5BR8I

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5br8I00
4DV3I 3QT8A 1HR0E 4HACA 2UXBE 1IBKI 4LF9I 1H74A 1XNRE 4KHPE 1EI1A 2OI2A 3V5RA 4JI6I 1Z0GA 2E5LI 2HFUA 4LFBE 1OJ4A 2UXBI 4DR3E 1ZM9A 1HNZE 5IT9C 4K0KI 3B82A 5IT9Q 2DEIA 2V8PA 1FWLA 1N34I 3ZKBA 4JI5I 4JG4A 1Z0TA 4B3RI 4DPTA 2UUBI 3LNUA 4DPUA 2UU9I 4LF4I 4JI3I 4JI2I 1A6FA 1KVKA 5FLXC 2UUCE 4WUCA 1ZXNA 1N0VC 1H7UA 4JI0I 2GS8A 1KIJA 3T1YI 1N36I 3PYGA 1Z0BA 4DR4I 1XMQE 1FJGI 3WU3A 4NXME 4DV6E 4P52A 1XHKA 5L3JA 1U2RA 1Z0WA 5GMDA 4DUZE 1Z0CA 1K47A 1XNQE 4DV1E 3ZM7A 1Z0EA 4UT4A 4X64I 4Z7CA 1HNXE 4NXNI 1RREA 1IBME 1Z59A 1S16A 2UXCI 4ZVIA 1KKHA 2A2DA 4GKJI 1H72C 1MU5A 4DV5E 3B78A 2Q2EB 1ELOA 1IBLE 3J7AM 3B8HA 1WUUA 4DR6I 1RR9A 1PVGA 4DV4I 4LF5E 4DR5E 4DV2I 5IWAI 1KTVA 4JI4E 1Z5AA 2AJ4A 4JV5I 1N33E 4X62E 4LF8E 4JI8I 3JAMC 1ZM2A 3PYEA 3JAMQ 4DV0E 2UUAI 2BM0A 4FW9A 5LL6R 1H73A 2ZBKB 2WW4A 2V2ZA 1Z0VA 2ZITA 1FNMA 4GKKE 1J5EE 2HHHE 3QT6A 4B3TE 1UEKA 4JI1E 4FWHA 1HNWE 1HR0I 3ZZUA 3PYFA 3V2UC 2CZ9A 1ZM3A 3K1JA 1XNRI 4KHPI 1MG7A 4B3ME 4DR7E 1BKNA 4LFBI 3H4LA 1DARA 2R3VA 4DR3I 4AQYE 4DV7E 4DR2E 1HNZI 2UXDE 1EA6A 4FN5A 4HY1A 1Z5BA 2DEJA 2UUCI 2LJPA 4M1KA 3LTOA 4R1FA 1XMOE 2VQEE 1Z5CA 1I94E 4YY3E 1ZM4A 5LMNE 3J81Q 3QT5A 4LF7E 2ZM6E 1XMQI 4NXMI 4OX9E 4DV6I 1B62A 1FKAE 1D6TA 3ZKDA 3F0NA 3T1HE 4DUZI 2XEXA 4DU7A 1XNQI 2VQFE 4DV1I 4B3SE 4LF6E 4PRVA 1N32E 1HNXI 1S4EA 4HACB 1IBMI 2F4VE 4YHHE 4P7AA 1FI4A 4LF6I 4DV5I 1IBLI 4DUYE 4LFCE 4X66E 4DPXA 3OTOE 4LFAE 4KQVA 2BM1A 4EMDA 4X65E 4LF5I 4DR5I 4USKA 4I3HA 4JYAE 5BR8E 2E1RA 4JI4I 1NHIA 3QT7A 4JI7E 1N33I 4X62I 4LF8I 5LMUE 5A2QQ 2VF3A 4DV0I 4DR1E 4DU8A 4DV3E 4HXZA 1PIEA 2NPFA 4PRXA 4GKKI 1J5EI 2HHHI 1N0UA 3K17A 3M6AA 3LPSA 4B3TI 4JI1I 1IBKE 4LF9E 2HKEA 4UTGA 1HNWI 4JI6E 2X7IA 2E5LE 2HFSA 4K0KE 1H7SA 4B3MI 4WUBA 1NHJA 4DR7I 4WUDA 4FWDA 1N34E 3WU5A 4JI5E 4B3RE 4AQYI 4DV7I 1NZ0A 4DR2I 2UUBE 2UXDI 2UU9E 4LF4E 4JI3E 4JI2E 4ED4A 1FWKA 2HKJA 2V2QA 3GONA 4JI0E 3J81C 2J7KA 3T1YE 3ZZ0A 1N36E 3ZZTA 1PKPA 5FLXQ 4DR4E 1FJGE 1XMOI 2VQEI 4PU9A 2X36A 1I94I 4YY3I 5LMNI 4LF7I 2ZM6I 1B63A 2V2VA 4OX9I 2HK2A 3HULA 4XTJA 4DPWA 4X64E 4NXNE 3T1HI 2EFGA 2UXCE 3WU6A 3PYDA 4RPFA 1QZRA 2VQFI 4B3SI 4GKJE 1N32I 1NHHA 3D4JA 4DXLA 4MYTA 2F4VI 4YHHI 4MYUA 4DR6E 1VISA 3J7AG 4Z7YA 4HYMA 4DUYI 1MX0A 4DV4E 4LFCI 2BV3A 4X66I 3OTOI 4LFAI 4DV2E 5IWAE 4USMA 5GMEA 4JV5E 1ZXMA 4X65I 3J80C 3WU4A 3J80Q 3CWVA 5A2QC 4JYAI 2HK3A 5BR8I 4JI8E 3Q1QA 2UUAE 4JI7I 2R42A 4DPYA 5LMUI 4FWGA 4URLA 2A2CA 2V34A 4DR1I
chains in the Genus database with same CATH superfamily
