5BR8I

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5br8I00
3LNUA 4B3TE 2HHHE 1U2RA 4JI4I 1NHJA 4DR2E 2DEJA 4B3TI 4PU9A 2HHHI 4X66E 4JG4A 1ZM9A 4X66I 4JI0E 4JI3E 2UUCE 1S16A 4GKKE 1J5EE 1H73A 4DV6E 4USMA 2GS8A 4NXMI 4JI3I 2UUCI 4GKKI 2UU9E 1J5EI 4JYAE 2WW4A 1NHHA 4DV0E 2V2QA 2UU9I 3ZKDA 4JYAI 4DV3E 1VISA 1KTVA 4DV0I 4DV7E 3M6AA 4DV3I 4DV7I 2BM1A 1H74A 1FNMA 1BKNA 4B3ME 4DPUA 2UXDI 1ZM3A 4FW9A 4DXLA 1XNRE 4LF9E 4B3MI 1Z5AA 2X36A 4LF9I 2OI2A 2V2VA 4NXNI 1Z0BA 3B82A 1XHKA 2VQFE 5LL6R 5GMDA 4JI7E 1RREA 1PVGA 2LJPA 4DV2E 3WU5A 1B63A 4JI7I 3LPSA 2E1RA 4DR4E 4DV5E 4MYUA 1S4EA 3J81Q 3T1YE 4HXZA 4DR4I 4DV5I 1OJ4A 3D4JA 1A6FA 4KQVA 3T1YI 1XMQI 5L3JA 1Z59A 4WUBA 3QT5A 1KKHA 3J81C 4DR6E 1NHIA 4LFAE 4ED4A 4JV5I 3ZM7A 1MU5A 4JI8E 1EA6A 2UUBE 3ZZUA 3LTOA 3QT8A 1XMOE 4JI5E 4JI8I 2ZBKB 2UUBI 4B3RE 2HFUA 4LF4E 2UXCE 4DR1E 4DR2I 1XMOI 3K1JA 4JI5I 3GONA 4P52A 2UXBE 4LF4I 2UXCI 1HNXE 1FKAE 2UXBI 2E5LE 4B3SE 2R3VA 2DEIA 4HACA 4JI0I 1N0UA 1FWLA 1HNXI 4DV6I 4PRVA 4K0KE 1ZXNA 4B3SI 1DARA 1FJGE 5GMEA 4K0KI 4GKJE 4URLA 4HACB 1FJGI 5A2QQ 4FN5A 4GKJI 4DR7E 1MG7A 4DUYE 4WUCA 1WUUA 2HKJA 1XNQE 4DR7I 4DUYI 3J7AM 4DUZE 1Z0EA 4EMDA 4JI1E 1XNRI 5A2QC 1Z0WA 4R1FA 2BM0A 4DUZI 1ZM2A 4AQYE 5IWAE 1KIJA 2HK3A 3ZKBA 4UTGA 1H7UA 1QZRA 3V5RA 3WU4A 2HFSA 3Q1QA 1UEKA 2UUAE 1I94E 4DPYA 4AQYI 2BV3A 4LF6E 1H7SA 4X64E 2CZ9A 2VQFI 4Z7YA 2UUAI 1I94I 2EFGA 4LF6I 5BR8E 5LMNE 4X64I 1Z0GA 3PYEA 3PYDA 4DV2I 4HYMA 2NPFA 5BR8I 1IBLE 5LMNI 2J7KA 1PIEA 4USKA 4JI6E 4I3HA 3J7AG 3ZZ0A 2VQEE 3ZZTA 4HY1A 4X65E 2VQEI 1N33E 4X65I 3B78A 5FLXC 4PRXA 4LF5E 2F4VE 1ZM4A 4FWGA 1N33I 1RR9A 4DR6I 1ZXMA 4LFAI 4LF5I 2F4VI 3H4LA 4UT4A 1H72C 1K47A 4RPFA 4M1KA 4WUDA 3OTOE 4JI4E 1N36E 1HNZE 4B3RI 1N32E 4DR1I 2VF3A 3B8HA 3OTOI 1N36I 1HNZI 3JAMC 1IBME 1Z5CA 1N32I 4LF8E 2E5LI 1Z0VA 1IBMI 4DR3E 2AJ4A 4XTJA 2HK2A 1PKPA 4LF8I 1HNWE 4NXME 3CWVA 4DPWA 4DR3I 1Z5BA 4KHPE 4JI2E 3PYFA 1HNWI 3V2UC 2X7IA 4KHPI 4JI2I 3QT6A 1B62A 4LFBE 3WU3A 4FWHA 4DPXA 4LFBI 1XNQI 1Z0CA 4DU8A 2V2ZA 2UXDE 1D6TA 4DR5E 1N0VC 1NZ0A 3HULA 4JI1I 2Q2EB 4DPTA 5IT9Q 2ZITA 4YHHE 1MX0A 1EI1A 4DR5I 5IWAI 5LMUE 2V34A 2R42A 4YHHI 2V8PA 3K17A 3QT7A 3T1HE 4MYTA 4NXNE 1N34E 4X62E 5LMUI 1HR0E 2HKEA 4YY3E 4LFCE 1Z0TA 5IT9C 4OX9E 3T1HI 4FWDA 1N34I 4X62I 4LF7E 1HR0I 3PYGA 4YY3I 4LFCI 5FLXQ 4OX9I 2ZM6E 1IBKE 4LF7I 3WU6A 1IBLI 4DV1E 2ZM6I 4JI6I 1IBKI 2XEXA 3F0NA 3J80Q 4DV1I 1KVKA 4Z7CA 1XMQE 4ZVIA 1ELOA 3J80C 1FI4A 4DV4E 1FWKA 3JAMQ 4JV5E 2A2DA 2A2CA 4DV4I 4P7AA 4DU7A
chains in the Genus database with same CATH superfamily
