4X65E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x65E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x65E02
1VISA 4YY3I 2ZM6E 2LRSA 3PYFA 4LF7I 4DR2E 2NPFA 1PKPA 1FI4A 5BR8I 3VYXA 1Z5CA 1O0WA 4DV4E 2NUEA 1EKZA 1IBME 2B7TA 4DV7I 1XMQI 4NXNE 2KHXA 4JV5E 5A2QC 2N3GA 1Z0VA 4DV6E 1XNRI 1MX0A 3QT6A 1Z0CA 4USMA 5A2QQ 3ZKDA 2R42A 4URLA 1D6TA 1H73A 2X7IA 2VQEI 3QT5A 4KHPE 1X49A 1K47A 3PYDA 1B63A 4MYUA 4JI7E 4JI6E 4B3SE 1RREA 4JI1E 2LTSA 2F4VI 3J7Yp 2EZ6A 1MU5A 3J7AM 2UXBI 4X8WA 1ELOA 4LF9I 4DV2E 3B78A 1EA6A 2HHHI 2LUQA 4LFBE 2Q2EB 4ZVIA 4WYQB 1IBLE 2LTRA 2V2ZA 2DEJA 4DR4I 1XNQI 1N0VC 4X65I 3ZZTA 1T4OA 4PU9A 4WUDA 4JYAE 2UUBE 4JI0E 4LF5I 4LF6E 1S4EA 3ADIA 1HR0I 3ZM7A 4DR1I 4JI4I 1XMOE 1J5EI 1WUUA 1WHNA 5LMNI 1KTVA 1A6FA 1HNZI 3T1HE 1KKHA 1Z0TA 2VF3A 2HFSA 3P1XA 1MG7A 1HNWI 1RR9A 1N32E 1ZXMA 2WW4A 4LFAE 2ZM6I 4GKJI 4DV3I 4DR2I 2CPNA 1Z0GA 4KQVA 2UXCE 1ZXNA 3T1YE 3ZZ0A 4X66E 4DR7E 2BM0A 5LMUI 1FWLA 3WU4A 2JVAA 1ZM9A 1OJ4A 4HXZA 4DR6I 4DR3E 4JI8E 4PRXA 1PVGA 1STUA 4LFCE 3ZKBA 2V8PA 2RTXA 4X64I 3LNUA 4DPYA 1N36E 1H7UA 1B62A 2MDRA 5GMEA 2X36A 3J80C 2NUGA 1YYWA 2ZITA 2JY9A 1GQEA 2L2MA 1N33E 4JG4A 4I3HA 2E5LI 2V2QA 1ZM3A 4DV5E 4XTJA 3J80Q 4JI7I 2VQFE 4B3SI 4JI2E 4M30A 5GMDA 3GONA 4DR5E 3C4BA 3D4JA 1RQ0A 1ZM2A 4B3TI 4USKA 4RPFA 4PRVA 1T4LB 4FWGA 3V5RA 4LF4E 1S16A 2XEXA 1BKNA 3QT7A 1NZ0A 1ZBTA 4AQYI 2DEIA 3J81C 2DMYA 4OX9E 4YHHI 3V2UC 3M6AA 3ADJA 2RS6A 4P7AA 4LF7E 4DPTA 2UXDE 3J81Q 1QZRA 1T4NA 1DI2A 4DUZI 2E1RA 4DUYE 4JYAI 2OI2A 2LUPB 3WU3A 2V34A 4DKKA 1XMQE 3C4TA 3ZZUA 4NXMI 2B7VA 4X62E 1FJGE 1XNRE 2L3JA 1ZM4A 4MYTA 2YT4A 4JI5E 2EFGA 5CFFE 2UUAI 2DIXA 4WFTA 4EMDA 4LFAI 1UEKA 2UU9I 1Z59A 1X48A 2VQEE 3LTOA 2HK3A 4DXLA 3F0NA 4DV0E 3OTOE 2UXCI 1H74A 4FWHA 4B3MI 1IBKI 4DR7I 4GKKI 2RS7A 3CWVA 1NHIA 4FN5A 4LF8E 4P52A 3J7AG 4DR3I 4LF9E 4JI8I 2A2CA 2LJHA 4LFCI 1Z0WA 4UT4A 4DU7A 2ZBKB 2L2NA 1N36I 4DV4I 4K0KE 1XNQE 1IBMI 1KVKA 4X65E 4NXNI 4JV5I 1RC7A 4DV6I 1N33I 2J7KA 1YYOA 4OOGC 2VQFI 4JI2I 4JI4E 4DR1E 4M2ZA 4DV1E 1J5EE 1N34E 1Z5BA 4FW9A 2DB2A 1HNZE 1QU6A 1NHHA 1HNWE 4KHPI 3B8HA 3ADGA 4OX9I 1HNXE 2RSMA 5IWAE 2UUCE 4GKJE 3JAMQ 1I94E 4JI3E 1EI1A 2IHR1 4DV3E 4FWDA 2A2DA 2LJPA 3HTXA 4JI6I 2UXDI 4JI1I 3ADLA 1N0UA 2HKEA 4DUYI 2L3CA 3H4LA 4M1KA 2CZ9A 1PIEA 4DV2I 5IT9C 1Z5AA 2HFUA 5LMUE 4DU8A 1KIJA 4X62I 4LFBI 1FJGI 4Z7CA 1IBLI 4DR6E 4B3RE 5IT9Q 4DPXA 4YY3E 1U2RA 3HULA 2LBSB 1J26A 4JI5I 2N3HA 4X64E 1X47A 4WUBA 2UUBI 4JI0I 5BR8E 4LF6I 4HACA 4DV7E 4DV0I 5FLXC 3QT8A 3OTOI 1XMOI 1UHZA 3K17A 2E5LE 1FKAE 4DPUA 1DARA 3T1HI 2L33A 3LPSA 5FLXQ 4LF8I 3B82A 4B3TE 2B3TB 1Z0EA 1N32I 2NA2A 1YZ9A 3K1JA 4AQYE 4R1FA 1UILA 4UTGA 1WHQA 4WUCA 4YHHE 3T1YI 4X66I 4K0KI 2V2VA 2NUFA 3LLHA 2GS8A 4DUZE 1YYKA 2F4VE 1FWKA 2UXBE 5L3JA 1H72C 2HHHE 3WU6A 4NXME 4DV1I 1XHKA 1N34I 5LL6R 4ED4A 4DR4E 3PYEA 2HKJA 3PYGA 1H7SA 4HY1A 2UUAE 4LF5E 1HNXI 5IWAI 2UUCI 2HK2A 2L2KB 1Z0BA 2UU9E 4DV5I 1I94I 3VYYA 4JI3I 1FNMA 2R3VA 2BV3A 4DPWA 2AJ4A 4HACB 1NHJA 4Z7YA 1HR0E 3Q1QA 4DR5I 3WU5A 4B3ME 1IBKE 4HYMA 5LMNE 4GKKE 2BM1A 4LF4I 3JAMC 4B3RI
chains in the Genus database with same CATH superfamily
4F2JC 1VISA 4YY3I 2EOOA 2HC5A 2EPZA 2ZM6E 2L6MA 2LRSA 3PYFA 4LF7I 4AM3A 2EMKA 4QNJA 2EPMX 2WZOA 3KZZA 3F6GA 4DR2E 2NPFA 1PKPA 5IV8B 1FI4A 3EPJA 5BR8I 3VYXA 1ZXNA 2WBUA 1Z5CA 1AH5A 1O0WA 4DV4E 1R6MA 2NUEA 2EMWA 2V88A 1EKZA 1IBME 1IQSA 2E72A 2B7TA 2FTXB 4DV7I 4NXNE 2BR2A 2KHXA 4JV5E 1XMQI 5A2QC 2N3GA 4ISAA 1MGTA 1Z0VA 4DV6E 3ZOQB 2ENAA 4HTGA 4O5GA 1XNRI 2M4IA 3UHMA 1MX0A 2Z5CA 2NN6C 4IFDA 3QT6A 1Z0CA 4USMA 5A2QQ 3ZKDA 2R42A 2YTEA 2YRKA 3HJCA 4URLA 1D6TA 3U1KA 2PO0A 1H73A 2HGHA 2GQ0A 2O1UA 1IMUA 4IFDE 2FGGA 2LT7A 2EPXA 3GCMA 2IERA 2X7IA 4WXDA 2VQEI 2JEAA 3QT5A 1X5WA 2EOFA 2CVEA 4KHPE 2YTDA 1X49A 1K47A 4AIMA 4IFDD 2K4VA 3EPHA 1WXRA 3PYDA 2EM9A 1B63A 2PO1A 2BB8A 4MYUA 2R1FA 4JI7E 4JI6E 1HK7A 4B3SE 4P78A 4R2PA 2EMXA 3MSWA 1RREA 4JI1E 2LCEA 4LCGA 5DROA 1KJKA 2LTSA 2F4VI 3J7Yp 2EZ6A 3BIDA 1MU5A 3J7AM 1YUJA 4X8WA 2UXBI 4WX9A 1ELOA 4LF9I 3JU0A 4DV2E 3B78A 2LO3A 2EMBA 2EMFA 1EA6A 4IZJA 2HHHI 3GMEA 2LUQA 2EP3A 2C39A 4LFBE 2JOBA 2Q2EB 4WYQB 1VI7A 1IBLE 2LTRA 2C37B 4ZVIA 3M7ND 2LVHA 4LTYA 2V2ZA 3KZYA 1A1GA 2N8XA 2DEJA 1BB8A 4DR4I 1XNQI 1N0VC 4X65I 5K36C 3ZZTA 3AV0A 2PNZA 4F9CB 1T4OA 