3T1YE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3t1yE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1yE02
3HTXA 2HFSA 1XMQI 4X64I 1Z0CA 4DR6I 1T4OA 1MX0A 4JYAE 1FJGE 3ADIA 5CFFE 4HACA 4DPWA 4JI6E 1NHHA 2UXDI 1Z59A 1ZM4A 2HK3A 4X65E 3J7AG 1IBMI 1KKHA 2NUEA 2NUFA 2VQEE 4LFBE 4USKA 3GONA 1WUUA 1RQ0A 1XNQI 2V2VA 5A2QQ 2N3HA 1HR0E 2VF3A 3JAMQ 1NHIA 3B78A 1B63A 5LMUI 4DPYA 4R1FA 2UUBE 2ZBKB 2CPNA 2JVAA 2DEJA 1QU6A 3K17A 3ZZUA 4DPUA 4FN5A 3JAMC 3CWVA 4X65I 1UHZA 1GQEA 5IWAE 4WUCA 4WUBA 2R3VA 4JI3E 1YYKA 3PYGA 4ZVIA 5BR8E 2A2DA 1Z0TA 4DR2I 4JI7I 2L2NA 1FI4A 2BM1A 4DKKA 4URLA 4JI1E 4I3HA 3M6AA 5LMNE 4JG4A 1HNXE 3VYYA 3T1HI 4LF8E 2UUAE 4XTJA 4DXLA 4DV4E 3ADLA 2RTXA 4DPTA 4WYQB 4MYTA 3OTOI 2ZM6E 2LBSB 1N33E 2E5LI 2HFUA 5FLXQ 1T4NA 4DR7E 4X8WA 3ADGA 2NPFA 2V2QA 2NA2A 1IBKI 4JI1I 4JI8I 5LMNI 2HK2A 4DV0E 4LFCE 4B3RE 2LJHA 1PKPA 4AQYE 1ZXMA 2YT4A 3ADJA 3PYEA 2AJ4A 2UUAI 4LF7I 5GMEA 4NXMI 4DV4I 4JI0E 4DV5E 4JI2E 3WU4A 4LFAE 3T1YE 4K0KE 4B3SE 4YY3I 3J81Q 2MDRA 4FWGA 2B7TA 4B3TE 4JI4E 3PYDA 4GKJE 3ZKBA 1RR9A 1EA6A 1PVGA 4DR7I 4DR3I 4PRVA 1WHQA 4LF6E 3J81C 1IBLE 4LFCI 3WU6A 4B3RI 5GMDA 1N34E 1HNZE 4FW9A 3QT6A 2L2MA 4OX9I 1O0WA 2UU9E 1STUA 4DR4E 4FWHA 3J7Yp 4JI0I 3V2UC 1I94I 4DV5I 4X62E 4LF5E 3WU3A 3T1YI 2CZ9A 4M1KA 4K0KI 4DV6E 4B3SI 2UXCI 2ZITA 4DV2E 2BV3A 4B3TI 2HKJA 4X66I 4DV7E 2RS7A 1DI2A 2HKEA 1NHJA 2NUGA 4JYAI 1FJGI 1Z0EA 5LL6R 1EKZA 1FNMA 4JI6I 1EI1A 1WHNA 1N34I 1XNRE 2UU9I 3WU5A 2VQEI 4DR4I 4LFBI 3B8HA 4M30A 2E1RA 2IHR1 1S16A 4LF4E 1XMOE 2J7KA 4GKKE 1HR0I 2LUQA 1H72C 2Q2EB 1Z0VA 3J80Q 2UUCE 2KHXA 4ED4A 2UUBI 3VYXA 1ZXNA 1DARA 1A6FA 1N36E 2LUPB 1BKNA 4DV1E 3LPSA 3HULA 1X49A 1NZ0A 3PYFA 5IWAI 1J26A 4YHHE 3J80C 4JI3I 5BR8I 1HNWE 4DUZE 4NXNE 1XHKA 1Z5BA 4HY1A 3ZZTA 1H74A 1H7SA 3K1JA 2A2CA 1OJ4A 3Q1QA 1XMOI 4GKKI 1HNXI 4EMDA 2LTRA 1N0UA 1Z5AA 2BM0A 2VQFE 4B3ME 4LF8I 2UXBE 2OI2A 1XMQE 4X64E 4DR6E 1B62A 2V34A 2F4VE 4DUYE 2ZM6I 2EFGA 4JI5E 2B7VA 1KIJA 4YHHI 1N33I 2UXDE 2EZ6A 1HNWI 4DUZI 3QT5A 4NXNI 3P1XA 1ZM9A 1IBME 4OOGC 3V5RA 5L3JA 2L2KB 1Z0WA 1ZM3A 4DV0I 4AQYI 1UILA 1ZM2A 4JV5E 1KVKA 1Z0GA 1VISA 4Z7YA 1J5EE 2DEIA 1Z0BA 4Z7CA 3F0NA 4JI2I 4LFAI 3ZKDA 2LRSA 1N0VC 2F4VI 4UTGA 4DUYI 5LMUE 1PIEA 4JI5I 1FWKA 1MU5A 1FWLA 2WW4A 2LTSA 4JI4I 4DR5E 4GKJI 2LJPA 4FWDA 4RPFA 2X7IA 4KQVA 2B3TB 4LF6I 1IBLI 2X36A 4DR2E 1RREA 4JI7E 1RC7A 1HNZI 4JV5I 1YYOA 1K47A 2DB2A 1KTVA 4DU8A 2L3CA 1J5EI 3LTOA 2RSMA 1D6TA 4X62I 4LF5I 1X47A 1MG7A 1YZ9A 4HXZA 3T1HE 3LLHA 4DV6I 2V2ZA 2L33A 5A2QC 4DV2I 4DV7I 4DR5I 2L3JA 3ZZ0A 3OTOE 4UT4A 5IT9Q 2E5LE 4DU7A 1ZBTA 4WUDA 3QT8A 4HYMA 2N3GA 2XEXA 4DR1E 1FKAE 1XNRI 1IBKE 4JI8E 5IT9C 1Z5CA 4LF9E 4M2ZA 2RS6A 4LF7E 3C4BA 2GS8A 4P7AA 4LF4I 4NXME 4HACB 1T4LB 4MYUA 2V8PA 2DIXA 4WFTA 4KHPE 1N32E 4DPXA 4YY3E 2UUCI 2JY9A 2HHHE 4DV3E 1H7UA 1QZRA 3C4TA 1N36I 4DV1I 4PRXA 4DR3E 2DMYA 4PU9A 4DR1I 1U2RA 1UEKA 1S4EA 4LF9I 1ELOA 3B82A 3QT7A 5FLXC 1YYWA 4USMA 4OX9E 1H73A 1X48A 1I94E 3LNUA 3ZM7A 3J7AM 2R42A 4KHPI 3H4LA 1N32I 4P52A 1XNQE 2VQFI 4B3MI 2UXCE 2HHHI 2UXBI 4DV3I 3D4JA 4X66E
chains in the Genus database with same CATH superfamily
1EH7A 2BBGA 4WSGA 5A6BD 3HTXA 2HFSA 1XMQI 4X64I 1Z0CA 4DR6I 2YU5A 2YTNA 1T4OA 1MX0A 1OYRA 2I9IA 1R6LA 4JYAE 4KWYA 4ZYHA 1FJGE 3ADIA 1Y6ZA 4IFDE 5CFFE 4N3OA 4OO1E 1E3HA 4HACA 2C37A 4DPWA 2HGHA 4JI6E 1NHHA 2UXDI 1Z59A 1ZM4A 4MU1A 1ZU1A 2EM4A 2HK3A 1A1IA 4X65E 2EORA 2MC6A 4MDTA 3J7AG 1IBMI 1KKHA 3NZKA 2NUEA 2NUFA 2EN1A 3MHSC 2VQEE 2EL5A 2M1SA 3HJCA 2JXPA 4LFBE 4USKA 3DJWA 1Y5YA 2B9DA 3GONA 4I8OA 1P47A 2EM7A 1WUUA 2H36X 4ZYEA 1RQ0A 2EOYA 5AC4A 1XNQI 4R03A 1GTKA 5C0XB 1A1JA 2V2VA 3Q6MA 5A2QQ 2N3HA 4IFDA 1A1HA 4OO1A 2EM8A 5IV8B 1HR0E 2VF3A 3JAMQ 2ENAA 2EMCA 1NHIA 4BMJA 1B63A 3B78A 5LMUI 4DPYA 5LLQA 4R1FA 4RH8A 2UUBE 2ZBKB 4QNKA 2CPNA 2JVAA 4LU9A 3L00A 2BB8A 3IWBA 2DEJA 1UDNA 1QU6A 1ZR9A 2EPPA 2O3ZA 3K17A 3ZZUA 1BBGA 2IOPA 3JAMC 1R6MA 4FN5A 4DPUA 1UDSA 3CWVA 4X65I 1UHZA 1GQEA 5IWAE 1UDOA 4WUCA 2JR1A 4WUBA 2R3VA 2EJ4A 4JI3E 1YYKA 3PYGA 4ZVIA 5BR8E 2E72A 2LVHA 2A2DA 1Z0TA 4DR2I 2MC5A 5K36E 3JTZA 4JI7I 1JK2A 2BA1D 4R2RA 4TUIA 2ODRC 2L2NA 2VF1A 2JPAA 1FI4A 2BM1A 2WBSA 5KL5A 5AC5A 4DKKA 2I13A 4NZVA 4JI1E 4I3HA 4URLA 4BC7A 3M6AA 5LMNE 3JU0A 4JG4A 5EL9A 2ODRD 1HNXE 2EM9A 3UK3C 3CDJA 