3LNUA 4B3TE 2HHHE 1U2RA 4JI4I 1UDOA 2NN6D 1NHJA 1R6LA 4DR2E 2NN6E 2JEAA 2DEJA 2PO2A 4B3TI 4PU9A 3U1KA 4X66E 2HHHI 4MU3A 5EKWA 2JEBB 4JG4A 2JE6A 1ZM9A 4X66I 3H1CA 4JI0E 1Y60A 2CG9A 3GLLA 4U3BA 2UUCE 4JI3E 1S16A 4GKKE 2Z5BA 2JEAB 1J5EE 1H73A 4DV6E 2Z5EA 4USMA 2GS8A 4NXMI 5DRPA 4JI3I 2UUCI 3PS3A 2UU9E 4GKKI 4FW7A 1J5EI 4JYAE 2WW4A 2PO0B 1NHHA 4DV0E 2V2QA 3KRNA 2O3ZA 2UU9I 3ZKDA 4JYAI 4BA1A 4DV3E 1VISA 1KTVA 4DV0I 2CVEA 4DV7E 3M6AA 4MQYA 5C0XB 4DV3I 2BR2A 4DV7I 2BM1A 2GQ0A 1H74A 1FNMA 1BKNA 4B3ME 4DPUA 2UXDI 4IZJD 1ZM3A 4FW9A 4OO1A 4DXLA 1XNRE 4BA1B 4LF9E 2GO3A 4B3MI 2WNRA 1Z5AA 2X36A 4OKGA 2BR2B 4LF9I 4AM3A 2OI2A 2BA0G 2J65A 2V2VA 4NXNI 1R6MA 1Z0BA 3B82A 4OO1B 1XHKA 2VQFE 5LL6R 5GMDA 4JI7E 1RREA 1PVGA 2LJPA 3PRYA 4DV2E 3WU5A 3P3CA 1B63A 4JI7I 3LPSA 2E1RA 4MDTA 2C39B 2IOQA 3U1YA 4DR4E 4IZKA 3P3EA 4DV5E 4IFDA 4MYUA 4BA2B 1S4EA 3J81Q 4QNKA 3T1YE 4HXZA 4DR4I 4DV5I 1OJ4A 4FW6A 2PNMA 3D4JA 1A6FA 1OYSA 4KQVA 3T1YI 3P06A 4MU1A 1XMQI 5L3JA 3K85A 1Z59A 4WUBA 4IFDF 3P3GA 3QT5A 4IZKB 5K36A 1KKHA 3PS1A 1Y5YA 3J81C 4DR6E 1NHIA 3P76A 2O1TA 2WP8B 4LFAE 4ED4A 4JV5I 4MU4A 3ZM7A 1MU5A 4JI8E 1EA6A 2UUBE 3ZZUA 5K36B 3LTOA 3QT8A 1XMOE 2JT2A 3M85D 5ELWA 4JI5E 4JI8I 2ZBKB 2UUBI 4B3RE 2HFUA 4LF4E 3CDIA 4DR1E 2UXCE 4DR2I 1XMOI 2PO0A 3K1JA 4JI5I 3GONA 4P52A 2UXBE 4LF4I 2UXCI 2IOPA 5DROA 1HNXE 1FKAE 2UXBI 2E5LE 4B3SE 2R3VA 2DEIA 4HACA 4JI0I 5C0XA 4NBQA 2VESA 1N0UA 1FWLA 1HNXI 4DV6I 4PRVA 4K0KE 1ZXNA 4B3SI 1DARA 1FJGE 3M7ND 5GMEA 4K0KI 4GKJE 4URLA 1USUA 5C0XF 4HACB 1FJGI 5A2QQ 2IESA 2O1UA 4FN5A 4GKJI 4DR7E 4FW3A 1MG7A 4DUYE 4WUCA 1WUUA 2HKJA 1UDSA 1XNQE 4DR7I 5DRRA 4DUYI 3J7AM 4DUZE 1Z0EA 4EMDA 4JI1E 1XNRI 5A2QC 1Z0WA 4R1FA 2BM0A 1ZM2A 4DUZI 4AQYE 5IWAE 1E3HA 2HK3A 1KIJA 3ZKBA 4UTGA 4OO1F 2C39A 1H7UA 1QZRA 3V5RA 3WU4A 4BA2A 1USVA 2HFSA 3Q1QA 1UEKA 2UUAE 1I94E 4DPYA 4AQYI 3HJCA 2BV3A 4LF6E 1VI7A 1H7SA 5EL9A 4X64E 1UDNA 2CGEA 2CZ9A 2VQFI 4Z7YA 3PS2A 1I94I 2UUAI 2EFGA 5JEAA 4LF6I 4OO1C 5BR8E 2IERA 5LMNE 4X64I 1Z0GA 3PYEA 3PYDA 4DV2I 3HKMA 4HYMA 4OO1D 4LCGA 4J3DA 2NPFA 5BR8I 1IBLE 4OO1E 5LMNI 2J7KA 1PIEA 2WP8A 4USKA 4JI6E 4I3HA 3J7AG 3ZZ0A 2VQEE 5JEAB 3ZZTA 1RHYA 4HY1A 4X65E 2BA0D 3CDJA 2NN6A 1OYPA 2VQEI 3M85G 1N33E 4X65I 3B78A 5FLXC 4PRXA 4LF5E 2F4VE 1ZM4A 4LCHA 4FWGA 3NZKA 1N33I 1RR9A 4DR6I 4IFDC 5FWKA 2PO1B 5K36F 3DD6A 1ZXMA 4LFAI 4LF5I 2F4VI 2NN6B 3H4LA 2O1VA 4UT4A 4IFDD 1HK7A 1H72C 1K47A 4IFDE 4RPFA 4GQUA 4M1KA 5DNLA 4WUDA 3L7ZA 5K36C 3OTOE 4JI4E 3GMEA 4N3OA 1N36E 1HNZE 4B3RI 1YH8A 3M7NG 1N32E 3Q6MA 4DR1I 2VF3A 2BA1D 3B8HA 5K36D 3OTOI 1YHCA 1N36I 1HNZI 5K36E 3JAMC 1IBME 1Z5CA 1XXEA 2PNLA 1N32I 4LF8E 2PNZA 3L7ZB 1Z0VA 2E5LI 1Y4SA 1IBMI 4DR3E 2AJ4A 4XTJA 2HK2A 1PKPA 4LF8I 4IZJA 1HNWE 4NXME 3CWVA 4DPWA 4DR3I 1Z5BA 4KHPE 1UDQA 4JI2E 3PYFA 4AIMA 2PO2B 3GCMA 1HNWI 3V2UC 2X7IA 4QNJA 4LCFA 2PNZB 4KHPI 2JE6B 4JI2I 3QT6A 1B62A 4LFBE 3WU3A 4FWHA 4IZJB 3Q6NA 5C0XC 2Z5BB 4DPXA 4LFBI 1XNQI 1Z0CA 4MU0A 4DU8A 2V2ZA 5DRQA 5C0XD 2UXDE 1D6TA 5C0XE 4DR5E 1N0VC 1NZ0A 3HULA 4JI1I 2Q2EB 