4B3TI

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3tI00
1MU5A 5GMDA 4X66E 4DPTA 4JI5E 4LF8E 4JI3I 3GONA 2F4VI 3LNUA 2R3VA 4P7AA 4DV0I 1HR0E 1PKPA 4JI2I 5IWAI 4GKKI 4HXZA 3LTOA 4JV5E 4B3TI 3D4JA 4AQYI 4DV1E 4Z7CA 4DR1E 3JAMQ 4JI4I 4URLA 1PVGA 3WU3A 1Z0EA 3V2UC 1K47A 4DR2I 4LF4I 4JI3E 4DR4I 3J7AM 2F4VE 1EI1A 2V2ZA 1BKNA 1H7UA 3T1HE 4JG4A 1HNXI 5IWAE 3QT8A 4GKKE 4ZVIA 4FWDA 4B3MI 2A2DA 4DUZI 2UXCE 4ED4A 1FJGI 2UUCE 4AQYE 1H74A 4WUBA 4K0KI 1ZXMA 1Z0WA 4USKA 2OI2A 4P52A 4DR2E 4DU7A 4LF4E 4JI0I 4DR4E 5IT9Q 2Q2EB 4LFAI 1HNXE 3WU4A 4DR5I 5BR8I 4B3ME 4DUZE 4I3HA 1FJGE 2DEIA 4DUYI 2V2VA 2LJPA 4K0KE 1N0VC 3LPSA 1XNQI 4JI7I 1IBME 4KHPE 4PRXA 2VF3A 3QT7A 4JI0E 4HACA 4LFAE 3K1JA 1H72C 4X65I 4LF9I 5BR8E 1N36I 2E5LI 3PYEA 4HACB 1VISA 2UUAI 4YY3I 1IBKI 3PYFA 4DPWA 5A2QQ 1S4EA 4NXNI 4GKJE 4JI7E 4JYAI 4X62I 1Z5CA 5FLXQ 1KTVA 4FWHA 1WUUA 3PYGA 3J80C 1HNWE 3J81Q 4JI6I 4FWGA 1Z5BA 4USMA 4X65E 4LF9E 1N33I 1N36E 1N32I 1N0UA 2E5LE 2UUAE 4YY3E 4JI8I 1IBKE 5LMUI 5IT9C 1N34I 4DV2I 2WW4A 1XMQI 4DPYA 1OJ4A 4NXNE 4DPXA 4DV0E 1XNRI 4HYMA 4DV4I 4JYAE 4X62E 2EFGA 3QT6A 4JI2E 4LF6I 1ZM4A 1H7SA 4LFCI 4LF5I 2V34A 4EMDA 4WUDA 2A2CA 3T1YI 4JI6E 4B3TE 4KQVA 1FWLA 1Z0VA 2HHHI 1N33E 1NHHA 4JI4E 1MG7A 4JI8E 5LMUE 1KIJA 1XHKA 1ZM9A 4DV2E 4Z7YA 4DR6I 3M6AA 4DXLA 1NHJA 4DV7I 4DV4E 4MYTA 4DV3I 4B3RI 4RPFA 4HY1A 4DV5I 4LF6E 4OX9I 4LFCE 4LF5E 2V2QA 1DARA 5L3JA 2ZBKB 2VQFI 4FN5A 2HHHE 5A2QC 4JI1I 4UTGA 1MX0A 4YHHI 5FLXC 1NZ0A 3F0NA 3H4LA 2X36A 3QT5A 3J81C 2ZM6I 4NXMI 4DV7E 3ZZUA 1ELOA 2X7IA 4DV3E 4DV5E 4OX9E 4DR5E 3OTOI 3JAMC 3ZZTA 1Z5AA 4UT4A 2NPFA 1EA6A 4DUYE 2VQFE 2HKJA 2XEXA 4JI1E 1ZXNA 1XNQE 4XTJA 4JV5I 3ZKBA 4YHHE 4DV1I 2ZM6E 4NXME 4PU9A 2UUBI 1ZM2A 1RREA 2UXBI 1H73A 2ZITA 3OTOE 2VQEI 4LFBI 1Z0GA 2HK2A 3T1HI 1HNZI 3WU5A 3HULA 2UXDI 5LL6R 2V8PA 2HKEA 2UXCI 2AJ4A 1FNMA 4M1KA 3B8HA 2UUCI 3PYDA 1UEKA 3B82A 1Z0CA 4MYUA 1KVKA 2UUBE 1B63A 1U2RA 2J7KA 2UXBE 1XMOI 1Z0BA 5LMNI 2VQEE 1Z59A 1ZM3A 1N32E 1D6TA 1J5EI 4LFBE 2HFSA 1IBLI 4DR7I 4DR3I 4WUCA 1HNZE 1A6FA 4B3SI 1N34E 1XMQE 2UXDE 3J80Q 1I94I 2E1RA 4X64I 2HK3A 1XNRE 3CWVA 4DV6I 4R1FA 3T1YE 1XMOE 1IBMI 4KHPI 2R42A 5LMNE 4DU8A 1J5EE 3Q1QA 1B62A 1IBLE 4DR7E 4DR3E 4LF7I 2UU9I 4B3SE 2HFUA 3K17A 3J7AG 2BM0A 4DR6E 1FI4A 1I94E 1FKAE 2DEJA 4X64E 3WU6A 4X66I 4B3RE 4JI5I 4LF8I 4DV6E 3B78A 1QZRA 1S16A 4GKJI 2BM1A 1NHIA 4PRVA 4DPUA 1FWKA 1HR0I 2BV3A 2CZ9A 5GMEA 1RR9A 1Z0TA 3V5RA 1HNWI 3ZKDA 1KKHA 4LF7E 4FW9A 2UU9E 3ZM7A 2GS8A 3ZZ0A 1PIEA 4DR1I
chains in the Genus database with same CATH superfamily
