5BR8I

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5br8I00
4X66E 1D6TA 1NHIA 2UUBE 2HK2A 1HNXE 4NXME 4GKJI 4DV2E 1NHHA 3T1HI 4WUDA 1N0VC 1HNWE 1Z5BA 4EMDA 1N34I 4P7AA 4HYMA 4GKKE 1ZM2A 4JI4E 1BKNA 4KQVA 3PYEA 3J7AG 1ELOA 1XMOE 4JI3I 1NHJA 1N36I 3ZZUA 1H7UA 4X64E 3LPSA 4DPXA 2BV3A 3PYGA 2UUBI 1HNXI 2EFGA 1U2RA 1Z5CA 2V34A 4DV2I 1NZ0A 4DU8A 2XEXA 4DV5E 2OI2A 4PU9A 4URLA 1RREA 4FWDA 3WU5A 4B3SI 4UTGA 4DR1E 4GKKI 2UXBE 1PVGA 4JI0I 4JI4I 4B3ME 5LMNE 3K17A 1XMQE 1FJGE 4X65E 3J80Q 1H74A 1XMOI 4P52A 4LFBE 4B3TI 3PYDA 2DEIA 3WU3A 5GMEA 3ZKDA 2UUAE 2X36A 4LFCI 4JV5E 3Q1QA 1WUUA 1Z0CA 2HHHI 1FI4A 2E1RA 4DR3E 4DV5I 5IT9Q 2V2VA 1FKAE 1N32E 3T1YE 1Z59A 4LF8E 4DV6E 4LF6E 3QT5A 4DR1I 2UXBI 1UEKA 4JI8E 4DV0E 4B3MI 4I3HA 5LMNI 2A2DA 4PRVA 4JYAE 1XMQI 1FJGI 4X65I 4LFAE 1Z0VA 3V5RA 2WW4A 4LFBI 3LNUA 4USMA 4DUZE 2J7KA 1FNMA 3J80C 1RR9A 4FN5A 4Z7YA 4JV5I 3M6AA 1B62A 1ZM4A 1OJ4A 4FWGA 4MYTA 4ED4A 1IBLE 3QT7A 2HFSA 1IBKE 1N32I 3T1YI 4DUYI 1ZXNA 4DR5I 2AJ4A 4DPTA 2HFUA 4UT4A 1MX0A 1MU5A 4LF8I 4DV6I 4LF6I 4NXNI 4JI7E 4DR4E 4JI5E 4DV0I 4FWHA 2HK3A 3OTOE 2HKJA 4JYAI 3LTOA 4X66I 4KHPE 5BR8E 2R3VA 2NPFA 1FWLA 4DUZI 1N33E 3D4JA 4WUCA 4NXMI 1MG7A 4K0KE 1EA6A 4DV3E 4Z7CA 4YHHE 4JI1E 4HXZA 1IBME 4B3RE 5LMUE 1XHKA 1K47A 4ZVIA 1HNWI 4LF4E 1I94E 3J81Q 1HNZE 2UUCE 5FLXQ 2HKEA 5LL6R 4JI7I 4DPYA 3J7AM 4FW9A 2F4VE 1H73A 4X64I 2ZM6E 4R1FA 1Z0TA 1B63A 4WUBA 4JI6E 1EI1A 4DPWA 3CWVA 1J5EE 1PIEA 3K1JA 1HR0E 2UXCE 4DV1E 4K0KI 4DV3I 4JI1I 4YHHI 2A2CA 1IBMI 4DV7E 5LMUI 2E5LE 2VQFE 1Z0WA 1I94I 2UXDE 3B78A 4DR7E 3WU6A 3T1HE 3J81C 1S16A 4DPUA 2V2QA 2BM0A 5FLXC 4M1KA 1S4EA 2BM1A 3B8HA 2F4VI 5A2QQ 2ZM6I 1Z0BA 3HULA 2UUAI 4JI6I 4YY3E 3JAMQ 1J5EI 4PRXA 4X62E 4JI3E 1HR0I 2UXCI 3QT6A 1N0UA 4DR3I 4DV1I 3B82A 4DV7I 4HACA 1KVKA 2E5LI 5IT9C 2VQFI 2X7IA 2UU9E 2V2ZA 2UXDI 4JI8I 4DR7I 1KKHA 1H72C 1VISA 3ZZTA 3ZKBA 1ZXMA 4LFAI 4HACB 1XNQE 1KIJA 4B3SE 4LF5E 4JI0E 4DR6E 4YY3I 4HY1A 5A2QC 5IWAE 2VQEE 4LF7E 4X62I 4B3TE 2DEJA 3F0NA 3JAMC 2CZ9A 1IBLI 1Z5AA 3ZM7A 4USKA 1IBKI 4LFCE 2VF3A 1QZRA 3ZZ0A 4LF9E 4DV4E 2HHHE 1A6FA 2UU9I 3QT8A 4DU7A 4DR4I 4JI5I 4JI2E 5GMDA 5L3JA 4AQYE 4XTJA 3OTOI 1KTVA 4MYUA 2GS8A 4KHPI 5BR8I 1XNQI 1N33I 1XNRE 1ZM3A 3GONA 4LF5I 4DR6I 4OX9E 5IWAI 2VQEI 4LF7I 3H4LA 4DR2E 1H7SA 1Z0GA 4B3RI 4GKJE 1Z0EA 2ZBKB 4LF4I 1ZM9A 2ZITA 1HNZI 4LF9I 3WU4A 4DV4I 2UUCI 4JG4A 2V8PA 1N34E 4JI2I 4DXLA 4AQYI 4DUYE 3PYFA 2R42A 4DR5E 2LJPA 3V2UC 1XNRI 4RPFA 4NXNE 2Q2EB 1N36E 1FWKA 1DARA 4OX9I 1PKPA 4DR2I
chains in the Genus database with same CATH superfamily
