5BR8I

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5br8I00
4YHHE 4GKJE 4B3MI 4DU7A 4I3HA 3ZZTA 3ZZUA 1ZXMA 5LMNE 1N32E 1N32I 4LF9I 1IBLE 4NXMI 4B3RE 3T1YE 4K0KI 4DR7I 4URLA 4JYAE 2GS8A 3ZZ0A 1H73A 2Q2EB 4JV5E 4ZVIA 4X62I 3QT7A 1N34I 3V5RA 4PRVA 1HNWE 5LL6R 2ZITA 3LPSA 2F4VE 3LTOA 4LF6E 1DARA 2UUAI 1IBLI 1FWLA 3K17A 4DR6I 4X65I 1Z5AA 4DR5I 1EA6A 3QT8A 3V2UC 4JI4I 3T1YI 4JI7I 2UXBE 3CWVA 4NXME 4P7AA 2E5LE 4JI0E 4DR6E 4LFCE 4LF4E 2NPFA 4UTGA 1ZM3A 2HKJA 2UUAE 1H74A 4Z7CA 4DV1E 2DEJA 1Z5CA 4DV0E 4DPXA 2LJPA 4YHHI 4GKJI 1Z59A 4JI2I 4DV4I 4X64I 1Z0WA 2BV3A 3JAMQ 4MYUA 2HFSA 5LMUI 1KVKA 4PRXA 4DR2E 2ZBKB 4K0KE 3PYDA 4DR7E 3HULA 2X7IA 4DPYA 4DV6E 2V2QA 1XNQE 4KQVA 4DR4E 2UUCI 1N0VC 3ZKBA 4DV2E 2UXDI 4AQYI 4DU8A 1XNRE 1S16A 4P52A 1N36I 4JI2E 3WU5A 2UXCE 1Z0CA 1ZM2A 4B3RI 1NHIA 4LF7I 3J7AG 1KIJA 3PYEA 2UU9E 1H7SA 2OI2A 3J80Q 5LMNI 2UUCE 3OTOE 4M1KA 2VQFE 4JI1E 3PYGA 4R1FA 4DV6I 4HY1A 4DR1I 4USKA 4DV3I 5IT9C 4B3TE 4DR5E 3B82A 1N34E 3WU6A 4DUYE 4UT4A 1QZRA 4HXZA 1D6TA 4JV5I 2HHHI 4LF5E 1Z0TA 2WW4A 1NZ0A 3T1HE 3PYFA 3ZKDA 5IWAE 4DXLA 5A2QC 2E1RA 5A2QQ 2UUBI 2BM1A 4NXNE 4JI1I 1ZXNA 4LF8E 4HACA 1FNMA 3F0NA 2UXBI 4JI4E 3Q1QA 4HYMA 1MX0A 1RR9A 1RREA 2HKEA 1XMOI 4OX9I 4JI8I 1XHKA 4X65E 3T1HI 1XMOE 1N36E 3GONA 3M6AA 4JG4A 4DUYI 2VF3A 4DPWA 4XTJA 4AQYE 4JI6E 4DV3E 4LFAE 2F4VI 4YY3I 4DR4I 1HNXI 1Z0GA 2HK3A 1K47A 1HNXE 1FKAE 1IBMI 1N33E 1HNWI 2X36A 3H4LA 4X64E 4DV7E 1N33I 4B3TI 1Z5BA 2VQEE 1UEKA 1ZM4A 4KHPI 2A2CA 1A6FA 4DV0I 4JI3I 4DV1I 2XEXA 5GMEA 2V34A 4DPTA 4JI3E 1B63A 2EFGA 1IBKE 3J81C 4JI5E 2DEIA 1J5EI 4OX9E 5L3JA 1HR0E 5IT9Q 3B78A 3JAMC 1IBKI 1ZM9A 1KTVA 1FJGI 1OJ4A 1Z0VA 4X66E 4NXNI 3QT6A 1XNQI 3WU4A 4DUZE 4B3SE 4B3SI 1NHJA 1XMQI 4DR3I 4GKKI 2V2VA 4X66I 1HNZE 4LF5I 4DPUA 2HHHE 4LFCI 4X62E 1U2RA 3D4JA 1EI1A 1S4EA 3ZM7A 1HR0I 2ZM6I 4JI5I 1XNRI 1VISA 3OTOI 1B62A 4LF8I 4LF6I 4LF4I 4ED4A 1KKHA 4LF7E 4B3ME 2HFUA 4LFBE 4JI8E 3WU3A 4DR2I 4FWGA 2VQEI 3J7AM 2A2DA 4DV2I 5BR8I 1HNZI 2V8PA 1MG7A 2BM0A 4FWDA 1IBME 5IWAI 3K1JA 4WUBA 4LFAI 4YY3E 2CZ9A 4JI6I 1FJGE 2UU9I 3LNUA 5GMDA 4DV4E 5FLXC 4EMDA 1H7UA 4JYAI 4GKKE 4LFBI 1XMQE 1Z0EA 2R3VA 1H72C 2VQFI 4WUCA 4LF9E 2UXDE 2HK2A 3QT5A 1PIEA 4JI0I 2E5LI 2UUBE 3B8HA 1ELOA 1MU5A 1NHHA 2ZM6E 2UXCI 4MYTA 1J5EE 5LMUE 1I94I 2R42A 4DV5E 4DV5I 4RPFA 4WUDA 1PKPA 1WUUA 4FN5A 4DR3E 5FLXQ 4FW9A 3J80C 4DR1E 4DUZI 4Z7YA 1FI4A 4KHPE 2J7KA 4PU9A 4DV7I 5BR8E 2V2ZA 3J81Q 1N0UA 1I94E 1BKNA 4USMA 1PVGA 1Z0BA 1FWKA 4JI7E 4HACB 2AJ4A 4FWHA
chains in the Genus database with same CATH superfamily