4FW6A 2LE2A 3VYYA 4MLQA 3T1HI 1E3PA 4MU0A 2GQ0A 2EQ1A 2WBUA 4LF8E 4ISAA 2UUAE 2EMBA 5A6AA 2JT2A 4XTJA 4DXLA 4DV4E 4GEQB 2EN6A 3ADLA 2C37B 1NEIA 2EM6A 2RTXA 4DPTA 4M9VC 3BBGA 4WYQB 2JE6B 4MYTA 2ADRA 3OTOI 2R1FA 2ZM6E 2HJJA 4N4RB 2LBSB 2KOUA 3TQMA 1N33E 2BA0D 2JWOA 4WX9A 4ZYGA 5AE3A 2E5LI 4IZJD 2HFUA 3BGHA 1WRJA 4DMIA 1X5WA 5FLXQ 1T4NA 4HEIA 4DR7E 2YSPA 2EMXA 4X8WA 3ADGA 2NPFA 2V2QA 2NA2A 1IBKI 4JI1I 4JI8I 2V88A 2C38A 5LMNI 2HK2A 2EOHA 4BCAA 4DV0E 4LFCE 4B3RE 1YHCA 4IFDB 2M9AA 4OO1B 2LJHA 1PKPA 4AQYE 2EE8A 1ZXMA 3M85G 3M7ND 2YT4A 2EN7A 3ADJA 3PYEA 2AJ4A 2UUAI 4LF7I 2EPLX 5GMEA 2V8QB 4NXMI 1AH5A 4DV4I 4JI0E 4DV5E 4JI2E 3WU4A 4LFAE 2JYAA 3AV0A 5K36F 2YTJA 4R2SA 3T1YE 4FK5C 4K0KE 4O5GA 1OYSA 3BIDA 2YTIA 3ZOQB 4B3SE 4YY3I 3J81Q 2CTDA 2MDRA 2B7TA 2EOOA 2NABA 4FWGA 4B3TE 4JI4E 3PYDA 4OKGA 4F9CB 2WZOA 4GKJE 3ZKBA 1NCSA 3F6HA 1RR9A 3F6GA 1EA6A 1PVGA 4DR7I 4DR3I 2EPZA 4BBYA 2O1WA 4PRVA 1WHQA 3J81C 4LF6E 2V86A 2EOIA 1IBLE 4BHBA 4LFCI 3WU6A 4B3RI 2JE6A 5GMDA 2DSYA 5AASA 5AE1A 2IOQA 1N34E 1HNZE 4BA2A 4FW9A 3QT6A 2L2MA 2J7JA 4OX9I 2V83A 1OYPA 1O0WA 2UU9E 1STUA 4DR4E 4FWHA 3J7Yp 4JI0I 3V2UC 3K6QA 2GPIA 4DV5I 1I94I 4X62E 4Q35B 4LF5E 2NN6C 5DNXA 3WU3A 3T1YI 2LMZA 2E1MA 2CZ9A 2CGEA 4M1KA 1N3GA 3P3EA 4DV6E 4BA1A 2O1TA 2JEAA 4B3SI 4K0KI 4LCFA 2NN6D 3VHTB 5K36B 2UXCI 2ZITA 4DV2E 2BV3A 2EMGA 4ZYDA 4B3TI 2HKJA 2EOMA 3DF6A 4DV7E 4X66I 4R2EA 2EM0A 2RS7A 1DI2A 2WNRA 1X6FA 4MLVA 2Z5EA 2ELYA 2ENHA 5DRPA 2HKEA 1VI7A 1NHJA 5JEAC 4WXDA 2NUGA 4JYAI 1FJGI 1T39A 1Z0EA 5LL6R 1EKZA 1FNMA 1IQOA 3DD6A 2PO2A 4JI6I 1L4SA 5JEAD 2C38B 5ELWA 1EI1A 2EN3A 2YTQA 2V89A 1USVA 2VE7C 1PJTA 1TF3A 1WHNA 2CG9A 1N34I 4BS9A 3Q6NA 4LPFA 1XNRE 2WCC3 1A1LA 2EM5A 2UU9I 1UN6B 3WU5A 2VQEI 2NN6F 4DR4I 4BC9A 4LFBI 4MQYA 3B8HA 3HXLA 4M30A 3UHMA 2E1RA 2EWLA 2IHR1 4HTGA 4FW3A 1S16A 4LF4E 1MEYC 2YZTA 4FW4A 5DRRA 1XMOE 2J7KA 2LO3A 2G7HA 4X9JA 4GKKE 1HR0I 4IJDA 2O1UA 5JEAF 2LUQA 1H72C 2Q2EB 3THNA 3CDIA 1KYQA 1Z0VA 4KZSA 2EM2A 3PRYA 2UUCE 3J80Q 2KHXA 2GO4A 2YU8A 4ED4A 2UUBI 3VYXA 1YH8A 1ZXNA 2JP9A 2PO1A 2DLQA 1A6FA 1DARA 1N36E 2YSOA 5KL3A 2LUPB 1BKNA 2EPXA 4DV1E 2L6MA 4GZNC 3LPSA 1NZ0A 1X49A 3HULA 2WP8B 3PYFA 5IWAI 2VRDA 3KWRA 2EP3A 4LTYA 1IMUA 1J26A 2C39B 4BA2B 2DRPA 2EMIA 4YHHE 3J80C 3IWDA 4FW7A 4LCHA 4JI3I 2DLKA 1Z1BA 5K36A 5BR8I 2Z5CA 4MU4A 3U1KA 1HNWE 4DUZE 2ENCA 4NXNE 2LT7A 1XHKA 3C6MA 3LMLA 1Z5BA 2EOFA 2EPUA 5KL4A 2YWQA 1UBDC 2EPAA 4HY1A 3ZZTA 2JEBA 1T38A 1H74A 1H7SA 3K1JA 4BA1B 2JEAB 3KZZA 4NHRA 2FV4B 2A2CA 1OJ4A 2JOXA 3Q1QA 1USUA 1XMOI 4GKKI 1ZBQA 1HNXI 2GHFA 4EMDA 5C0XC 2WNRB 2V87A 2LTRA 3HPSA 4L8NA 1N0UA 2VQFE 1Z5AA 4Q28A 5ADZA 4B3ME 2BM0A 4M0VA 1QNTA 4LF8I 4R2CA 2MKDA 2UXBE 1XXEA 4IS9A 2OI2A 4U3DA 3M85D 5C0XD 4P78A 1XMQE 4X64E 2YTFA 1YFHA 2PO2B 1WJPA 1YUJA 4DR6E 1B62A 2BR2A 2V34A 2D9HA 4F6NA 5F3WA 2F4VE 4BHCA 1BBOA 4DUYE 2ZM6I 3PS3A 4AIDA 2EFGA 4JI5E 2B7VA 1KIJA 1JK1A 4YHHI 1N33I 1EH6A 4O43A 5A6BA 4IZKA 2EMYA 2NN6E 2UXDE 3FIGA 2EZ6A 1HNWI 4DUZI 4QNJA 3QT5A 4NXNI 1PJQA 3P1XA 3QG5C 1ZM9A 3GLLA 2HC5A 3HKMA 1IBME 4WSPA 4OOGC 1KJKA 3PS2A 4LOMA 3H1CA 2N8XA 3V5RA 2EMAA 2L2KB 1Z0WA 5L3JA 1ZM3A 4U3BA 5C0XF 2EPNA 4F2JC 4DV0I 3GCMA 2EOZA 2YTDA 5JEAE 2WP8A 4AQYI 5KL7A 1UILA 1ZM2A 1TF6A 2C39A 4JV5E 1KVKA 1Z0GA 2J65A 1VISA 4Z7YA 4LCGA 3H09A 1YSAC 1J5EE 2DEIA 1Z0BA 4Z7CA 2YRKA 3F0NA 5KL6A 5DRQA 1BB8A 4JI2I 2PO1B 4LFAI 2EMLA 2LV2A 1EH8A 3ZKDA 2LRSA 1Y4SA 1N0VC 2NN6A 4UTGA 2F4VI 2EQ0A 4DUYI 2IESA 3OMLA 5LMUE 5A69A 1PIEA 3L7ZB 4JI5I 1FWKA 1SR9A 1MU5A 1PJSA 4O4KA 4IZJB 1FWLA 2V85A 2WW4A 5A6JA 2LTSA 2RPCA 5DNLA 4JI4I 2Z5CB 5EKWA 4DR5E 4GKJI 2LJPA 4FWDA 2EMWA 4J8ZA 4NBQA 4F54A 2K7IA 2Q8UA 5FWKA 2RQLA 2EMZA 4F9BB 4RPFA 4R8OA 4R2PA 2JEBB 2VESA 2X7IA 4IS1C 4KQVA 5JEAA 2B3TB 2PNZB 4LF6I 5IXMB 2EN2A 4P7DA 1IBLI 2X36A 3P3CA 2PO0A 4DR2E 1RREA 3K85A 5KL2A 4JI7E 3VK6A 2DMIA 1RC7A 1HNZI 1IQSA 4JV5I 3EPHA 1YYOA 1K47A 2CT1A 2DB2A 1MGTA 2FTXB 1KTVA 4IFDC 4OO1C 4DU8A 2L3CA 1DGCA 2GO3A 3LTOA 1J5EI 2RSMA 1D6TA 3PS1A 1LLMC 1RHYA 4X62I 4LF5I 4GQUA 2Z5BA 4IFDD 1X47A 2M4IA 1MG7A 1X6HA 1YZ9A 2BR2B 4HXZA 3T1HE 4OO1D 2EOSA 3LLHA 4R2DA 4DV6I 1AAYA 1P42A 2EL6A 2V2ZA 2EL4A 2L33A 2WBTA 2EOQA 5A2QC 2EOXA 1TN9A 4DV2I 1WXRA 4IZKB 4DV7I 4DR5I 2L3JA 3ZZ0A 4WPYA 2EM3A 3OTOE 2EMKA 4O24A 1A1KA 1RMDA 3KZYA 