4X66E 1D6TA 1NHIA 2UUBE 2HK2A 2C39A 1HNXE 4OO1F 4NXME 4GKJI 4IFDB 4DV2E 2PNZA 2NN6D 1NHHA 3K85A 2WNRB 3UHMA 3T1HI 4WUDA 4OO1A 4FW5A 1N0VC 4U3DA 1HNWE 3U1KA 1Z5BA 2NN6C 4EMDA 1N34I 4P7AA 2C39B 4HYMA 2IERA 4GKKE 1ZM2A 4JI4E 1OYPA 1BKNA 4KQVA 3PYEA 5JEAA 3J7AG 1ELOA 1XMOE 4JI3I 1NHJA 1N36I 3ZZUA 4N3OA 1H7UA 4OO1B 4X64E 3LPSA 4DPXA 2BV3A 3PYGA 2UUBI 1HNXI 2EFGA 1U2RA 4FW4A 1Z5CA 2V34A 4DV2I 2O1WA 1NZ0A 4DU8A 2XEXA 4DV5E 4PU9A 2OI2A 3NZKA 4URLA 1RREA 2BA1G 4FWDA 4AM3A 3U1YA 2BA0D 3WU5A 4B3SI 4UTGA 4DR1E 4GKKI 2UXBE 1PVGA 4JI0I 2C37A 4JI4I 3M7ND 4B3ME 5LMNE 3K17A 1XMQE 1FJGE 3PS1A 4X65E 3J80Q 1H74A 1XMOI 4P52A 4LFBE 4B3TI 3P3GA 3P3EA 2O1UA 3PYDA 2DEIA 3WU3A 5GMEA 3ZKDA 2UUAE 2X36A 4LFCI 4JV5E 3Q1QA 3Q6MA 1WUUA 1Z0CA 2HHHI 1FI4A 2C37B 2E1RA 5C0XD 4IFDE 4DR3E 2IESA 4DV5I 5IT9Q 2V2VA 1FKAE 1N32E 3T1YE 1XXEA 2PO2A 5DNXA 4J3DA 1Z59A 4NBQA 4LF8E 4DV6E 4LF6E 3QT5A 4DR1I 2UXBI 1UEKA 4JI8E 4FW6A 4DV0E 2O1TA 4B3MI 4I3HA 5LMNI 2A2DA 4PRVA 4JYAE 1XMQI 1FJGI 4X65I 3DD6A 4LFAE 1Z0VA 3V5RA 2WW4A 4LFBI 3LNUA 4USMA 1Y4UA 2PO2B 4DUZE 2J7KA 1FNMA 3J80C 4OO1E 1RR9A 3CDJA 4FN5A 4Z7YA 4JV5I 3M6AA 5DNLA 1B62A 1VI7A 1ZM4A 2GO3A 1RHYA 1OJ4A 4FWGA 4MYTA 4ED4A 1IBLE 2CVEA 3QT7A 2HFSA 5JEAE 4IZJA 1IBKE 5JEAF 1N32I 4IFDD 1Y5YA 3T1YI 4DUYI 1OYRA 2C38A 1ZXNA 5K36A 4DR5I 2AJ4A 5DRPA 4DPTA 1R6MA 2HFUA 2VESA 4UT4A 1MX0A 2PNZB 1R6LA 1MU5A 4LF8I 2PO1A 4DV6I 4LF6I 4NXNI 4JI7E 4DR4E 1UDSA 5EKWA 4IFDC 4JI5E 4DV0I 4FWHA 2HK3A 3GCMA 2O1VA 3OTOE 2HKJA 4JYAI 3H1CA 3Q6NA 3LTOA 4FW3A 4IZJB 4X66I 4KHPE 5BR8E 2R3VA 2NPFA 1FWLA 4DUZI 2C38B 1N33E 3D4JA 5K36B 2PNMA 4WUCA 4NXMI 1E3PA 2BA1D 2JT2A 4OO1D 5JEAB 1MG7A 4LCHA 2PO1B 4K0KE 1EA6A 2JEAA 4DV3E 4Z7CA 4YHHE 4JI1E 4HXZA 1IBME 4B3RE 5LMUE 1USUA 1XHKA 1USVA 1K47A 4ZVIA 4OKGA 1HNWI 4LF4E 1Y60A 1I94E 4OO1C 3P3CA 3HJCA 3J81Q 1HNZE 2UUCE 3PRYA 5FLXQ 4MU4A 2HKEA 1UDNA 2CG9A 4ISAA 5LL6R 4JI7I 4QNKA 1YHCA 2JEAB 4DPYA 3J7AM 4FW9A 5JEAC 2F4VE 1H73A 4X64I 2ZM6E 4R1FA 1Z0TA 1B63A 4MU0A 4WUBA 4JI6E 1EI1A 4DPWA 1P42A 4MDTA 3CWVA 1J5EE 1PIEA 3K1JA 1HR0E 4BA2A 2UXCE 3B4TA 4DV1E 4K0KI 5FWKA 4DV3I 5ELWA 4JI1I 4YHHI 2JEBA 2A2CA 1IBMI 4DV7E 5LMUI 2E5LE 2VQFE 1Z0WA 1I94I 2UXDE 2AE8A 3B78A 4BA2B 4DR7E 3WU6A 3T1HE 2NN6A 1OYSA 1S16A 3J81C 4DPUA 4MU3A 2V2QA 2BM0A 5FLXC 4M1KA 2GO4A 1S4EA 2BM1A 3B8HA 2JEBB 3L7ZA 2F4VI 5A2QQ 2ZM6I 1Z0BA 3HULA 4MU1A 2UUAI 4JI6I 4YY3E 3M85G 1E3HA 4MQYA 3JAMQ 2J65A 1J5EI 2Z5BA 3CDIA 4PRXA 4X62E 4JI3E 1HR0I 2UXCI 3QT6A 5K36E 1N0UA 2NN6B 5K36F 4DR3I 4DV1I 2PO0A 4LCFA 3L7ZB 3B82A 4DV7I 4HACA 1KVKA 2E5LI 5IT9C 2VQFI 2X7IA 1UDQA 2JE6A 2UU9E 2V2ZA 2UXDI 2Z5BB 4QNJA 4LCGA 4JI8I 4DR7I 1KKHA 5DRRA 1H72C 4AIMA 1VISA 4OZEA 3ZZTA 3ZKBA 1ZXMA 4U3BA 4GQUA 1Y4SA 4LFAI 2PO0B 4HACB 1XNQE 1KIJA 4B3SE 4LF5E 2PNLA 4JI0E 3GLLA 4DR6E 2IOPA 2F1DA 2JE6B 4YY3I 4HY1A 5A2QC 3P76A 5IWAE 2VQEE 4LF7E 2WP8B 4X62I 1UDOA 4IZJD 4B3TE 2DEJA 3F0NA 3JAMC 5DROA 4LOMA 2CZ9A 1IBLI 1HK7A 1Z5AA 5K36D 3ZM7A 4USKA 1IBKI 3KRNA 4LFCE 2VF3A 5C0XE 1QZRA 5C0XF 3ZZ0A 4LF9E 5JEAD 4DV4E 