4YHHE 3GMEA 2JT2A 4GKJE 4B3MI 2PNMA 4DU7A 4I3HA 5C0XC 1Y4UA 3ZZTA 3ZZUA 3CDJA 3U1KA 2JEAB 1ZXMA 5LMNE 1N32E 1N32I 4LF9I 1IBLE 4NXMI 4B3RE 3T1YE 4K0KI 4DR7I 4URLA 4JYAE 2GS8A 4LOMA 5C0XD 3ZZ0A 1H73A 2Q2EB 4JV5E 4ZVIA 2O1TA 4X62I 2PO2B 3QT7A 2BA1G 1N34I 4IFDF 3V5RA 2C37B 4AM3A 4PRVA 1HNWE 5K36B 5LL6R 2ZITA 3H1CA 3LPSA 2F4VE 2NN6C 3LTOA 4LF6E 1DARA 2UUAI 1IBLI 1FWLA 2VESA 1USVA 2Z5CA 3K17A 4DR6I 4X65I 4IFDE 5JEAA 1Z5AA 4DR5I 1EA6A 3QT8A 3P76A 2IOQA 4IZKA 3V2UC 4JI4I 3T1YI 4JI7I 3L7ZB 2UXBE 3CWVA 4NXME 4P7AA 2E5LE 4JI0E 4DR6E 4LFCE 4LF4E 2NPFA 4UTGA 1ZM3A 2HKJA 3K85A 2UUAE 5JEAD 1HK7A 1H74A 1Y4SA 4Z7CA 4DV1E 2DEJA 1Z5CA 4OO1A 4OO1F 4DV0E 4DPXA 2LJPA 4YHHI 4GKJI 1Z59A 4JI2I 4J3DA 4DV4I 3GCMA 4X64I 1UDOA 3CDIA 1Z0WA 1Y60A 3Q6NA 2BV3A 3JAMQ 4MYUA 2HFSA 5JEAE 1R6LA 5LMUI 1Y6ZA 1KVKA 4PRXA 1USUA 2ZBKB 4DR2E 4K0KE 3PYDA 4OO1E 4DR7E 3HULA 4LCGA 2X7IA 4DPYA 4DV6E 4U3BA 2V2QA 5C0XE 1XNQE 4KQVA 4FW7A 2UUCI 3HKMA 4DR4E 1N0VC 2WNRA 3ZKBA 5DRPA 4DV2E 2UXDI 2BR2B 4AQYI 4DU8A 2BA0G 5JEAC 4BA2A 1XNRE 2O3ZA 1S16A 2WP8B 4P52A 1N36I 4JI2E 2O1WA 3WU5A 2UXCE 1Z0CA 1ZM2A 4B3RI 1NHIA 2C38B 3PS1A 2CG9A 4LF7I 3J7AG 1KIJA 3PYEA 2UU9E 1H7SA 2OI2A 3J80Q 5LMNI 2UUCE 4OO1B 3OTOE 1P42A 4M1KA 2C37A 4AIMA 2VQFE 4JI1E 3M7ND 3PYGA 4R1FA 4DV6I 4HY1A 4DR1I 5K36D 4USKA 4DV3I 5IT9C 4B3TE 4DR5E 2C39A 3B82A 1N34E 2PO0B 2PNZB 3WU6A 4UT4A 4DUYE 1QZRA 2O1VA 4HXZA 4JV5I 1D6TA 2HHHI 4LF5E 1Z0TA 2WW4A 1NZ0A 3T1HE 2C38A 3PYFA 3P3EA 3ZKDA 3PS2A 5IWAE 4LCFA 4DXLA 3NZKA 5A2QC 2E1RA 4AIDA 2PO1A 5A2QQ 2UUBI 2BM1A 4NXNE 4JI1I 1ZXNA 2O1UA 4HACA 4LF8E 2PNZA 1FNMA 2WNRB 3F0NA 4IFDB 2PO2A 2UXBI 4JI4E 3Q1QA 4HYMA 1MX0A 1RR9A 1RREA 2HKEA 1XMOI 4OX9I 4JI8I 1XHKA 4X65E 3T1HI 1XMOE 1N36E 3GONA 3UHMA 5JEAB 3M6AA 4JG4A 4DUYI 5K36C 2VF3A 4DPWA 4XTJA 4AQYE 4JI6E 5K36E 4DV3E 4LFAE 2F4VI 3L7ZA 4YY3I 4DR4I 1HNXI 4QNKA 1Z0GA 2HK3A 1K47A 3GLLA 2BA1D 1HNXE 1FKAE 1IBMI 4U3DA 5DROA 1N33E 1HNWI 1UDNA 2X36A 2BR2A 3H4LA 4BA1B 2C39B 4X64E 4DV7E 1N33I 4B3TI 1Z5BA 2VQEE 1UEKA 5K36F 1ZM4A 4KHPI 5DNLA 2A2CA 2AE8A 1YH8A 1A6FA 1RHYA 2GO4A 4DV0I 4MU3A 4JI3I 4DV1I 2J65A 2XEXA 5GMEA 2PO1B 2V34A 4NBQA 4DPTA 4JI3E 1B63A 2EFGA 4N3OA 1IBKE 4IZKB 3J81C 4JI5E 2DEIA 1OYRA 2JEBB 4IZJB 3M85D 1J5EI 4OX9E 5L3JA 1HR0E 5IT9Q 3B78A 3JAMC 1IBKI 2PO0A 1ZM9A 2CVEA 1KTVA 1FJGI 1OJ4A 1Z0VA 3B4TA 4X66E 3M85G 4NXNI 3QT6A 1XNQI 1R6MA 3HJCA 3WU4A 4DUZE 4B3SE 4B3SI 1NHJA 1UDSA 1XMQI 4DR3I 2IERA 4GKKI 2V2VA 2PNLA 4IZJD 4X66I 1HNZE 1OYPA 3P3CA 2HHHE 4DPUA 4LF5I 4LFCI 4X62E 1U2RA 3D4JA 1EI1A 2IESA 3DD6A 1S4EA 3ZM7A 1HR0I 2ZM6I 5K36A 2Z5CB 4JI5I 1XNRI 5EKWA 1VISA 2NN6D 3OTOI 4ISAA 1B62A 4LF8I 2Z5EA 4LF6I 4LF4I 4ED4A 1KKHA 4LF7E 4OO1C 4B3ME 4LPFA 2JE6A 2HFUA 4LFBE 4OZEA 4JI8E 3WU3A 4DR2I 4FW4A 4FWGA 2VQEI 3PRYA 3J7AM 1VI7A 2A2DA 4DV2I 5BR8I 2Z5BB 2GO3A 1HNZI 2IOPA 2V8PA 1MG7A 2BM0A 4FWDA 1IBME 5DRQA 5IWAI 3K1JA 4LCHA 4WUBA 4LFAI 2NN6A 4YY3E 3P06A 2CZ9A 2NN6E 4JI6I 5FWKA 1FJGE 1Y5YA 4MU0A 2UU9I 3LNUA 4MQYA 5GMDA 4DV4E 5FLXC 4BA1A 1YHCA 4EMDA 1H7UA 4JYAI 