3WU5A

Reduced e.coli lon proteolytic domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
b'RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lon protease
molecule tags Hydrolase
source organism Escherichia coli
publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
total genus 60
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu5A01
4I3HA 1PKPA 4DV7E 4X65I 2ZITA 3LTOA 4DV5I 4DR3I 3J7AG 4JG4A 5FLXQ 4PRVA 1UEKA 4PU9A 4LFCI 3OTOE 1ZM2A 4DV4E 1A6FA 4LFBI 2UXCI 2Q2EB 5LMUI 4DR6I 1Z5CA 4DR2I 3PYGA 4FWHA 1FI4A 1PVGA 1NHHA 1Z59A 3T1HE 3ZM7A 4JI0I 1FWKA 4JI5E 2GS8A 3QT5A 5BR8I 1XMQI 1H7SA 4JI8I 2BM0A 4LF5I 3F0NA 4DR1I 4XTJA 1I94I 4HXZA 1XNRE 2R42A 3B78A 2HHHE 4DUZI 2UUBE 4WUDA 2F4VI 2UUCI 3V2UC 1IBLE 1H73A 1MG7A 1KTVA 4JI3E 4KHPE 2HFUA 1XNQE 4DR5E 4JI2I 4DV3I 5LMNI 4JI6E 4DPYA 4X62I 4LF9I 1FKAE 1ZM9A 4MYTA 1Z0CA 4DR7E 4WUBA 2HKEA 2E1RA 2CZ9A 4LF6I 2LJPA 4YHHE 1Z0WA 4M1KA 1N34I 1H74A 3J80C 4B3RI 1D6TA 1OJ4A 2XEXA 1XMOI 4DV5E 1KIJA 3J81C 4GKJI 3K1JA 4LFCE 2V8PA 3OTOI 4JV5E 4LFBE 2EFGA 5LMUE 4DR6E 1Z0TA 4LF8E 4P52A 1N0UA 3WU5A 1WUUA 4DPUA 3HULA 4X64I 1ZM4A 1HR0E 3QT8A 4DU7A 4JI0E 4JI5I 1IBMI 4LF7E 4B3MI 1FJGI 4JI8E 2UU9E 4LF5E 2DEIA 4HYMA 3ZKBA 2HK2A 2HHHI 4DUYE 4DUZE 3T1YE 1FWLA 1VISA 2UUCE 4GKKI 4AQYI 1J5EE 2NPFA 4JI3I 4KHPI 1Z0EA 2HFSA 2V34A 1H72C 1XNQI 4DR5I 4NXME 3Q1QA 5LMNE 1EA6A 4HACB 4X62E 1Z5BA 4YY3E 4JYAE 5IT9Q 3V5RA 5L3JA 1HNXE 1S16A 1Z0BA 4UT4A 1N36I 3J81Q 1QZRA 2UXBE 4LF6E 4KQVA 4R1FA 4EMDA 1N34E 3PYDA 4B3RE 4USKA 1XMOE 1RREA 4JI4I 1U2RA 2X36A 1S4EA 4GKJE 1NHJA 3JAMC 1ZXNA 2ZBKB 2DEJA 1HNWI 4URLA 2AJ4A 4JV5I 2BV3A 3D4JA 4LF8I 4X66I 2VQFI 4DU8A 4X64E 1HR0I 1ZXMA 1IBKE 4JI7E 1IBME 4LF7I 1N0VC 4Z7CA 4B3ME 1FJGE 4DR4E 2UU9I 3ZZTA 4DUYI 4B3SI 3T1YI 4DV6I 4JI1E 3WU3A 1KVKA 2VQEE 1NHIA 4GKKE 4AQYE 1J5EI 4PRXA 1B63A 2WW4A 4NXMI 2V2ZA 1DARA 2V2VA 4DV1I 1ELOA 1RR9A 4DPXA 4ZVIA 4JYAI 4YY3I 1K47A 1N33E 3B8HA 3ZKDA 2BM1A 1EI1A 1HNXI 4LF4E 5GMEA 2R3VA 4LFAI 4UTGA 1N36E 4OX9E 2UXBI 4DV2I 3QT7A 4NXNE 5IWAI 3B82A 1HNZE 2ZM6E 4B3TE 4K0KE 3WU6A 1NZ0A 4JI4E 5A2QQ 3PYFA 1MU5A 2E5LI 1H7UA 1HNWE 2A2CA 4DV0I 3M6AA 2UXDI 3LPSA 4RPFA 3LNUA 4HY1A 1N32E 4X66E 2VQFE 3JAMQ 4WUCA 2UUAE 3J7AM 1IBKI 4JI7I 4DPTA 4FWGA 4DR4I 4DV7I 1KKHA 3WU4A 2HKJA 5IT9C 5A2QC 4X65E 5GMDA 3CWVA 4DR3E 4B3SE 3H4LA 3ZZUA 4DV6E 4P7AA 4JI1I 1XHKA 2VQEI 4DV4I 4HACA 4ED4A 2UXCE 1Z5AA 2A2DA 4DR2E 4FW9A 1Z0VA 2X7IA 3K17A 1MX0A 4DV1E 3T1HI 2J7KA 3J80Q 4FN5A 1N33I 3GONA 1FNMA 5BR8E 1XMQE 4LF4I 4DR1E 1I94E 1XNRI 4LFAE 2V2QA 4OX9I 4USMA 2UUBI 2F4VE 4DV2E 4NXNI 4MYUA 5IWAE 1HNZI 4B3TI 1ZM3A 2ZM6I 1B62A 2VF3A 5FLXC 4K0KI 1BKNA 4DPWA 1IBLI 3QT6A 1PIEA 4JI2E 2E5LE 4DV3E 4JI6I 4LF9E 4DV0E 2UXDE 4FWDA 3PYEA 1N32I 5LL6R 1Z0GA 2OI2A 4DR7I 4DXLA 2UUAI 4Z7YA 2HK3A 3ZZ0A 4YHHI
chains in the Genus database with same CATH superfamily
