4X65E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x65E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x65E02
2BM0A 3LLHA 2MDRA 4DV2E 4LF4I 2CPNA 1A6FA 4DUYI 3J81Q 1XMQI 4LF5I 2RTXA 4AQYE 3ADIA 2HKEA 1N33I 3H4LA 4DPUA 1K47A 1NHIA 3ADGA 2NUFA 1XNRE 4WUBA 3PYEA 4Z7CA 4MYTA 1J5EI 1BKNA 1FI4A 4B3SE 4DV6I 2BV3A 3GONA 1KIJA 4DU8A 4PRXA 3VYYA 5FLXQ 4LFCE 4I3HA 3ZZTA 1H73A 4DR5I 4DV3E 2ZITA 1QU6A 4NXNI 4LF9I 3B78A 2KHXA 4JI1E 3OTOE 1XMOE 1N0UA 4LFAE 4FN5A 4JI6I 5LMUI 1ZM4A 4ED4A 4JI2E 4OOGC 1YYKA 1Z5AA 1D6TA 4JYAE 4WYQB 4B3ME 4DV2I 2AJ4A 1T4OA 4AQYI 1XHKA 1X48A 4XTJA 2LUQA 4B3RE 4FW9A 1IBMI 5GMDA 1XNRI 2ZBKB 1Z0TA 4B3SI 2VF3A 2DB2A 4USKA 1HR0E 2DIXA 3WU3A 1ZXNA 4DUYE 1XMQE 4LF5E 4FWDA 4KHPE 4M1KA 1H74A 2DEJA 1S16A 4LFCI 4X65I 1N0VC 3VYXA 2V2QA 4EMDA 1FNMA 4DV3I 5IT9Q 1J5EE 2VQFE 4JI5E 4DV6E 4HACB 4JI1I 2UXBE 3V2UC 2LRSA 3OTOI 4MYUA 1DI2A 4JI7E 2WW4A 4DPXA 4DPTA 4DKKA 4JI2I 1N34E 1XNQE 2BM1A 3J81C 2V2ZA 2DMYA 1STUA 2HFUA 4DR5E 2HK3A 2EFGA 2L33A 2UU9E 4JI4E 4PU9A 3HULA 1GQEA 3WU4A 1NHHA 3Q1QA 1Z0GA 5LMUE 4LF8E 3PYGA 3QT6A 4DR3E 4JI3E 1WHQA 5FLXC 1HR0I 5GMEA 4P52A 4GKKE 1Z0EA 1FJGE 1Z0VA 4KHPI 4X62E 2NPFA 2YT4A 2HFSA 1IBME 1Z0CA 1ZBTA 3B8HA 1ZM9A 1S4EA 2VQFI 4JI5I 2L3JA 2DEIA 2UXBI 4X8WA 2V34A 1IBKE 4JI7I 2A2CA 1X47A 3LTOA 3QT8A 1N34I 1XNQI 2N3GA 1IBLE 2X7IA 4X65E 1ZM2A 3K1JA 3WU6A 4LFBE 3JAMQ 1J26A 3C4TA 4OX9E 2VQEE 3ZKDA 4DV7I 3PYFA 2UU9I 4JI4I 1T4LB 4JI8I 4LF7I 4JI0E 4LF8I 1PKPA 5BR8E 1RQ0A 4DR3I 4JI3I 4WFTA 1B63A 4DV1E 1YYOA 3J80Q 1WHNA 4GKKI 2E5LE 1FJGI 5IT9C 2UUCE 4X62I 4RPFA 2L2NA 1MX0A 1NHJA 2NUGA 1MU5A 1T4NA 4Z7YA 1N32E 4DR4I 2J7KA 4UTGA 1IBKI 4B3TE 1I94I 2A2DA 2LJPA 1EI1A 4LF6E 3V5RA 4HY1A 2LTSA 1IBLI 4YHHE 4LFBI 4OX9I 3K17A 3J7Yp 2VQEI 2L3CA 2B7TA 1H72C 4JI0I 1ZXMA 2L2MA 5BR8I 1X49A 3ADJA 2NUEA 1U2RA 1EKZA 1N36E 1KKHA 1EA6A 1Z0BA 2LBSB 4DV1I 4DR6E 4DV7E 1FWLA 2E5LI 2GS8A 2RSMA 1FKAE 2UXDE 2UUCI 3LPSA 4JI8E 4LF7E 2F4VI 2X36A 3CWVA 1UILA 1HNZE 5A2QQ 4WUDA 2HHHE 1N32I 5LMNE 2V8PA 3JAMC 2NA2A 4HACA 4B3TI 4KQVA 1HNWE 4LF6I 3LNUA 4X66E 1HNXE 2RS6A 4YHHI 4M30A 1QZRA 4PRVA 2Q2EB 2L2KB 4JV5E 4NXME 1WUUA 2R3VA 4K0KE 4DV4E 4DR4E 1YYWA 1I94E 1Z5BA 4USMA 3QT5A 4GKJE 3J80C 3J7AM 2OI2A 1N36I 2E1RA 4DV5E 3T1YE 4YY3E 4DR6I 1VISA 2XEXA 2ZM6I 4DR7E 4DV0E 1ELOA 1H7SA 2UXDI 2R42A 2JY9A 1RR9A 1HNZI 3WU5A 3T1HE 2HHHI 2IHR1 5LMNI 2V2VA 2N3HA 2B3TB 3ZM7A 4DR1E 2HKJA 1HNWI 1KVKA 4DR2E 4M2ZA 1B62A 3ADLA 4X66I 1HNXI 4DXLA 4JG4A 1MG7A 1YZ9A 3ZZ0A 4JV5I 4NXMI 1PVGA 2UXCE 5IWAE 2EZ6A 2UUAE 4K0KI 4DUZE 4P7AA 2UUBE 4DV4I 1RC7A 3M6AA 1NZ0A 5CFFE 1O0WA 1OJ4A 4HYMA 4GKJI 1PIEA 3P1XA 4FWHA 3B82A 4DV5I 2RS7A 4URLA 3T1YI 3HTXA 4YY3I 4DPWA 4X64E 2B7VA 4DR7I 1Z0WA 4DV0I 2F4VE 5A2QC 3ZKBA 1KTVA 4DPYA 4HXZA 3F0NA 4LF4E 2LTRA 3T1HI 1H7UA 1N33E 2LJHA 5L3JA 3QT7A 4DR1I 2ZM6E 4DR2I 5LL6R 1RREA 3C4BA 3D4JA 4FWGA 3ZZUA 1XMOI 4LFAI 1UEKA 1FWKA 3PYDA 2UXCI 5IWAI 4WUCA 2HK2A 2UUAI 4DUZI 2UUBI 4JYAI 1DARA 4B3MI 2JVAA 4NXNE 1Z59A 4LF9E 4B3RI 1Z5CA 4JI6E 4X64I 1ZM3A 4UT4A 4R1FA 2CZ9A 1UHZA 2LUPB 4ZVIA 4DU7A 3J7AG
chains in the Genus database with same CATH superfamily
1JK2A 4BMJA 4LCHA 2BM0A 4LCFA 3LLHA 2EQ3A 2MDRA 4J8ZA 4DV2E 2CPNA 1A6FA 2Z5CA 4LF4I 4DUYI 3J81Q 1XMQI 5C0XD 4LF5I 4ZYGA 2YTFA 3MSWA 1Y4SA 2PNMA 2RTXA 4AQYE 3ADIA 5AE1A 1T39A 2HKEA 1N33I 2EE8A 3H4LA 2CTDA 1K47A 2LJUA 5DNLA 4DPUA 5K36E 4N4RB 2EOMA 1NHIA 3ADGA 2NUFA 1XNRE 1IMUA 4WUBA 3PYEA 4Z7CA 1T38A 4MYTA 3C6KA 4O43A 1J5EI 1BKNA 3NZKA 4GZNC 2EN4A 1FI4A 4B3SE 1A1HA 4DV6I 4F6MA 1JK1A 2BV3A 3GONA 4J3DA 1KIJA 4ZYDA 4DU8A 2I13A 3GMEA 4PRXA 2LV2A 2EOFA 2YTNA 4BBYA 2MC5A 4QNJA 3VYYA 1G2FC 5FLXQ 1UBDC 3M85D 2EMIA 2YU8A 5FWKA 1USUA 5JEAE 2NN6B 2MC6A 4MLVA 4LFCE 4R2SA 4I3HA 3ZZTA 2HJJA 2G7HA 4KWYA 2DGCA 1H73A 2EOJA 2VE7C 4DR5I 2ELYA 4DMIA 5KL6A 4DV3E 4IZJB 2ZITA 2PNLA 1QU6A 2PO2B 4NXNI 2EPAA 4FW6A 4LF9I 2R76A 1AAYA 3B78A 3P06A 3EPHA 2KHXA 4JI1E 3M99B 2YTPA 3OTOE 1XMOE 2O1WA 4LTYA 2DRPA 1N0UA 2EPPA 4LFAE 4FN5A 4JI6I 2WBTA 5LMUI 1ZM4A 2FTXB 4LU9A 4ED4A 4JI2E 4IS9A 4OO1C 2YWQA 2E72A 2EM0A 4OOGC 1YSAC 1YYKA 2Z5BA 1Z5AA 1D6TA 1X6EA 2DMIA 5C0XB 2CSHA 4R2PA 4JYAE 4WYQB 2WNRB 4B3ME 2EP3A 4DV2I 2FGGA 2V88A 2AJ4A 2EM6A 5LLQA 5DRRA 2BR2A 1T4OA 1X5WA 4AQYI 3P76A 4WXDA 2YTIA 2V8QB 1X48A 1HK7A 