3Q6MA 4GKKE 4LFBI 1XMQE 1OYSA 1Z0EA 4MU4A 2R3VA 1H72C 4IZJA 2CGEA 2BA0D 2VQFI 4FW3A 5C0XF 3P3GA 4WUCA 4LF9E 2UXDE 2HK2A 3QT5A 1PIEA 4JI0I 2E5LI 2UUBE 4IFDD 3B8HA 1ELOA 1MU5A 1NHHA 2GQ0A 2ZM6E 2UXCI 4FW5A 4OKGA 4IS9A 5DNXA 3U1YA 4MYTA 2JEAA 1J5EE 2NN6F 5LMUE 1I94I 5DRRA 2R42A 4DV5E 4DV5I 4RPFA 3M7NG 4WUDA 3KRNA 2F1DA 1PKPA 1WUUA 4FN5A 4IFDC 4DR3E 1UDQA 5FLXQ 4FW9A 3J80C 4GQUA 4DR1E 4DUZI 4Z7YA 4QNJA 2JEBA 1FI4A 4KHPE 2Z5BA 5C0XA 2J7KA 2JE6B 4PU9A 5C0XB 5EL9A 4DV7I 5ELWA 2WP8A 5BR8E 3PS3A 2V2ZA 1E3HA 4FW6A 1N0UA 3J81Q 1I94E 1BKNA 4BA2B 4USMA 4MDTA 1PVGA 1Z0BA 2NN6B 5JEAF 4IFDA 1XXEA 1FWKA 4MU1A 4JI7E 4OO1D 1E3PA 4HACB 2AJ4A 4FWHA
chains in the Genus database with same CATH topology
4YHHE 4GKJE 4B3MI 2PNMA 4DU7A 4I3HA 1Y4UA 3ZZTA 3ZZUA 1ZXMA 5LMNE 1N32E 1N32I 4LF9I 1IBLE 4NXMI 4B3RE 3T1YE 4K0KI 4DR7I 4URLA 4JYAE 2GS8A 3ZZ0A 1H73A 2Q2EB 4JV5E 4ZVIA 2O1TA 4X62I 3QT7A 1N34I 3V5RA 4PRVA 1HNWE 5LL6R 2ZITA 3LPSA 2F4VE 3LTOA 4LF6E 1DARA 2UUAI 1IBLI 1FWLA 1USVA 2Z5CA 3K17A 4DR6I 4X65I 1Z5AA 4DR5I 1EA6A 3QT8A 2IOQA 4IZKA 3V2UC 4JI4I 3T1YI 4JI7I 2UXBE 3CWVA 4NXME 4P7AA 2E5LE 4JI0E 4DR6E 4LFCE 4LF4E 2NPFA 4UTGA 1ZM3A 2HKJA 3K85A 2UUAE 1HK7A 1H74A 1Y4SA 4Z7CA 4DV1E 2DEJA 1Z5CA 4DV0E 4DPXA 2LJPA 4YHHI 4GKJI 1Z59A 4JI2I 4DV4I 4X64I 1Z0WA 3Q6NA 2BV3A 3JAMQ 4MYUA 2HFSA 5LMUI 1Y6ZA 1KVKA 4PRXA 1USUA 2ZBKB 4DR2E 4K0KE 3PYDA 4DR7E 3HULA 2X7IA 4DPYA 4DV6E 2V2QA 1XNQE 4KQVA 4DR4E 2UUCI 1N0VC 3ZKBA 4DV2E 2UXDI 4AQYI 4DU8A 1XNRE 1S16A 4P52A 1N36I 4JI2E 2O1WA 3WU5A 2UXCE 1Z0CA 1ZM2A 4B3RI 1NHIA 2CG9A 4LF7I 3J7AG 1KIJA 3PYEA 2UU9E 1H7SA 2OI2A 3J80Q 5LMNI 2UUCE 3OTOE 4M1KA 2VQFE 4JI1E 3PYGA 4R1FA 4DV6I 4HY1A 4DR1I 4USKA 4DV3I 5IT9C 4B3TE 4DR5E 3B82A 1N34E 3WU6A 4DUYE 4UT4A 1QZRA 2O1VA 4HXZA 4JV5I 1D6TA 2HHHI 4LF5E 1Z0TA 2WW4A 1NZ0A 3T1HE 3PYFA 3ZKDA 5IWAE 4DXLA 5A2QC 2E1RA 5A2QQ 2UUBI 2BM1A 4NXNE 4JI1I 1ZXNA 2O1UA 4HACA 4LF8E 1FNMA 3F0NA 2UXBI 4JI4E 3Q1QA 4HYMA 1MX0A 1RR9A 1RREA 2HKEA 1XMOI 4OX9I 4JI8I 1XHKA 4X65E 3T1HI 1XMOE 1N36E 3GONA 3M6AA 4JG4A 4DUYI 2VF3A 4DPWA 4XTJA 4AQYE 4JI6E 4DV3E 4LFAE 2F4VI 4YY3I 4DR4I 1HNXI 1Z0GA 2HK3A 1K47A 1HNXE 1FKAE 1IBMI 1N33E 1HNWI 2X36A 3H4LA 4X64E 4DV7E 1N33I 4B3TI 1Z5BA 2VQEE 1UEKA 1ZM4A 4KHPI 2A2CA 1A6FA 4DV0I 4JI3I 4DV1I 2XEXA 5GMEA 2V34A 4DPTA 4JI3E 1B63A 2EFGA 4N3OA 1IBKE 4IZKB 3J81C 4JI5E 2DEIA 4IZJB 1J5EI 4OX9E 5L3JA 1HR0E 5IT9Q 3B78A 3JAMC 1IBKI 1ZM9A 1KTVA 1FJGI 1OJ4A 1Z0VA 4X66E 4NXNI 3QT6A 1XNQI 3HJCA 3WU4A 4DUZE 4B3SE 4B3SI 1NHJA 1XMQI 4DR3I 4GKKI 2V2VA 2PNLA 4IZJD 4X66I 1HNZE 2HHHE 4DPUA 4LF5I 4LFCI 4X62E 1U2RA 3D4JA 1EI1A 1S4EA 3ZM7A 1HR0I 2ZM6I 2Z5CB 4JI5I 1XNRI 1VISA 3OTOI 1B62A 4LF8I 2Z5EA 4LF6I 4LF4I 4ED4A 1KKHA 4LF7E 4B3ME 2HFUA 4LFBE 4JI8E 3WU3A 4DR2I 4FWGA 2VQEI 3PRYA 3J7AM 2A2DA 