2EN4A 4PU9A 1Y5YA 4WUDA 4JYAE 2UUBE 1X6HA 4JI0E 4LF5I 4LF6E 2JXPA 4WPYA 1A1FA 4IZJD 5ELWA 2JP9A 4OKGA 2EORA 4KZSA 1S4EA 3ADIA 2BA0G 1OYPA 2BA1D 4R2SA 1HR0I 3ZM7A 4DR1I 2YTFA 4JI4I 4IFDF 1XMOE 1J5EI 1WUUA 1WHNA 4FW3A 4I8OA 5LMNI 1KTVA 2EN1A 1A6FA 1HNZI 4IJDA 5AC5A 3ECRA 2ODRD 5AASA 2RSIA 3T1HE 5F3WA 2C38B 5AE1A 1KKHA 1Z0TA 4R8OA 2VF3A 2HFSA 4FK5C 3P1XA 1MG7A 5KL2A 3BF2A 1HNWI 1RR9A 4NZVA 4X9JA 1N32E 5LLQA 2GO3A 5JEAC 2PO0B 2JEBB 2EMIA 1ZXMA 2WNRB 2WW4A 2Z5EA 4LFAE 2ZM6I 1X6FA 1B69A 4GKJI 3MHHC 4DV3I 2GPIA 2YRMA 2EPOA 5DRRA 2EM6A 4DR2I 2CPNA 1TN9A 1Z0GA 4KQVA 3THOB 2UXCE 3M99B 5DNYA 4BS9A 3QG5C 4F9BB 4F6MA 3T1YE 3OMLA 4WXCA 2JE6B 3ZZ0A 4X66E 4LCHA 1I94I 1DGCA 4DR7E 2BM0A 4FW4A 4U3BA 2DLKA 3U1YA 5LMUI 2MKDA 1T38A 1FWLA 2GLIA 3WU4A 4OO1F 2JVAA 1Z1BA 3FIGA 1ZM9A 1OJ4A 4HXZA 2EOXA 2VE7C 5AE2A 4R2CA 4AIDA 4DR6I 4HEIA 2CSHA 4JI8E 4DR3E 4PRXA 2ENHA 1PVGA 4N4RB 3MHSC 1STUA 4LFCE 4OO1B 3ZKBA 5KL5A 2V8PA 2RTXA 4X64I 4IZJB 3LNUA 4M9VC 4DPYA 5C0XA 1ZBQA 5A6KA 1N36E 2VRDA 1H7UA 2C39B 1B62A 2MDRA 4O4KA 3DJWA 1GZ6A 5GMEA 2X36A 3J80C 1A1KA 2NUGA 1YYWA 2ZITA 5C0XE 2JY9A 3LMLA 3PS3A 1GQEA 2V87A 2L2MA 4TUGA 2M7QA 2YSPA 1N33E 2JT2A 2GO4A 4JG4A 4LPFA 2C38A 2PNZB 4I3HA 2E5LI 5TSEA 4F54A 2V2QA 1ZM3A 4DV5E 4XTJA 3J80Q 4JI7I 2VQFE 2KONA 2PO2B 4B3SI 4JI2E 4M30A 4MU0A 1P42A 1BBGA 2WBTA 5GMDA 2MC5A 3GONA 2EPAA 4MU1A 4DR5E 2EL6A 2O3ZA 2ELYA 3C4BA 2JEBA 2M1SA 1YH8A 2WNRA 3D4JA 4O24A 1RQ0A 1ZM2A 4B3TI 4USKA 2L92A 4RPFA 4PRVA 2YTPA 2EPPA 1T4LB 4FWGA 2YTGA 1ZR9A 4LF4E 1S16A 3V5RA 2XEXA 4J8ZA 1BKNA 3QT7A 2I9IA 1ZBTA 1NZ0A 4U3DA 2JE6A 2DEIA 3J81C 4AQYI 4BBYA 1MEYC 4BMJA 2DMYA 4OX9E 2V86A 3HPZA 2EWLA 4FW6A 3THNA 4YHHI 3V2UC 3M6AA 2EN3A 3ADJA 2L8TA 2JOXA 2RS6A 4P7AA 4LF7E 2PRTA 1Y4UA 4DPTA 2UXDE 3J81Q 2PNLA 5K36B 1EH8A 1T4NA 2EM4A 1DI2A 1QZRA 4DUZI 2E1RA 3H09A 4DUYE 2EM0A 4JYAI 2EL4A 1PJSA 2G7HA 1E3PA 2OI2A 3GLLA 2EPCA 2YTIA 2YZTA 1SFEA 2YWQA 4OO1A 2LUPB 1BBOA 1G2DC 4GEQB 2V34A 3WU3A 2ADRA 4DKKA 3P3CA 1XMQE 2EPLX 3C4TA 3ZZUA 4MLVA 1G2FC 2B7VA 3EPKA 4NXMI 4X62E 5KL7A 1FJGE 3VK6A 1XNRE 4OO1E 2L3JA 1ZM4A 4IS9A 1WJPA 5C0XF 5JEAF 1GTKA 4MYTA 4IZKA 2YT4A 4JI5E 1USVA 4R2QA 2YTQA 2EFGA 5CFFE 4BHCA 3IWDA 2ELZA 1JK2A 4OO1D 2UUAI 2RQLA 2YPNA 2DIXA 4WFTA 2PO2A 1P47A 5JEAB 4ZYEA 4EMDA 5C0XB 1PJQA 4LFAI 1UEKA 2UU9I 1Z59A 1X48A 2VQEE 2M9AA 1N3GA 2V8QB 2HK3A 3LTOA 1JK1A 4OZEA 4DMIA 4DXLA 3F0NA 2EN2A 2GHFA 4O43A 4DV0E 1YUIA 2EM5A 3OTOE 2UXCI 1H74A 4FWHA 4B3MI 1IBKI 5KL3A 4RHBB 3K6QA 3KRNA 4DR7I 4GKKI 2RS7A 4R2EA 4R2AA 3CWVA 2KOUA 1NHIA 2EMGA 1USUA 2EOQA 4FN5A 4LF8E 2DMIA 2H36X 3L7ZA 4P52A 4BA2A 2V89A 2RPCA 4WSGA 2JR1A 1TF3A 3J7AG 3BBGA 2YTJA 4F9AB 4LF9E 2A2CA 2BA0D 2LJHA 4JI8I 4DR3I 2EOZA 3PS1A 4LFCI 5K36A 2EJ4A 1Z0WA 2EOYA 2EOEA 4UT4A 2F1DA 2CT1A 2DSYA 2LE2A 4DU7A 2ZBKB 1L4SA 2YU5A 2L2NA 1N36I 3P76A 2MDGA 2O1WA 3PS2A 3M85G 3Q6NA 1A1HA 4DV4I 5K36E 4K0KE 1XNQE 1IBMI 4JI3I 1KVKA 2NN6F 4X65E 4RH8A 1ZAAC 4NXNI 4JV5I 1ZU1A 1RC7A 2WP8A 3PRYA 2E1MA 1F2IG 2B9DA 4DV6I 2J7KA 1N33I 5K36D 1YYOA 1A1IA 4FW7A 2O1VA 4OOGC 2NN6B 4BA1A 2VQFI 4BHBA 3IWBA 2LMZA 3HQ1A 4JI2I 5T6JA 4MU3A 4JI4E 4DR1E 4M2ZA 2EOSA 4DV1E 1J5EE 5DRPA 2YU8A 5JEAA 1QNTA 1N34E 1Z5BA 4FW9A 5DNXA 4MQYA 2DB2A 1HNZE 4DV5I 1QU6A 4LU9A 3C6MA 2R76A 2NABA 5DNLA 1NCSA 2ENCA 3UK3C 1NHHA 4IFDC 1OYRA 2JYAA 2DRPA 4QNKA 3EPLA 1HNWE 5JEAE 4KHPI 2DLQA 3B8HA 3ADGA 1AAYA 2EPUA 2EL5A 1T39A 4IZKB 4OX9I 1UBDC 5ADZA 2WCC3 2LJUA 1HNXE 1Y60A 2A25A 2RSMA 5IWAE 2UUCE 4GKJE 1UDSA 1UN6B 1I94E 3JAMQ 4JI3E 2IHR1 1EI1A 4DV3E 1EH6A 2A2DA 3HTXA 2LJPA 4FWDA 1UDOA 4JI6I 2UXDI 4JI1I 3ADLA 5C0XD 5JEAD 1N0UA 2HKEA 4DUYI 1YPNA 2L3CA 3H4LA 2MKNA 3NZKA 4M1KA 2CZ9A 1PIEA 4DV2I 5IT9C 5A6BA 1Z5AA 2EM8A 2HFUA 5LMUE 4DU8A 3BGHA 2BBGA 1KIJA 5KL4A 1SR9A 5DRQA 2F8BA 4X62I 5K36F 3EQ1A 4LFBI 5IXMB 1FJGI 4Z7CA 1IBLI 4DR6E 4B3RE 1YHCA 3Q6MA 5IT9Q 4DPXA 3L7ZB 4YY3E 4BA2B 3B4TA 1RMDA 1U2RA 3HULA 4OO1C 2YRHA 2K7IA 2LBSB 3HKMA 4NHRA 1J26A 1OYSA 4JI5I 2VF1A 2MC6A 2N3HA 4X64E 4IS1C 1X47A 1A1JA 4R2RA 1Y4SA 2CGEA 4R2DA 2CG9A 3CDJA 4WUBA 2WBSA 2UUBI 2NN6A 4JI0I 5A6BD 5BR8E 1LLMC 3K85A 1IQOA 4LF6I 1X6EA 2EPKX 2EM2A 1WRJA 5KL6A 1YFHA 2I13A 4HACA 2EMHA 2Z5BA 2YSOA 3L00A 4P7DA 5EL9A 2EOHA 4DV7E 2EM3A 4TUIA 4GQUA 2EQ0A 2FV4B 5AC4A 5FLXC 4DV0I 3QT8A 2ODRC 2Q8UA 