1XHKA 4XTJA 4F54A 1A1IA 2LUQA 4B3RE 2EMAA 4TUIA 4IZKA 4FW9A 1IBMI 5GMDA 1XNRI 4WSGA 5A6AA 2EOSA 2ZBKB 3BF2A 2EMZA 1Z0TA 1SR9A 2VF3A 2DB2A 4L8NA 4USKA 4B3SI 2JPAA 1KYQA 2EPMX 4BC9A 1HR0E 4BA2A 4IFDA 1TF6A 3Q6MA 4LPFA 2DIXA 3WU3A 3VHTB 1ZXNA 5K36A 4DUYE 2JXPA 1XMQE 4LF5E 4FWDA 4KHPE 4M1KA 4R2AA 1H74A 2DEJA 1S16A 4LFCI 4X65I 1N0VC 1IQSA 3VYXA 1WXRA 2V2QA 3THOB 3AUZA 4EMDA 3L7ZA 1UN6B 1FNMA 1PJTA 5KL7A 4DV3I 5IT9Q 4L5NC 2PO1A 1J5EE 2CT1A 5JEAC 2VQFE 1WJPA 4JI5E 4DV6E 4FW5A 4HACB 1YH8A 4JI1I 2UXBE 2F8BA 2LRSA 3HPZA 4R03A 5TSEA 1UDQA 2WCC3 1DI2A 4MYUA 3OTOI 2JEAB 2JEBB 4JI7E 2EMWA 2WW4A 1GTKA 2EN3A 4DPXA 4DPTA 4DKKA 2YSPA 2JE6A 4JI2I 2LVHA 3J81C 1N34E 1XNQE 2EM7A 2BM1A 4MDTA 2YPNA 2EOOA 2V2ZA 2EWLA 2GPIA 1A1LA 2DMYA 1STUA 2HFUA 4DR5E 4BA1A 2HK3A 2KOUA 2EFGA 2WP8A 2NN6F 4BHCA 2L33A 3TQMA 2UU9E 4JI4E 4R2DA 4IS1C 4ZYHA 3HULA 1GQEA 4PU9A 3WU4A 1NHHA 1EH6A 2RQLA 3Q1QA 2C38B 4OO1F 2RPCA 3M85G 3EPKA 1Z0GA 5AC4A 5LMUE 2EOQA 3UK3C 2LO3A 1AH5A 4R2CA 4LF8E 3KZZA 3PYGA 2HC5A 3QT6A 4FK5C 2IESA 5FLXC 4DR3E 1WHQA 4JI3E 2ELZA 1HR0I 3HQ1A 2Z5EA 4ZYEA 4LCGA 3THNA 1X3CA 2O1UA 4P52A 3IWCA 4GKKE 1RMDA 2WBSA 1FJGE 1Z0EA 5GMEA 1Z0VA 4KHPI 4X62E 1A1GA 2NPFA 2YT4A 2HFSA 5C0XF 4NZVA 4IFDE 3K85A 2EMHA 2EMGA 2CG9A 2YRMA 1IBME 1Z0CA 5K36D 2EM9A 1YPNA 2EN1A 1ZBTA 3B8HA 1ZM9A 1S4EA 2VQFI 1GZ6A 2L3JA 4JI5I 4Q35B 3P3CA 4F2JC 2EOZA 2DEIA 2UXBI 1ZAAC 4X8WA 2ADRA 2V34A 1IBKE 4JI7I 3M7ND 3ZOQB 1X47A 1WRJA 2A2CA 3LTOA 2WBUA 3QT8A 2YU5A 3HKMA 2ENHA 3CDJA 2EPNA 5IXMB 2J65A 1N34I 1XNQI 3EQ1A 5JEAD 1OYPA 2N3GA 3LMLA 1IBLE 3JU0A 4X65E 1ZM2A 2X7IA 4LFBE 1UDNA 3K1JA 5DROA 2GO4A 3WU6A 1VI7A 1J26A 2O1VA 1BBGA 2C39A 1UDOA 2EM3A 3C4TA 4OX9E 4OO1B 2VQEE 3ZKDA 3HXLA 1L4SA 3PYFA 4DV7I 2UU9I 4JI4I 5KL2A 2V86A 1T4LB 5AE2A 4JI8I 2EMYA 4LF7I 3U1KA 4JI0E 2I9IA 2GO3A 2EL4A 2O3ZA 4LOMA 4LF8I 1PKPA 5KL3A 3EPLA 5BR8E 3CDIA 1RQ0A 3FIGA 2VESA 4R2RA 2L8TA 4FW7A 4WFTA 4DR3I 4JI3I 1B63A 2VF1A 3IWBA 1X6HA 5A6BD 2BBGA 4DV1E 1YYOA 3JTZA 3J80Q 2C37B 2FV4B 1BBOA 1WHNA 4GKKI 2E5LE 1FJGI 5IT9C 1MEYC 2YTEA 2UUCE 4X62I 3F6GA 1UDSA 4RPFA 2EMBA 3ECRA 2L2NA 2M7QA 2Q8UA 1MX0A 1NHJA 2NN6A 2J7JA 2NUGA 1MU5A 3PS1A 1T4NA 4WSPA 4Z7YA 1YUJA 4GQUA 1N32E 4F9BB 4IZJA 2GLIA 2GQ0A 3BGHA 4DR4I 1ZU1A 2CGEA 1RHYA 4IFDC 2PNZB 3UHMA 2J7KA 2YRHA 4M0VA 2EN2A 2PO2A 4BC7A 4UTGA 1IBKI 5K36C 4B3TE 1I94I 4BHBA 4AIDA 1A1FA 1TF3A 2A2DA 2LJPA 2BB8A 1EI1A 5JEAB 2M9AA 4LF6E 5DNYA 1ZBQA 3V5RA 4M9VC 4HY1A 2LTSA 1IBLI 4YHHE 4F9AB 4LFBI 4OX9I 3K17A 3J7Yp 2NABA 2V85A 2VQEI 5C0XA 2WNRA 3PS3A 4OKGA 2L3CA 2EMLA 1A1KA 2B7TA 2YTGA 2IERA 2WP8B 2PO0B 1H72C 4JI0I 5IV8B 1ZXMA 2L2MA 2ENAA 2AE8A 5BR8I 1X49A 2EPCA 2EPZA 3ADJA 2NUEA 1U2RA 1YHCA 1EKZA 4RH8A 1N36E 4BCAA 3OMLA 1KKHA 1EA6A 1Z0BA 2EOHA 2LMZA 2LBSB 2V83A 2EN8A 4DV1I 2D9HA 4DR6E 5T6JA 4DV7E 1FWLA 3KRNA 2E5LI 2GS8A 2RSMA 1FKAE 2UXDE 2YSOA 3LPSA 2UUCI 4HEIA 2JWOA 2Z5CB 4JI8E 4N3OA 3M7NG 4LF7E 2F4VI 3PRYA 2EN7A 1IQOA 2X36A 3CWVA 3PS2A 2BA0D 1Y6ZA 1UILA 1HNZE 1OYRA 2ODRC 4WXCA 3IWDA 4WX9A 4WUDA 2HHHE 5A2QQ 5LMNE 1N32I 1MGTA 2V8PA 4U3BA 2BA1D 2NN6E 2DSYA 5KL4A 1PDAA 2MDGA 3JAMC 2NA2A 4HACA 4B3TI 4KQVA 3MHSC 4AIMA 2M1SA 3P3GA 1HNWE 2JEAA 4OO1E 2GHFA 4X9JA 2JEBA 4LF6I 3LNUA 4X66E 5ADZA 1HNXE 2L6MA 2RS6A 1Y60A 5AE3A 4YHHI 5DRPA 4M30A 2EPUA 1QZRA 4Q28A 4IFDD 2VRDA 2Q2EB 4P78A 3DJWA 2L2KB 1Z1BA 4JV5E 4PRVA 2IOQA 4I8OA 4NXME 3EPJA 4MU4A 3U1YA 1WUUA 2R3VA 3BIDA 2EM5A 4IJDA 4WPYA 4K0KE 5K36F 2ENCA 2EMKA 2KONA 4DV4E 4DR4E 2C39B 4MU0A 2YRKA 3F6HA 4U3DA 2L92A 2YTQA 1YYWA 3HJCA 1I94E 1Z5BA 4USMA 3BBGA 4KZSA 2JP9A 3QT5A 5C0XE 2K7IA 2LE2A 2EJ4A 2C38A 4QNKA 2EMFA 2IOPA 4GKJE 3J80C 3J7AM 2OI2A 4FW3A 2WZOA 5A6KA 1N36I 2E1RA 4DV5E 3T1YE 4MU1A 2EM2A 3Q6NA 2A25A 4YY3E 4O5GA 5JEAF 4DR6I 1B69A 2MKNA 4F6NA 1NEIA 4F9CB 1VISA 2F1DA 2XEXA 4R2EA 2ZM6I 4DR7E 2Z5BB 4DV0E 1DGCA 1ELOA 1H7SA 1SFEA 4HTGA 1LLMC 1OYSA 2R42A 2UXDI 3B4TA 2LCEA 2JY9A 4TUGA 4GEQB 1RR9A 2BR2B 4O24A 1HNZI 1YFHA 3WU5A 3T1HE 2JT2A 2YZTA 3L00A 5ELWA 2IHR1 2M4IA 4IZKB 5LMNI 2HHHI 1QNTA 1R6LA 2MKDA 2V2VA 2N3HA 1F2IG 1P42A 2EOXA 2B3TB 1NCSA 2EN6A 2JYAA 4DR1E 3ZM7A 2EPOA 3QG5C 2HKJA 4ISAA 3AV0A 1HNWI 4NBQA 1KVKA 4DR2E 1G2DC 4M2ZA 1B62A 5DRQA 5KL5A 3ADLA 4BA2B 4IFDB 2ODRD 1BB8A 3H1CA 4X66I 3KZYA 1HNXI 4DXLA 4JG4A 2EQ0A 1MG7A 2NN6C 