4DV2I 5BR8I 2Z5BB 1HNZI 2IOPA 2V8PA 1MG7A 2BM0A 4FWDA 1IBME 5IWAI 3K1JA 4WUBA 4LFAI 4YY3E 3P06A 2CZ9A 4JI6I 5FWKA 1FJGE 2UU9I 3LNUA 5GMDA 4DV4E 5FLXC 4EMDA 1H7UA 4JYAI 3Q6MA 4GKKE 4LFBI 1XMQE 1Z0EA 2R3VA 1H72C 4IZJA 2CGEA 2VQFI 4WUCA 4LF9E 2UXDE 2HK2A 3QT5A 1PIEA 4JI0I 2E5LI 2UUBE 3B8HA 1ELOA 2GQ0A 1MU5A 1NHHA 2ZM6E 2UXCI 4MYTA 1J5EE 5LMUE 1I94I 2R42A 4DV5E 4DV5I 4RPFA 4WUDA 1PKPA 1WUUA 4FN5A 4DR3E 5FLXQ 4FW9A 3J80C 4DR1E 4DUZI 4Z7YA 1FI4A 4KHPE 2Z5BA 2J7KA 4PU9A 4DV7I 5BR8E 2V2ZA 3J81Q 1N0UA 1I94E 1BKNA 4USMA 1PVGA 1Z0BA 1FWKA 4JI7E 4HACB 2AJ4A 4FWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH E;  4GKJ E;  4B3M I;  4DU7 A;  4I3H A;  3ZZT A;  3ZZU A;  1ZXM A;  5LMN E;  1N32 E;  1N32 I;  4LF9 I;  1IBL E;  4NXM I;  4B3R E;  3T1Y E;  4K0K I;  4DR7 I;  4URL A;  4JYA E;  2GS8 A;  3ZZ0 A;  1H73 A;  2Q2E B;  4JV5 E;  4ZVI A;  4X62 I;  3QT7 A;  1N34 I;  3V5R A;  4PRV A;  1HNW E;  5LL6 R;  2ZIT A;  3LPS A;  2F4V E;  3LTO A;  4LF6 E;  1DAR A;  2UUA I;  1IBL I;  1FWL A;  3K17 A;  4DR6 I;  4X65 I;  1Z5A A;  4DR5 I;  1EA6 A;  3QT8 A;  3V2U C;  4JI4 I;  3T1Y I;  4JI7 I;  2UXB E;  3CWV A;  4NXM E;  4P7A A;  2E5L E;  4JI0 E;  4DR6 E;  4LFC E;  4LF4 E;  2NPF A;  4UTG A;  1ZM3 A;  2HKJ A;  2UUA E;  1H74 A;  4Z7C A;  4DV1 E;  2DEJ A;  1Z5C A;  4DV0 E;  4DPX A;  2LJP A;  4YHH I;  4GKJ I;  1Z59 A;  4JI2 I;  4DV4 I;  4X64 I;  1Z0W A;  2BV3 A;  3JAM Q;  4MYU A;  2HFS A;  5LMU I;  1KVK A;  4PRX A;  4DR2 E;  2ZBK B;  4K0K E;  3PYD A;  4DR7 E;  3HUL A;  2X7I A;  4DPY A;  4DV6 E;  2V2Q A;  1XNQ E;  4KQV A;  4DR4 E;  2UUC I;  1N0V C;  3ZKB A;  4DV2 E;  2UXD I;  4AQY I;  4DU8 A;  1XNR E;  1S16 A;  4P52 A;  1N36 I;  4JI2 E;  3WU5 A;  2UXC E;  1Z0C A;  1ZM2 A;  4B3R I;  1NHI A;  4LF7 I;  3J7A G;  1KIJ A;  3PYE A;  2UU9 E;  1H7S A;  2OI2 A;  3J80 Q;  5LMN I;  2UUC E;  3OTO E;  4M1K A;  2VQF E;  4JI1 E;  3PYG A;  4R1F A;  4DV6 I;  4HY1 A;  4DR1 I;  4USK A;  4DV3 I;  5IT9 C;  4B3T E;  4DR5 E;  3B82 A;  1N34 E;  3WU6 A;  4DUY E;  4UT4 A;  1QZR A;  4HXZ A;  1D6T A;  4JV5 I;  2HHH I;  4LF5 E;  1Z0T A;  2WW4 A;  1NZ0 A;  3T1H E;  3PYF A;  3ZKD A;  5IWA E;  4DXL A;  5A2Q C;  2E1R A;  5A2Q Q;  2UUB I;  2BM1 A;  4NXN E;  4JI1 I;  1ZXN A;  4LF8 E;  4HAC A;  1FNM A;  3F0N A;  2UXB I;  4JI4 E;  3Q1Q A;  4HYM A;  1MX0 A;  1RR9 A;  1RRE A;  2HKE A;  1XMO I;  4OX9 I;  4JI8 I;  1XHK A;  4X65 E;  3T1H I;  1XMO E;  1N36 E;  3GON A;  3M6A A;  4JG4 A;  4DUY I;  2VF3 A;  4DPW A;  4XTJ A;  4AQY E;  4JI6 E;  4DV3 E;  4LFA E;  2F4V I;  4YY3 I;  4DR4 I;  1HNX I;  1Z0G A;  2HK3 A;  1K47 A;  1HNX E;  1FKA E;  1IBM I;  1N33 E;  1HNW I;  2X36 A;  3H4L A;  4X64 E;  4DV7 E;  1N33 I;  4B3T I;  1Z5B A;  2VQE E;  1UEK A;  1ZM4 A;  4KHP I;  2A2C A;  1A6F A;  4DV0 I;  4JI3 