3WU5A

Reduced e.coli lon proteolytic domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Lon protease
publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 60
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu5A01
1U2RA 4X66I 1IBLI 3H4LA 4LF9I 5BR8E 1Z0VA 2VQEI 1Z5BA 1RREA 1N36I 1Z0BA 4LFAI 4HACB 4JI0E 2UUCI 4DUYI 4X65E 5A2QC 1NHIA 4HACA 1XNQI 2V2VA 2E1RA 1FWKA 2UUAE 2V8PA 1S16A 1N34E 4EMDA 1EI1A 1ZM2A 4B3TE 2UXCE 4JI6I 3ZM7A 4DUZI 2UXDE 4OX9E 1KIJA 4JI3I 1KKHA 2HK3A 1N32E 1DARA 4NXNI 4K0KE 2UXBE 4DR1E 4DV0E 4B3SE 4ZVIA 4I3HA 1J5EI 4USMA 4AQYE 5IWAE 1PIEA 2R3VA 1MU5A 1ZXMA 1HR0E 2E5LE 4DR5I 4YY3E 1NZ0A 4FWDA 2VQFE 4JI8E 4Z7CA 1IBKE 3K17A 1IBLE 2WW4A 4LF9E 3ZZ0A 1K47A 3OTOI 1N0UA 4LF5I 1Z0TA 4LFBE 4R1FA 1N36E 4ED4A 1H72C 1ZM3A 2AJ4A 3PYFA 3ZZUA 4FWGA 3JAMC 4KHPI 4DUYE 3T1HI 4DV7I 4PRXA 1XNQE 5A2QQ 2R42A 4M1KA 1ZM9A 1FNMA 5LMNI 4WUCA 4DV6I 3M6AA 4DR7I 4DPWA 4JI5I 4Z7YA 4B3RE 2V2ZA 4DUZE 2EFGA 1FWLA 4DPTA 1H7UA 4DR2I 4JI3E 4USKA 2HFSA 2BM0A 2BM1A 3GONA 4GKKI 1Z0GA 5FLXC 1UEKA 1N33E 2HKJA 4B3MI 2GS8A 4DV2I 1NHJA 2CZ9A 2DEJA 4UT4A 4DR4E 4X64I 3HULA 4UTGA 4JV5I 3J7AG 4DR5E 1Z59A 4DV5I 2HHHI 1HNXI 1FKAE 2V2QA 4KQVA 4DU8A 2UU9I 2BV3A 4JI1I 3ZKDA 2A2DA 4NXMI 3OTOE 3WU5A 4LF5E 4LF7I 3B8HA 4JI4I 4GKJE 1XNRI 4WUBA 2DEIA 2LJPA 1XMQI 1HNWI 1A6FA 2V34A 4KHPE 3PYGA 3J80C 3T1HE 1FJGI 4DV7E 4LF6I 3JAMQ 2F4VI 4DR6I 1ZXNA 4PRVA 3LPSA 5LMNE 1PKPA 1XMOI 4DR7E 4LF8I 4LF4I 1Z0EA 2UUBI 4LF6E 4X65I 4DR2E 3ZKBA 4X66E 2J7KA 2ZITA 1OJ4A 3WU6A 4GKKE 4RPFA 2VQEE 3Q1QA 4LFAE 2A2CA 3K1JA 5FLXQ 3T1YI 2X36A 4DV2E 2UUCE 1HNZI 4YHHI 3F0NA 4OX9I 5L3JA 1ZM4A 4DV3I 4JV5E 1N32I 4DR1I 4DV5E 1HNXE 4WUDA 4B3SI 1RR9A 1IBMI 4JI6E 2ZM6I 4MYTA 4AQYI 2UU9E 4JI1E 4LFCI 4X62I 1HR0I 2E5LI 4NXNE 2HKEA 4HXZA 4JI2I 5GMDA 4LF7E 1FI4A 1XNRE 2XEXA 4DV4I 1J5EE 1XMQE 1HNWE 4FWHA 1FJGE 2VF3A 5IT9C 2F4VE 3J80Q 1XHKA 1VISA 1N0VC 4DR6E 4JG4A 1BKNA 1H7SA 4DV1I 1I94I 4LFBI 4JYAI 2OI2A 1XMOE 1KVKA 4LF8E 2HFUA 4LF4E 4HY1A 3J81C 2UUBE 4FN5A 3WU4A 4HYMA 3V2UC 1Z5AA 3QT5A 1NHHA 4P52A 3V5RA 3QT7A 4B3RI 3PYDA 4P7AA 3T1YE 4XTJA 1H74A 4DR3I 1HNZE 5LMUI 3B78A 4YHHE 1D6TA 1EA6A 4JI7I 4DV3E 2ZBKB 5BR8I 1MG7A 4PU9A 4DV6E 1N33I 4JI5E 4JI0I 1IBME 2ZM6E 4DR4I 4MYUA 4X62E 4LFCE 4DPUA 3QT8A 3D4JA 4DU7A 2UUAI 3CWVA 1N34I 3WU3A 4JI2E 4B3TI 2UXCI 4B3ME 5GMEA 4DV4E 5LL6R 2UXDI 1QZRA 4X64E 3LTOA 1H73A 1Z0WA 3B82A 1KTVA 5IT9Q 4DXLA 3QT6A 1PVGA 4K0KI 1ELOA 4DV1E 2X7IA 1I94E 2UXBI 4JYAE 2HHHE 4DV0I 4GKJI 1B62A 1WUUA 3J81Q 1Z0CA 5IWAI 4FW9A 4DPYA 2NPFA 1Z5CA 4YY3I 2Q2EB 4NXME 3J7AM 1S4EA 3ZZTA 4DPXA 1MX0A 2VQFI 4JI4E 4JI8I 2HK2A 4URLA 1B63A 1IBKI 3PYEA 4DR3E 5LMUE 3LNUA 4JI7E
chains in the Genus database with same CATH superfamily
