5BR8I

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5br8I00
1QZRA 1Z0TA 2UU9E 4DR5E 1H72C 4LF7I 4JI3I 2HHHE 4DR6E 4JI0I 4KHPI 1EI1A 2DEJA 2UXBI 1N34E 1Z0BA 4JI4I 4JI6I 2VQFE 4DV4E 4PRXA 4UT4A 1FI4A 5IT9C 4Z7CA 1N36E 4DR3I 4B3SI 1I94E 3PYEA 4FWGA 4X62I 2UXCI 4KQVA 1XHKA 1FJGE 5FLXQ 4WUCA 4X65I 1WUUA 1PIEA 3J81Q 2E5LE 1K47A 1XMOI 1VISA 4DPTA 1DARA 2UUAI 4HXZA 1XNQI 4PRVA 4Z7YA 5L3JA 4YHHI 4DR7E 4MYUA 3Q1QA 1XMQE 2UUBE 4JI2I 4K0KI 4NXNE 4JI5I 4HACA 4JV5I 1BKNA 4LFAI 1S16A 2XEXA 3WU3A 2HK2A 3T1HI 1RR9A 4DV7E 1HNWI 3J81C 1MU5A 4OX9E 4JI8E 4X64I 3ZKDA 4DR1I 4URLA 4MYTA 2HFUA 2BM0A 3LTOA 2UXDI 1ZXMA 5IWAI 1Z5AA 4JI1E 4HACB 1FWKA 4ZVIA 4GKKI 3D4JA 3B82A 1XNRI 5LMUE 4LFBE 4X66E 3B8HA 3QT8A 2ZM6I 2EFGA 4HY1A 2V34A 1KKHA 4DUYE 4DPWA 4DR4E 1Z5CA 5LMNE 5IT9Q 4P7AA 1ZM2A 3ZM7A 2X36A 4LF9E 4GKJI 4P52A 5BR8I 1NHJA 4DV5E 4DV2E 4LF5I 4LF8E 4AQYI 1B63A 4R1FA 1N32E 1HR0I 4DV3I 2V8PA 2V2VA 3OTOI 1MG7A 1ZM4A 4USKA 4LF7E 3K1JA 4JI3E 1KVKA 4JYAI 1PVGA 4JI0E 4KHPE 3JAMC 2UXBE 3ZZTA 3V5RA 1B62A 4JI4E 4JI6E 3LPSA 2Q2EB 2DEIA 1H73A 3ZKBA 4DR3E 3ZZ0A 2A2CA 4B3SE 1HNZI 3LNUA 4B3TI 4LF6I 4JG4A 4USMA 4X62E 2UXCE 1PKPA 3QT7A 4PU9A 1NZ0A 3M6AA 4M1KA 1ZXNA 4B3RI 4X65E 4WUDA 4NXMI 4LF4I 4XTJA 2HKJA 1XMOE 1IBLI 1S4EA 4B3MI 3QT5A 2UUAE 1H7UA 2NPFA 1HNXI 1Z0WA 1XNQE 4YY3I 1OJ4A 1N0UA 1IBMI 4YHHE 2BV3A 4JI2E 3F0NA 4K0KE 4JI5E 4JV5E 2HK3A 4LFAE 1ELOA 4HYMA 4DPXA 4LFCI 1KTVA 1ZM3A 4DUZI 2F4VI 5LL6R 4DV1I 3T1HE 1HNWE 1IBKE 4FN5A 4X64E 1Z0GA 4DR1E 3PYFA 3J80Q 2VQEI 2UXDE 1NHHA 3WU5A 4DV0I 5IWAE 3T1YI 4DR2I 1J5EI 4GKKE 4FWDA 4DV6I 1MX0A 4JI7I 1XNRE 3JAMQ 1N33I 4WUBA 3K17A 1Z0EA 2ZM6E 3GONA 2UUCI 4NXNI 2V2ZA 2R3VA 3WU6A 2UU9I 4UTGA 4DR5I 2HKEA 1Z5BA 2HHHI 4DR6I 4GKJE 3J80C 5A2QC 2OI2A 5BR8E 2X7IA 3B78A 4EMDA 4LF5E 4I3HA 4ED4A 4AQYE 3ZZUA 1N34I 1RREA 1HR0E 4DXLA 4DV3E 2VQFI 4DV4I 3OTOE 1KIJA 4DU8A 3QT6A 4JYAE 1N36I 4DPYA 3PYGA 1NHIA 1I94I 2J7KA 1A6FA 2R42A 1D6TA 4DU7A 3J7AG 1FJGI 1Z59A 2LJPA 5GMEA 4RPFA 2E5LI 2VF3A 1U2RA 2AJ4A 1FNMA 1HNZE 3PYDA 4B3TE 3HULA 4FWHA 4LF6E 2BM1A 4DR7I 3CWVA 3V2UC 4B3RE 1XMQI 2UUBI 4NXME 5GMDA 4LF4E 1EA6A 1FKAE 1ZM9A 1IBLE 4B3ME 4DPUA 1HNXE 1Z0VA 4DV7I 2ZITA 4YY3E 2GS8A 1IBME 4OX9I 4JI8I 3H4LA 4FW9A 1H7SA 5FLXC 3J7AM 1IBKI 4LFCE 4JI1I 2HFSA 1N0VC 2WW4A 4DUZE 2F4VE 5A2QQ 4DV1E 2CZ9A 5LMUI 4LFBI 4X66I 1H74A 1UEKA 3WU4A 2VQEE 2ZBKB 4DUYI 4DV0E 4DR4I 3T1YE 4DR2E 5LMNI 1J5EE 4DV6E 4JI7E 4LF9I 2A2DA 2V2QA 1N33E 1Z0CA 4DV5I 4DV2I 4LF8I 2UUCE 2E1RA 1N32I 1FWLA
chains in the Genus database with same CATH superfamily
