3T1YE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3t1yE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1yE02
3D4JA 1PVGA 3WU6A 4DV1I 4DR4I 5CFFE 1YZ9A 2X7IA 3JAMQ 4Z7CA 2BM0A 3J7Yp 4ED4A 4DUYI 4P52A 1HNWE 1N32I 1MG7A 4JI6E 3ZKDA 3P1XA 2LJHA 4WFTA 4LF4E 1S16A 3ADJA 4DR5E 2RS7A 1FWKA 4DXLA 1XNQI 4JI8E 3HULA 2V8PA 1XMQE 4FN5A 1WHNA 3ADGA 4WUBA 2HHHE 3ZZ0A 5LMNI 2LUPB 4B3SE 3VYYA 1H7UA 2NUFA 2ZITA 2KHXA 4EMDA 1RQ0A 4LFCE 2UXBE 3T1HE 4LF6I 3PYDA 2EFGA 1UILA 1IBMI 1UEKA 2J7KA 1FI4A 3K17A 3ZKBA 4X65I 1Z59A 4DV7I 4JI2E 4DR5I 1NHJA 4ZVIA 2F4VE 4JI8I 2L33A 1KVKA 5A2QC 4RPFA 4B3RI 1XMQI 1IBKE 4USKA 4K0KE 5GMEA 4LFAI 1MU5A 4P7AA 1Z0VA 1XNRI 4X62E 3LLHA 3M6AA 4M2ZA 1KTVA 4HACA 5LL6R 1N33E 2UUBE 4LF8E 4NXNE 3T1HI 3ZZTA 4MYUA 4PU9A 4DV0E 2VQEE 1WUUA 4GKJI 3ZM7A 3PYFA 2NPFA 5FLXC 2IHR1 3ADLA 1ELOA 4JI2I 5A2QQ 4OX9E 4DPYA 1H73A 1U2RA 4DR7E 3T1YE 1FJGI 2LTRA 4K0KI 1FKAE 1IBLE 3ADIA 3B78A 2A2CA 4B3MI 4DV3I 4YHHI 2AJ4A 3VYXA 4JG4A 4JI4I 2UUBI 1N33I 2DB2A 3WU4A 4OOGC 4UT4A 4NXNI 4LF8I 1X49A 4DV5E 3J7AM 2VQEI 4HY1A 5FLXQ 1Z5CA 1QZRA 3QT7A 2NUEA 1H7SA 2HFSA 2A2DA 1YYKA 1H72C 1I94I 4JI7E 4LFBE 1K47A 1MX0A 5LMUE 2E1RA 4DR7I 4YY3I 2LUQA 2B7TA 2UU9E 4WUDA 2VF3A 4DV6E 1NZ0A 3GONA 5GMDA 1N34E 2X36A 1HNZE 5BR8E 1J5EI 2LRSA 3WU5A 4DUZE 4DV5I 1XMOI 4FW9A 1A6FA 1ZM3A 4X64E 3B82A 1T4OA 4B3TE 4JI1E 1N0UA 2NUGA 4JI3E 4LFBI 4FWDA 5LMUI 1EA6A 3LNUA 1RC7A 3LPSA 2BV3A 2UUCE 4I3HA 4DV2E 2UU9I 1YYOA 2VQFE 1HNWI 1N36E 4JI6I 1Z0GA 1HNZI 2HFUA 5BR8I 4LF4I 2CPNA 3H4LA 3B8HA 4DU7A 3OTOE 4NXME 1EKZA 1GQEA 1Z0WA 2WW4A 4X64I 1X47A 4B3TI 4LF9E 4X66E 4MYTA 1WHQA 2HHHI 2RSMA 2R42A 2HK3A 2N3HA 1X48A 2E5LE 4M30A 4B3SI 2UXCE 3QT6A 4KHPE 4LFCI 2UXBI 3J7AG 4JV5E 1N36I 4LF5E 2ZM6E 2OI2A 2L3JA 1FNMA 1Z5AA 1NHHA 4DR1E 2F4VI 4PRXA 4JI0E 2LTSA 1HR0E 3OTOI 2UXDE 4DR3E 1IBKI 4R1FA 1BKNA 4HYMA 3V2UC 4LF9I 1N0VC 4X62I 1HNXE 1PIEA 2E5LI 1UHZA 4FWGA 2B7VA 2UXCI 2DEIA 2GS8A 2YT4A 2MDRA 1B63A 2L3CA 4DR4E 2R3VA 4DV0I 4JV5I 1XHKA 2RTXA 4DV4E 2RS6A 3J81C 1O0WA 1DI2A 1FWLA 3QT5A 4OX9I 4DR1I 4DKKA 4JI0I 1HR0I 4GKKE 2JY9A 1ZBTA 4DR3I 3T1YI 4USMA 3C4TA 4HACB 1XNQE 1Z0EA 1IBLI 2L2NA 4JYAE 1KIJA 4DU8A 4AQYE 2BM1A 1ZXNA 3LTOA 3V5RA 1H74A 3J81Q 5LMNE 4DV4I 2HKEA 4KQVA 1S4EA 4DPXA 4LF6E 4WYQB 4FWHA 2JVAA 4JI7I 1YYWA 4GKKI 1IBME 4PRVA 4LF7E 4DR2E 2V2QA 1T4NA 4X65E 3PYGA 5IWAE 1Z0BA 2HK2A 4DV7E 2LJPA 4JYAI 1KKHA 3C4BA 4DV6I 1RR9A 4AQYI 4B3RE 1N34I 5IT9C 4LFAE 3K1JA 1XNRE 4DUZI 4DR6E 4URLA 4M1KA 2N3GA 3F0NA 1J26A 4JI5E 2NA2A 2V2VA 4JI1I 4JI3I 2B3TB 4GKJE 2DEJA 4LF7I 1NHIA 4DR2I 2UUAE 2XEXA 5IWAI 3QT8A 4UTGA 1ZM2A 2UUCI 4DV2I 4DPTA 1PKPA 5IT9Q 2VQFI 4DPWA 2DIXA 4WUCA 2LBSB 1FJGE 1D6TA 1EI1A 3HTXA 1QU6A 3PYEA 1T4LB 1ZM9A 4B3ME 2EZ6A 2ZBKB 4DR6I 4NXMI 4DV3E 4YHHE 4HXZA 4JI5I 2V34A 4JI4E 3ZZUA 4DPUA 4X66I 2Q2EB 2UUAI 4XTJA 1Z5BA 3J80C 4Z7YA 1I94E 1RREA 4KHPI 1STUA 2L2KB 2CZ9A 2DMYA 4DV1E 1DARA 4LF5I 4YY3E 2ZM6I 3CWVA 1VISA 1B62A 4DUYE 1ZM4A 3JAMC 1OJ4A 2HKJA 1N32E 2UXDI 4X8WA 3Q1QA 1J5EE 3WU3A 1ZXMA 5L3JA 2L2MA 1Z0TA 3J80Q 1XMOE 1HNXI 1Z0CA 2V2ZA
chains in the Genus database with same CATH superfamily
3AUZA 2C37A 1P42A 3D4JA 5JEAB 1UDNA 2EL5A 1PVGA 1X3CA 2RPCA 4P7DA 1Y60A 4OO1A 3HKMA 3WU6A 4DV1I 4DR4I 3MSWA 5CFFE 5A6AA 4BA2A 1YZ9A 5K36E 2ELYA 2EQ1A 2X7IA 3JAMQ 4Z7CA 5DNXA 1YHCA 2BM0A 3J7Yp 4ED4A 2EOFA 4DUYI 4P52A 2JOXA 3MHHC 4GZNC 2YPNA 1HNWE 2JE6A 2WBTA 1N32I 4F6MA 1MG7A 1AH5A 1MEYC 4LTYA 4JI6E 3BGHA 1Y4UA 2JXPA 2HC5A 1LLMC 3EPLA 3ZKDA 2LO3A 4IZKB 3P1XA 2LJHA 1OYSA 4QNJA 4WFTA 4LF4E 3JTZA 3ADJA 4DR5E 2RS7A 1FWKA 1S16A 4DXLA 1XNQI 1JK2A 4JI8E 1X6EA 2V83A 2VRDA 4F9AB 2EPRA 3HULA 2V8PA 2LJUA 1ZU1A 2JYAA 1XMQE 5DNYA 2JPAA 4FN5A 2ODRD 4R2PA 1WHNA 3ADGA 4J8ZA 4WUBA 2WBUA 2BA0G 2GO4A 2WP8A 3ECRA 2HHHE 3GCMA 4MLQA 2PNZB 5K36C 3ZZ0A 2YZTA 2LCEA 3H09A 3HQ1A 5LMNI 2LUPB 2EJ4A 3AV0A 4BMJA 4GQUA 4B3SE 2ENHA 3VYYA 1H7UA 2NUFA 2EPAA 2KHXA 2ZITA 4EMDA 1RQ0A 3EPKA 4LFCE 2UXBE 3T1HE 1USUA 4LF6I 2HJJA 3PYDA 2RQLA 2EFGA 2GPIA 2WBSA 1UILA 1IBMI 2EM4A 2PO2A 1UEKA 2JEBB 2J7KA 1FI4A 4N4RB 3K17A 1N3GA 3ZKBA 4X65I 1Z59A 2Z5CB 3C6KA 4DV7I 5C0XF 4JI2E 3P76A 4DR5I 1NHJA 2R1FA 1BBOA 2F4VE 4ZVIA 4KZSA 4JI8I 2L33A 4TUGA 1KVKA 3EPHA 1YFHA 2ENCA 5A2QC 4RPFA 4B3RI 1XMQI 1IBKE 2EM7A 5C0XA 5T6JA 3K85A 