4B3TI

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3tI00
4JI8I 4JI2I 1Z0EA 1D6TA 2HK3A 1H7UA 4DR1E 3T1YI 4KHPE 4FWDA 3K17A 1FWLA 4Z7YA 1Z5CA 5IT9Q 1RREA 4LF7I 2HKEA 5A2QC 2NPFA 5BR8I 4LFAI 1ZXNA 1DARA 2UU9I 2UUCE 2VQFI 4DR4I 2ZM6E 1U2RA 1ELOA 4DV6E 1Z0VA 1HNZE 2WW4A 2F4VE 4JYAI 4LF7E 1Z0CA 2VQFE 1N36I 3J7AM 4GKJE 1MX0A 3ZZ0A 1XNRE 2UXCI 1IBKE 1PIEA 4K0KE 1FWKA 1HR0I 2V8PA 4YY3I 2LJPA 4X62E 1PKPA 1WUUA 4DV2I 1J5EI 4DV4E 3WU5A 2UUBE 1IBME 2UUAE 4JI6I 1N34E 4X62I 3OTOE 2R42A 1NHHA 4DUZE 4JG4A 2ZBKB 4OX9E 4DR3I 5LMNI 1NHJA 1N34I 4R1FA 3K1JA 4EMDA 4LFBI 3V5RA 1N0UA 2V2VA 4JYAE 3J80C 4LFCE 1N32I 4LF4I 4JI3I 5LMUE 1XMQE 1UEKA 2BM0A 4XTJA 4Z7CA 2HKJA 5IT9C 3H4LA 1FJGI 1Z0BA 3F0NA 2V2ZA 4DR5E 5FLXC 4AQYE 1XNQE 5IWAE 5LMNE 1ZM9A 2OI2A 2DEIA 4DR6I 4DR2E 1KVKA 4USMA 3PYGA 4USKA 4ZVIA 1FNMA 5GMDA 3PYDA 4JI6E 4DPTA 4JI4I 5GMEA 4B3RI 3QT7A 4FN5A 4JI4E 5LMUI 2ZITA 4WUDA 1IBLE 4KHPI 4LF6E 1B63A 4OX9I 1A6FA 4LF6I 3D4JA 4MYTA 4JI0I 4B3SI 1XNQI 3HULA 4KQVA 4LF5E 3WU3A 4DV2E 2VQEE 1N36E 2X7IA 1MU5A 4DR2I 4HACB 1HNZI 2Q2EB 1NZ0A 1HNXI 4URLA 3ZKDA 4DU7A 3JAMC 4GKKI 1H74A 3JAMQ 1FJGE 4B3RE 2UUBI 4HACA 1H7SA 3J81Q 4LF9I 3J81C 2E5LE 1H73A 1EA6A 2R3VA 4DV7E 2EFGA 4JI1E 4NXNE 1N32E 3WU4A 5FLXQ 4AQYI 1ZXMA 4GKKE 4GKJI 1XMQI 4ED4A 1RR9A 2UXDI 4YHHE 3J7AG 2HHHI 4FWGA 3OTOI 4I3HA 4UT4A 3GONA 4LFBE 4B3TE 4LF5I 4DUZI 1J5EE 2A2DA 1Z59A 4LFAE 4JI8E 4DPWA 4JI2E 3T1YE 2BM1A 1Z0TA 4K0KI 4DV5E 2HFUA 1HNWE 1ZM3A 1K47A 2VF3A 4B3TI 4DV3I 3J80Q 4DR3E 4DV1I 5LL6R 4WUBA 1QZRA 4DR6E 4FW9A 4YHHI 2CZ9A 4DPUA 3ZZTA 2HK2A 1PVGA 5IWAI 1I94I 3LTOA 1N0VC 4YY3E 1Z0WA 4HXZA 4PRVA 4JI5I 2E5LI 2UUCI 1FI4A 4DPYA 2GS8A 4DPXA 4B3ME 4X66I 1I94E 3PYEA 4DV6I 4NXNI 4LF4E 4DV0I 1XMOI 2HFSA 4JI1I 4DUYI 4DR5I 3WU6A 2UXBE 4DUYE 1XMOE 1OJ4A 4DU8A 4JI5E 1Z0GA 4FWHA 5BR8E 3B82A 2A2CA 1Z5BA 1XHKA 1BKNA 4JV5E 2ZM6I 4WUCA 4P52A 1KIJA 3ZZUA 1ZM4A 5A2QQ 4B3SE 3T1HI 4LFCI 4DR7I 2V2QA 3M6AA 4NXMI 3QT6A 4M1KA 1KTVA 3QT5A 1ZM2A 4JI0E 4DV3E 3QT8A 3T1HE 4X65I 1NHIA 1IBLI 4X65E 2E1RA 2UXDE 4DXLA 4HY1A 4PU9A 3B78A 4JI7E 1S4EA 1HR0E 1IBMI 1IBKI 2UUAI 1Z5AA 1N33I 1XNRI 2UXCE 2V34A 1FKAE 4X66E 4DV4I 4DV7I 4LF8I 5L3JA 4X64E 3V2UC 2UXBI 4DR7E 4LF9E 2HHHE 4DR4E 4B3MI 3Q1QA 4JI7I 1MG7A 2UU9E 1H72C 4X64I 4JI3E 4DV0E 4UTGA 2BV3A 3PYFA 2DEJA 2F4VI 1S16A 4LF8E 4DV1E 1B62A 2J7KA 3ZKBA 1HNXE 1VISA 2XEXA 2AJ4A 1N33E 3LPSA 3B8HA 4HYMA 4PRXA 3CWVA 3LNUA 4RPFA 2VQEI 1KKHA 1EI1A 4NXME 1HNWI 3ZM7A 4JV5I 4MYUA 4DR1I 4DV5I 2X36A 4P7AA
chains in the Genus database with same CATH superfamily