3PS3A 5JEAB 2PNZA 5K36A 1MU5A 5EL9A 2BR2A 3P06A 3PS1A 5GMDA 4X66E 2C37B 4DPTA 4LPFA 4JI5E 4LF8E 4JI3I 3GONA 2F4VI 3LNUA 2R3VA 4P7AA 2PNZB 4DV0I 1HR0E 4FW5A 1PKPA 4JI2I 5IWAI 4GKKI 4HXZA 1OYSA 4LOMA 2IERA 2Z5CA 4AIMA 4ISAA 3LTOA 4JV5E 4B3TI 3D4JA 4AQYI 4DV1E 2O1UA 4Z7CA 4DR1E 3JAMQ 4JI4I 2Z5BB 4URLA 1PVGA 4OO1A 3WU3A 1Z0EA 3V2UC 1HK7A 1K47A 4DR2I 4LF4I 4JI3E 4DR4I 3J7AM 3M7ND 2F4VE 1EI1A 2V2ZA 1BKNA 4FW4A 1H7UA 3T1HE 3PS2A 4JG4A 4OO1B 3UHMA 1HNXI 5IWAE 2PO1A 3QT8A 4GKKE 4ZVIA 4FWDA 4B3MI 5K36E 2A2DA 2BA0G 4DUZI 2UXCE 4ED4A 1FJGI 1UDSA 2UUCE 4AQYE 1H74A 4WUBA 4K0KI 3DD6A 2PO1B 1UDQA 4NBQA 1ZXMA 1Z0WA 1YHCA 4USKA 2OI2A 5JEAD 2C39A 4U3DA 4P52A 3GCMA 4DR2E 4DU7A 4LF4E 4JI0I 4DR4E 5IT9Q 2JE6B 3U1KA 2Q2EB 3P3CA 2GO4A 1R6MA 4LFAI 1HNXE 5K36D 3WU4A 5DRPA 2C39B 4DR5I 5BR8I 4B3ME 4OO1E 4DUZE 5C0XA 4I3HA 1FJGE 5FWKA 2DEIA 4DUYI 2V2VA 5JEAF 2LJPA 4K0KE 2IOQA 1N0VC 2WP8B 4AM3A 4LCGA 3HKMA 2PO0A 3LPSA 3M85G 1XNQI 4JI7I 4OZEA 5C0XB 1IBME 4PRXA 4KHPE 2VF3A 1E3HA 4IZKA 5K36F 3QT7A 4JI0E 4MU1A 4HACA 4MQYA 2PO0B 4LFAE 3K1JA 1H72C 4X65I 4LF9I 1USVA 5BR8E 4IZKB 2JEAA 1N36I 4OO1D 2E5LI 3PYEA 4HACB 1VISA 2UUAI 4YY3I 1Y60A 2BA1D 2NN6A 1IBKI 3PYFA 4DPWA 5A2QQ 3P76A 2JEAB 4BA2A 1S4EA 4NXNI 4GKJE 4JI7E 3B4TA 4JYAI 4X62I 5EKWA 1Z5CA 5FLXQ 1KTVA 2NN6B 4FWHA 1WUUA 3PYGA 1UDNA 4OO1F 3J80C 3NZKA 2Z5BA 4BA2B 1HNWE 2JT2A 3J81Q 4JI6I 4FWGA 1Z5BA 4USMA 4X65E 4LF9E 3Q6NA 1N36E 1N33I 1N32I 1N0UA 2E5LE 3CDJA 2IESA 2UUAE 4IFDA 1Y4UA 4MU4A 4YY3E 4JI8I 1IBKE 5LMUI 2J65A 5IT9C 2O3ZA 2WNRA 4DV2I 1N34I 2WW4A 2CVEA 3U1YA 5JEAE 1XMQI 4DPYA 1OJ4A 4NXNE 4DPXA 4DV0E 1XNRI 4AIDA 4IFDB 4HYMA 4DV4I 4JYAE 4X62E 3M85D 2EFGA 3QT6A 4JI2E 4LF6I 1ZM4A 5C0XD 1H7SA 1XXEA 2WNRB 4LCHA 4LFCI 4LF5I 2V34A 4EMDA 4WUDA 1Y5YA 4IZJB 2A2CA 3T1YI 2GO3A 4JI6E 4B3TE 4KQVA 1FWLA 1Z0VA 2HHHI 1N33E 2JE6A 1NHHA 4JI4E 4GQUA 3GLLA 1MG7A 4JI8E 5LMUE 1KIJA 1XHKA 1ZM9A 4DV2E 4Z7YA 5C0XF 4DR6I 2PNLA 3M6AA 4DXLA 3P3EA 1NHJA 4DV7I 4DV4E 4MYTA 4DV3I 4B3RI 4RPFA 4HY1A 4DV5I 4LF6E 2WP8A 4OX9I 2PNMA 4LFCE 4LF5E 1VI7A 5JEAC 2NN6D 2V2QA 1DARA 5L3JA 2ZBKB 4MU3A 5DNXA 2VQFI 4FN5A 2HHHE 2O1TA 5A2QC 4JI1I 4UTGA 4OKGA 1MX0A 3PRYA 5K36C 4YHHI 5FLXC 4FW7A 3H1CA 5DROA 1NZ0A 4FW6A 3F0NA 1OYRA 1RHYA 2C38A 2X36A 3H4LA 3QT5A 3J81C 2ZM6I 2NN6F 4NXMI 4DV7E 3ZZUA 1ELOA 2X7IA 4DV3E 3L7ZB 4DV5E 4OX9E 4IFDD 4DR5E 3OTOI 3JAMC 3ZZTA 1Z5AA 2C38B 4UT4A 2NPFA 1EA6A 4DUYE 2VQFE 2BA0D 2HKJA 2XEXA 4JI1E 5DRQA 5DRRA 1ZXNA 2IOPA 2AE8A 1XNQE 4XTJA 4JV5I 4MU0A 3ZKBA 4YHHE 4OO1C 2CG9A 4DV1I 2JEBA 4IFDF 2F1DA 5C0XE 2ZM6E 4NXME 4PU9A 2UUBI 4FW3A 1ZM2A 1RREA 2UXBI 1H73A 1P42A 2ZITA 3OTOE 5DNLA 2VQEI 2JEBB 4LFBI 1Z0GA 5K36B 2HK2A 3T1HI 2BR2B 1HNZI 3K85A 3WU5A 3HULA 2Z5EA 5LL6R 2UXDI 2V8PA 4IZJA 2HKEA 2UXCI 2AJ4A 4LCFA 1FNMA 4M1KA 3B8HA 2UUCI 4BA1A 3PYDA 1UEKA 3B82A 1Z0CA 4MYUA 2GQ0A 1KVKA 2Z5CB 1B63A 1U2RA 2VESA 2UUBE 2J7KA 2UXBE 1XMOI 1Y6ZA 1Z0BA 2NN6E 1USUA 1R6LA 5LMNI 2VQEE 1Z59A 1ZM3A 4BA1B 2O1WA 4QNKA 1N32E 1D6TA 1J5EI 4LFBE 2HFSA 1IBLI 4DR7I 4DR3I 3GMEA 