4AIDA 4DPTA 5IT9Q 2ZITA 4IS9A 4YHHE 2GO4A 3B4TA 1MX0A 1EI1A 4DR5I 5IWAI 4LOMA 5LMUE 2V34A 2R42A 4YHHI 2V8PA 4ISAA 3K17A 3QT7A 3T1HE 4MYTA 4NXNE 1N34E 4X62E 5LMUI 1HR0E 2HKEA 4YY3E 4LFCE 1Z0TA 2C37A 5IT9C 4OX9E 3T1HI 4FWDA 1N34I 4X62I 4LF7E 1HR0I 3PYGA 4YY3I 4LFCI 2Z5CA 5FLXQ 4OX9I 2ZM6E 2WNRB 1IBKE 3UHMA 4LF7I 5JEAF 3WU6A 1IBLI 1Y4UA 4DV1E 4OZEA 1P42A 2C38A 2F1DA 2PO1A 2ZM6I 2C37B 4JI6I 1IBKI 2XEXA 3F0NA 3J80Q 4DV1I 1KVKA 2Z5CB 5JEAC 4Z7CA 1OYRA 4FW5A 1XMQE 4ZVIA 2AE8A 1E3PA 1ELOA 4U3DA 2C38B 2O1WA 5JEAD 2BA1G 2NN6F 5JEAE 4LPFA 3J80C 4FW4A 1FI4A 4DV4E 1FWKA 4IFDB 3JAMQ 1Y6ZA 4JV5E 2A2DA 2A2CA 5DNXA 4DV4I 2JEBA 4P7AA 2NN6C 4DU7A
chains in the Genus database with same CATH topology
3LNUA 4B3TE 2HHHE 1U2RA 4JI4I 1NHJA 4DR2E 2DEJA 4B3TI 4PU9A 2HHHI 4X66E 4JG4A 1ZM9A 4X66I 4JI0E 2CG9A 4JI3E 2UUCE 1S16A 4GKKE 2Z5BA 1J5EE 1H73A 4DV6E 2Z5EA 4USMA 2GS8A 4NXMI 4JI3I 2UUCI 4GKKI 2UU9E 1J5EI 4JYAE 2WW4A 1NHHA 4DV0E 2V2QA 2UU9I 3ZKDA 4JYAI 4DV3E 1VISA 1KTVA 4DV0I 4DV7E 3M6AA 4DV3I 4DV7I 2BM1A 2GQ0A 1H74A 1FNMA 1BKNA 4B3ME 4DPUA 2UXDI 4IZJD 1ZM3A 4FW9A 4DXLA 1XNRE 4LF9E 4B3MI 1Z5AA 2X36A 4LF9I 2OI2A 2V2VA 4NXNI 1Z0BA 3B82A 1XHKA 2VQFE 5LL6R 5GMDA 4JI7E 1RREA 1PVGA 2LJPA 3PRYA 4DV2E 3WU5A 1B63A 4JI7I 3LPSA 2E1RA 2IOQA 4DR4E 4IZKA 4DV5E 4MYUA 1S4EA 3J81Q 3T1YE 4HXZA 4DR4I 4DV5I 1OJ4A 2PNMA 3D4JA 1A6FA 4KQVA 3T1YI 3P06A 1XMQI 5L3JA 3K85A 1Z59A 4WUBA 3QT5A 4IZKB 1KKHA 3J81C 4DR6E 1NHIA 2O1TA 4LFAE 4ED4A 4JV5I 3ZM7A 1MU5A 4JI8E 1EA6A 2UUBE 3ZZUA 3LTOA 3QT8A 1XMOE 4JI5E 4JI8I 2ZBKB 2UUBI 4B3RE 2HFUA 4LF4E 2UXCE 4DR1E 4DR2I 1XMOI 3K1JA 4JI5I 3GONA 4P52A 2UXBE 4LF4I 2UXCI 2IOPA 1HNXE 1FKAE 2UXBI 2E5LE 4B3SE 2R3VA 2DEIA 4HACA 4JI0I 1N0UA 1FWLA 1HNXI 4DV6I 4PRVA 4K0KE 1ZXNA 4B3SI 1DARA 1FJGE 5GMEA 4K0KI 4GKJE 4URLA 1USUA 4HACB 1FJGI 5A2QQ 2O1UA 4FN5A 4GKJI 4DR7E 1MG7A 4DUYE 4WUCA 1WUUA 2HKJA 1XNQE 4DR7I 4DUYI 3J7AM 4DUZE 1Z0EA 4EMDA 4JI1E 1XNRI 5A2QC 1Z0WA 4R1FA 2BM0A 4DUZI 1ZM2A 4AQYE 5IWAE 2HK3A 1KIJA 3ZKBA 4UTGA 1H7UA 1QZRA 3V5RA 3WU4A 1USVA 2HFSA 3Q1QA 1UEKA 2UUAE 1I94E 4DPYA 4AQYI 3HJCA 2BV3A 4LF6E 1H7SA 4X64E 2CGEA 2CZ9A 2VQFI 4Z7YA 2UUAI 1I94I 2EFGA 4LF6I 5BR8E 5LMNE 4X64I 1Z0GA 3PYEA 3PYDA 4DV2I 4HYMA 2NPFA 5BR8I 1IBLE 5LMNI 2J7KA 1PIEA 4USKA 4JI6E 4I3HA 3J7AG 3ZZ0A 2VQEE 3ZZTA 4HY1A 4X65E 2VQEI 1N33E 4X65I 3B78A 5FLXC 4PRXA 4LF5E 2F4VE 1ZM4A 4FWGA 1N33I 1RR9A 4DR6I 5FWKA 1ZXMA 4LFAI 4LF5I 2F4VI 3H4LA 4UT4A 2O1VA 1HK7A 1H72C 1K47A 4RPFA 4M1KA 4WUDA 3OTOE 4JI4E 4N3OA 1N36E 1HNZE 4B3RI 1N32E 3Q6MA 4DR1I 2VF3A 3B8HA 3OTOI 1N36I 1HNZI 3JAMC 1IBME 1Z5CA 2PNLA 1N32I 4LF8E 2E5LI 1Z0VA 1Y4SA 1IBMI 4DR3E 2AJ4A 4XTJA 2HK2A 1PKPA 4LF8I 4IZJA 1HNWE 4NXME 3CWVA 4DPWA 4DR3I 1Z5BA 4KHPE 4JI2E 3PYFA 1HNWI 3V2UC 2X7IA 4KHPI 4JI2I 3QT6A 1B62A 