4DV3I 3QT8A 4OO1D 4MU0A 4LPFA 1HR0E 4HACA 2Z5CB 2UXBE 2F1DA 1IBKI 4LF9I 1H74A 1XNRE 4KHPE 1EI1A 2OI2A 4GQUA 4IZJB 1E3PA 4IZKB 3V5RA 4JI6I 1Z0GA 2PO0B 2GQ0A 2E5LI 2HFUA 4LFBE 4NBQA 1OJ4A 2UXBI 4DR3E 5C0XF 1ZM9A 1Y5YA 5JEAE 5IT9C 3B82A 1HNZE 4K0KI 5IT9Q 2DEIA 2V8PA 1E3HA 1FWLA 3NZKA 4ISAA 3U1YA 4IZJD 1N34I 4IFDF 3ZKBA 4JI5I 4JG4A 2CG9A 1Z0TA 4B3RI 4BA1A 3P3GA 4DPTA 2UUBI 3LNUA 4DPUA 2UU9I 4LF4I 4JI3I 4JI2I 1A6FA 1KVKA 5FLXC 2UUCE 2O1VA 4WUCA 1ZXNA 1N0VC 4LOMA 1H7UA 4JI0I 2GS8A 3DD6A 3GCMA 1P42A 1KIJA 3T1YI 1N36I 3PYGA 1Z0BA 3HKMA 4DR4I 3PS3A 1XMQE 1FJGI 3WU3A 1RHYA 4NXME 3U1KA 2JT2A 5DROA 4DV6E 4P52A 1XHKA 5L3JA 2JEBB 5C0XE 1U2RA 1Z0WA 5GMDA 2J65A 5JEAA 3K85A 4MU4A 4IFDE 4U3DA 5K36C 2VESA 4DUZE 2BR2B 1Z0CA 1K47A 1XNQE 4AIMA 4DV1E 3ZM7A 1Z0EA 4UT4A 4X64I 4Z7CA 1HNXE 4NXNI 1RREA 1IBME 2C38B 1Z59A 1S16A 2UXCI 3M7ND 4ZVIA 1KKHA 2A2DA 4GKJI 1H72C 1MU5A 4DV5E 3B78A 2PNZB 2Q2EB 1YHCA 4FW7A 1ELOA 1IBLE 4J3DA 3J7AM 2WP8A 3B8HA 1WUUA 4DR6I 2JEAA 1RR9A 5K36D 5C0XA 1PVGA 2WNRA 4DV4I 4LF5E 4DR5E 4OO1F 2O1UA 4IFDA 4DV2I 3Q6MA 4BA1B 5IWAI 5JEAF 1KTVA 4JI4E 1USVA 1Z5AA 1R6LA 2AJ4A 4JV5I 1N33E 4X62E 4LF8E 1UDNA 4JI8I 3JAMC 1ZM2A 3PYEA 3JAMQ 3P3EA 4DV0E 2UUAI 2BM0A 2C39A 4FW9A 5LL6R 1H73A 2ZBKB 2WW4A 2V2ZA 3KRNA 1Z0VA 2ZITA 1FNMA 4GKKE 1J5EE 2HHHE 2C37B 3QT6A 1UEKA 4B3TE 4JI1E 4FWHA 2PNMA 1HNWE 4FW5A 3Q6NA 1HR0I 3ZZUA 4OO1E 3PYFA 3V2UC 2CZ9A 1ZM3A 3K1JA 1XNRI 4KHPI 1MG7A 4B3ME 4DR7E 1UDQA 1BKNA 4LFBI 3H4LA 1DARA 2R3VA 2BA0G 3CDJA 4DR3I 4AQYE 4DV7E 4DR2E 1HNZI 4BA2B 2UXDE 4FW6A 1Y4SA 1UDSA 1EA6A 2PO2A 4FN5A 2IOQA 4HY1A 2BA1G 2WP8B 1HK7A 1Z5BA 1OYPA 2DEJA 2JEAB 2UUCI 2NN6C 2LJPA 1R6MA 3HJCA 3LTOA 4M1KA 5C0XB 3GLLA 4R1FA 1XMOE 2VQEE 1Z5CA 2Z5BB 1I94E 4YY3E 4OO1A 1ZM4A 3PS2A 5LMNE 3J81Q 1USUA 3QT5A 4LF7E 5DRPA 2ZM6E 1XMQI 4NXMI 4OX9E 2GO4A 4DV6I 1B62A 1FKAE 1OYSA 2NN6B 4IS9A 4FW3A 5DRRA 4U3BA 1D6TA 3ZKDA 3F0NA 3T1HE 5K36F 2Z5CA 2C39B 4DUZI 2XEXA 4DU7A 4IZJA 1XNQI 2VQFE 4IZKA 4DV1I 4B3SE 1Y60A 4AIDA 4PRVA 4LF6E 1N32E 2PO0A 1HNXI 4HACB 1S4EA 2NN6D 1IBMI 4AM3A 2F4VE 2PO1A 4FW4A 4YHHE 4P7AA 1FI4A 5DNLA 5EL9A 4LF6I 3B4TA 4DV5I 4OZEA 2O1WA 2IESA 1IBLI 4MQYA 4DUYE 4QNKA 2CVEA 3GMEA 1Y6ZA 4LFCE 4X66E 4DPXA 3OTOE 4LFAE 1VI7A 4KQVA 2CGEA 2BM1A 4EMDA 4X65E 5K36E 4LF5I 4DR5I 4USKA 4I3HA 4MU1A 4JYAE 3PS1A 5BR8E 2E1RA 1YH8A 4JI4I 5JEAC 1NHIA 3QT7A 3P06A 2Z5EA 2BA0D 4JI7E 3M85G 1N33I 4X62I 4LF8I 5LMUE 5A2QQ 2PNLA 2VF3A 4DV0I 4N3OA 5DRQA 4OO1B 4DR1E 2O1TA 4DU8A 4DV3E 4HXZA 1OYRA 1PIEA 2NPFA 4PRXA 2BA1D 5JEAB 4GKKI 1J5EI 2HHHI 1N0UA 3K17A 3M6AA 3LPSA 4B3TI 4JI1I 1IBKE 4LF9E 4QNJA 2JE6A 2HKEA 3P3CA 4UTGA 1HNWI 4JI6E 2X7IA 2E5LE 2HFSA 4LCGA 5K36A 4LCFA 5JEAD 3CDIA 2PNZA 4K0KE 1H7SA 5C0XC 4B3MI 4WUBA 1NHJA 4DR7I 4WUDA 4MDTA 4FWDA 1N34E 3WU5A 4IFDC 3P76A 4JI5E 2PO1B 4B3RE 4AQYI 4DV7I 1NZ0A 4DR2I 2UUBE 2UXDI 2UU9E 4LF4E 1Y4UA 4JI3E 4JI2E 4ED4A 1FWKA 2HKJA 2V2QA 2WNRB 3GONA 4IFDB 4JI0E 3J81C 2J7KA 2NN6F 3T1YE 5DNXA 3ZZ0A 1N36E 3ZZTA 1PKPA 5FLXQ 3H1CA 4DR4E 1FJGE 1XMOI 2VQEI 4OKGA 