5C0XC 4WUCA 1HNZE 1A6FA 4B3SI 1N34E 1XMQE 2UXDE 3J80Q 2BA1G 1I94I 2E1RA 4QNJA 4X64I 2HK3A 1XNRE 3CWVA 4DV6I 4MDTA 2PO2A 4IFDE 4R1FA 3T1YE 1XMOE 1IBMI 4KHPI 2R42A 5LMNE 3Q6MA 4IS9A 4N3OA 4DU8A 1J5EE 3Q1QA 1B62A 1IBLE 2PO2B 4DR7E 4DR3E 3L7ZA 4LF7I 2UU9I 3P3GA 4B3SE 2HFUA 2NN6C 3K17A 3J7AG 2BM0A 4DR6E 1FI4A 1I94E 1E3PA 1FKAE 2DEJA 4X64E 3WU6A 4X66I 4J3DA 4B3RE 2O1VA 4JI5I 4LF8I 5ELWA 1UDOA 3M7NG 4DV6E 3B78A 1YH8A 1OYPA 1QZRA 1S16A 1Y4SA 4GKJI 2BM1A 1NHIA 4PRVA 4DPUA 1FWKA 1HR0I 3KRNA 2BV3A 4IZJD 3HJCA 2CZ9A 5JEAA 5GMEA 1RR9A 1Z0TA 2CGEA 3V5RA 1HNWI 3ZKDA 4IFDC 1KKHA 2C37A 4LF7E 4FW9A 2UU9E 3ZM7A 2GS8A 3ZZ0A 1PIEA 3CDIA 4U3BA 4DR1I
chains in the Genus database with same CATH topology
1MU5A 3P06A 5GMDA 4X66E 4DPTA 4JI5E 4LF8E 4JI3I 3GONA 2F4VI 3LNUA 2R3VA 4P7AA 4DV0I 1HR0E 1PKPA 4JI2I 5IWAI 4GKKI 4HXZA 2Z5CA 3LTOA 4JV5E 4B3TI 3D4JA 4AQYI 4DV1E 2O1UA 4Z7CA 4DR1E 3JAMQ 4JI4I 2Z5BB 4URLA 1PVGA 3WU3A 1Z0EA 3V2UC 1HK7A 1K47A 4DR2I 4LF4I 4JI3E 4DR4I 3J7AM 2F4VE 1EI1A 2V2ZA 1BKNA 1H7UA 3T1HE 4JG4A 1HNXI 5IWAE 3QT8A 4GKKE 4ZVIA 4FWDA 4B3MI 2A2DA 4DUZI 2UXCE 4ED4A 1FJGI 2UUCE 4AQYE 1H74A 4WUBA 4K0KI 1ZXMA 1Z0WA 4USKA 2OI2A 4P52A 4DR2E 4DU7A 4LF4E 4JI0I 4DR4E 5IT9Q 2Q2EB 4LFAI 1HNXE 3WU4A 4DR5I 5BR8I 4B3ME 4DUZE 4I3HA 1FJGE 5FWKA 2DEIA 4DUYI 2V2VA 2LJPA 4K0KE 2IOQA 1N0VC 3LPSA 1XNQI 4JI7I 1IBME 4KHPE 4PRXA 2VF3A 4IZKA 3QT7A 4JI0E 4HACA 4LFAE 3K1JA 1H72C 4X65I 4LF9I 1USVA 5BR8E 4IZKB 1N36I 2E5LI 3PYEA 4HACB 1VISA 2UUAI 4YY3I 1IBKI 3PYFA 4DPWA 5A2QQ 1S4EA 4NXNI 4GKJE 4JI7E 4JYAI 4X62I 1Z5CA 5FLXQ 1KTVA 4FWHA 1WUUA 3PYGA 3J80C 2Z5BA 1HNWE 3J81Q 4JI6I 4FWGA 1Z5BA 4USMA 4X65E 4LF9E 3Q6NA 1N36E 1N33I 1N32I 1N0UA 2E5LE 2UUAE 1Y4UA 4YY3E 4JI8I 1IBKE 5LMUI 5IT9C 1N34I 4DV2I 2WW4A 1XMQI 4DPYA 1OJ4A 4NXNE 4DPXA 4DV0E 1XNRI 4HYMA 4DV4I 4JYAE 4X62E 2EFGA 3QT6A 4JI2E 4LF6I 1ZM4A 1H7SA 4LFCI 4LF5I 2V34A 4EMDA 4WUDA 4IZJB 2A2CA 3T1YI 4JI6E 4B3TE 4KQVA 1FWLA 1Z0VA 2HHHI 1N33E 1NHHA 4JI4E 1MG7A 4JI8E 5LMUE 1KIJA 1XHKA 1ZM9A 4DV2E 4Z7YA 4DR6I 2PNLA 3M6AA 4DXLA 1NHJA 4DV7I 4DV4E 4MYTA 4DV3I 4B3RI 4RPFA 4HY1A 4DV5I 4LF6E 4OX9I 2PNMA 4LFCE 4LF5E 2V2QA 1DARA 5L3JA 2ZBKB 2VQFI 4FN5A 2HHHE 2O1TA 5A2QC 4JI1I 4UTGA 1MX0A 3PRYA 4YHHI 5FLXC 1NZ0A 3F0NA 3H4LA 2X36A 3QT5A 3J81C 2ZM6I 4NXMI 4DV7E 3ZZUA 1ELOA 2X7IA 4DV3E 4DV5E 4OX9E 4DR5E 3OTOI 3JAMC 3ZZTA 1Z5AA 4UT4A 2NPFA 1EA6A 4DUYE 2VQFE 2HKJA 2XEXA 4JI1E 1ZXNA 2IOPA 1XNQE 4XTJA 4JV5I 3ZKBA 4YHHE 2CG9A 4DV1I 2ZM6E 4NXME 4PU9A 2UUBI 1ZM2A 1RREA 2UXBI 1H73A 2ZITA 3OTOE 2VQEI 4LFBI 1Z0GA 2HK2A 3T1HI 1HNZI 3K85A 3WU5A 3HULA 2Z5EA 5LL6R 2UXDI 2V8PA 4IZJA 2HKEA 2UXCI 2AJ4A 1FNMA 4M1KA 3B8HA 2UUCI 3PYDA 1UEKA 3B82A 1Z0CA 4MYUA 2GQ0A 1KVKA 2Z5CB 1B63A 1U2RA 2UUBE 2J7KA 2UXBE 1XMOI 1Y6ZA 1Z0BA 1USUA 5LMNI 2VQEE 1Z59A 