4USKA 4K0KE 2EMKA 1X6FA 1BBGA 1DQ3A 2CTDA 1MU5A 5GMEA 4LFAI 4P7AA 1Z0VA 3KWRA 4MQYA 2DSYA 4LPFA 4X62E 3LLHA 1XNRI 5AASA 3M6AA 4M2ZA 4I8OA 1KTVA 4HACA 5LL6R 4R2QA 2DGCA 2EMYA 2YTFA 1N33E 1R6MA 2UUBE 2YTEA 4FW6A 2ADRA 2YRKA 5AE1A 4LF8E 4NXNE 2IERA 3CDIA 4U3BA 2EPNA 5JEAE 3T1HI 5KL6A 4MYUA 3ZZTA 1AAYA 2BR2A 4DV0E 4PU9A 2VQEE 1YSAC 2F8BA 5DNLA 1WUUA 4NHRA 4GKJI 3ZM7A 2EN1A 3PYFA 3F6HA 3QG5C 3JU0A 2NPFA 2EMXA 3PS3A 1A1IA 5FLXC 2IHR1 5KL5A 2NN6D 4MLVA 3ADLA 1ELOA 1UDQA 4LCHA 5A2QQ 4JI2I 4OX9E 4DPYA 4R2EA 1XXEA 2MKDA 2EOJA 1H73A 1U2RA 4DR7E 4HEIA 2YWQA 3T1YE 5IXMB 2PO0A 1YPNA 1FJGI 2LTRA 4K0KI 3IWDA 1FKAE 1IBLE 2PO1B 3ADIA 3B78A 2A2CA 1NEIA 4R2DA 1DGCA 2EMCA 3C6MA 4IZKA 4B3MI 2JEAA 2L92A 2EE8A 2EM2A 3M85G 4DV3I 4YHHI 2AJ4A 2L8TA 2V89A 2MC5A 3VYXA 4JG4A 5JEAC 2UUBI 2DB2A 4JI4I 1N33I 1X5WA 2EPXA 2V85A 4OOGC 1B69A 1YUJA 3WU4A 1EH8A 4UT4A 4NXNI 4LF8I 1ZBQA 1X49A 4DV5E 3J7AM 2VQEI 1PDAA 2EM6A 1WRJA 4O24A 4HY1A 5FLXQ 1R6LA 1QZRA 1Z5CA 4OO1D 4ZYEA 4MU1A 5KL7A 3BIDA 3QT7A 3IWBA 2NUEA 1H7SA 2HFSA 2EPMX 2A2DA 1YYKA 1H72C 3L7ZB 1I94I 2ELZA 4IZJB 1SFEA 4JI7E 1A1FA 1GZ6A 4LFBE 2GO3A 1K47A 4QNKA 5DROA 2BA1G 3Q6MA 5K36F 1MX0A 5LMUE 2E1RA 2C39B 4DR7I 2EORA 1WXRA 4GEQB 4YY3I 2K4VA 4Q35B 2LUQA 2YRHA 1IMUA 2B7TA 4TUIA 5K36A 2LT7A 2UU9E 4WUDA 3M7NG 2KONA 1RHYA 4DV6E 2VF3A 1NZ0A 3GONA 2PNLA 2EM8A 1G2FC 3P06A 2JT2A 5GMDA 4IFDB 4L5NC 1N34E 2BBGA 2X36A 2V86A 1HNZE 5BR8E 4KWYA 2O1UA 1PJTA 1J5EI 2LRSA 3WU5A 2VF1A 2JP9A 5A6BA 4LCGA 3RMPA 2EMHA 4DUZE 4ISAA 2EN7A 2A25A 4DV5I 2M7QA 2ENAA 2V88A 1XMOI 4FW9A 1A6FA 1ZM3A 4BS9A 4ZYGA 4X64E 2VE7C 3THNA 1T4OA 3M99B 2MKNA 3B82A 4B3TE 4JI1E 1N0UA 2EOSA 2NUGA 2CGEA 4JI3E 2EN8A 2NN6B 4AIDA 5FWKA 1P47A 1E3HA 4LFBI 4FWDA 2M4IA 2IESA 2DMIA 5LMUI 1EA6A 1UBDC 3BF2A 3LNUA 1RC7A 1Y4SA 3LPSA 2CSHA 4AIMA 2V2ZA 2BV3A 2J65A 2I9IA 2UUCE 1YH8A 4I3HA 1USVA 2IOPA 4DV2E 2UU9I 1YYOA 5AC4A 2VQFE 2WNRB 1HNWI 2EMFA 4P78A 1WJPA 1N36E 2EOEA 4JI6I 1Z0GA 4MU0A 2YU5A 1HNZI 2HFUA 5BR8I 2PNMA 2LV2A 2CPNA 1HK7A 3THOB 3H4LA 3Q6NA 3F6GA 5C0XD 4LF4I 4ZYDA 1PJSA 2V87A 3B8HA 4DU7A 4LCFA 2C37B 3OTOE 2EM9A 4L8NA 4NXME 1EKZA 1G2DC 1GQEA 1Z0WA 2WW4A 2EPLX 2PRTA 4X64I 4OO1B 1X47A 4B3TI 4LF9E 4OZEA 4X66E 4MYTA 1WHQA 5ELWA 2EN3A 2HHHI 2RSMA 2C38A 2R42A 2HK3A 2BB8A 2N3HA 1X48A 2E5LE 2Z5BA 2EOHA 4M30A 1TN9A 4R2SA 4LU9A 2JE6B 2UXCE 5JEAF 4B3SI 3QT6A 4KHPE 3OMLA 2JOBA 4LFCI 2UXBI 2EQ3A 2EPKX 3J7AG 2EL6A 4BA1A 4JV5E 1N36I 4LF5E 3L7ZA 1A1KA 2ZM6E 3HXLA 2OI2A 3P3GA 5JEAA 2L3JA 1SR9A 1FNMA 2WCC3 1Z5AA 2F1DA 4FW4A 4BHCA 2YSPA 3TQMA 1NHHA 4AM3A 1T39A 4DR1E 2KOUA 2F4VI 2EMZA 4PRXA 1BB8A 2I13A 2LTSA 2D9HA 3UK3C 1HR0E 4JI0E 3B4TA 2UXDE 3OTOI 2JR1A 4DR3E 2WP8B 2DLKA 2EN4A 2BA0D 4NBQA 4IFDE 2HGHA 1IBKI 1VI7A 4R1FA 1BKNA 4HYMA 2EPUA 4NZVA 2E72A 3V2UC 4LF9I 2EMLA 1N0VC 4IFDA 3LMLA 2YTPA 4X62I 2FTXB 3KZZA 2DLQA 1HNXE 4MDTA 3U1YA 3UHMA 2K7IA 2YTDA 3EQ1A 3NZKA 1PIEA 3DF6A 2E5LI 4MU4A 1UHZA 4FWGA 2B7VA 4BC7A 2DEIA 4U3DA 4BC9A 2PO2B 2UXCI 2GS8A 2YT4A 2MDRA 2EWLA 1B63A 2NN6E 2Z5EA 2L3CA 4DR4E 2R3VA 4DV0I 4JV5I 2EOZA 4WXCA 1XHKA 2RTXA 3VHTB 5DRRA 4DV4E 2EOMA 2RS6A 3J81C 2PNZA 1O0WA 2EOIA 4LOMA 1DI2A 1EH7A 1FWLA 1NCSA 3QT5A 4OX9I 1T38A 5C0XB 4DR1I 3FIGA 4IFDC 4DKKA 4JI0I 2GHFA 2WZOA 4GKKE 1HR0I 5K36D 2JY9A 2JWOA 4IJDA 1ZBTA 4MU3A 4DR3I 3T1YI 5TSEA 4USMA 2MC6A 4Q28A 3C4TA 4HACB 1XNQE 1Z0EA 3HJCA 5LLQA 1IBLI 2L2NA 2JEBA 4JYAE 3IWCA 2YTOA 2EM0A 5A6BD 1KIJA 2G7HA 4WSGA 1A1LA 2GQ0A 2Z5CA 2EOQA 4BHBA 4AQYE 3PYGA 2BM1A 4DU8A 1ZXNA 4F9BB 3BBGA 3K6QA 4BBYA 4RH8A 1PJQA 2BR2B 2NN6C 3LTOA 1Y5YA 4OO1E 2M1SA 2CVEA 4WPYA 3GLLA 2N8XA 2EPCA 5AE3A 1IQSA 3V5RA 1H74A 2FV4B 2Q8UA 3J81Q 5LMNE 3U1KA 5ADZA 2FGGA 2LMZA 4DV4I 2HKEA 4KQVA 1GTKA 3ZOQB 1S4EA 1UDOA 4F9CB 4DPXA 4M0VA 2PO0B 2EOXA 4WYQB 4LF6E 4FWHA 1A1HA 4M9VC 2JVAA 2YTQA 4JI7I 1YYWA 2EMBA 2MDGA 4O5GA 1IBME 3PRYA 4LF7E 4PRVA 4DR2E 4GKKI 2V2QA 2JEAB 1T4NA 4X65E 1TF3A 1UN6B 4RHBB 2RSIA 5A6KA 5IWAE 1Z0BA 4O43A 2HK2A 4DV7E 3L00A 4F54A 2LJPA 3MHSC 1ZR9A 5IV8B 3M85D 4JYAI 2O1TA 2EMGA 1JK1A 1KKHA 4FW5A 3C4BA 4DV6I 2EPOA 1RR9A 4AQYI 4OO1C 5F3WA 4B3RE 1N34I 5IT9C 4LFAE 3K1JA 4FW7A 4BA1B 2B9DA 1OYRA 2LVHA 1XNRE 2YSOA 1EH6A 3DD6A 3P3CA 3GMEA 4DUZI 4DR6E 1L4SA 1KYQA 4URLA 4IS9A 5KL4A 2EOOA 4M1KA 4OKGA 2N3GA 2PO1A 3F0NA 1J26A 4JI5E 