4M0VA 3OTOI 2EN8A 1XMOI 1UHZA 1YSAC 4BC9A 1R6LA 2NN6E 3K17A 2V83A 2E5LE 2WP8B 1FKAE 4DPUA 1DARA 3M7NG 3IWCA 4LOMA 2L33A 2D9HA 1NEIA 5A69A 3T1HI 2EMZA 3LPSA 5FLXQ 2VESA 2J7JA 4LF8I 4BA1B 2NN6D 3B82A 1A1LA 4B3TE 2B3TB 1Z0EA 1N32I 2NA2A 2EOJA 1YZ9A 4ZYGA 5FWKA 2IOQA 3K1JA 3P06A 3F6HA 4AQYE 2EQ1A 4R1FA 1Y6ZA 2EOMA 1UILA 4F6NA 2BA1G 2EMYA 2JPAA 2O1TA 1WHQA 1UDNA 4YHHE 4UTGA 2EMAA 4MDTA 4WUCA 3T1YI 4X66I 4K0KI 4LCFA 1E3HA 2V2VA 2NUFA 3LLHA 2GS8A 4DUZE 1YYKA 3CDIA 2LV2A 2F4VE 1FWKA 2IOPA 1EH7A 3C6KA 2UXBE 4J3DA 2AE8A 5L3JA 4WSPA 1RHYA 4MU4A 5EKWA 1H72C 3VHTB 2HHHE 4NBQA 3WU6A 4NXME 4DV1I 1XHKA 2BR2B 2JWOA 4R03A 1N34I 5LL6R 2HJJA 1X3CA 2YTNA 2CTDA 4Q35B 2IESA 2J65A 4ED4A 2EM7A 2YTOA 5AE3A 4DR4E 2Z5CB 2EQ3A 3HPSA 4IFDB 3PYEA 1PDAA 2HKJA 2V85A 1TF6A 5A6JA 2EE8A 4ZYDA 3PYGA 1UDQA 1H7SA 4N3OA 1KYQA 4HY1A 2EN7A 3AUZA 2UUAE 1XXEA 3HXLA 2EPRA 4LF5E 5C0XC 1HNXI 2EN6A 4BCAA 5IWAI 2UUCI 2HK2A 2L2KB 4MLQA 2UU9E 1Z0BA 2PNMA 3VYYA 3H1CA 3DF6A 2EMLA 4Q28A 1FNMA 2BV3A 2R3VA 2EOIA 4DPWA 2EMCA 4L8NA 3P3GA 2AJ4A 4FW5A 1NHJA 4HACB 3RMPA 4Z7YA 5A6AA 2DGCA 1HR0E 2Z5BB 3DD6A 2JEAB 3JTZA 1DQ3A 3M85D 4DR5I 3Q1QA 3WU5A 2EPNA 4B3ME 1IBKE 4GZNC 5LMNE 4HYMA 3KWRA 4GKKE 4L5NC 4ZYHA 4BC7A 2BM1A 3P3EA 4LF4I 3TQMA 2C37A 2PO1B 3JAMC 4KWYA 1PJTA 4B3RI
chains in the Genus database with same CATH topology
1VISA 4YY3I 2ZM6E 2L6MA 2LRSA 3PYFA 4LF7I 2WZOA 4DR2E 3F6GA 2NPFA 1PKPA 1FI4A 5BR8I 3VYXA 1Z5CA 1O0WA 4DV4E 2NUEA 1EKZA 2V88A 1IBME 2FTXB 2B7TA 4DV7I 1XMQI 4NXNE 2KHXA 4JV5E 5A2QC 2N3GA 1Z0VA 4DV6E 3ZOQB 1XNRI 2M4IA 1MX0A 2Z5CA 3QT6A 1Z0CA 4USMA 5A2QQ 3ZKDA 2R42A 3HJCA 4URLA 1D6TA 1H73A 2GQ0A 2O1UA 2FGGA 2X7IA 2VQEI 3QT5A 4KHPE 1X49A 1K47A 2K4VA 1WXRA 3PYDA 1B63A 4MYUA 4JI7E 4JI6E 1HK7A 4B3SE 4P78A 3MSWA 1RREA 4JI1E 2LTSA 2F4VI 3J7Yp 2EZ6A 1MU5A 3J7AM 2UXBI 4X8WA 1ELOA 4LF9I 3JU0A 4DV2E 3B78A 1EA6A 4IZJA 2HHHI 2LUQA 4LFBE 2JOBA 2Q2EB 4WYQB 4ZVIA 1IBLE 2LTRA 4LTYA 2V2ZA 2DEJA 4DR4I 1XNQI 1N0VC 4X65I 3ZZTA 3AV0A 4F9CB 1T4OA 4PU9A 4WUDA 4JYAE 2UUBE 4JI0E 4LF5I 4LF6E 4IZJD 4WPYA 4KZSA 1S4EA 3ADIA 1HR0I 3ZM7A 4DR1I 4JI4I 1XMOE 1J5EI 1WUUA 1WHNA 4I8OA 5LMNI 1KTVA 1A6FA 1HNZI 5AASA 2ODRD 3T1HE 5F3WA 5AE1A 1KKHA 1Z0TA 4R8OA 2VF3A 2HFSA 3P1XA 1MG7A 1HNWI 1RR9A 1N32E 2Z5EA 1ZXMA 2WW4A 4LFAE 2ZM6I 4GKJI 4DV3I 4DR2I 2CPNA 1Z0GA 4KQVA 2UXCE 5DNYA 3T1YE 4BS9A 4F9BB 1ZXNA 3ZZ0A 3OMLA 4X66E 4DR7E 2BM0A 5LMUI 1FWLA 3WU4A 2JVAA 1ZM9A 3FIGA 1OJ4A 4HXZA 2VE7C 5AE2A 4DR6I 4DR3E 4JI8E 4PRXA 1PVGA 1STUA 4LFCE 3ZKBA 2V8PA 2RTXA 4X64I 4IZJB 3LNUA 4DPYA 1ZBQA 1N36E 1H7UA 1B62A 2MDRA 3DJWA 1GZ6A 5GMEA 2X36A 3J80C 2NUGA 1YYWA 2ZITA 2JY9A 3LMLA 1GQEA 2V87A 2L2MA 4TUGA 2M7QA 1N33E 4JG4A 4I3HA 2E5LI 4F54A 2V2QA 1ZM3A 4DV5E 4XTJA 3J80Q 4JI7I 2VQFE 2KONA 4B3SI 4JI2E 4M30A 5GMDA 2MC5A 3GONA 4DR5E 3C4BA 2M1SA 3D4JA 1RQ0A 1ZM2A 4B3TI 4USKA 2L92A 4RPFA 4PRVA 1T4LB 4FWGA 3V5RA 4LF4E 1S16A 2XEXA 4J8ZA 1BKNA 3QT7A 1NZ0A 1ZBTA 4AQYI 2DEIA 3J81C 4BBYA 4BMJA 2DMYA 4OX9E 2V86A 3HPZA 2EWLA 4YHHI 3V2UC 3M6AA 3ADJA 2L8TA 2JOXA 2RS6A 4P7AA 4LF7E 1Y4UA 4DPTA 2UXDE 3J81Q 2PNLA 1T4NA 1QZRA 1DI2A 4DUZI 2E1RA 3H09A 4DUYE 4JYAI 2G7HA 2OI2A 2YZTA 2LUPB 4GEQB 2V34A 3WU3A 4DKKA 1XMQE 3C4TA 3ZZUA 4NXMI 2B7VA 4X62E 1FJGE 3VK6A 1XNRE 2L3JA 1ZM4A 4MYTA 4IZKA 2YT4A 4JI5E 1USVA 2EFGA 5CFFE 3IWDA 2UUAI 2DIXA 4WFTA 4EMDA 4LFAI 1UEKA 2UU9I 1Z59A 1X48A 2VQEE 2V8QB 3LTOA 2HK3A 4DMIA 4DXLA 3F0NA 4DV0E 3OTOE 2UXCI 1H74A 4FWHA 4B3MI 1IBKI 3K6QA 4DR7I 4GKKI 2RS7A 3CWVA 2KOUA 1NHIA 1USUA 4FN5A 4LF8E 2H36X 4P52A 2V89A 2JR1A 3J7AG 4F9AB 4LF9E 4JI8I 2A2CA 4DR3I 2LJHA 4LFCI 1Z0WA 4UT4A 2DSYA 2LE2A 4DU7A 2ZBKB 2L2NA 1N36I 2O1WA 4DV4I 3Q6NA 4K0KE 1XNQE 1IBMI 1KVKA 4X65E 4NXNI 4JV5I 1RC7A 3PRYA 2E1MA 2B9DA 4DV6I 2J7KA 1N33I 1YYOA 2O1VA 4OOGC 2VQFI 3IWBA 2LMZA 3HQ1A 4JI2I 5T6JA 4JI4E 4DR1E 4M2ZA 4DV1E 1J5EE 1N34E 1Z5BA 4FW9A 2DB2A 1HNZE 1QU6A 4LU9A 1NHHA 1HNWE 4KHPI 3B8HA 3ADGA 4IZKB 4OX9I 5ADZA 1HNXE 2RSMA 5IWAE 2UUCE 4GKJE 3JAMQ 1I94E 4JI3E 1EI1A 2IHR1 4DV3E 4FWDA 2A2DA 3HTXA 2LJPA 4JI6I 2UXDI 4JI1I 3ADLA 1N0UA 2HKEA 4DUYI 2L3CA 3H4LA 4M1KA 2CZ9A 1PIEA 4DV2I 5IT9C 1Z5AA 2HFUA 5LMUE 4DU8A 1KIJA 1SR9A 2F8BA 4X62I 4LFBI 1FJGI 4Z7CA 1IBLI 4DR6E 4B3RE 3Q6MA 5IT9Q 4DPXA 4YY3E 1U2RA 3HULA 2LBSB 1J26A 4JI5I 2VF1A 2MC6A 