1U2RA 4X66I 1IBLI 3H4LA 4LF9I 1VI7A 2IOPA 4AM3A 3B4TA 1Z0VA 5BR8E 5JEAB 2VQEI 3CDIA 4OO1C 5K36B 1Z5BA 1RREA 1N36I 1Z0BA 5C0XE 4LFAI 2IERA 4HACB 4JI0E 2C39B 2UUCI 2BA1D 4DUYI 4IS9A 4X65E 5A2QC 4OO1F 5DRRA 1NHIA 4HACA 1XNQI 2V2VA 2E1RA 1FWKA 2UUAE 2V8PA 4U3DA 1S16A 2NN6C 1N34E 4EMDA 1EI1A 1ZM2A 4B3TE 2UXCE 1RHYA 2J65A 4JI6I 3M85D 2BA1G 3ZM7A 2GQ0A 4OO1A 4DUZI 2UXDE 3UHMA 4OX9E 1KIJA 4JI3I 2JE6A 1KKHA 4ISAA 2HK3A 1N32E 1DARA 4NXNI 2C38A 4K0KE 4IFDB 4FW3A 2UXBE 4DR1E 4DV0E 4B3SE 4ZVIA 4I3HA 1Y60A 1J5EI 2WNRB 2WP8B 4USMA 5ELWA 2GO3A 5IWAE 1PIEA 4AQYE 2R3VA 1MU5A 1ZXMA 2WNRA 4AIDA 1HR0E 2O1VA 2PO2B 2E5LE 4DR5I 4YY3E 3HJCA 3PS3A 1NZ0A 5DROA 4BA2A 2CGEA 3Q6MA 4FWDA 2VQFE 4MU0A 4JI8E 4Z7CA 5DNLA 1IBKE 2CVEA 2JEAA 1R6LA 3K17A 4AIMA 1IBLE 2WW4A 4LF9E 5C0XC 3ZZ0A 1K47A 3OTOI 1N0UA 4LF5I 4OZEA 1Z0TA 4LFBE 4R1FA 2O3ZA 1N36E 2O1WA 5C0XF 4ED4A 1H72C 2JEBB 1ZM3A 1P42A 2AJ4A 3PYFA 4LCGA 3ZZUA 4IFDE 4FWGA 3JAMC 4KHPI 4DUYE 3T1HI 4DV7I 4PRXA 1XNQE 1UDQA 5A2QQ 4FW5A 3L7ZA 2R42A 4M1KA 1ZM9A 1FNMA 5LMNI 4WUCA 4IZKA 4DV6I 3M6AA 4DR7I 1Y5YA 2PNZA 4U3BA 4DPWA 1E3HA 4JI5I 5C0XA 4Z7YA 4B3RE 2V2ZA 4DUZE 1FWLA 2EFGA 4DPTA 1H7UA 4DR2I 4JI3E 4OO1D 4USKA 2HFSA 2BM0A 2BM1A 3GONA 4GKKI 1Z0GA 2Z5BA 5FLXC 1UEKA 3P76A 1N33E 2HKJA 4B3MI 2GS8A 4DV2I 1NHJA 2CZ9A 2DEJA 4UT4A 4DR4E 4X64I 3HULA 4UTGA 2NN6D 4JV5I 4MU4A 1XXEA 3J7AG 4DR5E 1Z59A 3P3CA 4QNJA 4DV5I 2HHHI 3PS1A 1HNXI 4OO1B 1YH8A 2V2QA 1FKAE 2JE6B 2PO1A 2NN6F 4KQVA 4DU8A 2JT2A 1UDSA 2BV3A 4MU3A 2UU9I 4JI1I 2C38B 3ZKDA 3CDJA 2A2DA 4N3OA 4IFDC 4NXMI 3OTOE 2AE8A 1Y4UA 3WU5A 4LF5E 3PRYA 4FW6A 4MU1A 3U1YA 2IESA 4IZJD 4LF7I 3B8HA 4JI4I 3P06A 4GKJE 4IFDF 1XNRI 5JEAE 4WUBA 2IOQA 2DEIA 2LJPA 1XMQI 1HNWI 5K36E 1A6FA 2V34A 4KHPE 2BR2A 3PYGA 3J80C 3T1HE 1FJGI 4JI7E 2NN6A 4DV7E 4LF6I 3JAMQ 2F4VI 4BA2B 4DR6I 3M7NG 1ZXNA 5DNXA 4PRVA 3LPSA 5LMNE 1PKPA 1XMOI 4DR7E 4LF8I 4LF4I 2JEAB 1Z0EA 3U1KA 2UUBI 4LF6E 1USVA 4X65I 4OO1E 5C0XD 3PS2A 4DR2E 3ZKBA 2J7KA 4X66E 2ZITA 1OJ4A 3Q6NA 4LPFA 3WU6A 4IZJA 4GKKE 4RPFA 1UDNA 2VQEE 3Q1QA 4BA1A 4LFAE 2A2CA 3K1JA 5FLXQ 3T1YI 4OKGA 2X36A 4DV2E 2UUCE 3HKMA 1HNZI 4YHHI 3F0NA 4OX9I 3L7ZB 5L3JA 1R6MA 1ZM4A 4IZKB 4DV3I 2PO0A 4JV5E 2PNZB 1N32I 5C0XB 3NZKA 5DRPA 4DR1I 2PNLA 4DV5E 1HNXE 4WUDA 4B3SI 1RR9A 1IBMI 4JI6E 2ZM6I 4MYTA 4AQYI 2UU9E 4JI1E 4LFCI 4X62I 3H1CA 2Z5BB 1HR0I 2E5LI 5EKWA 5JEAC 4NXNE 2C37A 2HKEA 4HXZA 5K36C 2BA0D 4JI2I 5GMDA 4LF7E 1FI4A 5FWKA 5JEAF 1XNRE 2XEXA 4DV4I 1J5EE 1XMQE 5K36F 1HNWE 4FWHA 1FJGE 2VF3A 5IT9C 2F4VE 3J80Q 1XHKA 1VISA 1N0VC 4NBQA 4DR6E 4GQUA 4JG4A 1OYRA 4QNKA 1UDOA 1BKNA 1H7SA 4DV1I 1I94I 4LFBI 2BA0G 4JYAI 2OI2A 1XMOE 1KVKA 4LF8E 2HFUA 2PO1B 4LF4E 4HY1A 3J81C 5JEAA 1YHCA 1HK7A 2UUBE 5K36A 4LCFA 4FN5A 4IFDD 3GCMA 2C39A 1Y6ZA 3WU4A 1USUA 4HYMA 3V2UC 1Z5AA 3M7ND 3QT5A 1NHHA 2Z5CB 4P52A 3V5RA 3QT7A 2BR2B 2Z5CA 2NN6B 4B3RI 3PYDA 4P7AA 3T1YE 4XTJA 1H74A 2CG9A 4DR3I 