4WXCA 1PDAA 5TSEA 4UT4A 2L92A 1ZAAC 2YTOA 3U1YA 2CSHA 1HK7A 5IT9Q 2E5LE 4F9AB 4DU7A 5DNYA 3B4TA 5DROA 1SFEA 1ZBTA 4WUDA 3QT8A 4TUGA 4L5NC 2BA1G 5C0XE 4HYMA 2N3GA 2DGCA 1G2FC 4AM3A 4IFDF 2XEXA 2YTPA 3L7ZA 3EPKA 4OO1F 2EOEA 2KONA 3HPZA 1YPNA 5T6JA 5AE2A 4DR1E 1FKAE 2EPMX 1UDQA 2FGGA 1IBKE 4IZJA 3BF2A 1XNRI 4JI8E 5IT9C 4RHBB 1Z5CA 2PO0B 2A25A 2R76A 3MSWA 1Y4UA 2YPNA 4LF9E 4M2ZA 3AUZA 2NN6B 2EQ3A 2RS6A 3GMEA 2O1VA 1DQ3A 2JOBA 4LF7E 3C4BA 2GS8A 2YRHA 2PNZA 1F2IG 4NXME 3KRNA 4P7AA 4HACB 4LF4I 1T4LB 4MYUA 2CVEA 3M99B 2V8PA 2DIXA 3MHHC 4WFTA 4KHPE 3EQ1A 5K36C 3THOB 2AE8A 2EN8A 2EOJA 4R2QA 2EPOA 1N32E 2EPRA 1Y60A 2BA0G 2PNMA 4FW5A 4DPXA 5C0XA 4YY3E 2YTEA 2JY9A 2UUCI 2MDGA 2HHHE 2K4VA 1B69A 4DV3E 2MKNA 4AIMA 5JEAB 2M7QA 1H7UA 5K36D 1QZRA 3C4TA 2L8TA 1N36I 1A1GA 4DV1I 2ELZA 2EMFA 4PRXA 1X3CA 1YUIA 2IERA 2F8BA 2DMYA 4DR3E 2EN4A 2PNLA 1G2DC 4PU9A 2EMHA 4DR1I 3P3GA 2RSIA 3ECRA 2YRMA 3P76A 3HQ1A 3RMPA 1U2RA 2YTGA 1X6EA 2F1DA 1UEKA 1S4EA 4MU3A 1GZ6A 1ELOA 4LF9I 3B82A 2Z5BB 3M7NG 3QT7A 5FLXC 1YYWA 1A1FA 4USMA 4OX9E 4F6MA 1H73A 1X48A 1I94E 4OZEA 3EPJA 3C6KA 3LNUA 3IWCA 2EPKX 3ZM7A 3J7AM 3P06A 2R42A 4KHPI 3H4LA 2PRTA 4J3DA 1N32I 2GLIA 4P52A 1XNQE 2VQFI 4B3MI 3EPLA 4R2AA 2EPCA 2UXCE 5A6KA 2HHHI 4DV3I 2UXBI 2LCEA 3D4JA 2LJUA 4X66E
chains in the Genus database with same CATH topology
3HTXA 2HFSA 1XMQI 4X64I 1Z0CA 4DR6I 1T4OA 1MX0A 4JYAE 1FJGE 3ADIA 1Y6ZA 5CFFE 4N3OA 4HACA 4DPWA 4JI6E 1NHHA 2UXDI 1Z59A 1ZM4A 2HK3A 4X65E 2MC6A 3J7AG 1IBMI 1KKHA 2NUEA 2NUFA 2VQEE 2M1SA 3HJCA 4LFBE 4USKA 3DJWA 3GONA 2B9DA 4I8OA 1WUUA 2H36X 1RQ0A 1XNQI 4R03A 2V2VA 3Q6MA 5A2QQ 2N3HA 1HR0E 2VF3A 3JAMQ 1NHIA 4BMJA 1B63A 3B78A 5LMUI 4DPYA 4R1FA 2UUBE 2ZBKB 2CPNA 2JVAA 4LU9A 3IWBA 2DEJA 1QU6A 3K17A 3ZZUA 2IOPA 3JAMC 4FN5A 4DPUA 3CWVA 4X65I 1UHZA 1GQEA 5IWAE 4WUCA 2JR1A 4WUBA 2R3VA 4JI3E 1YYKA 3PYGA 4ZVIA 5BR8E 2A2DA 1Z0TA 4DR2I 2MC5A 3JTZA 4JI7I 4TUIA 2ODRC 2L2NA 2VF1A 1FI4A 2BM1A 4DKKA 4URLA 4JI1E 4I3HA 4BC7A 3M6AA 5LMNE 3JU0A 4JG4A 2ODRD 1HNXE 2LE2A 3VYYA 3T1HI 2GQ0A 4LF8E 2UUAE 4XTJA 4DXLA 4DV4E 4GEQB 3ADLA 2RTXA 4DPTA 4WYQB 4MYTA 3OTOI 2ZM6E 2LBSB 1N33E 2KOUA 2JWOA 5AE3A 2E5LI 4IZJD 2HFUA 4DMIA 5FLXQ 1T4NA 4DR7E 4X8WA 3ADGA 2NPFA 2V2QA 2NA2A 1IBKI 4JI1I 4JI8I 2V88A 5LMNI 2HK2A 4BCAA 4DV0E 4LFCE 4B3RE 2LJHA 1PKPA 4AQYE 1ZXMA 2YT4A 3ADJA 3PYEA 2AJ4A 2UUAI 4LF7I 5GMEA 2V8QB 4NXMI 4DV4I 4JI0E 4DV5E 4JI2E 3WU4A 4LFAE 3AV0A 3T1YE 4K0KE 3ZOQB 4B3SE 4YY3I 3J81Q 2MDRA 4FWGA 2B7TA 4B3TE 4JI4E 3PYDA 4F9CB 2WZOA 4GKJE 3ZKBA 3F6HA 1RR9A 3F6GA 1EA6A 1PVGA 4DR7I 4DR3I 4BBYA 2O1WA 4PRVA 1WHQA 3J81C 4LF6E 2V86A 1IBLE 4LFCI 3WU6A 4B3RI 5GMDA 2DSYA 5AASA 5AE1A 2IOQA 1N34E 1HNZE 4FW9A 3QT6A 2L2MA 4OX9I 2V83A 1O0WA 2UU9E 1STUA 4DR4E 4FWHA 3J7Yp 4JI0I 3V2UC 3K6QA 1I94I 4DV5I 4X62E 4LF5E 3WU3A 3T1YI 2LMZA 2E1MA 2CZ9A 2CGEA 4M1KA 4K0KI 4DV6E 2O1TA 4B3SI 2UXCI 2ZITA 4DV2E 2BV3A 4B3TI 2HKJA 3DF6A 4DV7E 4X66I 2RS7A 1DI2A 2Z5EA 2HKEA 1NHJA 2NUGA 4JYAI 1FJGI 1Z0EA 5LL6R 1EKZA 1FNMA 4JI6I 1EI1A 2V89A 1USVA 2VE7C 2CG9A 1WHNA 1N34I 4BS9A 3Q6NA 1XNRE 2UU9I 3WU5A 2VQEI 4DR4I 4BC9A 4LFBI 3B8HA 3HXLA 4M30A 2E1RA 2EWLA 2IHR1 1S16A 4LF4E 2YZTA 1XMOE 2J7KA 2G7HA 4GKKE 1HR0I 2O1UA 2LUQA 1H72C 2Q2EB 1Z0VA 4KZSA 3PRYA 2UUCE 3J80Q 2KHXA 4ED4A 2UUBI 3VYXA 1ZXNA 1DARA 1A6FA 1N36E 2LUPB 1BKNA 4DV1E 2L6MA 3LPSA 1NZ0A 1X49A 3HULA 3PYFA 5IWAI 3KWRA 4LTYA 1J26A 4YHHE 3J80C 4JI3I 3IWDA 5BR8I 2Z5CA 1HNWE 4DUZE 4NXNE 1XHKA 3LMLA 1Z5BA 4HY1A 3ZZTA 1H74A 1H7SA 3K1JA 2FV4B 2A2CA 1OJ4A 2JOXA 3Q1QA 1USUA 1XMOI 4GKKI 1ZBQA 1HNXI 4EMDA 2V87A 2LTRA 3HPSA 4L8NA 1N0UA 2VQFE 1Z5AA 4Q28A 5ADZA 4B3ME 2BM0A 4M0VA 4LF8I 2UXBE 2OI2A 4P78A 1XMQE 4X64E 4DR6E 1B62A 2V34A 5F3WA 2F4VE 4DUYE 2ZM6I 2EFGA 4JI5E 2B7VA 1KIJA 4YHHI 1N33I 4IZKA 2UXDE 3FIGA 2EZ6A 1HNWI 4DUZI 3QT5A 4NXNI 3P1XA 1ZM9A 1IBME 4WSPA 4OOGC 3V5RA 5L3JA 2L2KB 1Z0WA 1ZM3A 4DV0I 4AQYI 1UILA 1ZM2A 4JV5E 1KVKA 1Z0GA 1VISA 4Z7YA 3H09A 1J5EE 2DEIA 1Z0BA 4Z7CA 3F0NA 4JI2I 4LFAI 3ZKDA 2LRSA 1Y4SA 1N0VC 2F4VI 4UTGA 4DUYI 3OMLA 5LMUE 1PIEA 4JI5I 1FWKA 1SR9A 1MU5A 4IZJB 1FWLA 2V85A 2WW4A 2LTSA 4JI4I 2Z5CB 4DR5E 4GKJI 2LJPA 4FWDA 4J8ZA 4F54A 5FWKA 4F9BB 4RPFA 4R8OA 2X7IA 4KQVA 2B3TB 4LF6I 4P7DA 1IBLI 2X36A 3K85A 4DR2E 1RREA 4JI7E 3VK6A 1RC7A 1HNZI 4JV5I 