4LFBE 3WU3A 4FWHA 4IZJB 3Q6NA 2Z5BB 4DPXA 4LFBI 1XNQI 1Z0CA 4DU8A 2V2ZA 2UXDE 1D6TA 4DR5E 1N0VC 1NZ0A 3HULA 4JI1I 2Q2EB 4DPTA 5IT9Q 2ZITA 4YHHE 1MX0A 1EI1A 4DR5I 5IWAI 5LMUE 2V34A 2R42A 4YHHI 2V8PA 3K17A 3QT7A 3T1HE 4MYTA 4NXNE 1N34E 4X62E 5LMUI 1HR0E 2HKEA 4YY3E 4LFCE 1Z0TA 5IT9C 4OX9E 3T1HI 4FWDA 1N34I 4X62I 4LF7E 1HR0I 3PYGA 4YY3I 4LFCI 2Z5CA 5FLXQ 4OX9I 2ZM6E 1IBKE 4LF7I 3WU6A 1IBLI 1Y4UA 4DV1E 2ZM6I 4JI6I 1IBKI 2XEXA 3F0NA 3J80Q 4DV1I 1KVKA 2Z5CB 4Z7CA 1XMQE 4ZVIA 1ELOA 2O1WA 3J80C 1FI4A 4DV4E 1FWKA 3JAMQ 1Y6ZA 4JV5E 2A2DA 2A2CA 4DV4I 4P7AA 4DU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNU A;  4B3T E;  2HHH E;  1U2R A;  4JI4 I;  1NHJ A;  4DR2 E;  2DEJ A;  4B3T I;  4PU9 A;  2HHH I;  4X66 E;  4JG4 A;  1ZM9 A;  4X66 I;  4JI0 E;  4JI3 E;  2UUC E;  1S16 A;  4GKK E;  1J5E E;  1H73 A;  4DV6 E;  4USM A;  2GS8 A;  4NXM I;  4JI3 I;  2UUC I;  4GKK I;  2UU9 E;  1J5E I;  4JYA E;  2WW4 A;  1NHH A;  4DV0 E;  2V2Q A;  2UU9 I;  3ZKD A;  4JYA I;  4DV3 E;  1VIS A;  1KTV A;  4DV0 I;  4DV7 E;  3M6A A;  4DV3 I;  4DV7 I;  2BM1 A;  1H74 A;  1FNM A;  1BKN A;  4B3M E;  4DPU A;  2UXD I;  1ZM3 A;  4FW9 A;  4DXL A;  1XNR E;  4LF9 E;  4B3M I;  1Z5A A;  2X36 A;  4LF9 I;  2OI2 A;  2V2V A;  4NXN I;  1Z0B A;  3B82 A;  1XHK A;  2VQF E;  5LL6 R;  5GMD A;  4JI7 E;  1RRE A;  1PVG A;  2LJP A;  4DV2 E;  3WU5 A;  1B63 A;  4JI7 I;  3LPS A;  2E1R A;  4DR4 E;  4DV5 E;  4MYU A;  1S4E A;  3J81 Q;  3T1Y E;  4HXZ A;  4DR4 I;  4DV5 I;  1OJ4 A;  3D4J A;  1A6F A;  4KQV A;  3T1Y I;  1XMQ I;  5L3J A;  1Z59 A;  4WUB A;  3QT5 A;  1KKH A;  3J81 C;  4DR6 E;  1NHI A;  4LFA E;  4ED4 A;  4JV5 I;  3ZM7 A;  1MU5 A;  4JI8 E;  1EA6 A;  2UUB E;  3ZZU A;  3LTO A;  3QT8 A;  1XMO E;  4JI5 E;  4JI8 I;  2ZBK B;  2UUB I;  4B3R E;  2HFU A;  4LF4 E;  2UXC E;  4DR1 E;  4DR2 I;  1XMO I;  3K1J A;  4JI5 I;  3GON A;  4P52 A;  2UXB E;  4LF4 I;  2UXC I;  1HNX E;  1FKA E;  2UXB I;  2E5L E;  4B3S E;  2R3V A;  2DEI A;  4HAC A;  4JI0 I;  1N0U A;  1FWL A;  1HNX I;  4DV6 I;  4PRV A;  4K0K E;  1ZXN A;  4B3S I;  1DAR A;  1FJG E;  5GME A;  4K0K I;  4GKJ E;  4URL A;  4HAC B;  1FJG I;  5A2Q Q;  4FN5 A;  4GKJ I;  4DR7 E;  1MG7 A;  4DUY E;  4WUC A;  1WUU A;  2HKJ A;  1XNQ E;  4DR7 I;  4DUY I;  3J7A M;  4DUZ E;  1Z0E A;  4EMD A;  4JI1 E;  1XNR I;  5A2Q C;  1Z0W A;  4R1F A;  2BM0 A;  4DUZ I;  1ZM2 A;  4AQY E;  5IWA E;  1KIJ A;  2HK3 A;  3ZKB A;  4UTG A;  1H7U A;  1QZR A;  3V5R A;  3WU4 A;  2HFS A;  3Q1Q A;  1UEK A;  2UUA E;  1I94 E;  4DPY A;  4AQY I;  2BV3 A;  4LF6 E;  1H7S A;  4X64 E;  2CZ9 A;  2VQF I;  4Z7Y A;  2UUA I;  1I94 I;  2EFG A;  4LF6 I;  5BR8 E;  5LMN E;  4X64 I;  1Z0G A;  3PYE A;  3PYD A;  4DV2 I;  4HYM A;  2NPF A;  5BR8 I;  1IBL E;  5LMN I;  2J7K A;  1PIE A;  4USK A;  4JI6 E;  4I3H