1YZ9A 5K36B 4R8OA 3ZZ0A 4JV5I 2K4VA 5DNXA 2H36X 2JOBA 2YTOA 4NXMI 5EL9A 1PVGA 2UXCE 5IWAE 2EZ6A 2E1MA 1TN9A 3H09A 2UUAE 2R1FA 3DD6A 4OO1A 4DUZE 4P7AA 2UUBE 4DV4I 3L7ZB 1RC7A 4K0KI 2EOYA 3M6AA 1NZ0A 2PO1B 5CFFE 1EH7A 2CVEA 1P47A 3V2UC 1O0WA 2YTDA 2EPLX 1OJ4A 1R6MA 4HYMA 2EL6A 1PIEA 4GKJI 3C6MA 5A6JA 2N8XA 3P1XA 2RSIA 1Y4UA 2EORA 2BA0G 4FWHA 3B82A 4DV5I 2EOIA 2RS7A 4URLA 3T1YI 3HTXA 2JE6B 4YY3I 5C0XC 4O4KA 4DPWA 4X64E 2V89A 1E3PA 4NHRA 2O1TA 2BA1G 3GCMA 2B7VA 1Y5YA 4DR7I 1Z0WA 4DV0I 2F4VE 4MQYA 2C37A 5A2QC 4BA1B 2EL5A 5A69A 2HGHA 3ZKBA 1KTVA 1EH8A 4DPYA 4HXZA 3F0NA 4BS9A 4LF4E 2LTRA 4FW4A 4P7DA 3T1HI 1H7UA 1DQ3A 2EM8A 2EPKX 2JR1A 3P3EA 2JOXA 1ZR9A 1N33E 2LJHA 2V87A 5L3JA 3K6QA 3DF6A 2B9DA 3QT7A 4DR1I 2PNZA 4MLQA 2ZM6E 4DR2I 2EMXA 5LL6R 1RREA 4RHBB 5JEAA 3C4BA 3D4JA 4FWGA 3ZZUA 4AM3A 1XXEA 1XMOI 2EOEA 1KJKA 1UEKA 4LFAI 5F3WA 2EPXA 1FWKA 2EMCA 2DLQA 3PYDA 2UXCI 5IWAI 4WUCA 2HK2A 2UUAI 2YTJA 4DUZI 2UUBI 1USVA 3KWRA 2NN6D 2EM4A 3HPSA 3RMPA 4JYAI 5AASA 1DARA 3MHHC 4B3MI 1N3GA 3GLLA 2JVAA 2PO0A 4MU3A 4NXNE 1X6FA 2DLKA 1Z59A 4IZJD 5AC5A 2LT7A 4LF9E 4OO1D 2EPRA 1YUIA 1PJSA 1E3HA 4B3RI 5A6BA 1Z5CA 4JI6E 2EQ1A 4R2QA 1PJQA 3JAMQ 2PRTA 1A1JA 1ZM3A 4R1FA 2CZ9A 4UT4A 4X64I 4IFDF 3VK6A 1UHZA 2LUPB 5EKWA 4ZVIA 4OZEA 4DU7A 3J7AG
chains in the Genus database with same CATH topology
4BMJA 2BM0A 3LLHA 2MDRA 4DV2E 4J8ZA 2Z5CA 2CPNA 1A6FA 4LF4I 4DUYI 3J81Q 1XMQI 4LF5I 3MSWA 1Y4SA 2PNMA 2RTXA 4AQYE 3ADIA 5AE1A 2HKEA 1N33I 3H4LA 4DPUA 1K47A 1NHIA 3ADGA 2NUFA 1XNRE 4WUBA 3PYEA 4Z7CA 4MYTA 1J5EI 1BKNA 1FI4A 4B3SE 4DV6I 2BV3A 3GONA 1KIJA 4DU8A 4PRXA 4BBYA 2MC5A 3VYYA 5FLXQ 5FWKA 1USUA 2MC6A 4LFCE 4I3HA 3ZZTA 2G7HA 1H73A 4DR5I 2VE7C 4DMIA 4IZJB 4DV3E 2ZITA 2PNLA 1QU6A 4NXNI 4LF9I 3P06A 3B78A 2KHXA 4JI1E 3OTOE 2O1WA 1XMOE 4LTYA 1N0UA 4LFAE 4FN5A 4JI6I 5LMUI 1ZM4A 2FTXB 4LU9A 4ED4A 4JI2E 4OOGC 1YYKA 2Z5BA 1Z5AA 1D6TA 4JYAE 4WYQB 4B3ME 4DV2I 2FGGA 2V88A 2AJ4A 1T4OA 4AQYI 2V8QB 1X48A 1HK7A 1XHKA 4XTJA 4F54A 2LUQA 4B3RE 4IZKA 4TUIA 4FW9A 1IBMI 5GMDA 1XNRI 2ZBKB 1Z0TA 4B3SI 1SR9A 2VF3A 2DB2A 4L8NA 4USKA 4BC9A 1HR0E 3Q6MA 2DIXA 3WU3A 1ZXNA 4DUYE 1XMQE 4LF5E 4FWDA 4KHPE 4M1KA 1H74A 2DEJA 1S16A 4LFCI 4X65I 1N0VC 3VYXA 1WXRA 2V2QA 3AUZA 4EMDA 1FNMA 4DV3I 5IT9Q 4L5NC 1J5EE 2VQFE 4JI5E 4DV6E 4HACB 4JI1I 2UXBE 2F8BA 2LRSA 3HPZA 4R03A 4MYUA 3V2UC 3OTOI 1DI2A 4JI7E 2WW4A 4DPXA 4DPTA 4DKKA 4JI2I 1N34E 3J81C 1XNQE 2BM1A 2V2ZA 2EWLA 2DMYA 1STUA 2HFUA 4DR5E 2HK3A 2KOUA 2EFGA 2L33A 2UU9E 4JI4E 4PU9A 3HULA 1GQEA 3WU4A 1NHHA 3Q1QA 1Z0GA 5LMUE 4LF8E 3PYGA 3QT6A 5FLXC 4DR3E 1WHQA 4JI3E 1HR0I 3HQ1A 2Z5EA 5GMEA 2O1UA 4P52A 3IWCA 4GKKE 1Z0EA 1FJGE 1Z0VA 4KHPI 4X62E 2NPFA 2YT4A 2HFSA 3K85A 2CG9A 1IBME 1Z0CA 1ZBTA 3B8HA 1ZM9A 1S4EA 2VQFI 1GZ6A 2L3JA 4JI5I 2DEIA 2UXBI 4X8WA 2V34A 1IBKE 4JI7I 3ZOQB 1X47A 2A2CA 3LTOA 3QT8A 1N34I 1XNQI 2N3GA 3LMLA 1IBLE 3JU0A 4X65E 1ZM2A 2X7IA 4LFBE 3K1JA 3WU6A 1J26A 2O1VA 3C4TA 4OX9E 2VQEE 3ZKDA 3HXLA 3PYFA 4DV7I 2UU9I 4JI4I 2V86A 1T4LB 5AE2A 4JI8I 4LF7I 4JI0E 4LF8I 1PKPA 5BR8E 1RQ0A 3FIGA 4DR3I 2L8TA 4JI3I 4WFTA 1B63A 2VF1A 3IWBA 4DV1E 1YYOA 3JTZA 3J80Q 2FV4B 1WHNA 4GKKI 2E5LE 1FJGI 5IT9C 2UUCE 4X62I 3F6GA 4RPFA 2L2NA 2M7QA 1MX0A 1NHJA 2NUGA 1MU5A 1T4NA 4WSPA 4Z7YA 1N32E 4F9BB 4IZJA 2GQ0A 4DR4I 2CGEA 2J7KA 4M0VA 4UTGA 4BC7A 1IBKI 4B3TE 1I94I 2A2DA 2LJPA 1EI1A 4LF6E 5DNYA 1ZBQA 3V5RA 4HY1A 2LTSA 1IBLI 4YHHE 4F9AB 4LFBI 4OX9I 3K17A 3J7Yp 2V85A 2VQEI 2L3CA 2B7TA 1H72C 4JI0I 1ZXMA 2L2MA 5BR8I 1X49A 3ADJA 2NUEA 1U2RA 1EKZA 1N36E 4BCAA 3OMLA 1KKHA 1EA6A 1Z0BA 2LMZA 2LBSB 2V83A 4DV1I 4DR6E 5T6JA 4DV7E 1FWLA 2E5LI 2GS8A 2RSMA 1FKAE 2UXDE 2UUCI 3LPSA 2JWOA 2Z5CB 4JI8E 4N3OA 4LF7E 2F4VI 3PRYA 2X36A 3CWVA 1Y6ZA 1UILA 1HNZE 2ODRC 3IWDA 4WUDA 5A2QQ 2HHHE 1N32I 5LMNE 2V8PA 2DSYA 3JAMC 2NA2A 4HACA 4B3TI 4KQVA 2M1SA 1HNWE 4LF6I 3LNUA 4X66E 5ADZA 1HNXE 2L6MA 2RS6A 5AE3A 4YHHI 4M30A 1QZRA 4Q28A 4PRVA 2Q2EB 4P78A 3DJWA 2L2KB 4JV5E 2IOQA 4I8OA 4NXME 1WUUA 2R3VA 4WPYA 4K0KE 2KONA 4DV4E 4DR4E 3F6HA 2L92A 1YYWA 3HJCA 1I94E 1Z5BA 4USMA 4KZSA 3QT5A 2LE2A 2IOPA 4GKJE 3J80C 3J7AM 2OI2A 2WZOA 1N36I 2E1RA 4DV5E 3T1YE 3Q6NA 4YY3E 4DR6I 1VISA 4F9CB 2XEXA 2ZM6I 4DR7E 2Z5BB 4DV0E 1ELOA 1H7SA 2UXDI 2R42A 2JY9A 4TUGA 4GEQB 1RR9A 1HNZI 3WU5A 3T1HE 2YZTA 