1HNZE 5LMUI 3B78A 4YHHE 1D6TA 1EA6A 4JI7I 4MDTA 5DRQA 2O1TA 3KRNA 4DV3E 2F1DA 2ZBKB 5BR8I 1MG7A 4PU9A 4DV6E 1N33I 3DD6A 4JI5E 4IFDA 4FW7A 4JI0I 3M85G 1IBME 2ZM6E 4DR4I 4MYUA 4IZJB 2Z5EA 2WP8A 3K85A 4X62E 4LFCE 4DPUA 3QT8A 3D4JA 3P3EA 1Y4SA 4BA1B 1OYSA 2O1UA 4MQYA 4DU7A 2UUAI 3CWVA 2GO4A 1N34I 2PO2A 3WU3A 1E3PA 4JI2E 4B3TI 2UXCI 4B3ME 1OYPA 5GMEA 4DV4E 2VESA 5LL6R 2PO0B 2UXDI 2NN6E 1QZRA 4X64E 3LTOA 1H73A 4LOMA 1Z0WA 3GLLA 3B82A 1KTVA 2PNMA 4DXLA 3QT6A 5IT9Q 1PVGA 4K0KI 1ELOA 4DV1E 2X7IA 1I94E 2UXBI 4JYAE 2HHHE 4DV0I 4GKJI 1B62A 3GMEA 1WUUA 3J81Q 1Z0CA 2JEBA 4LCHA 5JEAD 5IWAI 4FW9A 5K36D 2C37B 4DPYA 2NPFA 1Z5CA 4YY3I 2Q2EB 4NXME 3J7AM 1S4EA 3ZZTA 4DPXA 1MX0A 2VQFI 4FW4A 4JI4E 4JI8I 2HK2A 4URLA 1B63A 1IBKI 3PYEA 4DR3E 3P3GA 5LMUE 4J3DA 3LNUA 5EL9A
chains in the Genus database with same CATH topology
1U2RA 4X66I 1IBLI 3H4LA 4LF9I 2IOPA 5BR8E 1Z0VA 2VQEI 1Z5BA 1RREA 1N36I 1Z0BA 4LFAI 4HACB 4JI0E 2UUCI 4DUYI 4X65E 5A2QC 1NHIA 4HACA 1XNQI 2V2VA 2E1RA 1FWKA 2UUAE 2V8PA 1S16A 1N34E 4EMDA 1EI1A 1ZM2A 4B3TE 2UXCE 4JI6I 3ZM7A 2GQ0A 4DUZI 2UXDE 4OX9E 1KIJA 4JI3I 1KKHA 2HK3A 1N32E 1DARA 4NXNI 4K0KE 2UXBE 4DR1E 4DV0E 4B3SE 4ZVIA 4I3HA 1J5EI 4USMA 4AQYE 5IWAE 1PIEA 2R3VA 1MU5A 1ZXMA 1HR0E 2O1VA 2E5LE 4DR5I 4YY3E 3HJCA 1NZ0A 2CGEA 3Q6MA 4FWDA 2VQFE 4JI8E 4Z7CA 1IBKE 3K17A 1IBLE 2WW4A 4LF9E 3ZZ0A 1K47A 3OTOI 1N0UA 4LF5I 1Z0TA 4LFBE 4R1FA 1N36E 2O1WA 4ED4A 1H72C 1ZM3A 2AJ4A 3PYFA 3ZZUA 4FWGA 3JAMC 4KHPI 4DUYE 3T1HI 4DV7I 4PRXA 1XNQE 5A2QQ 2R42A 4M1KA 1ZM9A 1FNMA 5LMNI 4WUCA 4IZKA 4DV6I 3M6AA 4DR7I 4DPWA 4JI5I 4Z7YA 4B3RE 2V2ZA 4DUZE 1FWLA 2EFGA 4DPTA 1H7UA 4DR2I 4JI3E 4USKA 2HFSA 2BM0A 2BM1A 3GONA 4GKKI 1Z0GA 2Z5BA 5FLXC 1UEKA 1N33E 2HKJA 4B3MI 2GS8A 4DV2I 1NHJA 2CZ9A 2DEJA 4UT4A 4DR4E 4X64I 3HULA 4UTGA 4JV5I 3J7AG 4DR5E 1Z59A 4DV5I 2HHHI 1HNXI 2V2QA 1FKAE 4KQVA 4DU8A 2UU9I 2BV3A 4JI1I 3ZKDA 2A2DA 4N3OA 4NXMI 3OTOE 1Y4UA 3WU5A 4LF5E 3PRYA 4IZJD 4LF7I 3B8HA 4JI4I 3P06A 4GKJE 1XNRI 4WUBA 2IOQA 2DEIA 2LJPA 1XMQI 1HNWI 1A6FA 2V34A 4KHPE 3PYGA 3J80C 3T1HE 1FJGI 4DV7E 4LF6I 3JAMQ 2F4VI 4DR6I 1ZXNA 4PRVA 3LPSA 5LMNE 1PKPA 1XMOI 4DR7E 4LF8I 4LF4I 1Z0EA 2UUBI 4LF6E 1USVA 4X65I 4DR2E 3ZKBA 4X66E 2J7KA 2ZITA 1OJ4A 3Q6NA 3WU6A 4IZJA 4GKKE 4RPFA 2VQEE 3Q1QA 4LFAE 2A2CA 3K1JA 5FLXQ 3T1YI 2X36A 4DV2E 2UUCE 1HNZI 4YHHI 3F0NA 4OX9I 5L3JA 1ZM4A 4IZKB 4DV3I 4JV5E 1N32I 4DR1I 2PNLA 4DV5E 1HNXE 4WUDA 4B3SI 1RR9A 1IBMI 4JI6E 2ZM6I 4MYTA 4AQYI 2UU9E 4JI1E 4LFCI 4X62I 2Z5BB 1HR0I 2E5LI 4NXNE 2HKEA 4HXZA 4JI2I 5GMDA 4LF7E 1FI4A 5FWKA 1XNRE 2XEXA 4DV4I 1J5EE 1XMQE 1HNWE 4FWHA 1FJGE 2VF3A 5IT9C 2F4VE 3J80Q 1XHKA 1VISA 1N0VC 4DR6E 4JG4A 1BKNA 1H7SA 4DV1I 1I94I 4LFBI 4JYAI 2OI2A 1XMOE 1KVKA 4LF8E 2HFUA 4LF4E 4HY1A 3J81C 1HK7A 2UUBE 4FN5A 1Y6ZA 3WU4A 1USUA 4HYMA 3V2UC 1Z5AA 3QT5A 