2NN6D 4JI8I 4JI2I 2GQ0A 1Z0EA 4J3DA 2GO3A 3PS1A 1D6TA 2HK3A 1H7UA 3M85D 2Z5BB 2O1TA 4DR1E 3T1YI 4KHPE 4IFDA 4FWDA 4AM3A 3K17A 1FWLA 3HKMA 4Z7YA 1Z5CA 5IT9Q 1YHCA 1RREA 4LF7I 2HKEA 4LPFA 3M7ND 2PO1A 5A2QC 2NPFA 5BR8I 4LFAI 1ZXNA 1DARA 4LOMA 2UU9I 2UUCE 2VQFI 4DR4I 5K36D 2WNRA 2ZM6E 1U2RA 1ELOA 4DV6E 4OO1A 1Z0VA 1HNZE 2WW4A 2F4VE 4JYAI 1E3PA 4LF7E 5JEAA 2PO0A 5JEAC 1Z0CA 2VQFE 2PNZA 2JE6A 1N36I 3J7AM 4GKJE 1MX0A 2BA0D 2Z5CA 3ZZ0A 1XNRE 2UXCI 1IBKE 5FWKA 1PIEA 4K0KE 1FWKA 1HR0I 2V8PA 2IESA 4YY3I 2LJPA 4X62E 1PKPA 1WUUA 4DV2I 1J5EI 4DV4E 3WU5A 2UUBE 3GCMA 3L7ZB 1IBME 2UUAE 5DNXA 1OYPA 4JI6I 1N34E 4X62I 3OTOE 5DRQA 2R42A 1NHHA 2IERA 3U1YA 5JEAF 4DUZE 4JG4A 2ZBKB 4OX9E 4MQYA 4FW7A 4DR3I 5LMNI 1NHJA 1USVA 1OYRA 3UHMA 1N34I 4R1FA 2O3ZA 2Z5EA 3K1JA 4EMDA 1USUA 4LFBI 3V5RA 3Q6NA 2BA1G 1N0UA 2V2VA 3NZKA 5EL9A 4JYAE 3J80C 4LFCE 1N32I 4LF4I 3U1KA 4JI3I 5LMUE 1XMQE 1UEKA 2BM0A 4XTJA 3L7ZA 1Y5YA 4Z7CA 1XXEA 1YH8A 2HKJA 5IT9C 3P06A 3H4LA 1FJGI 1Z0BA 3F0NA 2V2ZA 1Y4UA 4DR5E 5FLXC 4AQYE 1XNQE 5IWAE 5LMNE 1ZM9A 2OI2A 2DEIA 4DR6I 2BR2B 4DR2E 1KVKA 4OO1E 3GMEA 4U3DA 4MU3A 2JE6B 1R6MA 4USMA 3PRYA 3PYGA 4USKA 4ZVIA 1FNMA 2PO0B 4IZKB 5GMDA 3PYDA 5JEAB 4JI6E 2JEBB 4LCFA 4DPTA 4JI4I 5GMEA 4QNJA 5C0XC 2NN6A 4B3RI 3QT7A 4FW4A 3K85A 4FN5A 4JI4E 5LMUI 2ZITA 4WUDA 5C0XD 2JT2A 1IBLE 4KHPI 2PNLA 4LF6E 1P42A 2CGEA 2BA0G 1B63A 4OX9I 2AE8A 1A6FA 4LF6I 4FW3A 3D4JA 4MYTA 4JI0I 4B3SI 2J65A 1XNQI 3HULA 2O1UA 4KQVA 4LF5E 2IOQA 3WU3A 4DV2E 4BA1B 2VQEE 1N36E 4IFDB 1HK7A 2X7IA 1MU5A 2Z5BA 4DR2I 4OO1C 5K36A 4HACB 1HNZI 2CG9A 2Q2EB 4FW5A 1NZ0A 5C0XB 1HNXI 4URLA 3ZKDA 4DU7A 3P3EA 3JAMC 5C0XA 4GKKI 1H74A 3JAMQ 1FJGE 3P76A 4B3RE 5C0XE 5K36F 2UUBI 4HACA 5K36B 1H7SA 3J81Q 2VESA 4MU4A 4LF9I 3J81C 2PO2B 2E5LE 1E3HA 1H73A 1EA6A 2R3VA 4BA1A 4QNKA 1VI7A 4DV7E 2EFGA 4JI1E 5C0XF 5K36E 2JEAB 4NXNE 1N32E 3H1CA 3WU4A 5JEAD 5FLXQ 4AQYI 1ZXMA 4GKKE 4GKJI 1XMQI 2CVEA 5DRRA 4ED4A 1RR9A 2UXDI 4YHHE 3J7AG 2HHHI 1UDNA 4FWGA 3OTOI 4I3HA 4UT4A 5ELWA 5DROA 2NN6B 2WP8B 4GQUA 3GONA 4LFBE 4B3TE 2JEBA 4LF5I 4IZKA 4DUZI 1J5EE 2A2DA 1Z59A 4LFAE 4JI8E 4DPWA 4JI2E 3T1YE 2BM1A 1Z0TA 4IZJB 2BR2A 4K0KI 5K36C 3Q6MA 4DV5E 4MU1A 4IZJD 2HFUA 1HNWE 1ZM3A 1K47A 4IS9A 2VF3A 4B3TI 4DV3I 3J80Q 1UDOA 4DR3E 4DV1I 4OO1F 5LL6R 4IFDF 4WUBA 1QZRA 4DR6E 3CDJA 4FW9A 4YHHI 2CZ9A 4DPUA 3ZZTA 2HK2A 4MDTA 1PVGA 2IOPA 5IWAI 1I94I 3LTOA 2C39B 1N0VC 4AIMA 2C38A 2F1DA 4YY3E 1Z0WA 4HXZA 4PRVA 4JI5I 2E5LI 2UUCI 1FI4A 4DPYA 2GS8A 4DPXA 3PS2A 2NN6E 4X66I 4B3ME 4NBQA 1I94E 2C37B 3PYEA 4AIDA 4NXNI 4DV6I 3P3GA 4LF4E 4DV0I 4DUYI 2HFSA 4JI1I 4DR5I 1XMOI 3M7NG 3WU6A 2UXBE 4DUYE 1XMOE 1OJ4A 4DU8A 4JI5E 1Z0GA 4FWHA 5BR8E 3P3CA 3PS3A 1Y4SA 3B82A 2A2CA 1Z5BA 1XHKA 1BKNA 4ISAA 4OZEA 2ZM6I 4JV5E 4WUCA 4P52A 4FW6A 1KIJA 3ZZUA 3M85G 1ZM4A 5A2QQ 3CDIA 4B3SE 3T1HI 2C37A 4LFCI 1RHYA 4DR7I 5DRPA 2Z5CB 2V2QA 3M6AA 4IFDE 4NXMI 3HJCA 3QT6A 4M1KA 1KTVA 2C38B 3QT5A 1UDQA 2PNZB 2C39A 1ZM2A 3GLLA 3DD6A 4JI0E 4OO1D 4DV3E 4IFDD 4OO1B 3QT8A 3T1HE 1UDSA 4X65I 1NHIA 2WNRB 