2HHHI 2IHR1 2M4IA 4IZKB 5LMNI 2V2VA 2N3HA 2B3TB 3ZM7A 4DR1E 2HKJA 3AV0A 1HNWI 1KVKA 4DR2E 4M2ZA 1B62A 3ADLA 2ODRD 4X66I 1HNXI 4DXLA 4JG4A 1MG7A 1YZ9A 4R8OA 3ZZ0A 4JV5I 2K4VA 2H36X 2JOBA 4NXMI 1PVGA 2UXCE 5IWAE 2EZ6A 2E1MA 3H09A 2UUAE 4K0KI 4DUZE 4P7AA 2UUBE 4DV4I 1RC7A 3M6AA 1NZ0A 5CFFE 1O0WA 1OJ4A 4HYMA 4GKJI 1PIEA 3P1XA 1Y4UA 4FWHA 3B82A 4DV5I 2RS7A 4URLA 3T1YI 3HTXA 4YY3I 4DPWA 4X64E 2V89A 2O1TA 2B7VA 4DR7I 1Z0WA 4DV0I 2F4VE 5A2QC 3ZKBA 1KTVA 4DPYA 4HXZA 3F0NA 4BS9A 4LF4E 2LTRA 4P7DA 3T1HI 1H7UA 1DQ3A 2JR1A 2JOXA 1N33E 2LJHA 2V87A 5L3JA 3K6QA 3DF6A 2B9DA 3QT7A 4DR1I 2ZM6E 4DR2I 5LL6R 1RREA 3C4BA 3D4JA 4FWGA 3ZZUA 1XMOI 4LFAI 1UEKA 5F3WA 1FWKA 3PYDA 2UXCI 5IWAI 4WUCA 2HK2A 2UUAI 4DUZI 2UUBI 1USVA 3KWRA 3HPSA 3RMPA 4JYAI 5AASA 1DARA 4B3MI 2JVAA 4NXNE 1Z59A 4IZJD 4LF9E 4B3RI 1Z5CA 4JI6E 3JAMQ 4X64I 1ZM3A 4UT4A 4R1FA 2CZ9A 3VK6A 1UHZA 2LUPB 4ZVIA 4DU7A 3J7AG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM0 A;  3LLH A;  2MDR A;  4DV2 E;  4LF4 I;  2CPN A;  1A6F A;  4DUY I;  3J81 Q;  1XMQ I;  4LF5 I;  2RTX A;  4AQY E;  3ADI A;  2HKE A;  1N33 I;  3H4L A;  4DPU A;  1K47 A;  1NHI A;  3ADG A;  2NUF A;  1XNR E;  4WUB A;  3PYE A;  4Z7C A;  4MYT A;  1J5E I;  1BKN A;  1FI4 A;  4B3S E;  4DV6 I;  2BV3 A;  3GON A;  1KIJ A;  4DU8 A;  4PRX A;  3VYY A;  5FLX Q;  4LFC E;  4I3H A;  3ZZT A;  1H73 A;  4DR5 I;  4DV3 E;  2ZIT A;  1QU6 A;  4NXN I;  4LF9 I;  3B78 A;  2KHX A;  4JI1 E;  3OTO E;  1XMO E;  1N0U A;  4LFA E;  4FN5 A;  4JI6 I;  5LMU I;  1ZM4 A;  4ED4 A;  4JI2 E;  4OOG C;  1YYK A;  1Z5A A;  1D6T A;  4JYA E;  4WYQ B;  4B3M E;  4DV2 I;  2AJ4 A;  1T4O A;  4AQY I;  1XHK A;  1X48 A;  4XTJ A;  2LUQ A;  4B3R E;  4FW9 A;  1IBM I;  5GMD A;  1XNR I;  2ZBK B;  1Z0T A;  4B3S I;  2VF3 A;  2DB2 A;  4USK A;  1HR0 E;  2DIX A;  3WU3 A;  1ZXN A;  4DUY E;  1XMQ E;  4LF5 E;  4FWD A;  4KHP E;  4M1K A;  1H74 A;  2DEJ A;  1S16 A;  4LFC I;  4X65 I;  1N0V C;  3VYX A;  2V2Q A;  4EMD A;  1FNM A;  4DV3 I;  5IT9 Q;  1J5E E;  2VQF E;  4JI5 E;  4DV6 E;  4HAC B;  4JI1 I;  2UXB E;  3V2U C;  2LRS A;  3OTO I;  4MYU A;  1DI2 A;  4JI7 E;  2WW4 A;  4DPX A;  4DPT A;  4DKK A;  4JI2 I;  1N34 E;  1XNQ E;  2BM1 A;  3J81 C;  2V2Z A;  2DMY A;  1STU A;  2HFU A;  4DR5 E;  2HK3 A;  2EFG A;  2L33 A;  2UU9 E;  4JI4 E;  4PU9 A;  3HUL A;  1GQE A;  3WU4 A;  1NHH A;  3Q1Q A;  1Z0G A;  5LMU E;  4LF8 E;  3PYG A;  3QT6 A;  4DR3 E;  4JI3 E;  1WHQ A;  5FLX C;  1HR0 I;  5GME A;  4P52 A;  4GKK E;  1Z0E A;  1FJG E;  1Z0V A;  4KHP I;  4X62 E;  2NPF A;  2YT4 A;  2HFS A;  1IBM E;  1Z0C A;  1ZBT A;  3B8H A;  1ZM9 A;  1S4E A;  2VQF I;  4JI5 I;  2L3J A;  2DEI A;  2UXB I;  4X8W A;  2V34 A;  1IBK E;  4JI7 I;  2A2C A;  1X47 A;  3LTO A;  3QT8 A;  1N34 I;  1XNQ I;  2N3G A;  1IBL E;  2X7I A;  4X65 E;  1ZM2 A;  3K1J A;  3WU6 A;  4LFB E;  3JAM Q;  1J26 A;  3C4T A;  4OX9 E;  2VQE E;  3ZKD A;  4DV7 I;  3PYF A;  2UU9 I;  4JI4 I;  1T4L B;  4JI8 I;  4LF7 I;  4JI0 E;  4LF8 I;  1PKP A;  5BR8 E;  1RQ0 A;  4DR3 I;  4JI3 I;  4WFT A;  1B63 A;  4DV1 E;  1YYO A;  3J80 Q;  1WHN A;  4GKK I;  2E5L E;  1FJG I;  5IT9 C;  2UUC E;  4X62 I;  4RPF A;  2L2N A;  1MX0 A;  1NHJ A;  2NUG A;  1MU5 A;  1T4N A;  4Z7Y A;  1N32 E;  4DR4 I;  2J7K A;  4UTG A;  1IBK I;  4B3T E;  1I94 I;  2A2D A;  2LJP A;  1EI1 A;  4LF6 E;  3V5R A;  4HY1 A;  2LTS A;  1IBL I;  4YHH E;  4LFB I;  4OX9 I;  3K17 A;  3J7Y p;  2VQE I;  2L3C A;  2B7T A;  1H72 C;  4JI0 I;  1ZXM A;  2L2M A;  5BR8 I;  1X49 A;  3ADJ A;  2NUE A;  1U2R A;  1EKZ A;  1N36 E;  1KKH A;  1EA6 A;  1Z0B A;  2LBS B;  4DV1 I;  4DR6 E;  4DV7 E;  1FWL A;  2E5L I;  2GS8 A;  2RSM A;  1FKA E;  2UXD E;  2UUC I;  3LPS A;  4JI8 E;  4LF7 E;  2F4V I;  2X36 A;  3CWV A;  1UIL A;  1HNZ E;  5A2Q Q;  4WUD A;  2HHH E;  1N32 I;  5LMN E;  2V8P A;  3JAM C;  2NA2 A;  4HAC A;  4B3T I;  4KQV A;  1HNW E;  4LF6 I;  3LNU A;  4X66 E;  1HNX E;  2RS6 A;  4YHH I;  4M30 A;  1QZR A;  4PRV A;  2Q2E B;  2L2K B;  4JV5 E;  4NXM E;  1WUU A;  2R3V A;  4K0K E;  4DV4 E;  4DR4 E;  1YYW A;  1I94 E;  1Z5B A;  4USM A;  3QT5 A;  4GKJ E;  3J80 C;  3J7A M;  2OI2 A;  1N36 I;  2E1R A;  4DV5 E;  3T1Y E;  4YY3 E;  4DR6 I;  1VIS A;  2XEX A;  2ZM6 I;  4DR7 E;  4DV0 E;  1ELO A;  1H7S A;  2UXD I;  2R42 A;  2JY9 A;  1RR9 A;  