1QZRA 2VESA 5C0XE 1Z0TA 2UU9E 4DR5E 1H72C 4LF7I 4JI3I 2HHHE 4DR6E 3P3GA 4JI0I 4KHPI 2JEBB 1EI1A 2DEJA 2JE6B 2UXBI 2PO2B 1N34E 1Z0BA 4JI4I 1YHCA 3HKMA 4JI6I 3DD6A 2VQFE 4DV4E 2WP8A 2BA0G 4PRXA 4UT4A 4MU1A 1FI4A 5IT9C 4Z7CA 1N36E 4DR3I 4B3SI 1I94E 2IESA 4MQYA 3PYEA 4FWGA 4X62I 2UXCI 4KQVA 1XHKA 1FJGE 1Y4UA 4OO1F 4LOMA 5FLXQ 4WUCA 4X65I 1WUUA 1PIEA 5K36D 3J81Q 2E5LE 2WP8B 1K47A 1XMOI 1VISA 4DPTA 1DARA 5K36E 2UUAI 4HXZA 5DNXA 1XNQI 4NBQA 4PRVA 4Z7YA 5L3JA 4YHHI 4DR7E 4MYUA 3Q1QA 1XMQE 2UUBE 4JI2I 4K0KI 2J65A 4NXNE 4JI5I 4HACA 4JV5I 1BKNA 4LFAI 2CGEA 1S16A 2XEXA 4LPFA 4IFDF 4LCFA 3WU3A 2HK2A 1RR9A 4DV7E 3T1HI 5DRRA 1HNWI 2JEAA 3J81C 1MU5A 4OX9E 5JEAD 4JI8E 4X64I 1E3PA 5DNLA 3ZKDA 4DR1I 4OO1C 4URLA 4MYTA 2HFUA 2BM0A 3LTOA 5JEAE 3PS2A 2UXDI 1ZXMA 5IWAI 1Z5AA 4JI1E 4HACB 1FWKA 4ZVIA 4GKKI 3D4JA 3B82A 1XNRI 5LMUE 1YH8A 4LFBE 4X66E 3UHMA 3B8HA 2JEAB 3QT8A 2NN6D 2ZM6I 2EFGA 4HY1A 2V34A 3PS1A 1KKHA 2CG9A 4DPWA 4DUYE 4DR4E 2NN6E 3P3EA 1Z5CA 4BA1A 5LMNE 5IT9Q 4P7AA 2Z5CA 4MDTA 1ZM2A 3ZM7A 4IFDC 2X36A 4LF9E 4GKJI 5C0XC 4P52A 5BR8I 1NHJA 4DV5E 1P42A 1XXEA 4DV2E 4LF5I 4LF8E 4AQYI 5K36F 1B63A 4R1FA 1N32E 1OYRA 1HR0I 4DV3I 1OYPA 2V8PA 2V2VA 3M7NG 3OTOI 1MG7A 1ZM4A 4USKA 4IFDA 4LF7E 3K1JA 3H1CA 2C37A 4JI3E 4IZKA 1Y6ZA 4BA1B 1KVKA 4JYAI 1PVGA 4JI0E 4AM3A 4KHPE 4MU4A 3NZKA 3U1KA 2O3ZA 3JAMC 3GMEA 2UXBE 4QNKA 3ZZTA 3V5RA 1B62A 3L7ZA 4JI4E 4JI6E 1UDNA 3LPSA 2Q2EB 5DRQA 2DEIA 1H73A 4IFDB 3ZKBA 2IOPA 2C37B 4DR3E 4IZKB 3HJCA 3ZZ0A 2A2CA 4GQUA 5JEAF 1HNZI 4B3SE 3LNUA 4B3TI 4LF6I 3GCMA 4JG4A 4USMA 4J3DA 4X62E 2UXCE 1PKPA 3QT7A 4PU9A 5K36C 3L7ZB 1NZ0A 3M6AA 5EKWA 4M1KA 1ZXNA 4B3RI 4X65E 4WUDA 4NXMI 4LCHA 4LF4I 4XTJA 2BA1G 3P76A 2HKJA 5ELWA 1XMOE 1IBLI 1S4EA 4B3MI 3QT5A 2UUAE 1H7UA 2NPFA 1HNXI 1Y60A 1UDOA 1Z0WA 2NN6F 3M85D 1XNQE 4YY3I 1OJ4A 1N0UA 4FW5A 3U1YA 4YHHE 1IBMI 5C0XF 2O1VA 2CVEA 2BV3A 2O1WA 4JI2E 3F0NA 4K0KE 2BA0D 4JI5E 4ISAA 4JV5E 4AIMA 2HK3A 2C38A 2PNLA 4LFAE 1ELOA 4HYMA 4DPXA 3P3CA 4LFCI 1KTVA 1ZM3A 5JEAC 4DUZI 2F4VI 5LL6R 4DV1I 3T1HE 2C39A 1HNWE 1IBKE 1RHYA 4FN5A 4X64E 1Z0GA 3CDIA 4FW4A 4DR1E 3PYFA 1R6MA 3J80Q 2VQEI 4OO1A 1NHHA 2UXDE 3WU5A 4DV0I 5IWAE 3T1YI 2AE8A 3K85A 2C38B 4DR2I 1J5EI 4GKKE 4FWDA 4DV6I 3PRYA 1MX0A 4JI7I 1XNRE 3JAMQ 2NN6C 1N33I 2C39B 4WUBA 2PNZA 3K17A 1HK7A 1Z0EA 2ZM6E 2PO0A 5EL9A 3GONA 3B4TA 2UUCI 4IZJA 1USUA 4NXNI 2V2ZA 2R3VA 3CDJA 3WU6A 3Q6MA 2UU9I 4OO1B 4UTGA 4DR5I 4OKGA 4BA2A 1R6LA 3P06A 2HKEA 2NN6A 3GLLA 1Z5BA 2HHHI 4DR6I 4GKJE 3J80C 1USVA 2IOQA 4U3BA 2GQ0A 2IERA 5A2QC 2OI2A 5BR8E 5C0XA 2X7IA 3B78A 4EMDA 4LF5E 4I3HA 4ED4A 2PNZB 4AQYE 2Z5CB 3ZZUA 1N34I 1RREA 1HR0E 4DXLA 2PO0B 1OYSA 2PNMA 4DV3E 2GO4A 2VQFI 4IZJB 4DV4I 3OTOE 1KIJA 4DU8A 4FW6A 4BA2B 3QT6A 3M85G 4JYAE 2Z5EA 2NN6B 1N36I 4DPYA 3PYGA 1NHIA 1I94I 2J7KA 5C0XB 1A6FA 2R42A 1D6TA 1UDSA 4DU7A 1E3HA 3J7AG 1FJGI 1Z59A 2LJPA 5GMEA 3PS3A 4RPFA 2E5LI 2VF3A 1U2RA 2AJ4A 2JT2A 1FNMA 1HNZE 3PYDA 3Q6NA 4B3TE 3HULA 4FWHA 4LF6E 2BR2A 2BM1A 4DR7I 4OZEA 2GO3A 3CWVA 3V2UC 3M7ND 4B3RE 1XMQI 