1ZM3A 2O1WA 1N32E 1D6TA 1J5EI 4LFBE 2HFSA 1IBLI 4DR7I 4DR3I 4WUCA 1HNZE 1A6FA 4B3SI 1N34E 1XMQE 2UXDE 3J80Q 1I94I 2E1RA 4X64I 2HK3A 1XNRE 3CWVA 4DV6I 4R1FA 3T1YE 1XMOE 1IBMI 4KHPI 2R42A 5LMNE 3Q6MA 4N3OA 4DU8A 1J5EE 3Q1QA 1B62A 1IBLE 4DR7E 4DR3E 4LF7I 2UU9I 4B3SE 2HFUA 3K17A 3J7AG 2BM0A 4DR6E 1FI4A 1I94E 1FKAE 2DEJA 4X64E 3WU6A 4X66I 4B3RE 2O1VA 4JI5I 4LF8I 4DV6E 3B78A 1QZRA 1S16A 1Y4SA 4GKJI 2BM1A 1NHIA 4PRVA 4DPUA 1FWKA 1HR0I 2BV3A 4IZJD 3HJCA 2CZ9A 5GMEA 1RR9A 1Z0TA 2CGEA 3V5RA 1HNWI 3ZKDA 1KKHA 4LF7E 4FW9A 2UU9E 3ZM7A 2GS8A 3ZZ0A 1PIEA 4DR1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MU5 A;  5GMD A;  4X66 E;  4DPT A;  4JI5 E;  4LF8 E;  4JI3 I;  3GON A;  2F4V I;  3LNU A;  2R3V A;  4P7A A;  4DV0 I;  1HR0 E;  1PKP A;  4JI2 I;  5IWA I;  4GKK I;  4HXZ A;  3LTO A;  4JV5 E;  4B3T I;  3D4J A;  4AQY I;  4DV1 E;  4Z7C A;  4DR1 E;  3JAM Q;  4JI4 I;  4URL A;  1PVG A;  3WU3 A;  1Z0E A;  3V2U C;  1K47 A;  4DR2 I;  4LF4 I;  4JI3 E;  4DR4 I;  3J7A M;  2F4V E;  1EI1 A;  2V2Z A;  1BKN A;  1H7U A;  3T1H E;  4JG4 A;  1HNX I;  5IWA E;  3QT8 A;  4GKK E;  4ZVI A;  4FWD A;  4B3M I;  2A2D A;  4DUZ I;  2UXC E;  4ED4 A;  1FJG I;  2UUC E;  4AQY E;  1H74 A;  4WUB A;  4K0K I;  1ZXM A;  1Z0W A;  4USK A;  2OI2 A;  4P52 A;  4DR2 E;  4DU7 A;  4LF4 E;  4JI0 I;  4DR4 E;  5IT9 Q;  2Q2E B;  4LFA I;  1HNX E;  3WU4 A;  4DR5 I;  5BR8 I;  4B3M E;  4DUZ E;  4I3H A;  1FJG E;  2DEI A;  4DUY I;  2V2V A;  2LJP A;  4K0K E;  1N0V C;  3LPS A;  1XNQ I;  4JI7 I;  1IBM E;  4KHP E;  4PRX A;  2VF3 A;  3QT7 A;  4JI0 E;  4HAC A;  4LFA E;  3K1J A;  1H72 C;  4X65 I;  4LF9 I;  5BR8 E;  1N36 I;  2E5L I;  3PYE A;  4HAC B;  1VIS A;  2UUA I;  4YY3 I;  1IBK I;  3PYF A;  4DPW A;  5A2Q Q;  1S4E A;  4NXN I;  4GKJ E;  4JI7 E;  4JYA I;  4X62 I;  1Z5C A;  5FLX Q;  1KTV A;  4FWH A;  1WUU A;  3PYG A;  3J80 C;  1HNW E;  3J81 Q;  4JI6 I;  4FWG A;  1Z5B A;  4USM A;  4X65 E;  4LF9 E;  1N33 I;  1N36 E;  1N32 I;  1N0U A;  2E5L E;  2UUA E;  4YY3 E;  4JI8 I;  1IBK E;  5LMU I;  5IT9 C;  1N34 I;  4DV2 I;  2WW4 A;  1XMQ I;  4DPY A;  1OJ4 A;  4NXN E;  4DPX A;  4DV0 E;  1XNR I;  4HYM A;  4DV4 I;  4JYA E;  4X62 E;  2EFG A;  3QT6 A;  4JI2 E;  4LF6 I;  1ZM4 A;  1H7S A;  4LFC I;  4LF5 I;  2V34 A;  4EMD A;  4WUD A;  2A2C A;  3T1Y I;  4JI6 E;  4B3T E;  4KQV A;  1FWL A;  1Z0V A;  2HHH I;  1N33 E;  1NHH A;  4JI4 E;  1MG7 A;  4JI8 E;  5LMU E;  1KIJ A;  1XHK A;  1ZM9 A;  4DV2 E;  4Z7Y A;  4DR6 I;  3M6A A;  4DXL A;  1NHJ A;  4DV7 I;  4DV4 E;  4MYT A;  4DV3 I;  4B3R I;  4RPF A;  4HY1 A;  4DV5 I;  4LF6 E;  4OX9 I;  4LFC E;  4LF5 E;  2V2Q A;  1DAR A;  5L3J A;  2ZBK B;  2VQF I;  4FN5 A;  2HHH E;  5A2Q C;  4JI1 I;  4UTG A;  1MX0 A;  4YHH I;  5FLX C;  1NZ0 A;  3F0N A;  3H4L A;  2X36 A;  3QT5 A;  3J81 