4I3HA 1PKPA 4DV7E 2JT2A 4X65I 3M85D 2ZITA 3LTOA 4DV5I 4DR3I 3J7AG 4JG4A 2O3ZA 5FLXQ 3GCMA 3GMEA 4PRVA 1UEKA 4PU9A 4OO1F 4LFCI 2BA1G 4NXNE 3OTOE 1ZM2A 2CVEA 4DV4E 1A6FA 4LFBI 4OKGA 2UXCI 2Q2EB 5LMUI 4DR6I 1Z5CA 4DR2I 5JEAB 3PYGA 5K36D 4FWHA 1FI4A 2PO1A 1PVGA 1NHHA 1Z59A 3T1HE 1XXEA 3ZM7A 4IZJD 3NZKA 5K36B 4JI0I 1FWKA 2GS8A 3QT5A 5BR8I 4JI5E 1XMQI 1H7SA 4JI8I 2BM0A 4IZJB 4LF5I 4U3DA 3F0NA 4DR1I 4XTJA 1UDOA 4MDTA 1I94I 4HXZA 1XNRE 5C0XF 4LPFA 4OO1C 5JEAF 2R42A 4ISAA 3B78A 2HHHE 4DUZI 2UUBE 4MU0A 4WUDA 2F4VI 2C38B 2UUCI 3V2UC 3U1YA 4AM3A 1HK7A 1IBLE 1H73A 1MG7A 1KTVA 4JI3E 4KHPE 2IOQA 2HFUA 1XNQE 4DR5E 4JI2I 2O1VA 5LMNI 4DV3I 4JI6E 4DPYA 4X62I 5DRQA 4LF9I 4IFDC 2JEAB 1R6MA 2BA0D 1FKAE 5K36E 5JEAC 5C0XD 4MU4A 4MQYA 1ZM9A 4MYTA 1Z0CA 4DR7E 4WUBA 2HKEA 1YH8A 2E1RA 2CZ9A 4LF6I 2LJPA 4YHHE 4IZJA 2CG9A 1Z0WA 2NN6D 4M1KA 1N34I 1H74A 3J80C 4B3RI 2C39A 1D6TA 1OJ4A 2XEXA 1XMOI 4DV5E 4AIMA 1KIJA 4QNKA 3J81C 2PO0A 4GKJI 3K1JA 2C38A 3M7ND 4LFCE 2V8PA 3OTOI 4JV5E 4LFBE 5DROA 2EFGA 5LMUE 4FW4A 4DR6E 1Z0TA 4LF8E 4P52A 2PNMA 1N0UA 3WU5A 1WUUA 4DPUA 3HULA 4X64I 4GQUA 1ZM4A 1USVA 3QT8A 1HR0E 4DU7A 2WP8B 5DNLA 4JI0E 4BA1A 4JI5I 1IBMI 4LF7E 4B3MI 1FJGI 4JI8E 5C0XE 2NN6C 2UU9E 4LF5E 2DEIA 4HYMA 3ZKBA 2HK2A 2HHHI 4DUYE 4DUZE 3T1YE 3PRYA 5K36A 1FWLA 1VISA 2BA1D 2NN6E 2UUCE 2JE6A 4GKKI 4AQYI 1J5EE 2O1TA 2NPFA 4JI3I 4KHPI 1YHCA 1Z0EA 2HFSA 2V34A 5DRRA 1H72C 1XNQI 1R6LA 4DR5I 4NXME 3Q1QA 3KRNA 5LMNE 1EA6A 4HACB 4IZKB 4X62E 1P42A 1Z5BA 4YY3E 4JYAE 5IT9Q 5C0XB 4N3OA 3PS2A 3V5RA 5L3JA 1HNXE 1S16A 2VESA 2BA0G 1Z0BA 4UT4A 1N36I 2NN6B 2CGEA 3J81Q 1QZRA 2UXBE 3DD6A 4LF6E 4KQVA 5JEAE 4R1FA 1UDSA 2Z5CA 4EMDA 1N34E 3PYDA 2NN6F 4B3RE 4USKA 5EKWA 1XMOE 4IFDE 1RREA 4JI4I 1U2RA 2X36A 1S4EA 4GKJE 1NHJA 2Z5CB 3JAMC 1ZXNA 2ZBKB 2DEJA 1HNWI 4BA2A 1USUA 4URLA 2AJ4A 4JV5I 2BV3A 3D4JA 2O1UA 2IESA 2J65A 4FW3A 4LF8I 3HJCA 4X66I 2VQFI 4DU8A 4OO1B 4X64E 2GO3A 1HR0I 1ZXMA 1IBKE 4JI7E 2PNZA 2PO2B 4YHHI 1N0VC 1IBME 4LF7I 4Z7CA 4B3ME 1FJGE 4DR4E 2UU9I 4LCFA 4OO1A 1Y5YA 2PO2A 3ZZTA 4LCHA 4DUYI 4B3SI 3T1YI 4IFDB 4DV6I 4JI1E 2Z5BB 3WU3A 1KVKA 2VQEE 1NHIA 4IFDF 4GKKE 4AQYE 1J5EI 4PRXA 1OYRA 1B63A 2GQ0A 2WW4A 4NXMI 2V2ZA 1DARA 1Y4SA 2V2VA 4DV1I 4IFDA 5FWKA 1ELOA 3L7ZA 2Z5BA 1RR9A 4DPXA 4ZVIA 4JYAI 4YY3I 1K47A 3B4TA 1N33E 3B8HA 1Y6ZA 3ZKDA 4MU1A 5JEAA 2BM1A 1EI1A 1HNXI 2WNRB 2PO1B 4LF4E 3UHMA 5GMEA 2R3VA 4LFAI 4UTGA 1N36E 4OX9E 2UXBI 4J3DA 4DV2I 2GO4A 2C37A 3QT7A 3B82A 3Q6MA 2PO0B 5IWAI 2WNRA 2ZM6E 1HNZE 1RHYA 4B3TE 5K36C 3GLLA 4K0KE 3WU6A 2JE6B 1OYPA 1NZ0A 4AIDA 4JI4E 5A2QQ 1MU5A 2BR2A 2E5LI 1H7UA 4MU3A 2IOPA 1HNWE 2A2CA 4DV0I 3P76A 3M6AA 2UXDI 3LPSA 4RPFA 2BR2B 4BA1B 3LNUA 4OO1D 4HY1A 1N32E 1UDNA 4X66E 2VQFE 3JAMQ 4WUCA 2O1WA 3PS1A 2UUAE 2JEAA 2C39B 3J7AM 1IBKI 4JI7I 4DPTA 3M85G 5ELWA 