2UUBI 5K36A 4NXME 4MU3A 4LCGA 5GMDA 4LF4E 2Z5BA 1EA6A 1FKAE 1ZM9A 1IBLE 4B3ME 4DPUA 1HNXE 4N3OA 1Z0VA 4DV7I 2PO1A 2ZITA 4YY3E 2GS8A 1IBME 4OX9I 4JI8I 2BR2B 2F1DA 3H4LA 4FW9A 1H7SA 5K36B 5FLXC 3J7AM 4OO1D 2Z5BB 1IBKI 2WNRA 4LFCE 4JI1I 2HFSA 5DRPA 5DROA 1N0VC 2WW4A 4DUZE 2F4VE 4OO1E 5A2QQ 4DV1E 2CZ9A 5LMUI 4LFBI 5JEAA 4X66I 1H74A 1UDQA 2O1TA 1UEKA 4FW7A 2PO1B 1VI7A 4IS9A 3WU4A 1Y5YA 4AIDA 2VQEE 2BA1D 2ZBKB 4IZJD 4DUYI 4DV0E 4DR4I 3T1YE 4MU0A 4DR2E 5LMNI 1J5EE 3KRNA 5FWKA 4DV6E 2WNRB 2O1UA 4JI7E 2JEBA 4LF9I 4U3DA 2A2DA 2V2QA 1N33E 1Y4SA 2JE6A 4IFDD 1Z0CA 2PO2A 4QNJA 5JEAB 5C0XD 4DV5I 4DV2I 4FW3A 4LF8I 2UUCE 2E1RA 4IFDE 1N32I 1FWLA
chains in the Genus database with same CATH topology
1QZRA 1Z0TA 2UU9E 4DR5E 1H72C 4LF7I 4JI3I 2HHHE 4DR6E 4JI0I 4KHPI 1EI1A 2DEJA 2UXBI 1N34E 1Z0BA 4JI4I 4JI6I 2VQFE 4DV4E 4PRXA 4UT4A 1FI4A 5IT9C 4Z7CA 1N36E 4DR3I 4B3SI 1I94E 3PYEA 4FWGA 4X62I 2UXCI 4KQVA 1XHKA 1FJGE 1Y4UA 5FLXQ 4WUCA 4X65I 1WUUA 1PIEA 3J81Q 2E5LE 1K47A 1XMOI 1VISA 4DPTA 1DARA 2UUAI 4HXZA 1XNQI 4PRVA 4Z7YA 5L3JA 4YHHI 4DR7E 4MYUA 3Q1QA 1XMQE 2UUBE 4JI2I 4K0KI 4NXNE 4JI5I 4HACA 4JV5I 1BKNA 4LFAI 2CGEA 1S16A 2XEXA 3WU3A 2HK2A 3T1HI 1RR9A 4DV7E 1HNWI 3J81C 1MU5A 4OX9E 4JI8E 4X64I 3ZKDA 4DR1I 4URLA 4MYTA 2HFUA 2BM0A 3LTOA 2UXDI 1ZXMA 5IWAI 1Z5AA 4JI1E 4HACB 1FWKA 4ZVIA 4GKKI 3D4JA 3B82A 1XNRI 5LMUE 4LFBE 4X66E 3B8HA 3QT8A 2ZM6I 2EFGA 4HY1A 2V34A 1KKHA 2CG9A 4DPWA 4DUYE 4DR4E 1Z5CA 5LMNE 5IT9Q 4P7AA 2Z5CA 1ZM2A 3ZM7A 2X36A 4LF9E 4GKJI 4P52A 5BR8I 1NHJA 4DV5E 4DV2E 4LF5I 4LF8E 4AQYI 1B63A 4R1FA 1N32E 1HR0I 4DV3I 2V8PA 2V2VA 3OTOI 1MG7A 1ZM4A 4USKA 4LF7E 3K1JA 4JI3E 4IZKA 1Y6ZA 1KVKA 4JYAI 1PVGA 4JI0E 4KHPE 3JAMC 2UXBE 3ZZTA 3V5RA 1B62A 4JI4E 4JI6E 3LPSA 2Q2EB 2DEIA 1H73A 3ZKBA 2IOPA 4DR3E 4IZKB 3HJCA 3ZZ0A 2A2CA 4B3SE 1HNZI 3LNUA 4B3TI 4LF6I 4JG4A 4USMA 4X62E 2UXCE 1PKPA 3QT7A 4PU9A 1NZ0A 3M6AA 4M1KA 1ZXNA 4B3RI 4X65E 4WUDA 4NXMI 4LF4I 4XTJA 2HKJA 1XMOE 1IBLI 1S4EA 4B3MI 3QT5A 2UUAE 1H7UA 2NPFA 1HNXI 1Z0WA 1XNQE 4YY3I 1OJ4A 1N0UA 1IBMI 4YHHE 2O1VA 2BV3A 2O1WA 4JI2E 3F0NA 4K0KE 4JI5E 4JV5E 2HK3A 2PNLA 4LFAE 1ELOA 4HYMA 4DPXA 4LFCI 1KTVA 1ZM3A 4DUZI 2F4VI 5LL6R 4DV1I 3T1HE 1HNWE 1IBKE 4FN5A 4X64E 1Z0GA 4DR1E 3PYFA 3J80Q 2VQEI 2UXDE 1NHHA 3WU5A 4DV0I 5IWAE 3T1YI 3K85A 4DR2I 1J5EI 4GKKE 4FWDA 4DV6I 3PRYA 1MX0A 4JI7I 1XNRE 3JAMQ 1N33I 4WUBA 3K17A 1HK7A 1Z0EA 2ZM6E 3GONA 2UUCI 4IZJA 1USUA 4NXNI 2V2ZA 2R3VA 3WU6A 3Q6MA 2UU9I 4UTGA 4DR5I 3P06A 2HKEA 1Z5BA 2HHHI 4DR6I 4GKJE 3J80C 1USVA 2IOQA 2GQ0A 5A2QC 2OI2A 5BR8E 2X7IA 3B78A 4EMDA 4LF5E 4I3HA 4ED4A 4AQYE 2Z5CB 3ZZUA 1N34I 1RREA 1HR0E 4DXLA 4DV3E 2PNMA 2VQFI 4IZJB 4DV4I 3OTOE 1KIJA 4DU8A 3QT6A 4JYAE 2Z5EA 1N36I 4DPYA 3PYGA 1NHIA 1I94I 2J7KA 1A6FA 2R42A 1D6TA 4DU7A 3J7AG 1FJGI 1Z59A 