2N3HA 4X64E 2CGEA 1X47A 1Y4SA 4WUBA 2CG9A 2UUBI 4JI0I 5BR8E 3K85A 4LF6I 4HACA 2Z5BA 4P7DA 4DV7E 4TUIA 4DV0I 2FV4B 5FLXC 3QT8A 2ODRC 4M0VA 3OTOI 1XMOI 1UHZA 4BC9A 3K17A 2V83A 2E5LE 1FKAE 4DPUA 1DARA 3IWCA 3T1HI 2L33A 3LPSA 5FLXQ 4LF8I 3B82A 4B3TE 2B3TB 1Z0EA 1N32I 2NA2A 1YZ9A 5FWKA 2IOQA 3K1JA 3P06A 3F6HA 4AQYE 4R1FA 1Y6ZA 1UILA 2O1TA 4UTGA 1WHQA 4WUCA 4YHHE 3T1YI 4X66I 4K0KI 2V2VA 2NUFA 3LLHA 2GS8A 4DUZE 1YYKA 2F4VE 1FWKA 2IOPA 2UXBE 5L3JA 4WSPA 1H72C 2HHHE 3WU6A 4NXME 4DV1I 1XHKA 2JWOA 4R03A 1N34I 5LL6R 4ED4A 5AE3A 4DR4E 2Z5CB 3HPSA 3PYEA 2HKJA 2V85A 3PYGA 4N3OA 1H7SA 4HY1A 3AUZA 2UUAE 3HXLA 4LF5E 1HNXI 4BCAA 5IWAI 2UUCI 2HK2A 2L2KB 1Z0BA 2UU9E 2PNMA 4DV5I 3VYYA 1I94I 3DF6A 4Q28A 1FNMA 2R3VA 2BV3A 4JI3I 4DPWA 4L8NA 2AJ4A 4HACB 1NHJA 4Z7YA 3RMPA 1HR0E 2Z5BB 3Q1QA 3JTZA 1DQ3A 4DR5I 3WU5A 4B3ME 1IBKE 4HYMA 5LMNE 3KWRA 4GKKE 4L5NC 2BM1A 4BC7A 4LF4I 3JAMC 4B3RI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIS A;  4YY3 I;  2ZM6 E;  2LRS A;  3PYF A;  4LF7 I;  4DR2 E;  2NPF A;  1PKP A;  1FI4 A;  5BR8 I;  3VYX A;  1Z5C A;  1O0W A;  4DV4 E;  2NUE A;  1EKZ A;  1IBM E;  2B7T A;  4DV7 I;  1XMQ I;  4NXN E;  2KHX A;  4JV5 E;  5A2Q C;  2N3G A;  1Z0V A;  4DV6 E;  1XNR I;  1MX0 A;  3QT6 A;  1Z0C A;  4USM A;  5A2Q Q;  3ZKD A;  2R42 A;  4URL A;  1D6T A;  1H73 A;  2X7I A;  2VQE I;  3QT5 A;  4KHP E;  1X49 A;  1K47 A;  3PYD A;  1B63 A;  4MYU A;  4JI7 E;  4JI6 E;  4B3S E;  1RRE A;  4JI1 E;  2LTS A;  2F4V I;  3J7Y p;  2EZ6 A;  1MU5 A;  3J7A M;  2UXB I;  4X8W A;  1ELO A;  4LF9 I;  4DV2 E;  3B78 A;  1EA6 A;  2HHH I;  2LUQ A;  4LFB E;  2Q2E B;  4ZVI A;  4WYQ B;  1IBL E;  2LTR A;  2V2Z A;  2DEJ A;  4DR4 I;  1XNQ I;  1N0V C;  4X65 I;  3ZZT A;  1T4O A;  4PU9 A;  4WUD A;  4JYA E;  2UUB E;  4JI0 E;  4LF5 I;  4LF6 E;  1S4E A;  3ADI A;  1HR0 I;  3ZM7 A;  4DR1 I;  4JI4 I;  1XMO E;  1J5E I;  1WUU A;  1WHN A;  5LMN I;  1KTV A;  1A6F A;  1HNZ I;  3T1H E;  1KKH A;  1Z0T A;  2VF3 A;  2HFS A;  3P1X A;  1MG7 A;  1HNW I;  1RR9 A;  1N32 E;  1ZXM A;  2WW4 A;  4LFA E;  2ZM6 I;  4GKJ I;  4DV3 I;  4DR2 I;  2CPN A;  1Z0G A;  4KQV A;  2UXC E;  1ZXN A;  3T1Y E;  3ZZ0 A;  4X66 E;  4DR7 E;  2BM0 A;  5LMU I;  1FWL A;  3WU4 A;  2JVA A;  1ZM9 A;  1OJ4 A;  4HXZ A;  4DR6 I;  4DR3 E;  4JI8 E;  4PRX A;  1PVG A;  1STU A;  4LFC E;  3ZKB A;  2V8P A;  2RTX A;  4X64 I;  3LNU A;  4DPY A;  1N36 E;  1H7U A;  1B62 A;  2MDR A;  5GME A;  2X36 A;  3J80 C;  2NUG A;  1YYW A;  2ZIT A;  2JY9 A;  1GQE A;  2L2M A;  1N33 E;  4JG4 A;  4I3H A;  2E5L I;  2V2Q A;  1ZM3 A;  4DV5 E;  4XTJ A;  3J80 Q;  4JI7 I;  2VQF E;  4B3S I;  4JI2 E;  4M30 A;  5GMD A;  3GON A;  4DR5 E;  3C4B A;  3D4J A;  1RQ0 A;  1ZM2 A;  4B3T I;  4USK A;  4RPF A;  4PRV A;  1T4L B;  4FWG A;  3V5R A;  4LF4 E;  1S16 A;  2XEX A;  1BKN A;  3QT7 A;  1NZ0 A;  1ZBT A;  4AQY I;  2DEI A;  3J81 C;  2DMY A;  4OX9 E;  4YHH I;  3V2U C;  3M6A A;  3ADJ A;  2RS6 A;  4P7A A;  4LF7 E;  4DPT A;  2UXD E;  3J81 Q;  1QZR A;  1T4N A;  1DI2 A;  4DUZ I;  2E1R A;  4DUY E;  4JYA I;  2OI2 A;  2LUP B;  3WU3 A;  2V34 A;  4DKK A;  1XMQ E;  3C4T A;  3ZZU A;  4NXM I;  2B7V A;  4X62 E;  1FJG E;  1XNR E;  2L3J A;  1ZM4 A;  4MYT A;  2YT4 A;  4JI5 E;  2EFG A;  5CFF E;  2UUA I;  2DIX A;  4WFT A;  4EMD A;  4LFA I;  1UEK A;  2UU9 I;  1Z59 A;  1X48 A;  2VQE E;  3LTO A;  2HK3 A;  4DXL A;  3F0N A;  4DV0 E;  3OTO E;  2UXC I;  1H74 A;  4FWH A;  4B3M I;  1IBK I;  4DR7 I;  4GKK I;  2RS7 A;  3CWV A;  1NHI A;  4FN5 A;  4LF8 E;  4P52 A;  3J7A G;  4DR3 I;  4LF9 E;  4JI8 I;  2A2C A;  2LJH A;  4LFC I;  1Z0W A;  4UT4 A;  4DU7 A;  2ZBK B;  2L2N A;  1N36 I;  4DV4 I;  4K0K E;  1XNQ E;  1IBM I;  1KVK A;  4X65 E;  4NXN I;  4JV5 I;  1RC7 A;  4DV6 I;  1N33 I;  2J7K A;  1YYO A;  4OOG C;  2VQF I;  4JI2 I;  4JI4 E;  4DR1 E;  4M2Z A;  4DV1 E;  1J5E E;  1N34 E;  1Z5B A;  4FW9 A;  2DB2 A;  1HNZ E;  1QU6 A;  1NHH A;  1HNW E;  4KHP I;  3B8H A;  3ADG A;  4OX9 I;  1HNX E;  2RSM A;  5IWA E;  2UUC E;  4GKJ E;  3JAM Q;  1I94 E;  4JI3 E;  1EI1 A;  2IHR 1;  4DV3 E;  4FWD A;  2A2D A;  2LJP A;  3HTX A;  4JI6 I;  2UXD I;  4JI1 I;  3ADL A;  1N0U A;  2HKE A;  4DUY I;  2L3C A;  3H4L A;  4M1K A;  2CZ9 A;  1PIE A;  4DV2 I;  5IT9 C;  1Z5A A;  2HFU A;  5LMU E;  4DU8 A;  1KIJ A;  4X62 I;  