4FWGA 4DR4I 4DV7I 1KKHA 3WU4A 2HKJA 5IT9C 3P06A 5A2QC 3P3EA 4X65E 4NBQA 5GMDA 3CWVA 2JEBB 4IFDD 4DR3E 3K85A 4OZEA 4B3SE 4FW6A 2PNLA 3M7NG 3H4LA 3ZZUA 4DV6E 4P7AA 4JI1I 5JEAD 1XHKA 2VQEI 4DV4I 4IZKA 4HACA 4LCGA 4ED4A 4BA2B 2UXCE 3CDJA 1Z5AA 2A2DA 3HKMA 4DR2E 5C0XA 4FW9A 1Z0VA 2X7IA 3PS3A 3K17A 1MX0A 2IERA 4DV1E 3T1HI 2J7KA 3J80Q 4FN5A 1N33I 3GONA 4LOMA 1FNMA 5BR8E 4IS9A 1XMQE 4QNJA 4FW7A 4LF4I 2F1DA 4DR1E 1I94E 5K36F 1XNRI 4LFAE 2V2QA 3H1CA 4OX9I 4USMA 2WP8A 2UUBI 2F4VE 4DV2E 4NXNI 4MYUA 5IWAE 1HNZI 4B3TI 1ZM3A 1E3HA 1B62A 2ZM6I 2VF3A 5FLXC 4K0KI 1Y4UA 4OO1E 1BKNA 5DRPA 4U3BA 3P3GA 4DPWA 2JEBA 1IBLI 3QT6A 1OYSA 1PIEA 4JI2E 2E5LE 2AE8A 1E3PA 4DV3E 4JI6I 4FW5A 4LF9E 4DV0E 3Q6NA 2Z5EA 2C37B 2UXDE 1UDQA 5EL9A 4FWDA 2NN6A 3PYEA 1N32I 3P3CA 2PNZB 5LL6R 5C0XC 1Z0GA 2OI2A 4DR7I 4DXLA 2UUAI 3U1KA 4Z7YA 3CDIA 3L7ZB 2HK3A 3ZZ0A 3PYFA 1Y60A 1VI7A 5DNXA
chains in the Genus database with same CATH topology
4I3HA 1PKPA 4DV7E 4X65I 2ZITA 3LTOA 4DV5I 4DR3I 3J7AG 4JG4A 5FLXQ 4PRVA 1UEKA 4PU9A 4LFCI 3OTOE 1ZM2A 4DV4E 1A6FA 4LFBI 2UXCI 2Q2EB 5LMUI 4DR6I 1Z5CA 4DR2I 3PYGA 4FWHA 1FI4A 1PVGA 1NHHA 1Z59A 3T1HE 3ZM7A 4IZJD 4JI0I 1FWKA 2GS8A 3QT5A 5BR8I 4JI5E 1XMQI 1H7SA 4JI8I 2BM0A 4IZJB 4LF5I 3F0NA 4DR1I 4XTJA 1I94I 4HXZA 1XNRE 2R42A 3B78A 2HHHE 4DUZI 2UUBE 4WUDA 2F4VI 2UUCI 3V2UC 1HK7A 1IBLE 1H73A 1MG7A 1KTVA 4JI3E 4KHPE 2IOQA 2HFUA 1XNQE 4DR5E 4JI2I 2O1VA 5LMNI 4DV3I 4JI6E 4DPYA 4X62I 4LF9I 1FKAE 1ZM9A 4MYTA 1Z0CA 4DR7E 4WUBA 2HKEA 2E1RA 2CZ9A 4LF6I 2LJPA 4YHHE 4IZJA 2CG9A 1Z0WA 4M1KA 1N34I 1H74A 3J80C 4B3RI 1D6TA 1OJ4A 2XEXA 1XMOI 4DV5E 1KIJA 3J81C 4GKJI 3K1JA 4LFCE 2V8PA 3OTOI 4JV5E 4LFBE 2EFGA 5LMUE 4DR6E 1Z0TA 4LF8E 4P52A 2PNMA 1N0UA 3WU5A 1WUUA 4DPUA 3HULA 4X64I 1ZM4A 1USVA 3QT8A 1HR0E 4DU7A 4JI0E 4JI5I 1IBMI 4LF7E 4B3MI 1FJGI 4JI8E 2UU9E 4LF5E 2DEIA 4HYMA 3ZKBA 2HK2A 2HHHI 4DUYE 4DUZE 3T1YE 3PRYA 1FWLA 1VISA 2UUCE 4GKKI 4AQYI 1J5EE 2O1TA 2NPFA 4JI3I 4KHPI 1Z0EA 2HFSA 2V34A 1H72C 1XNQI 4DR5I 4NXME 3Q1QA 5LMNE 1EA6A 4HACB 4IZKB 4X62E 1Z5BA 4YY3E 4JYAE 5IT9Q 4N3OA 3V5RA 5L3JA 1HNXE 1S16A 1Z0BA 4UT4A 1N36I 2CGEA 3J81Q 1QZRA 2UXBE 4LF6E 4KQVA 4R1FA 2Z5CA 4EMDA 1N34E 3PYDA 4B3RE 4USKA 1XMOE 1RREA 4JI4I 1U2RA 2X36A 1S4EA 4GKJE 1NHJA 2Z5CB 3JAMC 1ZXNA 2ZBKB 2DEJA 1HNWI 1USUA 4URLA 2AJ4A 4JV5I 2BV3A 3D4JA 2O1UA 4LF8I 3HJCA 4X66I 2VQFI 4DU8A 4X64E 1HR0I 1ZXMA 1IBKE 4JI7E 1IBME 4LF7I 1N0VC 4Z7CA 4B3ME 1FJGE 4DR4E 2UU9I 3ZZTA 4DUYI 4B3SI 3T1YI 4DV6I 4JI1E 2Z5BB 3WU3A 1KVKA 2VQEE 1NHIA 4GKKE 4AQYE 1J5EI 4PRXA 1B63A 2GQ0A 2WW4A 4NXMI 2V2ZA 1DARA 1Y4SA 2V2VA 4DV1I 5FWKA 1ELOA 2Z5BA 1RR9A 4DPXA 4ZVIA 4JYAI 4YY3I 1K47A 1N33E 3B8HA 1Y6ZA 3ZKDA 2BM1A 1EI1A 1HNXI 4LF4E 5GMEA 2R3VA 4LFAI 4UTGA 1N36E 4OX9E 2UXBI 4DV2I 3QT7A 4NXNE 5IWAI 3B82A 3Q6MA 2ZM6E 1HNZE 4B3TE 4K0KE 3WU6A 1NZ0A 4JI4E 