2LJPA 5GMEA 4RPFA 2E5LI 2VF3A 1U2RA 2AJ4A 1FNMA 1HNZE 3PYDA 3Q6NA 4B3TE 3HULA 4FWHA 4LF6E 2BM1A 4DR7I 3CWVA 3V2UC 4B3RE 1XMQI 2UUBI 4NXME 5GMDA 4LF4E 2Z5BA 1EA6A 1FKAE 1ZM9A 1IBLE 4B3ME 4DPUA 1HNXE 4N3OA 1Z0VA 4DV7I 2ZITA 4YY3E 2GS8A 1IBME 4OX9I 4JI8I 3H4LA 4FW9A 1H7SA 5FLXC 3J7AM 2Z5BB 1IBKI 4LFCE 4JI1I 2HFSA 1N0VC 2WW4A 4DUZE 2F4VE 5A2QQ 4DV1E 2CZ9A 5LMUI 4LFBI 4X66I 1H74A 2O1TA 1UEKA 3WU4A 2VQEE 2ZBKB 4IZJD 4DUYI 4DV0E 4DR4I 3T1YE 4DR2E 5LMNI 1J5EE 5FWKA 4DV6E 2O1UA 4JI7E 4LF9I 2A2DA 2V2QA 1N33E 1Y4SA 1Z0CA 4DV5I 4DV2I 4LF8I 2UUCE 2E1RA 1N32I 1FWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZR A;  1Z0T A;  2UU9 E;  4DR5 E;  1H72 C;  4LF7 I;  4JI3 I;  2HHH E;  4DR6 E;  4JI0 I;  4KHP I;  1EI1 A;  2DEJ A;  2UXB I;  1N34 E;  1Z0B A;  4JI4 I;  4JI6 I;  2VQF E;  4DV4 E;  4PRX A;  4UT4 A;  1FI4 A;  5IT9 C;  4Z7C A;  1N36 E;  4DR3 I;  4B3S I;  1I94 E;  3PYE A;  4FWG A;  4X62 I;  2UXC I;  4KQV A;  1XHK A;  1FJG E;  5FLX Q;  4WUC A;  4X65 I;  1WUU A;  1PIE A;  3J81 Q;  2E5L E;  1K47 A;  1XMO I;  1VIS A;  4DPT A;  1DAR A;  2UUA I;  4HXZ A;  1XNQ I;  4PRV A;  4Z7Y A;  5L3J A;  4YHH I;  4DR7 E;  4MYU A;  3Q1Q A;  1XMQ E;  2UUB E;  4JI2 I;  4K0K I;  4NXN E;  4JI5 I;  4HAC A;  4JV5 I;  1BKN A;  4LFA I;  1S16 A;  2XEX A;  3WU3 A;  2HK2 A;  3T1H I;  1RR9 A;  4DV7 E;  1HNW I;  3J81 C;  1MU5 A;  4OX9 E;  4JI8 E;  4X64 I;  3ZKD A;  4DR1 I;  4URL A;  4MYT A;  2HFU A;  2BM0 A;  3LTO A;  2UXD I;  1ZXM A;  5IWA I;  1Z5A A;  4JI1 E;  4HAC B;  1FWK A;  4ZVI A;  4GKK I;  3D4J A;  3B82 A;  1XNR I;  5LMU E;  4LFB E;  4X66 E;  3B8H A;  3QT8 A;  2ZM6 I;  2EFG A;  4HY1 A;  2V34 A;  1KKH A;  4DUY E;  4DPW A;  4DR4 E;  1Z5C A;  5LMN E;  5IT9 Q;  4P7A A;  1ZM2 A;  3ZM7 A;  2X36 A;  4LF9 E;  4GKJ I;  4P52 A;  5BR8 I;  1NHJ A;  4DV5 E;  4DV2 E;  4LF5 I;  4LF8 E;  4AQY I;  1B63 A;  4R1F A;  1N32 E;  1HR0 I;  4DV3 I;  2V8P A;  2V2V A;  3OTO I;  1MG7 A;  1ZM4 A;  4USK A;  4LF7 E;  3K1J A;  4JI3 E;  1KVK A;  4JYA I;  1PVG A;  4JI0 E;  4KHP E;  3JAM C;  2UXB E;  3ZZT A;  3V5R A;  1B62 A;  4JI4 E;  4JI6 E;  3LPS A;  2Q2E B;  2DEI A;  1H73 A;  3ZKB A;  4DR3 E;  3ZZ0 A;  2A2C A;  4B3S E;  1HNZ I;  3LNU A;  4B3T I;  4LF6 I;  4JG4 A;  4USM A;  4X62 E;  2UXC E;  1PKP A;  3QT7 A;  4PU9 A;  1NZ0 A;  3M6A A;  4M1K A;  1ZXN A;  4B3R I;  4X65 E;  4WUD A;  4NXM I;  4LF4 I;  4XTJ A;  2HKJ A;  1XMO E;  1IBL I;  1S4E A;  4B3M I;  3QT5 A;  2UUA E;  1H7U A;  2NPF A;  1HNX I;  1Z0W A;  1XNQ E;  4YY3 I;  1OJ4 A;  1N0U A;  1IBM I;  4YHH E;  2BV3 A;  4JI2 E;  3F0N A;  4K0K E;  4JI5 E;  4JV5 E;  2HK3 A;  4LFA E;  1ELO A;  4HYM A;  4DPX A;  4LFC I;  1KTV A;  1ZM3 A;  4DUZ I;  2F4V I;  5LL6 R;  4DV1 I;  3T1H E;  1HNW E;  1IBK E;  4FN5 A;  4X64 E;  1Z0G A;  4DR1 E;  3PYF