2HHHE 1A6FA 2UU9I 3QT8A 5K36C 3P06A 4DU7A 4IZKA 4DR4I 2O3ZA 4JI5I 1Y6ZA 5C0XA 5GMDA 5L3JA 4AQYE 4JI2E 2Z5EA 4XTJA 3OTOI 1KTVA 4MYUA 2GS8A 4KHPI 4LPFA 5BR8I 3PS3A 1XNQI 2CGEA 1N33I 1XNRE 1ZM3A 3GONA 4LF5I 2BR2A 5DRQA 4DR6I 2BA0G 4OX9E 5IWAI 2VQEI 4LF7I 3GMEA 3H4LA 4IZKB 4DR2E 5C0XB 2Z5CA 3M7NG 1H7SA 1Z0GA 2NN6E 4B3RI 2NN6F 4GKJE 3HKMA 1Z0EA 2ZBKB 4LF4I 1ZM9A 5EL9A 2ZITA 1HNZI 4LF9I 3WU4A 4DV4I 2UUCI 4FW7A 4JG4A 2BR2B 2V8PA 4BA1A 4IFDF 2WP8A 3M85D 2IOQA 1N34E 4DXLA 4AQYI 4JI2I 2Z5CB 4DUYE 3PYFA 2R42A 4DR5E 2LJPA 5C0XC 4IFDA 3PS2A 3V2UC 1XNRI 4RPFA 4NXNE 2Q2EB 2WNRA 1YH8A 1N36E 4BA1B 1FWKA 4AIDA 1DARA 4OX9I 1PKPA 2GQ0A 4DR2I 4IS9A
chains in the Genus database with same CATH topology
4X66E 1D6TA 1NHIA 2UUBE 2HK2A 1HNXE 4NXME 4GKJI 4DV2E 1NHHA 3K85A 3T1HI 4WUDA 1N0VC 1HNWE 1Z5BA 4EMDA 1N34I 4P7AA 4HYMA 4GKKE 1ZM2A 4JI4E 1BKNA 4KQVA 3PYEA 3J7AG 1ELOA 1XMOE 4JI3I 1NHJA 1N36I 3ZZUA 4N3OA 1H7UA 4X64E 3LPSA 4DPXA 2BV3A 3PYGA 2UUBI 1HNXI 2EFGA 1U2RA 1Z5CA 2V34A 4DV2I 2O1WA 1NZ0A 4DU8A 2XEXA 4DV5E 2OI2A 4PU9A 4URLA 1RREA 4FWDA 3WU5A 4B3SI 4UTGA 4DR1E 4GKKI 2UXBE 1PVGA 4JI0I 4JI4I 4B3ME 5LMNE 3K17A 1XMQE 1FJGE 4X65E 3J80Q 1H74A 1XMOI 4P52A 4LFBE 4B3TI 2O1UA 3PYDA 2DEIA 3WU3A 5GMEA 3ZKDA 2UUAE 2X36A 4LFCI 4JV5E 3Q1QA 3Q6MA 1WUUA 1Z0CA 2HHHI 1FI4A 2E1RA 4DR3E 4DV5I 5IT9Q 2V2VA 1FKAE 1N32E 3T1YE 1Z59A 4LF8E 4DV6E 4LF6E 3QT5A 4DR1I 2UXBI 1UEKA 4JI8E 4DV0E 2O1TA 4B3MI 4I3HA 5LMNI 2A2DA 4PRVA 4JYAE 1XMQI 1FJGI 4X65I 4LFAE 1Z0VA 3V5RA 2WW4A 4LFBI 3LNUA 4USMA 1Y4UA 4DUZE 2J7KA 1FNMA 3J80C 1RR9A 4FN5A 4Z7YA 4JV5I 3M6AA 1B62A 1ZM4A 1OJ4A 4FWGA 4MYTA 4ED4A 1IBLE 3QT7A 2HFSA 1IBKE 4IZJA 1N32I 3T1YI 4DUYI 1ZXNA 4DR5I 2AJ4A 4DPTA 2HFUA 4UT4A 1MX0A 1MU5A 4LF8I 4DV6I 4LF6I 4NXNI 4JI7E 4DR4E 4JI5E 4DV0I 4FWHA 2HK3A 2O1VA 3OTOE 2HKJA 4JYAI 3Q6NA 3LTOA 4IZJB 4X66I 4KHPE 5BR8E 2R3VA 2NPFA 1FWLA 4DUZI 1N33E 3D4JA 2PNMA 4WUCA 4NXMI 1MG7A 4K0KE 1EA6A 4DV3E 4Z7CA 4YHHE 4JI1E 4HXZA 1IBME 4B3RE 5LMUE 1USUA 1XHKA 1USVA 1K47A 4ZVIA 1HNWI 4LF4E 1I94E 3HJCA 3J81Q 1HNZE 2UUCE 3PRYA 5FLXQ 2HKEA 2CG9A 5LL6R 4JI7I 4DPYA 3J7AM 4FW9A 2F4VE 1H73A 4X64I 2ZM6E 4R1FA 1Z0TA 1B63A 4WUBA 4JI6E 1EI1A 4DPWA 3CWVA 1J5EE 1PIEA 3K1JA 1HR0E 2UXCE 4DV1E 4K0KI 5FWKA 4DV3I 4JI1I 4YHHI 2A2CA 1IBMI 4DV7E 5LMUI 2E5LE 2VQFE 1Z0WA 1I94I 2UXDE 3B78A 4DR7E 3WU6A 3T1HE 3J81C 1S16A 4DPUA 2V2QA 2BM0A 5FLXC 4M1KA 1S4EA 2BM1A 3B8HA 2F4VI 5A2QQ 2ZM6I 1Z0BA 3HULA 2UUAI 4JI6I 4YY3E 3JAMQ 1J5EI 2Z5BA 4PRXA 4X62E 4JI3E 1HR0I 2UXCI 3QT6A 1N0UA 4DR3I 4DV1I 3B82A 4DV7I 4HACA 1KVKA 2E5LI 5IT9C 2VQFI 2X7IA 2UU9E 2V2ZA 2UXDI 2Z5BB 4JI8I 4DR7I 1KKHA 1H72C 1VISA 3ZZTA 3ZKBA 1ZXMA 1Y4SA 4LFAI 4HACB 1XNQE 1KIJA 4B3SE 4LF5E 2PNLA 4JI0E 4DR6E 2IOPA 4YY3I 4HY1A 5A2QC 5IWAE 2VQEE 4LF7E 4X62I 4IZJD 4B3TE 