4LFB I;  1FJG I;  4Z7C A;  1IBL I;  4DR6 E;  4B3R E;  5IT9 Q;  4DPX A;  4YY3 E;  1U2R A;  3HUL A;  2LBS B;  1J26 A;  4JI5 I;  2N3H A;  4X64 E;  1X47 A;  4WUB A;  2UUB I;  4JI0 I;  5BR8 E;  4LF6 I;  4HAC A;  4DV7 E;  4DV0 I;  5FLX C;  3QT8 A;  3OTO I;  1XMO I;  1UHZ A;  3K17 A;  2E5L E;  1FKA E;  4DPU A;  1DAR A;  3T1H I;  2L33 A;  3LPS A;  5FLX Q;  4LF8 I;  3B82 A;  4B3T E;  2B3T B;  1Z0E A;  1N32 I;  2NA2 A;  1YZ9 A;  3K1J A;  4AQY E;  4R1F A;  1UIL A;  4UTG A;  1WHQ A;  4WUC A;  4YHH E;  3T1Y I;  4X66 I;  4K0K I;  2V2V A;  2NUF A;  3LLH A;  2GS8 A;  4DUZ E;  1YYK A;  2F4V E;  1FWK A;  2UXB E;  5L3J A;  1H72 C;  2HHH E;  3WU6 A;  4NXM E;  4DV1 I;  1XHK A;  1N34 I;  5LL6 R;  4ED4 A;  4DR4 E;  3PYE A;  2HKJ A;  3PYG A;  1H7S A;  4HY1 A;  2UUA E;  4LF5 E;  1HNX I;  5IWA I;  2UUC I;  2HK2 A;  2L2K B;  1Z0B A;  2UU9 E;  4DV5 I;  1I94 I;  3VYY A;  4JI3 I;  1FNM A;  2R3V A;  2BV3 A;  4DPW A;  2AJ4 A;  4HAC B;  1NHJ A;  4Z7Y A;  1HR0 E;  3Q1Q A;  4DR5 I;  3WU5 A;  4B3M E;  1IBK E;  4HYM A;  5LMN E;  4GKK E;  2BM1 A;  4LF4 I;  3JAM C;  4B3R I; 
#chains in the Genus database with same CATH topology
 4F2J C;  1VIS A;  4YY3 I;  2EOO A;  2HC5 A;  2EPZ A;  2ZM6 E;  2L6M A;  2LRS A;  3PYF A;  4LF7 I;  4AM3 A;  2EMK A;  4QNJ A;  2EPM X;  2WZO A;  3KZZ A;  3F6G A;  4DR2 E;  2NPF A;  1PKP A;  5IV8 B;  1FI4 A;  3EPJ A;  5BR8 I;  3VYX A;  1ZXN A;  2WBU A;  1Z5C A;  1AH5 A;  1O0W A;  4DV4 E;  1R6M A;  2NUE A;  2EMW A;  2V88 A;  1EKZ A;  1IBM E;  1IQS A;  2E72 A;  2B7T A;  2FTX B;  4DV7 I;  4NXN E;  2BR2 A;  2KHX A;  4JV5 E;  1XMQ I;  5A2Q C;  2N3G A;  4ISA A;  1MGT A;  1Z0V A;  4DV6 E;  3ZOQ B;  2ENA A;  4HTG A;  4O5G A;  1XNR I;  2M4I A;  3UHM A;  1MX0 A;  2Z5C A;  2NN6 C;  4IFD A;  3QT6 A;  1Z0C A;  4USM A;  5A2Q Q;  3ZKD A;  2R42 A;  2YTE A;  2YRK A;  3HJC A;  4URL A;  1D6T A;  3U1K A;  2PO0 A;  1H73 A;  2HGH A;  2GQ0 A;  2O1U A;  1IMU A;  4IFD E;  2FGG A;  2LT7 A;  2EPX A;  3GCM A;  2IER A;  2X7I A;  4WXD A;  2VQE I;  2JEA A;  3QT5 A;  1X5W A;  2EOF A;  2CVE A;  4KHP E;  2YTD A;  1X49 A;  1K47 A;  4AIM A;  4IFD D;  2K4V A;  3EPH A;  1WXR A;  3PYD A;  2EM9 A;  1B63 A;  2PO1 A;  2BB8 A;  4MYU A;  2R1F A;  4JI7 E;  4JI6 E;  1HK7 A;  4B3S E;  4P78 A;  4R2P A;  2EMX A;  3MSW A;  1RRE A;  4JI1 E;  2LCE A;  4LCG A;  5DRO A;  1KJK A;  2LTS A;  2F4V I;  3J7Y p;  2EZ6 A;  3BID A;  1MU5 A;  3J7A M;  1YUJ A;  4X8W A;  2UXB I;  4WX9 A;  1ELO A;  4LF9 I;  3JU0 A;  4DV2 E;  3B78 A;  2LO3 A;  2EMB A;  2EMF A;  1EA6 A;  4IZJ A;  2HHH I;  3GME A;  2LUQ A;  2EP3 A;  2C39 A;  4LFB E;  2JOB A;  2Q2E B;  4WYQ B;  1VI7 A;  1IBL E;  2LTR A;  2C37 B;  4ZVI A;  3M7N D;  2LVH A;  4LTY A;  2V2Z A;  3KZY A;  1A1G A;  2N8X A;  2DEJ A;  1BB8 A;  4DR4 I;  1XNQ I;  1N0V C;  4X65 I;  5K36 C;  3ZZT A;  3AV0 A;  2PNZ A;  4F9C B;  1T4O A;  2EN4 A;  4PU9 A;  1Y5Y A;  4WUD A;  4JYA E;  2UUB E;  1X6H A;  4JI0 E;  4LF5 I;  4LF6 E;  2JXP A;  4WPY A;  1A1F A;  4IZJ D;  5ELW A;  2JP9 A;  4OKG A;  2EOR A;  4KZS A;  1S4E A;  3ADI A;  2BA0 G;  1OYP A;  2BA1 D;  4R2S A;  1HR0 I;  3ZM7 A;  4DR1 I;  2YTF A;  4JI4 I;  4IFD F;  1XMO E;  1J5E I;  1WUU A;  1WHN A;  4FW3 A;  4I8O A;  5LMN I;  1KTV A;  2EN1 A;  1A6F A;  1HNZ I;  4IJD A;  5AC5 A;  3ECR A;  2ODR D;  5AAS A;  2RSI A;  3T1H E;  5F3W A;  2C38 B;  5AE1 A;  1KKH A;  1Z0T A;  4R8O A;  2VF3 A;  2HFS A;  4FK5 C;  3P1X A;  1MG7 A;  5KL2 A;  3BF2 A;  1HNW I;  1RR9 A;  4NZV A;  4X9J A;  1N32 E;  5LLQ A;  2GO3 A;  5JEA C;  2PO0 B;  2JEB B;  2EMI A;  1ZXM A;  2WNR B;  2WW4 A;  2Z5E A;  4LFA E;  2ZM6 I;  1X6F A;  1B69 A;  4GKJ I;  3MHH C;  4DV3 I;  2GPI A;  2YRM A;  2EPO A;  5DRR A;  2EM6 A;  4DR2 I;  2CPN A;  1TN9 A;  1Z0G A;  4KQV A;  3THO B;  2UXC E;  3M99 B;  5DNY A;  4BS9 A;  3QG5 C;  4F9B B;  4F6M A;  3T1Y E;  3OML A;  4WXC A;  2JE6 B;  3ZZ0 A;  4X66 E;  4LCH A;  1I94 I;  1DGC A;  4DR7 E;  2BM0 A;  4FW4 A;  4U3B A;  2DLK A;  3U1Y A;  5LMU I;  2MKD A;  1T38 A;  1FWL A;  2GLI A;  3WU4 A;  4OO1 F;  2JVA A;  1Z1B A;  3FIG A;  1ZM9 A;  1OJ4 A;  4HXZ A;  2EOX A;  2VE7 C;  5AE2 A;  4R2C A;  4AID A;  4DR6 I;  4HEI A;  2CSH A;  4JI8 E;  4DR3 E;  4PRX A;  2ENH A;  1PVG A;  4N4R B;  3MHS C;  1STU A;  4LFC E;  4OO1 B;  