A;  3J80 Q;  2VQE I;  2UXD E;  1NHH A;  3WU5 A;  4DV0 I;  5IWA E;  3T1Y I;  4DR2 I;  1J5E I;  4GKK E;  4FWD A;  4DV6 I;  1MX0 A;  4JI7 I;  1XNR E;  3JAM Q;  1N33 I;  4WUB A;  3K17 A;  1Z0E A;  2ZM6 E;  3GON A;  2UUC I;  4NXN I;  2V2Z A;  2R3V A;  3WU6 A;  2UU9 I;  4UTG A;  4DR5 I;  2HKE A;  1Z5B A;  2HHH I;  4DR6 I;  4GKJ E;  3J80 C;  5A2Q C;  2OI2 A;  5BR8 E;  2X7I A;  3B78 A;  4EMD A;  4LF5 E;  4I3H A;  4ED4 A;  4AQY E;  3ZZU A;  1N34 I;  1RRE A;  1HR0 E;  4DXL A;  4DV3 E;  2VQF I;  4DV4 I;  3OTO E;  1KIJ A;  4DU8 A;  3QT6 A;  4JYA E;  1N36 I;  4DPY A;  3PYG A;  1NHI A;  1I94 I;  2J7K A;  1A6F A;  2R42 A;  1D6T A;  4DU7 A;  3J7A G;  1FJG I;  1Z59 A;  2LJP A;  5GME A;  4RPF A;  2E5L I;  2VF3 A;  1U2R A;  2AJ4 A;  1FNM A;  1HNZ E;  3PYD A;  4B3T E;  3HUL A;  4FWH A;  4LF6 E;  2BM1 A;  4DR7 I;  3CWV A;  3V2U C;  4B3R E;  1XMQ I;  2UUB I;  4NXM E;  5GMD A;  4LF4 E;  1EA6 A;  1FKA E;  1ZM9 A;  1IBL E;  4B3M E;  4DPU A;  1HNX E;  1Z0V A;  4DV7 I;  2ZIT A;  4YY3 E;  2GS8 A;  1IBM E;  4OX9 I;  4JI8 I;  3H4L A;  4FW9 A;  1H7S A;  5FLX C;  3J7A M;  1IBK I;  4LFC E;  4JI1 I;  2HFS A;  1N0V C;  2WW4 A;  4DUZ E;  2F4V E;  5A2Q Q;  4DV1 E;  2CZ9 A;  5LMU I;  4LFB I;  4X66 I;  1H74 A;  1UEK A;  3WU4 A;  2VQE E;  2ZBK B;  4DUY I;  4DV0 E;  4DR4 I;  3T1Y E;  4DR2 E;  5LMN I;  1J5E E;  4DV6 E;  4JI7 E;  4LF9 I;  2A2D A;  2V2Q A;  1N33 E;  1Z0C A;  4DV5 I;  4DV2 I;  4LF8 I;  2UUC E;  2E1R A;  1N32 I;  1FWL A; 
#chains in the Genus database with same CATH topology
 1QZR A;  2VES A;  5C0X E;  1Z0T A;  2UU9 E;  4DR5 E;  1H72 C;  4LF7 I;  4JI3 I;  2HHH E;  4DR6 E;  3P3G A;  4JI0 I;  4KHP I;  2JEB B;  1EI1 A;  2DEJ A;  2JE6 B;  2UXB I;  2PO2 B;  1N34 E;  1Z0B A;  4JI4 I;  1YHC A;  3HKM A;  4JI6 I;  3DD6 A;  2VQF E;  4DV4 E;  2WP8 A;  2BA0 G;  4PRX A;  4UT4 A;  4MU1 A;  1FI4 A;  5IT9 C;  4Z7C A;  1N36 E;  4DR3 I;  4B3S I;  1I94 E;  2IES A;  4MQY A;  3PYE A;  4FWG A;  4X62 I;  2UXC I;  4KQV A;  1XHK A;  1FJG E;  1Y4U A;  4OO1 F;  4LOM A;  5FLX Q;  4WUC A;  4X65 I;  1WUU A;  1PIE A;  5K36 D;  3J81 Q;  2E5L E;  2WP8 B;  1K47 A;  1XMO I;  1VIS A;  4DPT A;  1DAR A;  5K36 E;  2UUA I;  4HXZ A;  5DNX A;  1XNQ I;  4NBQ A;  4PRV A;  4Z7Y A;  5L3J A;  4YHH I;  4DR7 E;  4MYU A;  3Q1Q A;  1XMQ E;  2UUB E;  4JI2 I;  4K0K I;  2J65 A;  4NXN E;  4JI5 I;  4HAC A;  4JV5 I;  1BKN A;  4LFA I;  2CGE A;  1S16 A;  2XEX A;  4LPF A;  4IFD F;  4LCF A;  3WU3 A;  2HK2 A;  1RR9 A;  4DV7 E;  3T1H I;  5DRR A;  1HNW I;  2JEA A;  3J81 C;  1MU5 A;  4OX9 E;  5JEA D;  4JI8 E;  4X64 I;  1E3P A;  5DNL A;  3ZKD A;  4DR1 I;  4OO1 C;  4URL A;  4MYT A;  2HFU A;  2BM0 A;  3LTO A;  5JEA E;  3PS2 A;  2UXD I;  1ZXM A;  5IWA I;  1Z5A A;  4JI1 E;  4HAC B;  1FWK A;  4ZVI A;  4GKK I;  3D4J