1IBLI 4X65E 2E1RA 2UXDE 4DXLA 4HY1A 4PU9A 3B78A 4JI7E 1S4EA 1HR0E 1IBMI 1IBKI 2UUAI 1Z5AA 1N33I 1XNRI 2PO1B 2UXCE 2V34A 1FKAE 4X66E 4DV4I 4MU0A 4DV7I 5DNLA 2NN6C 4LCGA 4LF8I 5L3JA 4X64E 3V2UC 2UXBI 4DR7E 1Y60A 4LF9E 4OKGA 4IZJA 4LCHA 2HHHE 2GO4A 4N3OA 4IFDC 4DR4E 4B3MI 3Q1QA 4JI7I 1MG7A 2UU9E 1H72C 4X64I 4JI3E 4DV0E 4UTGA 2BV3A 2WP8A 2DEJA 3PYFA 2F4VI 1S16A 4LF8E 4BA2A 4DV1E 1B62A 2J7KA 1Y6ZA 4U3BA 3ZKBA 1R6LA 1HNXE 1VISA 2O1VA 2XEXA 5JEAE 2AJ4A 1N33E 2JEAA 3LPSA 3B8HA 4HYMA 4PRXA 3CWVA 3LNUA 4RPFA 2VQEI 1KKHA 2PNMA 3B4TA 2PO2A 1OYSA 3KRNA 1EI1A 4NXME 2BA1D 4BA2B 1HNWI 2O1WA 3ZM7A 4JV5I 4MYUA 5EKWA 4DR1I 4DV5I 2X36A 4P7AA 2NN6F
chains in the Genus database with same CATH topology
4JI8I 4JI2I 2GQ0A 1Z0EA 1D6TA 2HK3A 1H7UA 2Z5BB 2O1TA 4DR1E 3T1YI 4KHPE 4FWDA 3K17A 1FWLA 4Z7YA 1Z5CA 5IT9Q 1RREA 4LF7I 2HKEA 5A2QC 2NPFA 5BR8I 4LFAI 1ZXNA 1DARA 2UU9I 2UUCE 2VQFI 4DR4I 2ZM6E 1U2RA 1ELOA 4DV6E 1Z0VA 1HNZE 2WW4A 2F4VE 4JYAI 4LF7E 1Z0CA 2VQFE 1N36I 3J7AM 4GKJE 1MX0A 2Z5CA 3ZZ0A 1XNRE 2UXCI 1IBKE 5FWKA 1PIEA 4K0KE 1FWKA 1HR0I 2V8PA 4YY3I 2LJPA 4X62E 1PKPA 1WUUA 4DV2I 1J5EI 4DV4E 3WU5A 2UUBE 1IBME 2UUAE 4JI6I 1N34E 4X62I 3OTOE 2R42A 1NHHA 4DUZE 4JG4A 2ZBKB 4OX9E 4DR3I 5LMNI 1NHJA 1USVA 1N34I 4R1FA 2Z5EA 3K1JA 4EMDA 1USUA 4LFBI 3V5RA 3Q6NA 1N0UA 2V2VA 4JYAE 3J80C 4LFCE 1N32I 4LF4I 4JI3I 5LMUE 1XMQE 1UEKA 2BM0A 4XTJA 4Z7CA 2HKJA 5IT9C 3P06A 3H4LA 1FJGI 1Z0BA 3F0NA 2V2ZA 1Y4UA 4DR5E 5FLXC 4AQYE 1XNQE 5IWAE 5LMNE 1ZM9A 2OI2A 2DEIA 4DR6I 4DR2E 1KVKA 4USMA 3PRYA 3PYGA 4USKA 4ZVIA 1FNMA 4IZKB 5GMDA 3PYDA 4JI6E 4DPTA 4JI4I 5GMEA 4B3RI 3QT7A 3K85A 4FN5A 4JI4E 5LMUI 2ZITA 4WUDA 1IBLE 4KHPI 2PNLA 4LF6E 2CGEA 1B63A 4OX9I 1A6FA 4LF6I 3D4JA 4MYTA 4JI0I 4B3SI 1XNQI 3HULA 2O1UA 4KQVA 4LF5E 2IOQA 3WU3A 4DV2E 2VQEE 1N36E 1HK7A 2X7IA 1MU5A 2Z5BA 4DR2I 4HACB 1HNZI 2CG9A 2Q2EB 1NZ0A 1HNXI 4URLA 3ZKDA 4DU7A 3JAMC 4GKKI 1H74A 3JAMQ 1FJGE 4B3RE 2UUBI 4HACA 1H7SA 3J81Q 4LF9I 3J81C 2E5LE 1H73A 1EA6A 2R3VA 4DV7E 2EFGA 4JI1E 4NXNE 1N32E 3WU4A 5FLXQ 4AQYI 1ZXMA 4GKKE 4GKJI 1XMQI 4ED4A 1RR9A 2UXDI 4YHHE 3J7AG 2HHHI 4FWGA 3OTOI 4I3HA 4UT4A 3GONA 4LFBE 4B3TE 4LF5I 4IZKA 4DUZI 1J5EE 2A2DA 1Z59A 4LFAE 4JI8E 4DPWA 4JI2E 3T1YE 2BM1A 1Z0TA 4IZJB 4K0KI 3Q6MA 4DV5E 4IZJD 2HFUA 1HNWE 1ZM3A 1K47A 2VF3A 4B3TI 4DV3I 3J80Q 4DR3E 4DV1I 5LL6R 4WUBA 1QZRA 4DR6E 4FW9A 4YHHI 2CZ9A 4DPUA 3ZZTA 2HK2A 1PVGA 2IOPA 5IWAI 1I94I 3LTOA 1N0VC 4YY3E 1Z0WA 4HXZA 4PRVA 4JI5I 2E5LI 2UUCI 1FI4A 4DPYA 2GS8A 4DPXA 4B3ME 4X66I 1I94E 3PYEA 4DV6I 4NXNI 4LF4E 4DV0I 1XMOI 2HFSA 4JI1I 4DUYI 4DR5I 3WU6A 2UXBE 4DUYE 1XMOE 1OJ4A 4DU8A 4JI5E 1Z0GA 4FWHA 5BR8E 1Y4SA 3B82A 2A2CA 1Z5BA 1XHKA 1BKNA 4JV5E 2ZM6I 4WUCA 4P52A 1KIJA 3ZZUA 1ZM4A 5A2QQ 4B3SE 3T1HI 4LFCI 4DR7I 2Z5CB 2V2QA 3M6AA 4NXMI 3HJCA 3QT6A 