1YYOA 1K47A 2DB2A 2FTXB 1KTVA 4DU8A 2L3CA 1J5EI 3LTOA 2RSMA 1D6TA 4X62I 4LF5I 2Z5BA 1X47A 2M4IA 1MG7A 1YZ9A 4HXZA 3T1HE 3LLHA 4DV6I 2V2ZA 2L33A 5A2QC 4DV2I 1WXRA 4IZKB 4DV7I 4DR5I 2L3JA 3ZZ0A 4WPYA 3OTOE 4UT4A 2L92A 1HK7A 5IT9Q 2E5LE 4F9AB 4DU7A 5DNYA 1ZBTA 4WUDA 3QT8A 4TUGA 4L5NC 4HYMA 2N3GA 2XEXA 2KONA 3HPZA 4DR1E 5T6JA 5AE2A 1FKAE 4IZJA 1XNRI 2FGGA 1IBKE 4JI8E 5IT9C 1Z5CA 3MSWA 1Y4UA 4LF9E 4M2ZA 3AUZA 2RS6A 2O1VA 1DQ3A 2JOBA 4LF7E 3C4BA 2GS8A 4P7AA 4LF4I 4NXME 4HACB 1T4LB 4MYUA 2V8PA 2DIXA 4WFTA 4KHPE 1N32E 2PNMA 4DPXA 4YY3E 2UUCI 2JY9A 2HHHE 2K4VA 4DV3E 2M7QA 1H7UA 1QZRA 3C4TA 2L8TA 1N36I 4DV1I 4PRXA 2PNLA 2F8BA 2DMYA 4DR3E 4PU9A 4DR1I 3HQ1A 3RMPA 1U2RA 1UEKA 1S4EA 1GZ6A 1ELOA 4LF9I 3B82A 2Z5BB 3QT7A 5FLXC 1YYWA 4USMA 4OX9E 1H73A 1X48A 1I94E 3LNUA 3IWCA 3ZM7A 3J7AM 3P06A 2R42A 4KHPI 3H4LA 1N32I 4P52A 1XNQE 2VQFI 4B3MI 2UXCE 2HHHI 2UXBI 4DV3I 3D4JA 4X66E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTX A;  2HFS A;  1XMQ I;  4X64 I;  1Z0C A;  4DR6 I;  1T4O A;  1MX0 A;  4JYA E;  1FJG E;  3ADI A;  5CFF E;  4HAC A;  4DPW A;  4JI6 E;  1NHH A;  2UXD I;  1Z59 A;  1ZM4 A;  2HK3 A;  4X65 E;  3J7A G;  1IBM I;  1KKH A;  2NUE A;  2NUF A;  2VQE E;  4LFB E;  4USK A;  3GON A;  1WUU A;  1RQ0 A;  1XNQ I;  2V2V A;  5A2Q Q;  2N3H A;  1HR0 E;  2VF3 A;  3JAM Q;  1NHI A;  3B78 A;  1B63 A;  5LMU I;  4DPY A;  4R1F A;  2UUB E;  2ZBK B;  2CPN A;  2JVA A;  2DEJ A;  1QU6 A;  3K17 A;  3ZZU A;  4DPU A;  4FN5 A;  3JAM C;  3CWV A;  4X65 I;  1UHZ A;  1GQE A;  5IWA E;  4WUC A;  4WUB A;  2R3V A;  4JI3 E;  1YYK A;  3PYG A;  4ZVI A;  5BR8 E;  2A2D A;  1Z0T A;  4DR2 I;  4JI7 I;  2L2N A;  1FI4 A;  2BM1 A;  4DKK A;  4URL A;  4JI1 E;  4I3H A;  3M6A A;  5LMN E;  4JG4 A;  1HNX E;  3VYY A;  3T1H I;  4LF8 E;  2UUA E;  4XTJ A;  4DXL A;  4DV4 E;  3ADL A;  2RTX A;  4DPT A;  4WYQ B;  4MYT A;  3OTO I;  2ZM6 E;  2LBS B;  1N33 E;  2E5L I;  2HFU A;  5FLX Q;  1T4N A;  4DR7 E;  4X8W A;  3ADG A;  2NPF A;  2V2Q A;  2NA2 A;  1IBK I;  4JI1 I;  4JI8 I;  5LMN I;  2HK2 A;  4DV0 E;  4LFC E;  4B3R E;  2LJH A;  1PKP A;  4AQY E;  1ZXM A;  2YT4 A;  3ADJ A;  3PYE A;  2AJ4 A;  2UUA I;  4LF7 I;  5GME A;  4NXM I;  4DV4 I;  4JI0 E;  4DV5 E;  4JI2 E;  3WU4 A;  4LFA E;  3T1Y E;  4K0K E;  4B3S E;  4YY3 I;  3J81 Q;  2MDR A;  4FWG A;  2B7T A;  4B3T E;  4JI4 E;  3PYD A;  4GKJ E;  3ZKB A;  1RR9 A;  1EA6 A;  1PVG A;  4DR7 I;  4DR3 I;  4PRV A;  1WHQ A;  4LF6 E;  3J81 C;  1IBL E;  4LFC I;  3WU6 A;  4B3R I;  5GMD A;  1N34 E;  1HNZ E;  4FW9 A;  3QT6 A;  2L2M A;  4OX9 I;  1O0W A;  2UU9 E;  1STU A;  4DR4 E;  4FWH A;  3J7Y p;  4JI0 I;  3V2U C;  1I94 I;  4DV5 I;  4X62 E;  4LF5 E;  3WU3 A;  3T1Y I;  2CZ9 A;  4M1K A;  4K0K I;  4DV6 E;  4B3S I;  2UXC I;  2ZIT A;  4DV2 E;  2BV3 A;  4B3T I;  2HKJ A;  4X66 I;  4DV7 E;  2RS7 A;  1DI2 A;  2HKE A;  1NHJ A;  2NUG A;  4JYA I;  1FJG I;  1Z0E A;  5LL6 R;  1EKZ A;  1FNM A;  4JI6 I;  1EI1 A;  1WHN A;  1N34 I;  1XNR E;  2UU9 I;  3WU5 A;  2VQE I;  4DR4 I;  4LFB I;  3B8H A;  4M30 A;  2E1R A;  2IHR 1;  1S16 A;  4LF4 E;  1XMO E;  2J7K A;  4GKK E;  1HR0 I;  2LUQ A;  1H72 C;  2Q2E B;  1Z0V A;  3J80 Q;  2UUC E;  2KHX A;  4ED4 A;  2UUB I;  3VYX A;  1ZXN A;  1DAR A;  1A6F A;  1N36 E;  2LUP B;  1BKN A;  4DV1 E;  3LPS A;  3HUL A;  1X49 A;  1NZ0 A;  3PYF A;  5IWA I;  1J26 A;  4YHH E;  3J80 C;  4JI3 I;  5BR8 I;  1HNW E;  4DUZ E;  4NXN E;  1XHK A;  1Z5B A;  4HY1 A;  3ZZT A;  1H74 A;  1H7S A;  3K1J A;  2A2C A;  1OJ4 A;  3Q1Q A;  1XMO I;  4GKK I;  1HNX I;  4EMD A;  2LTR A;  1N0U A;  1Z5A A;  2BM0 A;  2VQF E;  4B3M E;  4LF8 I;  2UXB E;  2OI2 A;  1XMQ E;  4X64 E;  4DR6 E;  1B62 A;  2V34 A;  2F4V E;  4DUY E;  2ZM6 I;  2EFG A;  4JI5 E;  2B7V A;  1KIJ A;  4YHH I;  1N33 I;  2UXD E;  2EZ6 A;  1HNW I;  4DUZ I;  3QT5 A;  4NXN I;  3P1X A;  1ZM9 A;  1IBM E;  4OOG C;  3V5R A;  5L3J A;  2L2K B;  1Z0W A;  1ZM3 A;  4DV0 I;  4AQY I;  1UIL A;  1ZM2 A;  4JV5 E;  1KVK A;  1Z0G A;  1VIS A;  4Z7Y A;  1J5E E;  2DEI A;  1Z0B A;  4Z7C A;  3F0N A;  4JI2 I;  4LFA I;  3ZKD A;  2LRS A;  1N0V C;  2F4V I;  4UTG A;  4DUY I;  5LMU E;  1PIE A;  4JI5 I;  1FWK A;  1MU5 A;  1FWL A;  2WW4 A;  2LTS A;  4JI4 I;  4DR5 E;  4GKJ I;  2LJP A;  4FWD A;  4RPF A;  2X7I A;  4KQV A;  2B3T B;  4LF6 I;  