4PU9A 2X36A 5ELWA 5C0XD 1I94I 4YY3I 3L7ZA 3UHMA 5LMNI 4IFDD 4LF7I 2ZM6I 1B63A 2V2VA 4OX9I 2C37A 2HK2A 4XTJA 3HULA 4DPWA 2GO3A 4X64E 4NXNE 1UDOA 5EKWA 3T1HI 2EFGA 2UXCE 2IERA 3WU6A 3PYDA 4RPFA 1QZRA 2O3ZA 2VQFI 4B3SI 4GKJE 1N32I 1NHHA 3M85D 3D4JA 4DXLA 4MYTA 2F4VI 2NN6E 2AE8A 2JE6B 4YHHI 4BA2A 4MYUA 4DR6E 5K36B 1VISA 3J7AG 4Z7YA 4HYMA 4DUYI 1MX0A 4DV4E 4LFCI 4LCHA 2BV3A 4X66I 3OTOI 4OO1C 4LFAI 4DV2E 2PO2B 5IWAE 4USMA 5GMEA 4JV5E 1ZXMA 4X65I 3J80C 3WU4A 3PRYA 2Z5BA 3J80Q 3CWVA 5A2QC 4JYAI 2HK3A 2JEBA 4JI8E 5BR8I 3M7NG 3Q1QA 2UUAE 4MU3A 1XXEA 4JI7I 2R42A 4DPYA 2BR2A 5LMUI 4FWGA 2NN6A 4URLA 2A2CA 2IOPA 2C38A 5FWKA 2V34A 3L7ZB 4DR1I
chains in the Genus database with same CATH topology
4DV3I 3QT8A 1HR0E 4HACA 2Z5CB 2UXBE 1IBKI 4LF9I 1H74A 1XNRE 4KHPE 1EI1A 2OI2A 4IZJB 4IZKB 3V5RA 4JI6I 1Z0GA 2GQ0A 2E5LI 2HFUA 4LFBE 1OJ4A 2UXBI 4DR3E 1ZM9A 1HNZE 5IT9C 4K0KI 3B82A 5IT9Q 2DEIA 2V8PA 1FWLA 1N34I 4IZJD 3ZKBA 4JI5I 4JG4A 2CG9A 1Z0TA 4B3RI 4DPTA 2UUBI 3LNUA 4DPUA 2UU9I 4LF4I 4JI3I 4JI2I 1A6FA 1KVKA 5FLXC 2UUCE 2O1VA 4WUCA 1ZXNA 1N0VC 1H7UA 4JI0I 2GS8A 1KIJA 3T1YI 1N36I 3PYGA 1Z0BA 4DR4I 1XMQE 1FJGI 3WU3A 4NXME 4DV6E 4P52A 1XHKA 5L3JA 1U2RA 1Z0WA 5GMDA 3K85A 4DUZE 1Z0CA 1K47A 1XNQE 4DV1E 3ZM7A 1Z0EA 4UT4A 4X64I 4Z7CA 1HNXE 4NXNI 1RREA 1IBME 1Z59A 1S16A 2UXCI 4ZVIA 1KKHA 2A2DA 4GKJI 1H72C 1MU5A 4DV5E 3B78A 2Q2EB 1ELOA 1IBLE 3J7AM 3B8HA 1WUUA 4DR6I 1RR9A 1PVGA 4DV4I 4LF5E 4DR5E 2O1UA 4DV2I 3Q6MA 5IWAI 1KTVA 4JI4E 1USVA 1Z5AA 2AJ4A 4JV5I 1N33E 4X62E 4LF8E 4JI8I 3JAMC 1ZM2A 3PYEA 3JAMQ 4DV0E 2UUAI 2BM0A 4FW9A 5LL6R 1H73A 2ZBKB 2WW4A 2V2ZA 1Z0VA 2ZITA 1FNMA 4GKKE 1J5EE 2HHHE 3QT6A 4B3TE 1UEKA 4JI1E 4FWHA 2PNMA 1HNWE 3Q6NA 1HR0I 3ZZUA 3PYFA 3V2UC 2CZ9A 1ZM3A 3K1JA 1XNRI 4KHPI 1MG7A 4B3ME 4DR7E 1BKNA 4LFBI 3H4LA 1DARA 2R3VA 4DR3I 4AQYE 4DV7E 4DR2E 1HNZI 2UXDE 1Y4SA 1EA6A 4FN5A 2IOQA 4HY1A 1HK7A 1Z5BA 2DEJA 2UUCI 2LJPA 3HJCA 3LTOA 4M1KA 4R1FA 1XMOE 2VQEE 1Z5CA 2Z5BB 1I94E 4YY3E 1ZM4A 5LMNE 3J81Q 1USUA 3QT5A 4LF7E 2ZM6E 1XMQI 4NXMI 4OX9E 4DV6I 1B62A 1FKAE 1D6TA 3ZKDA 3F0NA 3T1HE 2Z5CA 4DUZI 2XEXA 4DU7A 4IZJA 1XNQI 2VQFE 4IZKA 4DV1I 4B3SE 4LF6E 4PRVA 1N32E 1HNXI 1S4EA 4HACB 1IBMI 2F4VE 4YHHE 4P7AA 1FI4A 4LF6I 4DV5I 2O1WA 1IBLI 4DUYE 1Y6ZA 4LFCE 4X66E 4DPXA 3OTOE 4LFAE 4KQVA 2CGEA 2BM1A 4EMDA 4X65E 4LF5I 4DR5I 4USKA 4I3HA 4JYAE 5BR8E 2E1RA 4JI4I 1NHIA 3QT7A 3P06A 2Z5EA 4JI7E 1N33I 4X62I 4LF8I 5LMUE 5A2QQ 2PNLA 2VF3A 4DV0I 4N3OA 4DR1E 2O1TA 4DU8A 4DV3E 4HXZA 1PIEA 2NPFA 4PRXA 4GKKI 1J5EI 2HHHI 1N0UA 3K17A 3M6AA 3LPSA 4B3TI 4JI1I 1IBKE 4LF9E 2HKEA 4UTGA 1HNWI 4JI6E 2X7IA 2E5LE 2HFSA 4K0KE 1H7SA 4B3MI 4WUBA 1NHJA 4DR7I 4WUDA 4FWDA 1N34E 3WU5A 4JI5E 4B3RE 4AQYI 4DV7I 1NZ0A 4DR2I 2UUBE 2UXDI 2UU9E 4LF4E 1Y4UA 4JI3E 4JI2E 4ED4A 1FWKA 2HKJA 