A;  3B82 A;  1XNR I;  5LMU E;  1YH8 A;  4LFB E;  4X66 E;  3UHM A;  3B8H A;  2JEA B;  3QT8 A;  2NN6 D;  2ZM6 I;  2EFG A;  4HY1 A;  2V34 A;  3PS1 A;  1KKH A;  2CG9 A;  4DPW A;  4DUY E;  4DR4 E;  2NN6 E;  3P3E A;  1Z5C A;  4BA1 A;  5LMN E;  5IT9 Q;  4P7A A;  2Z5C A;  4MDT A;  1ZM2 A;  3ZM7 A;  4IFD C;  2X36 A;  4LF9 E;  4GKJ I;  5C0X C;  4P52 A;  5BR8 I;  1NHJ A;  4DV5 E;  1P42 A;  1XXE A;  4DV2 E;  4LF5 I;  4LF8 E;  4AQY I;  5K36 F;  1B63 A;  4R1F A;  1N32 E;  1OYR A;  1HR0 I;  4DV3 I;  1OYP A;  2V8P A;  2V2V A;  3M7N G;  3OTO I;  1MG7 A;  1ZM4 A;  4USK A;  4IFD A;  4LF7 E;  3K1J A;  3H1C A;  2C37 A;  4JI3 E;  4IZK A;  1Y6Z A;  4BA1 B;  1KVK A;  4JYA I;  1PVG A;  4JI0 E;  4AM3 A;  4KHP E;  4MU4 A;  3NZK A;  3U1K A;  2O3Z A;  3JAM C;  3GME A;  2UXB E;  4QNK A;  3ZZT A;  3V5R A;  1B62 A;  3L7Z A;  4JI4 E;  4JI6 E;  1UDN A;  3LPS A;  2Q2E B;  5DRQ A;  2DEI A;  1H73 A;  4IFD B;  3ZKB A;  2IOP A;  2C37 B;  4DR3 E;  4IZK B;  3HJC A;  3ZZ0 A;  2A2C A;  4GQU A;  5JEA F;  1HNZ I;  4B3S E;  3LNU A;  4B3T I;  4LF6 I;  3GCM A;  4JG4 A;  4USM A;  4J3D A;  4X62 E;  2UXC E;  1PKP A;  3QT7 A;  4PU9 A;  5K36 C;  3L7Z B;  1NZ0 A;  3M6A A;  5EKW A;  4M1K A;  1ZXN A;  4B3R I;  4X65 E;  4WUD A;  4NXM I;  4LCH A;  4LF4 I;  4XTJ A;  2BA1 G;  3P76 A;  2HKJ A;  5ELW A;  1XMO E;  1IBL I;  1S4E A;  4B3M I;  3QT5 A;  2UUA E;  1H7U A;  2NPF A;  1HNX I;  1Y60 A;  1UDO A;  1Z0W A;  2NN6 F;  3M85 D;  1XNQ E;  4YY3 I;  1OJ4 A;  1N0U A;  4FW5 A;  3U1Y A;  4YHH E;  1IBM I;  5C0X F;  2O1V A;  2CVE A;  2BV3 A;  2O1W A;  4JI2 E;  3F0N A;  4K0K E;  2BA0 D;  4JI5 E;  4ISA A;  4JV5 E;  4AIM A;  2HK3 A;  2C38 A;  2PNL A;  4LFA E;  1ELO A;  4HYM A;  4DPX A;  3P3C A;  4LFC I;  1KTV A;  1ZM3 A;  5JEA C;  4DUZ I;  2F4V I;  5LL6 R;  4DV1 I;  3T1H E;  2C39 A;  1HNW E;  1IBK E;  1RHY A;  4FN5 A;  4X64 E;  1Z0G A;  3CDI A;  4FW4 A;  4DR1 E;  3PYF A;  1R6M A;  3J80 Q;  2VQE I;  4OO1 A;  1NHH A;  2UXD E;  3WU5 A;  4DV0 I;  5IWA E;  3T1Y I;  2AE8 A;  3K85 A;  2C38 B;  4DR2 I;  1J5E I;  4GKK E;  4FWD A;  4DV6 I;  3PRY A;  1MX0 A;  4JI7 I;  1XNR E;  3JAM Q;  2NN6 C;  1N33 I;  2C39 B;  4WUB A;  2PNZ A;  3K17 A;  1HK7 A;  1Z0E A;  2ZM6 E;  2PO0 A;  5EL9 A;  3GON A;  3B4T A;  2UUC I;  4IZJ A;  1USU A;  4NXN I;  2V2Z A;  2R3V A;  3CDJ A;  3WU6 A;  3Q6M A;  2UU9 I;  4OO1 B;  4UTG A;  4DR5 I;  4OKG A;  4BA2 A;  1R6L A;  3P06 A;  2HKE A;  2NN6 A;  3GLL A;  1Z5B A;  2HHH I;  4DR6 I;  4GKJ E;  3J80 C;  1USV A;  2IOQ A;  4U3B A;  2GQ0 A;  2IER A;  5A2Q C;  2OI2 A;  5BR8 E;  5C0X A;  2X7I A;  3B78 A;  4EMD A;  4LF5 E;  4I3H A;  4ED4 A;  2PNZ B;  4AQY E;  2Z5C B;  3ZZU A;  1N34 I;  1RRE A;  1HR0 E;  4DXL A;  2PO0 B;  1OYS A;  2PNM A;  4DV3 E;  2GO4 A;  2VQF I;  4IZJ B;  4DV4 I;  