3ZKB A;  5KL5 A;  2V8P A;  2RTX A;  4X64 I;  4IZJ B;  3LNU A;  4M9V C;  4DPY A;  5C0X A;  1ZBQ A;  5A6K A;  1N36 E;  2VRD A;  1H7U A;  2C39 B;  1B62 A;  2MDR A;  4O4K A;  3DJW A;  1GZ6 A;  5GME A;  2X36 A;  3J80 C;  1A1K A;  2NUG A;  1YYW A;  2ZIT A;  5C0X E;  2JY9 A;  3LML A;  3PS3 A;  1GQE A;  2V87 A;  2L2M A;  4TUG A;  2M7Q A;  2YSP A;  1N33 E;  2JT2 A;  2GO4 A;  4JG4 A;  4LPF A;  2C38 A;  2PNZ B;  4I3H A;  2E5L I;  5TSE A;  4F54 A;  2V2Q A;  1ZM3 A;  4DV5 E;  4XTJ A;  3J80 Q;  4JI7 I;  2VQF E;  2KON A;  2PO2 B;  4B3S I;  4JI2 E;  4M30 A;  4MU0 A;  1P42 A;  1BBG A;  2WBT A;  5GMD A;  2MC5 A;  3GON A;  2EPA A;  4MU1 A;  4DR5 E;  2EL6 A;  2O3Z A;  2ELY A;  3C4B A;  2JEB A;  2M1S A;  1YH8 A;  2WNR A;  3D4J A;  4O24 A;  1RQ0 A;  1ZM2 A;  4B3T I;  4USK A;  2L92 A;  4RPF A;  4PRV A;  2YTP A;  2EPP A;  1T4L B;  4FWG A;  2YTG A;  1ZR9 A;  4LF4 E;  1S16 A;  3V5R A;  2XEX A;  4J8Z A;  1BKN A;  3QT7 A;  2I9I A;  1ZBT A;  1NZ0 A;  4U3D A;  2JE6 A;  2DEI A;  3J81 C;  4AQY I;  4BBY A;  1MEY C;  4BMJ A;  2DMY A;  4OX9 E;  2V86 A;  3HPZ A;  2EWL A;  4FW6 A;  3THN A;  4YHH I;  3V2U C;  3M6A A;  2EN3 A;  3ADJ A;  2L8T A;  2JOX A;  2RS6 A;  4P7A A;  4LF7 E;  2PRT A;  1Y4U A;  4DPT A;  2UXD E;  3J81 Q;  2PNL A;  5K36 B;  1EH8 A;  1T4N A;  2EM4 A;  1DI2 A;  1QZR A;  4DUZ I;  2E1R A;  3H09 A;  4DUY E;  2EM0 A;  4JYA I;  2EL4 A;  1PJS A;  2G7H A;  1E3P A;  2OI2 A;  3GLL A;  2EPC A;  2YTI A;  2YZT A;  1SFE A;  2YWQ A;  4OO1 A;  2LUP B;  1BBO A;  1G2D C;  4GEQ B;  2V34 A;  3WU3 A;  2ADR A;  4DKK A;  3P3C A;  1XMQ E;  2EPL X;  3C4T A;  3ZZU A;  4MLV A;  1G2F C;  2B7V A;  3EPK A;  4NXM I;  4X62 E;  5KL7 A;  1FJG E;  3VK6 A;  1XNR E;  4OO1 E;  2L3J A;  1ZM4 A;  4IS9 A;  1WJP A;  5C0X F;  5JEA F;  1GTK A;  4MYT A;  4IZK A;  2YT4 A;  4JI5 E;  1USV A;  4R2Q A;  2YTQ A;  2EFG A;  5CFF E;  4BHC A;  3IWD A;  2ELZ A;  1JK2 A;  4OO1 D;  2UUA I;  2RQL A;  2YPN A;  2DIX A;  4WFT A;  2PO2 A;  1P47 A;  5JEA B;  4ZYE A;  4EMD A;  5C0X B;  1PJQ A;  4LFA I;  1UEK A;  2UU9 I;  1Z59 A;  1X48 A;  2VQE E;  2M9A A;  1N3G A;  2V8Q B;  2HK3 A;  3LTO A;  1JK1 A;  4OZE A;  4DMI A;  4DXL A;  3F0N A;  2EN2 A;  2GHF A;  4O43 A;  4DV0 E;  1YUI A;  2EM5 A;  3OTO E;  2UXC I;  1H74 A;  4FWH A;  4B3M I;  1IBK I;  5KL3 A;  4RHB B;  3K6Q A;  3KRN A;  4DR7 I;  4GKK I;  2RS7 A;  4R2E A;  4R2A A;  3CWV A;  2KOU A;  1NHI A;  2EMG A;  1USU A;  2EOQ A;  4FN5 A;  4LF8 E;  2DMI A;  2H36 X;  3L7Z A;  4P52 A;  4BA2 A;  2V89 A;  2RPC A;  4WSG A;  2JR1 A;  1TF3 A;  3J7A G;  3BBG A;  2YTJ A;  4F9A B;  4LF9 E;  2A2C A;  2BA0 D;  2LJH A;  4JI8 I;  4DR3 I;  2EOZ A;  3PS1 A;  4LFC I;  5K36 A;  2EJ4 A;  1Z0W A;  2EOY A;  2EOE A;  4UT4 A;  2F1D A;  2CT1 A;  2DSY A;  2LE2 A;  4DU7 A;  2ZBK B;  1L4S A;  2YU5 A;  2L2N A;  1N36 I;  3P76 A;  2MDG A;  2O1W A;  3PS2 A;  3M85 G;  3Q6N A;  1A1H A;  4DV4 I;  5K36 E;  4K0K E;  1XNQ E;  1IBM I;  4JI3 I;  1KVK A;  2NN6 F;  4X65 E;  4RH8 A;  1ZAA C;  4NXN I;  4JV5 I;  1ZU1 A;  1RC7 A;  2WP8 A;  3PRY A;  2E1M A;  1F2I G;  2B9D A;  4DV6 I;  2J7K A;  1N33 I;  5K36 D;  1YYO A;  1A1I A;  4FW7 A;  2O1V A;  4OOG C;  2NN6 B;  4BA1 A;  2VQF I;  4BHB A;  3IWB A;  2LMZ A;  3HQ1 A;  4JI2 I;  5T6J A;  4MU3 A;  4JI4 E;  4DR1 E;  4M2Z A;  2EOS A;  4DV1 E;  1J5E E;  5DRP A;  2YU8 A;  5JEA A;  1QNT A;  1N34 E;  1Z5B A;  4FW9 A;  5DNX A;  4MQY A;  2DB2 A;  1HNZ E;  4DV5 I;  1QU6 A;  4LU9 A;  3C6M A;  2R76 A;  2NAB A;  5DNL A;  1NCS A;  2ENC A;  3UK3 C;  1NHH A;  4IFD C;  1OYR A;  2JYA A;  2DRP A;  4QNK A;  3EPL A;  1HNW E;  5JEA E;  4KHP I;  2DLQ A;  3B8H A;  3ADG A;  1AAY A;  2EPU A;  2EL5 A;  1T39 A;  4IZK B;  4OX9 I;  1UBD C;  5ADZ A;  2WCC 3;  2LJU A;  1HNX E;  1Y60 A;  2A25 A;  2RSM A;  5IWA E;  2UUC E;  4GKJ E;  1UDS A;  1UN6 B;  1I94 E;  3JAM Q;  4JI3 E;  2IHR 1;  1EI1 A;  4DV3 E;  1EH6 A;  2A2D A;  3HTX A;  2LJP A;  4FWD A;  1UDO A;  4JI6 I;  2UXD I;  4JI1 I;  3ADL A;  5C0X D;  5JEA D;  1N0U A;  2HKE A;  4DUY I;  1YPN A;  2L3C A;  3H4L A;  2MKN A;  3NZK A;  4M1K A;  2CZ9 A;  1PIE A;  4DV2 I;  5IT9 C;  5A6B A;  1Z5A A;  2EM8 A;  2HFU A;  5LMU E;  4DU8 A;  3BGH A;  2BBG A;  1KIJ A;  5KL4 A;  1SR9 A;  5DRQ A;  2F8B A;  4X62 I;  5K36 F;  3EQ1 A;  