2V2QA 3GONA 4JI0E 3J81C 2J7KA 3T1YE 3ZZ0A 1N36E 3ZZTA 1PKPA 5FLXQ 4DR4E 1FJGE 1XMOI 2VQEI 4PU9A 2X36A 1I94I 4YY3I 5LMNI 4LF7I 2ZM6I 1B63A 2V2VA 4OX9I 2HK2A 3HULA 4XTJA 4DPWA 4X64E 4NXNE 3T1HI 2EFGA 2UXCE 3WU6A 3PYDA 4RPFA 1QZRA 2VQFI 4B3SI 4GKJE 1N32I 1NHHA 3D4JA 4DXLA 4MYTA 2F4VI 4YHHI 4MYUA 4DR6E 1VISA 3J7AG 4Z7YA 4HYMA 4DUYI 1MX0A 4DV4E 4LFCI 2BV3A 4X66I 3OTOI 4LFAI 4DV2E 5IWAE 4USMA 5GMEA 4JV5E 1ZXMA 4X65I 3J80C 3WU4A 3PRYA 2Z5BA 3J80Q 3CWVA 5A2QC 4JYAI 2HK3A 5BR8I 4JI8E 3Q1QA 2UUAE 4JI7I 2R42A 4DPYA 5LMUI 4FWGA 4URLA 2A2CA 2IOPA 5FWKA 2V34A 4DR1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 I;  3QT8 A;  1HR0 E;  4HAC A;  2UXB E;  1IBK I;  4LF9 I;  1H74 A;  1XNR E;  4KHP E;  1EI1 A;  2OI2 A;  3V5R A;  4JI6 I;  1Z0G A;  2E5L I;  2HFU A;  4LFB E;  1OJ4 A;  2UXB I;  4DR3 E;  1ZM9 A;  1HNZ E;  5IT9 C;  4K0K I;  3B82 A;  5IT9 Q;  2DEI A;  2V8P A;  1FWL A;  1N34 I;  3ZKB A;  4JI5 I;  4JG4 A;  1Z0T A;  4B3R I;  4DPT A;  2UUB I;  3LNU A;  4DPU A;  2UU9 I;  4LF4 I;  4JI3 I;  4JI2 I;  1A6F A;  1KVK A;  5FLX C;  2UUC E;  4WUC A;  1ZXN A;  1N0V C;  1H7U A;  4JI0 I;  2GS8 A;  1KIJ A;  3T1Y I;  1N36 I;  3PYG A;  1Z0B A;  4DR4 I;  1XMQ E;  1FJG I;  3WU3 A;  4NXM E;  4DV6 E;  4P52 A;  1XHK A;  5L3J A;  1U2R A;  1Z0W A;  5GMD A;  4DUZ E;  1Z0C A;  1K47 A;  1XNQ E;  4DV1 E;  3ZM7 A;  1Z0E A;  4UT4 A;  4X64 I;  4Z7C A;  1HNX E;  4NXN I;  1RRE A;  1IBM E;  1Z59 A;  1S16 A;  2UXC I;  4ZVI A;  1KKH A;  2A2D A;  4GKJ I;  1H72 C;  1MU5 A;  4DV5 E;  3B78 A;  2Q2E B;  1ELO A;  1IBL E;  3J7A M;  3B8H A;  1WUU A;  4DR6 I;  1RR9 A;  1PVG A;  4DV4 I;  4LF5 E;  4DR5 E;  4DV2 I;  5IWA I;  1KTV A;  4JI4 E;  1Z5A A;  2AJ4 A;  4JV5 I;  1N33 E;  4X62 E;  4LF8 E;  4JI8 I;  3JAM C;  1ZM2 A;  3PYE A;  3JAM Q;  4DV0 E;  2UUA I;  2BM0 A;  4FW9 A;  5LL6 R;  1H73 A;  2ZBK B;  2WW4 A;  2V2Z A;  1Z0V A;  2ZIT A;  1FNM A;  4GKK E;  1J5E E;  2HHH E;  3QT6 A;  4B3T E;  1UEK A;  4JI1 E;  4FWH A;  1HNW E;  1HR0 I;  3ZZU A;  3PYF A;  3V2U C;  2CZ9 A;  1ZM3 A;  3K1J A;  1XNR I;  4KHP I;  1MG7 A;  4B3M E;  4DR7 E;  1BKN A;  4LFB I;  3H4L A;  1DAR A;  2R3V A;  4DR3 I;  4AQY E;  4DV7 E;  4DR2 E;  1HNZ I;  2UXD E;  1EA6 A;  4FN5 A;  4HY1 A;  1Z5B A;  2DEJ A;  2UUC I;  2LJP A;  4M1K A;  3LTO A;  4R1F A;  1XMO E;  2VQE E;  1Z5C A;  1I94 E;  4YY3 E;  1ZM4 A;  5LMN E;  3J81 Q;  3QT5 A;  4LF7 E;  2ZM6 E;  1XMQ I;  4NXM I;  4OX9 E;  4DV6 I;  1B62 A;  1FKA E;  1D6T A;  3ZKD A;  3F0N A;  3T1H E;  4DUZ I;  2XEX A;  4DU7 A;  1XNQ I;  2VQF E;  4DV1 I;  4B3S E;  4LF6 E;  4PRV A;  1N32 E;  1HNX I;  1S4E A;  4HAC B;  1IBM I;  2F4V E;  4YHH E;  4P7A A;  1FI4 A;  4LF6 I;  4DV5 I;  1IBL I;  4DUY E;  4LFC E;  4X66 E;  4DPX A;  3OTO E;  4LFA E;  4KQV A;  2BM1 A;  4EMD A;  4X65 E;  