1NHHA 2Z5CB 4P52A 3V5RA 3QT7A 2Z5CA 4B3RI 3PYDA 4P7AA 3T1YE 4XTJA 1H74A 2CG9A 4DR3I 1HNZE 5LMUI 3B78A 4YHHE 1D6TA 1EA6A 4JI7I 2O1TA 4DV3E 2ZBKB 5BR8I 1MG7A 4PU9A 4DV6E 1N33I 4JI5E 4JI0I 1IBME 2ZM6E 4DR4I 4MYUA 4IZJB 2Z5EA 3K85A 4X62E 4LFCE 4DPUA 3QT8A 3D4JA 1Y4SA 2O1UA 4DU7A 2UUAI 3CWVA 1N34I 3WU3A 4JI2E 4B3TI 2UXCI 4B3ME 5GMEA 4DV4E 5LL6R 2UXDI 1QZRA 4X64E 3LTOA 1H73A 1Z0WA 3B82A 1KTVA 2PNMA 4DXLA 3QT6A 5IT9Q 1PVGA 4K0KI 1ELOA 4DV1E 2X7IA 1I94E 2UXBI 4JYAE 2HHHE 4DV0I 4GKJI 1B62A 1WUUA 3J81Q 1Z0CA 5IWAI 4FW9A 4DPYA 2NPFA 1Z5CA 4YY3I 2Q2EB 4NXME 3J7AM 1S4EA 3ZZTA 4DPXA 1MX0A 2VQFI 4JI4E 4JI8I 2HK2A 4URLA 1B63A 1IBKI 3PYEA 4DR3E 5LMUE 3LNUA 4JI7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2R A;  4X66 I;  1IBL I;  3H4L A;  4LF9 I;  5BR8 E;  1Z0V A;  2VQE I;  1Z5B A;  1RRE A;  1N36 I;  1Z0B A;  4LFA I;  4HAC B;  4JI0 E;  2UUC I;  4DUY I;  4X65 E;  5A2Q C;  1NHI A;  4HAC A;  1XNQ I;  2V2V A;  2E1R A;  1FWK A;  2UUA E;  2V8P A;  1S16 A;  1N34 E;  4EMD A;  1EI1 A;  1ZM2 A;  4B3T E;  2UXC E;  4JI6 I;  3ZM7 A;  4DUZ I;  2UXD E;  4OX9 E;  1KIJ A;  4JI3 I;  1KKH A;  2HK3 A;  1N32 E;  1DAR A;  4NXN I;  4K0K E;  2UXB E;  4DR1 E;  4DV0 E;  4B3S E;  4ZVI A;  4I3H A;  1J5E I;  4USM A;  4AQY E;  5IWA E;  1PIE A;  2R3V A;  1MU5 A;  1ZXM A;  1HR0 E;  2E5L E;  4DR5 I;  4YY3 E;  1NZ0 A;  4FWD A;  2VQF E;  4JI8 E;  4Z7C A;  1IBK E;  3K17 A;  1IBL E;  2WW4 A;  4LF9 E;  3ZZ0 A;  1K47 A;  3OTO I;  1N0U A;  4LF5 I;  1Z0T A;  4LFB E;  4R1F A;  1N36 E;  4ED4 A;  1H72 C;  1ZM3 A;  2AJ4 A;  3PYF A;  3ZZU A;  4FWG A;  3JAM C;  4KHP I;  4DUY E;  3T1H I;  4DV7 I;  4PRX A;  1XNQ E;  5A2Q Q;  2R42 A;  4M1K A;  1ZM9 A;  1FNM A;  5LMN I;  4WUC A;  4DV6 I;  3M6A A;  4DR7 I;  4DPW A;  4JI5 I;  4Z7Y A;  4B3R E;  2V2Z A;  4DUZ E;  2EFG A;  1FWL A;  4DPT A;  1H7U A;  4DR2 I;  4JI3 E;  4USK A;  2HFS A;  2BM0 A;  2BM1 A;  3GON A;  4GKK I;  1Z0G A;  5FLX C;  1UEK A;  1N33 E;  2HKJ A;  4B3M I;  2GS8 A;  4DV2 I;  1NHJ A;  2CZ9 A;  2DEJ A;  4UT4 A;  4DR4 E;  4X64 I;  3HUL A;  4UTG A;  4JV5 I;  3J7A G;  4DR5 E;  1Z59 A;  4DV5 I;  2HHH I;  1HNX I;  1FKA E;  2V2Q A;  4KQV A;  4DU8 A;  2UU9 I;  2BV3 A;  4JI1 I;  3ZKD A;  2A2D A;  4NXM I;  3OTO E;  3WU5 A;  4LF5 E;  4LF7 I;  3B8H A;  4JI4 I;  4GKJ E;  1XNR I;  4WUB A;  2DEI A;  2LJP A;  1XMQ I;  1HNW I;  1A6F A;  2V34 A;  4KHP E;  3PYG A;  3J80 C;  3T1H E;  1FJG I;  4DV7 E;  4LF6 I;  3JAM Q;  2F4V I;  4DR6 I;  1ZXN A;  4PRV A;  3LPS A;  5LMN E;  1PKP A;  1XMO I;  4DR7 E;  4LF8 I;  4LF4 I;  1Z0E A;  2UUB I;  4LF6 E;  4X65 I;  4DR2 E;  3ZKB A;  4X66 E;  2J7K A;  2ZIT A;  1OJ4 A;  3WU6 A;  4GKK E;  4RPF A;  2VQE E;  3Q1Q A;  4LFA E;  2A2C A;  3K1J A;  5FLX Q;  3T1Y I;  2X36 A;  4DV2 E;  2UUC E;  1HNZ I;  4YHH I;  3F0N A;  4OX9 I;  