2DEJA 3F0NA 3JAMC 2CZ9A 1IBLI 1HK7A 1Z5AA 3ZM7A 4USKA 1IBKI 4LFCE 2VF3A 1QZRA 3ZZ0A 4LF9E 4DV4E 2HHHE 1A6FA 2UU9I 3QT8A 3P06A 4DU7A 4IZKA 4DR4I 4JI5I 1Y6ZA 4JI2E 5GMDA 5L3JA 4AQYE 2Z5EA 4XTJA 3OTOI 1KTVA 4MYUA 2GS8A 4KHPI 5BR8I 1XNQI 2CGEA 1N33I 1XNRE 1ZM3A 3GONA 4LF5I 4DR6I 4OX9E 5IWAI 2VQEI 4LF7I 3H4LA 4IZKB 4DR2E 2Z5CA 1H7SA 1Z0GA 4B3RI 4GKJE 1Z0EA 2ZBKB 4LF4I 1ZM9A 2ZITA 1HNZI 4LF9I 3WU4A 4DV4I 2UUCI 4JG4A 2V8PA 1N34E 2IOQA 4DXLA 4AQYI 4JI2I 2Z5CB 4DUYE 3PYFA 2R42A 4DR5E 2LJPA 3V2UC 1XNRI 4RPFA 4NXNE 2Q2EB 1N36E 1FWKA 1DARA 4OX9I 1PKPA 2GQ0A 4DR2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 E;  1D6T A;  1NHI A;  2UUB E;  2HK2 A;  1HNX E;  4NXM E;  4GKJ I;  4DV2 E;  1NHH A;  3T1H I;  4WUD A;  1N0V C;  1HNW E;  1Z5B A;  4EMD A;  1N34 I;  4P7A A;  4HYM A;  4GKK E;  1ZM2 A;  4JI4 E;  1BKN A;  4KQV A;  3PYE A;  3J7A G;  1ELO A;  1XMO E;  4JI3 I;  1NHJ A;  1N36 I;  3ZZU A;  1H7U A;  4X64 E;  3LPS A;  4DPX A;  2BV3 A;  3PYG A;  2UUB I;  1HNX I;  2EFG A;  1U2R A;  1Z5C A;  2V34 A;  4DV2 I;  1NZ0 A;  4DU8 A;  2XEX A;  4DV5 E;  2OI2 A;  4PU9 A;  4URL A;  1RRE A;  4FWD A;  3WU5 A;  4B3S I;  4UTG A;  4DR1 E;  4GKK I;  2UXB E;  1PVG A;  4JI0 I;  4JI4 I;  4B3M E;  5LMN E;  3K17 A;  1XMQ E;  1FJG E;  4X65 E;  3J80 Q;  1H74 A;  1XMO I;  4P52 A;  4LFB E;  4B3T I;  3PYD A;  2DEI A;  3WU3 A;  5GME A;  3ZKD A;  2UUA E;  2X36 A;  4LFC I;  4JV5 E;  3Q1Q A;  1WUU A;  1Z0C A;  2HHH I;  1FI4 A;  2E1R A;  4DR3 E;  4DV5 I;  5IT9 Q;  2V2V A;  1FKA E;  1N32 E;  3T1Y E;  1Z59 A;  4LF8 E;  4DV6 E;  4LF6 E;  3QT5 A;  4DR1 I;  2UXB I;  1UEK A;  4JI8 E;  4DV0 E;  4B3M I;  4I3H A;  5LMN I;  2A2D A;  4PRV A;  4JYA E;  1XMQ I;  1FJG I;  4X65 I;  4LFA E;  1Z0V A;  3V5R A;  2WW4 A;  4LFB I;  3LNU A;  4USM A;  4DUZ E;  2J7K A;  1FNM A;  3J80 C;  1RR9 A;  4FN5 A;  4Z7Y A;  4JV5 I;  3M6A A;  1B62 A;  1ZM4 A;  1OJ4 A;  4FWG A;  4MYT A;  4ED4 A;  1IBL E;  3QT7 A;  2HFS A;  1IBK E;  1N32 I;  3T1Y I;  4DUY I;  1ZXN A;  4DR5 I;  2AJ4 A;  4DPT A;  2HFU A;  4UT4 A;  1MX0 A;  1MU5 A;  4LF8 I;  4DV6 I;  4LF6 I;  4NXN I;  4JI7 E;  4DR4 E;  4JI5 E;  4DV0 I;  4FWH A;  2HK3 A;  3OTO E;  2HKJ A;  4JYA I;  3LTO A;  4X66 I;  4KHP E;  5BR8 E;  2R3V A;  2NPF A;  1FWL A;  4DUZ I;  1N33 E;  3D4J A;  4WUC A;  4NXM I;  1MG7 A;  4K0K E;  1EA6 A;  4DV3 E;  4Z7C A;  4YHH E;  4JI1 E;  4HXZ A;  1IBM E;  4B3R E;  5LMU E;  1XHK A;  1K47 A;  4ZVI A;  1HNW I;  4LF4 E;  1I94 E;  3J81 Q;  1HNZ E;  2UUC E;  5FLX Q;  2HKE A;  5LL6 R;  4JI7 I;  4DPY A;  3J7A M;  4FW9 A;  2F4V E;  1H73 A;  4X64 I;  2ZM6 E;  4R1F A;  1Z0T A;  1B63 A;  4WUB A;  4JI6 E;  1EI1 A;  4DPW A;  3CWV A;  1J5E E;  1PIE A;  3K1J A;  1HR0 E;  2UXC E;  4DV1 E;  4K0K I;  4DV3 I;  4JI1 I;  4YHH I;  2A2C A;  1IBM I;  