4LF5 I;  4DR5 I;  4USK A;  4I3H A;  4JYA E;  5BR8 E;  2E1R A;  4JI4 I;  1NHI A;  3QT7 A;  4JI7 E;  1N33 I;  4X62 I;  4LF8 I;  5LMU E;  5A2Q Q;  2VF3 A;  4DV0 I;  4DR1 E;  4DU8 A;  4DV3 E;  4HXZ A;  1PIE A;  2NPF A;  4PRX A;  4GKK I;  1J5E I;  2HHH I;  1N0U A;  3K17 A;  3M6A A;  3LPS A;  4B3T I;  4JI1 I;  1IBK E;  4LF9 E;  2HKE A;  4UTG A;  1HNW I;  4JI6 E;  2X7I A;  2E5L E;  2HFS A;  4K0K E;  1H7S A;  4B3M I;  4WUB A;  1NHJ A;  4DR7 I;  4WUD A;  4FWD A;  1N34 E;  3WU5 A;  4JI5 E;  4B3R E;  4AQY I;  4DV7 I;  1NZ0 A;  4DR2 I;  2UUB E;  2UXD I;  2UU9 E;  4LF4 E;  4JI3 E;  4JI2 E;  4ED4 A;  1FWK A;  2HKJ A;  2V2Q A;  3GON A;  4JI0 E;  3J81 C;  2J7K A;  3T1Y E;  3ZZ0 A;  1N36 E;  3ZZT A;  1PKP A;  5FLX Q;  4DR4 E;  1FJG E;  1XMO I;  2VQE I;  4PU9 A;  2X36 A;  1I94 I;  4YY3 I;  5LMN I;  4LF7 I;  2ZM6 I;  1B63 A;  2V2V A;  4OX9 I;  2HK2 A;  3HUL A;  4XTJ A;  4DPW A;  4X64 E;  4NXN E;  3T1H I;  2EFG A;  2UXC E;  3WU6 A;  3PYD A;  4RPF A;  1QZR A;  2VQF I;  4B3S I;  4GKJ E;  1N32 I;  1NHH A;  3D4J A;  4DXL A;  4MYT A;  2F4V I;  4YHH I;  4MYU A;  4DR6 E;  1VIS A;  3J7A G;  4Z7Y A;  4HYM A;  4DUY I;  1MX0 A;  4DV4 E;  4LFC I;  2BV3 A;  4X66 I;  3OTO I;  4LFA I;  4DV2 E;  5IWA E;  4USM A;  5GME A;  4JV5 E;  1ZXM A;  4X65 I;  3J80 C;  3WU4 A;  3J80 Q;  3CWV A;  5A2Q C;  4JYA I;  2HK3 A;  5BR8 I;  4JI8 E;  3Q1Q A;  2UUA E;  4JI7 I;  2R42 A;  4DPY A;  5LMU I;  4FWG A;  4URL A;  2A2C A;  2V34 A;  4DR1 I; 
#chains in the Genus database with same CATH topology
 4DV3 I;  3QT8 A;  4OO1 D;  4MU0 A;  4LPF A;  1HR0 E;  4HAC A;  2Z5C B;  2UXB E;  2F1D A;  1IBK I;  4LF9 I;  1H74 A;  1XNR E;  4KHP E;  1EI1 A;  2OI2 A;  4GQU A;  4IZJ B;  1E3P A;  4IZK B;  3V5R A;  4JI6 I;  1Z0G A;  2PO0 B;  2GQ0 A;  2E5L I;  2HFU A;  4LFB E;  4NBQ A;  1OJ4 A;  2UXB I;  4DR3 E;  5C0X F;  1ZM9 A;  1Y5Y A;  5JEA E;  5IT9 C;  3B82 A;  1HNZ E;  4K0K I;  5IT9 Q;  2DEI A;  2V8P A;  1E3H A;  1FWL A;  3NZK A;  4ISA A;  3U1Y A;  4IZJ D;  1N34 I;  4IFD F;  3ZKB A;  4JI5 I;  4JG4 A;  2CG9 A;  1Z0T A;  4B3R I;  4BA1 A;  3P3G A;  4DPT A;  2UUB I;  3LNU A;  4DPU A;  2UU9 I;  4LF4 I;  4JI3 I;  4JI2 I;  1A6F A;  1KVK A;  5FLX C;  2UUC E;  2O1V A;  4WUC A;  1ZXN A;  1N0V C;  4LOM A;  1H7U A;  4JI0 I;  2GS8 A;  3DD6 A;  3GCM A;  1P42 A;  1KIJ A;  3T1Y I;  1N36 I;  3PYG A;  1Z0B A;  3HKM A;  4DR4 I;  3PS3 A;  1XMQ E;  1FJG I;  3WU3 A;  1RHY A;  4NXM E;  3U1K A;  2JT2 A;  5DRO A;  4DV6 E;  4P52 A;  1XHK A;  5L3J A;  2JEB B;  5C0X E;  1U2R A;  1Z0W A;  5GMD A;  2J65 A;  5JEA A;  3K85 A;  4MU4 A;  4IFD E;  4U3D A;  5K36 C;  2VES A;  4DUZ E;  2BR2 B;  1Z0C A;  1K47 A;  1XNQ E;  4AIM A;  4DV1 E;  3ZM7 A;  1Z0E A;  4UT4 A;  4X64 I;  4Z7C A;  1HNX E;  4NXN I;  1RRE A;  1IBM E;  2C38 