1HNZ I;  3WU5 A;  3T1H E;  2HHH I;  2IHR 1;  5LMN I;  2V2V A;  2N3H A;  2B3T B;  3ZM7 A;  4DR1 E;  2HKJ A;  1HNW I;  1KVK A;  4DR2 E;  4M2Z A;  1B62 A;  3ADL A;  4X66 I;  1HNX I;  4DXL A;  4JG4 A;  1MG7 A;  1YZ9 A;  3ZZ0 A;  4JV5 I;  4NXM I;  1PVG A;  2UXC E;  5IWA E;  2EZ6 A;  2UUA E;  4K0K I;  4DUZ E;  4P7A A;  2UUB E;  4DV4 I;  1RC7 A;  3M6A A;  1NZ0 A;  5CFF E;  1O0W A;  1OJ4 A;  4HYM A;  4GKJ I;  1PIE A;  3P1X A;  4FWH A;  3B82 A;  4DV5 I;  2RS7 A;  4URL A;  3T1Y I;  3HTX A;  4YY3 I;  4DPW A;  4X64 E;  2B7V A;  4DR7 I;  1Z0W A;  4DV0 I;  2F4V E;  5A2Q C;  3ZKB A;  1KTV A;  4DPY A;  4HXZ A;  3F0N A;  4LF4 E;  2LTR A;  3T1H I;  1H7U A;  1N33 E;  2LJH A;  5L3J A;  3QT7 A;  4DR1 I;  2ZM6 E;  4DR2 I;  5LL6 R;  1RRE A;  3C4B A;  3D4J A;  4FWG A;  3ZZU A;  1XMO I;  4LFA I;  1UEK A;  1FWK A;  3PYD A;  2UXC I;  5IWA I;  4WUC A;  2HK2 A;  2UUA I;  4DUZ I;  2UUB I;  4JYA I;  1DAR A;  4B3M I;  2JVA A;  4NXN E;  1Z59 A;  4LF9 E;  4B3R I;  1Z5C A;  4JI6 E;  4X64 I;  1ZM3 A;  4UT4 A;  4R1F A;  2CZ9 A;  1UHZ A;  2LUP B;  4ZVI A;  4DU7 A;  3J7A G; 
#chains in the Genus database with same CATH topology
 1JK2 A;  4BMJ A;  4LCH A;  2BM0 A;  4LCF A;  3LLH A;  2EQ3 A;  2MDR A;  4J8Z A;  4DV2 E;  2CPN A;  1A6F A;  2Z5C A;  4LF4 I;  4DUY I;  3J81 Q;  1XMQ I;  5C0X D;  4LF5 I;  4ZYG A;  2YTF A;  3MSW A;  1Y4S A;  2PNM A;  2RTX A;  4AQY E;  3ADI A;  5AE1 A;  1T39 A;  2HKE A;  1N33 I;  2EE8 A;  3H4L A;  2CTD A;  1K47 A;  2LJU A;  5DNL A;  4DPU A;  5K36 E;  4N4R B;  2EOM A;  1NHI A;  3ADG A;  2NUF A;  1XNR E;  1IMU A;  4WUB A;  3PYE A;  4Z7C A;  1T38 A;  4MYT A;  3C6K A;  4O43 A;  1J5E I;  1BKN A;  3NZK A;  4GZN C;  2EN4 A;  1FI4 A;  4B3S E;  1A1H A;  4DV6 I;  4F6M A;  1JK1 A;  2BV3 A;  3GON A;  4J3D A;  1KIJ A;  4ZYD A;  4DU8 A;  2I13 A;  3GME A;  4PRX A;  2LV2 A;  2EOF A;  2YTN A;  4BBY A;  2MC5 A;  4QNJ A;  3VYY A;  1G2F C;  5FLX Q;  1UBD C;  3M85 D;  2EMI A;  2YU8 A;  5FWK A;  1USU A;  5JEA E;  2NN6 B;  2MC6 A;  4MLV A;  4LFC E;  4R2S A;  4I3H A;  3ZZT A;  2HJJ A;  2G7H A;  4KWY A;  2DGC A;  1H73 A;  2EOJ A;  2VE7 C;  4DR5 I;  2ELY A;  4DMI A;  5KL6 A;  4DV3 E;  4IZJ B;  2ZIT A;  2PNL A;  1QU6 A;  2PO2 B;  4NXN I;  2EPA A;  4FW6 A;  4LF9 I;  2R76 A;  1AAY A;  3B78 A;  3P06 A;  3EPH A;  2KHX A;  4JI1 E;  3M99 B;  2YTP A;  3OTO E;  1XMO E;  2O1W A;  4LTY A;  2DRP A;  1N0U A;  2EPP A;  4LFA E;  4FN5 A;  4JI6 I;  2WBT A;  5LMU I;  1ZM4 A;  2FTX B;  4LU9 A;  4ED4 A;  4JI2 E;  4IS9 A;  4OO1 C;  2YWQ A;  2E72 A;  2EM0 A;  4OOG C;  1YSA C;  1YYK A;  2Z5B A;  1Z5A A;  1D6T A;  1X6E A;  2DMI A;  5C0X B;  2CSH A;  4R2P A;  4JYA E;  4WYQ B;  2WNR B;  4B3M E;  2EP3 A;  4DV2 I;  2FGG A;  2V88 A;  2AJ4 A;  2EM6 A;  5LLQ A;  5DRR A;  2BR2 A;  1T4O A;  1X5W A;  4AQY I;  3P76 A;  4WXD A;  2YTI A;  2V8Q B;  1X48 A;  1HK7 A;  1XHK A;  4XTJ A;  4F54 A;  1A1I A;  2LUQ A;  4B3R E;  2EMA A;  4TUI A;  4IZK A;  4FW9 A;  1IBM I;  5GMD A;  1XNR I;  4WSG A;  5A6A A;  2EOS A;  2ZBK B;  3BF2 A;  2EMZ A;  1Z0T A;  1SR9 A;  2VF3 A;  2DB2 A;  4L8N A;  4USK A;  4B3S I;  2JPA A;  1KYQ A;  2EPM X;  4BC9 A;  1HR0 E;  4BA2 A;  4IFD A;  1TF6 A;  3Q6M A;  4LPF A;  2DIX A;  3WU3 A;  3VHT B;  1ZXN A;  5K36 A;  4DUY E;  2JXP A;  1XMQ E;  4LF5 E;  4FWD A;  4KHP E;  4M1K A;  4R2A A;  1H74 A;  2DEJ A;  1S16 A;  4LFC I;  4X65 I;  1N0V C;  1IQS A;  3VYX A;  1WXR A;  2V2Q A;  3THO B;  3AUZ A;  4EMD A;  3L7Z A;  1UN6 B;  1FNM A;  1PJT A;  5KL7 A;  4DV3 I;  5IT9 Q;  4L5N C;  2PO1 A;  1J5E E;  2CT1 A;  5JEA C;  2VQF E;  1WJP A;  4JI5 E;  4DV6 E;  4FW5 A;  4HAC B;  1YH8 A;  4JI1 I;  2UXB E;  2F8B A;  2LRS A;  3HPZ A;  4R03 A;  5TSE A;  1UDQ A;  2WCC 3;  1DI2 A;  4MYU A;  3OTO I;  2JEA B;  2JEB B;  4JI7 E;  2EMW A;  2WW4 A;  1GTK A;  2EN3 A;  4DPX A;  4DPT A;  4DKK A;  2YSP A;  2JE6 A;  4JI2 I;  2LVH A;  3J81 C;  1N34 E;  1XNQ E;  2EM7 A;  2BM1 A;  4MDT A;  2YPN A;  2EOO A;  2V2Z A;  2EWL A;  2GPI A;  1A1L A;  2DMY A;  1STU A;  2HFU A;  4DR5 E;  4BA1 A;  2HK3 A;  2KOU A;  2EFG A;  2WP8 A;  2NN6 F;  4BHC A;  2L33 A;  3TQM A;  2UU9 E;  4JI4 E;  4R2D A;  4IS1 C;  4ZYH A;  3HUL A;  1GQE A;  4PU9 A;  3WU4 A;  1NHH A;  1EH6 A;  2RQL A;  3Q1Q A;  2C38 B;  4OO1 F;  2RPC A;  