5L3J A;  1ZM4 A;  4DV3 I;  4JV5 E;  1N32 I;  4DR1 I;  4DV5 E;  1HNX E;  4WUD A;  4B3S I;  1RR9 A;  1IBM I;  4JI6 E;  2ZM6 I;  4MYT A;  4AQY I;  2UU9 E;  4JI1 E;  4LFC I;  4X62 I;  1HR0 I;  2E5L I;  4NXN E;  2HKE A;  4HXZ A;  4JI2 I;  5GMD A;  4LF7 E;  1FI4 A;  1XNR E;  2XEX A;  4DV4 I;  1J5E E;  1XMQ E;  1HNW E;  4FWH A;  1FJG E;  2VF3 A;  5IT9 C;  2F4V E;  3J80 Q;  1XHK A;  1VIS A;  1N0V C;  4DR6 E;  4JG4 A;  1BKN A;  1H7S A;  4DV1 I;  1I94 I;  4LFB I;  4JYA I;  2OI2 A;  1XMO E;  1KVK A;  4LF8 E;  2HFU A;  4LF4 E;  4HY1 A;  3J81 C;  2UUB E;  4FN5 A;  3WU4 A;  4HYM A;  3V2U C;  1Z5A A;  3QT5 A;  1NHH A;  4P52 A;  3V5R A;  3QT7 A;  4B3R I;  3PYD A;  4P7A A;  3T1Y E;  4XTJ A;  1H74 A;  4DR3 I;  1HNZ E;  5LMU I;  3B78 A;  4YHH E;  1D6T A;  1EA6 A;  4JI7 I;  4DV3 E;  2ZBK B;  5BR8 I;  1MG7 A;  4PU9 A;  4DV6 E;  1N33 I;  4JI5 E;  4JI0 I;  1IBM E;  2ZM6 E;  4DR4 I;  4MYU A;  4X62 E;  4LFC E;  4DPU A;  3QT8 A;  3D4J A;  4DU7 A;  2UUA I;  3CWV A;  1N34 I;  3WU3 A;  4JI2 E;  4B3T I;  2UXC I;  4B3M E;  5GME A;  4DV4 E;  5LL6 R;  2UXD I;  1QZR A;  4X64 E;  3LTO A;  1H73 A;  1Z0W A;  3B82 A;  1KTV A;  5IT9 Q;  4DXL A;  3QT6 A;  1PVG A;  4K0K I;  1ELO A;  4DV1 E;  2X7I A;  1I94 E;  2UXB I;  4JYA E;  2HHH E;  4DV0 I;  4GKJ I;  1B62 A;  1WUU A;  3J81 Q;  1Z0C A;  5IWA I;  4FW9 A;  4DPY A;  2NPF A;  1Z5C A;  4YY3 I;  2Q2E B;  4NXM E;  3J7A M;  1S4E A;  3ZZT A;  4DPX A;  1MX0 A;  2VQF I;  4JI4 E;  4JI8 I;  2HK2 A;  4URL A;  1B63 A;  1IBK I;  3PYE A;  4DR3 E;  5LMU E;  3LNU A;  4JI7 E; 
#chains in the Genus database with same CATH topology
 1U2R A;  4X66 I;  1IBL I;  3H4L A;  4LF9 I;  1VI7 A;  2IOP A;  4AM3 A;  3B4T A;  1Z0V A;  5BR8 E;  5JEA B;  2VQE I;  3CDI A;  4OO1 C;  5K36 B;  1Z5B A;  1RRE A;  1N36 I;  1Z0B A;  5C0X E;  4LFA I;  2IER A;  4HAC B;  4JI0 E;  2C39 B;  2UUC I;  2BA1 D;  4DUY I;  4IS9 A;  4X65 E;  5A2Q C;  4OO1 F;  5DRR A;  1NHI A;  4HAC A;  1XNQ I;  2V2V A;  2E1R A;  1FWK A;  2UUA E;  2V8P A;  4U3D A;  1S16 A;  2NN6 C;  1N34 E;  4EMD A;  1EI1 A;  1ZM2 A;  4B3T E;  2UXC E;  1RHY A;  2J65 A;  4JI6 I;  3M85 D;  2BA1 G;  3ZM7 A;  2GQ0 A;  4OO1 A;  4DUZ I;  2UXD E;  3UHM A;  4OX9 E;  1KIJ A;  4JI3 I;  2JE6 A;  1KKH A;  4ISA A;  2HK3 A;  1N32 E;  1DAR A;  4NXN I;  2C38 A;  4K0K E;  4IFD B;  4FW3 A;  2UXB E;  4DR1 E;  4DV0 E;  4B3S E;  4ZVI A;  4I3H A;  1Y60 A;  1J5E I;  2WNR B;  2WP8 B;  4USM A;  5ELW A;  2GO3 A;  5IWA E;  1PIE A;  4AQY E;  2R3V A;  1MU5 A;  1ZXM A;  2WNR A;  4AID A;  1HR0 E;  2O1V A;  2PO2 B;  2E5L E;  4DR5 I;  4YY3 E;  3HJC A;  3PS3 A;  1NZ0 A;  5DRO A;  4BA2 A;  2CGE A;  3Q6M A;  4FWD A;  2VQF E;  4MU0 A;  4JI8 E;  4Z7C A;  5DNL A;  1IBK E;  2CVE A;  2JEA A;  1R6L A;  3K17 A;  4AIM A;  1IBL E;  2WW4 A;  4LF9 E;  5C0X