B;  1Z59 A;  1S16 A;  2UXC I;  3M7N D;  4ZVI A;  1KKH A;  2A2D A;  4GKJ I;  1H72 C;  1MU5 A;  4DV5 E;  3B78 A;  2PNZ B;  2Q2E B;  1YHC A;  4FW7 A;  1ELO A;  1IBL E;  4J3D A;  3J7A M;  2WP8 A;  3B8H A;  1WUU A;  4DR6 I;  2JEA A;  1RR9 A;  5K36 D;  5C0X A;  1PVG A;  2WNR A;  4DV4 I;  4LF5 E;  4DR5 E;  4OO1 F;  2O1U A;  4IFD A;  4DV2 I;  3Q6M A;  4BA1 B;  5IWA I;  5JEA F;  1KTV A;  4JI4 E;  1USV A;  1Z5A A;  1R6L A;  2AJ4 A;  4JV5 I;  1N33 E;  4X62 E;  4LF8 E;  1UDN A;  4JI8 I;  3JAM C;  1ZM2 A;  3PYE A;  3JAM Q;  3P3E A;  4DV0 E;  2UUA I;  2BM0 A;  2C39 A;  4FW9 A;  5LL6 R;  1H73 A;  2ZBK B;  2WW4 A;  2V2Z A;  3KRN A;  1Z0V A;  2ZIT A;  1FNM A;  4GKK E;  1J5E E;  2HHH E;  2C37 B;  3QT6 A;  1UEK A;  4B3T E;  4JI1 E;  4FWH A;  2PNM A;  1HNW E;  4FW5 A;  3Q6N A;  1HR0 I;  3ZZU A;  4OO1 E;  3PYF A;  3V2U C;  2CZ9 A;  1ZM3 A;  3K1J A;  1XNR I;  4KHP I;  1MG7 A;  4B3M E;  4DR7 E;  1UDQ A;  1BKN A;  4LFB I;  3H4L A;  1DAR A;  2R3V A;  2BA0 G;  3CDJ A;  4DR3 I;  4AQY E;  4DV7 E;  4DR2 E;  1HNZ I;  4BA2 B;  2UXD E;  4FW6 A;  1Y4S A;  1UDS A;  1EA6 A;  2PO2 A;  4FN5 A;  2IOQ A;  4HY1 A;  2BA1 G;  2WP8 B;  1HK7 A;  1Z5B A;  1OYP A;  2DEJ A;  2JEA B;  2UUC I;  2NN6 C;  2LJP A;  1R6M A;  3HJC A;  3LTO A;  4M1K A;  5C0X B;  3GLL A;  4R1F A;  1XMO E;  2VQE E;  1Z5C A;  2Z5B B;  1I94 E;  4YY3 E;  4OO1 A;  1ZM4 A;  3PS2 A;  5LMN E;  3J81 Q;  1USU A;  3QT5 A;  4LF7 E;  5DRP A;  2ZM6 E;  1XMQ I;  4NXM I;  4OX9 E;  2GO4 A;  4DV6 I;  1B62 A;  1FKA E;  1OYS A;  2NN6 B;  4IS9 A;  4FW3 A;  5DRR A;  4U3B A;  1D6T A;  3ZKD A;  3F0N A;  3T1H E;  5K36 F;  2Z5C A;  2C39 B;  4DUZ I;  2XEX A;  4DU7 A;  4IZJ A;  1XNQ I;  2VQF E;  4IZK A;  4DV1 I;  4B3S E;  1Y60 A;  4AID A;  4PRV A;  4LF6 E;  1N32 E;  2PO0 A;  1HNX I;  4HAC B;  1S4E A;  2NN6 D;  1IBM I;  4AM3 A;  2F4V E;  2PO1 A;  4FW4 A;  4YHH E;  4P7A A;  1FI4 A;  5DNL A;  5EL9 A;  4LF6 I;  3B4T A;  4DV5 I;  4OZE A;  2O1W A;  2IES A;  1IBL I;  4MQY A;  4DUY E;  4QNK A;  2CVE A;  3GME A;  1Y6Z A;  4LFC E;  4X66 E;  4DPX A;  3OTO E;  4LFA E;  1VI7 A;  4KQV A;  2CGE A;  2BM1 A;  4EMD A;  4X65 E;  5K36 E;  4LF5 I;  4DR5 I;  4USK A;  4I3H A;  4MU1 A;  4JYA E;  3PS1 A;  5BR8 E;  2E1R A;  1YH8 A;  4JI4 I;  5JEA C;  1NHI A;  3QT7 A;  3P06 A;  2Z5E A;  2BA0 D;  4JI7 E;  3M85 G;  1N33 I;  4X62 I;  4LF8 I;  5LMU E;  5A2Q Q;  2PNL A;  2VF3 A;  4DV0 I;  4N3O A;  5DRQ A;  4OO1 B;  4DR1 E;  2O1T A;  4DU8 A;  4DV3 E;  4HXZ A;  1OYR A;  1PIE A;  2NPF A;  4PRX A;  2BA1 D;  5JEA B;  4GKK I;  1J5E I;  2HHH I;  1N0U A;  3K17 A;  3M6A A;  3LPS A;  4B3T I;  4JI1 I;  1IBK E;  4LF9 E;  4QNJ A;  2JE6 A;  2HKE A;  3P3C A;  4UTG A;  1HNW I;  4JI6 E;  2X7I A;  2E5L E;  2HFS A;  4LCG A;  5K36 A;  4LCF A;  5JEA D;  3CDI A;  2PNZ A;  4K0K E;  1H7S A;  5C0X C;  4B3M I;  4WUB A;  1NHJ A;  4DR7 I;  4WUD A;  4MDT A;  4FWD A;  1N34 E;  3WU5 A;  4IFD C;  3P76 A;  4JI5 E;  2PO1 B;  4B3R E;  4AQY I;  4DV7 I;  1NZ0 A;  4DR2 I;  2UUB E;  2UXD I;  2UU9 E;  4LF4 E;  1Y4U A;  4JI3 E;  4JI2 E;  4ED4 A;  1FWK A;  2HKJ A;  2V2Q A;  2WNR B;  3GON A;  4IFD B;  4JI0 E;  3J81 C;  2J7K A;  2NN6 F;  3T1Y E;  5DNX A;  3ZZ0 A;  1N36 E;  3ZZT A;  1PKP A;  5FLX Q;  3H1C A;  4DR4 E;  1FJG E;  1XMO I;  2VQE I;  4OKG A;  4PU9 A;  2X36 A;  5ELW A;  5C0X D;  1I94 I;  4YY3 I;  3L7Z A;  3UHM A;  5LMN I;  4IFD D;  4LF7 I;  2ZM6 I;  1B63 A;  2V2V A;  4OX9 I;  2C37 A;  2HK2 A;  4XTJ A;  3HUL A;  4DPW A;  2GO3 A;  4X64 E;  4NXN E;  1UDO A;  5EKW A;  3T1H I;  2EFG A;  2UXC E;  2IER A;  3WU6 A;  3PYD A;  4RPF A;  1QZR A;  2O3Z A;  2VQF I;  4B3S I;  4GKJ E;  1N32 I;  1NHH A;  3M85 D;  3D4J A;  4DXL A;  4MYT A;  2F4V I;  2NN6 E;  2AE8 A;  2JE6 B;  4YHH I;  4BA2 A;  4MYU A;  4DR6 E;  5K36 B;  1VIS A;  3J7A G;  4Z7Y A;  4HYM A;  4DUY I;  1MX0 A;  4DV4 E;  4LFC I;  4LCH A;  2BV3 A;  4X66 I;  3OTO I;  4OO1 C;  4LFA I;  4DV2 E;  2PO2 B;  5IWA E;  4USM A;  5GME A;  4JV5 E;  1ZXM A;  4X65 I;  3J80 C;  3WU4 A;  3PRY A;  2Z5B A;  3J80 Q;  3CWV A;  5A2Q C;  4JYA I;  2HK3 A;  2JEB A;  4JI8 E;  5BR8 I;  3M7N G;  3Q1Q A;  2UUA E;  4MU3 A;  1XXE A;  4JI7 I;  2R42 A;  4DPY A;  2BR2 A;  5LMU I;  4FWG A;  2NN6 A;  4URL A;  2A2C A;  2IOP A;  2C38 A;  5FWK A;  2V34 A;  3L7Z B;  4DR1 I; 
#chains in the Genus database with same CATH homology
 4DV3 I;  3QT8 A;  1HR0 E;  4HAC A;  2Z5C B;  2UXB E;  1IBK I;  4LF9 I;  1H74 A;  1XNR E;  4KHP E;  1EI1 A;  2OI2 A;  4IZJ B;  4IZK B;  3V5R A;  4JI6 I;  1Z0G A;  2GQ0 A;  2E5L I;  2HFU A;  4LFB E;  1OJ4 A;  2UXB I;  4DR3 E;  1ZM9 A;  1HNZ E;  5IT9 C;  4K0K I;  3B82 A;  5IT9 Q;  2DEI A;  2V8P A;  1FWL A;  1N34 I;  4IZJ D;  3ZKB A;  4JI5 I;  4JG4 A;  2CG9 A;  1Z0T A;  4B3R I;  4DPT A;  2UUB I;  3LNU A;  4DPU A;  2UU9 I;  4LF4 I;  4JI3 I;  4JI2 I;  1A6F A;  1KVK A;  5FLX C;  2UUC E;  2O1V A;  4WUC A;  1ZXN A;  1N0V C;  1H7U A;  4JI0 I;  2GS8 A;  1KIJ A;  3T1Y I;  1N36 I;  3PYG A;  1Z0B A;  4DR4 I;  1XMQ E;  1FJG I;  3WU3 A;  4NXM E;  4DV6 E;  4P52 A;  1XHK A;  5L3J A;  1U2R A;  1Z0W A;  5GMD A;  3K85 A;  4DUZ E;  1Z0C A;  1K47 A;  1XNQ E;  4DV1 E;  3ZM7 A;  1Z0E A;  4UT4 A;  4X64 I;  4Z7C A;  1HNX E;  4NXN I;  1RRE A;  1IBM E;  1Z59 A;  1S16 A;  2UXC I;  4ZVI A;  1KKH A;  2A2D A;  4GKJ I;  1H72 C;  1MU5 A;  4DV5 E;  3B78 A;  2Q2E B;  1ELO A;  1IBL E;  3J7A M;  3B8H A;  1WUU A;  4DR6 I;  1RR9 A;  1PVG A;  4DV4 I;  4LF5 E;  4DR5 E;  2O1U A;  4DV2 I;  3Q6M A;  5IWA I;  1KTV A;  4JI4 E;  1USV A;  1Z5A A;  2AJ4 A;  4JV5 I;  1N33 E;  4X62 E;  4LF8 E;  4JI8 I;  3JAM C;  