3OTO E;  1KIJ A;  4DU8 A;  4FW6 A;  4BA2 B;  3QT6 A;  3M85 G;  4JYA E;  2Z5E A;  2NN6 B;  1N36 I;  4DPY A;  3PYG A;  1NHI A;  1I94 I;  2J7K A;  5C0X B;  1A6F A;  2R42 A;  1D6T A;  1UDS A;  4DU7 A;  1E3H A;  3J7A G;  1FJG I;  1Z59 A;  2LJP A;  5GME A;  3PS3 A;  4RPF A;  2E5L I;  2VF3 A;  1U2R A;  2AJ4 A;  2JT2 A;  1FNM A;  1HNZ E;  3PYD A;  3Q6N A;  4B3T E;  3HUL A;  4FWH A;  4LF6 E;  2BR2 A;  2BM1 A;  4DR7 I;  4OZE A;  2GO3 A;  3CWV A;  3V2U C;  3M7N D;  4B3R E;  1XMQ I;  2UUB I;  5K36 A;  4NXM E;  4MU3 A;  4LCG A;  5GMD A;  4LF4 E;  2Z5B A;  1EA6 A;  1FKA E;  1ZM9 A;  1IBL E;  4B3M E;  4DPU A;  1HNX E;  4N3O A;  1Z0V A;  4DV7 I;  2PO1 A;  2ZIT A;  4YY3 E;  2GS8 A;  1IBM E;  4OX9 I;  4JI8 I;  2BR2 B;  2F1D A;  3H4L A;  4FW9 A;  1H7S A;  5K36 B;  5FLX C;  3J7A M;  4OO1 D;  2Z5B B;  1IBK I;  2WNR A;  4LFC E;  4JI1 I;  2HFS A;  5DRP A;  5DRO A;  1N0V C;  2WW4 A;  4DUZ E;  2F4V E;  4OO1 E;  5A2Q Q;  4DV1 E;  2CZ9 A;  5LMU I;  4LFB I;  5JEA A;  4X66 I;  1H74 A;  1UDQ A;  2O1T A;  1UEK A;  4FW7 A;  2PO1 B;  1VI7 A;  4IS9 A;  3WU4 A;  1Y5Y A;  4AID A;  2VQE E;  2BA1 D;  2ZBK B;  4IZJ D;  4DUY I;  4DV0 E;  4DR4 I;  3T1Y E;  4MU0 A;  4DR2 E;  5LMN I;  1J5E E;  3KRN A;  5FWK A;  4DV6 E;  2WNR B;  2O1U A;  4JI7 E;  2JEB A;  4LF9 I;  4U3D A;  2A2D A;  2V2Q A;  1N33 E;  1Y4S A;  2JE6 A;  4IFD D;  1Z0C A;  2PO2 A;  4QNJ A;  5JEA B;  5C0X D;  4DV5 I;  4DV2 I;  4FW3 A;  4LF8 I;  2UUC E;  2E1R A;  4IFD E;  1N32 I;  1FWL A; 
#chains in the Genus database with same CATH homology
 1QZR A;  1Z0T A;  2UU9 E;  4DR5 E;  1H72 C;  4LF7 I;  4JI3 I;  2HHH E;  4DR6 E;  4JI0 I;  4KHP I;  1EI1 A;  2DEJ A;  2UXB I;  1N34 E;  1Z0B A;  4JI4 I;  4JI6 I;  2VQF E;  4DV4 E;  4PRX A;  4UT4 A;  1FI4 A;  5IT9 C;  4Z7C A;  1N36 E;  4DR3 I;  4B3S I;  1I94 E;  3PYE A;  4FWG A;  4X62 I;  2UXC I;  4KQV A;  1XHK A;  1FJG E;  1Y4U A;  5FLX Q;  4WUC A;  4X65 I;  1WUU A;  1PIE A;  3J81 Q;  2E5L E;  1K47 A;  1XMO I;  1VIS A;  4DPT A;  1DAR A;  2UUA I;  4HXZ A;  1XNQ I;  4PRV A;  4Z7Y A;  5L3J A;  4YHH I;  4DR7 E;  4MYU A;  3Q1Q A;  1XMQ E;  2UUB E;  4JI2 I;  4K0K I;  4NXN E;  4JI5 I;  4HAC A;  4JV5 I;  1BKN A;  4LFA I;  2CGE A;  1S16 A;  2XEX A;  3WU3 A;  2HK2 A;  3T1H I;  1RR9 A;  4DV7 E;  1HNW I;  3J81 C;  1MU5 A;  4OX9 E;  4JI8 E;  4X64 I;  3ZKD A;  4DR1 I;  4URL A;  4MYT A;  2HFU A;  2BM0 A;  3LTO A;  2UXD I;  1ZXM A;  5IWA I;  1Z5A A;  4JI1 E;  4HAC B;  1FWK A;  4ZVI A;  4GKK I;  3D4J A;  3B82 A;  1XNR I;  5LMU E;  4LFB E;  4X66 E;  3B8H A;  3QT8 A;  2ZM6 I;  2EFG A;  4HY1 A;  2V34 A;  1KKH A;  2CG9 A;  4DPW A;  4DUY E;  4DR4 E;  1Z5C A;  5LMN E;  5IT9 Q;  4P7A A;  2Z5C A;  1ZM2 A;  3ZM7 A;  2X36 A;  4LF9 E;  4GKJ I;  4P52 A;  5BR8 I;  1NHJ A;  4DV5 E;  4DV2 E;  