4LFB I;  5IXM B;  1FJG I;  4Z7C A;  1IBL I;  4DR6 E;  4B3R E;  1YHC A;  3Q6M A;  5IT9 Q;  4DPX A;  3L7Z B;  4YY3 E;  4BA2 B;  3B4T A;  1RMD A;  1U2R A;  3HUL A;  4OO1 C;  2YRH A;  2K7I A;  2LBS B;  3HKM A;  4NHR A;  1J26 A;  1OYS A;  4JI5 I;  2VF1 A;  2MC6 A;  2N3H A;  4X64 E;  4IS1 C;  1X47 A;  1A1J A;  4R2R A;  1Y4S A;  2CGE A;  4R2D A;  2CG9 A;  3CDJ A;  4WUB A;  2WBS A;  2UUB I;  2NN6 A;  4JI0 I;  5A6B D;  5BR8 E;  1LLM C;  3K85 A;  1IQO A;  4LF6 I;  1X6E A;  2EPK X;  2EM2 A;  1WRJ A;  5KL6 A;  1YFH A;  2I13 A;  4HAC A;  2EMH A;  2Z5B A;  2YSO A;  3L00 A;  4P7D A;  5EL9 A;  2EOH A;  4DV7 E;  2EM3 A;  4TUI A;  4GQU A;  2EQ0 A;  2FV4 B;  5AC4 A;  5FLX C;  4DV0 I;  3QT8 A;  2ODR C;  2Q8U A;  4M0V A;  3OTO I;  2EN8 A;  1XMO I;  1UHZ A;  1YSA C;  4BC9 A;  1R6L A;  2NN6 E;  3K17 A;  2V83 A;  2E5L E;  2WP8 B;  1FKA E;  4DPU A;  1DAR A;  3M7N G;  3IWC A;  4LOM A;  2L33 A;  2D9H A;  1NEI A;  5A69 A;  3T1H I;  2EMZ A;  3LPS A;  5FLX Q;  2VES A;  2J7J A;  4LF8 I;  4BA1 B;  2NN6 D;  3B82 A;  1A1L A;  4B3T E;  2B3T B;  1Z0E A;  1N32 I;  2NA2 A;  2EOJ A;  1YZ9 A;  4ZYG A;  5FWK A;  2IOQ A;  3K1J A;  3P06 A;  3F6H A;  4AQY E;  2EQ1 A;  4R1F A;  1Y6Z A;  2EOM A;  1UIL A;  4F6N A;  2BA1 G;  2EMY A;  2JPA A;  2O1T A;  1WHQ A;  1UDN A;  4YHH E;  4UTG A;  2EMA A;  4MDT A;  4WUC A;  3T1Y I;  4X66 I;  4K0K I;  4LCF A;  1E3H A;  2V2V A;  2NUF A;  3LLH A;  2GS8 A;  4DUZ E;  1YYK A;  3CDI A;  2LV2 A;  2F4V E;  1FWK A;  2IOP A;  1EH7 A;  3C6K A;  2UXB E;  4J3D A;  2AE8 A;  5L3J A;  4WSP A;  1RHY A;  4MU4 A;  5EKW A;  1H72 C;  3VHT B;  2HHH E;  4NBQ A;  3WU6 A;  4NXM E;  4DV1 I;  1XHK A;  2BR2 B;  2JWO A;  4R03 A;  1N34 I;  5LL6 R;  2HJJ A;  1X3C A;  2YTN A;  2CTD A;  4Q35 B;  2IES A;  2J65 A;  4ED4 A;  2EM7 A;  2YTO A;  5AE3 A;  4DR4 E;  2Z5C B;  2EQ3 A;  3HPS A;  4IFD B;  3PYE A;  1PDA A;  2HKJ A;  2V85 A;  1TF6 A;  5A6J A;  2EE8 A;  4ZYD A;  3PYG A;  1UDQ A;  1H7S A;  4N3O A;  1KYQ A;  4HY1 A;  2EN7 A;  3AUZ A;  2UUA E;  1XXE A;  3HXL A;  2EPR A;  4LF5 E;  5C0X C;  1HNX I;  2EN6 A;  4BCA A;  5IWA I;  2UUC I;  2HK2 A;  2L2K B;  4MLQ A;  2UU9 E;  1Z0B A;  2PNM A;  3VYY A;  3H1C A;  3DF6 A;  2EML A;  4Q28 A;  1FNM A;  2BV3 A;  2R3V A;  2EOI A;  4DPW A;  2EMC A;  4L8N A;  3P3G A;  2AJ4 A;  4FW5 A;  1NHJ A;  4HAC B;  3RMP A;  4Z7Y A;  5A6A A;  2DGC A;  1HR0 E;  2Z5B B;  3DD6 A;  2JEA B;  3JTZ A;  1DQ3 A;  3M85 D;  4DR5 I;  3Q1Q A;  3WU5 A;  2EPN A;  4B3M E;  1IBK E;  4GZN C;  5LMN E;  4HYM A;  3KWR A;  4GKK E;  4L5N C;  4ZYH A;  4BC7 A;  2BM1 A;  3P3E A;  4LF4 I;  3TQM A;  2C37 A;  2PO1 B;  3JAM C;  4KWY A;  1PJT A;  4B3R I; 
#chains in the Genus database with same CATH homology
 1VIS A;  4YY3 I;  2ZM6 E;  2L6M A;  2LRS A;  3PYF A;  4LF7 I;  2WZO A;  4DR2 E;  3F6G A;  2NPF A;  1PKP A;  1FI4 A;  5BR8 I;  3VYX A;  1Z5C A;  1O0W A;  4DV4 E;  2NUE A;  1EKZ A;  2V88 A;  1IBM E;  2FTX B;  2B7T A;  4DV7 I;  1XMQ I;  4NXN E;  2KHX A;  4JV5 E;  5A2Q C;  2N3G A;  1Z0V A;  4DV6 E;  3ZOQ B;  1XNR I;  2M4I A;  1MX0 A;  2Z5C A;  3QT6 A;  1Z0C A;  4USM A;  5A2Q Q;  3ZKD A;  2R42 A;  3HJC A;  4URL A;  1D6T A;  1H73 A;  2GQ0 A;  2O1U A;  2FGG A;  2X7I A;  2VQE I;  3QT5 A;  4KHP E;  1X49 A;  1K47 A;  2K4V A;  1WXR A;  3PYD A;  1B63 A;  4MYU A;  4JI7 E;  4JI6 E;  1HK7 A;  4B3S E;  4P78 A;  3MSW A;  1RRE A;  4JI1 E;  2LTS A;  2F4V I;  3J7Y p;  2EZ6 A;  1MU5 A;  3J7A M;  2UXB I;  4X8W A;  1ELO A;  4LF9 I;  3JU0 A;  4DV2 E;  3B78 A;  1EA6 A;  4IZJ A;  2HHH I;  2LUQ A;  4LFB E;  2JOB A;  2Q2E B;  4WYQ B;  4ZVI A;  1IBL E;  2LTR A;  4LTY A;  2V2Z A;  2DEJ A;  4DR4 I;  1XNQ I;  1N0V C;  4X65 I;  3ZZT A;  3AV0 A;  4F9C B;  1T4O A;  4PU9 A;  4WUD A;  4JYA E;  2UUB E;  4JI0 E;  4LF5 I;  4LF6 E;  4IZJ D;  4WPY A;  4KZS A;  1S4E A;  3ADI A;  1HR0 I;  3ZM7 A;  4DR1 I;  4JI4 I;  1XMO E;  1J5E I;  1WUU A;  1WHN A;  4I8O A;  5LMN I;  1KTV A;  1A6F A;  1HNZ I;  5AAS A;  2ODR D;  3T1H E;  5F3W A;  5AE1 A;  1KKH A;  1Z0T A;  4R8O A;  2VF3 A;  2HFS A;  3P1X A;  1MG7 A;  1HNW I;  1RR9 A;  1N32 E;  2Z5E A;  1ZXM A;  2WW4 A;  4LFA E;  2ZM6 I;  4GKJ I;  4DV3 I;  4DR2 I;  2CPN A;  1Z0G A;  4KQV A;  2UXC E;  5DNY A;  3T1Y E;  4BS9 A;  4F9B B;  1ZXN A;  3ZZ0 A;  