3T1YE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3t1yE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1yE02
5FLXQ 2UUBE 1NHJA 4DV1I 4LFCI 4JI2I 1GQEA 1Z59A 4DPYA 1XNRE 4DV2E 4AQYE 2LJHA 4GKJE 1ZBTA 3ZZ0A 4DR3E 2A2CA 1J5EI 2Q2EB 3VYXA 3OTOE 4HY1A 4JI6E 1X49A 2HHHI 4DV0E 4DV0I 4JI7I 3ZZUA 1OJ4A 1PIEA 3V2UC 1HNWE 5BR8I 1T4OA 1XNRI 2HFSA 1B63A 2BM1A 3J81C 2LJPA 2UUCI 4JYAI 3HULA 4GKKI 4LFCE 1NHHA 4YHHE 2E1RA 2UUAE 2RTXA 4HYMA 1STUA 2L2NA 3QT5A 2DB2A 2UUCE 1NZ0A 3ZKDA 2CZ9A 4DUYI 3PYDA 1HR0E 5LMNI 4DV7I 3LNUA 1RC7A 4KHPI 4DR5E 2BM0A 3C4TA 2EZ6A 3K1JA 4DPUA 5LMNE 3K17A 2R3VA 2CPNA 2UUAI 2V34A 1FI4A 1ZM4A 2V2QA 4OX9E 1N34I 2NUFA 2UUBI 4HXZA 4PU9A 5LMUI 1KIJA 4LFAE 4LF6E 4DR2E 1H74A 4FW9A 2YT4A 4FWHA 3D4JA 2N3GA 4LF8I 2EFGA 1Z5BA 4DV5E 1XMOE 1UILA 1XNQE 2B7VA 4MYUA 4DV2I 2ZBKB 3PYGA 4OOGC 1KTVA 4JI0I 1EI1A 1MG7A 3Q1QA 2JVAA 4DR6E 2E5LE 1FWKA 3B82A 1I94E 1YYOA 1HNZE 4DU7A 1KKHA 4WUDA 2HHHE 4DV5I 4PRXA 4YY3E 3T1HE 4DV3I 3LPSA 1H7UA 4DUYE 1J5EE 2V2ZA 5FLXC 4X65E 1U2RA 3CWVA 1H7SA 4LFAI 4LFBI 2ZITA 1XMQI 4X62I 4Z7CA 4JYAE 4DV1E 4EMDA 1VISA 2B7TA 1Z0GA 4M2ZA 4JI7E 4WUCA 2RS6A 2A2DA 4JI5I 4JI8E 4Z7YA 4YY3I 3T1HI 1K47A 4DPTA 1BKNA 4DR1E 3ZZTA 2GS8A 4FWGA 3J80Q 2UXCE 4B3TI 1Z0VA 2E5LI 3M6AA 3J81Q 2L3JA 4R1FA 4M1KA 1X47A 3ZKBA 2DMYA 2MDRA 4X66I 4KHPE 5LL6R 4GKKE 3ADLA 2HKJA 1FKAE 4P7AA 2LTSA 2ZM6E 3LTOA 3VYYA 4B3TE 4B3SE 2UXCI 3ADGA 3LLHA 1HR0I 3B8HA 3J7AM 3OTOI 1A6FA 2HK2A 3ZM7A 4WUBA 4FN5A 4NXNI 1XHKA 2RS7A 1Z0BA 4HACA 4UT4A 3QT7A 4JI5E 4LF5I 2RSMA 4JV5I 4M30A 1IBKI 4URLA 1HNWI 1NHIA 1N33I 4JV5E 1J26A 2UU9E 2NUEA 2N3HA 1QZRA 3H4LA 1ZM9A 5GMDA 3T1YI 2IHR1 1EKZA 3PYEA 4P52A 4B3RE 4ZVIA 1ZM2A 4PRVA 1S4EA 2F4VE 2KHXA 4DUZE 4JI1I 1EA6A 3P1XA 1UHZA 1N34E 3B78A 4OX9I 1N32E 4DV6E 4X64I 4FWDA 3JAMQ 1WHQA 1PKPA 1ELOA 1ZM3A 2HFUA 1QU6A 1Z5CA 4DU8A 2J7KA 1D6TA 4ED4A 5A2QQ 1HNXE 3WU4A 2UXDI 2V2VA 4K0KI 1YYKA 4K0KE 2L3CA 1ZXMA 1HNZI 3V5RA 1XMOI 2ZM6I 2R42A 4B3MI 2NPFA 4DR7E 2NA2A 1WHNA 1IBKE 1Z5AA 2L33A 1WUUA 4JI1E 1RQ0A 2VF3A 4XTJA 4JI3I 1MU5A 4LF5E 4MYTA 1X48A 2UXDE 1HNXI 1T4LB 4DR7I 4X65I 4JI6I 2L2MA 4JG4A 4LF9I 5IWAE 5IWAI 4JI8I 3T1YE 4DV3E 1FJGE 3C4BA 4GKJI 4X64E 1N32I 2UXBI 2UXBE 3J7Yp 2F4VI 4X62E 2LTRA 2LBSB 1H73A 4USKA 2HKEA 1Z0TA 3JAMC 4DUZI 2NUGA 1T4NA 4LF9E 1Z0CA 4JI4I 2VQFE 1N36I 4B3ME 4DV4E 2BV3A 2X7IA 4WYQB 1N36E 2VQFI 4LF7E 5GMEA 1O0WA 2UU9I 4DR6I 4DR3I 1FWLA 4UTGA 5LMUE 4RPFA 4LF7I 4X8WA 2XEXA 3HTXA 4WFTA 4DXLA 4DPXA 4DV4I 3ADJA 3GONA 1FNMA 2JY9A 4B3SI 2LUQA 4DR5I 2HK3A 4USMA 3PYFA 4DR4E 2LUPB 3WU3A 4JI3E 1DARA 4JI0E 4LF4I 4LF4E 5IT9C 2VQEE 4NXME 1IBME 2LRSA 1YZ9A 2DEIA 4I3HA 2AJ4A 5A2QC 3QT8A 1IBLI 1N33E 3ADIA 1I94I 4DPWA 2X36A 4DKKA 4KQVA 1YYWA 1B62A 1H72C 3WU5A 3J80C 4LFBE 3J7AG 5IT9Q 2DIXA 4DR2I 1PVGA 1S16A 1UEKA 3WU6A 4DV6I 5CFFE 1IBMI 1N0VC 1RREA 4YHHI 1RR9A 4JI2E 1Z0WA 4NXNE 1KVKA 1XMQE 5BR8E 1FJGI 2V8PA 1XNQI 1IBLE 5L3JA 4B3RI 2WW4A 4DR4I 4DR1I 4LF8E 3QT6A 4HACB 2B3TB 1MX0A 4JI4E 1Z0EA 4X66E 3F0NA 1ZXNA 1N0UA 4DV7E 2L2KB 2DEJA 4AQYI 2OI2A 4NXMI 4LF6I 2VQEI 1DI2A
chains in the Genus database with same CATH superfamily
5FLXQ 2KONA 2UUBE 1HNXI 4IFDA 2YTQA 1NHJA 2ODRC 2WP8A 3THNA 1PDAA 4DV1I 4LFCI 5JEAE 4JI2I 2EN3A 1GQEA 1Z59A 4DPYA 1XNRE 4DV2E 4AQYE 2EOYA 2LJHA 4GKJE 1ZBTA 3ZZ0A 4DR3E 5KL2A 2EOIA 2A2CA 2YSOA 1IMUA 1AH5A 2EWLA 3MSWA 1J5EI 2PNZB 4KWYA 2EOQA 2EM0A 3VYXA 2Q2EB 1Y60A 3HJCA 2GO3A 4NHRA 2JP9A 3OTOE 2HC5A 2VF1A 4JI6E 4HY1A 5C0XE 5K36E 4OO1D 1X49A 2EM9A 4DV0E 3VHTB 2HHHI 1PJQA 4DV0I 3EPKA 4JI7I 2EMFA 2GHFA 5AC4A 3ZZUA 2EPCA 1OJ4A 4R8OA 1PIEA 3V2UC 3C6KA 1HNWE 1T4OA 2GPIA 2HFSA 4P78A 1B63A 2FV4B 2EOEA 1ZAAC 2BM1A 3J81C 2LJPA 2UUCI 4JYAI 1Y5YA 3HULA 4BMJA 4LFCE 2NN6B 4GKKI 1NHHA 5IXMB 4YHHE 5EKWA 3LMLA 2E1RA 2LE2A 2EPUA 2UUAE 2RTXA 4HYMA 2G7HA 1STUA 2L2NA 1A1JA 1X6EA 3QT5A 1DGCA 2DB2A 5AE3A 2UUCE 1NZ0A 2NN6A 3ZKDA 5A6KA 2CZ9A 4DUYI 3PYDA 2WBTA 2EPKX 4MQYA 2PO1B 4MDTA 1HR0E 2EP3A 2LMZA 1MGTA 1PJTA 4L8NA 4R2CA 4BS9A 3P3GA 1N3GA 5LMNI 4DV7I 3C6MA 3LNUA 2E72A 1RC7A 4R2RA 4KHPI 1BBGA 4DR5E 2BM0A 1ZU1A 3C4TA 4WXDA 3UHMA 3EPLA 2EZ6A 3K1JA 4ZYDA 5LMNE 3MHHC 4DPUA 2N8XA 3F6HA 4IFDD 3K17A 2R3VA 4F6NA 2CPNA 2UUAI 2DSYA 2V34A 1TF3A 1FI4A 1ZM4A 2V2QA 4OX9E 1N34I 4ISAA 2NUFA 2UUBI 3KZYA 2C37A 