C;  3ZZ0 A;  1K47 A;  3OTO I;  1N0U A;  4LF5 I;  4OZE A;  1Z0T A;  4LFB E;  4R1F A;  2O3Z A;  1N36 E;  2O1W A;  5C0X F;  4ED4 A;  1H72 C;  2JEB B;  1ZM3 A;  1P42 A;  2AJ4 A;  3PYF A;  4LCG A;  3ZZU A;  4IFD E;  4FWG A;  3JAM C;  4KHP I;  4DUY E;  3T1H I;  4DV7 I;  4PRX A;  1XNQ E;  1UDQ A;  5A2Q Q;  4FW5 A;  3L7Z A;  2R42 A;  4M1K A;  1ZM9 A;  1FNM A;  5LMN I;  4WUC A;  4IZK A;  4DV6 I;  3M6A A;  4DR7 I;  1Y5Y A;  2PNZ A;  4U3B A;  4DPW A;  1E3H A;  4JI5 I;  5C0X A;  4Z7Y A;  4B3R E;  2V2Z A;  4DUZ E;  1FWL A;  2EFG A;  4DPT A;  1H7U A;  4DR2 I;  4JI3 E;  4OO1 D;  4USK A;  2HFS A;  2BM0 A;  2BM1 A;  3GON A;  4GKK I;  1Z0G A;  2Z5B A;  5FLX C;  1UEK A;  3P76 A;  1N33 E;  2HKJ A;  4B3M I;  2GS8 A;  4DV2 I;  1NHJ A;  2CZ9 A;  2DEJ A;  4UT4 A;  4DR4 E;  4X64 I;  3HUL A;  4UTG A;  2NN6 D;  4JV5 I;  4MU4 A;  1XXE A;  3J7A G;  4DR5 E;  1Z59 A;  3P3C A;  4QNJ A;  4DV5 I;  2HHH I;  3PS1 A;  1HNX I;  4OO1 B;  1YH8 A;  2V2Q A;  1FKA E;  2JE6 B;  2PO1 A;  2NN6 F;  4KQV A;  4DU8 A;  2JT2 A;  1UDS A;  2BV3 A;  4MU3 A;  2UU9 I;  4JI1 I;  2C38 B;  3ZKD A;  3CDJ A;  2A2D A;  4N3O A;  4IFD C;  4NXM I;  3OTO E;  2AE8 A;  1Y4U A;  3WU5 A;  4LF5 E;  3PRY A;  4FW6 A;  4MU1 A;  3U1Y A;  2IES A;  4IZJ D;  4LF7 I;  3B8H A;  4JI4 I;  3P06 A;  4GKJ E;  4IFD F;  1XNR I;  5JEA E;  4WUB A;  2IOQ A;  2DEI A;  2LJP A;  1XMQ I;  1HNW I;  5K36 E;  1A6F A;  2V34 A;  4KHP E;  2BR2 A;  3PYG A;  3J80 C;  3T1H E;  1FJG I;  4JI7 E;  2NN6 A;  4DV7 E;  4LF6 I;  3JAM Q;  2F4V I;  4BA2 B;  4DR6 I;  3M7N G;  1ZXN A;  5DNX A;  4PRV A;  3LPS A;  5LMN E;  1PKP A;  1XMO I;  4DR7 E;  4LF8 I;  4LF4 I;  2JEA B;  1Z0E A;  3U1K A;  2UUB I;  4LF6 E;  1USV A;  4X65 I;  4OO1 E;  5C0X D;  3PS2 A;  4DR2 E;  3ZKB A;  2J7K A;  4X66 E;  2ZIT A;  1OJ4 A;  3Q6N A;  4LPF A;  3WU6 A;  4IZJ A;  4GKK E;  4RPF A;  1UDN A;  2VQE E;  3Q1Q A;  4BA1 A;  4LFA E;  2A2C A;  3K1J A;  5FLX Q;  3T1Y I;  4OKG A;  2X36 A;  4DV2 E;  2UUC E;  3HKM A;  1HNZ I;  4YHH I;  3F0N A;  4OX9 I;  3L7Z B;  5L3J A;  1R6M A;  1ZM4 A;  4IZK B;  4DV3 I;  2PO0 A;  4JV5 E;  2PNZ B;  1N32 I;  5C0X B;  3NZK A;  5DRP A;  4DR1 I;  2PNL A;  4DV5 E;  1HNX E;  4WUD A;  4B3S I;  1RR9 A;  1IBM I;  4JI6 E;  2ZM6 I;  4MYT A;  4AQY I;  2UU9 E;  4JI1 E;  4LFC I;  4X62 I;  3H1C A;  2Z5B B;  1HR0 I;  2E5L I;  5EKW A;  5JEA C;  4NXN E;  2C37 A;  2HKE A;  4HXZ A;  5K36 C;  2BA0 D;  4JI2 I;  5GMD A;  4LF7 E;  1FI4 A;  5FWK A;  5JEA F;  1XNR E;  2XEX A;  4DV4 I;  1J5E E;  1XMQ E;  5K36 F;  1HNW E;  4FWH A;  1FJG E;  2VF3 A;  5IT9 C;  2F4V E;  3J80 Q;  1XHK A;  1VIS A;  1N0V C;  4NBQ A;  4DR6 E;  4GQU A;  4JG4 A;  1OYR A;  4QNK A;  1UDO A;  1BKN A;  1H7S A;  4DV1 I;  1I94 I;  4LFB I;  2BA0 G;  4JYA I;  2OI2 A;  1XMO E;  1KVK A;  4LF8 E;  2HFU A;  2PO1 