4M1KA 1KTVA 3QT5A 1ZM2A 4JI0E 4DV3E 3QT8A 3T1HE 4X65I 1NHIA 1IBLI 4X65E 2E1RA 2UXDE 4DXLA 4HY1A 4PU9A 3B78A 4JI7E 1S4EA 1HR0E 1IBMI 1IBKI 2UUAI 1Z5AA 1N33I 1XNRI 2UXCE 2V34A 1FKAE 4X66E 4DV4I 4DV7I 4LF8I 5L3JA 4X64E 3V2UC 2UXBI 4DR7E 4LF9E 4IZJA 2HHHE 4N3OA 4DR4E 4B3MI 3Q1QA 4JI7I 1MG7A 2UU9E 1H72C 4X64I 4JI3E 4DV0E 4UTGA 2BV3A 3PYFA 2DEJA 2F4VI 1S16A 4LF8E 4DV1E 1B62A 2J7KA 1Y6ZA 3ZKBA 1HNXE 1VISA 2O1VA 2XEXA 2AJ4A 1N33E 3LPSA 3B8HA 4HYMA 4PRXA 3CWVA 3LNUA 4RPFA 2VQEI 1KKHA 2PNMA 1EI1A 4NXME 1HNWI 2O1WA 3ZM7A 4JV5I 4MYUA 4DR1I 4DV5I 2X36A 4P7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 I;  4JI2 I;  1Z0E A;  1D6T A;  2HK3 A;  1H7U A;  4DR1 E;  3T1Y I;  4KHP E;  4FWD A;  3K17 A;  1FWL A;  4Z7Y A;  1Z5C A;  5IT9 Q;  1RRE A;  4LF7 I;  2HKE A;  5A2Q C;  2NPF A;  5BR8 I;  4LFA I;  1ZXN A;  1DAR A;  2UU9 I;  2UUC E;  2VQF I;  4DR4 I;  2ZM6 E;  1U2R A;  1ELO A;  4DV6 E;  1Z0V A;  1HNZ E;  2WW4 A;  2F4V E;  4JYA I;  4LF7 E;  1Z0C A;  2VQF E;  1N36 I;  3J7A M;  4GKJ E;  1MX0 A;  3ZZ0 A;  1XNR E;  2UXC I;  1IBK E;  1PIE A;  4K0K E;  1FWK A;  1HR0 I;  2V8P A;  4YY3 I;  2LJP A;  4X62 E;  1PKP A;  1WUU A;  4DV2 I;  1J5E I;  4DV4 E;  3WU5 A;  2UUB E;  1IBM E;  2UUA E;  4JI6 I;  1N34 E;  4X62 I;  3OTO E;  2R42 A;  1NHH A;  4DUZ E;  4JG4 A;  2ZBK B;  4OX9 E;  4DR3 I;  5LMN I;  1NHJ A;  1N34 I;  4R1F A;  3K1J A;  4EMD A;  4LFB I;  3V5R A;  1N0U A;  2V2V A;  4JYA E;  3J80 C;  4LFC E;  1N32 I;  4LF4 I;  4JI3 I;  5LMU E;  1XMQ E;  1UEK A;  2BM0 A;  4XTJ A;  4Z7C A;  2HKJ A;  5IT9 C;  3H4L A;  1FJG I;  1Z0B A;  3F0N A;  2V2Z A;  4DR5 E;  5FLX C;  4AQY E;  1XNQ E;  5IWA E;  5LMN E;  1ZM9 A;  2OI2 A;  2DEI A;  4DR6 I;  4DR2 E;  1KVK A;  4USM A;  3PYG A;  4USK A;  4ZVI A;  1FNM A;  5GMD A;  3PYD A;  4JI6 E;  4DPT A;  4JI4 I;  5GME A;  4B3R I;  3QT7 A;  4FN5 A;  4JI4 E;  5LMU I;  2ZIT A;  4WUD A;  1IBL E;  4KHP I;  4LF6 E;  1B63 A;  4OX9 I;  1A6F A;  4LF6 I;  3D4J A;  4MYT A;  4JI0 I;  4B3S I;  1XNQ I;  3HUL A;  4KQV A;  4LF5 E;  3WU3 A;  4DV2 E;  2VQE E;  1N36 E;  2X7I A;  1MU5 A;  4DR2 I;  4HAC B;  1HNZ I;  2Q2E B;  1NZ0 A;  1HNX I;  4URL A;  3ZKD A;  4DU7 A;  3JAM C;  4GKK I;  1H74 A;  3JAM Q;  1FJG E;  4B3R E;  2UUB I;  4HAC A;  1H7S A;  3J81 Q;  4LF9 I;  3J81 C;  2E5L E;  1H73 A;  1EA6 A;  2R3V A;  4DV7 E;  2EFG A;  4JI1 E;  4NXN E;  1N32 E;  3WU4 A;  5FLX Q;  4AQY I;  1ZXM A;  4GKK E;  4GKJ I;  1XMQ I;  4ED4 A;  1RR9 A;  2UXD I;  4YHH E;  3J7A G;  2HHH I;  4FWG A;  3OTO I;  4I3H A;  4UT4 A;  3GON A;  4LFB E;  4B3T E;  4LF5 I;  4DUZ I;  1J5E E;  2A2D A;  1Z59 A;  4LFA E;  4JI8 E;  4DPW A;  4JI2 E;  3T1Y E;  2BM1 A;  1Z0T A;  4K0K I;  4DV5 E;  2HFU A;  1HNW E;  1ZM3 A;  1K47 A;  2VF3 A;  4B3T I;  4DV3 I;  3J80 Q;  4DR3 E;  