1IBL I;  2X36 A;  4DR2 E;  1RRE A;  4JI7 E;  1RC7 A;  1HNZ I;  4JV5 I;  1YYO A;  1K47 A;  2DB2 A;  1KTV A;  4DU8 A;  2L3C A;  1J5E I;  3LTO A;  2RSM A;  1D6T A;  4X62 I;  4LF5 I;  1X47 A;  1MG7 A;  1YZ9 A;  4HXZ A;  3T1H E;  3LLH A;  4DV6 I;  2V2Z A;  2L33 A;  5A2Q C;  4DV2 I;  4DV7 I;  4DR5 I;  2L3J A;  3ZZ0 A;  3OTO E;  4UT4 A;  5IT9 Q;  2E5L E;  4DU7 A;  1ZBT A;  4WUD A;  3QT8 A;  4HYM A;  2N3G A;  2XEX A;  4DR1 E;  1FKA E;  1XNR I;  1IBK E;  4JI8 E;  5IT9 C;  1Z5C A;  4LF9 E;  4M2Z A;  2RS6 A;  4LF7 E;  3C4B A;  2GS8 A;  4P7A A;  4LF4 I;  4NXM E;  4HAC B;  1T4L B;  4MYU A;  2V8P A;  2DIX A;  4WFT A;  4KHP E;  1N32 E;  4DPX A;  4YY3 E;  2UUC I;  2JY9 A;  2HHH E;  4DV3 E;  1H7U A;  1QZR A;  3C4T A;  1N36 I;  4DV1 I;  4PRX A;  4DR3 E;  2DMY A;  4PU9 A;  4DR1 I;  1U2R A;  1UEK A;  1S4E A;  4LF9 I;  1ELO A;  3B82 A;  3QT7 A;  5FLX C;  1YYW A;  4USM A;  4OX9 E;  1H73 A;  1X48 A;  1I94 E;  3LNU A;  3ZM7 A;  3J7A M;  2R42 A;  4KHP I;  3H4L A;  1N32 I;  4P52 A;  1XNQ E;  2VQF I;  4B3M I;  2UXC E;  2HHH I;  2UXB I;  4DV3 I;  3D4J A;  4X66 E; 
#chains in the Genus database with same CATH topology
 1EH7 A;  2BBG A;  4WSG A;  5A6B D;  3HTX A;  2HFS A;  1XMQ I;  4X64 I;  1Z0C A;  4DR6 I;  2YU5 A;  2YTN A;  1T4O A;  1MX0 A;  1OYR A;  2I9I A;  1R6L A;  4JYA E;  4KWY A;  4ZYH A;  1FJG E;  3ADI A;  1Y6Z A;  4IFD E;  5CFF E;  4N3O A;  4OO1 E;  1E3H A;  4HAC A;  2C37 A;  4DPW A;  2HGH A;  4JI6 E;  1NHH A;  2UXD I;  1Z59 A;  1ZM4 A;  4MU1 A;  1ZU1 A;  2EM4 A;  2HK3 A;  1A1I A;  4X65 E;  2EOR A;  2MC6 A;  4MDT A;  3J7A G;  1IBM I;  1KKH A;  3NZK A;  2NUE A;  2NUF A;  2EN1 A;  3MHS C;  2VQE E;  2EL5 A;  2M1S A;  3HJC A;  2JXP A;  4LFB E;  4USK A;  3DJW A;  1Y5Y A;  2B9D A;  3GON A;  4I8O A;  1P47 A;  2EM7 A;  1WUU A;  2H36 X;  4ZYE A;  1RQ0 A;  2EOY A;  5AC4 A;  1XNQ I;  4R03 A;  1GTK A;  5C0X B;  1A1J A;  2V2V A;  3Q6M A;  5A2Q Q;  2N3H A;  4IFD A;  1A1H A;  4OO1 A;  2EM8 A;  5IV8 B;  1HR0 E;  2VF3 A;  3JAM Q;  2ENA A;  2EMC A;  1NHI A;  4BMJ A;  1B63 A;  3B78 A;  5LMU I;  4DPY A;  5LLQ A;  4R1F A;  4RH8 A;  2UUB E;  2ZBK B;  4QNK A;  2CPN A;  2JVA A;  4LU9 A;  3L00 A;  2BB8 A;  3IWB A;  2DEJ A;  1UDN A;  1QU6 A;  1ZR9 A;  2EPP A;  2O3Z A;  3K17 A;  3ZZU A;  1BBG A;  2IOP A;  3JAM C;  1R6M A;  4FN5 A;  4DPU A;  1UDS A;  3CWV A;  4X65 I;  1UHZ A;  1GQE A;  5IWA E;  1UDO A;  4WUC A;  2JR1 A;  4WUB A;  2R3V A;  2EJ4 A;  4JI3 E;  1YYK A;  3PYG A;  4ZVI A;  5BR8 E;  2E72 A;  2LVH A;  2A2D A;  1Z0T A;  4DR2 I;  2MC5 A;  5K36 E;  3JTZ A;  4JI7 I;  1JK2 A;  2BA1 D;  4R2R A;  4TUI A;  2ODR C;  2L2N A;  2VF1 A;  2JPA A;  1FI4 A;  2BM1 A;  2WBS A;  5KL5 A;  5AC5 A;  4DKK A;  2I13 A;  4NZV A;  4JI1 E;  4I3H A;  4URL A;  4BC7 A;  3M6A A;  5LMN E;  3JU0 A;  4JG4 A;  5EL9 A;  2ODR D;  1HNX E;  2EM9 A;  3UK3 C;  3CDJ A;  4FW6 A;  2LE2 A;  3VYY A;  4MLQ A;  3T1H I;  1E3P A;  4MU0 A;  2GQ0 A;  2EQ1 A;  2WBU A;  4LF8 E;  4ISA A;  2UUA E;  2EMB A;  5A6A A;  2JT2 A;  4XTJ A;  4DXL A;  4DV4 E;  4GEQ B;  2EN6 A;  3ADL A;  2C37 B;  1NEI A;  2EM6 A;  2RTX A;  4DPT A;  4M9V C;  3BBG A;  4WYQ B;  2JE6 B;  4MYT A;  2ADR A;  3OTO I;  2R1F A;  2ZM6 E;  2HJJ A;  4N4R B;  2LBS B;  2KOU A;  3TQM A;  1N33 E;  2BA0 D;  2JWO A;  4WX9 A;  4ZYG A;  5AE3 A;  2E5L I;  4IZJ D;  2HFU A;  3BGH A;  1WRJ A;  4DMI A;  1X5W A;  5FLX Q;  1T4N A;  4HEI A;  4DR7 E;  2YSP A;  2EMX A;  4X8W A;  3ADG A;  2NPF A;  2V2Q A;  2NA2 A;  1IBK I;  4JI1 I;  4JI8 I;  2V88 A;  2C38 A;  5LMN I;  2HK2 A;  2EOH A;  4BCA A;  4DV0 E;  4LFC E;  4B3R E;  1YHC A;  4IFD B;  2M9A A;  4OO1 B;  2LJH A;  1PKP A;  4AQY E;  2EE8 A;  1ZXM A;  3M85 G;  3M7N D;  2YT4 A;  2EN7 A;  3ADJ A;  3PYE A;  2AJ4 A;  2UUA I;  4LF7 I;  2EPL X;  5GME A;  2V8Q B;  4NXM I;  1AH5 A;  4DV4 I;  4JI0 E;  4DV5 E;  4JI2 E;  3WU4 A;  4LFA E;  2JYA A;  3AV0 A;  5K36 F;  2YTJ A;  4R2S A;  3T1Y E;  4FK5 C;  4K0K E;  4O5G A;  1OYS A;  3BID A;  2YTI A;  3ZOQ B;  4B3S E;  4YY3 I;  3J81 Q;  2CTD A;  2MDR A;  2B7T A;  2EOO A;  2NAB A;  4FWG A;  4B3T E;  4JI4 E;  3PYD A;  4OKG A;  4F9C B;  2WZO A;  4GKJ E;  3ZKB A;  1NCS A;  3F6H A;  1RR9 A;  3F6G A;  1EA6 A;  1PVG A;  4DR7 I;  4DR3 I;  2EPZ A;  4BBY A;  2O1W A;  4PRV A;  