I;  4DV1 I;  2XEX A;  5GME A;  2V34 A;  4DPT A;  4JI3 E;  1B63 A;  2EFG A;  1IBK E;  3J81 C;  4JI5 E;  2DEI A;  1J5E I;  4OX9 E;  5L3J A;  1HR0 E;  5IT9 Q;  3B78 A;  3JAM C;  1IBK I;  1ZM9 A;  1KTV A;  1FJG I;  1OJ4 A;  1Z0V A;  4X66 E;  4NXN I;  3QT6 A;  1XNQ I;  3WU4 A;  4DUZ E;  4B3S E;  4B3S I;  1NHJ A;  1XMQ I;  4DR3 I;  4GKK I;  2V2V A;  4X66 I;  1HNZ E;  4LF5 I;  4DPU A;  2HHH E;  4LFC I;  4X62 E;  1U2R A;  3D4J A;  1EI1 A;  1S4E A;  3ZM7 A;  1HR0 I;  2ZM6 I;  4JI5 I;  1XNR I;  1VIS A;  3OTO I;  1B62 A;  4LF8 I;  4LF6 I;  4LF4 I;  4ED4 A;  1KKH A;  4LF7 E;  4B3M E;  2HFU A;  4LFB E;  4JI8 E;  3WU3 A;  4DR2 I;  4FWG A;  2VQE I;  3J7A M;  2A2D A;  4DV2 I;  5BR8 I;  1HNZ I;  2V8P A;  1MG7 A;  2BM0 A;  4FWD A;  1IBM E;  5IWA I;  3K1J A;  4WUB A;  4LFA I;  4YY3 E;  2CZ9 A;  4JI6 I;  1FJG E;  2UU9 I;  3LNU A;  5GMD A;  4DV4 E;  5FLX C;  4EMD A;  1H7U A;  4JYA I;  4GKK E;  4LFB I;  1XMQ E;  1Z0E A;  2R3V A;  1H72 C;  2VQF I;  4WUC A;  4LF9 E;  2UXD E;  2HK2 A;  3QT5 A;  1PIE A;  4JI0 I;  2E5L I;  2UUB E;  3B8H A;  1ELO A;  1MU5 A;  1NHH A;  2ZM6 E;  2UXC I;  4MYT A;  1J5E E;  5LMU E;  1I94 I;  2R42 A;  4DV5 E;  4DV5 I;  4RPF A;  4WUD A;  1PKP A;  1WUU A;  4FN5 A;  4DR3 E;  5FLX Q;  4FW9 A;  3J80 C;  4DR1 E;  4DUZ I;  4Z7Y A;  1FI4 A;  4KHP E;  2J7K A;  4PU9 A;  4DV7 I;  5BR8 E;  2V2Z A;  3J81 Q;  1N0U A;  1I94 E;  1BKN A;  4USM A;  1PVG A;  1Z0B A;  1FWK A;  4JI7 E;  4HAC B;  2AJ4 A;  4FWH A; 
#chains in the Genus database with same CATH topology
 4YHH E;  3GME A;  2JT2 A;  4GKJ E;  4B3M I;  2PNM A;  4DU7 A;  4I3H A;  5C0X C;  1Y4U A;  3ZZT A;  3ZZU A;  3CDJ A;  3U1K A;  2JEA B;  1ZXM A;  5LMN E;  1N32 E;  1N32 I;  4LF9 I;  1IBL E;  4NXM I;  4B3R E;  3T1Y E;  4K0K I;  4DR7 I;  4URL A;  4JYA E;  2GS8 A;  4LOM A;  5C0X D;  3ZZ0 A;  1H73 A;  2Q2E B;  4JV5 E;  4ZVI A;  2O1T A;  4X62 I;  2PO2 B;  3QT7 A;  2BA1 G;  1N34 I;  4IFD F;  3V5R A;  2C37 B;  4AM3 A;  4PRV A;  1HNW E;  5K36 B;  5LL6 R;  2ZIT A;  3H1C A;  3LPS A;  2F4V E;  2NN6 C;  3LTO A;  4LF6 E;  1DAR A;  2UUA I;  1IBL I;  1FWL A;  2VES A;  1USV A;  2Z5C A;  3K17 A;  4DR6 I;  4X65 I;  4IFD E;  5JEA A;  1Z5A A;  4DR5 I;  1EA6 A;  3QT8 A;  3P76 A;  2IOQ A;  4IZK A;  3V2U C;  4JI4 I;  3T1Y I;  4JI7 I;  3L7Z B;  2UXB E;  3CWV A;  4NXM E;  4P7A A;  2E5L E;  4JI0 E;  4DR6 E;  4LFC E;  4LF4 E;  2NPF A;  4UTG A;  1ZM3 A;  2HKJ A;  3K85 A;  2UUA E;  5JEA D;  1HK7 A;  1H74 A;  1Y4S A;  4Z7C A;  4DV1 E;  2DEJ A;  1Z5C A;  4OO1 A;  4OO1 F;  4DV0 E;  4DPX A;  2LJP A;  4YHH I;  4GKJ I;  1Z59 A;  4JI2 I;  4J3D A;  4DV4 I;  3GCM A;  4X64 I;  1UDO A;  3CDI A;  1Z0W A;  1Y60 A;  3Q6N A;  2BV3 A;  3JAM Q;  4MYU A;  2HFS A;  5JEA E;  1R6L A;  5LMU I;  1Y6Z A;  1KVK A;  4PRX A;  1USU