3U1K A;  4DR5 I;  5C0X A;  1XMO I;  1YH8 A;  2R1F A;  4XTJ A;  1WXR A;  2EMH A;  1A1G A;  1AAY A;  2YSO A;  2UUC E;  3DD6 A;  2EN7 A;  3M7N D;  3Q6N A;  3ZZ0 A;  2JEA A;  4GKJ I;  3EPH A;  1S16 A;  2O1U A;  2V2V A;  1JK2 A;  1KIJ A;  4B3M E;  1XMQ E;  4JI3 I;  4LF4 E;  2Q2E B;  1G2F C;  4RPF A;  3JAM C;  2YTF A;  2DB2 A;  1EKZ A;  4MU3 A;  3Q1Q A;  1FWK A;  2EPN A;  3THN A;  3OTO E;  3QT7 A;  4WFT A;  1KJK A;  2LUP B;  1RR9 A;  4HYM A;  2UUC I;  2YTO A;  5CFF E;  1IBM E;  2R42 A;  1MX0 A;  2LCE A;  4FW9 A;  2DRP A;  3B4T A;  2M7Q A;  5BR8 E;  5LLQ A;  4BC9 A;  4ZYD A;  1X3C A;  2DSY A;  1NZ0 A;  1EI1 A;  2PO0 B;  4OO1 C;  4DUZ E;  3HJC A;  5A2Q Q;  5AE1 A;  1N34 E;  5L3J A;  2BM1 A;  1KTV A;  1ELO A;  1ZBT A;  3OTO I;  5FLX C;  4N3O A;  4DV3 E;  2EL5 A;  2PO0 A;  1X6E A;  3F6G A;  2UXD E;  1IBM I;  4ZYG A;  1X49 A;  1FJG E;  2M4I A;  2EP3 A;  4ED4 A;  4LPF A;  2YT4 A;  1TN9 A;  3ADG A;  1KKH A;  3V2U C;  4FWD A;  2EM0 A;  2IER A;  4DUZ I;  2EOI A;  2EM5 A;  3DF6 A;  2JWO A;  5IWA E;  3VYY A;  1Z59 A;  3ECR A;  2CVE A;  4I8O A;  4GZN C;  1TF3 A;  2UXD I;  1X48 A;  1FI4 A;  2EL4 A;  1O0W A;  2YTD A;  4DU8 A;  4X66 E;  4DR1 E;  3GME A;  2M1S A;  1ZU1 A;  3HXL A;  1PJS A;  2EOX A;  2PO1 B;  4U3D A;  2BB8 A;  2EL6 A;  5LMU E;  4DR6 E;  2V2Z A;  2IOQ A;  2EMK A;  4Q28 A;  2I13 A;  1Z0B A;  3F0N A;  4MYU A;  1JK1 A;  3QT6 A;  2UXB E;  1A1F A;  5DRR A;  2YRH A;  2K7I A;  4UT4 A;  2JVA A;  1Z5A A;  1X6H A;  4NXM E;  4USK A;  1X5W A;  2EOY A;  2ODR C;  3J81 C;  2EM4 A;  4O24 A;  2Z5E A;  3P76 A;  4BCA A;  4IZK B;  4DV0 I;  2LV2 A;  4DR1 I;  4LFB E;  2DGC A;  1H7U A;  3PRY A;  4GKK E;  1XNQ E;  1A1H A;  1ZXM A;  4WUC A;  1N32 E;  2LBS B;  1Z5B A;  2ZIT A;  1ZM3 A;  2N3H A;  4HTG A;  1PDA A;  2EOH A;  4JI8 I;  3VK6 A;  3J80 Q;  4IZK A;  4X65 E;  4DKK A;  5A69 A;  4AQY E;  2EOJ A;  4L5N C;  1Z0E A; 
#chains in the Genus database with same CATH homology
 2HK3 A;  1OJ4 A;  1XNR I;  5LL6 R;  2K4V A;  1DAR A;  1PKP A;  3B8H A;  4GKK I;  3J7Y p;  3LNU A;  4JV5 I;  1ZM2 A;  4DV2 I;  4DMI A;  3P1X A;  2RSM A;  4M0V A;  2ZM6 E;  1A6F A;  4TUI A;  4R03 A;  4JI4 E;  1STU A;  2DIX A;  3AV0 A;  3JAM Q;  2DEI A;  4JYA E;  4X64 E;  1IBL E;  4LF5 E;  1Y6Z A;  2PNM A;  4P78 A;  2CG9 A;  3PYE A;  3JTZ A;  4IZJ D;  4PRV A;  4BC7 A;  2L2K B;  2ZM6 I;  1HNX I;  4DV6 I;  4B3R E;  3PYF A;  1H73 A;  3WU3 A;  4DR3 E;  4JI6 I;  3IWB A;  5FWK A;  2VE7 C;  4Z7C A;  4F9C B;  4X64 I;  4WUD A;  4LF5 I;  4X8W A;  4LF9 E;  2X36 A;  2RS6 A;  4M2Z A;  2HKJ A;  1X47 A;  