A;  3J7A G;  3ZZ0 A;  2VQE E;  3ZZT A;  4HY1 A;  4X65 E;  2VQE I;  1N33 E;  4X65 I;  3B78 A;  5FLX C;  4PRX A;  4LF5 E;  2F4V E;  1ZM4 A;  4FWG A;  1N33 I;  1RR9 A;  4DR6 I;  1ZXM A;  4LFA I;  4LF5 I;  2F4V I;  3H4L A;  4UT4 A;  1H72 C;  1K47 A;  4RPF A;  4M1K A;  4WUD A;  3OTO E;  4JI4 E;  1N36 E;  1HNZ E;  4B3R I;  1N32 E;  4DR1 I;  2VF3 A;  3B8H A;  3OTO I;  1N36 I;  1HNZ I;  3JAM C;  1IBM E;  1Z5C A;  1N32 I;  4LF8 E;  2E5L I;  1Z0V A;  1IBM I;  4DR3 E;  2AJ4 A;  4XTJ A;  2HK2 A;  1PKP A;  4LF8 I;  1HNW E;  4NXM E;  3CWV A;  4DPW A;  4DR3 I;  1Z5B A;  4KHP E;  4JI2 E;  3PYF A;  1HNW I;  3V2U C;  2X7I A;  4KHP I;  4JI2 I;  3QT6 A;  1B62 A;  4LFB E;  3WU3 A;  4FWH A;  4DPX A;  4LFB I;  1XNQ I;  1Z0C A;  4DU8 A;  2V2Z A;  2UXD E;  1D6T A;  4DR5 E;  1N0V C;  1NZ0 A;  3HUL A;  4JI1 I;  2Q2E B;  4DPT A;  5IT9 Q;  2ZIT A;  4YHH E;  1MX0 A;  1EI1 A;  4DR5 I;  5IWA I;  5LMU E;  2V34 A;  2R42 A;  4YHH I;  2V8P A;  3K17 A;  3QT7 A;  3T1H E;  4MYT A;  4NXN E;  1N34 E;  4X62 E;  5LMU I;  1HR0 E;  2HKE A;  4YY3 E;  4LFC E;  1Z0T A;  5IT9 C;  4OX9 E;  3T1H I;  4FWD A;  1N34 I;  4X62 I;  4LF7 E;  1HR0 I;  3PYG A;  4YY3 I;  4LFC I;  5FLX Q;  4OX9 I;  2ZM6 E;  1IBK E;  4LF7 I;  3WU6 A;  1IBL I;  4DV1 E;  2ZM6 I;  4JI6 I;  1IBK I;  2XEX A;  3F0N A;  3J80 Q;  4DV1 I;  1KVK A;  4Z7C A;  1XMQ E;  4ZVI A;  1ELO A;  3J80 C;  1FI4 A;  4DV4 E;  1FWK A;  3JAM Q;  4JV5 E;  2A2D A;  2A2C A;  4DV4 I;  4P7A A;  4DU7 A; 
#chains in the Genus database with same CATH topology
 3LNU A;  4B3T E;  2HHH E;  1U2R A;  4JI4 I;  1UDO A;  2NN6 D;  1NHJ A;  1R6L A;  4DR2 E;  2NN6 E;  2JEA A;  2DEJ A;  2PO2 A;  4B3T I;  4PU9 A;  3U1K A;  4X66 E;  2HHH I;  4MU3 A;  5EKW A;  2JEB B;  4JG4 A;  2JE6 A;  1ZM9 A;  4X66 I;  3H1C A;  4JI0 E;  1Y60 A;  2CG9 A;  3GLL A;  4U3B A;  2UUC E;  4JI3 E;  1S16 A;  4GKK E;  2Z5B A;  2JEA B;  1J5E E;  1H73 A;  4DV6 E;  2Z5E A;  4USM A;  2GS8 A;  4NXM I;  5DRP A;  4JI3 I;  2UUC I;  3PS3 A;  2UU9 E;  4GKK I;  4FW7 A;  1J5E I;  4JYA E;  2WW4 A;  2PO0 B;  1NHH A;  4DV0 E;  2V2Q A;  3KRN A;  2O3Z A;  2UU9 I;  3ZKD A;  4JYA I;  4BA1 A;  4DV3 E;  1VIS A;  1KTV A;  4DV0 I;  2CVE A;  4DV7 E;  3M6A A;  4MQY A;  5C0X B;  4DV3 I;  2BR2 A;  4DV7 I;  2BM1 A;  2GQ0 A;  1H74 A;  1FNM A;  1BKN A;  4B3M E;  4DPU A;  2UXD I;  4IZJ D;  1ZM3 A;  4FW9 A;  4OO1 A;  4DXL A;  1XNR E;  4BA1 B;  4LF9 E;  2GO3 A;  4B3M I;  2WNR A;  1Z5A A;  2X36 A;  4OKG A;  2BR2 B;  4LF9 I;  4AM3 A;  2OI2 A;  2BA0 G;  2J65 A;  2V2V A;  4NXN I;  1R6M A;  1Z0B A;  3B82 A;  4OO1 B;  1XHK A;  2VQF E;  5LL6 R;  5GMD A;  4JI7 E;  1RRE A;  1PVG A;  2LJP A;  3PRY A;  4DV2 E;  3WU5 A;  3P3C A;  1B63 A;  4JI7 I;  3LPS A;  2E1R A;  4MDT A;  2C39 B;  2IOQ A;  3U1Y A;  4DR4 E;  4IZK