4HXZA 4PU9A 5DNYA 5LMUI 1ZBQA 1KIJA 2EMAA 2EL5A 4LFAE 2ADRA 1F2IG 2EM4A 4LF6E 4DR2E 2YTOA 2BA0D 1H74A 4HTGA 2EOOA 2EMHA 4FW9A 1L4SA 3KRNA 2YT4A 4O43A 4R2SA 1KJKA 4FWHA 1MEYC 4TUGA 2LO3A 3D4JA 5F3WA 2ELZA 1KYQA 1OYSA 3GCMA 4BHCA 2JPAA 5ADZA 2N3GA 4LF8I 2EFGA 1T39A 5FWKA 1Z5BA 4DV5E 1XMOE 4WPYA 2WNRB 1UILA 1XNQE 1T38A 2EN1A 4WX9A 3U1KA 2B7VA 4MYUA 4DV2I 2ODRD 1G2DC 2YU5A 2ZBKB 2C39B 1XXEA 4OO1C 1B69A 1A1FA 3PYGA 5JEAC 4OOGC 1KTVA 4JI0I 1EI1A 1E3HA 1MG7A 4BHBA 2PNLA 3Q1QA 2JVAA 2YTJA 4DR6E 2E5LE 2EPLX 1FWKA 4AIDA 4F2JC 3B82A 1IQOA 1I94E 1YYOA 4QNKA 1HNZE 4DU7A 1KKHA 2YTFA 1YH8A 2YTEA 1X6FA 4WUDA 2FTXB 4R2PA 4LU9A 2HHHE 4DV5I 2EN6A 4PRXA 4J8ZA 4YY3E 3T1HE 4DV3I 3LPSA 2PRTA 1H7UA 2IOPA 4DUYE 4FW3A 1P42A 1J5EE 2NN6C 2V2ZA 3P06A 5FLXC 3BGHA 3P3EA 4X65E 2EPOA 1U2RA 3CWVA 2EPPA 1GZ6A 1H7SA 4FW6A 3B4TA 3HQ1A 3UK3C 2YTPA 4DMIA 2GLIA 4LFAI 4LFBI 5AE1A 1X5WA 2ZITA 1XMQI 3KWRA 2GO4A 4Z7CA 2EOSA 4X62I 4F9AB 4JYAE 2LV2A 4DV1E 2EQ0A 5KL7A 4EMDA 1VISA 2B7TA 1Z0GA 4M2ZA 1BB8A 1HK7A 4MLQA 4JI7E 2BA1D 4IZJA 2RS6A 4WUCA 2EPRA 2RQLA 1WXRA 4FK5C 2A2DA 5DRRA 2DMIA 4O4KA 1BBOA 2LCEA 4JI5I 2I9IA 2EPAA 4JI8E 4Z7YA 1OYPA 2JEBA 4YY3I 3T1HI 1K47A 5JEAB 4IZJB 3M7NG 4DPTA 4IFDC 2YTDA 1BKNA 4DR1E 2ENCA 4BBYA 4N3OA 3ZZTA 3ECRA 5LLQA 1R6LA 2JE6A 2GS8A 5JEAF 1A1LA 2A25A 4FWGA 3J80Q 1OYRA 2JEBB 4OZEA 3M7ND 4OO1F 2V85A 2UXCE 4B3TI 4OO1E 2Z5CA 2EMLA 2EN4A 5AC5A 1QNTA 1Z0VA 4KZSA 2AE8A 4BC9A 1X3CA 2E5LI 3M6AA 2WZOA 3AV0A 3J81Q 2L3JA 2RPCA 1EH7A 4R1FA 4F6MA 1YFHA 3K85A 4M1KA 1X47A 3M99B 3ZKBA 3HPZA 2DMYA 2MDRA 2KOUA 4X66I 4KHPE 5LL6R 3GMEA 4GKKE 2YRHA 3ADLA 2HKJA 1FKAE 4P7AA 2J7JA 2LTSA 2O1VA 2ZM6E 4U3BA 3LTOA 4OO1A 3NZKA 4BA1B 4NZVA 2EPXA 3VYYA 4B3TE 4B3SE 2UXCI 3ADGA 1UBDC 3LLHA 1HR0I 3B8HA 3J7AM 3OTOI 1A6FA 2HK2A 3ZM7A 1A1KA 4WUBA 4OO1B 1NEIA 2R1FA 2WCC3 2Z5BA 4BA1A 3FIGA 4FN5A 1LLMC 4NXNI 3THOB 1XHKA 2YRMA 2F1DA 1WJPA 2EMKA 2NN6E 3CDIA 2RS7A 1R6MA 1Z0BA 2NN6F 4HACA 4OKGA 3QT7A 4UT4A 4JI5E 2JEAA 4LF5I 2RSMA 2O1TA 4JV5I 4M30A 2EL6A 2EPNA 3P3CA 4IJDA 2E1MA 2EMZA 4P7DA 5K36D 1P47A 1IBKI 4URLA 2EPZA 2JXPA 1HNWI 1NHIA 4X9JA 2WP8B 3HKMA 1Y4SA 4BA2B 1N33I 4JV5E 1JK1A 4FW4A 1J26A 2UU9E 2NUEA 4LCFA 2EMYA 2L6MA 2N3HA 1QZRA 2BR2B 3CDJA 3H4LA 2MC5A 2WBSA 1SR9A 1TN9A 4BC7A 2EMWA 2EORA 1ZM9A 2O1WA 5GMDA 3T1YI 4AIMA 2IHR1 2EM8A 1EKZA 5JEAD 2EMXA 3PYEA 4P52A 4B3RE 4NBQA 4ZVIA 2PNZA 2H36X 3DF6A 1ZM2A 1WRJA 4I8OA 5EL9A 4R03A 4AM3A 4N4RB 4PRVA 1S4EA 2PO2A 4BCAA 3PRYA 2F4VE 1G2FC 2KHXA 4DUZE 4JI1I 5DRQA 1EA6A 3P1XA 1UHZA 5DROA 1N34E 4F9BB 3B78A 4OX9I 2EM5A 4DV6E 1N32E 2EQ1A 4F9CB 2FGGA 1JK2A 1AAYA 3AUZA 2CGEA 5AE2A 4FWDA 1WHQA 1PKPA 2VE7C 2EOFA 2DRPA 2DLKA 3JAMQ 4BA2A 3MHSC 1ELOA 1ZM3A 3Q6NA 3EPHA 3JTZA 5DRPA 2HFUA 1QU6A 2EMGA 1Z5CA 4DU8A 2J7KA 5KL4A 1D6TA 4IFDB 4ED4A 4FW5A 1X6HA 3H09A 5A2QQ 4O5GA 4WSGA 1HNXE 3WU4A 2PO1A 2UXDI 1USVA 2V2VA 2F8BA 1YYKA 4K0KI 4K0KE 4LPFA 1IQSA 2L3CA 2YRKA 1ZXMA 4MU4A 5DNLA 3RMPA 3V5RA 1HNZI 2EMCA 2YSPA 2ZM6I 1XMOI 2R42A 4B3MI 2NPFA 2I13A 2L92A 5C0XC 5BR8I 3BF2A 2PO2B 3M85G 4DR7E 2NA2A 1WHNA 1IBKE 1Z5AA 1USUA 3H1CA 2L33A 1UDQA 2K7IA 5A6BA 2C38A 1WUUA 4HEIA 4JI1E 4ZYHA 2CTDA 1RQ0A 2ENAA 5C0XA 2VF3A 4XTJA 3PS3A 2R76A 4JI3I 3GLLA 1GTKA 2C38B 1MU5A 1UN6B 2IOQA 4LF5E 1RHYA 2J65A 5K36C 2YPNA 2NN6D 4MYTA 1X48A 2EM3A 2EN8A 1T4LB 1NCSA 3K6QA 1TF6A 2UXDE 2V8QB 2EM6A 2IERA 4X65I 2RSIA 4JI6I 2L2MA 1YHCA 4JG4A 4LF9I 2EM7A 5IWAE 2MDGA 5IWAI 3BBGA 2MC6A 3F6GA 2EQ3A 2EOZA 3T1YE 1A1HA 4JI8I 4DV3E 2Z5EA 4MU3A 2YWQA 3IWCA 1FJGE 3C4BA 3OMLA 2WNRA 4GKJI 2EM2A 4X64E 1N32I 2HGHA 4GEQB 2EN7A 1A1GA 4L5NC 2YU8A 3DD6A 2UXBI 1EH6A 2C37B 4O24A 2UXBE 3J7Yp 2F4VI 2EOJA 2LTRA 4X62E 4RHBB 2LBSB 4ZYGA 2V86A 5C0XB 1H73A 3ZOQB 1UDNA 2JOBA 2LT7A 4USKA 2K4VA 2Q8UA 2HKEA 2IESA 4U3DA 4MU0A 1Z0TA 2EMIA 2VRDA 2MKDA 3JAMC 2BBGA 4R2AA 4DUZI 2NUGA 1Y4UA 1T4NA 2HJJA 2V87A 4LF9E 2VQFE 1Z0CA 4GQUA 1N36I 3U1YA 4JI4I 4R2DA 4B3ME 2CVEA 2M4IA 4DV4E 2CG9A 4ZYEA 2BV3A 2X7IA 4WYQB 2EE8A 3TQMA 1N36E 2VQFI 1YPNA 4LF7E 1PJSA 2JOXA 5GMEA 2D9HA 1XNRI 1O0WA 2L8TA 3DJWA 2M9AA 4WSPA 4LOMA 2UU9I 4DR6I 5K36B 2ENHA 4FW7A 2PO0A 5C0XD 4DR3I 3JU0A 5A6JA 1FWLA 4UTGA 5LMUE 4RPFA 4LF7I 4X8WA 4R2QA 5AASA 5A6AA 3VK6A 5KL3A 4LCHA 2XEXA 3HTXA 2DLQA 4IFDE 4WFTA 2C39A 2WBUA 3Q6MA 2PO0B 4DXLA 5KL5A 