1WHQ A;  3J81 C;  4LF6 E;  2V86 A;  2EOI A;  1IBL E;  4BHB A;  4LFC I;  3WU6 A;  4B3R I;  2JE6 A;  5GMD A;  2DSY A;  5AAS A;  5AE1 A;  2IOQ A;  1N34 E;  1HNZ E;  4BA2 A;  4FW9 A;  3QT6 A;  2L2M A;  2J7J A;  4OX9 I;  2V83 A;  1OYP A;  1O0W A;  2UU9 E;  1STU A;  4DR4 E;  4FWH A;  3J7Y p;  4JI0 I;  3V2U C;  3K6Q A;  2GPI A;  4DV5 I;  1I94 I;  4X62 E;  4Q35 B;  4LF5 E;  2NN6 C;  5DNX A;  3WU3 A;  3T1Y I;  2LMZ A;  2E1M A;  2CZ9 A;  2CGE A;  4M1K A;  1N3G A;  3P3E A;  4DV6 E;  4BA1 A;  2O1T A;  2JEA A;  4B3S I;  4K0K I;  4LCF A;  2NN6 D;  3VHT B;  5K36 B;  2UXC I;  2ZIT A;  4DV2 E;  2BV3 A;  2EMG A;  4ZYD A;  4B3T I;  2HKJ A;  2EOM A;  3DF6 A;  4DV7 E;  4X66 I;  4R2E A;  2EM0 A;  2RS7 A;  1DI2 A;  2WNR A;  1X6F A;  4MLV A;  2Z5E A;  2ELY A;  2ENH A;  5DRP A;  2HKE A;  1VI7 A;  1NHJ A;  5JEA C;  4WXD A;  2NUG A;  4JYA I;  1FJG I;  1T39 A;  1Z0E A;  5LL6 R;  1EKZ A;  1FNM A;  1IQO A;  3DD6 A;  2PO2 A;  4JI6 I;  1L4S A;  5JEA D;  2C38 B;  5ELW A;  1EI1 A;  2EN3 A;  2YTQ A;  2V89 A;  1USV A;  2VE7 C;  1PJT A;  1TF3 A;  1WHN A;  2CG9 A;  1N34 I;  4BS9 A;  3Q6N A;  4LPF A;  1XNR E;  2WCC 3;  1A1L A;  2EM5 A;  2UU9 I;  1UN6 B;  3WU5 A;  2VQE I;  2NN6 F;  4DR4 I;  4BC9 A;  4LFB I;  4MQY A;  3B8H A;  3HXL A;  4M30 A;  3UHM A;  2E1R A;  2EWL A;  2IHR 1;  4HTG A;  4FW3 A;  1S16 A;  4LF4 E;  1MEY C;  2YZT A;  4FW4 A;  5DRR A;  1XMO E;  2J7K A;  2LO3 A;  2G7H A;  4X9J A;  4GKK E;  1HR0 I;  4IJD A;  2O1U A;  5JEA F;  2LUQ A;  1H72 C;  2Q2E B;  3THN A;  3CDI A;  1KYQ A;  1Z0V A;  4KZS A;  2EM2 A;  3PRY A;  2UUC E;  3J80 Q;  2KHX A;  2GO4 A;  2YU8 A;  4ED4 A;  2UUB I;  3VYX A;  1YH8 A;  1ZXN A;  2JP9 A;  2PO1 A;  2DLQ A;  1A6F A;  1DAR A;  1N36 E;  2YSO A;  5KL3 A;  2LUP B;  1BKN A;  2EPX A;  4DV1 E;  2L6M A;  4GZN C;  3LPS A;  1NZ0 A;  1X49 A;  3HUL A;  2WP8 B;  3PYF A;  5IWA I;  2VRD A;  3KWR A;  2EP3 A;  4LTY A;  1IMU A;  1J26 A;  2C39 B;  4BA2 B;  2DRP A;  2EMI A;  4YHH E;  3J80 C;  3IWD A;  4FW7 A;  4LCH A;  4JI3 I;  2DLK A;  1Z1B A;  5K36 A;  5BR8 I;  2Z5C A;  4MU4 A;  3U1K A;  1HNW E;  4DUZ E;  2ENC A;  4NXN E;  2LT7 A;  1XHK A;  3C6M A;  3LML A;  1Z5B A;  2EOF A;  2EPU A;  5KL4 A;  2YWQ A;  1UBD C;  2EPA A;  4HY1 A;  3ZZT A;  2JEB A;  1T38 A;  1H74 A;  1H7S A;  3K1J A;  4BA1 B;  2JEA B;  3KZZ A;  4NHR A;  2FV4 B;  2A2C A;  1OJ4 A;  2JOX A;  3Q1Q A;  1USU A;  1XMO I;  4GKK I;  1ZBQ A;  1HNX I;  2GHF A;  4EMD A;  5C0X C;  2WNR B;  2V87 A;  2LTR A;  3HPS A;  4L8N A;  1N0U A;  2VQF E;  1Z5A A;  4Q28 A;  5ADZ A;  4B3M E;  2BM0 A;  4M0V A;  1QNT A;  4LF8 I;  4R2C A;  2MKD A;  2UXB E;  1XXE A;  4IS9 A;  2OI2 A;  4U3D A;  3M85 D;  5C0X D;  4P78 A;  1XMQ E;  4X64 E;  2YTF A;  1YFH A;  2PO2 B;  1WJP A;  1YUJ A;  4DR6 E;  1B62 A;  2BR2 A;  2V34 A;  2D9H A;  4F6N A;  5F3W A;  2F4V E;  4BHC A;  1BBO A;  4DUY E;  2ZM6 I;  3PS3 A;  4AID A;  2EFG A;  4JI5 E;  2B7V A;  1KIJ A;  1JK1 A;  4YHH I;  1N33 I;  1EH6 A;  4O43 A;  5A6B A;  4IZK A;  2EMY A;  2NN6 E;  2UXD E;  3FIG A;  2EZ6 A;  1HNW I;  4DUZ I;  4QNJ A;  3QT5 A;  4NXN I;  1PJQ A;  3P1X A;  3QG5 C;  1ZM9 A;  3GLL A;  2HC5 A;  3HKM A;  1IBM E;  4WSP A;  4OOG C;  1KJK A;  3PS2 A;  4LOM A;  3H1C A;  2N8X A;  3V5R A;  2EMA A;  2L2K B;  1Z0W A;  5L3J A;  1ZM3 A;  4U3B A;  5C0X F;  2EPN A;  4F2J C;  4DV0 I;  3GCM A;  2EOZ A;  2YTD A;  5JEA E;  2WP8 A;  4AQY I;  5KL7 A;  1UIL A;  1ZM2 A;  1TF6 A;  2C39 A;  4JV5 E;  1KVK A;  1Z0G A;  2J65 A;  1VIS A;  4Z7Y A;  4LCG A;  3H09 A;  1YSA C;  1J5E E;  2DEI A;  1Z0B A;  4Z7C A;  2YRK A;  3F0N A;  5KL6 A;  5DRQ A;  1BB8 A;  4JI2 I;  2PO1 B;  4LFA I;  2EML A;  2LV2 A;  1EH8 A;  3ZKD A;  2LRS A;  1Y4S A;  1N0V C;  2NN6 A;  4UTG A;  2F4V I;  2EQ0 A;  4DUY I;  2IES A;  3OML A;  5LMU E;  5A69 A;  1PIE A;  3L7Z B;  4JI5 I;  1FWK A;  1SR9 A;  1MU5 A;  1PJS A;  4O4K A;  4IZJ B;  1FWL A;  2V85 A;  2WW4 A;  5A6J A;  2LTS A;  2RPC A;  5DNL A;  4JI4 I;  2Z5C B;  5EKW A;  4DR5 E;  4GKJ I;  2LJP A;  4FWD A;  2EMW A;  4J8Z A;  4NBQ A;  4F54 A;  2K7I A;  2Q8U A;  5FWK A;  2RQL A;  2EMZ A;  4F9B B;  4RPF A;  4R8O A;  4R2P A;  2JEB B;  2VES A;  2X7I A;  4IS1 C;  4KQV A;  5JEA A;  2B3T B;  2PNZ B;  4LF6 I;  5IXM B;  2EN2 A;  4P7D A;  1IBL I;  2X36 A;  