4DV7 E;  5LMU I;  2E5L E;  2VQF E;  1Z0W A;  1I94 I;  2UXD E;  3B78 A;  4DR7 E;  3WU6 A;  3T1H E;  3J81 C;  1S16 A;  4DPU A;  2V2Q A;  2BM0 A;  5FLX C;  4M1K A;  1S4E A;  2BM1 A;  3B8H A;  2F4V I;  5A2Q Q;  2ZM6 I;  1Z0B A;  3HUL A;  2UUA I;  4JI6 I;  4YY3 E;  3JAM Q;  1J5E I;  4PRX A;  4X62 E;  4JI3 E;  1HR0 I;  2UXC I;  3QT6 A;  1N0U A;  4DR3 I;  4DV1 I;  3B82 A;  4DV7 I;  4HAC A;  1KVK A;  2E5L I;  5IT9 C;  2VQF I;  2X7I A;  2UU9 E;  2V2Z A;  2UXD I;  4JI8 I;  4DR7 I;  1KKH A;  1H72 C;  1VIS A;  3ZZT A;  3ZKB A;  1ZXM A;  4LFA I;  4HAC B;  1XNQ E;  1KIJ A;  4B3S E;  4LF5 E;  4JI0 E;  4DR6 E;  4YY3 I;  4HY1 A;  5A2Q C;  5IWA E;  2VQE E;  4LF7 E;  4X62 I;  4B3T E;  2DEJ A;  3F0N A;  3JAM C;  2CZ9 A;  1IBL I;  1Z5A A;  3ZM7 A;  4USK A;  1IBK I;  4LFC E;  2VF3 A;  1QZR A;  3ZZ0 A;  4LF9 E;  4DV4 E;  2HHH E;  1A6F A;  2UU9 I;  3QT8 A;  4DU7 A;  4DR4 I;  4JI5 I;  4JI2 E;  5GMD A;  5L3J A;  4AQY E;  4XTJ A;  3OTO I;  1KTV A;  4MYU A;  2GS8 A;  4KHP I;  5BR8 I;  1XNQ I;  1N33 I;  1XNR E;  1ZM3 A;  3GON A;  4LF5 I;  4DR6 I;  4OX9 E;  5IWA I;  2VQE I;  4LF7 I;  3H4L A;  4DR2 E;  1H7S A;  1Z0G A;  4B3R I;  4GKJ E;  1Z0E A;  2ZBK B;  4LF4 I;  1ZM9 A;  2ZIT A;  1HNZ I;  4LF9 I;  3WU4 A;  4DV4 I;  2UUC I;  4JG4 A;  2V8P A;  1N34 E;  4JI2 I;  4DXL A;  4AQY I;  4DUY E;  3PYF A;  2R42 A;  4DR5 E;  2LJP A;  3V2U C;  1XNR I;  4RPF A;  4NXN E;  2Q2E B;  1N36 E;  1FWK A;  1DAR A;  4OX9 I;  1PKP A;  4DR2 I; 
#chains in the Genus database with same CATH topology
 4X66 E;  1D6T A;  1NHI A;  2UUB E;  2HK2 A;  2C39 A;  1HNX E;  4OO1 F;  4NXM E;  4GKJ I;  4IFD B;  4DV2 E;  2PNZ A;  2NN6 D;  1NHH A;  3K85 A;  2WNR B;  3UHM A;  3T1H I;  4WUD A;  4OO1 A;  4FW5 A;  1N0V C;  4U3D A;  1HNW E;  3U1K A;  1Z5B A;  2NN6 C;  4EMD A;  1N34 I;  4P7A A;  2C39 B;  4HYM A;  2IER A;  4GKK E;  1ZM2 A;  4JI4 E;  1OYP A;  1BKN A;  4KQV A;  3PYE A;  5JEA A;  3J7A G;  1ELO A;  1XMO E;  4JI3 I;  1NHJ A;  1N36 I;  3ZZU A;  4N3O A;  1H7U A;  4OO1 B;  4X64 E;  3LPS A;  4DPX A;  2BV3 A;  3PYG A;  2UUB I;  1HNX I;  2EFG A;  1U2R A;  4FW4 A;  1Z5C A;  2V34 A;  4DV2 I;  2O1W A;  1NZ0 A;  4DU8 A;  2XEX A;  4DV5 E;  4PU9 A;  2OI2 A;  3NZK A;  4URL A;  1RRE A;  2BA1 G;  4FWD A;  4AM3 A;  3U1Y A;  2BA0 D;  3WU5 A;  4B3S I;  4UTG A;  4DR1 E;  4GKK I;  2UXB E;  1PVG A;  4JI0 I;  2C37 A;  4JI4 I;  3M7N D;  4B3M E;  5LMN E;  3K17 A;  1XMQ E;  1FJG E;  3PS1 A;  4X65 E;  3J80 Q;  1H74 A;  1XMO I;  4P52 A;  4LFB E;  4B3T I;  3P3G A;  3P3E A;  2O1U A;  3PYD A;  2DEI A;  3WU3 A;  5GME A;  3ZKD A;  2UUA E;  2X36 A;  4LFC I;  4JV5 E;  3Q1Q A;  3Q6M A;  1WUU A;  1Z0C A;  2HHH I;  1FI4 A;  2C37 B;  2E1R A;  5C0X D;  4IFD E;  4DR3 E;  2IES A;  4DV5 I;  5IT9 Q;  2V2V A;  1FKA E;  1N32 