4DPXA 4IS9A 4DV4I 3ADJA 3GONA 4Q35B 1FNMA 4LTYA 2JY9A 2BA0G 2YTNA 4J3DA 4B3SI 3PS1A 2LUQA 3QG5C 2EL4A 2M7QA 1VI7A 4DR5I 2EPMX 1SFEA 2HK3A 2JWOA 2EN2A 4USMA 3EPJA 2BA1G 2EJ4A 1EH8A 2NABA 3KZZA 4DR4E 3PYFA 2LUPB 3WU3A 2V83A 5K36A 2YTGA 3HXLA 2JE6B 4JI3E 1DARA 4Q28A 2CT1A 4JI0E 2PNMA 3IWDA 4LF4I 4LF4E 5IT9C 3L00A 4MU1A 1YUJA 2VQEE 2DGCA 4NXME 2MKNA 1IBME 2LRSA 2YTIA 2Z5BB 1YZ9A 4M9VC 4IS1C 2DEIA 5JEAA 4R2EA 4I3HA 4X64I 2LVHA 4IFDF 2EMBA 2O1UA 4IZJD 2EOMA 2EOHA 2JEAB 5DNXA 4M0VA 1DQ3A 2M1SA 1YUIA 2AJ4A 5A2QC 3QT8A 1IBLI 1N33E 3P76A 2Z5CB 3ADIA 1I94I 4DPWA 3HPSA 2JYAA 2X36A 5IV8B 4DKKA 2O3ZA 2JR1A 1YYWA 4KQVA 4DR7I 1B62A 2EOXA 5C0XF 2CSHA 1H72C 1Z1BA 3WU5A 3J80C 3EQ1A 3J7AG 4LFBE 4TUIA 2BR2A 2GQ0A 4IZKB 5IT9Q 2DIXA 4DR2I 4RH8A 1PVGA 1S16A 1UEKA 3WU6A 2VESA 5CFFE 3M85D 4DV6I 1IBMI 1N0VC 1RREA 4YHHI 1RR9A 4GZNC 2LJUA 4JI2E 1YSAC 1Z0WA 4NXNE 2BB8A 1KVKA 5A6BD 5TSEA 1XMQE 2B9DA 5BR8E 4QNJA 5K36F 3BIDA 1E3PA 1RMDA 4MLVA 1ZR9A 4WXCA 1FJGI 2V8PA 2ELYA 1XNQI 5A69A 4LCGA 3L7ZA 1IBLE 1A1IA 5L3JA 4B3RI 2WW4A 2JT2A 2YZTA 4DR1I 4DR4I 5KL6A 4LF8E 2V89A 3QT6A 2B3TB 1MX0A 5T6JA 4JI4E 1UDSA 4X66E 1Z0EA 3F0NA 1ZXNA 4HACB 3IWBA 1N0UA 3L7ZB 4DV7E 2L2KB 1Y6ZA 3PS2A 2DEJA 1UDOA 4F54A 4AQYI 5ELWA 2OI2A 2V88A 4NXMI 4IZKA 4LF6I 2VQEI 1DI2A
chains in the Genus database with same CATH topology
5FLXQ 2KONA 2UUBE 1NHJA 2ODRC 4DV1I 4LFCI 4JI2I 1GQEA 1Z59A 4DPYA 1XNRE 4DV2E 4AQYE 2LJHA 4GKJE 1ZBTA 3ZZ0A 4DR3E 2A2CA 2EWLA 3MSWA 1J5EI 3HJCA 2Q2EB 3VYXA 3OTOE 2VF1A 4JI6E 4HY1A 1X49A 2HHHI 4DV0E 4DV0I 4JI7I 3ZZUA 1OJ4A 4R8OA 1PIEA 3V2UC 1HNWE 5BR8I 1T4OA 1XNRI 2HFSA 4P78A 1B63A 2FV4B 2BM1A 3J81C 2LJPA 2UUCI 4JYAI 3HULA 4GKKI 4BMJA 4LFCE 1NHHA 4YHHE 3LMLA 2E1RA 2LE2A 2UUAE 2RTXA 4HYMA 2G7HA 1STUA 2L2NA 3QT5A 2DB2A 5AE3A 2UUCE 1NZ0A 3ZKDA 2CZ9A 4DUYI 3PYDA 1HR0E 2LMZA 5LMNI 4L8NA 4BS9A 4DV7I 3LNUA 1RC7A 4KHPI 4DR5E 2BM0A 3C4TA 2EZ6A 3K1JA 4DPUA 5LMNE 3F6HA 3K17A 2R3VA 2CPNA 2UUAI 2DSYA 2V34A 1FI4A 1ZM4A 2V2QA 4OX9E 1N34I 2NUFA 2UUBI 4HXZA 4PU9A 5DNYA 5LMUI 1ZBQA 1KIJA 4LFAE 4LF6E 4DR2E 1H74A 4FW9A 2YT4A 4FWHA 4TUGA 3D4JA 5F3WA 5ADZA 2N3GA 4LF8I 2EFGA 5FWKA 1Z5BA 4DV5E 1XMOE 4WPYA 1UILA 1XNQE 2B7VA 4MYUA 4DV2I 2ODRD 2ZBKB 3PYGA 4OOGC 1KTVA 4JI0I 1EI1A 1MG7A 2PNLA 3Q1QA 2JVAA 4DR6E 2E5LE 1FWKA 3B82A 1I94E 1YYOA 1HNZE 4DU7A 1KKHA 4WUDA 2FTXB 4LU9A 2HHHE 4DV5I 4PRXA 4J8ZA 4YY3E 3T1HE 4DV3I 3LPSA 1H7UA 2IOPA 4DUYE 1J5EE 3P06A 2V2ZA 5FLXC 4X65E 1U2RA 3CWVA 1GZ6A 1H7SA 3HQ1A 4DMIA 4LFAI 4LFBI 5AE1A 2ZITA 1XMQI 3KWRA 4X62I 4Z7CA 4F9AB 4JYAE 4DV1E 4EMDA 1VISA 2B7TA 1Z0GA 4M2ZA 1HK7A 4JI7E 4IZJA 4WUCA 2RS6A 1WXRA 2A2DA 4JI5I 4JI8E 4Z7YA 4YY3I 3T1HI 1K47A 4IZJB 4DPTA 1BKNA 4DR1E 4BBYA 4N3OA 3ZZTA 2GS8A 4FWGA 3J80Q 2V85A 2UXCE 4B3TI 2Z5CA 1Z0VA 4KZSA 4BC9A 2E5LI 3M6AA 2WZOA 3AV0A 3J81Q 2L3JA 4R1FA 3K85A 4M1KA 1X47A 3ZKBA 3HPZA 2DMYA 2MDRA 2KOUA 4X66I 4KHPE 5LL6R 4GKKE 3ADLA 2HKJA 1FKAE 4P7AA 2O1VA 2LTSA 2ZM6E 3LTOA 3VYYA 4B3TE 4B3SE 2UXCI 3ADGA 3LLHA 1HR0I 3B8HA 3J7AM 3OTOI 1A6FA 2HK2A 3ZM7A 4WUBA 2Z5BA 3FIGA 4FN5A 4NXNI 1XHKA 2RS7A 1Z0BA 4HACA 4UT4A 3QT7A 4JI5E 4LF5I 2RSMA 2O1TA 4JV5I 4M30A 2E1MA 4P7DA 1IBKI 4URLA 1HNWI 1NHIA 1Y4SA 1N33I 4JV5E 1J26A 2UU9E 2NUEA 2L6MA 2N3HA 1QZRA 3H4LA 2MC5A 1SR9A 4BC7A 1ZM9A 2O1WA 5GMDA 3T1YI 2IHR1 1EKZA 3PYEA 4P52A 4B3RE 4ZVIA 2H36X 3DF6A 1ZM2A 4I8OA 4R03A 4PRVA 1S4EA 4BCAA 3PRYA 2F4VE 2KHXA 4DUZE 4JI1I 1EA6A 3P1XA 1UHZA 1N34E 4F9BB 3B78A 4OX9I 1N32E 4DV6E 2CGEA 4F9CB 4FWDA 2FGGA 4X64I 3AUZA 5AE2A 3JAMQ 1WHQA 1PKPA 2VE7C 1ELOA 1ZM3A 3Q6NA 3JTZA 2HFUA 1QU6A 1Z5CA 4DU8A 2J7KA 1D6TA 4ED4A 3H09A 5A2QQ 1HNXE 3WU4A 2UXDI 1USVA 2V2VA 2F8BA 1YYKA 4K0KI 4K0KE 2L3CA 1ZXMA 1HNZI 3V5RA 3RMPA 1XMOI 2ZM6I 2R42A 4B3MI 2NPFA 2L92A 4DR7E 2NA2A 1WHNA 1IBKE 1Z5AA 1USUA 2L33A 1WUUA 4JI1E 1RQ0A 2VF3A 4XTJA 4JI3I 1MU5A 2IOQA 4LF5E 4MYTA 1X48A 2UXDE 1HNXI 1T4LB 3K6QA 4DR7I 2V8QB 4X65I 4JI6I 2L2MA 4JG4A 4LF9I 5IWAE 5IWAI 2MC6A 3F6GA 3T1YE 4JI8I 4DV3E 2Z5EA 3IWCA 1FJGE 3C4BA 3OMLA 4GKJI 4X64E 1N32I 4GEQB 4L5NC 2UXBI 2UXBE 3J7Yp 2F4VI 4X62E 2LTRA 2LBSB 2V86A 1H73A 3ZOQB 2JOBA 4USKA 2K4VA 2HKEA 1Z0TA 3JAMC 4DUZI 2NUGA 1Y4UA 1T4NA 2V87A 4LF9E 1Z0CA 2VQFE 1N36I 4JI4I 4B3ME 2M4IA 4DV4E 2CG9A 2BV3A 2X7IA 4WYQB 1N36E 2VQFI 4LF7E 2JOXA 5GMEA 