3PS1A 3DJWA 1A1GA 1E3PA 2NA2A 2V2VA 1YUIA 2EMIA 2YTIA 4FK5C 4JI1I 2BA1D 4N3OA 4JI3I 4BA2B 2EMAA 4IS1C 4F6NA 5A6JA 2B3TB 4GKJE 1F2IG 2DEJA 4LF7I 1NHIA 4DR2I 5K36B 2UUAE 2XEXA 5IWAI 3QT8A 3M7ND 2EN6A 2EPPA 5JEAD 5AC5A 2M9AA 4IZJD 3HPZA 1ZM2A 4UTGA 2UUCI 4DV2I 4DPTA 5EL9A 1PKPA 5C0XE 5IT9Q 2EP3A 2YRMA 2VQFI 1KJKA 2YTGA 2DIXA 4DPWA 4WUCA 3HPSA 2LBSB 4R2CA 1FJGE 2ODRC 4R2AA 4IZJA 2J7JA 2YTJA 1D6TA 1EI1A 2EM5A 5KL2A 3HTXA 1QU6A 1X6HA 3PYEA 1T4LB 1ZM9A 2C39A 4B3ME 2EZ6A 4R03A 2ZBKB 3VK6A 4R8OA 4DR6I 4IFDD 4IFDF 2E1MA 2EPZA 4NXMI 2GLIA 4DV3E 4BCAA 4YHHE 4HXZA 2IOQA 4JI5I 2V34A 4JI4E 3EPJA 3ZZUA 4DPUA 2EL4A 4WX9A 4X66I 2Q2EB 4F2JC 2V8QB 3KZYA 1MGTA 4FW3A 1TF6A 5A69A 2AE8A 5EKWA 1OYPA 5AE2A 3H1CA 2UUAI 1Y6ZA 2NABA 1UDSA 5DRQA 4DMIA 2NN6F 4XTJA 5KL3A 3J80C 1Z5BA 5C0XC 2YTNA 4O4KA 1I94E 1RREA 4Z7YA 4KHPI 2O1VA 1STUA 2L2KB 2CZ9A 2L6MA 2CG9A 2DMYA 4DV1E 1IQOA 1DARA 2O1WA 1RMDA 2EOYA 4R2RA 4LF5I 4YY3E 2EM3A 2NN6A 2ZM6I 2CT1A 3CWVA 4WSPA 1VISA 1B62A 4WXDA 4DUYE 2O3ZA 1ZM4A 3JAMC 1OJ4A 3KRNA 2HKJA 1N32E 2UXDI 1A1JA 4X8WA 4X9JA 1Z1BA 3Q1QA 2C38B 2DRPA 5DRPA 2R76A 2YU8A 1J5EE 2WNRA 3WU3A 3PS2A 2LE2A 4HTGA 1ZXMA 3P3EA 1ZAAC 2Z5BB 2H36X 2VESA 2L2MA 5L3JA 2EQ0A 1Z0TA 1QNTA 3J80Q 1XMOE 1HNXI 4OO1F 2EN2A 1Z0CA 3CDJA 2EMWA 4J3DA 4ZYHA
chains in the Genus database with same CATH topology
3AUZA 3D4JA 1PVGA 4P7DA 3WU6A 4DV1I 4DR4I 3MSWA 5CFFE 1YZ9A 2X7IA 3JAMQ 4Z7CA 2BM0A 3J7Yp 4ED4A 4DUYI 4P52A 2JOXA 1HNWE 1N32I 1MG7A 4JI6E 4LTYA 1Y4UA 3ZKDA 4IZKB 3P1XA 2LJHA 4WFTA 4LF4E 3JTZA 3ADJA 4DR5E 2RS7A 1FWKA 1S16A 4DXLA 1XNQI 4JI8E 4F9AB 2V83A 3HULA 2V8PA 1XMQE 5DNYA 4FN5A 2ODRD 1WHNA 3ADGA 4J8ZA 4WUBA 2HHHE 3ZZ0A 2YZTA 3H09A 3HQ1A 5LMNI 2LUPB 3AV0A 4BMJA 4B3SE 3VYYA 1H7UA 2NUFA 2ZITA 2KHXA 4EMDA 1RQ0A 4LFCE 2UXBE 3T1HE 1USUA 4LF6I 3PYDA 2EFGA 1UILA 1IBMI 1UEKA 2J7KA 1FI4A 3K17A 3ZKBA 4X65I 1Z59A 2Z5CB 4DV7I 4JI2E 4DR5I 1NHJA 4ZVIA 2F4VE 4KZSA 4JI8I 2L33A 4TUGA 1KVKA 5A2QC 4RPFA 4B3RI 1XMQI 1IBKE 5T6JA 3K85A 4USKA 4K0KE 5GMEA 4LFAI 1DQ3A 1MU5A 4P7AA 1Z0VA 3KWRA 2DSYA 1XNRI 4X62E 3LLHA 5AASA 3M6AA 4M2ZA 4I8OA 1KTVA 4HACA 5LL6R 1N33E 2UUBE 5AE1A 4LF8E 4NXNE 3T1HI 3ZZTA 4MYUA 4PU9A 4DV0E 2VQEE 2F8BA 1WUUA 4GKJI 3ZM7A 3PYFA 3F6HA 3JU0A 2NPFA 5FLXC 2IHR1 3ADLA 1ELOA 4JI2I 5A2QQ 4OX9E 4DPYA 1H73A 1U2RA 4DR7E 3T1YE 1FJGI 2LTRA 4K0KI 3IWDA 1FKAE 1IBLE 3ADIA 3B78A 2A2CA 4B3MI 4IZKA 2L92A 4DV3I 4YHHI 2AJ4A 2L8TA 2V89A 2MC5A 3VYXA 4JG4A 2UUBI 4JI4I 2DB2A 1N33I 2V85A 3WU4A 4OOGC 4UT4A 4NXNI 4LF8I 1ZBQA 1X49A 4DV5E 3J7AM 2VQEI 4HY1A 5FLXQ 1Z5CA 1QZRA 3QT7A 3IWBA 2NUEA 1H7SA 2HFSA 2A2DA 1YYKA 1H72C 1I94I 4IZJB 4JI7E 1GZ6A 4LFBE 1K47A 3Q6MA 1MX0A 5LMUE 2E1RA 4DR7I 1WXRA 4GEQB 4YY3I 2K4VA 2LUQA 2B7TA 4TUIA 2UU9E 4WUDA 2KONA 2VF3A 4DV6E 1NZ0A 3GONA 2PNLA 3P06A 5GMDA 4L5NC 1N34E 2X36A 2V86A 1HNZE 5BR8E 2O1UA 1J5EI 2LRSA 3WU5A 2VF1A 3RMPA 4DUZE 4DV5I 2M7QA 2V88A 1XMOI 4FW9A 1A6FA 1ZM3A 4BS9A 4X64E 2VE7C 3B82A 1T4OA 4B3TE 4JI1E 1N0UA 2NUGA 2CGEA 4JI3E 5FWKA 4LFBI 4FWDA 2M4IA 5LMUI 1EA6A 3LNUA 1RC7A 1Y4SA 3LPSA 2BV3A 2UUCE 4I3HA 1USVA 2IOPA 4DV2E 2UU9I 1YYOA 2VQFE 1HNWI 4P78A 1N36E 4JI6I 1Z0GA 1HNZI 2HFUA 5BR8I 2PNMA 4LF4I 2CPNA 1HK7A 3H4LA 3Q6NA 3F6GA 3B8HA 4DU7A 2V87A 3OTOE 4L8NA 4NXME 1EKZA 1GQEA 1Z0WA 2WW4A 4X64I 1X47A 4B3TI 4LF9E 4X66E 4MYTA 1WHQA 2HHHI 2RSMA 2R42A 2HK3A 2N3HA 1X48A 2E5LE 2Z5BA 4M30A 4B3SI 4LU9A 2UXCE 3QT6A 4KHPE 3OMLA 2JOBA 4LFCI 2UXBI 3J7AG 4JV5E 1N36I 4LF5E 2ZM6E 3HXLA 2OI2A 2L3JA 1SR9A 1FNMA 1Z5AA 1NHHA 4DR1E 2KOUA 2F4VI 4PRXA 4JI0E 2LTSA 1HR0E 3OTOI 2UXDE 2JR1A 4DR3E 1IBKI 4R1FA 1BKNA 4HYMA 3V2UC 4LF9I 1N0VC 3LMLA 4X62I 2FTXB 1HNXE 1PIEA 3DF6A 2E5LI 1UHZA 4FWGA 2B7VA 4BC7A 2DEIA 2UXCI 4BC9A 2GS8A 2YT4A 2MDRA 2EWLA 1B63A 2Z5EA 2L3CA 4DR4E 2R3VA 4DV0I 4JV5I 1XHKA 2RTXA 4DV4E 2RS6A 3J81C 1O0WA 1DI2A 1FWLA 3QT5A 4OX9I 4DR1I 3FIGA 4DKKA 4JI0I 1HR0I 2WZOA 4GKKE 2JY9A 2JWOA 1ZBTA 4DR3I 3T1YI 4USMA 2MC6A 4Q28A 3C4TA 4HACB 1XNQE 1Z0EA 3HJCA 1IBLI 2L2NA 4JYAE 3IWCA 1KIJA 2GQ0A 2G7HA 2Z5CA 4DU8A 4AQYE 2BM1A 1ZXNA 4F9BB 3K6QA 4BBYA 3LTOA 2M1SA 4WPYA 5AE3A 3V5RA 1H74A 2FV4B 3J81Q 5LMNE 5ADZA 2FGGA 2LMZA 4DV4I 2HKEA 4KQVA 3ZOQB 1S4EA 4F9CB 4DPXA 4M0VA 4LF6E 4WYQB 4FWHA 2JVAA 4JI7I 1YYWA 4GKKI 1IBME 3PRYA 4PRVA 4LF7E 4DR2E 2V2QA 1T4NA 