E;  3T1Y E;  1XXE A;  2PO2 A;  5DNX A;  4J3D A;  1Z59 A;  4NBQ A;  4LF8 E;  4DV6 E;  4LF6 E;  3QT5 A;  4DR1 I;  2UXB I;  1UEK A;  4JI8 E;  4FW6 A;  4DV0 E;  2O1T A;  4B3M I;  4I3H A;  5LMN I;  2A2D A;  4PRV A;  4JYA E;  1XMQ I;  1FJG I;  4X65 I;  3DD6 A;  4LFA E;  1Z0V A;  3V5R A;  2WW4 A;  4LFB I;  3LNU A;  4USM A;  1Y4U A;  2PO2 B;  4DUZ E;  2J7K A;  1FNM A;  3J80 C;  4OO1 E;  1RR9 A;  3CDJ A;  4FN5 A;  4Z7Y A;  4JV5 I;  3M6A A;  5DNL A;  1B62 A;  1VI7 A;  1ZM4 A;  2GO3 A;  1RHY A;  1OJ4 A;  4FWG A;  4MYT A;  4ED4 A;  1IBL E;  2CVE A;  3QT7 A;  2HFS A;  5JEA E;  4IZJ A;  1IBK E;  5JEA F;  1N32 I;  4IFD D;  1Y5Y A;  3T1Y I;  4DUY I;  1OYR A;  2C38 A;  1ZXN A;  5K36 A;  4DR5 I;  2AJ4 A;  5DRP A;  4DPT A;  1R6M A;  2HFU A;  2VES A;  4UT4 A;  1MX0 A;  2PNZ B;  1R6L A;  1MU5 A;  4LF8 I;  2PO1 A;  4DV6 I;  4LF6 I;  4NXN I;  4JI7 E;  4DR4 E;  1UDS A;  5EKW A;  4IFD C;  4JI5 E;  4DV0 I;  4FWH A;  2HK3 A;  3GCM A;  2O1V A;  3OTO E;  2HKJ A;  4JYA I;  3H1C A;  3Q6N A;  3LTO A;  4FW3 A;  4IZJ B;  4X66 I;  4KHP E;  5BR8 E;  2R3V A;  2NPF A;  1FWL A;  4DUZ I;  2C38 B;  1N33 E;  3D4J A;  5K36 B;  2PNM A;  4WUC A;  4NXM I;  1E3P A;  2BA1 D;  2JT2 A;  4OO1 D;  5JEA B;  1MG7 A;  4LCH A;  2PO1 B;  4K0K E;  1EA6 A;  2JEA A;  4DV3 E;  4Z7C A;  4YHH E;  4JI1 E;  4HXZ A;  1IBM E;  4B3R E;  5LMU E;  1USU A;  1XHK A;  1USV A;  1K47 A;  4ZVI A;  4OKG A;  1HNW I;  4LF4 E;  1Y60 A;  1I94 E;  4OO1 C;  3P3C A;  3HJC A;  3J81 Q;  1HNZ E;  2UUC E;  3PRY A;  5FLX Q;  4MU4 A;  2HKE A;  1UDN A;  2CG9 A;  4ISA A;  5LL6 R;  4JI7 I;  4QNK A;  1YHC A;  2JEA B;  4DPY A;  3J7A M;  4FW9 A;  5JEA C;  2F4V E;  1H73 A;  4X64 I;  2ZM6 E;  4R1F A;  1Z0T A;  1B63 A;  4MU0 A;  4WUB A;  4JI6 E;  1EI1 A;  4DPW A;  1P42 A;  4MDT A;  3CWV A;  1J5E E;  1PIE A;  3K1J A;  1HR0 E;  4BA2 A;  2UXC E;  3B4T A;  4DV1 E;  4K0K I;  5FWK A;  4DV3 I;  5ELW A;  4JI1 I;  4YHH I;  2JEB A;  2A2C A;  1IBM I;  4DV7 E;  5LMU I;  2E5L E;  2VQF E;  1Z0W A;  1I94 I;  2UXD E;  2AE8 A;  3B78 A;  4BA2 B;  4DR7 E;  3WU6 A;  3T1H E;  2NN6 A;  1OYS A;  1S16 A;  3J81 C;  4DPU A;  4MU3 A;  2V2Q A;  2BM0 A;  5FLX C;  4M1K A;  2GO4 A;  1S4E A;  2BM1 A;  3B8H A;  2JEB B;  3L7Z A;  2F4V I;  5A2Q Q;  2ZM6 I;  1Z0B A;  3HUL A;  4MU1 A;  2UUA I;  4JI6 I;  4YY3 E;  3M85 G;  1E3H A;  4MQY A;  3JAM Q;  2J65 A;  1J5E I;  2Z5B A;  3CDI A;  4PRX A;  4X62 E;  4JI3 E;  1HR0 I;  2UXC I;  3QT6 A;  5K36 E;  1N0U A;  2NN6 B;  5K36 F;  4DR3 I;  4DV1 I;  2PO0 A;  4LCF A;  3L7Z B;  3B82 A;  4DV7 I;  4HAC A;  1KVK A;  2E5L I;  5IT9 C;  2VQF I;  2X7I A;  1UDQ A;  2JE6 A;  2UU9 E;  2V2Z A;  2UXD I;  2Z5B B;  4QNJ A;  4LCG A;  4JI8 I;  4DR7 I;  1KKH A;  5DRR A;  1H72 C;  4AIM A;  1VIS A;  4OZE A;  3ZZT A;  3ZKB A;  