5A2QQ 3PYFA 1MU5A 2E5LI 1H7UA 2IOPA 1HNWE 2A2CA 4DV0I 3M6AA 2UXDI 3LPSA 4RPFA 3LNUA 4HY1A 1N32E 4X66E 2VQFE 3JAMQ 4WUCA 2O1WA 2UUAE 3J7AM 1IBKI 4JI7I 4DPTA 4FWGA 4DR4I 4DV7I 1KKHA 3WU4A 2HKJA 5IT9C 3P06A 5A2QC 4X65E 5GMDA 3CWVA 4DR3E 3K85A 4B3SE 2PNLA 3H4LA 3ZZUA 4DV6E 4P7AA 4JI1I 1XHKA 2VQEI 4DV4I 4IZKA 4HACA 4ED4A 2UXCE 1Z5AA 2A2DA 4DR2E 4FW9A 1Z0VA 2X7IA 3K17A 1MX0A 4DV1E 3T1HI 2J7KA 3J80Q 4FN5A 1N33I 3GONA 1FNMA 5BR8E 1XMQE 4LF4I 4DR1E 1I94E 1XNRI 4LFAE 2V2QA 4OX9I 4USMA 2UUBI 2F4VE 4DV2E 4NXNI 4MYUA 5IWAE 1HNZI 4B3TI 1ZM3A 2ZM6I 1B62A 2VF3A 5FLXC 4K0KI 1Y4UA 1BKNA 4DPWA 1IBLI 3QT6A 1PIEA 4JI2E 2E5LE 4DV3E 4JI6I 4LF9E 4DV0E 3Q6NA 2Z5EA 2UXDE 4FWDA 3PYEA 1N32I 5LL6R 1Z0GA 2OI2A 4DR7I 4DXLA 2UUAI 4Z7YA 2HK3A 3ZZ0A 4YHHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3H A;  1PKP A;  4DV7 E;  4X65 I;  2ZIT A;  3LTO A;  4DV5 I;  4DR3 I;  3J7A G;  4JG4 A;  5FLX Q;  4PRV A;  1UEK A;  4PU9 A;  4LFC I;  3OTO E;  1ZM2 A;  4DV4 E;  1A6F A;  4LFB I;  2UXC I;  2Q2E B;  5LMU I;  4DR6 I;  1Z5C A;  4DR2 I;  3PYG A;  4FWH A;  1FI4 A;  1PVG A;  1NHH A;  1Z59 A;  3T1H E;  3ZM7 A;  4JI0 I;  1FWK A;  4JI5 E;  2GS8 A;  3QT5 A;  5BR8 I;  1XMQ I;  1H7S A;  4JI8 I;  2BM0 A;  4LF5 I;  3F0N A;  4DR1 I;  4XTJ A;  1I94 I;  4HXZ A;  1XNR E;  2R42 A;  3B78 A;  2HHH E;  4DUZ I;  2UUB E;  4WUD A;  2F4V I;  2UUC I;  3V2U C;  1IBL E;  1H73 A;  1MG7 A;  1KTV A;  4JI3 E;  4KHP E;  2HFU A;  1XNQ E;  4DR5 E;  4JI2 I;  4DV3 I;  5LMN I;  4JI6 E;  4DPY A;  4X62 I;  4LF9 I;  1FKA E;  1ZM9 A;  4MYT A;  1Z0C A;  4DR7 E;  4WUB A;  2HKE A;  2E1R A;  2CZ9 A;  4LF6 I;  2LJP A;  4YHH E;  1Z0W A;  4M1K A;  1N34 I;  1H74 A;  3J80 C;  4B3R I;  1D6T A;  1OJ4 A;  2XEX A;  1XMO I;  4DV5 E;  1KIJ A;  3J81 C;  4GKJ I;  3K1J A;  4LFC E;  2V8P A;  3OTO I;  4JV5 E;  4LFB E;  2EFG A;  5LMU E;  4DR6 E;  1Z0T A;  4LF8 E;  4P52 A;  1N0U A;  3WU5 A;  1WUU A;  4DPU A;  3HUL A;  4X64 I;  1ZM4 A;  1HR0 E;  3QT8 A;  4DU7 A;  4JI0 E;  4JI5 I;  1IBM I;  4LF7 E;  4B3M I;  1FJG I;  4JI8 E;  2UU9 E;  4LF5 E;  2DEI A;  4HYM A;  3ZKB A;  2HK2 A;  2HHH I;  4DUY E;  4DUZ E;  3T1Y E;  1FWL A;  1VIS A;  2UUC E;  4GKK I;  4AQY I;  1J5E E;  2NPF A;  4JI3 I;  4KHP I;  1Z0E A;  2HFS A;  2V34 A;  1H72 C;  1XNQ I;  4DR5 I;  4NXM E;  3Q1Q A;  5LMN E;  1EA6 A;  4HAC B;  4X62 E;  1Z5B A;  4YY3 E;  4JYA E;  5IT9 Q;  3V5R A;  5L3J A;  1HNX E;  1S16 A;  1Z0B A;  4UT4 A;  1N36 I;  3J81 Q;  1QZR A;  2UXB E;  4LF6 E;  4KQV A;  4R1F A;  4EMD A;  1N34 E;  3PYD A;  4B3R E;  4USK A;  1XMO E;  1RRE A;  4JI4 I;  1U2R A;  2X36 A;  1S4E A;  4GKJ E;  1NHJ A;  3JAM C;  1ZXN A;  2ZBK B;  2DEJ A;  1HNW I;  4URL A;  2AJ4 A;  4JV5 I;  2BV3 A;  3D4J A;  4LF8 I;  4X66 I;  2VQF I;  4DU8 A;  4X64 E;  1HR0 I;  1ZXM A;  1IBK E;  4JI7 E;  1IBM E;  4LF7 I;  