C;  2ZM6 I;  4NXM I;  4DV7 E;  3ZZU A;  1ELO A;  2X7I A;  4DV3 E;  4DV5 E;  4OX9 E;  4DR5 E;  3OTO I;  3JAM C;  3ZZT A;  1Z5A A;  4UT4 A;  2NPF A;  1EA6 A;  4DUY E;  2VQF E;  2HKJ A;  2XEX A;  4JI1 E;  1ZXN A;  1XNQ E;  4XTJ A;  4JV5 I;  3ZKB A;  4YHH E;  4DV1 I;  2ZM6 E;  4NXM E;  4PU9 A;  2UUB I;  1ZM2 A;  1RRE A;  2UXB I;  1H73 A;  2ZIT A;  3OTO E;  2VQE I;  4LFB I;  1Z0G A;  2HK2 A;  3T1H I;  1HNZ I;  3WU5 A;  3HUL A;  2UXD I;  5LL6 R;  2V8P A;  2HKE A;  2UXC I;  2AJ4 A;  1FNM A;  4M1K A;  3B8H A;  2UUC I;  3PYD A;  1UEK A;  3B82 A;  1Z0C A;  4MYU A;  1KVK A;  2UUB E;  1B63 A;  1U2R A;  2J7K A;  2UXB E;  1XMO I;  1Z0B A;  5LMN I;  2VQE E;  1Z59 A;  1ZM3 A;  1N32 E;  1D6T A;  1J5E I;  4LFB E;  2HFS A;  1IBL I;  4DR7 I;  4DR3 I;  4WUC A;  1HNZ E;  1A6F A;  4B3S I;  1N34 E;  1XMQ E;  2UXD E;  3J80 Q;  1I94 I;  2E1R A;  4X64 I;  2HK3 A;  1XNR E;  3CWV A;  4DV6 I;  4R1F A;  3T1Y E;  1XMO E;  1IBM I;  4KHP I;  2R42 A;  5LMN E;  4DU8 A;  1J5E E;  3Q1Q A;  1B62 A;  1IBL E;  4DR7 E;  4DR3 E;  4LF7 I;  2UU9 I;  4B3S E;  2HFU A;  3K17 A;  3J7A G;  2BM0 A;  4DR6 E;  1FI4 A;  1I94 E;  1FKA E;  2DEJ A;  4X64 E;  3WU6 A;  4X66 I;  4B3R E;  4JI5 I;  4LF8 I;  4DV6 E;  3B78 A;  1QZR A;  1S16 A;  4GKJ I;  2BM1 A;  1NHI A;  4PRV A;  4DPU A;  1FWK A;  1HR0 I;  2BV3 A;  2CZ9 A;  5GME A;  1RR9 A;  1Z0T A;  3V5R A;  1HNW I;  3ZKD A;  1KKH A;  4LF7 E;  4FW9 A;  2UU9 E;  3ZM7 A;  2GS8 A;  3ZZ0 A;  1PIE A;  4DR1 I; 
#chains in the Genus database with same CATH topology
 3PS3 A;  5JEA B;  2PNZ A;  5K36 A;  1MU5 A;  5EL9 A;  2BR2 A;  3P06 A;  3PS1 A;  5GMD A;  4X66 E;  2C37 B;  4DPT A;  4LPF A;  4JI5 E;  4LF8 E;  4JI3 I;  3GON A;  2F4V I;  3LNU A;  2R3V A;  4P7A A;  2PNZ B;  4DV0 I;  1HR0 E;  4FW5 A;  1PKP A;  4JI2 I;  5IWA I;  4GKK I;  4HXZ A;  1OYS A;  4LOM A;  2IER A;  2Z5C A;  4AIM A;  4ISA A;  3LTO A;  4JV5 E;  4B3T I;  3D4J A;  4AQY I;  4DV1 E;  2O1U A;  4Z7C A;  4DR1 E;  3JAM Q;  4JI4 I;  2Z5B B;  4URL A;  1PVG A;  4OO1 A;  3WU3 A;  1Z0E A;  3V2U C;  1HK7 A;  1K47 A;  4DR2 I;  4LF4 I;  4JI3 E;  4DR4 I;  3J7A M;  3M7N D;  2F4V E;  1EI1 A;  2V2Z A;  1BKN A;  4FW4 A;  1H7U A;  3T1H E;  3PS2 A;  4JG4 A;  4OO1 B;  3UHM A;  1HNX I;  5IWA E;  2PO1 A;  3QT8 A;  4GKK E;  4ZVI A;  4FWD A;  4B3M I;  5K36 E;  2A2D A;  2BA0 G;  4DUZ I;  2UXC E;  4ED4 A;  1FJG I;  1UDS A;  2UUC E;  4AQY E;  1H74 A;  4WUB A;  4K0K I;  3DD6 A;  2PO1 B;  1UDQ A;  4NBQ A;  1ZXM A;  1Z0W A;  1YHC A;  4USK A;  2OI2 A;  5JEA D;  2C39 A;  4U3D A;  4P52 A;  3GCM A;  4DR2 E;  4DU7 A;  4LF4 E;  4JI0 I;  4DR4 E;  5IT9 Q;  2JE6 B;  3U1K A;  2Q2E B;  3P3C A;  2GO4 A;  1R6M A;  4LFA I;  1HNX E;  5K36 D;  3WU4 A;  5DRP A;  2C39 B;  4DR5 I;  5BR8 I;  4B3M E;  4OO1 E;  4DUZ E;  5C0X