1O0WA 2L8TA 3DJWA 4WSPA 2UU9I 4DR6I 4DR3I 3JU0A 1FWLA 4UTGA 5LMUE 4RPFA 4LF7I 4X8WA 5AASA 3VK6A 2XEXA 3HTXA 4WFTA 3Q6MA 4DXLA 4DPXA 4DV4I 3ADJA 3GONA 1FNMA 4LTYA 2JY9A 4B3SI 2LUQA 2M7QA 4DR5I 2HK3A 2JWOA 4USMA 3PYFA 4DR4E 2LUPB 3WU3A 2V83A 3HXLA 4JI3E 1DARA 4Q28A 4JI0E 2PNMA 3IWDA 4LF4I 4LF4E 5IT9C 2VQEE 4NXME 1IBME 2LRSA 2Z5BB 1YZ9A 2DEIA 4I3HA 2O1UA 4IZJD 4M0VA 1DQ3A 2M1SA 2AJ4A 5A2QC 3QT8A 1IBLI 1N33E 2Z5CB 3ADIA 1I94I 4DPWA 3HPSA 2X36A 4DKKA 2JR1A 1YYWA 4KQVA 1B62A 1H72C 3WU5A 3J80C 4LFBE 3J7AG 2GQ0A 4TUIA 5IT9Q 4IZKB 2DIXA 4DR2I 1PVGA 1S16A 1UEKA 3WU6A 4DV6I 5CFFE 1IBMI 1N0VC 1RREA 4YHHI 1RR9A 4JI2E 1Z0WA 4NXNE 1KVKA 1XMQE 2B9DA 5BR8E 1FJGI 2V8PA 1XNQI 1IBLE 5L3JA 4B3RI 2WW4A 2YZTA 4DR1I 4DR4I 4LF8E 3QT6A 2V89A 2B3TB 1MX0A 5T6JA 4JI4E 1Z0EA 4X66E 3F0NA 4HACB 1ZXNA 3IWBA 1N0UA 4DV7E 2L2KB 1Y6ZA 2DEJA 4F54A 4AQYI 2OI2A 2V88A 4NXMI 4IZKA 4LF6I 2VQEI 1DI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX Q;  2UUB E;  1NHJ A;  4DV1 I;  4LFC I;  4JI2 I;  1GQE A;  1Z59 A;  4DPY A;  1XNR E;  4DV2 E;  4AQY E;  2LJH A;  4GKJ E;  1ZBT A;  3ZZ0 A;  4DR3 E;  2A2C A;  1J5E I;  2Q2E B;  3VYX A;  3OTO E;  4HY1 A;  4JI6 E;  1X49 A;  2HHH I;  4DV0 E;  4DV0 I;  4JI7 I;  3ZZU A;  1OJ4 A;  1PIE A;  3V2U C;  1HNW E;  5BR8 I;  1T4O A;  1XNR I;  2HFS A;  1B63 A;  2BM1 A;  3J81 C;  2LJP A;  2UUC I;  4JYA I;  3HUL A;  4GKK I;  4LFC E;  1NHH A;  4YHH E;  2E1R A;  2UUA E;  2RTX A;  4HYM A;  1STU A;  2L2N A;  3QT5 A;  2DB2 A;  2UUC E;  1NZ0 A;  3ZKD A;  2CZ9 A;  4DUY I;  3PYD A;  1HR0 E;  5LMN I;  4DV7 I;  3LNU A;  1RC7 A;  4KHP I;  4DR5 E;  2BM0 A;  3C4T A;  2EZ6 A;  3K1J A;  4DPU A;  5LMN E;  3K17 A;  2R3V A;  2CPN A;  2UUA I;  2V34 A;  1FI4 A;  1ZM4 A;  2V2Q A;  4OX9 E;  1N34 I;  2NUF A;  2UUB I;  4HXZ A;  4PU9 A;  5LMU I;  1KIJ A;  4LFA E;  4LF6 E;  4DR2 E;  1H74 A;  4FW9 A;  2YT4 A;  4FWH A;  3D4J A;  2N3G A;  4LF8 I;  2EFG A;  1Z5B A;  4DV5 E;  1XMO E;  1UIL A;  1XNQ E;  2B7V A;  4MYU A;  4DV2 I;  2ZBK B;  3PYG A;  4OOG C;  1KTV A;  4JI0 I;  1EI1 A;  1MG7 A;  3Q1Q A;  2JVA A;  4DR6 E;  2E5L E;  1FWK A;  3B82 A;  1I94 E;  1YYO A;  1HNZ E;  4DU7 A;  1KKH A;  4WUD A;  2HHH E;  4DV5 I;  4PRX A;  4YY3 E;  3T1H E;  4DV3 I;  3LPS A;  1H7U A;  4DUY E;  1J5E E;  2V2Z A;  5FLX C;  4X65 E;  1U2R A;  3CWV A;  1H7S A;  4LFA I;  4LFB I;  2ZIT A;  1XMQ I;  4X62 I;  4Z7C A;  4JYA E;  4DV1 E;  4EMD A;  1VIS A;  2B7T A;  1Z0G A;  4M2Z A;  4JI7 E;  4WUC A;  2RS6 A;  2A2D A;  4JI5 I;  4JI8 E;  4Z7Y A;  4YY3 I;  3T1H I;  1K47 A;  4DPT A;  1BKN A;  4DR1 E;  3ZZT A;  2GS8 A;  4FWG A;  3J80 Q;  2UXC E;  4B3T I;  1Z0V A;  2E5L I;  3M6A A;  3J81 Q;  2L3J A;  4R1F A;  4M1K A;  1X47 A;  3ZKB A;  2DMY A;  2MDR A;  4X66 I;  4KHP E;  5LL6 R;  4GKK E;  3ADL A;  2HKJ A;  1FKA E;  4P7A A;  2LTS A;  2ZM6 E;  3LTO A;  3VYY A;  4B3T E;  4B3S E;  2UXC I;  3ADG A;  3LLH A;  1HR0 I;  3B8H A;  3J7A M;  3OTO I;  1A6F A;  2HK2 A;  3ZM7 A;  4WUB A;  4FN5 A;  4NXN I;  1XHK A;  2RS7 A;  1Z0B A;  4HAC A;  4UT4 A;  3QT7 A;  4JI5 E;  4LF5 I;  2RSM A;  4JV5 I;  4M30 A;  1IBK I;  4URL A;  1HNW I;  1NHI A;  1N33 I;  4JV5 E;  1J26 A;  2UU9 E;  2NUE A;  2N3H A;  1QZR A;  3H4L A;  1ZM9 A;  5GMD A;  3T1Y I;  2IHR 1;  1EKZ A;  3PYE A;  4P52 A;  4B3R E;  4ZVI A;  1ZM2 A;  4PRV A;  1S4E A;  2F4V E;  2KHX A;  4DUZ E;  4JI1 I;  1EA6 A;  3P1X A;  1UHZ A;  1N34 E;  3B78 A;  4OX9 I;  1N32 E;  4DV6 E;  4X64 I;  4FWD A;  3JAM Q;  1WHQ A;  1PKP A;  1ELO A;  1ZM3 A;  2HFU A;  1QU6 A;  1Z5C A;  4DU8 A;  2J7K A;  1D6T A;  4ED4 A;  5A2Q Q;  1HNX E;  3WU4 A;  2UXD I;  2V2V A;  4K0K I;  1YYK A;  4K0K E;  2L3C A;  1ZXM A;  1HNZ I;  3V5R A;  1XMO I;  2ZM6 I;  2R42 A;  4B3M I;  2NPF A;  4DR7 E;  2NA2 A;  1WHN A;  1IBK E;  1Z5A A;  2L33 A;  1WUU A;  4JI1 E;  1RQ0 A;  2VF3 A;  4XTJ A;  4JI3 I;  1MU5 A;  4LF5 E;  4MYT A;  1X48 A;  2UXD E;  1HNX I;  1T4L B;  4DR7 I;  4X65 I;  4JI6 I;  2L2M A;  4JG4 A;  4LF9 I;  5IWA E;  5IWA I;  4JI8 I;  3T1Y E;  4DV3 E;  1FJG E;  3C4B A;  4GKJ I;  4X64 E;  1N32 I;  2UXB I;  2UXB E;  3J7Y p;  2F4V I;  4X62 E;  2LTR A;  2LBS B;  1H73 A;  4USK A;  2HKE A;  1Z0T A;  3JAM C;  4DUZ I;  2NUG A;  1T4N A;  4LF9 E;  1Z0C A;  4JI4 I;  2VQF E;  1N36 I;  4B3M E;  