A;  3P3E A;  4DV5 E;  4IFD A;  4MYU A;  4BA2 B;  1S4E A;  3J81 Q;  4QNK A;  3T1Y E;  4HXZ A;  4DR4 I;  4DV5 I;  1OJ4 A;  4FW6 A;  2PNM A;  3D4J A;  1A6F A;  1OYS A;  4KQV A;  3T1Y I;  3P06 A;  4MU1 A;  1XMQ I;  5L3J A;  3K85 A;  1Z59 A;  4WUB A;  4IFD F;  3P3G A;  3QT5 A;  4IZK B;  5K36 A;  1KKH A;  3PS1 A;  1Y5Y A;  3J81 C;  4DR6 E;  1NHI A;  3P76 A;  2O1T A;  2WP8 B;  4LFA E;  4ED4 A;  4JV5 I;  4MU4 A;  3ZM7 A;  1MU5 A;  4JI8 E;  1EA6 A;  2UUB E;  3ZZU A;  5K36 B;  3LTO A;  3QT8 A;  1XMO E;  2JT2 A;  3M85 D;  5ELW A;  4JI5 E;  4JI8 I;  2ZBK B;  2UUB I;  4B3R E;  2HFU A;  4LF4 E;  3CDI A;  4DR1 E;  2UXC E;  4DR2 I;  1XMO I;  2PO0 A;  3K1J A;  4JI5 I;  3GON A;  4P52 A;  2UXB E;  4LF4 I;  2UXC I;  2IOP A;  5DRO A;  1HNX E;  1FKA E;  2UXB I;  2E5L E;  4B3S E;  2R3V A;  2DEI A;  4HAC A;  4JI0 I;  5C0X A;  4NBQ A;  2VES A;  1N0U A;  1FWL A;  1HNX I;  4DV6 I;  4PRV A;  4K0K E;  1ZXN A;  4B3S I;  1DAR A;  1FJG E;  3M7N D;  5GME A;  4K0K I;  4GKJ E;  4URL A;  1USU A;  5C0X F;  4HAC B;  1FJG I;  5A2Q Q;  2IES A;  2O1U A;  4FN5 A;  4GKJ I;  4DR7 E;  4FW3 A;  1MG7 A;  4DUY E;  4WUC A;  1WUU A;  2HKJ A;  1UDS A;  1XNQ E;  4DR7 I;  5DRR A;  4DUY I;  3J7A M;  4DUZ E;  1Z0E A;  4EMD A;  4JI1 E;  1XNR I;  5A2Q C;  1Z0W A;  4R1F A;  2BM0 A;  1ZM2 A;  4DUZ I;  4AQY E;  5IWA E;  1E3H A;  2HK3 A;  1KIJ A;  3ZKB A;  4UTG A;  4OO1 F;  2C39 A;  1H7U A;  1QZR A;  3V5R A;  3WU4 A;  4BA2 A;  1USV A;  2HFS A;  3Q1Q A;  1UEK A;  2UUA E;  1I94 E;  4DPY A;  4AQY I;  3HJC A;  2BV3 A;  4LF6 E;  1VI7 A;  1H7S A;  5EL9 A;  4X64 E;  1UDN A;  2CGE A;  2CZ9 A;  2VQF I;  4Z7Y A;  3PS2 A;  1I94 I;  2UUA I;  2EFG A;  5JEA A;  4LF6 I;  4OO1 C;  5BR8 E;  2IER A;  5LMN E;  4X64 I;  1Z0G A;  3PYE A;  3PYD A;  4DV2 I;  3HKM A;  4HYM A;  4OO1 D;  4LCG A;  4J3D A;  2NPF A;  5BR8 I;  1IBL E;  4OO1 E;  5LMN I;  2J7K A;  1PIE A;  2WP8 A;  4USK A;  4JI6 E;  4I3H A;  3J7A G;  3ZZ0 A;  2VQE E;  5JEA B;  3ZZT A;  1RHY A;  4HY1 A;  4X65 E;  2BA0 D;  3CDJ A;  2NN6 A;  1OYP A;  2VQE I;  3M85 G;  1N33 E;  4X65 I;  3B78 A;  5FLX C;  4PRX A;  4LF5 E;  2F4V E;  1ZM4 A;  4LCH A;  4FWG A;  3NZK A;  1N33 I;  1RR9 A;  4DR6 I;  4IFD C;  5FWK A;  2PO1 B;  5K36 F;  3DD6 A;  1ZXM A;  4LFA I;  4LF5 I;  2F4V I;  2NN6 B;  3H4L A;  2O1V A;  4UT4 A;  4IFD D;  1HK7 A;  1H72 C;  1K47 A;  4IFD E;  4RPF A;  4GQU A;  4M1K A;  5DNL A;  4WUD A;  3L7Z A;  5K36 C;  3OTO E;  4JI4 E;  3GME A;  4N3O A;  1N36 E;  1HNZ E;  4B3R I;  1YH8 A;  3M7N G;  1N32 E;  3Q6M A;  4DR1 I;  2VF3 A;  2BA1 D;  3B8H A;  5K36 D;  3OTO I;  1YHC A;  1N36 I;  1HNZ I;  5K36 E;  3JAM C;  1IBM E;  1Z5C A;  1XXE A;  2PNL A;  1N32 I;  4LF8 E;  2PNZ A;  3L7Z B;  1Z0V A;  2E5L I;  1Y4S A;  1IBM I;  4DR3 E;  2AJ4 A;  4XTJ A;  