A;  4I3H A;  1FJG E;  5FWK A;  2DEI A;  4DUY I;  2V2V A;  5JEA F;  2LJP A;  4K0K E;  2IOQ A;  1N0V C;  2WP8 B;  4AM3 A;  4LCG A;  3HKM A;  2PO0 A;  3LPS A;  3M85 G;  1XNQ I;  4JI7 I;  4OZE A;  5C0X B;  1IBM E;  4PRX A;  4KHP E;  2VF3 A;  1E3H A;  4IZK A;  5K36 F;  3QT7 A;  4JI0 E;  4MU1 A;  4HAC A;  4MQY A;  2PO0 B;  4LFA E;  3K1J A;  1H72 C;  4X65 I;  4LF9 I;  1USV A;  5BR8 E;  4IZK B;  2JEA A;  1N36 I;  4OO1 D;  2E5L I;  3PYE A;  4HAC B;  1VIS A;  2UUA I;  4YY3 I;  1Y60 A;  2BA1 D;  2NN6 A;  1IBK I;  3PYF A;  4DPW A;  5A2Q Q;  3P76 A;  2JEA B;  4BA2 A;  1S4E A;  4NXN I;  4GKJ E;  4JI7 E;  3B4T A;  4JYA I;  4X62 I;  5EKW A;  1Z5C A;  5FLX Q;  1KTV A;  2NN6 B;  4FWH A;  1WUU A;  3PYG A;  1UDN A;  4OO1 F;  3J80 C;  3NZK A;  2Z5B A;  4BA2 B;  1HNW E;  2JT2 A;  3J81 Q;  4JI6 I;  4FWG A;  1Z5B A;  4USM A;  4X65 E;  4LF9 E;  3Q6N A;  1N36 E;  1N33 I;  1N32 I;  1N0U A;  2E5L E;  3CDJ A;  2IES A;  2UUA E;  4IFD A;  1Y4U A;  4MU4 A;  4YY3 E;  4JI8 I;  1IBK E;  5LMU I;  2J65 A;  5IT9 C;  2O3Z A;  2WNR A;  4DV2 I;  1N34 I;  2WW4 A;  2CVE A;  3U1Y A;  5JEA E;  1XMQ I;  4DPY A;  1OJ4 A;  4NXN E;  4DPX A;  4DV0 E;  1XNR I;  4AID A;  4IFD B;  4HYM A;  4DV4 I;  4JYA E;  4X62 E;  3M85 D;  2EFG A;  3QT6 A;  4JI2 E;  4LF6 I;  1ZM4 A;  5C0X D;  1H7S A;  1XXE A;  2WNR B;  4LCH A;  4LFC I;  4LF5 I;  2V34 A;  4EMD A;  4WUD A;  1Y5Y A;  4IZJ B;  2A2C A;  3T1Y I;  2GO3 A;  4JI6 E;  4B3T E;  4KQV A;  1FWL A;  1Z0V A;  2HHH I;  1N33 E;  2JE6 A;  1NHH A;  4JI4 E;  4GQU A;  3GLL A;  1MG7 A;  4JI8 E;  5LMU E;  1KIJ A;  1XHK A;  1ZM9 A;  4DV2 E;  4Z7Y A;  5C0X F;  4DR6 I;  2PNL A;  3M6A A;  4DXL A;  3P3E A;  1NHJ A;  4DV7 I;  4DV4 E;  4MYT A;  4DV3 I;  4B3R I;  4RPF A;  4HY1 A;  4DV5 I;  4LF6 E;  2WP8 A;  4OX9 I;  2PNM A;  4LFC E;  4LF5 E;  1VI7 A;  5JEA C;  2NN6 D;  2V2Q A;  1DAR A;  5L3J A;  2ZBK B;  4MU3 A;  5DNX A;  2VQF I;  4FN5 A;  2HHH E;  2O1T A;  5A2Q C;  4JI1 I;  4UTG A;  4OKG A;  1MX0 A;  3PRY A;  5K36 C;  4YHH I;  5FLX C;  4FW7 A;  3H1C A;  5DRO A;  1NZ0 A;  4FW6 A;  3F0N A;  1OYR A;  1RHY A;  2C38 A;  2X36 A;  3H4L A;  3QT5 A;  3J81 C;  2ZM6 I;  2NN6 F;  4NXM I;  4DV7 E;  3ZZU A;  1ELO A;  2X7I A;  4DV3 E;  3L7Z B;  4DV5 E;  4OX9 E;  4IFD D;  4DR5 E;  3OTO I;  3JAM C;  3ZZT A;  1Z5A A;  2C38 B;  4UT4 A;  2NPF A;  1EA6 A;  4DUY E;  2VQF E;  2BA0 D;  2HKJ A;  2XEX A;  4JI1 E;  5DRQ A;  5DRR A;  1ZXN A;  2IOP A;  2AE8 A;  1XNQ E;  4XTJ A;  4JV5 I;  4MU0 A;  3ZKB A;  4YHH E;  4OO1 C;  2CG9 A;  4DV1 I;  2JEB A;  4IFD F;  2F1D A;  5C0X E;  2ZM6 E;  4NXM E;  4PU9 A;  2UUB I;  4FW3 A;  1ZM2 A;  1RRE A;  2UXB I;  1H73 A;  1P42 A;  2ZIT A;  3OTO E;  5DNL A;  2VQE I;  2JEB B;  4LFB I;  1Z0G A;  5K36 B;  2HK2 A;  3T1H I;  2BR2 B;  1HNZ I;  