B;  4LF4 E;  4HY1 A;  3J81 C;  5JEA A;  1YHC A;  1HK7 A;  2UUB E;  5K36 A;  4LCF A;  4FN5 A;  4IFD D;  3GCM A;  2C39 A;  1Y6Z A;  3WU4 A;  1USU A;  4HYM A;  3V2U C;  1Z5A A;  3M7N D;  3QT5 A;  1NHH A;  2Z5C B;  4P52 A;  3V5R A;  3QT7 A;  2BR2 B;  2Z5C A;  2NN6 B;  4B3R I;  3PYD A;  4P7A A;  3T1Y E;  4XTJ A;  1H74 A;  2CG9 A;  4DR3 I;  1HNZ E;  5LMU I;  3B78 A;  4YHH E;  1D6T A;  1EA6 A;  4JI7 I;  4MDT A;  5DRQ A;  2O1T A;  3KRN A;  4DV3 E;  2F1D A;  2ZBK B;  5BR8 I;  1MG7 A;  4PU9 A;  4DV6 E;  1N33 I;  3DD6 A;  4JI5 E;  4IFD A;  4FW7 A;  4JI0 I;  3M85 G;  1IBM E;  2ZM6 E;  4DR4 I;  4MYU A;  4IZJ B;  2Z5E A;  2WP8 A;  3K85 A;  4X62 E;  4LFC E;  4DPU A;  3QT8 A;  3D4J A;  3P3E A;  1Y4S A;  4BA1 B;  1OYS A;  2O1U A;  4MQY A;  4DU7 A;  2UUA I;  3CWV A;  2GO4 A;  1N34 I;  2PO2 A;  3WU3 A;  1E3P A;  4JI2 E;  4B3T I;  2UXC I;  4B3M E;  1OYP A;  5GME A;  4DV4 E;  2VES A;  5LL6 R;  2PO0 B;  2UXD I;  2NN6 E;  1QZR A;  4X64 E;  3LTO A;  1H73 A;  4LOM A;  1Z0W A;  3GLL A;  3B82 A;  1KTV A;  2PNM A;  4DXL A;  3QT6 A;  5IT9 Q;  1PVG A;  4K0K I;  1ELO A;  4DV1 E;  2X7I A;  1I94 E;  2UXB I;  4JYA E;  2HHH E;  4DV0 I;  4GKJ I;  1B62 A;  3GME A;  1WUU A;  3J81 Q;  1Z0C A;  2JEB A;  4LCH A;  5JEA D;  5IWA I;  4FW9 A;  5K36 D;  2C37 B;  4DPY A;  2NPF A;  1Z5C A;  4YY3 I;  2Q2E B;  4NXM E;  3J7A M;  1S4E A;  3ZZT A;  4DPX A;  1MX0 A;  2VQF I;  4FW4 A;  4JI4 E;  4JI8 I;  2HK2 A;  4URL A;  1B63 A;  1IBK I;  3PYE A;  4DR3 E;  3P3G A;  5LMU E;  4J3D A;  3LNU A;  5EL9 A; 
#chains in the Genus database with same CATH homology
 1U2R A;  4X66 I;  1IBL I;  3H4L A;  4LF9 I;  2IOP A;  5BR8 E;  1Z0V A;  2VQE I;  1Z5B A;  1RRE A;  1N36 I;  1Z0B A;  4LFA I;  4HAC B;  4JI0 E;  2UUC I;  4DUY I;  4X65 E;  5A2Q C;  1NHI A;  4HAC A;  1XNQ I;  2V2V A;  2E1R A;  1FWK A;  2UUA E;  2V8P A;  1S16 A;  1N34 E;  4EMD A;  1EI1 A;  1ZM2 A;  4B3T E;  2UXC E;  4JI6 I;  3ZM7 A;  2GQ0 A;  4DUZ I;  2UXD E;  4OX9 E;  1KIJ A;  4JI3 I;  1KKH A;  2HK3 A;  1N32 E;  1DAR A;  4NXN I;  4K0K E;  2UXB E;  4DR1 E;  4DV0 E;  4B3S E;  4ZVI A;  4I3H A;  1J5E I;  4USM A;  4AQY E;  5IWA E;  1PIE A;  2R3V A;  1MU5 A;  1ZXM A;  1HR0 E;  2O1V A;  2E5L E;  4DR5 I;  4YY3 E;  3HJC A;  1NZ0 A;  2CGE A;  3Q6M A;  4FWD A;  2VQF E;  4JI8 E;  4Z7C A;  1IBK E;  3K17 A;  1IBL E;  2WW4 A;  4LF9 E;  3ZZ0 A;  1K47 A;  3OTO I;  1N0U A;  4LF5 I;  1Z0T A;  4LFB E;  4R1F A;  1N36 E;  2O1W A;  4ED4 A;  1H72 C;  1ZM3 A;  2AJ4 A;  3PYF A;  3ZZU A;  4FWG A;  3JAM C;  4KHP I;  4DUY E;  3T1H I;  4DV7 I;  4PRX A;  1XNQ E;  5A2Q Q;  2R42 A;  4M1K A;  1ZM9 A;  1FNM A;  5LMN I;  4WUC A;  4IZK A;  4DV6 I;  3M6A A;  4DR7 I;  4DPW A;  4JI5 I;  4Z7Y A;  4B3R E;  2V2Z A;  4DUZ E;  1FWL A;  2EFG A;  4DPT A;  1H7U A;  4DR2 I;  4JI3 E;  4USK