4LF5 I;  4LF8 E;  4AQY I;  1B63 A;  4R1F A;  1N32 E;  1HR0 I;  4DV3 I;  2V8P A;  2V2V A;  3OTO I;  1MG7 A;  1ZM4 A;  4USK A;  4LF7 E;  3K1J A;  4JI3 E;  4IZK A;  1Y6Z A;  1KVK A;  4JYA I;  1PVG A;  4JI0 E;  4KHP E;  3JAM C;  2UXB E;  3ZZT A;  3V5R A;  1B62 A;  4JI4 E;  4JI6 E;  3LPS A;  2Q2E B;  2DEI A;  1H73 A;  3ZKB A;  2IOP A;  4DR3 E;  4IZK B;  3HJC A;  3ZZ0 A;  2A2C A;  4B3S E;  1HNZ I;  3LNU A;  4B3T I;  4LF6 I;  4JG4 A;  4USM A;  4X62 E;  2UXC E;  1PKP A;  3QT7 A;  4PU9 A;  1NZ0 A;  3M6A A;  4M1K A;  1ZXN A;  4B3R I;  4X65 E;  4WUD A;  4NXM I;  4LF4 I;  4XTJ A;  2HKJ A;  1XMO E;  1IBL I;  1S4E A;  4B3M I;  3QT5 A;  2UUA E;  1H7U A;  2NPF A;  1HNX I;  1Z0W A;  1XNQ E;  4YY3 I;  1OJ4 A;  1N0U A;  1IBM I;  4YHH E;  2O1V A;  2BV3 A;  2O1W A;  4JI2 E;  3F0N A;  4K0K E;  4JI5 E;  4JV5 E;  2HK3 A;  2PNL A;  4LFA E;  1ELO A;  4HYM A;  4DPX A;  4LFC I;  1KTV A;  1ZM3 A;  4DUZ I;  2F4V I;  5LL6 R;  4DV1 I;  3T1H E;  1HNW E;  1IBK E;  4FN5 A;  4X64 E;  1Z0G A;  4DR1 E;  3PYF A;  3J80 Q;  2VQE I;  2UXD E;  1NHH A;  3WU5 A;  4DV0 I;  5IWA E;  3T1Y I;  3K85 A;  4DR2 I;  1J5E I;  4GKK E;  4FWD A;  4DV6 I;  3PRY A;  1MX0 A;  4JI7 I;  1XNR E;  3JAM Q;  1N33 I;  4WUB A;  3K17 A;  1HK7 A;  1Z0E A;  2ZM6 E;  3GON A;  2UUC I;  4IZJ A;  1USU A;  4NXN I;  2V2Z A;  2R3V A;  3WU6 A;  3Q6M A;  2UU9 I;  4UTG A;  4DR5 I;  3P06 A;  2HKE A;  1Z5B A;  2HHH I;  4DR6 I;  4GKJ E;  3J80 C;  1USV A;  2IOQ A;  2GQ0 A;  5A2Q C;  2OI2 A;  5BR8 E;  2X7I A;  3B78 A;  4EMD A;  4LF5 E;  4I3H A;  4ED4 A;  4AQY E;  2Z5C B;  3ZZU A;  1N34 I;  1RRE A;  1HR0 E;  4DXL A;  4DV3 E;  2PNM A;  2VQF I;  4IZJ B;  4DV4 I;  3OTO E;  1KIJ A;  4DU8 A;  3QT6 A;  4JYA E;  2Z5E A;  1N36 I;  4DPY A;  3PYG A;  1NHI A;  1I94 I;  2J7K A;  1A6F A;  2R42 A;  1D6T A;  4DU7 A;  3J7A G;  1FJG I;  1Z59 A;  2LJP A;  5GME A;  4RPF A;  2E5L I;  2VF3 A;  1U2R A;  2AJ4 A;  1FNM A;  1HNZ E;  3PYD A;  3Q6N A;  4B3T E;  3HUL A;  4FWH A;  4LF6 E;  2BM1 A;  4DR7 I;  3CWV A;  3V2U C;  4B3R E;  1XMQ I;  2UUB I;  4NXM E;  5GMD A;  4LF4 E;  2Z5B A;  1EA6 A;  1FKA E;  1ZM9 A;  1IBL E;  4B3M E;  4DPU A;  1HNX E;  4N3O A;  1Z0V A;  4DV7 I;  2ZIT A;  4YY3 E;  2GS8 A;  1IBM E;  4OX9 I;  4JI8 I;  3H4L A;  4FW9 A;  1H7S A;  5FLX C;  3J7A M;  2Z5B B;  1IBK I;  4LFC E;  4JI1 I;  2HFS A;  1N0V C;  2WW4 A;  4DUZ E;  2F4V E;  5A2Q Q;  4DV1 E;  2CZ9 A;  5LMU I;  4LFB I;  4X66 I;  1H74 A;  2O1T A;  1UEK A;  3WU4 A;  2VQE E;  2ZBK B;  4IZJ D;  4DUY I;  4DV0 E;  4DR4 I;  3T1Y E;  4DR2 E;  5LMN I;  1J5E E;  5FWK A;  4DV6 E;  2O1U A;  4JI7 E;  4LF9 I;  2A2D A;  2V2Q A;  1N33 E;  1Y4S A;  1Z0C A;  4DV5 I;  4DV2 I;  4LF8 I;  2UUC E;  2E1R A;  1N32 I;  1FWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...