3K85 A;  3WU5 A;  3HUL A;  2Z5E A;  5LL6 R;  2UXD I;  2V8P A;  4IZJ A;  2HKE A;  2UXC I;  2AJ4 A;  4LCF A;  1FNM A;  4M1K A;  3B8H A;  2UUC I;  4BA1 A;  3PYD A;  1UEK A;  3B82 A;  1Z0C A;  4MYU A;  2GQ0 A;  1KVK A;  2Z5C B;  1B63 A;  1U2R A;  2VES A;  2UUB E;  2J7K A;  2UXB E;  1XMO I;  1Y6Z A;  1Z0B A;  2NN6 E;  1USU A;  1R6L A;  5LMN I;  2VQE E;  1Z59 A;  1ZM3 A;  4BA1 B;  2O1W A;  4QNK A;  1N32 E;  1D6T A;  1J5E I;  4LFB E;  2HFS A;  1IBL I;  4DR7 I;  4DR3 I;  3GME A;  5C0X C;  4WUC A;  1HNZ E;  1A6F A;  4B3S I;  1N34 E;  1XMQ E;  2UXD E;  3J80 Q;  2BA1 G;  1I94 I;  2E1R A;  4QNJ A;  4X64 I;  2HK3 A;  1XNR E;  3CWV A;  4DV6 I;  4MDT A;  2PO2 A;  4IFD E;  4R1F A;  3T1Y E;  1XMO E;  1IBM I;  4KHP I;  2R42 A;  5LMN E;  3Q6M A;  4IS9 A;  4N3O A;  4DU8 A;  1J5E E;  3Q1Q A;  1B62 A;  1IBL E;  2PO2 B;  4DR7 E;  4DR3 E;  3L7Z A;  4LF7 I;  2UU9 I;  3P3G A;  4B3S E;  2HFU A;  2NN6 C;  3K17 A;  3J7A G;  2BM0 A;  4DR6 E;  1FI4 A;  1I94 E;  1E3P A;  1FKA E;  2DEJ A;  4X64 E;  3WU6 A;  4X66 I;  4J3D A;  4B3R E;  2O1V A;  4JI5 I;  4LF8 I;  5ELW A;  1UDO A;  3M7N G;  4DV6 E;  3B78 A;  1YH8 A;  1OYP A;  1QZR A;  1S16 A;  1Y4S A;  4GKJ I;  2BM1 A;  1NHI A;  4PRV A;  4DPU A;  1FWK A;  1HR0 I;  3KRN A;  2BV3 A;  4IZJ D;  3HJC A;  2CZ9 A;  5JEA A;  5GME A;  1RR9 A;  1Z0T A;  2CGE A;  3V5R A;  1HNW I;  3ZKD A;  4IFD C;  1KKH A;  2C37 A;  4LF7 E;  4FW9 A;  2UU9 E;  3ZM7 A;  2GS8 A;  3ZZ0 A;  1PIE A;  3CDI A;  4U3B A;  4DR1 I; 
#chains in the Genus database with same CATH homology
 1MU5 A;  3P06 A;  5GMD A;  4X66 E;  4DPT A;  4JI5 E;  4LF8 E;  4JI3 I;  3GON A;  2F4V I;  3LNU A;  2R3V A;  4P7A A;  4DV0 I;  1HR0 E;  1PKP A;  4JI2 I;  5IWA I;  4GKK I;  4HXZ A;  2Z5C A;  3LTO A;  4JV5 E;  4B3T I;  3D4J A;  4AQY I;  4DV1 E;  2O1U A;  4Z7C A;  4DR1 E;  3JAM Q;  4JI4 I;  2Z5B B;  4URL A;  1PVG A;  3WU3 A;  1Z0E A;  3V2U C;  1HK7 A;  1K47 A;  4DR2 I;  4LF4 I;  4JI3 E;  4DR4 I;  3J7A M;  2F4V E;  1EI1 A;  2V2Z A;  1BKN A;  1H7U A;  3T1H E;  4JG4 A;  1HNX I;  5IWA E;  3QT8 A;  4GKK E;  4ZVI A;  4FWD A;  4B3M I;  2A2D A;  4DUZ I;  2UXC E;  4ED4 A;  1FJG I;  2UUC E;  4AQY E;  1H74 A;  4WUB A;  4K0K I;  1ZXM A;  1Z0W A;  4USK A;  2OI2 A;  4P52 A;  4DR2 E;  4DU7 A;  4LF4 E;  4JI0 I;  4DR4 E;  5IT9 Q;  2Q2E B;  4LFA I;  1HNX E;  3WU4 A;  4DR5 I;  5BR8 I;  4B3M E;  4DUZ E;  4I3H A;  1FJG E;  5FWK A;  2DEI A;  4DUY I;  2V2V A;  2LJP A;  4K0K E;  2IOQ A;  1N0V C;  3LPS A;  1XNQ I;  4JI7 I;  1IBM E;  4KHP E;  4PRX A;  2VF3 A;  4IZK A;  3QT7 A;  4JI0 E;  4HAC A;  4LFA E;  3K1J A;  1H72 C;  4X65 I;  4LF9 I;  1USV A;  5BR8 E;  4IZK B;  1N36 I;  2E5L I;  3PYE A;  4HAC B;  1VIS A;  2UUA I;  4YY3 I;  1IBK I;  3PYF A;  4DPW A;  5A2Q Q;  1S4E A;  4NXN I;  4GKJ E;  