4X65E 3PYGA 5IWAE 1Z0BA 2HK2A 4DV7E 4F54A 2LJPA 4JYAI 2O1TA 1KKHA 3C4BA 4DV6I 1RR9A 4AQYI 5F3WA 4B3RE 1N34I 5IT9C 4LFAE 3K1JA 2B9DA 1XNRE 4DUZI 4DR6E 4URLA 4M1KA 2N3GA 3F0NA 1J26A 4JI5E 3DJWA 2NA2A 2V2VA 4JI1I 4N3OA 4JI3I 2B3TB 4GKJE 2DEJA 4LF7I 1NHIA 4DR2I 2UUAE 2XEXA 5IWAI 3QT8A 4IZJD 4UTGA 3HPZA 1ZM2A 2UUCI 4DV2I 4DPTA 1PKPA 5IT9Q 2VQFI 4DPWA 2DIXA 4WUCA 3HPSA 2LBSB 1FJGE 2ODRC 4IZJA 1D6TA 1EI1A 3HTXA 1QU6A 3PYEA 1T4LB 1ZM9A 4B3ME 2EZ6A 4R03A 2ZBKB 3VK6A 4R8OA 4DR6I 2E1MA 4NXMI 4DV3E 4BCAA 4YHHE 4HXZA 2IOQA 4JI5I 2V34A 4JI4E 3ZZUA 4DPUA 4X66I 2Q2EB 2V8QB 5AE2A 2UUAI 1Y6ZA 4DMIA 4XTJA 1Z5BA 3J80C 4Z7YA 1I94E 1RREA 4KHPI 2O1VA 1STUA 2L2KB 2CZ9A 2L6MA 2CG9A 2DMYA 4DV1E 1DARA 2O1WA 4LF5I 4YY3E 2ZM6I 3CWVA 4WSPA 1VISA 1B62A 4DUYE 1ZM4A 3JAMC 1OJ4A 2HKJA 1N32E 2UXDI 4X8WA 3Q1QA 1J5EE 3WU3A 2LE2A 1ZXMA 5L3JA 2Z5BB 2H36X 2L2MA 1Z0TA 3J80Q 1XMOE 1HNXI 1Z0CA 2V2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4J A;  1PVG A;  3WU6 A;  4DV1 I;  4DR4 I;  5CFF E;  1YZ9 A;  2X7I A;  3JAM Q;  4Z7C A;  2BM0 A;  3J7Y p;  4ED4 A;  4DUY I;  4P52 A;  1HNW E;  1N32 I;  1MG7 A;  4JI6 E;  3ZKD A;  3P1X A;  2LJH A;  4WFT A;  4LF4 E;  1S16 A;  3ADJ A;  4DR5 E;  2RS7 A;  1FWK A;  4DXL A;  1XNQ I;  4JI8 E;  3HUL A;  2V8P A;  1XMQ E;  4FN5 A;  1WHN A;  3ADG A;  4WUB A;  2HHH E;  3ZZ0 A;  5LMN I;  2LUP B;  4B3S E;  3VYY A;  1H7U A;  2NUF A;  2ZIT A;  2KHX A;  4EMD A;  1RQ0 A;  4LFC E;  2UXB E;  3T1H E;  4LF6 I;  3PYD A;  2EFG A;  1UIL A;  1IBM I;  1UEK A;  2J7K A;  1FI4 A;  3K17 A;  3ZKB A;  4X65 I;  1Z59 A;  4DV7 I;  4JI2 E;  4DR5 I;  1NHJ A;  4ZVI A;  2F4V E;  4JI8 I;  2L33 A;  1KVK A;  5A2Q C;  4RPF A;  4B3R I;  1XMQ I;  1IBK E;  4USK A;  4K0K E;  5GME A;  4LFA I;  1MU5 A;  4P7A A;  1Z0V A;  1XNR I;  4X62 E;  3LLH A;  3M6A A;  4M2Z A;  1KTV A;  4HAC A;  5LL6 R;  1N33 E;  2UUB E;  4LF8 E;  4NXN E;  3T1H I;  3ZZT A;  4MYU A;  4PU9 A;  4DV0 E;  2VQE E;  1WUU A;  4GKJ I;  3ZM7 A;  3PYF A;  2NPF A;  5FLX C;  2IHR 1;  3ADL A;  1ELO A;  4JI2 I;  5A2Q Q;  4OX9 E;  4DPY A;  1H73 A;  1U2R A;  4DR7 E;  3T1Y E;  1FJG I;  2LTR A;  4K0K I;  1FKA E;  1IBL E;  3ADI A;  3B78 A;  2A2C A;  4B3M I;  4DV3 I;  4YHH I;  2AJ4 A;  3VYX A;  4JG4 A;  4JI4 I;  2UUB I;  1N33 I;  2DB2 A;  3WU4 A;  4OOG C;  4UT4 A;  4NXN I;  4LF8 I;  1X49 A;  4DV5 E;  3J7A M;  2VQE I;  4HY1 A;  5FLX Q;  1Z5C A;  1QZR A;  3QT7 A;  2NUE A;  1H7S A;  2HFS A;  2A2D A;  1YYK A;  1H72 C;  1I94 I;  4JI7 E;  4LFB E;  1K47 A;  1MX0 A;  5LMU E;  2E1R A;  4DR7 I;  4YY3 I;  2LUQ A;  2B7T A;  2UU9 E;  4WUD A;  2VF3 A;  4DV6 E;  1NZ0 A;  3GON A;  5GMD A;  1N34 E;  2X36 A;  1HNZ E;  5BR8 E;  1J5E I;  2LRS A;  3WU5 A;  4DUZ E;  4DV5 I;  1XMO I;  4FW9 A;  1A6F A;  1ZM3 A;  4X64 E;  3B82 A;  1T4O A;  4B3T E;  4JI1 E;  1N0U A;  2NUG A;  4JI3 E;  4LFB I;  4FWD A;  5LMU I;  1EA6 A;  3LNU A;  1RC7 A;  3LPS A;  2BV3 A;  2UUC E;  4I3H A;  4DV2 E;  2UU9 I;  1YYO A;  2VQF E;  1HNW I;  1N36 E;  4JI6 I;  1Z0G A;  1HNZ I;  2HFU A;  5BR8 I;  4LF4 I;  2CPN A;  3H4L A;  3B8H A;  4DU7 A;  3OTO E;  4NXM E;  1EKZ A;  1GQE A;  1Z0W A;  2WW4 A;  4X64 I;  1X47 A;  4B3T I;  4LF9 E;  4X66 E;  4MYT A;  1WHQ A;  2HHH I;  2RSM A;  2R42 A;  2HK3 A;  2N3H A;  1X48 A;  2E5L E;  4M30 A;  4B3S I;  2UXC E;  3QT6 A;  4KHP E;  4LFC I;  2UXB I;  3J7A G;  4JV5 E;  1N36 I;  4LF5 E;  2ZM6 E;  2OI2 A;  2L3J A;  1FNM A;  1Z5A A;  1NHH A;  4DR1 E;  2F4V I;  4PRX A;  4JI0 E;  2LTS A;  1HR0 E;  3OTO I;  2UXD E;  4DR3 E;  1IBK I;  4R1F A;  1BKN A;  4HYM A;  3V2U C;  4LF9 I;  1N0V C;  4X62 I;  1HNX E;  1PIE A;  2E5L I;  1UHZ A;  4FWG A;  2B7V A;  2UXC I;  2DEI A;  2GS8 A;  2YT4 A;  2MDR A;  1B63 A;  2L3C A;  4DR4 E;  2R3V A;  4DV0 I;  4JV5 I;  1XHK A;  2RTX A;  4DV4 E;  2RS6 A;  3J81 C;  1O0W A;  1DI2 A;  1FWL A;  3QT5 A;  4OX9 I;  4DR1 I;  4DKK A;  4JI0 I;  1HR0 I;  4GKK E;  2JY9 A;  1ZBT A;  4DR3 I;  3T1Y I;  4USM A;  3C4T A;  4HAC B;  1XNQ E;  1Z0E A;  1IBL I;  2L2N A;  4JYA E;  1KIJ A;  4DU8 A;  4AQY E;  2BM1 A;  1ZXN A;  3LTO A;  3V5R A;  1H74 A;  3J81 Q;  5LMN E;  4DV4 I;  2HKE A;  4KQV A;  1S4E A;  4DPX A;  4LF6 E;  4WYQ B;  4FWH A;  2JVA A;  4JI7 I;  1YYW A;  4GKK I;  1IBM E;  4PRV A;  4LF7 E;  4DR2 E;  2V2Q A;  