1ZXM A;  4U3B A;  4GQU A;  1Y4S A;  4LFA I;  2PO0 B;  4HAC B;  1XNQ E;  1KIJ A;  4B3S E;  4LF5 E;  2PNL A;  4JI0 E;  3GLL A;  4DR6 E;  2IOP A;  2F1D A;  2JE6 B;  4YY3 I;  4HY1 A;  5A2Q C;  3P76 A;  5IWA E;  2VQE E;  4LF7 E;  2WP8 B;  4X62 I;  1UDO A;  4IZJ D;  4B3T E;  2DEJ A;  3F0N A;  3JAM C;  5DRO A;  4LOM A;  2CZ9 A;  1IBL I;  1HK7 A;  1Z5A A;  5K36 D;  3ZM7 A;  4USK A;  1IBK I;  3KRN A;  4LFC E;  2VF3 A;  5C0X E;  1QZR A;  5C0X F;  3ZZ0 A;  4LF9 E;  5JEA D;  4DV4 E;  2HHH E;  1A6F A;  2UU9 I;  3QT8 A;  5K36 C;  3P06 A;  4DU7 A;  4IZK A;  4DR4 I;  2O3Z A;  4JI5 I;  1Y6Z A;  5C0X A;  5GMD A;  5L3J A;  4AQY E;  4JI2 E;  2Z5E A;  4XTJ A;  3OTO I;  1KTV A;  4MYU A;  2GS8 A;  4KHP I;  4LPF A;  5BR8 I;  3PS3 A;  1XNQ I;  2CGE A;  1N33 I;  1XNR E;  1ZM3 A;  3GON A;  4LF5 I;  2BR2 A;  5DRQ A;  4DR6 I;  2BA0 G;  4OX9 E;  5IWA I;  2VQE I;  4LF7 I;  3GME A;  3H4L A;  4IZK B;  4DR2 E;  5C0X B;  2Z5C A;  3M7N G;  1H7S A;  1Z0G A;  2NN6 E;  4B3R I;  2NN6 F;  4GKJ E;  3HKM A;  1Z0E A;  2ZBK B;  4LF4 I;  1ZM9 A;  5EL9 A;  2ZIT A;  1HNZ I;  4LF9 I;  3WU4 A;  4DV4 I;  2UUC I;  4FW7 A;  4JG4 A;  2BR2 B;  2V8P A;  4BA1 A;  4IFD F;  2WP8 A;  3M85 D;  2IOQ A;  1N34 E;  4DXL A;  4AQY I;  4JI2 I;  2Z5C B;  4DUY E;  3PYF A;  2R42 A;  4DR5 E;  2LJP A;  5C0X C;  4IFD A;  3PS2 A;  3V2U C;  1XNR I;  4RPF A;  4NXN E;  2Q2E B;  2WNR A;  1YH8 A;  1N36 E;  4BA1 B;  1FWK A;  4AID A;  1DAR A;  4OX9 I;  1PKP A;  2GQ0 A;  4DR2 I;  4IS9 A; 
#chains in the Genus database with same CATH homology
 4X66 E;  1D6T A;  1NHI A;  2UUB E;  2HK2 A;  1HNX E;  4NXM E;  4GKJ I;  4DV2 E;  1NHH A;  3K85 A;  3T1H I;  4WUD A;  1N0V C;  1HNW E;  1Z5B A;  4EMD A;  1N34 I;  4P7A A;  4HYM A;  4GKK E;  1ZM2 A;  4JI4 E;  1BKN A;  4KQV A;  3PYE A;  3J7A G;  1ELO A;  1XMO E;  4JI3 I;  1NHJ A;  1N36 I;  3ZZU A;  4N3O A;  1H7U A;  4X64 E;  3LPS A;  4DPX A;  2BV3 A;  3PYG A;  2UUB I;  1HNX I;  2EFG A;  1U2R A;  1Z5C A;  2V34 A;  4DV2 I;  2O1W A;  1NZ0 A;  4DU8 A;  2XEX A;  4DV5 E;  2OI2 A;  4PU9 A;  4URL A;  1RRE A;  4FWD A;  3WU5 A;  4B3S I;  4UTG A;  4DR1 E;  4GKK I;  2UXB E;  1PVG A;  4JI0 I;  4JI4 I;  4B3M E;  5LMN E;  3K17 A;  1XMQ E;  1FJG E;  4X65 E;  3J80 Q;  1H74 A;  1XMO I;  4P52 A;  4LFB E;  4B3T I;  2O1U A;  3PYD A;  2DEI A;  3WU3 A;  5GME A;  3ZKD A;  2UUA E;  2X36 A;  4LFC I;  4JV5 E;  3Q1Q A;  3Q6M A;  1WUU A;  1Z0C A;  2HHH I;  1FI4 A;  2E1R A;  4DR3 E;  4DV5 I;  5IT9 Q;  2V2V A;  1FKA E;  1N32 E;  3T1Y E;  1Z59 A;  4LF8 E;  4DV6 E;  4LF6 E;  3QT5 A;  4DR1 I;  2UXB I;  1UEK A;  4JI8 E;  4DV0 E;  2O1T A;  4B3M I;  4I3H A;  5LMN I;  2A2D A;  4PRV A;  4JYA E;  1XMQ I;  1FJG I;  4X65 I;  4LFA E;  1Z0V A;  3V5R A;  2WW4 A;  4LFB I;  3LNU A;  4USM A;  1Y4U A;  4DUZ E;  