3M85 G;  3EPK A;  1Z0G A;  5AC4 A;  5LMU E;  2EOQ A;  3UK3 C;  2LO3 A;  1AH5 A;  4R2C A;  4LF8 E;  3KZZ A;  3PYG A;  2HC5 A;  3QT6 A;  4FK5 C;  2IES A;  5FLX C;  4DR3 E;  1WHQ A;  4JI3 E;  2ELZ A;  1HR0 I;  3HQ1 A;  2Z5E A;  4ZYE A;  4LCG A;  3THN A;  1X3C A;  2O1U A;  4P52 A;  3IWC A;  4GKK E;  1RMD A;  2WBS A;  1FJG E;  1Z0E A;  5GME A;  1Z0V A;  4KHP I;  4X62 E;  1A1G A;  2NPF A;  2YT4 A;  2HFS A;  5C0X F;  4NZV A;  4IFD E;  3K85 A;  2EMH A;  2EMG A;  2CG9 A;  2YRM A;  1IBM E;  1Z0C A;  5K36 D;  2EM9 A;  1YPN A;  2EN1 A;  1ZBT A;  3B8H A;  1ZM9 A;  1S4E A;  2VQF I;  1GZ6 A;  2L3J A;  4JI5 I;  4Q35 B;  3P3C A;  4F2J C;  2EOZ A;  2DEI A;  2UXB I;  1ZAA C;  4X8W A;  2ADR A;  2V34 A;  1IBK E;  4JI7 I;  3M7N D;  3ZOQ B;  1X47 A;  1WRJ A;  2A2C A;  3LTO A;  2WBU A;  3QT8 A;  2YU5 A;  3HKM A;  2ENH A;  3CDJ A;  2EPN A;  5IXM B;  2J65 A;  1N34 I;  1XNQ I;  3EQ1 A;  5JEA D;  1OYP A;  2N3G A;  3LML A;  1IBL E;  3JU0 A;  4X65 E;  1ZM2 A;  2X7I A;  4LFB E;  1UDN A;  3K1J A;  5DRO A;  2GO4 A;  3WU6 A;  1VI7 A;  1J26 A;  2O1V A;  1BBG A;  2C39 A;  1UDO A;  2EM3 A;  3C4T A;  4OX9 E;  4OO1 B;  2VQE E;  3ZKD A;  3HXL A;  1L4S A;  3PYF A;  4DV7 I;  2UU9 I;  4JI4 I;  5KL2 A;  2V86 A;  1T4L B;  5AE2 A;  4JI8 I;  2EMY A;  4LF7 I;  3U1K A;  4JI0 E;  2I9I A;  2GO3 A;  2EL4 A;  2O3Z A;  4LOM A;  4LF8 I;  1PKP A;  5KL3 A;  3EPL A;  5BR8 E;  3CDI A;  1RQ0 A;  3FIG A;  2VES A;  4R2R A;  2L8T A;  4FW7 A;  4WFT A;  4DR3 I;  4JI3 I;  1B63 A;  2VF1 A;  3IWB A;  1X6H A;  5A6B D;  2BBG A;  4DV1 E;  1YYO A;  3JTZ A;  3J80 Q;  2C37 B;  2FV4 B;  1BBO A;  1WHN A;  4GKK I;  2E5L E;  1FJG I;  5IT9 C;  1MEY C;  2YTE A;  2UUC E;  4X62 I;  3F6G A;  1UDS A;  4RPF A;  2EMB A;  3ECR A;  2L2N A;  2M7Q A;  2Q8U A;  1MX0 A;  1NHJ A;  2NN6 A;  2J7J A;  2NUG A;  1MU5 A;  3PS1 A;  1T4N A;  4WSP A;  4Z7Y A;  1YUJ A;  4GQU A;  1N32 E;  4F9B B;  4IZJ A;  2GLI A;  2GQ0 A;  3BGH A;  4DR4 I;  1ZU1 A;  2CGE A;  1RHY A;  4IFD C;  2PNZ B;  3UHM A;  2J7K A;  2YRH A;  4M0V A;  2EN2 A;  2PO2 A;  4BC7 A;  4UTG A;  1IBK I;  5K36 C;  4B3T E;  1I94 I;  4BHB A;  4AID A;  1A1F A;  1TF3 A;  2A2D A;  2LJP A;  2BB8 A;  1EI1 A;  5JEA B;  2M9A A;  4LF6 E;  5DNY A;  1ZBQ A;  3V5R A;  4M9V C;  4HY1 A;  2LTS A;  1IBL I;  4YHH E;  4F9A B;  4LFB I;  4OX9 I;  3K17 A;  3J7Y p;  2NAB A;  2V85 A;  2VQE I;  5C0X A;  2WNR A;  3PS3 A;  4OKG A;  2L3C A;  2EML A;  1A1K A;  2B7T A;  2YTG A;  2IER A;  2WP8 B;  2PO0 B;  1H72 C;  4JI0 I;  5IV8 B;  1ZXM A;  2L2M A;  2ENA A;  2AE8 A;  5BR8 I;  1X49 A;  2EPC A;  2EPZ A;  3ADJ A;  2NUE A;  1U2R A;  1YHC A;  1EKZ A;  4RH8 A;  1N36 E;  4BCA A;  3OML A;  1KKH A;  1EA6 A;  1Z0B A;  2EOH A;  2LMZ A;  2LBS B;  2V83 A;  2EN8 A;  4DV1 I;  2D9H A;  4DR6 E;  5T6J A;  4DV7 E;  1FWL A;  3KRN A;  2E5L I;  2GS8 A;  2RSM A;  1FKA E;  2UXD E;  2YSO A;  3LPS A;  2UUC I;  4HEI A;  2JWO A;  2Z5C B;  4JI8 E;  4N3O A;  3M7N G;  4LF7 E;  2F4V I;  3PRY A;  2EN7 A;  1IQO A;  2X36 A;  3CWV A;  3PS2 A;  2BA0 D;  1Y6Z A;  1UIL A;  1HNZ E;  1OYR A;  2ODR C;  4WXC A;  3IWD A;  4WX9 A;  4WUD A;  2HHH E;  5A2Q Q;  5LMN E;  1N32 I;  1MGT A;  2V8P A;  4U3B A;  2BA1 D;  2NN6 E;  2DSY A;  5KL4 A;  1PDA A;  2MDG A;  3JAM C;  2NA2 A;  4HAC A;  4B3T I;  4KQV A;  3MHS C;  4AIM A;  2M1S A;  3P3G A;  1HNW E;  2JEA A;  4OO1 E;  2GHF A;  4X9J A;  2JEB A;  4LF6 I;  3LNU A;  4X66 E;  5ADZ A;  1HNX E;  2L6M A;  2RS6 A;  1Y60 A;  5AE3 A;  4YHH I;  5DRP A;  4M30 A;  2EPU A;  1QZR A;  4Q28 A;  4IFD D;  2VRD A;  2Q2E B;  4P78 A;  3DJW A;  2L2K B;  1Z1B A;  4JV5 E;  4PRV A;  2IOQ A;  4I8O A;  4NXM E;  3EPJ A;  4MU4 A;  3U1Y A;  1WUU A;  2R3V A;  3BID A;  2EM5 A;  4IJD A;  4WPY A;  4K0K E;  5K36 F;  2ENC A;  2EMK A;  2KON A;  4DV4 E;  4DR4 E;  2C39 B;  4MU0 A;  2YRK A;  3F6H A;  4U3D A;  2L92 A;  2YTQ A;  1YYW A;  3HJC A;  1I94 E;  1Z5B A;  4USM A;  3BBG A;  4KZS A;  2JP9 A;  3QT5 A;  5C0X E;  2K7I A;  2LE2 A;  2EJ4 A;  2C38 A;  4QNK A;  2EMF A;  2IOP A;  4GKJ E;  3J80 C;  3J7A M;  2OI2 A;  4FW3 A;  2WZO A;  5A6K A;  1N36 I;  2E1R A;  4DV5 E;  3T1Y E;  4MU1 A;  2EM2 A;  3Q6N A;  2A25 A;  4YY3 E;  4O5G A;  5JEA F;  4DR6 I;  1B69 A;  2MKN A;  4F6N A;  1NEI A;  4F9C B;  1VIS A;  2F1D A;  