A;  2ZBK B;  4DR2 E;  4K0K E;  3PYD A;  4OO1 E;  4DR7 E;  3HUL A;  4LCG A;  2X7I A;  4DPY A;  4DV6 E;  4U3B A;  2V2Q A;  5C0X E;  1XNQ E;  4KQV A;  4FW7 A;  2UUC I;  3HKM A;  4DR4 E;  1N0V C;  2WNR A;  3ZKB A;  5DRP A;  4DV2 E;  2UXD I;  2BR2 B;  4AQY I;  4DU8 A;  2BA0 G;  5JEA C;  4BA2 A;  1XNR E;  2O3Z A;  1S16 A;  2WP8 B;  4P52 A;  1N36 I;  4JI2 E;  2O1W A;  3WU5 A;  2UXC E;  1Z0C A;  1ZM2 A;  4B3R I;  1NHI A;  2C38 B;  3PS1 A;  2CG9 A;  4LF7 I;  3J7A G;  1KIJ A;  3PYE A;  2UU9 E;  1H7S A;  2OI2 A;  3J80 Q;  5LMN I;  2UUC E;  4OO1 B;  3OTO E;  1P42 A;  4M1K A;  2C37 A;  4AIM A;  2VQF E;  4JI1 E;  3M7N D;  3PYG A;  4R1F A;  4DV6 I;  4HY1 A;  4DR1 I;  5K36 D;  4USK A;  4DV3 I;  5IT9 C;  4B3T E;  4DR5 E;  2C39 A;  3B82 A;  1N34 E;  2PO0 B;  2PNZ B;  3WU6 A;  4UT4 A;  4DUY E;  1QZR A;  2O1V A;  4HXZ A;  4JV5 I;  1D6T A;  2HHH I;  4LF5 E;  1Z0T A;  2WW4 A;  1NZ0 A;  3T1H E;  2C38 A;  3PYF A;  3P3E A;  3ZKD A;  3PS2 A;  5IWA E;  4LCF A;  4DXL A;  3NZK A;  5A2Q C;  2E1R A;  4AID A;  2PO1 A;  5A2Q Q;  2UUB I;  2BM1 A;  4NXN E;  4JI1 I;  1ZXN A;  2O1U A;  4HAC A;  4LF8 E;  2PNZ A;  1FNM A;  2WNR B;  3F0N A;  4IFD B;  2PO2 A;  2UXB I;  4JI4 E;  3Q1Q A;  4HYM A;  1MX0 A;  1RR9 A;  1RRE A;  2HKE A;  1XMO I;  4OX9 I;  4JI8 I;  1XHK A;  4X65 E;  3T1H I;  1XMO E;  1N36 E;  3GON A;  3UHM A;  5JEA B;  3M6A A;  4JG4 A;  4DUY I;  5K36 C;  2VF3 A;  4DPW A;  4XTJ A;  4AQY E;  4JI6 E;  5K36 E;  4DV3 E;  4LFA E;  2F4V I;  3L7Z A;  4YY3 I;  4DR4 I;  1HNX I;  4QNK A;  1Z0G A;  2HK3 A;  1K47 A;  3GLL A;  2BA1 D;  1HNX E;  1FKA E;  1IBM I;  4U3D A;  5DRO A;  1N33 E;  1HNW I;  1UDN A;  2X36 A;  2BR2 A;  3H4L A;  4BA1 B;  2C39 B;  4X64 E;  4DV7 E;  1N33 I;  4B3T I;  1Z5B A;  2VQE E;  1UEK A;  5K36 F;  1ZM4 A;  4KHP I;  5DNL A;  2A2C A;  2AE8 A;  1YH8 A;  1A6F A;  1RHY A;  2GO4 A;  4DV0 I;  4MU3 A;  4JI3 I;  4DV1 I;  2J65 A;  2XEX A;  5GME A;  2PO1 B;  2V34 A;  4NBQ A;  4DPT A;  4JI3 E;  1B63 A;  2EFG A;  4N3O A;  1IBK E;  4IZK B;  3J81 C;  4JI5 E;  2DEI A;  1OYR A;  2JEB B;  4IZJ B;  3M85 D;  1J5E I;  4OX9 E;  5L3J A;  1HR0 E;  5IT9 Q;  3B78 A;  3JAM C;  1IBK I;  2PO0 A;  1ZM9 A;  2CVE A;  1KTV A;  1FJG I;  1OJ4 A;  1Z0V A;  3B4T A;  4X66 E;  3M85 G;  4NXN I;  3QT6 A;  1XNQ I;  1R6M A;  3HJC A;  3WU4 A;  4DUZ E;  4B3S E;  4B3S I;  1NHJ A;  1UDS A;  1XMQ I;  4DR3 I;  2IER A;  4GKK I;  2V2V A;  2PNL A;  4IZJ D;  4X66 I;  1HNZ E;  1OYP A;  3P3C A;  2HHH E;  4DPU A;  4LF5 I;  4LFC I;  4X62 E;  1U2R A;  3D4J A;  1EI1 A;  2IES A;  3DD6 A;  1S4E A;  3ZM7 A;  1HR0 I;  2ZM6 I;  5K36 A;  2Z5C B;  4JI5 I;  1XNR I;  5EKW A;  1VIS A;  2NN6 D;  3OTO I;  4ISA A;  1B62 A;  4LF8 I;  2Z5E A;  4LF6 I;  4LF4 I;  4ED4 A;  1KKH A;  4LF7 E;  4OO1 C;  4B3M E;  