4DV1 I;  5LL6 R;  4WUB A;  1QZR A;  4DR6 E;  4FW9 A;  4YHH I;  2CZ9 A;  4DPU A;  3ZZT A;  2HK2 A;  1PVG A;  5IWA I;  1I94 I;  3LTO A;  1N0V C;  4YY3 E;  1Z0W A;  4HXZ A;  4PRV A;  4JI5 I;  2E5L I;  2UUC I;  1FI4 A;  4DPY A;  2GS8 A;  4DPX A;  4B3M E;  4X66 I;  1I94 E;  3PYE A;  4DV6 I;  4NXN I;  4LF4 E;  4DV0 I;  1XMO I;  2HFS A;  4JI1 I;  4DUY I;  4DR5 I;  3WU6 A;  2UXB E;  4DUY E;  1XMO E;  1OJ4 A;  4DU8 A;  4JI5 E;  1Z0G A;  4FWH A;  5BR8 E;  3B82 A;  2A2C A;  1Z5B A;  1XHK A;  1BKN A;  4JV5 E;  2ZM6 I;  4WUC A;  4P52 A;  1KIJ A;  3ZZU A;  1ZM4 A;  5A2Q Q;  4B3S E;  3T1H I;  4LFC I;  4DR7 I;  2V2Q A;  3M6A A;  4NXM I;  3QT6 A;  4M1K A;  1KTV A;  3QT5 A;  1ZM2 A;  4JI0 E;  4DV3 E;  3QT8 A;  3T1H E;  4X65 I;  1NHI A;  1IBL I;  4X65 E;  2E1R A;  2UXD E;  4DXL A;  4HY1 A;  4PU9 A;  3B78 A;  4JI7 E;  1S4E A;  1HR0 E;  1IBM I;  1IBK I;  2UUA I;  1Z5A A;  1N33 I;  1XNR I;  2UXC E;  2V34 A;  1FKA E;  4X66 E;  4DV4 I;  4DV7 I;  4LF8 I;  5L3J A;  4X64 E;  3V2U C;  2UXB I;  4DR7 E;  4LF9 E;  2HHH E;  4DR4 E;  4B3M I;  3Q1Q A;  4JI7 I;  1MG7 A;  2UU9 E;  1H72 C;  4X64 I;  4JI3 E;  4DV0 E;  4UTG A;  2BV3 A;  3PYF A;  2DEJ A;  2F4V I;  1S16 A;  4LF8 E;  4DV1 E;  1B62 A;  2J7K A;  3ZKB A;  1HNX E;  1VIS A;  2XEX A;  2AJ4 A;  1N33 E;  3LPS A;  3B8H A;  4HYM A;  4PRX A;  3CWV A;  3LNU A;  4RPF A;  2VQE I;  1KKH A;  1EI1 A;  4NXM E;  1HNW I;  3ZM7 A;  4JV5 I;  4MYU A;  4DR1 I;  4DV5 I;  2X36 A;  4P7A A; 
#chains in the Genus database with same CATH topology
 2NN6 D;  4JI8 I;  4JI2 I;  2GQ0 A;  1Z0E A;  4J3D A;  2GO3 A;  3PS1 A;  1D6T A;  2HK3 A;  1H7U A;  3M85 D;  2Z5B B;  2O1T A;  4DR1 E;  3T1Y I;  4KHP E;  4IFD A;  4FWD A;  4AM3 A;  3K17 A;  1FWL A;  3HKM A;  4Z7Y A;  1Z5C A;  5IT9 Q;  1YHC A;  1RRE A;  4LF7 I;  2HKE A;  4LPF A;  3M7N D;  2PO1 A;  5A2Q C;  2NPF A;  5BR8 I;  4LFA I;  1ZXN A;  1DAR A;  4LOM A;  2UU9 I;  2UUC E;  2VQF I;  4DR4 I;  5K36 D;  2WNR A;  2ZM6 E;  1U2R A;  1ELO A;  4DV6 E;  4OO1 A;  1Z0V A;  1HNZ E;  2WW4 A;  2F4V E;  4JYA I;  1E3P A;  4LF7 E;  5JEA A;  2PO0 A;  5JEA C;  1Z0C A;  2VQF E;  2PNZ A;  2JE6 A;  1N36 I;  3J7A M;  4GKJ E;  1MX0 A;  2BA0 D;  2Z5C A;  3ZZ0 A;  1XNR E;  2UXC I;  1IBK E;  5FWK A;  1PIE A;  4K0K E;  1FWK A;  1HR0 I;  2V8P A;  2IES A;  4YY3 I;  2LJP A;  4X62 E;  1PKP A;  1WUU A;  4DV2 I;  1J5E I;  4DV4 E;  3WU5 A;  2UUB E;  3GCM A;  3L7Z B;  1IBM E;  2UUA E;  5DNX A;  1OYP A;  4JI6 I;  1N34 E;  4X62 I;  3OTO E;  5DRQ A;  2R42 A;  1NHH A;  2IER A;  3U1Y A;  5JEA F;  4DUZ E;  4JG4 A;  2ZBK B;  4OX9 E;  4MQY A;  4FW7 A;  4DR3 I;  5LMN I;  1NHJ A;  1USV A;  1OYR A;  3UHM A;  1N34 I;  4R1F A;  2O3Z A;  2Z5E A;  3K1J A;  4EMD A;  1USU A;  4LFB I;  3V5R A;  3Q6N A;  2BA1 G;  1N0U A;  2V2V