4DV4 E;  2BV3 A;  2X7I A;  4WYQ B;  1N36 E;  2VQF I;  4LF7 E;  5GME A;  1O0W A;  2UU9 I;  4DR6 I;  4DR3 I;  1FWL A;  4UTG A;  5LMU E;  4RPF A;  4LF7 I;  4X8W A;  2XEX A;  3HTX A;  4WFT A;  4DXL A;  4DPX A;  4DV4 I;  3ADJ A;  3GON A;  1FNM A;  2JY9 A;  4B3S I;  2LUQ A;  4DR5 I;  2HK3 A;  4USM A;  3PYF A;  4DR4 E;  2LUP B;  3WU3 A;  4JI3 E;  1DAR A;  4JI0 E;  4LF4 I;  4LF4 E;  5IT9 C;  2VQE E;  4NXM E;  1IBM E;  2LRS A;  1YZ9 A;  2DEI A;  4I3H A;  2AJ4 A;  5A2Q C;  3QT8 A;  1IBL I;  1N33 E;  3ADI A;  1I94 I;  4DPW A;  2X36 A;  4DKK A;  4KQV A;  1YYW A;  1B62 A;  1H72 C;  3WU5 A;  3J80 C;  4LFB E;  3J7A G;  5IT9 Q;  2DIX A;  4DR2 I;  1PVG A;  1S16 A;  1UEK A;  3WU6 A;  4DV6 I;  5CFF E;  1IBM I;  1N0V C;  1RRE A;  4YHH I;  1RR9 A;  4JI2 E;  1Z0W A;  4NXN E;  1KVK A;  1XMQ E;  5BR8 E;  1FJG I;  2V8P A;  1XNQ I;  1IBL E;  5L3J A;  4B3R I;  2WW4 A;  4DR4 I;  4DR1 I;  4LF8 E;  3QT6 A;  4HAC B;  2B3T B;  1MX0 A;  4JI4 E;  1Z0E A;  4X66 E;  3F0N A;  1ZXN A;  1N0U A;  4DV7 E;  2L2K B;  2DEJ A;  4AQY I;  2OI2 A;  4NXM I;  4LF6 I;  2VQE I;  1DI2 A; 
#chains in the Genus database with same CATH topology
 5FLX Q;  2KON A;  2UUB E;  1HNX I;  4IFD A;  2YTQ A;  1NHJ A;  2ODR C;  2WP8 A;  3THN A;  1PDA A;  4DV1 I;  4LFC I;  5JEA E;  4JI2 I;  2EN3 A;  1GQE A;  1Z59 A;  4DPY A;  1XNR E;  4DV2 E;  4AQY E;  2EOY A;  2LJH A;  4GKJ E;  1ZBT A;  3ZZ0 A;  4DR3 E;  5KL2 A;  2EOI A;  2A2C A;  2YSO A;  1IMU A;  1AH5 A;  2EWL A;  3MSW A;  1J5E I;  2PNZ B;  4KWY A;  2EOQ A;  2EM0 A;  3VYX A;  2Q2E B;  1Y60 A;  3HJC A;  2GO3 A;  4NHR A;  2JP9 A;  3OTO E;  2HC5 A;  2VF1 A;  4JI6 E;  4HY1 A;  5C0X E;  5K36 E;  4OO1 D;  1X49 A;  2EM9 A;  4DV0 E;  3VHT B;  2HHH I;  1PJQ A;  4DV0 I;  3EPK A;  4JI7 I;  2EMF A;  2GHF A;  5AC4 A;  3ZZU A;  2EPC A;  1OJ4 A;  4R8O A;  1PIE A;  3V2U C;  3C6K A;  1HNW E;  1T4O A;  2GPI A;  2HFS A;  4P78 A;  1B63 A;  2FV4 B;  2EOE A;  1ZAA C;  2BM1 A;  3J81 C;  2LJP A;  2UUC I;  4JYA I;  1Y5Y A;  3HUL A;  4BMJ A;  4LFC E;  2NN6 B;  4GKK I;  1NHH A;  5IXM B;  4YHH E;  5EKW A;  3LML A;  2E1R A;  2LE2 A;  2EPU A;  2UUA E;  2RTX A;  4HYM A;  2G7H A;  1STU A;  2L2N A;  1A1J A;  1X6E A;  3QT5 A;  1DGC A;  2DB2 A;  5AE3 A;  2UUC E;  1NZ0 A;  2NN6 A;  3ZKD A;  5A6K A;  2CZ9 A;  4DUY I;  3PYD A;  2WBT A;  2EPK X;  4MQY A;  2PO1 B;  4MDT A;  1HR0 E;  2EP3 A;  2LMZ A;  1MGT A;  1PJT A;  4L8N A;  4R2C A;  4BS9 A;  3P3G A;  1N3G A;  5LMN I;  4DV7 I;  3C6M A;  3LNU A;  2E72 A;  1RC7 A;  4R2R A;  4KHP I;  1BBG A;  4DR5 E;  2BM0 A;  1ZU1 A;  3C4T A;  4WXD A;  3UHM A;  3EPL A;  2EZ6 A;  3K1J A;  4ZYD A;  5LMN E;  3MHH C;  4DPU A;  2N8X A;  3F6H A;  4IFD D;  3K17 A;  2R3V A;  4F6N A;  2CPN A;  2UUA I;  2DSY A;  2V34 A;  1TF3 A;  1FI4 A;  1ZM4 A;  2V2Q A;  4OX9 E;  1N34 I;  4ISA A;  2NUF A;  2UUB I;  3KZY A;  2C37 A;  4HXZ A;  4PU9 A;  5DNY A;  5LMU I;  1ZBQ A;  1KIJ A;  2EMA A;  2EL5 A;  4LFA E;  2ADR A;  1F2I G;  2EM4 A;  4LF6 E;  4DR2 E;  2YTO A;  2BA0 D;  1H74 A;  4HTG A;  2EOO A;  2EMH A;  4FW9 A;  1L4S A;  3KRN A;  2YT4 A;  4O43 A;  4R2S A;  1KJK A;  4FWH A;  1MEY C;  4TUG A;  2LO3 A;  3D4J A;  5F3W A;  2ELZ A;  1KYQ A;  1OYS A;  3GCM A;  4BHC A;  2JPA A;  5ADZ A;  2N3G A;  4LF8 I;  2EFG A;  1T39 A;  5FWK A;  1Z5B A;  4DV5 E;  1XMO E;  4WPY A;  2WNR B;  1UIL A;  1XNQ E;  1T38 A;  2EN1 A;  4WX9 A;  3U1K A;  2B7V A;  4MYU A;  4DV2 I;  2ODR D;  1G2D C;  2YU5 A;  2ZBK B;  2C39 B;  1XXE A;  4OO1 C;  1B69 A;  1A1F A;  3PYG A;  5JEA C;  4OOG C;  1KTV A;  4JI0 I;  1EI1 A;  1E3H A;  1MG7 A;  4BHB A;  2PNL A;  3Q1Q A;  2JVA A;  2YTJ A;  4DR6 E;  2E5L E;  2EPL X;  1FWK A;  4AID A;  4F2J C;  3B82 A;  1IQO A;  1I94 E;  1YYO A;  4QNK A;  1HNZ E;  4DU7 A;  1KKH A;  2YTF A;  1YH8 A;  2YTE A;  1X6F A;  4WUD A;  2FTX B;  4R2P A;  4LU9 A;  2HHH E;  4DV5 I;  2EN6 A;  4PRX A;  4J8Z A;  4YY3 E;  3T1H E;  4DV3 I;  3LPS A;  2PRT A;  1H7U A;  2IOP A;  4DUY E;  4FW3 A;  1P42 A;  1J5E E;  2NN6 C;  2V2Z A;  3P06 A;  5FLX C;  3BGH A;  3P3E A;  4X65 E;  2EPO A;  1U2R A;  3CWV A;  2EPP A;  1GZ6 A;  1H7S A;  4FW6 A;  3B4T A;  3HQ1 A;  3UK3 C;  2YTP A;  4DMI A;  2GLI A;  4LFA I;  4LFB I;  5AE1 A;  1X5W A;  2ZIT A;  1XMQ I;  3KWR A;  2GO4 A;  4Z7C A;  