1ZM2 A;  3PYE A;  3JAM Q;  4DV0 E;  2UUA I;  2BM0 A;  4FW9 A;  5LL6 R;  1H73 A;  2ZBK B;  2WW4 A;  2V2Z A;  1Z0V A;  2ZIT A;  1FNM A;  4GKK E;  1J5E E;  2HHH E;  3QT6 A;  4B3T E;  1UEK A;  4JI1 E;  4FWH A;  2PNM A;  1HNW E;  3Q6N A;  1HR0 I;  3ZZU A;  3PYF A;  3V2U C;  2CZ9 A;  1ZM3 A;  3K1J A;  1XNR I;  4KHP I;  1MG7 A;  4B3M E;  4DR7 E;  1BKN A;  4LFB I;  3H4L A;  1DAR A;  2R3V A;  4DR3 I;  4AQY E;  4DV7 E;  4DR2 E;  1HNZ I;  2UXD E;  1Y4S A;  1EA6 A;  4FN5 A;  2IOQ A;  4HY1 A;  1HK7 A;  1Z5B A;  2DEJ A;  2UUC I;  2LJP A;  3HJC A;  3LTO A;  4M1K A;  4R1F A;  1XMO E;  2VQE E;  1Z5C A;  2Z5B B;  1I94 E;  4YY3 E;  1ZM4 A;  5LMN E;  3J81 Q;  1USU A;  3QT5 A;  4LF7 E;  2ZM6 E;  1XMQ I;  4NXM I;  4OX9 E;  4DV6 I;  1B62 A;  1FKA E;  1D6T A;  3ZKD A;  3F0N A;  3T1H E;  2Z5C A;  4DUZ I;  2XEX A;  4DU7 A;  4IZJ A;  1XNQ I;  2VQF E;  4IZK A;  4DV1 I;  4B3S E;  4LF6 E;  4PRV A;  1N32 E;  1HNX I;  1S4E A;  4HAC B;  1IBM I;  2F4V E;  4YHH E;  4P7A A;  1FI4 A;  4LF6 I;  4DV5 I;  2O1W A;  1IBL I;  4DUY E;  1Y6Z A;  4LFC E;  4X66 E;  4DPX A;  3OTO E;  4LFA E;  4KQV A;  2CGE A;  2BM1 A;  4EMD A;  4X65 E;  4LF5 I;  4DR5 I;  4USK A;  4I3H A;  4JYA E;  5BR8 E;  2E1R A;  4JI4 I;  1NHI A;  3QT7 A;  3P06 A;  2Z5E A;  4JI7 E;  1N33 I;  4X62 I;  4LF8 I;  5LMU E;  5A2Q Q;  2PNL A;  2VF3 A;  4DV0 I;  4N3O A;  4DR1 E;  2O1T A;  4DU8 A;  4DV3 E;  4HXZ A;  1PIE A;  2NPF A;  4PRX A;  4GKK I;  1J5E I;  2HHH I;  1N0U A;  3K17 A;  3M6A A;  3LPS A;  4B3T I;  4JI1 I;  1IBK E;  4LF9 E;  2HKE A;  4UTG A;  1HNW I;  4JI6 E;  2X7I A;  2E5L E;  2HFS A;  4K0K E;  1H7S A;  4B3M I;  4WUB A;  1NHJ A;  4DR7 I;  4WUD A;  4FWD A;  1N34 E;  3WU5 A;  4JI5 E;  4B3R E;  4AQY I;  4DV7 I;  1NZ0 A;  4DR2 I;  2UUB E;  2UXD I;  2UU9 E;  4LF4 E;  1Y4U A;  4JI3 E;  4JI2 E;  4ED4 A;  1FWK A;  2HKJ A;  2V2Q A;  3GON A;  4JI0 E;  3J81 C;  2J7K A;  3T1Y E;  3ZZ0 A;  1N36 E;  3ZZT A;  1PKP A;  5FLX Q;  4DR4 E;  1FJG E;  1XMO I;  2VQE I;  4PU9 A;  2X36 A;  1I94 I;  4YY3 I;  5LMN I;  4LF7 I;  2ZM6 I;  1B63 A;  2V2V A;  4OX9 I;  2HK2 A;  3HUL A;  4XTJ A;  4DPW A;  4X64 E;  4NXN E;  3T1H I;  2EFG A;  2UXC E;  3WU6 A;  3PYD A;  4RPF A;  1QZR A;  2VQF I;  4B3S I;  4GKJ E;  1N32 I;  1NHH A;  3D4J A;  4DXL A;  4MYT A;  2F4V I;  4YHH I;  4MYU A;  4DR6 E;  1VIS A;  3J7A G;  4Z7Y A;  4HYM A;  4DUY I;  1MX0 A;  4DV4 E;  4LFC I;  2BV3 A;  4X66 I;  3OTO I;  4LFA I;  4DV2 E;  5IWA E;  4USM A;  5GME A;  4JV5 E;  1ZXM A;  4X65 I;  3J80 C;  3WU4 A;  3PRY A;  2Z5B A;  3J80 Q;  3CWV A;  5A2Q C;  4JYA I;  2HK3 A;  5BR8 I;  4JI8 E;  3Q1Q A;  2UUA E;  4JI7 I;  2R42 A;  4DPY A;  5LMU I;  4FWG A;  4URL A;  2A2C A;  2IOP A;  5FWK A;  2V34 A;  4DR1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...