A;  3NZK A;  5EL9 A;  4JYA E;  3J80 C;  4LFC E;  1N32 I;  4LF4 I;  3U1K A;  4JI3 I;  5LMU E;  1XMQ E;  1UEK A;  2BM0 A;  4XTJ A;  3L7Z A;  1Y5Y A;  4Z7C A;  1XXE A;  1YH8 A;  2HKJ A;  5IT9 C;  3P06 A;  3H4L A;  1FJG I;  1Z0B A;  3F0N A;  2V2Z A;  1Y4U A;  4DR5 E;  5FLX C;  4AQY E;  1XNQ E;  5IWA E;  5LMN E;  1ZM9 A;  2OI2 A;  2DEI A;  4DR6 I;  2BR2 B;  4DR2 E;  1KVK A;  4OO1 E;  3GME A;  4U3D A;  4MU3 A;  2JE6 B;  1R6M A;  4USM A;  3PRY A;  3PYG A;  4USK A;  4ZVI A;  1FNM A;  2PO0 B;  4IZK B;  5GMD A;  3PYD A;  5JEA B;  4JI6 E;  2JEB B;  4LCF A;  4DPT A;  4JI4 I;  5GME A;  4QNJ A;  5C0X C;  2NN6 A;  4B3R I;  3QT7 A;  4FW4 A;  3K85 A;  4FN5 A;  4JI4 E;  5LMU I;  2ZIT A;  4WUD A;  5C0X D;  2JT2 A;  1IBL E;  4KHP I;  2PNL A;  4LF6 E;  1P42 A;  2CGE A;  2BA0 G;  1B63 A;  4OX9 I;  2AE8 A;  1A6F A;  4LF6 I;  4FW3 A;  3D4J A;  4MYT A;  4JI0 I;  4B3S I;  2J65 A;  1XNQ I;  3HUL A;  2O1U A;  4KQV A;  4LF5 E;  2IOQ A;  3WU3 A;  4DV2 E;  4BA1 B;  2VQE E;  1N36 E;  4IFD B;  1HK7 A;  2X7I A;  1MU5 A;  2Z5B A;  4DR2 I;  4OO1 C;  5K36 A;  4HAC B;  1HNZ I;  2CG9 A;  2Q2E B;  4FW5 A;  1NZ0 A;  5C0X B;  1HNX I;  4URL A;  3ZKD A;  4DU7 A;  3P3E A;  3JAM C;  5C0X A;  4GKK I;  1H74 A;  3JAM Q;  1FJG E;  3P76 A;  4B3R E;  5C0X E;  5K36 F;  2UUB I;  4HAC A;  5K36 B;  1H7S A;  3J81 Q;  2VES A;  4MU4 A;  4LF9 I;  3J81 C;  2PO2 B;  2E5L E;  1E3H A;  1H73 A;  1EA6 A;  2R3V A;  4BA1 A;  4QNK A;  1VI7 A;  4DV7 E;  2EFG A;  4JI1 E;  5C0X F;  5K36 E;  2JEA B;  4NXN E;  1N32 E;  3H1C A;  3WU4 A;  5JEA D;  5FLX Q;  4AQY I;  1ZXM A;  4GKK E;  4GKJ I;  1XMQ I;  2CVE A;  5DRR A;  4ED4 A;  1RR9 A;  2UXD I;  4YHH E;  3J7A G;  2HHH I;  1UDN A;  4FWG A;  3OTO I;  4I3H A;  4UT4 A;  5ELW A;  5DRO A;  2NN6 B;  2WP8 B;  4GQU A;  3GON A;  4LFB E;  4B3T E;  2JEB A;  4LF5 I;  4IZK A;  4DUZ I;  1J5E E;  2A2D A;  1Z59 A;  4LFA E;  4JI8 E;  4DPW A;  4JI2 E;  3T1Y E;  2BM1 A;  1Z0T A;  4IZJ B;  2BR2 A;  4K0K I;  5K36 C;  3Q6M A;  4DV5 E;  4MU1 A;  4IZJ D;  2HFU A;  1HNW E;  1ZM3 A;  1K47 A;  4IS9 A;  2VF3 A;  4B3T I;  4DV3 I;  3J80 Q;  1UDO A;  4DR3 E;  4DV1 I;  4OO1 F;  5LL6 R;  4IFD F;  4WUB A;  1QZR A;  4DR6 E;  3CDJ A;  4FW9 A;  4YHH I;  2CZ9 A;  4DPU A;  3ZZT A;  2HK2 A;  4MDT A;  1PVG A;  2IOP A;  5IWA I;  1I94 I;  3LTO A;  2C39 B;  1N0V C;  4AIM A;  2C38 A;  2F1D A;  4YY3 E;  1Z0W A;  4HXZ A;  4PRV A;  4JI5 I;  2E5L I;  2UUC I;  1FI4 A;  4DPY A;  2GS8 A;  4DPX A;  3PS2 A;  2NN6 E;  4X66 I;  4B3M E;  4NBQ A;  1I94 E;  2C37 B;  3PYE A;  4AID A;  4NXN I;  4DV6 I;  3P3G A;  4LF4 E;  4DV0 I;  4DUY I;  2HFS A;  4JI1 I;  4DR5 I;  1XMO I;  3M7N G;  3WU6 A;  2UXB E;  4DUY E;  1XMO E;  1OJ4 A;  4DU8 A;  4JI5 E;  1Z0G A;  4FWH A;  5BR8 E;  3P3C A;  3PS3 A;  1Y4S A;  