1N0V C;  4Z7C A;  4B3M E;  1FJG E;  4DR4 E;  2UU9 I;  3ZZT A;  4DUY I;  4B3S I;  3T1Y I;  4DV6 I;  4JI1 E;  3WU3 A;  1KVK A;  2VQE E;  1NHI A;  4GKK E;  4AQY E;  1J5E I;  4PRX A;  1B63 A;  2WW4 A;  4NXM I;  2V2Z A;  1DAR A;  2V2V A;  4DV1 I;  1ELO A;  1RR9 A;  4DPX A;  4ZVI A;  4JYA I;  4YY3 I;  1K47 A;  1N33 E;  3B8H A;  3ZKD A;  2BM1 A;  1EI1 A;  1HNX I;  4LF4 E;  5GME A;  2R3V A;  4LFA I;  4UTG A;  1N36 E;  4OX9 E;  2UXB I;  4DV2 I;  3QT7 A;  4NXN E;  5IWA I;  3B82 A;  1HNZ E;  2ZM6 E;  4B3T E;  4K0K E;  3WU6 A;  1NZ0 A;  4JI4 E;  5A2Q Q;  3PYF A;  1MU5 A;  2E5L I;  1H7U A;  1HNW E;  2A2C A;  4DV0 I;  3M6A A;  2UXD I;  3LPS A;  4RPF A;  3LNU A;  4HY1 A;  1N32 E;  4X66 E;  2VQF E;  3JAM Q;  4WUC A;  2UUA E;  3J7A M;  1IBK I;  4JI7 I;  4DPT A;  4FWG A;  4DR4 I;  4DV7 I;  1KKH A;  3WU4 A;  2HKJ A;  5IT9 C;  5A2Q C;  4X65 E;  5GMD A;  3CWV A;  4DR3 E;  4B3S E;  3H4L A;  3ZZU A;  4DV6 E;  4P7A A;  4JI1 I;  1XHK A;  2VQE I;  4DV4 I;  4HAC A;  4ED4 A;  2UXC E;  1Z5A A;  2A2D A;  4DR2 E;  4FW9 A;  1Z0V A;  2X7I A;  3K17 A;  1MX0 A;  4DV1 E;  3T1H I;  2J7K A;  3J80 Q;  4FN5 A;  1N33 I;  3GON A;  1FNM A;  5BR8 E;  1XMQ E;  4LF4 I;  4DR1 E;  1I94 E;  1XNR I;  4LFA E;  2V2Q A;  4OX9 I;  4USM A;  2UUB I;  2F4V E;  4DV2 E;  4NXN I;  4MYU A;  5IWA E;  1HNZ I;  4B3T I;  1ZM3 A;  2ZM6 I;  1B62 A;  2VF3 A;  5FLX C;  4K0K I;  1BKN A;  4DPW A;  1IBL I;  3QT6 A;  1PIE A;  4JI2 E;  2E5L E;  4DV3 E;  4JI6 I;  4LF9 E;  4DV0 E;  2UXD E;  4FWD A;  3PYE A;  1N32 I;  5LL6 R;  1Z0G A;  2OI2 A;  4DR7 I;  4DXL A;  2UUA I;  4Z7Y A;  2HK3 A;  3ZZ0 A;  4YHH I; 
#chains in the Genus database with same CATH topology
 4I3H A;  1PKP A;  4DV7 E;  2JT2 A;  4X65 I;  3M85 D;  2ZIT A;  3LTO A;  4DV5 I;  4DR3 I;  3J7A G;  4JG4 A;  2O3Z A;  5FLX Q;  3GCM A;  3GME A;  4PRV A;  1UEK A;  4PU9 A;  4OO1 F;  4LFC I;  2BA1 G;  4NXN E;  3OTO E;  1ZM2 A;  2CVE A;  4DV4 E;  1A6F A;  4LFB I;  4OKG A;  2UXC I;  2Q2E B;  5LMU I;  4DR6 I;  1Z5C A;  4DR2 I;  5JEA B;  3PYG A;  5K36 D;  4FWH A;  1FI4 A;  2PO1 A;  1PVG A;  1NHH A;  1Z59 A;  3T1H E;  1XXE A;  3ZM7 A;  4IZJ D;  3NZK A;  5K36 B;  4JI0 I;  1FWK A;  2GS8 A;  3QT5 A;  5BR8 I;  4JI5 E;  1XMQ I;  1H7S A;  4JI8 I;  2BM0 A;  4IZJ B;  4LF5 I;  4U3D A;  3F0N A;  4DR1 I;  4XTJ A;  1UDO A;  4MDT A;  1I94 I;  4HXZ A;  1XNR E;  5C0X F;  4LPF A;  4OO1 C;  5JEA F;  2R42 A;  4ISA A;  3B78 A;  2HHH E;  4DUZ I;  2UUB E;  4MU0 A;  4WUD A;  2F4V I;  2C38 B;  2UUC I;  3V2U C;  3U1Y A;  4AM3 A;  1HK7 A;  1IBL E;  1H73 A;  1MG7 A;  1KTV A;  4JI3 E;  4KHP E;  2IOQ A;  2HFU A;  1XNQ E;  4DR5 E;  4JI2 I;  2O1V A;  5LMN I;  4DV3 I;  4JI6 E;  4DPY A;  4X62 I;  5DRQ A;  4LF9 I;  4IFD C;  2JEA B;  1R6M A;  2BA0 D;  1FKA E;  5K36 E;  5JEA C;  5C0X D;  4MU4 A;  4MQY A;  1ZM9 