2EOS A;  4X62 I;  4F9A B;  4JYA E;  2LV2 A;  4DV1 E;  2EQ0 A;  5KL7 A;  4EMD A;  1VIS A;  2B7T A;  1Z0G A;  4M2Z A;  1BB8 A;  1HK7 A;  4MLQ A;  4JI7 E;  2BA1 D;  4IZJ A;  2RS6 A;  4WUC A;  2EPR A;  2RQL A;  1WXR A;  4FK5 C;  2A2D A;  5DRR A;  2DMI A;  4O4K A;  1BBO A;  2LCE A;  4JI5 I;  2I9I A;  2EPA A;  4JI8 E;  4Z7Y A;  1OYP A;  2JEB A;  4YY3 I;  3T1H I;  1K47 A;  5JEA B;  4IZJ B;  3M7N G;  4DPT A;  4IFD C;  2YTD A;  1BKN A;  4DR1 E;  2ENC A;  4BBY A;  4N3O A;  3ZZT A;  3ECR A;  5LLQ A;  1R6L A;  2JE6 A;  2GS8 A;  5JEA F;  1A1L A;  2A25 A;  4FWG A;  3J80 Q;  1OYR A;  2JEB B;  4OZE A;  3M7N D;  4OO1 F;  2V85 A;  2UXC E;  4B3T I;  4OO1 E;  2Z5C A;  2EML A;  2EN4 A;  5AC5 A;  1QNT A;  1Z0V A;  4KZS A;  2AE8 A;  4BC9 A;  1X3C A;  2E5L I;  3M6A A;  2WZO A;  3AV0 A;  3J81 Q;  2L3J A;  2RPC A;  1EH7 A;  4R1F A;  4F6M A;  1YFH A;  3K85 A;  4M1K A;  1X47 A;  3M99 B;  3ZKB A;  3HPZ A;  2DMY A;  2MDR A;  2KOU A;  4X66 I;  4KHP E;  5LL6 R;  3GME A;  4GKK E;  2YRH A;  3ADL A;  2HKJ A;  1FKA E;  4P7A A;  2J7J A;  2LTS A;  2O1V A;  2ZM6 E;  4U3B A;  3LTO A;  4OO1 A;  3NZK A;  4BA1 B;  4NZV A;  2EPX A;  3VYY A;  4B3T E;  4B3S E;  2UXC I;  3ADG A;  1UBD C;  3LLH A;  1HR0 I;  3B8H A;  3J7A M;  3OTO I;  1A6F A;  2HK2 A;  3ZM7 A;  1A1K A;  4WUB A;  4OO1 B;  1NEI A;  2R1F A;  2WCC 3;  2Z5B A;  4BA1 A;  3FIG A;  4FN5 A;  1LLM C;  4NXN I;  3THO B;  1XHK A;  2YRM A;  2F1D A;  1WJP A;  2EMK A;  2NN6 E;  3CDI A;  2RS7 A;  1R6M A;  1Z0B A;  2NN6 F;  4HAC A;  4OKG A;  3QT7 A;  4UT4 A;  4JI5 E;  2JEA A;  4LF5 I;  2RSM A;  2O1T A;  4JV5 I;  4M30 A;  2EL6 A;  2EPN A;  3P3C A;  4IJD A;  2E1M A;  2EMZ A;  4P7D A;  5K36 D;  1P47 A;  1IBK I;  4URL A;  2EPZ A;  2JXP A;  1HNW I;  1NHI A;  4X9J A;  2WP8 B;  3HKM A;  1Y4S A;  4BA2 B;  1N33 I;  4JV5 E;  1JK1 A;  4FW4 A;  1J26 A;  2UU9 E;  2NUE A;  4LCF A;  2EMY A;  2L6M A;  2N3H A;  1QZR A;  2BR2 B;  3CDJ A;  3H4L A;  2MC5 A;  2WBS A;  1SR9 A;  1TN9 A;  4BC7 A;  2EMW A;  2EOR A;  1ZM9 A;  2O1W A;  5GMD A;  3T1Y I;  4AIM A;  2IHR 1;  2EM8 A;  1EKZ A;  5JEA D;  2EMX A;  3PYE A;  4P52 A;  4B3R E;  4NBQ A;  4ZVI A;  2PNZ A;  2H36 X;  3DF6 A;  1ZM2 A;  1WRJ A;  4I8O A;  5EL9 A;  4R03 A;  4AM3 A;  4N4R B;  4PRV A;  1S4E A;  2PO2 A;  4BCA A;  3PRY A;  2F4V E;  1G2F C;  2KHX A;  4DUZ E;  4JI1 I;  5DRQ A;  1EA6 A;  3P1X A;  1UHZ A;  5DRO A;  1N34 E;  4F9B B;  3B78 A;  4OX9 I;  2EM5 A;  4DV6 E;  1N32 E;  2EQ1 A;  4F9C B;  2FGG A;  1JK2 A;  1AAY A;  3AUZ A;  2CGE A;  5AE2 A;  4FWD A;  1WHQ A;  1PKP A;  2VE7 C;  2EOF A;  2DRP A;  2DLK A;  3JAM Q;  4BA2 A;  3MHS C;  1ELO A;  1ZM3 A;  3Q6N A;  3EPH A;  3JTZ A;  5DRP A;  2HFU A;  1QU6 A;  2EMG A;  1Z5C A;  4DU8 A;  2J7K A;  5KL4 A;  1D6T A;  4IFD B;  4ED4 A;  4FW5 A;  1X6H A;  3H09 A;  5A2Q Q;  4O5G A;  4WSG A;  1HNX E;  3WU4 A;  2PO1 A;  2UXD I;  1USV A;  2V2V A;  2F8B A;  1YYK A;  4K0K I;  4K0K E;  4LPF A;  1IQS A;  2L3C A;  2YRK A;  1ZXM A;  4MU4 A;  5DNL A;  3RMP A;  3V5R A;  1HNZ I;  2EMC A;  2YSP A;  2ZM6 I;  1XMO I;  2R42 A;  4B3M I;  2NPF A;  2I13 A;  2L92 A;  5C0X C;  5BR8 I;  3BF2 A;  2PO2 B;  3M85 G;  4DR7 E;  2NA2 A;  1WHN A;  1IBK E;  1Z5A A;  1USU A;  3H1C A;  2L33 A;  1UDQ A;  2K7I A;  5A6B A;  2C38 A;  1WUU A;  4HEI A;  4JI1 E;  4ZYH A;  2CTD A;  1RQ0 A;  2ENA A;  5C0X A;  2VF3 A;  4XTJ A;  3PS3 A;  2R76 A;  4JI3 I;  3GLL A;  1GTK A;  2C38 B;  1MU5 A;  1UN6 B;  2IOQ A;  4LF5 E;  1RHY A;  2J65 A;  5K36 C;  2YPN A;  2NN6 D;  4MYT A;  1X48 A;  2EM3 A;  2EN8 A;  1T4L B;  1NCS A;  3K6Q A;  1TF6 A;  2UXD E;  2V8Q B;  2EM6 A;  2IER A;  4X65 I;  2RSI A;  4JI6 I;  2L2M A;  1YHC A;  4JG4 A;  4LF9 I;  2EM7 A;  5IWA E;  2MDG A;  5IWA I;  3BBG A;  2MC6 A;  3F6G A;  2EQ3 A;  2EOZ A;  3T1Y E;  1A1H A;  4JI8 I;  4DV3 E;  2Z5E A;  4MU3 A;  2YWQ A;  3IWC A;  1FJG E;  3C4B A;  3OML A;  2WNR A;  4GKJ I;  2EM2 A;  4X64 E;  1N32 I;  2HGH A;  4GEQ B;  2EN7 A;  1A1G A;  4L5N C;  2YU8 A;  3DD6 A;  2UXB I;  1EH6 A;  2C37 B;  4O24 A;  2UXB E;  3J7Y p;  2F4V I;  2EOJ A;  2LTR A;  4X62 E;  4RHB B;  2LBS B;  4ZYG A;  2V86 A;  5C0X B;  1H73 A;  3ZOQ B;  1UDN A;  2JOB A;  2LT7 A;  4USK A;  2K4V A;  2Q8U A;  2HKE A;  2IES A;  4U3D A;  4MU0 A;  1Z0T A;  2EMI A;  