3B82 A;  2A2C A;  1Z5B A;  1XHK A;  1BKN A;  4ISA A;  4OZE A;  2ZM6 I;  4JV5 E;  4WUC A;  4P52 A;  4FW6 A;  1KIJ A;  3ZZU A;  3M85 G;  1ZM4 A;  5A2Q Q;  3CDI A;  4B3S E;  3T1H I;  2C37 A;  4LFC I;  1RHY A;  4DR7 I;  5DRP A;  2Z5C B;  2V2Q A;  3M6A A;  4IFD E;  4NXM I;  3HJC A;  3QT6 A;  4M1K A;  1KTV A;  2C38 B;  3QT5 A;  1UDQ A;  2PNZ B;  2C39 A;  1ZM2 A;  3GLL A;  3DD6 A;  4JI0 E;  4OO1 D;  4DV3 E;  4IFD D;  4OO1 B;  3QT8 A;  3T1H E;  1UDS A;  4X65 I;  1NHI A;  2WNR B;  1IBL I;  4X65 E;  2E1R A;  2UXD E;  4DXL A;  4HY1 A;  4PU9 A;  3B78 A;  4JI7 E;  1S4E A;  1HR0 E;  1IBM I;  1IBK I;  2UUA I;  1Z5A A;  1N33 I;  1XNR I;  2PO1 B;  2UXC E;  2V34 A;  1FKA E;  4X66 E;  4DV4 I;  4MU0 A;  4DV7 I;  5DNL A;  2NN6 C;  4LCG A;  4LF8 I;  5L3J A;  4X64 E;  3V2U C;  2UXB I;  4DR7 E;  1Y60 A;  4LF9 E;  4OKG A;  4IZJ A;  4LCH A;  2HHH E;  2GO4 A;  4N3O A;  4IFD C;  4DR4 E;  4B3M I;  3Q1Q A;  4JI7 I;  1MG7 A;  2UU9 E;  1H72 C;  4X64 I;  4JI3 E;  4DV0 E;  4UTG A;  2BV3 A;  2WP8 A;  2DEJ A;  3PYF A;  2F4V I;  1S16 A;  4LF8 E;  4BA2 A;  4DV1 E;  1B62 A;  2J7K A;  1Y6Z A;  4U3B A;  3ZKB A;  1R6L A;  1HNX E;  1VIS A;  2O1V A;  2XEX A;  5JEA E;  2AJ4 A;  1N33 E;  2JEA A;  3LPS A;  3B8H A;  4HYM A;  4PRX A;  3CWV A;  3LNU A;  4RPF A;  2VQE I;  1KKH A;  2PNM A;  3B4T A;  2PO2 A;  1OYS A;  3KRN A;  1EI1 A;  4NXM E;  2BA1 D;  4BA2 B;  1HNW I;  2O1W A;  3ZM7 A;  4JV5 I;  4MYU A;  5EKW A;  4DR1 I;  4DV5 I;  2X36 A;  4P7A A;  2NN6 F; 
#chains in the Genus database with same CATH homology
 4JI8 I;  4JI2 I;  2GQ0 A;  1Z0E A;  1D6T A;  2HK3 A;  1H7U A;  2Z5B B;  2O1T A;  4DR1 E;  3T1Y I;  4KHP E;  4FWD A;  3K17 A;  1FWL A;  4Z7Y A;  1Z5C A;  5IT9 Q;  1RRE A;  4LF7 I;  2HKE A;  5A2Q C;  2NPF A;  5BR8 I;  4LFA I;  1ZXN A;  1DAR A;  2UU9 I;  2UUC E;  2VQF I;  4DR4 I;  2ZM6 E;  1U2R A;  1ELO A;  4DV6 E;  1Z0V A;  1HNZ E;  2WW4 A;  2F4V E;  4JYA I;  4LF7 E;  1Z0C A;  2VQF E;  1N36 I;  3J7A M;  4GKJ E;  1MX0 A;  2Z5C A;  3ZZ0 A;  1XNR E;  2UXC I;  1IBK E;  5FWK A;  1PIE A;  4K0K E;  1FWK A;  1HR0 I;  2V8P A;  4YY3 I;  2LJP A;  4X62 E;  1PKP A;  1WUU A;  4DV2 I;  1J5E I;  4DV4 E;  3WU5 A;  2UUB E;  1IBM E;  2UUA E;  4JI6 I;  1N34 E;  4X62 I;  3OTO E;  2R42 A;  1NHH A;  4DUZ E;  4JG4 A;  2ZBK B;  4OX9 E;  4DR3 I;  5LMN I;  1NHJ A;  1USV A;  1N34 I;  4R1F A;  2Z5E A;  3K1J A;  4EMD A;  1USU A;  4LFB I;  3V5R A;  3Q6N A;  1N0U A;  2V2V A;  4JYA E;  3J80 C;  4LFC E;  1N32 I;  4LF4 I;  4JI3 I;  5LMU E;  1XMQ E;  1UEK A;  2BM0 A;  4XTJ A;  4Z7C A;  2HKJ A;  5IT9 C;  3P06 A;  3H4L A;  1FJG I;  1Z0B A;  3F0N A;  2V2Z A;  1Y4U A;  4DR5 E;  5FLX C;  4AQY E;  1XNQ E;  5IWA E;  5LMN E;  1ZM9 A;  2OI2 A;  2DEI A;  4DR6 I;  4DR2 E;  1KVK A;  4USM A;  3PRY A;  3PYG A;  