2HK2 A;  1PKP A;  4LF8 I;  4IZJ A;  1HNW E;  4NXM E;  3CWV A;  4DPW A;  4DR3 I;  1Z5B A;  4KHP E;  1UDQ A;  4JI2 E;  3PYF A;  4AIM A;  2PO2 B;  3GCM A;  1HNW I;  3V2U C;  2X7I A;  4QNJ A;  4LCF A;  2PNZ B;  4KHP I;  2JE6 B;  4JI2 I;  3QT6 A;  1B62 A;  4LFB E;  3WU3 A;  4FWH A;  4IZJ B;  3Q6N A;  5C0X C;  2Z5B B;  4DPX A;  4LFB I;  1XNQ I;  1Z0C A;  4MU0 A;  4DU8 A;  2V2Z A;  5DRQ A;  5C0X D;  2UXD E;  1D6T A;  5C0X E;  4DR5 E;  1N0V C;  1NZ0 A;  3HUL A;  4JI1 I;  2Q2E B;  4AID A;  4DPT A;  5IT9 Q;  2ZIT A;  4IS9 A;  4YHH E;  2GO4 A;  3B4T A;  1MX0 A;  1EI1 A;  4DR5 I;  5IWA I;  4LOM A;  5LMU E;  2V34 A;  2R42 A;  4YHH I;  2V8P A;  4ISA A;  3K17 A;  3QT7 A;  3T1H E;  4MYT A;  4NXN E;  1N34 E;  4X62 E;  5LMU I;  1HR0 E;  2HKE A;  4YY3 E;  4LFC E;  1Z0T A;  2C37 A;  5IT9 C;  4OX9 E;  3T1H I;  4FWD A;  1N34 I;  4X62 I;  4LF7 E;  1HR0 I;  3PYG A;  4YY3 I;  4LFC I;  2Z5C A;  5FLX Q;  4OX9 I;  2ZM6 E;  2WNR B;  1IBK E;  3UHM A;  4LF7 I;  5JEA F;  3WU6 A;  1IBL I;  1Y4U A;  4DV1 E;  4OZE A;  1P42 A;  2C38 A;  2F1D A;  2PO1 A;  2ZM6 I;  2C37 B;  4JI6 I;  1IBK I;  2XEX A;  3F0N A;  3J80 Q;  4DV1 I;  1KVK A;  2Z5C B;  5JEA C;  4Z7C A;  1OYR A;  4FW5 A;  1XMQ E;  4ZVI A;  2AE8 A;  1E3P A;  1ELO A;  4U3D A;  2C38 B;  2O1W A;  5JEA D;  2BA1 G;  2NN6 F;  5JEA E;  4LPF A;  3J80 C;  4FW4 A;  1FI4 A;  4DV4 E;  1FWK A;  4IFD B;  3JAM Q;  1Y6Z A;  4JV5 E;  2A2D A;  2A2C A;  5DNX A;  4DV4 I;  2JEB A;  4P7A A;  2NN6 C;  4DU7 A; 
#chains in the Genus database with same CATH homology
 3LNU A;  4B3T E;  2HHH E;  1U2R A;  4JI4 I;  1NHJ A;  4DR2 E;  2DEJ A;  4B3T I;  4PU9 A;  2HHH I;  4X66 E;  4JG4 A;  1ZM9 A;  4X66 I;  4JI0 E;  2CG9 A;  4JI3 E;  2UUC E;  1S16 A;  4GKK E;  2Z5B A;  1J5E E;  1H73 A;  4DV6 E;  2Z5E A;  4USM A;  2GS8 A;  4NXM I;  4JI3 I;  2UUC I;  4GKK I;  2UU9 E;  1J5E I;  4JYA E;  2WW4 A;  1NHH A;  4DV0 E;  2V2Q A;  2UU9 I;  3ZKD A;  4JYA I;  4DV3 E;  1VIS A;  1KTV A;  4DV0 I;  4DV7 E;  3M6A A;  4DV3 I;  4DV7 I;  2BM1 A;  2GQ0 A;  1H74 A;  1FNM A;  1BKN A;  4B3M E;  4DPU A;  2UXD I;  4IZJ D;  1ZM3 A;  4FW9 A;  4DXL A;  1XNR E;  4LF9 E;  4B3M I;  1Z5A A;  2X36 A;  4LF9 I;  2OI2 A;  2V2V A;  4NXN I;  1Z0B A;  3B82 A;  1XHK A;  2VQF E;  5LL6 R;  5GMD A;  4JI7 E;  1RRE A;  1PVG A;  2LJP A;  3PRY A;  4DV2 E;  3WU5 A;  1B63 A;  4JI7 I;  3LPS A;  2E1R A;  2IOQ A;  4DR4 E;  4IZK A;  4DV5 E;  4MYU A;  1S4E A;  3J81 Q;  3T1Y E;  4HXZ A;  4DR4 I;  4DV5 I;  1OJ4 A;  2PNM A;  3D4J A;  1A6F A;  4KQV A;  3T1Y I;  3P06 A;  1XMQ I;  5L3J A;  3K85 A;  1Z59 A;  4WUB A;  3QT5 A;  4IZK B;  1KKH A;  3J81 C;  4DR6 E;  1NHI A;  2O1T A;  4LFA E;  4ED4 A;  4JV5 I;  3ZM7 A;  1MU5 A;  4JI8 E;  1EA6 A;  2UUB E;  3ZZU A;  3LTO A;  3QT8 A;  1XMO E;  4JI5 E;  