1T4N A;  4X65 E;  3PYG A;  5IWA E;  1Z0B A;  2HK2 A;  4DV7 E;  2LJP A;  4JYA I;  1KKH A;  3C4B A;  4DV6 I;  1RR9 A;  4AQY I;  4B3R E;  1N34 I;  5IT9 C;  4LFA E;  3K1J A;  1XNR E;  4DUZ I;  4DR6 E;  4URL A;  4M1K A;  2N3G A;  3F0N A;  1J26 A;  4JI5 E;  2NA2 A;  2V2V A;  4JI1 I;  4JI3 I;  2B3T B;  4GKJ E;  2DEJ A;  4LF7 I;  1NHI A;  4DR2 I;  2UUA E;  2XEX A;  5IWA I;  3QT8 A;  4UTG A;  1ZM2 A;  2UUC I;  4DV2 I;  4DPT A;  1PKP A;  5IT9 Q;  2VQF I;  4DPW A;  2DIX A;  4WUC A;  2LBS B;  1FJG E;  1D6T A;  1EI1 A;  3HTX A;  1QU6 A;  3PYE A;  1T4L B;  1ZM9 A;  4B3M E;  2EZ6 A;  2ZBK B;  4DR6 I;  4NXM I;  4DV3 E;  4YHH E;  4HXZ A;  4JI5 I;  2V34 A;  4JI4 E;  3ZZU A;  4DPU A;  4X66 I;  2Q2E B;  2UUA I;  4XTJ A;  1Z5B A;  3J80 C;  4Z7Y A;  1I94 E;  1RRE A;  4KHP I;  1STU A;  2L2K B;  2CZ9 A;  2DMY A;  4DV1 E;  1DAR A;  4LF5 I;  4YY3 E;  2ZM6 I;  3CWV A;  1VIS A;  1B62 A;  4DUY E;  1ZM4 A;  3JAM C;  1OJ4 A;  2HKJ A;  1N32 E;  2UXD I;  4X8W A;  3Q1Q A;  1J5E E;  3WU3 A;  1ZXM A;  5L3J A;  2L2M A;  1Z0T A;  3J80 Q;  1XMO E;  1HNX I;  1Z0C A;  2V2Z A; 
#chains in the Genus database with same CATH topology
 3AUZ A;  2C37 A;  1P42 A;  3D4J A;  5JEA B;  1UDN A;  2EL5 A;  1PVG A;  1X3C A;  2RPC A;  4P7D A;  1Y60 A;  4OO1 A;  3HKM A;  3WU6 A;  4DV1 I;  4DR4 I;  3MSW A;  5CFF E;  5A6A A;  4BA2 A;  1YZ9 A;  5K36 E;  2ELY A;  2EQ1 A;  2X7I A;  3JAM Q;  4Z7C A;  5DNX A;  1YHC A;  2BM0 A;  3J7Y p;  4ED4 A;  2EOF A;  4DUY I;  4P52 A;  2JOX A;  3MHH C;  4GZN C;  2YPN A;  1HNW E;  2JE6 A;  2WBT A;  1N32 I;  4F6M A;  1MG7 A;  1AH5 A;  1MEY C;  4LTY A;  4JI6 E;  3BGH A;  1Y4U A;  2JXP A;  2HC5 A;  1LLM C;  3EPL A;  3ZKD A;  2LO3 A;  4IZK B;  3P1X A;  2LJH A;  1OYS A;  4QNJ A;  4WFT A;  4LF4 E;  3JTZ A;  3ADJ A;  4DR5 E;  2RS7 A;  1FWK A;  1S16 A;  4DXL A;  1XNQ I;  1JK2 A;  4JI8 E;  1X6E A;  2V83 A;  2VRD A;  4F9A B;  2EPR A;  3HUL A;  2V8P A;  2LJU A;  1ZU1 A;  2JYA A;  1XMQ E;  5DNY A;  2JPA A;  4FN5 A;  2ODR D;  4R2P A;  1WHN A;  3ADG A;  4J8Z A;  4WUB A;  2WBU A;  2BA0 G;  2GO4 A;  2WP8 A;  3ECR A;  2HHH E;  3GCM A;  4MLQ A;  2PNZ B;  5K36 C;  3ZZ0 A;  2YZT A;  2LCE A;  3H09 A;  3HQ1 A;  5LMN I;  2LUP B;  2EJ4 A;  3AV0 A;  4BMJ A;  4GQU A;  4B3S E;  2ENH A;  3VYY A;  1H7U A;  2NUF A;  2EPA A;  2KHX A;  2ZIT A;  4EMD A;  1RQ0 A;  3EPK A;  4LFC E;  2UXB E;  3T1H E;  1USU A;  4LF6 I;  2HJJ A;  3PYD A;  2RQL A;  2EFG A;  2GPI A;  2WBS A;  1UIL A;  1IBM I;  2EM4 A;  2PO2 A;  1UEK A;  2JEB B;  2J7K A;  1FI4 A;  4N4R B;  3K17 A;  1N3G A;  3ZKB A;  4X65 I;  1Z59 A;  2Z5C B;  3C6K A;  4DV7 I;  5C0X F;  4JI2 E;  3P76 A;  4DR5 I;  1NHJ A;  2R1F A;  1BBO A;  2F4V E;  4ZVI A;  4KZS A;  4JI8 I;  2L33 A;  4TUG A;  1KVK A;  3EPH A;  1YFH A;  2ENC A;  5A2Q C;  4RPF A;  4B3R I;  1XMQ I;  1IBK E;  2EM7 A;  5C0X A;  5T6J A;  3K85 A;  4USK A;  4K0K E;  2EMK A;  1X6F A;  1BBG A;  1DQ3 A;  2CTD A;  1MU5 A;  5GME A;  4LFA I;  4P7A A;  1Z0V A;  3KWR A;  4MQY A;  2DSY A;  4LPF A;  4X62 E;  3LLH A;  1XNR I;  5AAS A;  3M6A A;  4M2Z A;  4I8O A;  1KTV A;  4HAC A;  5LL6 R;  4R2Q A;  2DGC A;  2EMY A;  2YTF A;  1N33 E;  1R6M A;  2UUB E;  2YTE A;  4FW6 A;  2ADR A;  2YRK A;  5AE1 A;  4LF8 E;  4NXN E;  2IER A;  3CDI A;  4U3B A;  2EPN A;  5JEA E;  3T1H I;  5KL6 A;  4MYU A;  3ZZT A;  1AAY A;  2BR2 A;  4DV0 E;  4PU9 A;  2VQE E;  1YSA C;  2F8B A;  5DNL A;  1WUU A;  4NHR A;  4GKJ I;  3ZM7 A;  2EN1 A;  3PYF A;  3F6H A;  3QG5 C;  3JU0 A;  2NPF A;  2EMX A;  3PS3 A;  1A1I A;  5FLX C;  2IHR 1;  5KL5 A;  2NN6 D;  4MLV A;  3ADL A;  1ELO A;  1UDQ A;  4LCH A;  5A2Q Q;  4JI2 I;  4OX9 E;  4DPY A;  4R2E A;  1XXE A;  2MKD A;  2EOJ A;  1H73 A;  1U2R A;  4DR7 E;  4HEI A;  2YWQ A;  3T1Y E;  5IXM B;  2PO0 A;  1YPN A;  1FJG I;  2LTR A;  4K0K I;  3IWD A;  1FKA E;  1IBL E;  2PO1 B;  3ADI A;  3B78 A;  2A2C A;  1NEI A;  4R2D A;  1DGC A;  2EMC A;  3C6M A;  4IZK A;  4B3M I;  2JEA A;  2L92 A;  2EE8 A;  2EM2 A;  3M85 G;  4DV3 I;  4YHH I;  2AJ4 A;  2L8T A;  2V89 A;  2MC5 A;  3VYX A;  4JG4 A;  5JEA C;  2UUB I;  2DB2 A;  4JI4 I;  1N33 I;  1X5W A;  2EPX A;  2V85 A;  4OOG C;  1B69 A;  1YUJ A;  3WU4 A;  1EH8 A;  4UT4 A;  4NXN I;  4LF8 I;  1ZBQ A;  1X49 A;  4DV5 E;  3J7A M;  2VQE I;  1PDA A;  