A;  4MYT A;  1Z0C A;  4DR7 E;  4WUB A;  2HKE A;  1YH8 A;  2E1R A;  2CZ9 A;  4LF6 I;  2LJP A;  4YHH E;  4IZJ A;  2CG9 A;  1Z0W A;  2NN6 D;  4M1K A;  1N34 I;  1H74 A;  3J80 C;  4B3R I;  2C39 A;  1D6T A;  1OJ4 A;  2XEX A;  1XMO I;  4DV5 E;  4AIM A;  1KIJ A;  4QNK A;  3J81 C;  2PO0 A;  4GKJ I;  3K1J A;  2C38 A;  3M7N D;  4LFC E;  2V8P A;  3OTO I;  4JV5 E;  4LFB E;  5DRO A;  2EFG A;  5LMU E;  4FW4 A;  4DR6 E;  1Z0T A;  4LF8 E;  4P52 A;  2PNM A;  1N0U A;  3WU5 A;  1WUU A;  4DPU A;  3HUL A;  4X64 I;  4GQU A;  1ZM4 A;  1USV A;  3QT8 A;  1HR0 E;  4DU7 A;  2WP8 B;  5DNL A;  4JI0 E;  4BA1 A;  4JI5 I;  1IBM I;  4LF7 E;  4B3M I;  1FJG I;  4JI8 E;  5C0X E;  2NN6 C;  2UU9 E;  4LF5 E;  2DEI A;  4HYM A;  3ZKB A;  2HK2 A;  2HHH I;  4DUY E;  4DUZ E;  3T1Y E;  3PRY A;  5K36 A;  1FWL A;  1VIS A;  2BA1 D;  2NN6 E;  2UUC E;  2JE6 A;  4GKK I;  4AQY I;  1J5E E;  2O1T A;  2NPF A;  4JI3 I;  4KHP I;  1YHC A;  1Z0E A;  2HFS A;  2V34 A;  5DRR A;  1H72 C;  1XNQ I;  1R6L A;  4DR5 I;  4NXM E;  3Q1Q A;  3KRN A;  5LMN E;  1EA6 A;  4HAC B;  4IZK B;  4X62 E;  1P42 A;  1Z5B A;  4YY3 E;  4JYA E;  5IT9 Q;  5C0X B;  4N3O A;  3PS2 A;  3V5R A;  5L3J A;  1HNX E;  1S16 A;  2VES A;  2BA0 G;  1Z0B A;  4UT4 A;  1N36 I;  2NN6 B;  2CGE A;  3J81 Q;  1QZR A;  2UXB E;  3DD6 A;  4LF6 E;  4KQV A;  5JEA E;  4R1F A;  1UDS A;  2Z5C A;  4EMD A;  1N34 E;  3PYD A;  2NN6 F;  4B3R E;  4USK A;  5EKW A;  1XMO E;  4IFD E;  1RRE A;  4JI4 I;  1U2R A;  2X36 A;  1S4E A;  4GKJ E;  1NHJ A;  2Z5C B;  3JAM C;  1ZXN A;  2ZBK B;  2DEJ A;  1HNW I;  4BA2 A;  1USU A;  4URL A;  2AJ4 A;  4JV5 I;  2BV3 A;  3D4J A;  2O1U A;  2IES A;  2J65 A;  4FW3 A;  4LF8 I;  3HJC A;  4X66 I;  2VQF I;  4DU8 A;  4OO1 B;  4X64 E;  2GO3 A;  1HR0 I;  1ZXM A;  1IBK E;  4JI7 E;  2PNZ A;  2PO2 B;  4YHH I;  1N0V C;  1IBM E;  4LF7 I;  4Z7C A;  4B3M E;  1FJG E;  4DR4 E;  2UU9 I;  4LCF A;  4OO1 A;  1Y5Y A;  2PO2 A;  3ZZT A;  4LCH A;  4DUY I;  4B3S I;  3T1Y I;  4IFD B;  4DV6 I;  4JI1 E;  2Z5B B;  3WU3 A;  1KVK A;  2VQE E;  1NHI A;  4IFD F;  4GKK E;  4AQY E;  1J5E I;  4PRX A;  1OYR A;  1B63 A;  2GQ0 A;  2WW4 A;  4NXM I;  2V2Z A;  1DAR A;  1Y4S A;  2V2V A;  4DV1 I;  4IFD A;  5FWK A;  1ELO A;  3L7Z A;  2Z5B A;  1RR9 A;  4DPX A;  4ZVI A;  4JYA I;  4YY3 I;  1K47 A;  3B4T A;  1N33 E;  3B8H A;  1Y6Z A;  3ZKD A;  4MU1 A;  5JEA A;  2BM1 A;  1EI1 A;  1HNX I;  2WNR B;  2PO1 B;  4LF4 E;  3UHM A;  5GME A;  2R3V A;  4LFA I;  4UTG A;  1N36 E;  4OX9 E;  2UXB I;  4J3D A;  4DV2 I;  2GO4 A;  2C37 A;  3QT7 A;  3B82 A;  3Q6M A;  2PO0 B;  5IWA I;  2WNR A;  2ZM6 E;  1HNZ E;  1RHY A;  4B3T E;  5K36 C;  3GLL A;  4K0K E;  3WU6 A;  2JE6 B;  1OYP A;  1NZ0 A;  4AID A;  4JI4 E;  5A2Q Q;  1MU5 A;  2BR2 A;  2E5L I;  1H7U A;  4MU3 A;  2IOP A;  1HNW E;  2A2C A;  4DV0 I;  3P76 A;  3M6A A;  