4LPF A;  2JE6 A;  2HFU A;  4LFB E;  4OZE A;  4JI8 E;  3WU3 A;  4DR2 I;  4FW4 A;  4FWG A;  2VQE I;  3PRY A;  3J7A M;  1VI7 A;  2A2D A;  4DV2 I;  5BR8 I;  2Z5B B;  2GO3 A;  1HNZ I;  2IOP A;  2V8P A;  1MG7 A;  2BM0 A;  4FWD A;  1IBM E;  5DRQ A;  5IWA I;  3K1J A;  4LCH A;  4WUB A;  4LFA I;  2NN6 A;  4YY3 E;  3P06 A;  2CZ9 A;  2NN6 E;  4JI6 I;  5FWK A;  1FJG E;  1Y5Y A;  4MU0 A;  2UU9 I;  3LNU A;  4MQY A;  5GMD A;  4DV4 E;  5FLX C;  4BA1 A;  1YHC A;  4EMD A;  1H7U A;  4JYA I;  3Q6M A;  4GKK E;  4LFB I;  1XMQ E;  1OYS A;  1Z0E A;  4MU4 A;  2R3V A;  1H72 C;  4IZJ A;  2CGE A;  2BA0 D;  2VQF I;  4FW3 A;  5C0X F;  3P3G A;  4WUC A;  4LF9 E;  2UXD E;  2HK2 A;  3QT5 A;  1PIE A;  4JI0 I;  2E5L I;  2UUB E;  4IFD D;  3B8H A;  1ELO A;  1MU5 A;  1NHH A;  2GQ0 A;  2ZM6 E;  2UXC I;  4FW5 A;  4OKG A;  4IS9 A;  5DNX A;  3U1Y A;  4MYT A;  2JEA A;  1J5E E;  2NN6 F;  5LMU E;  1I94 I;  5DRR A;  2R42 A;  4DV5 E;  4DV5 I;  4RPF A;  3M7N G;  4WUD A;  3KRN A;  2F1D A;  1PKP A;  1WUU A;  4FN5 A;  4IFD C;  4DR3 E;  1UDQ A;  5FLX Q;  4FW9 A;  3J80 C;  4GQU A;  4DR1 E;  4DUZ I;  4Z7Y A;  4QNJ A;  2JEB A;  1FI4 A;  4KHP E;  2Z5B A;  5C0X A;  2J7K A;  2JE6 B;  4PU9 A;  5C0X B;  5EL9 A;  4DV7 I;  5ELW A;  2WP8 A;  5BR8 E;  3PS3 A;  2V2Z A;  1E3H A;  4FW6 A;  1N0U A;  3J81 Q;  1I94 E;  1BKN A;  4BA2 B;  4USM A;  4MDT A;  1PVG A;  1Z0B A;  2NN6 B;  5JEA F;  4IFD A;  1XXE A;  1FWK A;  4MU1 A;  4JI7 E;  4OO1 D;  1E3P A;  4HAC B;  2AJ4 A;  4FWH A; 
#chains in the Genus database with same CATH homology
 4YHH E;  4GKJ E;  4B3M I;  2PNM A;  4DU7 A;  4I3H A;  1Y4U A;  3ZZT A;  3ZZU A;  1ZXM A;  5LMN E;  1N32 E;  1N32 I;  4LF9 I;  1IBL E;  4NXM I;  4B3R E;  3T1Y E;  4K0K I;  4DR7 I;  4URL A;  4JYA E;  2GS8 A;  3ZZ0 A;  1H73 A;  2Q2E B;  4JV5 E;  4ZVI A;  2O1T A;  4X62 I;  3QT7 A;  1N34 I;  3V5R A;  4PRV A;  1HNW E;  5LL6 R;  2ZIT A;  3LPS A;  2F4V E;  3LTO A;  4LF6 E;  1DAR A;  2UUA I;  1IBL I;  1FWL A;  1USV A;  2Z5C A;  3K17 A;  4DR6 I;  4X65 I;  1Z5A A;  4DR5 I;  1EA6 A;  3QT8 A;  2IOQ A;  4IZK A;  3V2U C;  4JI4 I;  3T1Y I;  4JI7 I;  2UXB E;  3CWV A;  4NXM E;  4P7A A;  2E5L E;  4JI0 E;  4DR6 E;  4LFC E;  4LF4 E;  2NPF A;  4UTG A;  1ZM3 A;  2HKJ A;  3K85 A;  2UUA E;  1HK7 A;  1H74 A;  1Y4S A;  4Z7C A;  4DV1 E;  2DEJ A;  1Z5C A;  4DV0 E;  4DPX A;  2LJP A;  4YHH I;  4GKJ I;  1Z59 A;  4JI2 I;  4DV4 I;  4X64 I;  1Z0W A;  3Q6N A;  2BV3 A;  3JAM Q;  4MYU A;  2HFS A;  5LMU I;  1Y6Z A;  1KVK A;  4PRX A;  1USU A;  2ZBK B;  4DR2 E;  4K0K E;  3PYD A;  4DR7 E;  3HUL A;  2X7I A;  4DPY A;  4DV6 E;  2V2Q A;  1XNQ E;  4KQV A;  4DR4 E;  2UUC I;  1N0V C;  3ZKB A;  4DV2 E;  2UXD I;  4AQY I;  4DU8 A;  1XNR E;  1S16 A;  4P52 A;  1N36 I;  4JI2 E;  2O1W A;  3WU5 A;  2UXC E;  1Z0C A;  