2J7K A;  1FNM A;  3J80 C;  1RR9 A;  4FN5 A;  4Z7Y A;  4JV5 I;  3M6A A;  1B62 A;  1ZM4 A;  1OJ4 A;  4FWG A;  4MYT A;  4ED4 A;  1IBL E;  3QT7 A;  2HFS A;  1IBK E;  4IZJ A;  1N32 I;  3T1Y I;  4DUY I;  1ZXN A;  4DR5 I;  2AJ4 A;  4DPT A;  2HFU A;  4UT4 A;  1MX0 A;  1MU5 A;  4LF8 I;  4DV6 I;  4LF6 I;  4NXN I;  4JI7 E;  4DR4 E;  4JI5 E;  4DV0 I;  4FWH A;  2HK3 A;  2O1V A;  3OTO E;  2HKJ A;  4JYA I;  3Q6N A;  3LTO A;  4IZJ B;  4X66 I;  4KHP E;  5BR8 E;  2R3V A;  2NPF A;  1FWL A;  4DUZ I;  1N33 E;  3D4J A;  2PNM A;  4WUC A;  4NXM I;  1MG7 A;  4K0K E;  1EA6 A;  4DV3 E;  4Z7C A;  4YHH E;  4JI1 E;  4HXZ A;  1IBM E;  4B3R E;  5LMU E;  1USU A;  1XHK A;  1USV A;  1K47 A;  4ZVI A;  1HNW I;  4LF4 E;  1I94 E;  3HJC A;  3J81 Q;  1HNZ E;  2UUC E;  3PRY A;  5FLX Q;  2HKE A;  2CG9 A;  5LL6 R;  4JI7 I;  4DPY A;  3J7A M;  4FW9 A;  2F4V E;  1H73 A;  4X64 I;  2ZM6 E;  4R1F A;  1Z0T A;  1B63 A;  4WUB A;  4JI6 E;  1EI1 A;  4DPW A;  3CWV A;  1J5E E;  1PIE A;  3K1J A;  1HR0 E;  2UXC E;  4DV1 E;  4K0K I;  5FWK A;  4DV3 I;  4JI1 I;  4YHH I;  2A2C A;  1IBM I;  4DV7 E;  5LMU I;  2E5L E;  2VQF E;  1Z0W A;  1I94 I;  2UXD E;  3B78 A;  4DR7 E;  3WU6 A;  3T1H E;  3J81 C;  1S16 A;  4DPU A;  2V2Q A;  2BM0 A;  5FLX C;  4M1K A;  1S4E A;  2BM1 A;  3B8H A;  2F4V I;  5A2Q Q;  2ZM6 I;  1Z0B A;  3HUL A;  2UUA I;  4JI6 I;  4YY3 E;  3JAM Q;  1J5E I;  2Z5B A;  4PRX A;  4X62 E;  4JI3 E;  1HR0 I;  2UXC I;  3QT6 A;  1N0U A;  4DR3 I;  4DV1 I;  3B82 A;  4DV7 I;  4HAC A;  1KVK A;  2E5L I;  5IT9 C;  2VQF I;  2X7I A;  2UU9 E;  2V2Z A;  2UXD I;  2Z5B B;  4JI8 I;  4DR7 I;  1KKH A;  1H72 C;  1VIS A;  3ZZT A;  3ZKB A;  1ZXM A;  1Y4S A;  4LFA I;  4HAC B;  1XNQ E;  1KIJ A;  4B3S E;  4LF5 E;  2PNL A;  4JI0 E;  4DR6 E;  2IOP A;  4YY3 I;  4HY1 A;  5A2Q C;  5IWA E;  2VQE E;  4LF7 E;  4X62 I;  4IZJ D;  4B3T E;  2DEJ A;  3F0N A;  3JAM C;  2CZ9 A;  1IBL I;  1HK7 A;  1Z5A A;  3ZM7 A;  4USK A;  1IBK I;  4LFC E;  2VF3 A;  1QZR A;  3ZZ0 A;  4LF9 E;  4DV4 E;  2HHH E;  1A6F A;  2UU9 I;  3QT8 A;  3P06 A;  4DU7 A;  4IZK A;  4DR4 I;  4JI5 I;  1Y6Z A;  4JI2 E;  5GMD A;  5L3J A;  4AQY E;  2Z5E A;  4XTJ A;  3OTO I;  1KTV A;  4MYU A;  2GS8 A;  4KHP I;  5BR8 I;  1XNQ I;  2CGE A;  1N33 I;  1XNR E;  1ZM3 A;  3GON A;  4LF5 I;  4DR6 I;  4OX9 E;  5IWA I;  2VQE I;  4LF7 I;  3H4L A;  4IZK B;  4DR2 E;  2Z5C A;  1H7S A;  1Z0G A;  4B3R I;  4GKJ E;  1Z0E A;  2ZBK B;  4LF4 I;  1ZM9 A;  2ZIT A;  1HNZ I;  4LF9 I;  3WU4 A;  4DV4 I;  2UUC I;  4JG4 A;  2V8P A;  1N34 E;  2IOQ A;  4DXL A;  4AQY I;  4JI2 I;  2Z5C B;  4DUY E;  3PYF A;  2R42 A;  4DR5 E;  2LJP A;  3V2U C;  1XNR I;  4RPF A;  4NXN E;  2Q2E B;  1N36 E;  1FWK A;  1DAR A;  4OX9 I;  1PKP A;  2GQ0 A;  4DR2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...