4JI7 E;  4JYA I;  4X62 I;  1Z5C A;  5FLX Q;  1KTV A;  4FWH A;  1WUU A;  3PYG A;  3J80 C;  2Z5B A;  1HNW E;  3J81 Q;  4JI6 I;  4FWG A;  1Z5B A;  4USM A;  4X65 E;  4LF9 E;  3Q6N A;  1N36 E;  1N33 I;  1N32 I;  1N0U A;  2E5L E;  2UUA E;  1Y4U A;  4YY3 E;  4JI8 I;  1IBK E;  5LMU I;  5IT9 C;  1N34 I;  4DV2 I;  2WW4 A;  1XMQ I;  4DPY A;  1OJ4 A;  4NXN E;  4DPX A;  4DV0 E;  1XNR I;  4HYM A;  4DV4 I;  4JYA E;  4X62 E;  2EFG A;  3QT6 A;  4JI2 E;  4LF6 I;  1ZM4 A;  1H7S A;  4LFC I;  4LF5 I;  2V34 A;  4EMD A;  4WUD A;  4IZJ B;  2A2C A;  3T1Y I;  4JI6 E;  4B3T E;  4KQV A;  1FWL A;  1Z0V A;  2HHH I;  1N33 E;  1NHH A;  4JI4 E;  1MG7 A;  4JI8 E;  5LMU E;  1KIJ A;  1XHK A;  1ZM9 A;  4DV2 E;  4Z7Y A;  4DR6 I;  2PNL A;  3M6A A;  4DXL A;  1NHJ A;  4DV7 I;  4DV4 E;  4MYT A;  4DV3 I;  4B3R I;  4RPF A;  4HY1 A;  4DV5 I;  4LF6 E;  4OX9 I;  2PNM A;  4LFC E;  4LF5 E;  2V2Q A;  1DAR A;  5L3J A;  2ZBK B;  2VQF I;  4FN5 A;  2HHH E;  2O1T A;  5A2Q C;  4JI1 I;  4UTG A;  1MX0 A;  3PRY A;  4YHH I;  5FLX C;  1NZ0 A;  3F0N A;  3H4L A;  2X36 A;  3QT5 A;  3J81 C;  2ZM6 I;  4NXM I;  4DV7 E;  3ZZU A;  1ELO A;  2X7I A;  4DV3 E;  4DV5 E;  4OX9 E;  4DR5 E;  3OTO I;  3JAM C;  3ZZT A;  1Z5A A;  4UT4 A;  2NPF A;  1EA6 A;  4DUY E;  2VQF E;  2HKJ A;  2XEX A;  4JI1 E;  1ZXN A;  2IOP A;  1XNQ E;  4XTJ A;  4JV5 I;  3ZKB A;  4YHH E;  2CG9 A;  4DV1 I;  2ZM6 E;  4NXM E;  4PU9 A;  2UUB I;  1ZM2 A;  1RRE A;  2UXB I;  1H73 A;  2ZIT A;  3OTO E;  2VQE I;  4LFB I;  1Z0G A;  2HK2 A;  3T1H I;  1HNZ I;  3K85 A;  3WU5 A;  3HUL A;  2Z5E A;  5LL6 R;  2UXD I;  2V8P A;  4IZJ A;  2HKE A;  2UXC I;  2AJ4 A;  1FNM A;  4M1K A;  3B8H A;  2UUC I;  3PYD A;  1UEK A;  3B82 A;  1Z0C A;  4MYU A;  2GQ0 A;  1KVK A;  2Z5C B;  1B63 A;  1U2R A;  2UUB E;  2J7K A;  2UXB E;  1XMO I;  1Y6Z A;  1Z0B A;  1USU A;  5LMN I;  2VQE E;  1Z59 A;  1ZM3 A;  2O1W A;  1N32 E;  1D6T A;  1J5E I;  4LFB E;  2HFS A;  1IBL I;  4DR7 I;  4DR3 I;  4WUC A;  1HNZ E;  1A6F A;  4B3S I;  1N34 E;  1XMQ E;  2UXD E;  3J80 Q;  1I94 I;  2E1R A;  4X64 I;  2HK3 A;  1XNR E;  3CWV A;  4DV6 I;  4R1F A;  3T1Y E;  1XMO E;  1IBM I;  4KHP I;  2R42 A;  5LMN E;  3Q6M A;  4N3O A;  4DU8 A;  1J5E E;  3Q1Q A;  1B62 A;  1IBL E;  4DR7 E;  4DR3 E;  4LF7 I;  2UU9 I;  4B3S E;  2HFU A;  3K17 A;  3J7A G;  2BM0 A;  4DR6 E;  1FI4 A;  1I94 E;  1FKA E;  2DEJ A;  4X64 E;  3WU6 A;  4X66 I;  4B3R E;  2O1V A;  4JI5 I;  4LF8 I;  4DV6 E;  3B78 A;  1QZR A;  1S16 A;  1Y4S A;  4GKJ I;  2BM1 A;  1NHI A;  4PRV A;  4DPU A;  1FWK A;  1HR0 I;  2BV3 A;  4IZJ D;  3HJC A;  2CZ9 A;  5GME A;  1RR9 A;  1Z0T A;  2CGE A;  3V5R A;  1HNW I;  3ZKD A;  1KKH A;  4LF7 E;  4FW9 A;  2UU9 E;  3ZM7 A;  2GS8 A;  3ZZ0 A;  1PIE A;  4DR1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...