2VRD A;  2MKD A;  3JAM C;  2BBG A;  4R2A A;  4DUZ I;  2NUG A;  1Y4U A;  1T4N A;  2HJJ A;  2V87 A;  4LF9 E;  2VQF E;  1Z0C A;  4GQU A;  1N36 I;  3U1Y A;  4JI4 I;  4R2D A;  4B3M E;  2CVE A;  2M4I A;  4DV4 E;  2CG9 A;  4ZYE A;  2BV3 A;  2X7I A;  4WYQ B;  2EE8 A;  3TQM A;  1N36 E;  2VQF I;  1YPN A;  4LF7 E;  1PJS A;  2JOX A;  5GME A;  2D9H A;  1XNR I;  1O0W A;  2L8T A;  3DJW A;  2M9A A;  4WSP A;  4LOM A;  2UU9 I;  4DR6 I;  5K36 B;  2ENH A;  4FW7 A;  2PO0 A;  5C0X D;  4DR3 I;  3JU0 A;  5A6J A;  1FWL A;  4UTG A;  5LMU E;  4RPF A;  4LF7 I;  4X8W A;  4R2Q A;  5AAS A;  5A6A A;  3VK6 A;  5KL3 A;  4LCH A;  2XEX A;  3HTX A;  2DLQ A;  4IFD E;  4WFT A;  2C39 A;  2WBU A;  3Q6M A;  2PO0 B;  4DXL A;  5KL5 A;  4DPX A;  4IS9 A;  4DV4 I;  3ADJ A;  3GON A;  4Q35 B;  1FNM A;  4LTY A;  2JY9 A;  2BA0 G;  2YTN A;  4J3D A;  4B3S I;  3PS1 A;  2LUQ A;  3QG5 C;  2EL4 A;  2M7Q A;  1VI7 A;  4DR5 I;  2EPM X;  1SFE A;  2HK3 A;  2JWO A;  2EN2 A;  4USM A;  3EPJ A;  2BA1 G;  2EJ4 A;  1EH8 A;  2NAB A;  3KZZ A;  4DR4 E;  3PYF A;  2LUP B;  3WU3 A;  2V83 A;  5K36 A;  2YTG A;  3HXL A;  2JE6 B;  4JI3 E;  1DAR A;  4Q28 A;  2CT1 A;  4JI0 E;  2PNM A;  3IWD A;  4LF4 I;  4LF4 E;  5IT9 C;  3L00 A;  4MU1 A;  1YUJ A;  2VQE E;  2DGC A;  4NXM E;  2MKN A;  1IBM E;  2LRS A;  2YTI A;  2Z5B B;  1YZ9 A;  4M9V C;  4IS1 C;  2DEI A;  5JEA A;  4R2E A;  4I3H A;  4X64 I;  2LVH A;  4IFD F;  2EMB A;  2O1U A;  4IZJ D;  2EOM A;  2EOH A;  2JEA B;  5DNX A;  4M0V A;  1DQ3 A;  2M1S A;  1YUI A;  2AJ4 A;  5A2Q C;  3QT8 A;  1IBL I;  1N33 E;  3P76 A;  2Z5C B;  3ADI A;  1I94 I;  4DPW A;  3HPS A;  2JYA A;  2X36 A;  5IV8 B;  4DKK A;  2O3Z A;  2JR1 A;  1YYW A;  4KQV A;  4DR7 I;  1B62 A;  2EOX A;  5C0X F;  2CSH A;  1H72 C;  1Z1B A;  3WU5 A;  3J80 C;  3EQ1 A;  3J7A G;  4LFB E;  4TUI A;  2BR2 A;  2GQ0 A;  4IZK B;  5IT9 Q;  2DIX A;  4DR2 I;  4RH8 A;  1PVG A;  1S16 A;  1UEK A;  3WU6 A;  2VES A;  5CFF E;  3M85 D;  4DV6 I;  1IBM I;  1N0V C;  1RRE A;  4YHH I;  1RR9 A;  4GZN C;  2LJU A;  4JI2 E;  1YSA C;  1Z0W A;  4NXN E;  2BB8 A;  1KVK A;  5A6B D;  5TSE A;  1XMQ E;  2B9D A;  5BR8 E;  4QNJ A;  5K36 F;  3BID A;  1E3P A;  1RMD A;  4MLV A;  1ZR9 A;  4WXC A;  1FJG I;  2V8P A;  2ELY A;  1XNQ I;  5A69 A;  4LCG A;  3L7Z A;  1IBL E;  1A1I A;  5L3J A;  4B3R I;  2WW4 A;  2JT2 A;  2YZT A;  4DR1 I;  4DR4 I;  5KL6 A;  4LF8 E;  2V89 A;  3QT6 A;  2B3T B;  1MX0 A;  5T6J A;  4JI4 E;  1UDS A;  4X66 E;  1Z0E A;  3F0N A;  1ZXN A;  4HAC B;  3IWB A;  1N0U A;  3L7Z B;  4DV7 E;  2L2K B;  1Y6Z A;  3PS2 A;  2DEJ A;  1UDO A;  4F54 A;  4AQY I;  5ELW A;  2OI2 A;  2V88 A;  4NXM I;  4IZK A;  4LF6 I;  2VQE I;  1DI2 A; 
#chains in the Genus database with same CATH homology
 5FLX Q;  2KON A;  2UUB E;  1NHJ A;  2ODR C;  4DV1 I;  4LFC I;  4JI2 I;  1GQE A;  1Z59 A;  4DPY A;  1XNR E;  4DV2 E;  4AQY E;  2LJH A;  4GKJ E;  1ZBT A;  3ZZ0 A;  4DR3 E;  2A2C A;  2EWL A;  3MSW A;  1J5E I;  3HJC A;  2Q2E B;  3VYX A;  3OTO E;  2VF1 A;  4JI6 E;  4HY1 A;  1X49 A;  2HHH I;  4DV0 E;  4DV0 I;  4JI7 I;  3ZZU A;  1OJ4 A;  4R8O A;  1PIE A;  3V2U C;  1HNW E;  5BR8 I;  1T4O A;  1XNR I;  2HFS A;  4P78 A;  1B63 A;  2FV4 B;  2BM1 A;  3J81 C;  2LJP A;  2UUC I;  4JYA I;  3HUL A;  4GKK I;  4BMJ A;  4LFC E;  1NHH A;  4YHH E;  3LML A;  2E1R A;  2LE2 A;  2UUA E;  2RTX A;  4HYM A;  2G7H A;  1STU A;  2L2N A;  3QT5 A;  2DB2 A;  5AE3 A;  2UUC E;  1NZ0 A;  3ZKD A;  2CZ9 A;  4DUY I;  3PYD A;  1HR0 E;  2LMZ A;  5LMN I;  4L8N A;  4BS9 A;  4DV7 I;  3LNU A;  1RC7 A;  4KHP I;  4DR5 E;  2BM0 A;  3C4T A;  2EZ6 A;  3K1J A;  4DPU A;  5LMN E;  3F6H A;  3K17 A;  2R3V A;  2CPN A;  2UUA I;  2DSY A;  2V34 A;  1FI4 A;  1ZM4 A;  2V2Q A;  4OX9 E;  1N34 I;  2NUF A;  2UUB I;  4HXZ A;  4PU9 A;  5DNY A;  5LMU I;  1ZBQ A;  1KIJ A;  4LFA E;  4LF6 E;  4DR2 E;  1H74 A;  4FW9 A;  2YT4 A;  4FWH A;  4TUG A;  3D4J A;  5F3W A;  5ADZ A;  2N3G A;  4LF8 I;  2EFG A;  5FWK A;  1Z5B A;  4DV5 E;  1XMO E;  4WPY A;  1UIL A;  1XNQ E;  2B7V A;  4MYU A;  4DV2 I;  2ODR D;  2ZBK B;  3PYG A;  4OOG C;  1KTV A;  4JI0 I;  1EI1 A;  1MG7 A;  2PNL A;  3Q1Q A;  2JVA A;  4DR6 E;  2E5L E;  1FWK A;  3B82 A;  1I94 E;  1YYO A;  1HNZ E;  4DU7 A;  1KKH A;  4WUD A;  2FTX B;  4LU9 A;  2HHH E;  4DV5 I;  4PRX