2EM6 A;  1WRJ A;  4O24 A;  4HY1 A;  5FLX Q;  1R6L A;  1QZR A;  1Z5C A;  4OO1 D;  4ZYE A;  4MU1 A;  5KL7 A;  3BID A;  3QT7 A;  3IWB A;  2NUE A;  1H7S A;  2HFS A;  2EPM X;  2A2D A;  1YYK A;  1H72 C;  3L7Z B;  1I94 I;  2ELZ A;  4IZJ B;  1SFE A;  4JI7 E;  1A1F A;  1GZ6 A;  4LFB E;  2GO3 A;  1K47 A;  4QNK A;  5DRO A;  2BA1 G;  3Q6M A;  5K36 F;  1MX0 A;  5LMU E;  2E1R A;  2C39 B;  4DR7 I;  2EOR A;  1WXR A;  4GEQ B;  4YY3 I;  2K4V A;  4Q35 B;  2LUQ A;  2YRH A;  1IMU A;  2B7T A;  4TUI A;  5K36 A;  2LT7 A;  2UU9 E;  4WUD A;  3M7N G;  2KON A;  1RHY A;  4DV6 E;  2VF3 A;  1NZ0 A;  3GON A;  2PNL A;  2EM8 A;  1G2F C;  3P06 A;  2JT2 A;  5GMD A;  4IFD B;  4L5N C;  1N34 E;  2BBG A;  2X36 A;  2V86 A;  1HNZ E;  5BR8 E;  4KWY A;  2O1U A;  1PJT A;  1J5E I;  2LRS A;  3WU5 A;  2VF1 A;  2JP9 A;  5A6B A;  4LCG A;  3RMP A;  2EMH A;  4DUZ E;  4ISA A;  2EN7 A;  2A25 A;  4DV5 I;  2M7Q A;  2ENA A;  2V88 A;  1XMO I;  4FW9 A;  1A6F A;  1ZM3 A;  4BS9 A;  4ZYG A;  4X64 E;  2VE7 C;  3THN A;  1T4O A;  3M99 B;  2MKN A;  3B82 A;  4B3T E;  4JI1 E;  1N0U A;  2EOS A;  2NUG A;  2CGE A;  4JI3 E;  2EN8 A;  2NN6 B;  4AID A;  5FWK A;  1P47 A;  1E3H A;  4LFB I;  4FWD A;  2M4I A;  2IES A;  2DMI A;  5LMU I;  1EA6 A;  1UBD C;  3BF2 A;  3LNU A;  1RC7 A;  1Y4S A;  3LPS A;  2CSH A;  4AIM A;  2V2Z A;  2BV3 A;  2J65 A;  2I9I A;  2UUC E;  1YH8 A;  4I3H A;  1USV A;  2IOP A;  4DV2 E;  2UU9 I;  1YYO A;  5AC4 A;  2VQF E;  2WNR B;  1HNW I;  2EMF A;  4P78 A;  1WJP A;  1N36 E;  2EOE A;  4JI6 I;  1Z0G A;  4MU0 A;  2YU5 A;  1HNZ I;  2HFU A;  5BR8 I;  2PNM A;  2LV2 A;  2CPN A;  1HK7 A;  3THO B;  3H4L A;  3Q6N A;  3F6G A;  5C0X D;  4LF4 I;  4ZYD A;  1PJS A;  2V87 A;  3B8H A;  4DU7 A;  4LCF A;  2C37 B;  3OTO E;  2EM9 A;  4L8N A;  4NXM E;  1EKZ A;  1G2D C;  1GQE A;  1Z0W A;  2WW4 A;  2EPL X;  2PRT A;  4X64 I;  4OO1 B;  1X47 A;  4B3T I;  4LF9 E;  4OZE A;  4X66 E;  4MYT A;  1WHQ A;  5ELW A;  2EN3 A;  2HHH I;  2RSM A;  2C38 A;  2R42 A;  2HK3 A;  2BB8 A;  2N3H A;  1X48 A;  2E5L E;  2Z5B A;  2EOH A;  4M30 A;  1TN9 A;  4R2S A;  4LU9 A;  2JE6 B;  2UXC E;  5JEA F;  4B3S I;  3QT6 A;  4KHP E;  3OML A;  2JOB A;  4LFC I;  2UXB I;  2EQ3 A;  2EPK X;  3J7A G;  2EL6 A;  4BA1 A;  4JV5 E;  1N36 I;  4LF5 E;  3L7Z A;  1A1K A;  2ZM6 E;  3HXL A;  2OI2 A;  3P3G A;  5JEA A;  2L3J A;  1SR9 A;  1FNM A;  2WCC 3;  1Z5A A;  2F1D A;  4FW4 A;  4BHC A;  2YSP A;  3TQM A;  1NHH A;  4AM3 A;  1T39 A;  4DR1 E;  2KOU A;  2F4V I;  2EMZ A;  4PRX A;  1BB8 A;  2I13 A;  2LTS A;  2D9H A;  3UK3 C;  1HR0 E;  4JI0 E;  3B4T A;  2UXD E;  3OTO I;  2JR1 A;  4DR3 E;  2WP8 B;  2DLK A;  2EN4 A;  2BA0 D;  4NBQ A;  4IFD E;  2HGH A;  1IBK I;  1VI7 A;  4R1F A;  1BKN A;  4HYM A;  2EPU A;  4NZV A;  2E72 A;  3V2U C;  4LF9 I;  2EML A;  1N0V C;  4IFD A;  3LML A;  2YTP A;  4X62 I;  2FTX B;  3KZZ A;  2DLQ A;  1HNX E;  4MDT A;  3U1Y A;  3UHM A;  2K7I A;  2YTD A;  3EQ1 A;  3NZK A;  1PIE A;  3DF6 A;  2E5L I;  4MU4 A;  1UHZ A;  4FWG A;  2B7V A;  4BC7 A;  2DEI A;  4U3D A;  4BC9 A;  2PO2 B;  2UXC I;  2GS8 A;  2YT4 A;  2MDR A;  2EWL A;  1B63 A;  2NN6 E;  2Z5E A;  2L3C A;  4DR4 E;  2R3V A;  4DV0 I;  4JV5 I;  2EOZ A;  4WXC A;  1XHK A;  2RTX A;  3VHT B;  5DRR A;  4DV4 E;  2EOM A;  2RS6 A;  3J81 C;  2PNZ A;  1O0W A;  2EOI A;  4LOM A;  1DI2 A;  1EH7 A;  1FWL A;  1NCS A;  3QT5 A;  4OX9 I;  1T38 A;  5C0X B;  4DR1 I;  3FIG A;  4IFD C;  4DKK A;  4JI0 I;  2GHF A;  2WZO A;  4GKK E;  1HR0 I;  5K36 D;  2JY9 A;  2JWO A;  4IJD A;  1ZBT A;  4MU3 A;  4DR3 I;  3T1Y I;  5TSE A;  4USM A;  2MC6 A;  4Q28 A;  3C4T A;  4HAC B;  1XNQ E;  1Z0E A;  3HJC A;  5LLQ A;  1IBL I;  2L2N A;  2JEB A;  4JYA E;  3IWC A;  2YTO A;  2EM0 A;  5A6B D;  1KIJ A;  2G7H A;  4WSG A;  1A1L A;  2GQ0 A;  2Z5C A;  2EOQ A;  4BHB A;  4AQY E;  3PYG A;  2BM1 A;  4DU8 A;  1ZXN A;  4F9B B;  3BBG A;  3K6Q A;  4BBY A;  4RH8 A;  1PJQ A;  2BR2 B;  2NN6 C;  3LTO A;  1Y5Y A;  4OO1 E;  2M1S A;  2CVE A;  4WPY A;  3GLL A;  2N8X A;  2EPC A;  5AE3 A;  1IQS A;  3V5R A;  1H74 A;  2FV4 B;  2Q8U A;  3J81 Q;  5LMN E;  3U1K A;  5ADZ A;  2FGG A;  2LMZ A;  4DV4 I;  2HKE A;  4KQV A;  1GTK A;  3ZOQ B;  1S4E A;  1UDO A;  4F9C B;  4DPX A;  4M0V A;  2PO0 B;  2EOX A;  4WYQ B;  4LF6 E;  4FWH A;  1A1H A;  4M9V C;  