3P3C A;  2PO0 A;  4DR2 E;  1RRE A;  3K85 A;  5KL2 A;  4JI7 E;  3VK6 A;  2DMI A;  1RC7 A;  1HNZ I;  1IQS A;  4JV5 I;  3EPH A;  1YYO A;  1K47 A;  2CT1 A;  2DB2 A;  1MGT A;  2FTX B;  1KTV A;  4IFD C;  4OO1 C;  4DU8 A;  2L3C A;  1DGC A;  2GO3 A;  3LTO A;  1J5E I;  2RSM A;  1D6T A;  3PS1 A;  1LLM C;  1RHY A;  4X62 I;  4LF5 I;  4GQU A;  2Z5B A;  4IFD D;  1X47 A;  2M4I A;  1MG7 A;  1X6H A;  1YZ9 A;  2BR2 B;  4HXZ A;  3T1H E;  4OO1 D;  2EOS A;  3LLH A;  4R2D A;  4DV6 I;  1AAY A;  1P42 A;  2EL6 A;  2V2Z A;  2EL4 A;  2L33 A;  2WBT A;  2EOQ A;  5A2Q C;  2EOX A;  1TN9 A;  4DV2 I;  1WXR A;  4IZK B;  4DV7 I;  4DR5 I;  2L3J A;  3ZZ0 A;  4WPY A;  2EM3 A;  3OTO E;  2EMK A;  4O24 A;  1A1K A;  1RMD A;  3KZY A;  4WXC A;  1PDA A;  5TSE A;  4UT4 A;  2L92 A;  1ZAA C;  2YTO A;  3U1Y A;  2CSH A;  1HK7 A;  5IT9 Q;  2E5L E;  4F9A B;  4DU7 A;  5DNY A;  3B4T A;  5DRO A;  1SFE A;  1ZBT A;  4WUD A;  3QT8 A;  4TUG A;  4L5N C;  2BA1 G;  5C0X E;  4HYM A;  2N3G A;  2DGC A;  1G2F C;  4AM3 A;  4IFD F;  2XEX A;  2YTP A;  3L7Z A;  3EPK A;  4OO1 F;  2EOE A;  2KON A;  3HPZ A;  1YPN A;  5T6J A;  5AE2 A;  4DR1 E;  1FKA E;  2EPM X;  1UDQ A;  2FGG A;  1IBK E;  4IZJ A;  3BF2 A;  1XNR I;  4JI8 E;  5IT9 C;  4RHB B;  1Z5C A;  2PO0 B;  2A25 A;  2R76 A;  3MSW A;  1Y4U A;  2YPN A;  4LF9 E;  4M2Z A;  3AUZ A;  2NN6 B;  2EQ3 A;  2RS6 A;  3GME A;  2O1V A;  1DQ3 A;  2JOB A;  4LF7 E;  3C4B A;  2GS8 A;  2YRH A;  2PNZ A;  1F2I G;  4NXM E;  3KRN A;  4P7A A;  4HAC B;  4LF4 I;  1T4L B;  4MYU A;  2CVE A;  3M99 B;  2V8P A;  2DIX A;  3MHH C;  4WFT A;  4KHP E;  3EQ1 A;  5K36 C;  3THO B;  2AE8 A;  2EN8 A;  2EOJ A;  4R2Q A;  2EPO A;  1N32 E;  2EPR A;  1Y60 A;  2BA0 G;  2PNM A;  4FW5 A;  4DPX A;  5C0X A;  4YY3 E;  2YTE A;  2JY9 A;  2UUC I;  2MDG A;  2HHH E;  2K4V A;  1B69 A;  4DV3 E;  2MKN A;  4AIM A;  5JEA B;  2M7Q A;  1H7U A;  5K36 D;  1QZR A;  3C4T A;  2L8T A;  1N36 I;  1A1G A;  4DV1 I;  2ELZ A;  2EMF A;  4PRX A;  1X3C A;  1YUI A;  2IER A;  2F8B A;  2DMY A;  4DR3 E;  2EN4 A;  2PNL A;  1G2D C;  4PU9 A;  2EMH A;  4DR1 I;  3P3G A;  2RSI A;  3ECR A;  2YRM A;  3P76 A;  3HQ1 A;  3RMP A;  1U2R A;  2YTG A;  1X6E A;  2F1D A;  1UEK A;  1S4E A;  4MU3 A;  1GZ6 A;  1ELO A;  4LF9 I;  3B82 A;  2Z5B B;  3M7N G;  3QT7 A;  5FLX C;  1YYW A;  1A1F A;  4USM A;  4OX9 E;  4F6M A;  1H73 A;  1X48 A;  1I94 E;  4OZE A;  3EPJ A;  3C6K A;  3LNU A;  3IWC A;  2EPK X;  3ZM7 A;  3J7A M;  3P06 A;  2R42 A;  4KHP I;  3H4L A;  2PRT A;  4J3D A;  1N32 I;  2GLI A;  4P52 A;  1XNQ E;  2VQF I;  4B3M I;  3EPL A;  4R2A A;  2EPC A;  2UXC E;  5A6K A;  2HHH I;  4DV3 I;  2UXB I;  2LCE A;  3D4J A;  2LJU A;  4X66 E; 
#chains in the Genus database with same CATH homology
 3HTX A;  2HFS A;  1XMQ I;  4X64 I;  1Z0C A;  4DR6 I;  1T4O A;  1MX0 A;  4JYA E;  1FJG E;  3ADI A;  1Y6Z A;  5CFF E;  4N3O A;  4HAC A;  4DPW A;  4JI6 E;  1NHH A;  2UXD I;  1Z59 A;  1ZM4 A;  2HK3 A;  4X65 E;  2MC6 A;  3J7A G;  1IBM I;  1KKH A;  2NUE A;  2NUF A;  2VQE E;  2M1S A;  3HJC A;  4LFB E;  4USK A;  3DJW A;  3GON A;  2B9D A;  4I8O A;  1WUU A;  2H36 X;  1RQ0 A;  1XNQ I;  4R03 A;  2V2V A;  3Q6M A;  5A2Q Q;  2N3H A;  1HR0 E;  2VF3 A;  3JAM Q;  1NHI A;  4BMJ A;  1B63 A;  3B78 A;  5LMU I;  4DPY A;  4R1F A;  2UUB E;  2ZBK B;  2CPN A;  2JVA A;  4LU9 A;  3IWB A;  2DEJ A;  1QU6 A;  3K17 A;  3ZZU A;  2IOP A;  3JAM C;  4FN5 A;  4DPU A;  3CWV A;  4X65 I;  1UHZ A;  1GQE A;  5IWA E;  4WUC A;  2JR1 A;  4WUB A;  2R3V A;  4JI3 E;  1YYK A;  3PYG A;  4ZVI A;  5BR8 E;  2A2D A;  1Z0T A;  4DR2 I;  2MC5 A;  3JTZ A;  4JI7 I;  4TUI A;  2ODR C;  2L2N A;  2VF1 A;  1FI4 A;  2BM1 A;  4DKK A;  4URL A;  4JI1 E;  4I3H A;  4BC7 A;  3M6A A;  5LMN E;  3JU0 A;  4JG4 A;  2ODR D;  1HNX E;  2LE2 A;  3VYY A;  3T1H I;  2GQ0 A;  4LF8 E;  2UUA E;  4XTJ A;  4DXL A;  4DV4 E;  4GEQ B;  3ADL A;  2RTX A;  4DPT A;  4WYQ B;  4MYT A;  3OTO I;  2ZM6 E;  2LBS B;  1N33 E;  2KOU A;  2JWO A;  5AE3 A;  2E5L I;  4IZJ D;  2HFU A;  4DMI A;  5FLX Q;  1T4N A;  4DR7 E;  4X8W A;  3ADG A;  2NPF A;  2V2Q A;  2NA2 A;  1IBK I;  4JI1 I;  4JI8 I;  2V88 A;  5LMN I;  2HK2 A;  4BCA A;  4DV0 E;  4LFC E;  4B3R E;  2LJH A;  1PKP A;  4AQY E;  1ZXM A;  2YT4 A;  3ADJ A;  3PYE A;  2AJ4 A;  2UUA I;  4LF7 I;  5GME A;  