2XEX A;  4R2E A;  2ZM6 I;  4DR7 E;  2Z5B B;  4DV0 E;  1DGC A;  1ELO A;  1H7S A;  1SFE A;  4HTG A;  1LLM C;  1OYS A;  2R42 A;  2UXD I;  3B4T A;  2LCE A;  2JY9 A;  4TUG A;  4GEQ B;  1RR9 A;  2BR2 B;  4O24 A;  1HNZ I;  1YFH A;  3WU5 A;  3T1H E;  2JT2 A;  2YZT A;  3L00 A;  5ELW A;  2IHR 1;  2M4I A;  4IZK B;  5LMN I;  2HHH I;  1QNT A;  1R6L A;  2MKD A;  2V2V A;  2N3H A;  1F2I G;  1P42 A;  2EOX A;  2B3T B;  1NCS A;  2EN6 A;  2JYA A;  4DR1 E;  3ZM7 A;  2EPO A;  3QG5 C;  2HKJ A;  4ISA A;  3AV0 A;  1HNW I;  4NBQ A;  1KVK A;  4DR2 E;  1G2D C;  4M2Z A;  1B62 A;  5DRQ A;  5KL5 A;  3ADL A;  4BA2 B;  4IFD B;  2ODR D;  1BB8 A;  3H1C A;  4X66 I;  3KZY A;  1HNX I;  4DXL A;  4JG4 A;  2EQ0 A;  1MG7 A;  2NN6 C;  1YZ9 A;  5K36 B;  4R8O A;  3ZZ0 A;  4JV5 I;  2K4V A;  5DNX A;  2H36 X;  2JOB A;  2YTO A;  4NXM I;  5EL9 A;  1PVG A;  2UXC E;  5IWA E;  2EZ6 A;  2E1M A;  1TN9 A;  3H09 A;  2UUA E;  2R1F A;  3DD6 A;  4OO1 A;  4DUZ E;  4P7A A;  2UUB E;  4DV4 I;  3L7Z B;  1RC7 A;  4K0K I;  2EOY A;  3M6A A;  1NZ0 A;  2PO1 B;  5CFF E;  1EH7 A;  2CVE A;  1P47 A;  3V2U C;  1O0W A;  2YTD A;  2EPL X;  1OJ4 A;  1R6M A;  4HYM A;  2EL6 A;  1PIE A;  4GKJ I;  3C6M A;  5A6J A;  2N8X A;  3P1X A;  2RSI A;  1Y4U A;  2EOR A;  2BA0 G;  4FWH A;  3B82 A;  4DV5 I;  2EOI A;  2RS7 A;  4URL A;  3T1Y I;  3HTX A;  2JE6 B;  4YY3 I;  5C0X C;  4O4K A;  4DPW A;  4X64 E;  2V89 A;  1E3P A;  4NHR A;  2O1T A;  2BA1 G;  3GCM A;  2B7V A;  1Y5Y A;  4DR7 I;  1Z0W A;  4DV0 I;  2F4V E;  4MQY A;  2C37 A;  5A2Q C;  4BA1 B;  2EL5 A;  5A69 A;  2HGH A;  3ZKB A;  1KTV A;  1EH8 A;  4DPY A;  4HXZ A;  3F0N A;  4BS9 A;  4LF4 E;  2LTR A;  4FW4 A;  4P7D A;  3T1H I;  1H7U A;  1DQ3 A;  2EM8 A;  2EPK X;  2JR1 A;  3P3E A;  2JOX A;  1ZR9 A;  1N33 E;  2LJH A;  2V87 A;  5L3J A;  3K6Q A;  3DF6 A;  2B9D A;  3QT7 A;  4DR1 I;  2PNZ A;  4MLQ A;  2ZM6 E;  4DR2 I;  2EMX A;  5LL6 R;  1RRE A;  4RHB B;  5JEA A;  3C4B A;  3D4J A;  4FWG A;  3ZZU A;  4AM3 A;  1XXE A;  1XMO I;  2EOE A;  1KJK A;  1UEK A;  4LFA I;  5F3W A;  2EPX A;  1FWK A;  2EMC A;  2DLQ A;  3PYD A;  2UXC I;  5IWA I;  4WUC A;  2HK2 A;  2UUA I;  2YTJ A;  4DUZ I;  2UUB I;  1USV A;  3KWR A;  2NN6 D;  2EM4 A;  3HPS A;  3RMP A;  4JYA I;  5AAS A;  1DAR A;  3MHH C;  4B3M I;  1N3G A;  3GLL A;  2JVA A;  2PO0 A;  4MU3 A;  4NXN E;  1X6F A;  2DLK A;  1Z59 A;  4IZJ D;  5AC5 A;  2LT7 A;  4LF9 E;  4OO1 D;  2EPR A;  1YUI A;  1PJS A;  1E3H A;  4B3R I;  5A6B A;  1Z5C A;  4JI6 E;  2EQ1 A;  4R2Q A;  1PJQ A;  3JAM Q;  2PRT A;  1A1J A;  1ZM3 A;  4R1F A;  2CZ9 A;  4UT4 A;  4X64 I;  4IFD F;  3VK6 A;  1UHZ A;  2LUP B;  5EKW A;  4ZVI A;  4OZE A;  4DU7 A;  3J7A G; 
#chains in the Genus database with same CATH homology
 4BMJ A;  2BM0 A;  3LLH A;  2MDR A;  4DV2 E;  4J8Z A;  2Z5C A;  2CPN A;  1A6F A;  4LF4 I;  4DUY I;  3J81 Q;  1XMQ I;  4LF5 I;  3MSW A;  1Y4S A;  2PNM A;  2RTX A;  4AQY E;  3ADI A;  5AE1 A;  2HKE A;  1N33 I;  3H4L A;  4DPU A;  1K47 A;  1NHI A;  3ADG A;  2NUF A;  1XNR E;  4WUB A;  3PYE A;  4Z7C A;  4MYT A;  1J5E I;  1BKN A;  1FI4 A;  4B3S E;  4DV6 I;  2BV3 A;  3GON A;  1KIJ A;  4DU8 A;  4PRX A;  4BBY A;  2MC5 A;  3VYY A;  5FLX Q;  5FWK A;  1USU A;  2MC6 A;  4LFC E;  4I3H A;  3ZZT A;  2G7H A;  1H73 A;  4DR5 I;  2VE7 C;  4DMI A;  4IZJ B;  4DV3 E;  2ZIT A;  2PNL A;  1QU6 A;  4NXN I;  4LF9 I;  3P06 A;  3B78 A;  2KHX A;  4JI1 E;  3OTO E;  2O1W A;  1XMO E;  4LTY A;  1N0U A;  4LFA E;  4FN5 A;  4JI6 I;  5LMU I;  1ZM4 A;  2FTX B;  4LU9 A;  4ED4 A;  4JI2 E;  4OOG C;  1YYK A;  2Z5B A;  1Z5A A;  1D6T A;  4JYA E;  4WYQ B;  4B3M E;  4DV2 I;  2FGG A;  2V88 A;  2AJ4 A;  1T4O A;  4AQY I;  2V8Q B;  1X48 A;  1HK7 A;  1XHK A;  4XTJ A;  4F54 A;  2LUQ A;  4B3R E;  4IZK A;  4TUI A;  4FW9 A;  1IBM I;  5GMD A;  1XNR I;  2ZBK B;  1Z0T A;  4B3S I;  1SR9 A;  2VF3 A;  2DB2 A;  4L8N A;  4USK A;  4BC9 A;  1HR0 E;  3Q6M A;  2DIX A;  3WU3 A;  1ZXN A;  4DUY E;  1XMQ E;  4LF5 E;  4FWD A;  4KHP E;  4M1K A;  1H74 A;  2DEJ A;  1S16 A;  4LFC I;  4X65 I;  1N0V C;  3VYX A;  1WXR A;  2V2Q A;  3AUZ A;  4EMD A;  1FNM A;  4DV3 I;  5IT9 Q;  4L5N C;  1J5E E;  2VQF E;  4JI5 E;  4DV6 E;  4HAC B;  4JI1 I;  2UXB E;  2F8B A;  2LRS A;  3HPZ A;  4R03 A;  4MYU A;  3V2U C;  3OTO I;  1DI2 A;  4JI7 E;  