2JVA A;  2YTQ A;  4JI7 I;  1YYW A;  2EMB A;  2MDG A;  4O5G A;  1IBM E;  3PRY A;  4LF7 E;  4PRV A;  4DR2 E;  4GKK I;  2V2Q A;  2JEA B;  1T4N A;  4X65 E;  1TF3 A;  1UN6 B;  4RHB B;  2RSI A;  5A6K A;  5IWA E;  1Z0B A;  4O43 A;  2HK2 A;  4DV7 E;  3L00 A;  4F54 A;  2LJP A;  3MHS C;  1ZR9 A;  5IV8 B;  3M85 D;  4JYA I;  2O1T A;  2EMG A;  1JK1 A;  1KKH A;  4FW5 A;  3C4B A;  4DV6 I;  2EPO A;  1RR9 A;  4AQY I;  4OO1 C;  5F3W A;  4B3R E;  1N34 I;  5IT9 C;  4LFA E;  3K1J A;  4FW7 A;  4BA1 B;  2B9D A;  1OYR A;  2LVH A;  1XNR E;  2YSO A;  1EH6 A;  3DD6 A;  3P3C A;  3GME A;  4DUZ I;  4DR6 E;  1L4S A;  1KYQ A;  4URL A;  4IS9 A;  5KL4 A;  2EOO A;  4M1K A;  4OKG A;  2N3G A;  2PO1 A;  3F0N A;  1J26 A;  4JI5 E;  3PS1 A;  3DJW A;  1A1G A;  1E3P A;  2NA2 A;  2V2V A;  1YUI A;  2EMI A;  2YTI A;  4FK5 C;  4JI1 I;  2BA1 D;  4N3O A;  4JI3 I;  4BA2 B;  2EMA A;  4IS1 C;  4F6N A;  5A6J A;  2B3T B;  4GKJ E;  1F2I G;  2DEJ A;  4LF7 I;  1NHI A;  4DR2 I;  5K36 B;  2UUA E;  2XEX A;  5IWA I;  3QT8 A;  3M7N D;  2EN6 A;  2EPP A;  5JEA D;  5AC5 A;  2M9A A;  4IZJ D;  3HPZ A;  1ZM2 A;  4UTG A;  2UUC I;  4DV2 I;  4DPT A;  5EL9 A;  1PKP A;  5C0X E;  5IT9 Q;  2EP3 A;  2YRM A;  2VQF I;  1KJK A;  2YTG A;  2DIX A;  4DPW A;  4WUC A;  3HPS A;  2LBS B;  4R2C A;  1FJG E;  2ODR C;  4R2A A;  4IZJ A;  2J7J A;  2YTJ A;  1D6T A;  1EI1 A;  2EM5 A;  5KL2 A;  3HTX A;  1QU6 A;  1X6H A;  3PYE A;  1T4L B;  1ZM9 A;  2C39 A;  4B3M E;  2EZ6 A;  4R03 A;  2ZBK B;  3VK6 A;  4R8O A;  4DR6 I;  4IFD D;  4IFD F;  2E1M A;  2EPZ A;  4NXM I;  2GLI A;  4DV3 E;  4BCA A;  4YHH E;  4HXZ A;  2IOQ A;  4JI5 I;  2V34 A;  4JI4 E;  3EPJ A;  3ZZU A;  4DPU A;  2EL4 A;  4WX9 A;  4X66 I;  2Q2E B;  4F2J C;  2V8Q B;  3KZY A;  1MGT A;  4FW3 A;  1TF6 A;  5A69 A;  2AE8 A;  5EKW A;  1OYP A;  5AE2 A;  3H1C A;  2UUA I;  1Y6Z A;  2NAB A;  1UDS A;  5DRQ A;  4DMI A;  2NN6 F;  4XTJ A;  5KL3 A;  3J80 C;  1Z5B A;  5C0X C;  2YTN A;  4O4K A;  1I94 E;  1RRE A;  4Z7Y A;  4KHP I;  2O1V A;  1STU A;  2L2K B;  2CZ9 A;  2L6M A;  2CG9 A;  2DMY A;  4DV1 E;  1IQO A;  1DAR A;  2O1W A;  1RMD A;  2EOY A;  4R2R A;  4LF5 I;  4YY3 E;  2EM3 A;  2NN6 A;  2ZM6 I;  2CT1 A;  3CWV A;  4WSP A;  1VIS A;  1B62 A;  4WXD A;  4DUY E;  2O3Z A;  1ZM4 A;  3JAM C;  1OJ4 A;  3KRN A;  2HKJ A;  1N32 E;  2UXD I;  1A1J A;  4X8W A;  4X9J A;  1Z1B A;  3Q1Q A;  2C38 B;  2DRP A;  5DRP A;  2R76 A;  2YU8 A;  1J5E E;  2WNR A;  3WU3 A;  3PS2 A;  2LE2 A;  4HTG A;  1ZXM A;  3P3E A;  1ZAA C;  2Z5B B;  2H36 X;  2VES A;  2L2M A;  5L3J A;  2EQ0 A;  1Z0T A;  1QNT A;  3J80 Q;  1XMO E;  1HNX I;  4OO1 F;  2EN2 A;  1Z0C A;  3CDJ A;  2EMW A;  4J3D A;  4ZYH A; 
#chains in the Genus database with same CATH homology
 3AUZ A;  3D4J A;  1PVG A;  4P7D A;  3WU6 A;  4DV1 I;  4DR4 I;  3MSW A;  5CFF E;  1YZ9 A;  2X7I A;  3JAM Q;  4Z7C A;  2BM0 A;  3J7Y p;  4ED4 A;  4DUY I;  4P52 A;  2JOX A;  1HNW E;  1N32 I;  1MG7 A;  4JI6 E;  4LTY A;  1Y4U A;  3ZKD A;  4IZK B;  3P1X A;  2LJH A;  4WFT A;  4LF4 E;  3JTZ A;  3ADJ A;  4DR5 E;  2RS7 A;  1FWK A;  1S16 A;  4DXL A;  1XNQ I;  4JI8 E;  4F9A B;  2V83 A;  3HUL A;  2V8P A;  1XMQ E;  5DNY A;  4FN5 A;  2ODR D;  1WHN A;  3ADG A;  4J8Z A;  4WUB A;  2HHH E;  3ZZ0 A;  2YZT A;  3H09 A;  3HQ1 A;  5LMN I;  2LUP B;  3AV0 A;  4BMJ A;  4B3S E;  3VYY A;  1H7U A;  2NUF A;  2ZIT A;  2KHX A;  4EMD A;  1RQ0 A;  4LFC E;  2UXB E;  3T1H E;  1USU A;  4LF6 I;  3PYD A;  2EFG A;  1UIL A;  1IBM I;  1UEK A;  2J7K A;  1FI4 A;  3K17 A;  3ZKB A;  4X65 I;  1Z59 A;  2Z5C B;  4DV7 I;  4JI2 E;  4DR5 I;  1NHJ A;  4ZVI A;  2F4V E;  4KZS A;  4JI8 I;  2L33 A;  4TUG A;  1KVK A;  5A2Q C;  4RPF A;  4B3R I;  1XMQ I;  1IBK E;  5T6J A;  3K85 A;  4USK A;  4K0K E;  5GME A;  4LFA I;  1DQ3 A;  1MU5 A;  4P7A A;  1Z0V A;  3KWR A;  2DSY A;  1XNR I;  4X62 E;  3LLH A;  5AAS A;  3M6A A;  4M2Z A;  4I8O A;  1KTV A;  4HAC A;  5LL6 R;  1N33 E;  2UUB E;  5AE1 A;  4LF8 E;  4NXN E;  3T1H I;  3ZZT A;  4MYU A;  4PU9 A;  4DV0 E;  2VQE E;  2F8B A;  1WUU A;  4GKJ I;  3ZM7 A;  3PYF A;  3F6H A;  3JU0 A;  2NPF A;  5FLX C;  2IHR 1;  3ADL A;  1ELO A;  4JI2 I;  5A2Q Q;  4OX9 E;  4DPY A;  1H73 A;  1U2R A;  4DR7 E;  3T1Y E;  1FJG I;  2LTR A;  4K0K I;  3IWD A;  1FKA E;  1IBL E;  3ADI A;  3B78 