1USU A;  1N36 E;  4DR5 E;  1XMO E;  2J7K A;  2NA2 A;  2IOP A;  1UIL A;  3KWR A;  2A2D A;  1BKN A;  1N0V C;  4GKJ E;  2HFS A;  4FN5 A;  2V87 A;  3OML A;  4DV4 I;  4JI3 E;  3FIG A;  3LLH A;  3J80 C;  2E5L E;  4HXZ A;  4DR4 E;  1Z0G A;  4DPX A;  1H74 A;  4WPY A;  2V89 A;  3IWD A;  4X62 E;  3J81 Q;  5AAS A;  3WU5 A;  2L92 A;  2E1R A;  1Z0W A;  1J5E I;  2E5L I;  4DR4 I;  2EFG A;  2L3C A;  2HFU A;  4JI1 I;  3MSW A;  2LUQ A;  3K85 A;  2GQ0 A;  3HPZ A;  5F3W A;  2FTX B;  4ZVI A;  1Y4S A;  4X62 I;  1H7S A;  2MC6 A;  2KON A;  3F6H A;  3PYG A;  3J7A G;  4JI5 I;  1WHQ A;  4DR7 I;  3K6Q A;  4WSP A;  4DR2 I;  2WZO A;  2GS8 A;  2OI2 A;  2HKE A;  2LTR A;  4F9B B;  1J26 A;  1K47 A;  5AE3 A;  2BV3 A;  4URL A;  3ZZU A;  3WU4 A;  2DEJ A;  1HNZ I;  1GZ6 A;  4J8Z A;  4LU9 A;  4YY3 E;  2ODR D;  4DV0 E;  2L6M A;  3H4L A;  4DPT A;  4JI7 E;  2HK2 A;  1GQE A;  1S4E A;  2WW4 A;  4UTG A;  4JI8 E;  3ZM7 A;  3WU6 A;  1HR0 I;  1Y4U A;  4YY3 I;  3V5R A;  1Z0V A;  1XNR E;  4L8N A;  1DQ3 A;  4JV5 E;  4DV2 E;  2V8P A;  3QT5 A;  4JI7 I;  2YZT A;  4KZS A;  2B7T A;  4FWG A;  4HY1 A;  3IWC A;  4DV7 I;  2VQE E;  3ZZT A;  4LFC I;  4DV5 I;  3HPS A;  2B9D A;  3AUZ A;  4PRX A;  5LMN E;  1YZ9 A;  2E1M A;  3C4T A;  4R8O A;  1HNX E;  1NHI A;  4DV6 E;  2NPF A;  4LF7 I;  3ADI A;  1N0U A;  4JI6 E;  4IZJ B;  1T4L B;  4DU7 A;  2V2Q A;  1USV A;  1FKA E;  2RTX A;  2VQE I;  5DNY A;  1YYW A;  2Z5C B;  2UU9 I;  5LMN I;  4IZJ A;  1PIE A;  1Z0C A;  1NHJ A;  4FWH A;  2HHH I;  1QU6 A;  2Z5C A;  2UXC I;  4PU9 A;  2L8T A;  4DV1 I;  3B82 A;  4BMJ A;  4KHP E;  4P7D A;  4DV4 E;  1N33 I;  1H72 C;  1IBK E;  4JI2 I;  3GON A;  1HNW I;  1ZM9 A;  3T1H I;  4DUY E;  5IT9 C;  2O1V A;  2LMZ A;  2ZBK B;  5GMD A;  2LRS A;  4DPU A;  2NUF A;  4KHP I;  3QT8 A;  3DJW A;  2UUB I;  1IBK I;  1J5E E;  3RMP A;  4R1F A;  4OX9 I;  4F54 A;  4JI1 E;  4K0K I;  3H09 A;  4DUY I;  1RC7 A;  3J7A M;  4NXN E;  2Z5B B;  3ADJ A;  1T4N A;  3CWV A;  4KQV A;  4I3H A;  1D6T A;  1NHH A;  4YHH I;  3K1J A;  2V85 A;  5AE2 A;  2X7I A;  4B3T I;  1RQ0 A;  2JR1 A;  1B63 A;  2Z5B A;  3JU0 A;  2AJ4 A;  4GEQ B;  2O1T A;  4JI5 E;  4EMD A;  4DR7 E;  4NXN I;  1I94 I;  4DR2 E;  2NUE A;  1QZR A;  2CZ9 A;  2DMY A;  4JI0 I;  4LF8 I;  2FV4 B;  2V8Q B;  1ZBQ A;  3M6A A;  1DI2 A;  3HTX A;  2VF3 A;  1RRE A;  4LF6 I;  1HNZ E;  3HQ1 A;  3ZOQ B;  4BS9 A;  2LJP A;  1XHK A;  1UEK A;  3D4J A;  4B3S E;  1MG7 A;  1KVK A;  4WUB A;  2KHX A;  4BBY A;  1FWL A;  3B78 A;  2VQF E;  4B3M I;  1XMQ I;  1YYK A;  4LF4 I;  4P7A A;  2FGG A;  1HR0 E;  4B3S I;  3C4B A;  5ADZ A;  2O1W A;  1Z0T A;  1HK7 A;  2R3V A;  4M30 A;  2L3J A;  2H36 X;  2VQF I;  5BR8 I;  1WHN A;  4DV7 E;  2JOB A;  4P52 A;  1N34 I;  2V88 A;  5IT9 Q;  1ZM4 A;  3HUL A;  1Z5C A;  4LFC E;  4DV5 E;  2CPN A;  4OOG C;  3VYX A;  2BM0 A;  4DV3 I;  2B3T B;  4DPY A;  4HAC B;  1FJG I;  3LML A;  4LF7 E;  2PNL A;  2G7H A;  1SR9 A;  3PYD A;  2LJH A;  2B7V A;  4HAC A;  4LFA E;  5T6J A;  5IWA I;  2NUG A;  2EWL A;  2KOU A;  2IHR 1;  3ZKD A;  4F9A B;  2F4V E;  2L2M A;  4TUG A;  2V34 A;  1VIS A;  2UU9 E;  3Q6M A;  4M1K A;  2L33 A;  2V86 A;  2UUA E;  4X66 I;  3LPS A;  2HHH E;  1FNM A;  5LMU I;  4LFA I;  4DR6 I;  2UXC E;  4DV1 E;  2UXB I;  3T1Y E;  2F4V I;  2VF1 A;  1ZXN A;  1UHZ A;  4NXM I;  1N33 E;  2UUA I;  4JI2 E;  1HNW E;  4DPW A;  3T1H E;  4LFB I;  5A2Q C;  1B62 A;  1XNQ I;  2XEX A;  1N32 I;  1MU5 A;  2RS7 A;  2MDR A;  2JY9 A;  1PVG A;  2N3G A;  4X65 I;  3T1Y I;  4USM A;  2UUB E;  2EZ6 A;  4AQY I;  1WUU A;  2MC5 A;  4OX9 E;  4JG4 A;  5GME A;  3LTO A;  4K0K E;  3ZKB A;  3K17 A;  4LTY A;  2LE2 A;  2V83 A;  4YHH E;  4JI4 I;  3P06 A;  4B3T E;  1YYO A;  4DXL A;  5FLX Q;  4JYA I;  1EA6 A;  1IBL I;  4Z7Y A;  2L2N A;  1I94 E;  1U2R A;  4MYT A;  4B3R I;  2F8B A;  4DR3 I;  4LF8 E;  2LTS A;  4JI0 E;  4LF9 I;  4LF6 E;  4WYQ B;  1T4O A;  2A2C A;  2CGE A;  2JOX A;  3ADL A;  1N36 I;  4DR5 I;  1XMO I;  4XTJ A;  1WXR A;  2UUC E;  3Q6N A;  3ZZ0 A;  4GKJ I;  1S16 A;  2O1U A;  2V2V A;  1KIJ A;  4B3M E;  1XMQ E;  4JI3 I;  4LF4 E;  2Q2E B;  4RPF A;  3JAM C;  2DB2 A;  1EKZ A;  3Q1Q A;  1FWK A;  3OTO E;  3QT7 A;  4WFT A;  2LUP B;  1RR9 A;  4HYM A;  2UUC I;  5CFF E;  1IBM E;  2R42 A;  1MX0 A;  4FW9 A;  2M7Q A;  5BR8 E;  4BC9 A;  2DSY A;  1NZ0 A;  1EI1 A;  4DUZ E;  3HJC A;  5A2Q Q;  5AE1 A;  1N34 E;  5L3J A;  2BM1 A;  1KTV A;  1ELO A;  1ZBT A;  3OTO I;  5FLX C;  4N3O A;  4DV3 E;  2UXD E;  3F6G A;  1IBM I;  1X49 A;  1FJG E;  2M4I A;  4ED4 A;  2YT4 A;  3ADG A;  1KKH A;  3V2U C;  4FWD A;  4DUZ I;  3DF6 A;  5IWA E;  2JWO A;  3VYY A;  1Z59 A;  4I8O A;  2UXD I;  1X48 A;  1FI4 A;  1O0W A;  4DU8 A;  4X66 E;  4DR1 E;  2M1S A;  3HXL A;  5LMU E;  4DR6 E;  2V2Z A;  2IOQ A;  4Q28 A;  1Z0B A;  3F0N A;  4MYU A;  3QT6 A;  2UXB E;  4UT4 A;  2JVA A;  1Z5A A;  4NXM E;  4USK A;  2ODR C;  3J81 C;  2Z5E A;  4IZK B;  4BCA A;  4DV0 I;  4DR1 I;  4LFB E;  1H7U A;  3PRY A;  4GKK E;  1XNQ E;  1ZXM A;  4WUC A;  1N32 E;  2LBS B;  1Z5B A;  2ZIT A;  1ZM3 A;  2N3H A;  4JI8 I;  3VK6 A;  3J80 Q;  4IZK A;  4X65 E;  4DKK A;  4AQY E;  4L5N C;  1Z0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...