4JI8 I;  2ZBK B;  2UUB I;  4B3R E;  2HFU A;  4LF4 E;  2UXC E;  4DR1 E;  4DR2 I;  1XMO I;  3K1J A;  4JI5 I;  3GON A;  4P52 A;  2UXB E;  4LF4 I;  2UXC I;  2IOP A;  1HNX E;  1FKA E;  2UXB I;  2E5L E;  4B3S E;  2R3V A;  2DEI A;  4HAC A;  4JI0 I;  1N0U A;  1FWL A;  1HNX I;  4DV6 I;  4PRV A;  4K0K E;  1ZXN A;  4B3S I;  1DAR A;  1FJG E;  5GME A;  4K0K I;  4GKJ E;  4URL A;  1USU A;  4HAC B;  1FJG I;  5A2Q Q;  2O1U A;  4FN5 A;  4GKJ I;  4DR7 E;  1MG7 A;  4DUY E;  4WUC A;  1WUU A;  2HKJ A;  1XNQ E;  4DR7 I;  4DUY I;  3J7A M;  4DUZ E;  1Z0E A;  4EMD A;  4JI1 E;  1XNR I;  5A2Q C;  1Z0W A;  4R1F A;  2BM0 A;  4DUZ I;  1ZM2 A;  4AQY E;  5IWA E;  2HK3 A;  1KIJ A;  3ZKB A;  4UTG A;  1H7U A;  1QZR A;  3V5R A;  3WU4 A;  1USV A;  2HFS A;  3Q1Q A;  1UEK A;  2UUA E;  1I94 E;  4DPY A;  4AQY I;  3HJC A;  2BV3 A;  4LF6 E;  1H7S A;  4X64 E;  2CGE A;  2CZ9 A;  2VQF I;  4Z7Y A;  2UUA I;  1I94 I;  2EFG A;  4LF6 I;  5BR8 E;  5LMN E;  4X64 I;  1Z0G A;  3PYE A;  3PYD A;  4DV2 I;  4HYM A;  2NPF A;  5BR8 I;  1IBL E;  5LMN I;  2J7K A;  1PIE A;  4USK A;  4JI6 E;  4I3H A;  3J7A G;  3ZZ0 A;  2VQE E;  3ZZT A;  4HY1 A;  4X65 E;  2VQE I;  1N33 E;  4X65 I;  3B78 A;  5FLX C;  4PRX A;  4LF5 E;  2F4V E;  1ZM4 A;  4FWG A;  1N33 I;  1RR9 A;  4DR6 I;  5FWK A;  1ZXM A;  4LFA I;  4LF5 I;  2F4V I;  3H4L A;  4UT4 A;  2O1V A;  1HK7 A;  1H72 C;  1K47 A;  4RPF A;  4M1K A;  4WUD A;  3OTO E;  4JI4 E;  4N3O A;  1N36 E;  1HNZ E;  4B3R I;  1N32 E;  3Q6M A;  4DR1 I;  2VF3 A;  3B8H A;  3OTO I;  1N36 I;  1HNZ I;  3JAM C;  1IBM E;  1Z5C A;  2PNL A;  1N32 I;  4LF8 E;  2E5L I;  1Z0V A;  1Y4S A;  1IBM I;  4DR3 E;  2AJ4 A;  4XTJ A;  2HK2 A;  1PKP A;  4LF8 I;  4IZJ A;  1HNW E;  4NXM E;  3CWV A;  4DPW A;  4DR3 I;  1Z5B A;  4KHP E;  4JI2 E;  3PYF A;  1HNW I;  3V2U C;  2X7I A;  4KHP I;  4JI2 I;  3QT6 A;  1B62 A;  4LFB E;  3WU3 A;  4FWH A;  4IZJ B;  3Q6N A;  2Z5B B;  4DPX A;  4LFB I;  1XNQ I;  1Z0C A;  4DU8 A;  2V2Z A;  2UXD E;  1D6T A;  4DR5 E;  1N0V C;  1NZ0 A;  3HUL A;  4JI1 I;  2Q2E B;  4DPT A;  5IT9 Q;  2ZIT A;  4YHH E;  1MX0 A;  1EI1 A;  4DR5 I;  5IWA I;  5LMU E;  2V34 A;  2R42 A;  4YHH I;  2V8P A;  3K17 A;  3QT7 A;  3T1H E;  4MYT A;  4NXN E;  1N34 E;  4X62 E;  5LMU I;  1HR0 E;  2HKE A;  4YY3 E;  4LFC E;  1Z0T A;  5IT9 C;  4OX9 E;  3T1H I;  4FWD A;  1N34 I;  4X62 I;  4LF7 E;  1HR0 I;  3PYG A;  4YY3 I;  4LFC I;  2Z5C A;  5FLX Q;  4OX9 I;  2ZM6 E;  1IBK E;  4LF7 I;  3WU6 A;  1IBL I;  1Y4U A;  4DV1 E;  2ZM6 I;  4JI6 I;  1IBK I;  2XEX A;  3F0N A;  3J80 Q;  4DV1 I;  1KVK A;  2Z5C B;  4Z7C A;  1XMQ E;  4ZVI A;  1ELO A;  2O1W A;  3J80 C;  1FI4 A;  4DV4 E;  1FWK A;  3JAM Q;  1Y6Z A;  4JV5 E;  2A2D A;  2A2C A;  4DV4 I;  4P7A A;  4DU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...