1ZM2 A;  4B3R I;  1NHI A;  2CG9 A;  4LF7 I;  3J7A G;  1KIJ A;  3PYE A;  2UU9 E;  1H7S A;  2OI2 A;  3J80 Q;  5LMN I;  2UUC E;  3OTO E;  4M1K A;  2VQF E;  4JI1 E;  3PYG A;  4R1F A;  4DV6 I;  4HY1 A;  4DR1 I;  4USK A;  4DV3 I;  5IT9 C;  4B3T E;  4DR5 E;  3B82 A;  1N34 E;  3WU6 A;  4DUY E;  4UT4 A;  1QZR A;  2O1V A;  4HXZ A;  4JV5 I;  1D6T A;  2HHH I;  4LF5 E;  1Z0T A;  2WW4 A;  1NZ0 A;  3T1H E;  3PYF A;  3ZKD A;  5IWA E;  4DXL A;  5A2Q C;  2E1R A;  5A2Q Q;  2UUB I;  2BM1 A;  4NXN E;  4JI1 I;  1ZXN A;  2O1U A;  4HAC A;  4LF8 E;  1FNM A;  3F0N A;  2UXB I;  4JI4 E;  3Q1Q A;  4HYM A;  1MX0 A;  1RR9 A;  1RRE A;  2HKE A;  1XMO I;  4OX9 I;  4JI8 I;  1XHK A;  4X65 E;  3T1H I;  1XMO E;  1N36 E;  3GON A;  3M6A A;  4JG4 A;  4DUY I;  2VF3 A;  4DPW A;  4XTJ A;  4AQY E;  4JI6 E;  4DV3 E;  4LFA E;  2F4V I;  4YY3 I;  4DR4 I;  1HNX I;  1Z0G A;  2HK3 A;  1K47 A;  1HNX E;  1FKA E;  1IBM I;  1N33 E;  1HNW I;  2X36 A;  3H4L A;  4X64 E;  4DV7 E;  1N33 I;  4B3T I;  1Z5B A;  2VQE E;  1UEK A;  1ZM4 A;  4KHP I;  2A2C A;  1A6F A;  4DV0 I;  4JI3 I;  4DV1 I;  2XEX A;  5GME A;  2V34 A;  4DPT A;  4JI3 E;  1B63 A;  2EFG A;  4N3O A;  1IBK E;  4IZK B;  3J81 C;  4JI5 E;  2DEI A;  4IZJ B;  1J5E I;  4OX9 E;  5L3J A;  1HR0 E;  5IT9 Q;  3B78 A;  3JAM C;  1IBK I;  1ZM9 A;  1KTV A;  1FJG I;  1OJ4 A;  1Z0V A;  4X66 E;  4NXN I;  3QT6 A;  1XNQ I;  3HJC A;  3WU4 A;  4DUZ E;  4B3S E;  4B3S I;  1NHJ A;  1XMQ I;  4DR3 I;  4GKK I;  2V2V A;  2PNL A;  4IZJ D;  4X66 I;  1HNZ E;  2HHH E;  4DPU A;  4LF5 I;  4LFC I;  4X62 E;  1U2R A;  3D4J A;  1EI1 A;  1S4E A;  3ZM7 A;  1HR0 I;  2ZM6 I;  2Z5C B;  4JI5 I;  1XNR I;  1VIS A;  3OTO I;  1B62 A;  4LF8 I;  2Z5E A;  4LF6 I;  4LF4 I;  4ED4 A;  1KKH A;  4LF7 E;  4B3M E;  2HFU A;  4LFB E;  4JI8 E;  3WU3 A;  4DR2 I;  4FWG A;  2VQE I;  3PRY A;  3J7A M;  2A2D A;  4DV2 I;  5BR8 I;  2Z5B B;  1HNZ I;  2IOP A;  2V8P A;  1MG7 A;  2BM0 A;  4FWD A;  1IBM E;  5IWA I;  3K1J A;  4WUB A;  4LFA I;  4YY3 E;  3P06 A;  2CZ9 A;  4JI6 I;  5FWK A;  1FJG E;  2UU9 I;  3LNU A;  5GMD A;  4DV4 E;  5FLX C;  4EMD A;  1H7U A;  4JYA I;  3Q6M A;  4GKK E;  4LFB I;  1XMQ E;  1Z0E A;  2R3V A;  1H72 C;  4IZJ A;  2CGE A;  2VQF I;  4WUC A;  4LF9 E;  2UXD E;  2HK2 A;  3QT5 A;  1PIE A;  4JI0 I;  2E5L I;  2UUB E;  3B8H A;  1ELO A;  2GQ0 A;  1MU5 A;  1NHH A;  2ZM6 E;  2UXC I;  4MYT A;  1J5E E;  5LMU E;  1I94 I;  2R42 A;  4DV5 E;  4DV5 I;  4RPF A;  4WUD A;  1PKP A;  1WUU A;  4FN5 A;  4DR3 E;  5FLX Q;  4FW9 A;  3J80 C;  4DR1 E;  4DUZ I;  4Z7Y A;  1FI4 A;  4KHP E;  2Z5B A;  2J7K A;  4PU9 A;  4DV7 I;  5BR8 E;  2V2Z A;  3J81 Q;  1N0U A;  1I94 E;  1BKN A;  4USM A;  1PVG A;  1Z0B A;  1FWK A;  4JI7 E;  4HAC B;  2AJ4 A;  4FWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...