2UXD I;  3LPS A;  4RPF A;  2BR2 B;  4BA1 B;  3LNU A;  4OO1 D;  4HY1 A;  1N32 E;  1UDN A;  4X66 E;  2VQF E;  3JAM Q;  4WUC A;  2O1W A;  3PS1 A;  2UUA E;  2JEA A;  2C39 B;  3J7A M;  1IBK I;  4JI7 I;  4DPT A;  3M85 G;  5ELW A;  4FWG A;  4DR4 I;  4DV7 I;  1KKH A;  3WU4 A;  2HKJ A;  5IT9 C;  3P06 A;  5A2Q C;  3P3E A;  4X65 E;  4NBQ A;  5GMD A;  3CWV A;  2JEB B;  4IFD D;  4DR3 E;  3K85 A;  4OZE A;  4B3S E;  4FW6 A;  2PNL A;  3M7N G;  3H4L A;  3ZZU A;  4DV6 E;  4P7A A;  4JI1 I;  5JEA D;  1XHK A;  2VQE I;  4DV4 I;  4IZK A;  4HAC A;  4LCG A;  4ED4 A;  4BA2 B;  2UXC E;  3CDJ A;  1Z5A A;  2A2D A;  3HKM A;  4DR2 E;  5C0X A;  4FW9 A;  1Z0V A;  2X7I A;  3PS3 A;  3K17 A;  1MX0 A;  2IER A;  4DV1 E;  3T1H I;  2J7K A;  3J80 Q;  4FN5 A;  1N33 I;  3GON A;  4LOM A;  1FNM A;  5BR8 E;  4IS9 A;  1XMQ E;  4QNJ A;  4FW7 A;  4LF4 I;  2F1D A;  4DR1 E;  1I94 E;  5K36 F;  1XNR I;  4LFA E;  2V2Q A;  3H1C A;  4OX9 I;  4USM A;  2WP8 A;  2UUB I;  2F4V E;  4DV2 E;  4NXN I;  4MYU A;  5IWA E;  1HNZ I;  4B3T I;  1ZM3 A;  1E3H A;  1B62 A;  2ZM6 I;  2VF3 A;  5FLX C;  4K0K I;  1Y4U A;  4OO1 E;  1BKN A;  5DRP A;  4U3B A;  3P3G A;  4DPW A;  2JEB A;  1IBL I;  3QT6 A;  1OYS A;  1PIE A;  4JI2 E;  2E5L E;  2AE8 A;  1E3P A;  4DV3 E;  4JI6 I;  4FW5 A;  4LF9 E;  4DV0 E;  3Q6N A;  2Z5E A;  2C37 B;  2UXD E;  1UDQ A;  5EL9 A;  4FWD A;  2NN6 A;  3PYE A;  1N32 I;  3P3C A;  2PNZ B;  5LL6 R;  5C0X C;  1Z0G A;  2OI2 A;  4DR7 I;  4DXL A;  2UUA I;  3U1K A;  4Z7Y A;  3CDI A;  3L7Z B;  2HK3 A;  3ZZ0 A;  3PYF A;  1Y60 A;  1VI7 A;  5DNX A; 
#chains in the Genus database with same CATH homology
 4I3H A;  1PKP A;  4DV7 E;  4X65 I;  2ZIT A;  3LTO A;  4DV5 I;  4DR3 I;  3J7A G;  4JG4 A;  5FLX Q;  4PRV A;  1UEK A;  4PU9 A;  4LFC I;  3OTO E;  1ZM2 A;  4DV4 E;  1A6F A;  4LFB I;  2UXC I;  2Q2E B;  5LMU I;  4DR6 I;  1Z5C A;  4DR2 I;  3PYG A;  4FWH A;  1FI4 A;  1PVG A;  1NHH A;  1Z59 A;  3T1H E;  3ZM7 A;  4IZJ D;  4JI0 I;  1FWK A;  2GS8 A;  3QT5 A;  5BR8 I;  4JI5 E;  1XMQ I;  1H7S A;  4JI8 I;  2BM0 A;  4IZJ B;  4LF5 I;  3F0N A;  4DR1 I;  4XTJ A;  1I94 I;  4HXZ A;  1XNR E;  2R42 A;  3B78 A;  2HHH E;  4DUZ I;  2UUB E;  4WUD A;  2F4V I;  2UUC I;  3V2U C;  1HK7 A;  1IBL E;  1H73 A;  1MG7 A;  1KTV A;  4JI3 E;  4KHP E;  2IOQ A;  2HFU A;  1XNQ E;  4DR5 E;  4JI2 I;  2O1V A;  5LMN I;  4DV3 I;  4JI6 E;  4DPY A;  4X62 I;  4LF9 I;  1FKA E;  1ZM9 A;  4MYT A;  1Z0C A;  4DR7 E;  4WUB A;  2HKE A;  2E1R A;  2CZ9 A;  4LF6 I;  2LJP A;  4YHH E;  4IZJ A;  2CG9 A;  1Z0W A;  4M1K A;  1N34 I;  1H74 A;  3J80 C;  4B3R I;  1D6T A;  1OJ4 A;  2XEX A;  1XMO I;  4DV5 E;  1KIJ A;  3J81 C;  4GKJ I;  3K1J A;  4LFC E;  2V8P A;  3OTO I;  4JV5 E;  4LFB E;  2EFG A;  5LMU E;  4DR6 E;  1Z0T A;  4LF8 E;  4P52 A;  2PNM A;  1N0U A;  3WU5 A;  1WUU A;  4DPU A;  3HUL A;  