2V8Q B;  4NXM I;  4DV4 I;  4JI0 E;  4DV5 E;  4JI2 E;  3WU4 A;  4LFA E;  3AV0 A;  3T1Y E;  4K0K E;  3ZOQ B;  4B3S E;  4YY3 I;  3J81 Q;  2MDR A;  4FWG A;  2B7T A;  4B3T E;  4JI4 E;  3PYD A;  4F9C B;  2WZO A;  4GKJ E;  3ZKB A;  3F6H A;  1RR9 A;  3F6G A;  1EA6 A;  1PVG A;  4DR7 I;  4DR3 I;  4BBY A;  2O1W A;  4PRV A;  1WHQ A;  3J81 C;  4LF6 E;  2V86 A;  1IBL E;  4LFC I;  3WU6 A;  4B3R I;  5GMD A;  2DSY A;  5AAS A;  5AE1 A;  2IOQ A;  1N34 E;  1HNZ E;  4FW9 A;  3QT6 A;  2L2M A;  4OX9 I;  2V83 A;  1O0W A;  2UU9 E;  1STU A;  4DR4 E;  4FWH A;  3J7Y p;  4JI0 I;  3V2U C;  3K6Q A;  1I94 I;  4DV5 I;  4X62 E;  4LF5 E;  3WU3 A;  3T1Y I;  2LMZ A;  2E1M A;  2CZ9 A;  2CGE A;  4M1K A;  4K0K I;  4DV6 E;  2O1T A;  4B3S I;  2UXC I;  2ZIT A;  4DV2 E;  2BV3 A;  4B3T I;  2HKJ A;  3DF6 A;  4DV7 E;  4X66 I;  2RS7 A;  1DI2 A;  2Z5E A;  2HKE A;  1NHJ A;  2NUG A;  4JYA I;  1FJG I;  1Z0E A;  5LL6 R;  1EKZ A;  1FNM A;  4JI6 I;  1EI1 A;  2V89 A;  1USV A;  2VE7 C;  2CG9 A;  1WHN A;  1N34 I;  4BS9 A;  3Q6N A;  1XNR E;  2UU9 I;  3WU5 A;  2VQE I;  4DR4 I;  4BC9 A;  4LFB I;  3B8H A;  3HXL A;  4M30 A;  2E1R A;  2EWL A;  2IHR 1;  1S16 A;  4LF4 E;  2YZT A;  1XMO E;  2J7K A;  2G7H A;  4GKK E;  1HR0 I;  2O1U A;  2LUQ A;  1H72 C;  2Q2E B;  1Z0V A;  4KZS A;  3PRY A;  2UUC E;  3J80 Q;  2KHX A;  4ED4 A;  2UUB I;  3VYX A;  1ZXN A;  1DAR A;  1A6F A;  1N36 E;  2LUP B;  1BKN A;  4DV1 E;  2L6M A;  3LPS A;  1NZ0 A;  1X49 A;  3HUL A;  3PYF A;  5IWA I;  3KWR A;  4LTY A;  1J26 A;  4YHH E;  3J80 C;  4JI3 I;  3IWD A;  5BR8 I;  2Z5C A;  1HNW E;  4DUZ E;  4NXN E;  1XHK A;  3LML A;  1Z5B A;  4HY1 A;  3ZZT A;  1H74 A;  1H7S A;  3K1J A;  2FV4 B;  2A2C A;  1OJ4 A;  2JOX A;  3Q1Q A;  1USU A;  1XMO I;  4GKK I;  1ZBQ A;  1HNX I;  4EMD A;  2V87 A;  2LTR A;  3HPS A;  4L8N A;  1N0U A;  2VQF E;  1Z5A A;  4Q28 A;  5ADZ A;  4B3M E;  2BM0 A;  4M0V A;  4LF8 I;  2UXB E;  2OI2 A;  4P78 A;  1XMQ E;  4X64 E;  4DR6 E;  1B62 A;  2V34 A;  5F3W A;  2F4V E;  4DUY E;  2ZM6 I;  2EFG A;  4JI5 E;  2B7V A;  1KIJ A;  4YHH I;  1N33 I;  4IZK A;  2UXD E;  3FIG A;  2EZ6 A;  1HNW I;  4DUZ I;  3QT5 A;  4NXN I;  3P1X A;  1ZM9 A;  1IBM E;  4WSP A;  4OOG C;  3V5R A;  5L3J A;  2L2K B;  1Z0W A;  1ZM3 A;  4DV0 I;  4AQY I;  1UIL A;  1ZM2 A;  4JV5 E;  1KVK A;  1Z0G A;  1VIS A;  4Z7Y A;  3H09 A;  1J5E E;  2DEI A;  1Z0B A;  4Z7C A;  3F0N A;  4JI2 I;  4LFA I;  3ZKD A;  2LRS A;  1Y4S A;  1N0V C;  2F4V I;  4UTG A;  4DUY I;  3OML A;  5LMU E;  1PIE A;  4JI5 I;  1FWK A;  1SR9 A;  1MU5 A;  4IZJ B;  1FWL A;  2V85 A;  2WW4 A;  2LTS A;  4JI4 I;  2Z5C B;  4DR5 E;  4GKJ I;  2LJP A;  4FWD A;  4J8Z A;  4F54 A;  5FWK A;  4F9B B;  4RPF A;  4R8O A;  2X7I A;  4KQV A;  2B3T B;  4LF6 I;  4P7D A;  1IBL I;  2X36 A;  3K85 A;  4DR2 E;  1RRE A;  4JI7 E;  3VK6 A;  1RC7 A;  1HNZ I;  4JV5 I;  1YYO A;  1K47 A;  2DB2 A;  2FTX B;  1KTV A;  4DU8 A;  2L3C A;  1J5E I;  3LTO A;  2RSM A;  1D6T A;  4X62 I;  4LF5 I;  2Z5B A;  1X47 A;  2M4I A;  1MG7 A;  1YZ9 A;  4HXZ A;  3T1H E;  3LLH A;  4DV6 I;  2V2Z A;  2L33 A;  5A2Q C;  4DV2 I;  1WXR A;  4IZK B;  4DV7 I;  4DR5 I;  2L3J A;  3ZZ0 A;  4WPY A;  3OTO E;  4UT4 A;  2L92 A;  1HK7 A;  5IT9 Q;  2E5L E;  4F9A B;  4DU7 A;  5DNY A;  1ZBT A;  4WUD A;  3QT8 A;  4TUG A;  4L5N C;  4HYM A;  2N3G A;  2XEX A;  2KON A;  3HPZ A;  4DR1 E;  5T6J A;  5AE2 A;  1FKA E;  4IZJ A;  1XNR I;  2FGG A;  1IBK E;  4JI8 E;  5IT9 C;  1Z5C A;  3MSW A;  1Y4U A;  4LF9 E;  4M2Z A;  3AUZ A;  2RS6 A;  2O1V A;  1DQ3 A;  2JOB A;  4LF7 E;  3C4B A;  2GS8 A;  4P7A A;  4LF4 I;  4NXM E;  4HAC B;  1T4L B;  4MYU A;  2V8P A;  2DIX A;  4WFT A;  4KHP E;  1N32 E;  2PNM A;  4DPX A;  4YY3 E;  2UUC I;  2JY9 A;  2HHH E;  2K4V A;  4DV3 E;  2M7Q A;  1H7U A;  1QZR A;  3C4T A;  2L8T A;  1N36 I;  4DV1 I;  4PRX A;  2PNL A;  2F8B A;  2DMY A;  4DR3 E;  4PU9 A;  4DR1 I;  3HQ1 A;  3RMP A;  1U2R A;  1UEK A;  1S4E A;  1GZ6 A;  1ELO A;  4LF9 I;  3B82 A;  2Z5B B;  3QT7 A;  5FLX C;  1YYW A;  4USM A;  4OX9 E;  1H73 A;  1X48 A;  1I94 E;  3LNU A;  3IWC A;  3ZM7 A;  3J7A M;  3P06 A;  2R42 A;  4KHP I;  3H4L A;  1N32 I;  4P52 A;  1XNQ E;  2VQF I;  4B3M I;  2UXC E;  2HHH I;  2UXB I;  4DV3 I;  3D4J A;  4X66 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...