2WW4 A;  4DPX A;  4DPT A;  4DKK A;  4JI2 I;  1N34 E;  3J81 C;  1XNQ E;  2BM1 A;  2V2Z A;  2EWL A;  2DMY A;  1STU A;  2HFU A;  4DR5 E;  2HK3 A;  2KOU A;  2EFG A;  2L33 A;  2UU9 E;  4JI4 E;  4PU9 A;  3HUL A;  1GQE A;  3WU4 A;  1NHH A;  3Q1Q A;  1Z0G A;  5LMU E;  4LF8 E;  3PYG A;  3QT6 A;  5FLX C;  4DR3 E;  1WHQ A;  4JI3 E;  1HR0 I;  3HQ1 A;  2Z5E A;  5GME A;  2O1U A;  4P52 A;  3IWC A;  4GKK E;  1Z0E A;  1FJG E;  1Z0V A;  4KHP I;  4X62 E;  2NPF A;  2YT4 A;  2HFS A;  3K85 A;  2CG9 A;  1IBM E;  1Z0C A;  1ZBT A;  3B8H A;  1ZM9 A;  1S4E A;  2VQF I;  1GZ6 A;  2L3J A;  4JI5 I;  2DEI A;  2UXB I;  4X8W A;  2V34 A;  1IBK E;  4JI7 I;  3ZOQ B;  1X47 A;  2A2C A;  3LTO A;  3QT8 A;  1N34 I;  1XNQ I;  2N3G A;  3LML A;  1IBL E;  3JU0 A;  4X65 E;  1ZM2 A;  2X7I A;  4LFB E;  3K1J A;  3WU6 A;  1J26 A;  2O1V A;  3C4T A;  4OX9 E;  2VQE E;  3ZKD A;  3HXL A;  3PYF A;  4DV7 I;  2UU9 I;  4JI4 I;  2V86 A;  1T4L B;  5AE2 A;  4JI8 I;  4LF7 I;  4JI0 E;  4LF8 I;  1PKP A;  5BR8 E;  1RQ0 A;  3FIG A;  4DR3 I;  2L8T A;  4JI3 I;  4WFT A;  1B63 A;  2VF1 A;  3IWB A;  4DV1 E;  1YYO A;  3JTZ A;  3J80 Q;  2FV4 B;  1WHN A;  4GKK I;  2E5L E;  1FJG I;  5IT9 C;  2UUC E;  4X62 I;  3F6G A;  4RPF A;  2L2N A;  2M7Q A;  1MX0 A;  1NHJ A;  2NUG A;  1MU5 A;  1T4N A;  4WSP A;  4Z7Y A;  1N32 E;  4F9B B;  4IZJ A;  2GQ0 A;  4DR4 I;  2CGE A;  2J7K A;  4M0V A;  4UTG A;  4BC7 A;  1IBK I;  4B3T E;  1I94 I;  2A2D A;  2LJP A;  1EI1 A;  4LF6 E;  5DNY A;  1ZBQ A;  3V5R A;  4HY1 A;  2LTS A;  1IBL I;  4YHH E;  4F9A B;  4LFB I;  4OX9 I;  3K17 A;  3J7Y p;  2V85 A;  2VQE I;  2L3C A;  2B7T A;  1H72 C;  4JI0 I;  1ZXM A;  2L2M A;  5BR8 I;  1X49 A;  3ADJ A;  2NUE A;  1U2R A;  1EKZ A;  1N36 E;  4BCA A;  3OML A;  1KKH A;  1EA6 A;  1Z0B A;  2LMZ A;  2LBS B;  2V83 A;  4DV1 I;  4DR6 E;  5T6J A;  4DV7 E;  1FWL A;  2E5L I;  2GS8 A;  2RSM A;  1FKA E;  2UXD E;  2UUC I;  3LPS A;  2JWO A;  2Z5C B;  4JI8 E;  4N3O A;  4LF7 E;  2F4V I;  3PRY A;  2X36 A;  3CWV A;  1Y6Z A;  1UIL A;  1HNZ E;  2ODR C;  3IWD A;  4WUD A;  5A2Q Q;  2HHH E;  1N32 I;  5LMN E;  2V8P A;  2DSY A;  3JAM C;  2NA2 A;  4HAC A;  4B3T I;  4KQV A;  2M1S A;  1HNW E;  4LF6 I;  3LNU A;  4X66 E;  5ADZ A;  1HNX E;  2L6M A;  2RS6 A;  5AE3 A;  4YHH I;  4M30 A;  1QZR A;  4Q28 A;  4PRV A;  2Q2E B;  4P78 A;  3DJW A;  2L2K B;  4JV5 E;  2IOQ A;  4I8O A;  4NXM E;  1WUU A;  2R3V A;  4WPY A;  4K0K E;  2KON A;  4DV4 E;  4DR4 E;  3F6H A;  2L92 A;  1YYW A;  3HJC A;  1I94 E;  1Z5B A;  4USM A;  4KZS A;  3QT5 A;  2LE2 A;  2IOP A;  4GKJ E;  3J80 C;  3J7A M;  2OI2 A;  2WZO A;  1N36 I;  2E1R A;  4DV5 E;  3T1Y E;  3Q6N A;  4YY3 E;  4DR6 I;  1VIS A;  4F9C B;  2XEX A;  2ZM6 I;  4DR7 E;  2Z5B B;  4DV0 E;  1ELO A;  1H7S A;  2UXD I;  2R42 A;  2JY9 A;  4TUG A;  4GEQ B;  1RR9 A;  1HNZ I;  3WU5 A;  3T1H E;  2YZT A;  2HHH I;  2IHR 1;  2M4I A;  4IZK B;  5LMN I;  2V2V A;  2N3H A;  2B3T B;  3ZM7 A;  4DR1 E;  2HKJ A;  3AV0 A;  1HNW I;  1KVK A;  4DR2 E;  4M2Z A;  1B62 A;  3ADL A;  2ODR D;  4X66 I;  1HNX I;  4DXL A;  4JG4 A;  1MG7 A;  1YZ9 A;  4R8O A;  3ZZ0 A;  4JV5 I;  2K4V A;  2H36 X;  2JOB A;  4NXM I;  1PVG A;  2UXC E;  5IWA E;  2EZ6 A;  2E1M A;  3H09 A;  2UUA E;  4K0K I;  4DUZ E;  4P7A A;  2UUB E;  4DV4 I;  1RC7 A;  3M6A A;  1NZ0 A;  5CFF E;  1O0W A;  1OJ4 A;  4HYM A;  4GKJ I;  1PIE A;  3P1X A;  1Y4U A;  4FWH A;  3B82 A;  4DV5 I;  2RS7 A;  4URL A;  3T1Y I;  3HTX A;  4YY3 I;  4DPW A;  4X64 E;  2V89 A;  2O1T A;  2B7V A;  4DR7 I;  1Z0W A;  4DV0 I;  2F4V E;  5A2Q C;  3ZKB A;  1KTV A;  4DPY A;  4HXZ A;  3F0N A;  4BS9 A;  4LF4 E;  2LTR A;  4P7D A;  3T1H I;  1H7U A;  1DQ3 A;  2JR1 A;  2JOX A;  1N33 E;  2LJH A;  2V87 A;  5L3J A;  3K6Q A;  3DF6 A;  2B9D A;  3QT7 A;  4DR1 I;  2ZM6 E;  4DR2 I;  5LL6 R;  1RRE A;  3C4B A;  3D4J A;  4FWG A;  3ZZU A;  1XMO I;  4LFA I;  1UEK A;  5F3W A;  1FWK A;  3PYD A;  2UXC I;  5IWA I;  4WUC A;  2HK2 A;  2UUA I;  4DUZ I;  2UUB I;  1USV A;  3KWR A;  3HPS A;  3RMP A;  4JYA I;  5AAS A;  1DAR A;  4B3M I;  2JVA A;  4NXN E;  1Z59 A;  4IZJ D;  4LF9 E;  4B3R I;  1Z5C A;  4JI6 E;  3JAM Q;  4X64 I;  1ZM3 A;  4UT4 A;  4R1F A;  2CZ9 A;  3VK6 A;  1UHZ A;  2LUP B;  4ZVI A;  4DU7 A;  3J7A G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...