A;  4J8Z A;  4YY3 E;  3T1H E;  4DV3 I;  3LPS A;  1H7U A;  2IOP A;  4DUY E;  1J5E E;  3P06 A;  2V2Z A;  5FLX C;  4X65 E;  1U2R A;  3CWV A;  1GZ6 A;  1H7S A;  3HQ1 A;  4DMI A;  4LFA I;  4LFB I;  5AE1 A;  2ZIT A;  1XMQ I;  3KWR A;  4X62 I;  4Z7C A;  4F9A B;  4JYA E;  4DV1 E;  4EMD A;  1VIS A;  2B7T A;  1Z0G A;  4M2Z A;  1HK7 A;  4JI7 E;  4IZJ A;  4WUC A;  2RS6 A;  1WXR A;  2A2D A;  4JI5 I;  4JI8 E;  4Z7Y A;  4YY3 I;  3T1H I;  1K47 A;  4IZJ B;  4DPT A;  1BKN A;  4DR1 E;  4BBY A;  4N3O A;  3ZZT A;  2GS8 A;  4FWG A;  3J80 Q;  2V85 A;  2UXC E;  4B3T I;  2Z5C A;  1Z0V A;  4KZS A;  4BC9 A;  2E5L I;  3M6A A;  2WZO A;  3AV0 A;  3J81 Q;  2L3J A;  4R1F A;  3K85 A;  4M1K A;  1X47 A;  3ZKB A;  3HPZ A;  2DMY A;  2MDR A;  2KOU A;  4X66 I;  4KHP E;  5LL6 R;  4GKK E;  3ADL A;  2HKJ A;  1FKA E;  4P7A A;  2O1V A;  2LTS A;  2ZM6 E;  3LTO A;  3VYY A;  4B3T E;  4B3S E;  2UXC I;  3ADG A;  3LLH A;  1HR0 I;  3B8H A;  3J7A M;  3OTO I;  1A6F A;  2HK2 A;  3ZM7 A;  4WUB A;  2Z5B A;  3FIG A;  4FN5 A;  4NXN I;  1XHK A;  2RS7 A;  1Z0B A;  4HAC A;  4UT4 A;  3QT7 A;  4JI5 E;  4LF5 I;  2RSM A;  2O1T A;  4JV5 I;  4M30 A;  2E1M A;  4P7D A;  1IBK I;  4URL A;  1HNW I;  1NHI A;  1Y4S A;  1N33 I;  4JV5 E;  1J26 A;  2UU9 E;  2NUE A;  2L6M A;  2N3H A;  1QZR A;  3H4L A;  2MC5 A;  1SR9 A;  4BC7 A;  1ZM9 A;  2O1W A;  5GMD A;  3T1Y I;  2IHR 1;  1EKZ A;  3PYE A;  4P52 A;  4B3R E;  4ZVI A;  2H36 X;  3DF6 A;  1ZM2 A;  4I8O A;  4R03 A;  4PRV A;  1S4E A;  4BCA A;  3PRY A;  2F4V E;  2KHX A;  4DUZ E;  4JI1 I;  1EA6 A;  3P1X A;  1UHZ A;  1N34 E;  4F9B B;  3B78 A;  4OX9 I;  1N32 E;  4DV6 E;  2CGE A;  4F9C B;  4FWD A;  2FGG A;  4X64 I;  3AUZ A;  5AE2 A;  3JAM Q;  1WHQ A;  1PKP A;  2VE7 C;  1ELO A;  1ZM3 A;  3Q6N A;  3JTZ A;  2HFU A;  1QU6 A;  1Z5C A;  4DU8 A;  2J7K A;  1D6T A;  4ED4 A;  3H09 A;  5A2Q Q;  1HNX E;  3WU4 A;  2UXD I;  1USV A;  2V2V A;  2F8B A;  1YYK A;  4K0K I;  4K0K E;  2L3C A;  1ZXM A;  1HNZ I;  3V5R A;  3RMP A;  1XMO I;  2ZM6 I;  2R42 A;  4B3M I;  2NPF A;  2L92 A;  4DR7 E;  2NA2 A;  1WHN A;  1IBK E;  1Z5A A;  1USU A;  2L33 A;  1WUU A;  4JI1 E;  1RQ0 A;  2VF3 A;  4XTJ A;  4JI3 I;  1MU5 A;  2IOQ A;  4LF5 E;  4MYT A;  1X48 A;  2UXD E;  1HNX I;  1T4L B;  3K6Q A;  4DR7 I;  2V8Q B;  4X65 I;  4JI6 I;  2L2M A;  4JG4 A;  4LF9 I;  5IWA E;  5IWA I;  2MC6 A;  3F6G A;  3T1Y E;  4JI8 I;  4DV3 E;  2Z5E A;  3IWC A;  1FJG E;  3C4B A;  3OML A;  4GKJ I;  4X64 E;  1N32 I;  4GEQ B;  4L5N C;  2UXB I;  2UXB E;  3J7Y p;  2F4V I;  4X62 E;  2LTR A;  2LBS B;  2V86 A;  1H73 A;  3ZOQ B;  2JOB A;  4USK A;  2K4V A;  2HKE A;  1Z0T A;  3JAM C;  4DUZ I;  2NUG A;  1Y4U A;  1T4N A;  2V87 A;  4LF9 E;  1Z0C A;  2VQF E;  1N36 I;  4JI4 I;  4B3M E;  2M4I A;  4DV4 E;  2CG9 A;  2BV3 A;  2X7I A;  4WYQ B;  1N36 E;  2VQF I;  4LF7 E;  2JOX A;  5GME A;  1O0W A;  2L8T A;  3DJW A;  4WSP A;  2UU9 I;  4DR6 I;  4DR3 I;  3JU0 A;  1FWL A;  4UTG A;  5LMU E;  4RPF A;  4LF7 I;  4X8W A;  5AAS A;  3VK6 A;  2XEX A;  3HTX A;  4WFT A;  3Q6M A;  4DXL A;  4DPX A;  4DV4 I;  3ADJ A;  3GON A;  1FNM A;  4LTY A;  2JY9 A;  4B3S I;  2LUQ A;  2M7Q A;  4DR5 I;  2HK3 A;  2JWO A;  4USM A;  3PYF A;  4DR4 E;  2LUP B;  3WU3 A;  2V83 A;  3HXL A;  4JI3 E;  1DAR A;  4Q28 A;  4JI0 E;  2PNM A;  3IWD A;  4LF4 I;  4LF4 E;  5IT9 C;  2VQE E;  4NXM E;  1IBM E;  2LRS A;  2Z5B B;  1YZ9 A;  2DEI A;  4I3H A;  2O1U A;  4IZJ D;  4M0V A;  1DQ3 A;  2M1S A;  2AJ4 A;  5A2Q C;  3QT8 A;  1IBL I;  1N33 E;  2Z5C B;  3ADI A;  1I94 I;  4DPW A;  3HPS A;  2X36 A;  4DKK A;  2JR1 A;  1YYW A;  4KQV A;  1B62 A;  1H72 C;  3WU5 A;  3J80 C;  4LFB E;  3J7A G;  2GQ0 A;  4TUI A;  5IT9 Q;  4IZK B;  2DIX A;  4DR2 I;  1PVG A;  1S16 A;  1UEK A;  3WU6 A;  4DV6 I;  5CFF E;  1IBM I;  1N0V C;  1RRE A;  4YHH I;  1RR9 A;  4JI2 E;  1Z0W A;  4NXN E;  1KVK A;  1XMQ E;  2B9D A;  5BR8 E;  1FJG I;  2V8P A;  1XNQ I;  1IBL E;  5L3J A;  4B3R I;  2WW4 A;  2YZT A;  4DR1 I;  4DR4 I;  4LF8 E;  3QT6 A;  2V89 A;  2B3T B;  1MX0 A;  5T6J A;  4JI4 E;  1Z0E A;  4X66 E;  3F0N A;  4HAC B;  1ZXN A;  3IWB A;  1N0U A;  4DV7 E;  2L2K B;  1Y6Z A;  2DEJ A;  4F54 A;  4AQY I;  2OI2 A;  2V88 A;  4NXM I;  4IZK A;  4LF6 I;  2VQE I;  1DI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...