A;  2A2C A;  4B3M I;  4IZK A;  2L92 A;  4DV3 I;  4YHH I;  2AJ4 A;  2L8T A;  2V89 A;  2MC5 A;  3VYX A;  4JG4 A;  2UUB I;  4JI4 I;  2DB2 A;  1N33 I;  2V85 A;  3WU4 A;  4OOG C;  4UT4 A;  4NXN I;  4LF8 I;  1ZBQ A;  1X49 A;  4DV5 E;  3J7A M;  2VQE I;  4HY1 A;  5FLX Q;  1Z5C A;  1QZR A;  3QT7 A;  3IWB A;  2NUE A;  1H7S A;  2HFS A;  2A2D A;  1YYK A;  1H72 C;  1I94 I;  4IZJ B;  4JI7 E;  1GZ6 A;  4LFB E;  1K47 A;  3Q6M A;  1MX0 A;  5LMU E;  2E1R A;  4DR7 I;  1WXR A;  4GEQ B;  4YY3 I;  2K4V A;  2LUQ A;  2B7T A;  4TUI A;  2UU9 E;  4WUD A;  2KON A;  2VF3 A;  4DV6 E;  1NZ0 A;  3GON A;  2PNL A;  3P06 A;  5GMD A;  4L5N C;  1N34 E;  2X36 A;  2V86 A;  1HNZ E;  5BR8 E;  2O1U A;  1J5E I;  2LRS A;  3WU5 A;  2VF1 A;  3RMP A;  4DUZ E;  4DV5 I;  2M7Q A;  2V88 A;  1XMO I;  4FW9 A;  1A6F A;  1ZM3 A;  4BS9 A;  4X64 E;  2VE7 C;  3B82 A;  1T4O A;  4B3T E;  4JI1 E;  1N0U A;  2NUG A;  2CGE A;  4JI3 E;  5FWK A;  4LFB I;  4FWD A;  2M4I A;  5LMU I;  1EA6 A;  3LNU A;  1RC7 A;  1Y4S A;  3LPS A;  2BV3 A;  2UUC E;  4I3H A;  1USV A;  2IOP A;  4DV2 E;  2UU9 I;  1YYO A;  2VQF E;  1HNW I;  4P78 A;  1N36 E;  4JI6 I;  1Z0G A;  1HNZ I;  2HFU A;  5BR8 I;  2PNM A;  4LF4 I;  2CPN A;  1HK7 A;  3H4L A;  3Q6N A;  3F6G A;  3B8H A;  4DU7 A;  2V87 A;  3OTO E;  4L8N A;  4NXM E;  1EKZ A;  1GQE A;  1Z0W A;  2WW4 A;  4X64 I;  1X47 A;  4B3T I;  4LF9 E;  4X66 E;  4MYT A;  1WHQ A;  2HHH I;  2RSM A;  2R42 A;  2HK3 A;  2N3H A;  1X48 A;  2E5L E;  2Z5B A;  4M30 A;  4B3S I;  4LU9 A;  2UXC E;  3QT6 A;  4KHP E;  3OML A;  2JOB A;  4LFC I;  2UXB I;  3J7A G;  4JV5 E;  1N36 I;  4LF5 E;  2ZM6 E;  3HXL A;  2OI2 A;  2L3J A;  1SR9 A;  1FNM A;  1Z5A A;  1NHH A;  4DR1 E;  2KOU A;  2F4V I;  4PRX A;  4JI0 E;  2LTS A;  1HR0 E;  3OTO I;  2UXD E;  2JR1 A;  4DR3 E;  1IBK I;  4R1F A;  1BKN A;  4HYM A;  3V2U C;  4LF9 I;  1N0V C;  3LML A;  4X62 I;  2FTX B;  1HNX E;  1PIE A;  3DF6 A;  2E5L I;  1UHZ A;  4FWG A;  2B7V A;  4BC7 A;  2DEI A;  2UXC I;  4BC9 A;  2GS8 A;  2YT4 A;  2MDR A;  2EWL A;  1B63 A;  2Z5E A;  2L3C A;  4DR4 E;  2R3V A;  4DV0 I;  4JV5 I;  1XHK A;  2RTX A;  4DV4 E;  2RS6 A;  3J81 C;  1O0W A;  1DI2 A;  1FWL A;  3QT5 A;  4OX9 I;  4DR1 I;  3FIG A;  4DKK A;  4JI0 I;  1HR0 I;  2WZO A;  4GKK E;  2JY9 A;  2JWO A;  1ZBT A;  4DR3 I;  3T1Y I;  4USM A;  2MC6 A;  4Q28 A;  3C4T A;  4HAC B;  1XNQ E;  1Z0E A;  3HJC A;  1IBL I;  2L2N A;  4JYA E;  3IWC A;  1KIJ A;  2GQ0 A;  2G7H A;  2Z5C A;  4DU8 A;  4AQY E;  2BM1 A;  1ZXN A;  4F9B B;  3K6Q A;  4BBY A;  3LTO A;  2M1S A;  4WPY A;  5AE3 A;  3V5R A;  1H74 A;  2FV4 B;  3J81 Q;  5LMN E;  5ADZ A;  2FGG A;  2LMZ A;  4DV4 I;  2HKE A;  4KQV A;  3ZOQ B;  1S4E A;  4F9C B;  4DPX A;  4M0V A;  4LF6 E;  4WYQ B;  4FWH A;  2JVA A;  4JI7 I;  1YYW A;  4GKK I;  1IBM E;  3PRY A;  4PRV A;  4LF7 E;  4DR2 E;  2V2Q A;  1T4N A;  4X65 E;  3PYG A;  5IWA E;  1Z0B A;  2HK2 A;  4DV7 E;  4F54 A;  2LJP A;  4JYA I;  2O1T A;  1KKH A;  3C4B A;  4DV6 I;  1RR9 A;  4AQY I;  5F3W A;  4B3R E;  1N34 I;  5IT9 C;  4LFA E;  3K1J A;  2B9D A;  1XNR E;  4DUZ I;  4DR6 E;  4URL A;  4M1K A;  2N3G A;  3F0N A;  1J26 A;  4JI5 E;  3DJW A;  2NA2 A;  2V2V A;  4JI1 I;  4N3O A;  4JI3 I;  2B3T B;  4GKJ E;  2DEJ A;  4LF7 I;  1NHI A;  4DR2 I;  2UUA E;  2XEX A;  5IWA I;  3QT8 A;  4IZJ D;  4UTG A;  3HPZ A;  1ZM2 A;  2UUC I;  4DV2 I;  4DPT A;  1PKP A;  5IT9 Q;  2VQF I;  4DPW A;  2DIX A;  4WUC A;  3HPS A;  2LBS B;  1FJG E;  2ODR C;  4IZJ A;  1D6T A;  1EI1 A;  3HTX A;  1QU6 A;  3PYE A;  1T4L B;  1ZM9 A;  4B3M E;  2EZ6 A;  4R03 A;  2ZBK B;  3VK6 A;  4R8O A;  4DR6 I;  2E1M A;  4NXM I;  4DV3 E;  4BCA A;  4YHH E;  4HXZ A;  2IOQ A;  4JI5 I;  2V34 A;  4JI4 E;  3ZZU A;  4DPU A;  4X66 I;  2Q2E B;  2V8Q B;  5AE2 A;  2UUA I;  1Y6Z A;  4DMI A;  4XTJ A;  1Z5B A;  3J80 C;  4Z7Y A;  1I94 E;  1RRE A;  4KHP I;  2O1V A;  1STU A;  2L2K B;  2CZ9 A;  2L6M A;  2CG9 A;  2DMY A;  4DV1 E;  1DAR A;  2O1W A;  4LF5 I;  4YY3 E;  2ZM6 I;  3CWV A;  4WSP A;  1VIS A;  1B62 A;  4DUY E;  1ZM4 A;  3JAM C;  1OJ4 A;  2HKJ A;  1N32 E;  2UXD I;  4X8W A;  3Q1Q A;  1J5E E;  3WU3 A;  2LE2 A;  1ZXM A;  5L3J A;  2Z5B B;  2H36 X;  2L2M A;  1Z0T A;  3J80 Q;  1XMO E;  1HNX I;  1Z0C A;  2V2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...