A;  2HFS A;  2BM0 A;  2BM1 A;  3GON A;  4GKK I;  1Z0G A;  2Z5B A;  5FLX C;  1UEK A;  1N33 E;  2HKJ A;  4B3M I;  2GS8 A;  4DV2 I;  1NHJ A;  2CZ9 A;  2DEJ A;  4UT4 A;  4DR4 E;  4X64 I;  3HUL A;  4UTG A;  4JV5 I;  3J7A G;  4DR5 E;  1Z59 A;  4DV5 I;  2HHH I;  1HNX I;  2V2Q A;  1FKA E;  4KQV A;  4DU8 A;  2UU9 I;  2BV3 A;  4JI1 I;  3ZKD A;  2A2D A;  4N3O A;  4NXM I;  3OTO E;  1Y4U A;  3WU5 A;  4LF5 E;  3PRY A;  4IZJ D;  4LF7 I;  3B8H A;  4JI4 I;  3P06 A;  4GKJ E;  1XNR I;  4WUB A;  2IOQ A;  2DEI A;  2LJP A;  1XMQ I;  1HNW I;  1A6F A;  2V34 A;  4KHP E;  3PYG A;  3J80 C;  3T1H E;  1FJG I;  4DV7 E;  4LF6 I;  3JAM Q;  2F4V I;  4DR6 I;  1ZXN A;  4PRV A;  3LPS A;  5LMN E;  1PKP A;  1XMO I;  4DR7 E;  4LF8 I;  4LF4 I;  1Z0E A;  2UUB I;  4LF6 E;  1USV A;  4X65 I;  4DR2 E;  3ZKB A;  4X66 E;  2J7K A;  2ZIT A;  1OJ4 A;  3Q6N A;  3WU6 A;  4IZJ A;  4GKK E;  4RPF A;  2VQE E;  3Q1Q A;  4LFA E;  2A2C A;  3K1J A;  5FLX Q;  3T1Y I;  2X36 A;  4DV2 E;  2UUC E;  1HNZ I;  4YHH I;  3F0N A;  4OX9 I;  5L3J A;  1ZM4 A;  4IZK B;  4DV3 I;  4JV5 E;  1N32 I;  4DR1 I;  2PNL A;  4DV5 E;  1HNX E;  4WUD A;  4B3S I;  1RR9 A;  1IBM I;  4JI6 E;  2ZM6 I;  4MYT A;  4AQY I;  2UU9 E;  4JI1 E;  4LFC I;  4X62 I;  2Z5B B;  1HR0 I;  2E5L I;  4NXN E;  2HKE A;  4HXZ A;  4JI2 I;  5GMD A;  4LF7 E;  1FI4 A;  5FWK A;  1XNR E;  2XEX A;  4DV4 I;  1J5E E;  1XMQ E;  1HNW E;  4FWH A;  1FJG E;  2VF3 A;  5IT9 C;  2F4V E;  3J80 Q;  1XHK A;  1VIS A;  1N0V C;  4DR6 E;  4JG4 A;  1BKN A;  1H7S A;  4DV1 I;  1I94 I;  4LFB I;  4JYA I;  2OI2 A;  1XMO E;  1KVK A;  4LF8 E;  2HFU A;  4LF4 E;  4HY1 A;  3J81 C;  1HK7 A;  2UUB E;  4FN5 A;  1Y6Z A;  3WU4 A;  1USU A;  4HYM A;  3V2U C;  1Z5A A;  3QT5 A;  1NHH A;  2Z5C B;  4P52 A;  3V5R A;  3QT7 A;  2Z5C A;  4B3R I;  3PYD A;  4P7A A;  3T1Y E;  4XTJ A;  1H74 A;  2CG9 A;  4DR3 I;  1HNZ E;  5LMU I;  3B78 A;  4YHH E;  1D6T A;  1EA6 A;  4JI7 I;  2O1T A;  4DV3 E;  2ZBK B;  5BR8 I;  1MG7 A;  4PU9 A;  4DV6 E;  1N33 I;  4JI5 E;  4JI0 I;  1IBM E;  2ZM6 E;  4DR4 I;  4MYU A;  4IZJ B;  2Z5E A;  3K85 A;  4X62 E;  4LFC E;  4DPU A;  3QT8 A;  3D4J A;  1Y4S A;  2O1U A;  4DU7 A;  2UUA I;  3CWV A;  1N34 I;  3WU3 A;  4JI2 E;  4B3T I;  2UXC I;  4B3M E;  5GME A;  4DV4 E;  5LL6 R;  2UXD I;  1QZR A;  4X64 E;  3LTO A;  1H73 A;  1Z0W A;  3B82 A;  1KTV A;  2PNM A;  4DXL A;  3QT6 A;  5IT9 Q;  1PVG A;  4K0K I;  1ELO A;  4DV1 E;  2X7I A;  1I94 E;  2UXB I;  4JYA E;  2HHH E;  4DV0 I;  4GKJ I;  1B62 A;  1WUU A;  3J81 Q;  1Z0C A;  5IWA I;  4FW9 A;  4DPY A;  2NPF A;  1Z5C A;  4YY3 I;  2Q2E B;  4NXM E;  3J7A M;  1S4E A;  3ZZT A;  4DPX A;  1MX0 A;  2VQF I;  4JI4 E;  4JI8 I;  2HK2 A;  4URL A;  1B63 A;  1IBK I;  3PYE A;  4DR3 E;  5LMU E;  3LNU A;  4JI7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...