4USK A;  4ZVI A;  1FNM A;  4IZK B;  5GMD A;  3PYD A;  4JI6 E;  4DPT A;  4JI4 I;  5GME A;  4B3R I;  3QT7 A;  3K85 A;  4FN5 A;  4JI4 E;  5LMU I;  2ZIT A;  4WUD A;  1IBL E;  4KHP I;  2PNL A;  4LF6 E;  2CGE A;  1B63 A;  4OX9 I;  1A6F A;  4LF6 I;  3D4J A;  4MYT A;  4JI0 I;  4B3S I;  1XNQ I;  3HUL A;  2O1U A;  4KQV A;  4LF5 E;  2IOQ A;  3WU3 A;  4DV2 E;  2VQE E;  1N36 E;  1HK7 A;  2X7I A;  1MU5 A;  2Z5B A;  4DR2 I;  4HAC B;  1HNZ I;  2CG9 A;  2Q2E B;  1NZ0 A;  1HNX I;  4URL A;  3ZKD A;  4DU7 A;  3JAM C;  4GKK I;  1H74 A;  3JAM Q;  1FJG E;  4B3R E;  2UUB I;  4HAC A;  1H7S A;  3J81 Q;  4LF9 I;  3J81 C;  2E5L E;  1H73 A;  1EA6 A;  2R3V A;  4DV7 E;  2EFG A;  4JI1 E;  4NXN E;  1N32 E;  3WU4 A;  5FLX Q;  4AQY I;  1ZXM A;  4GKK E;  4GKJ I;  1XMQ I;  4ED4 A;  1RR9 A;  2UXD I;  4YHH E;  3J7A G;  2HHH I;  4FWG A;  3OTO I;  4I3H A;  4UT4 A;  3GON A;  4LFB E;  4B3T E;  4LF5 I;  4IZK A;  4DUZ I;  1J5E E;  2A2D A;  1Z59 A;  4LFA E;  4JI8 E;  4DPW A;  4JI2 E;  3T1Y E;  2BM1 A;  1Z0T A;  4IZJ B;  4K0K I;  3Q6M A;  4DV5 E;  4IZJ D;  2HFU A;  1HNW E;  1ZM3 A;  1K47 A;  2VF3 A;  4B3T I;  4DV3 I;  3J80 Q;  4DR3 E;  4DV1 I;  5LL6 R;  4WUB A;  1QZR A;  4DR6 E;  4FW9 A;  4YHH I;  2CZ9 A;  4DPU A;  3ZZT A;  2HK2 A;  1PVG A;  2IOP A;  5IWA I;  1I94 I;  3LTO A;  1N0V C;  4YY3 E;  1Z0W A;  4HXZ A;  4PRV A;  4JI5 I;  2E5L I;  2UUC I;  1FI4 A;  4DPY A;  2GS8 A;  4DPX A;  4B3M E;  4X66 I;  1I94 E;  3PYE A;  4DV6 I;  4NXN I;  4LF4 E;  4DV0 I;  1XMO I;  2HFS A;  4JI1 I;  4DUY I;  4DR5 I;  3WU6 A;  2UXB E;  4DUY E;  1XMO E;  1OJ4 A;  4DU8 A;  4JI5 E;  1Z0G A;  4FWH A;  5BR8 E;  1Y4S A;  3B82 A;  2A2C A;  1Z5B A;  1XHK A;  1BKN A;  4JV5 E;  2ZM6 I;  4WUC A;  4P52 A;  1KIJ A;  3ZZU A;  1ZM4 A;  5A2Q Q;  4B3S E;  3T1H I;  4LFC I;  4DR7 I;  2Z5C B;  2V2Q A;  3M6A A;  4NXM I;  3HJC A;  3QT6 A;  4M1K A;  1KTV A;  3QT5 A;  1ZM2 A;  4JI0 E;  4DV3 E;  3QT8 A;  3T1H E;  4X65 I;  1NHI A;  1IBL I;  4X65 E;  2E1R A;  2UXD E;  4DXL A;  4HY1 A;  4PU9 A;  3B78 A;  4JI7 E;  1S4E A;  1HR0 E;  1IBM I;  1IBK I;  2UUA I;  1Z5A A;  1N33 I;  1XNR I;  2UXC E;  2V34 A;  1FKA E;  4X66 E;  4DV4 I;  4DV7 I;  4LF8 I;  5L3J A;  4X64 E;  3V2U C;  2UXB I;  4DR7 E;  4LF9 E;  4IZJ A;  2HHH E;  4N3O A;  4DR4 E;  4B3M I;  3Q1Q A;  4JI7 I;  1MG7 A;  2UU9 E;  1H72 C;  4X64 I;  4JI3 E;  4DV0 E;  4UTG A;  2BV3 A;  3PYF A;  2DEJ A;  2F4V I;  1S16 A;  4LF8 E;  4DV1 E;  1B62 A;  2J7K A;  1Y6Z A;  3ZKB A;  1HNX E;  1VIS A;  2O1V A;  2XEX A;  2AJ4 A;  1N33 E;  3LPS A;  3B8H A;  4HYM A;  4PRX A;  3CWV A;  3LNU A;  4RPF A;  2VQE I;  1KKH A;  2PNM A;  1EI1 A;  4NXM E;  1HNW I;  2O1W A;  3ZM7 A;  4JV5 I;  4MYU A;  4DR1 I;  4DV5 I;  2X36 A;  4P7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...