4X64 I;  1ZM4 A;  1USV A;  3QT8 A;  1HR0 E;  4DU7 A;  4JI0 E;  4JI5 I;  1IBM I;  4LF7 E;  4B3M I;  1FJG I;  4JI8 E;  2UU9 E;  4LF5 E;  2DEI A;  4HYM A;  3ZKB A;  2HK2 A;  2HHH I;  4DUY E;  4DUZ E;  3T1Y E;  3PRY A;  1FWL A;  1VIS A;  2UUC E;  4GKK I;  4AQY I;  1J5E E;  2O1T A;  2NPF A;  4JI3 I;  4KHP I;  1Z0E A;  2HFS A;  2V34 A;  1H72 C;  1XNQ I;  4DR5 I;  4NXM E;  3Q1Q A;  5LMN E;  1EA6 A;  4HAC B;  4IZK B;  4X62 E;  1Z5B A;  4YY3 E;  4JYA E;  5IT9 Q;  4N3O A;  3V5R A;  5L3J A;  1HNX E;  1S16 A;  1Z0B A;  4UT4 A;  1N36 I;  2CGE A;  3J81 Q;  1QZR A;  2UXB E;  4LF6 E;  4KQV A;  4R1F A;  2Z5C A;  4EMD A;  1N34 E;  3PYD A;  4B3R E;  4USK A;  1XMO E;  1RRE A;  4JI4 I;  1U2R A;  2X36 A;  1S4E A;  4GKJ E;  1NHJ A;  2Z5C B;  3JAM C;  1ZXN A;  2ZBK B;  2DEJ A;  1HNW I;  1USU A;  4URL A;  2AJ4 A;  4JV5 I;  2BV3 A;  3D4J A;  2O1U A;  4LF8 I;  3HJC A;  4X66 I;  2VQF I;  4DU8 A;  4X64 E;  1HR0 I;  1ZXM A;  1IBK E;  4JI7 E;  1IBM E;  4LF7 I;  1N0V C;  4Z7C A;  4B3M E;  1FJG E;  4DR4 E;  2UU9 I;  3ZZT A;  4DUY I;  4B3S I;  3T1Y I;  4DV6 I;  4JI1 E;  2Z5B B;  3WU3 A;  1KVK A;  2VQE E;  1NHI A;  4GKK E;  4AQY E;  1J5E I;  4PRX A;  1B63 A;  2GQ0 A;  2WW4 A;  4NXM I;  2V2Z A;  1DAR A;  1Y4S A;  2V2V A;  4DV1 I;  5FWK A;  1ELO A;  2Z5B A;  1RR9 A;  4DPX A;  4ZVI A;  4JYA I;  4YY3 I;  1K47 A;  1N33 E;  3B8H A;  1Y6Z A;  3ZKD A;  2BM1 A;  1EI1 A;  1HNX I;  4LF4 E;  5GME A;  2R3V A;  4LFA I;  4UTG A;  1N36 E;  4OX9 E;  2UXB I;  4DV2 I;  3QT7 A;  4NXN E;  5IWA I;  3B82 A;  3Q6M A;  2ZM6 E;  1HNZ E;  4B3T E;  4K0K E;  3WU6 A;  1NZ0 A;  4JI4 E;  5A2Q Q;  3PYF A;  1MU5 A;  2E5L I;  1H7U A;  2IOP A;  1HNW E;  2A2C A;  4DV0 I;  3M6A A;  2UXD I;  3LPS A;  4RPF A;  3LNU A;  4HY1 A;  1N32 E;  4X66 E;  2VQF E;  3JAM Q;  4WUC A;  2O1W A;  2UUA E;  3J7A M;  1IBK I;  4JI7 I;  4DPT A;  4FWG A;  4DR4 I;  4DV7 I;  1KKH A;  3WU4 A;  2HKJ A;  5IT9 C;  3P06 A;  5A2Q C;  4X65 E;  5GMD A;  3CWV A;  4DR3 E;  3K85 A;  4B3S E;  2PNL A;  3H4L A;  3ZZU A;  4DV6 E;  4P7A A;  4JI1 I;  1XHK A;  2VQE I;  4DV4 I;  4IZK A;  4HAC A;  4ED4 A;  2UXC E;  1Z5A A;  2A2D A;  4DR2 E;  4FW9 A;  1Z0V A;  2X7I A;  3K17 A;  1MX0 A;  4DV1 E;  3T1H I;  2J7K A;  3J80 Q;  4FN5 A;  1N33 I;  3GON A;  1FNM A;  5BR8 E;  1XMQ E;  4LF4 I;  4DR1 E;  1I94 E;  1XNR I;  4LFA E;  2V2Q A;  4OX9 I;  4USM A;  2UUB I;  2F4V E;  4DV2 E;  4NXN I;  4MYU A;  5IWA E;  1HNZ I;  4B3T I;  1ZM3 A;  2ZM6 I;  1B62 A;  2VF3 A;  5FLX C;  4K0K I;  1Y4U A;  1BKN A;  4DPW A;  1IBL I;  3QT6 A;  1PIE A;  4JI2 E;  2E5L E;  4DV3 E;  4JI6 I;  4LF9 E;  4DV0 E;  3Q6N A;  2Z5E A;  2UXD E;  4FWD A;  3PYE A;  1N32 I;  5LL6 R;  1Z0G A;  2OI2 A;  4DR7 I;  4DXL A;  2UUA I;  4Z7Y A;  2HK3 A;  3ZZ0 A;  4YHH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...