3OML A;  4X66 E;  4DR7 E;  2BM0 A;  5LMU I;  1FWL A;  3WU4 A;  2JVA A;  1ZM9 A;  3FIG A;  1OJ4 A;  4HXZ A;  2VE7 C;  5AE2 A;  4DR6 I;  4DR3 E;  4JI8 E;  4PRX A;  1PVG A;  1STU A;  4LFC E;  3ZKB A;  2V8P A;  2RTX A;  4X64 I;  4IZJ B;  3LNU A;  4DPY A;  1ZBQ A;  1N36 E;  1H7U A;  1B62 A;  2MDR A;  3DJW A;  1GZ6 A;  5GME A;  2X36 A;  3J80 C;  2NUG A;  1YYW A;  2ZIT A;  2JY9 A;  3LML A;  1GQE A;  2V87 A;  2L2M A;  4TUG A;  2M7Q A;  1N33 E;  4JG4 A;  4I3H A;  2E5L I;  4F54 A;  2V2Q A;  1ZM3 A;  4DV5 E;  4XTJ A;  3J80 Q;  4JI7 I;  2VQF E;  2KON A;  4B3S I;  4JI2 E;  4M30 A;  5GMD A;  2MC5 A;  3GON A;  4DR5 E;  3C4B A;  2M1S A;  3D4J A;  1RQ0 A;  1ZM2 A;  4B3T I;  4USK A;  2L92 A;  4RPF A;  4PRV A;  1T4L B;  4FWG A;  3V5R A;  4LF4 E;  1S16 A;  2XEX A;  4J8Z A;  1BKN A;  3QT7 A;  1NZ0 A;  1ZBT A;  4AQY I;  2DEI A;  3J81 C;  4BBY A;  4BMJ A;  2DMY A;  4OX9 E;  2V86 A;  3HPZ A;  2EWL A;  4YHH I;  3V2U C;  3M6A A;  3ADJ A;  2L8T A;  2JOX A;  2RS6 A;  4P7A A;  4LF7 E;  1Y4U A;  4DPT A;  2UXD E;  3J81 Q;  2PNL A;  1T4N A;  1QZR A;  1DI2 A;  4DUZ I;  2E1R A;  3H09 A;  4DUY E;  4JYA I;  2G7H A;  2OI2 A;  2YZT A;  2LUP B;  4GEQ B;  2V34 A;  3WU3 A;  4DKK A;  1XMQ E;  3C4T A;  3ZZU A;  4NXM I;  2B7V A;  4X62 E;  1FJG E;  3VK6 A;  1XNR E;  2L3J A;  1ZM4 A;  4MYT A;  4IZK A;  2YT4 A;  4JI5 E;  1USV A;  2EFG A;  5CFF E;  3IWD A;  2UUA I;  2DIX A;  4WFT A;  4EMD A;  4LFA I;  1UEK A;  2UU9 I;  1Z59 A;  1X48 A;  2VQE E;  2V8Q B;  3LTO A;  2HK3 A;  4DMI A;  4DXL A;  3F0N A;  4DV0 E;  3OTO E;  2UXC I;  1H74 A;  4FWH A;  4B3M I;  1IBK I;  3K6Q A;  4DR7 I;  4GKK I;  2RS7 A;  3CWV A;  2KOU A;  1NHI A;  1USU A;  4FN5 A;  4LF8 E;  2H36 X;  4P52 A;  2V89 A;  2JR1 A;  3J7A G;  4F9A B;  4LF9 E;  4JI8 I;  2A2C A;  4DR3 I;  2LJH A;  4LFC I;  1Z0W A;  4UT4 A;  2DSY A;  2LE2 A;  4DU7 A;  2ZBK B;  2L2N A;  1N36 I;  2O1W A;  4DV4 I;  3Q6N A;  4K0K E;  1XNQ E;  1IBM I;  1KVK A;  4X65 E;  4NXN I;  4JV5 I;  1RC7 A;  3PRY A;  2E1M A;  2B9D A;  4DV6 I;  2J7K A;  1N33 I;  1YYO A;  2O1V A;  4OOG C;  2VQF I;  3IWB A;  2LMZ A;  3HQ1 A;  4JI2 I;  5T6J A;  4JI4 E;  4DR1 E;  4M2Z A;  4DV1 E;  1J5E E;  1N34 E;  1Z5B A;  4FW9 A;  2DB2 A;  1HNZ E;  1QU6 A;  4LU9 A;  1NHH A;  1HNW E;  4KHP I;  3B8H A;  3ADG A;  4IZK B;  4OX9 I;  5ADZ A;  1HNX E;  2RSM A;  5IWA E;  2UUC E;  4GKJ E;  3JAM Q;  1I94 E;  4JI3 E;  1EI1 A;  2IHR 1;  4DV3 E;  4FWD A;  2A2D A;  3HTX A;  2LJP A;  4JI6 I;  2UXD I;  4JI1 I;  3ADL A;  1N0U A;  2HKE A;  4DUY I;  2L3C A;  3H4L A;  4M1K A;  2CZ9 A;  1PIE A;  4DV2 I;  5IT9 C;  1Z5A A;  2HFU A;  5LMU E;  4DU8 A;  1KIJ A;  1SR9 A;  2F8B A;  4X62 I;  4LFB I;  1FJG I;  4Z7C A;  1IBL I;  4DR6 E;  4B3R E;  3Q6M A;  5IT9 Q;  4DPX A;  4YY3 E;  1U2R A;  3HUL A;  2LBS B;  1J26 A;  4JI5 I;  2VF1 A;  2MC6 A;  2N3H A;  4X64 E;  2CGE A;  1X47 A;  1Y4S A;  4WUB A;  2CG9 A;  2UUB I;  4JI0 I;  5BR8 E;  3K85 A;  4LF6 I;  4HAC A;  2Z5B A;  4P7D A;  4DV7 E;  4TUI A;  4DV0 I;  2FV4 B;  5FLX C;  3QT8 A;  2ODR C;  4M0V A;  3OTO I;  1XMO I;  1UHZ A;  4BC9 A;  3K17 A;  2V83 A;  2E5L E;  1FKA E;  4DPU A;  1DAR A;  3IWC A;  3T1H I;  2L33 A;  3LPS A;  5FLX Q;  4LF8 I;  3B82 A;  4B3T E;  2B3T B;  1Z0E A;  1N32 I;  2NA2 A;  1YZ9 A;  5FWK A;  2IOQ A;  3K1J A;  3P06 A;  3F6H A;  4AQY E;  4R1F A;  1Y6Z A;  1UIL A;  2O1T A;  4UTG A;  1WHQ A;  4WUC A;  4YHH E;  3T1Y I;  4X66 I;  4K0K I;  2V2V A;  2NUF A;  3LLH A;  2GS8 A;  4DUZ E;  1YYK A;  2F4V E;  1FWK A;  2IOP A;  2UXB E;  5L3J A;  4WSP A;  1H72 C;  2HHH E;  3WU6 A;  4NXM E;  4DV1 I;  1XHK A;  2JWO A;  4R03 A;  1N34 I;  5LL6 R;  4ED4 A;  5AE3 A;  4DR4 E;  2Z5C B;  3HPS A;  3PYE A;  2HKJ A;  2V85 A;  3PYG A;  4N3O A;  1H7S A;  4HY1 A;  3AUZ A;  2UUA E;  3HXL A;  4LF5 E;  1HNX I;  4BCA A;  5IWA I;  2UUC I;  2HK2 A;  2L2K B;  1Z0B A;  2UU9 E;  2PNM A;  4DV5 I;  3VYY A;  1I94 I;  3DF6 A;  4Q28 A;  1FNM A;  2R3V A;  2BV3 A;  4JI3 I;  4DPW A;  4L8N A;  2AJ4 A;  4HAC B;  1NHJ A;  4Z7Y A;  3RMP A;  1HR0 E;  2Z5B B;  3Q1Q A;  3JTZ A;  1DQ3 A;  4DR5 I;  3WU5 A;  4B3M E;  1IBK E;  4HYM A;  5LMN E;  3KWR A;  4GKK E;  4L5N C;  2BM1 A;  4BC7 A;  4LF4 I;  3JAM C;  4B3R I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...