4B3TI

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3tI00
1S16A 4X65E 1J5EI 2UXCI 2GS8A 4PRXA 1KTVA 4I3HA 1ZM3A 4P7AA 2LJPA 2Q2EB 4JI8I 4B3RI 2ZM6E 4B3RE 2HK3A 4LFCE 4DPYA 1EA6A 3ZKDA 4DR1E 3ZZTA 1H72C 3D4JA 1VISA 4DUZI 4DV7E 3H4LA 3J7AG 1S4EA 4OX9E 4X64E 2VQEE 2J7KA 4JI0I 4PU9A 2AJ4A 3J80C 4JI3E 1H7UA 2HHHE 3JAMQ 2BM0A 4DV4I 4HXZA 1XNRI 1FWKA 4YY3I 3LTOA 4USMA 3WU4A 2F4VE 1HNXE 2UXDE 1N36I 1FKAE 1IBKI 3K17A 4WUDA 4UT4A 4K0KI 4JI7I 2ZITA 4JI4I 1Z59A 4FW9A 3T1HI 4JYAI 4B3TE 1XNQE 1KVKA 4JI5I 4UTGA 3ZKBA 1ZM2A 1ZM4A 4DR4E 4DV7I 3QT6A 1DARA 4JG4A 1NHJA 1N34I 5IWAE 4JI5E 4DV3E 2UUBI 1XMQE 4DU8A 2BM1A 4JI6E 3T1YI 5A2QC 4JI6I 1I94E 3LPSA 4X62E 3PYEA 4AQYI 1FWLA 5LL6R 4GKJI 5GMEA 1IBMI 2XEXA 4DUYI 1N36E 2UXDI 1IBLE 2DEIA 2BV3A 2V2QA 4DR4I 2E5LI 4JV5I 1HNWI 4P52A 4KHPI 4B3MI 3PYFA 4DV4E 4DV5E 4PRVA 4DR5I 4LF4E 4LF7E 1OJ4A 1XHKA 4DUYE 1MG7A 4JI7E 4JI2I 1HNWE 2WW4A 1MX0A 4NXMI 2E5LE 3Q1QA 4DR3E 5A2QQ 4DPUA 1N33E 1I94I 2A2DA 4AQYE 5GMDA 4DR6E 3B8HA 4XTJA 1PVGA 4LF8E 4ED4A 4DR7E 4LF8I 3T1YE 4RPFA 5IT9Q 3QT5A 4KQVA 1N33I 1N34E 1HR0I 4DV3I 3QT7A 4GKKI 4ZVIA 2VQFI 3QT8A 4X66E 4B3SE 1XMQI 3J81C 1A6FA 5BR8I 1ZXNA 4B3TI 4LFAE 3B82A 4NXNI 1B63A 3ZZUA 2EFGA 1Z0CA 4DR6I 4HYMA 4DR7I 4K0KE 1PKPA 4FWGA 5LMUI 1HNXI 1K47A 1XMOE 4X62I 5FLXQ 4FN5A 3PYDA 3WU5A 4JI2E 4EMDA 3PYGA 4LF7I 3J80Q 4NXNE 1EI1A 1KKHA 2UUAE 4LFAI 4MYTA 4JI3I 3LNUA 5IWAI 2HHHI 2VQEI 1Z0BA 3HULA 4USKA 1Z0TA 2VQFE 1Z0GA 4GKKE 4DUZE 1NHHA 4B3SI 1PIEA 4DXLA 1RREA 1Z5AA 2E1RA 4LF5I 3J81Q 4JI8E 2X7IA 4MYUA 4DR2I 1ZXMA 2CZ9A 4HACA 3WU3A 2R3VA 2V2ZA 3T1HE 4LF9E 3K1JA 4DR2E 4X65I 5FLXC 2UXCE 4M1KA 2X36A 4LF5E 1H73A 1WUUA 3JAMC 1ZM9A 5L3JA 2UUBE 2HK2A 1UEKA 1ELOA 4DV0I 2UU9I 4LF4I 1Z0WA 3OTOE 4DR5E 1NHIA 4DV1E 4LFBI 1Z0VA 2V2VA 1FJGE 5IT9C 3B78A 1N32I 4B3ME 3V5RA 3J7AM 4JV5E 4HY1A 1D6TA 4X64I 2V34A 4DV2I 1IBLI 1QZRA 1KIJA 2ZBKB 4FWHA 4WUBA 4DV6I 2VF3A 1IBKE 4LF6E 5LMUE 5LMNI 4R1FA 2R42A 2UXBE 1H74A 4DV2E 4YHHE 1Z5CA 1N0UA 3V2UC 5BR8E 1J5EE 3GONA 4DU7A 2V8PA 2HFSA 4X66I 1MU5A 4DR1I 3F0NA 4JI1I 3ZZ0A 1Z0EA 2UUCI 2UUAI 2UXBI 2OI2A 2ZM6I 4LFCI 4JI4E 2DEJA 1XNQI 5LMNE 4JYAE 4DPWA 4YHHI 4LF9I 1B62A 1BKNA 4FWDA 4DV6E 2HKEA 4DPTA 1HNZI 3CWVA 1HNZE 4Z7YA 3ZM7A 4DR3I 1XMOI 4LF6I 1NZ0A 2HKJA 1FNMA 2A2CA 4NXME 4WUCA 2F4VI 1RR9A 1H7SA 4DV5I 1FI4A 4KHPE 4Z7CA 1Z5BA 2HFUA 2UUCE 4YY3E 1XNRE 1N32E 4URLA 4JI1E 3M6AA 4OX9I 4HACB 4DPXA 4DV0E 2UU9E 1FJGI 1U2RA 4JI0E 3OTOI 4GKJE 1HR0E 4DV1I 3WU6A 4LFBE 1IBME 1N0VC 2NPFA
chains in the Genus database with same CATH superfamily
1S16A 2IOPA 3M85G 4X65E 1J5EI 4MU4A 2GS8A 2UXCI 4PRXA 2C37A 1KTVA 1USVA 4I3HA 4LF9E 1ZM3A 5JEAB 4P7AA 5C0XA 2LJPA 2Q2EB 4JI8I 4B3RI 3DD6A 2ZM6E 4B3RE 2HK3A 3M85D 4IZJD 4LFCE 4BA1A 4DPYA 3M7ND 1EA6A 2BA1G 4OO1D 3ZKDA 4IFDF 4DR1E 1HK7A 3Q6NA 3ZZTA 1H72C 3D4JA 1VISA 3PRYA 1XXEA 4DUZI 4DV7E 1R6LA 3H4LA 2WP8B 3PS1A 3J7AG 1S4EA 4OX9E 4X64E 2VQEE 2J7KA 4JI0I 4PU9A 2AJ4A 3J80C 4JI3E 1H7UA 2HHHE 3JAMQ 2BM0A 4DV4I 4HXZA 1XNRI 1FWKA 5C0XD 3K85A 4YY3I 3LTOA 2WNRA 4USMA 4FW7A 2PO2B 3WU4A 3GMEA 2F4VE 1OYRA 1HNXE 1OYSA 4OO1F 2UXDE 1N36I 1USUA 3M7NG 1FKAE 2PNZA 1IBKI 3K17A 3P3CA 5K36B 4WUDA 4FW6A 4QNJA 4UT4A 4K0KI 4JI7I 2ZITA 2CGEA 4JI4I 1Z59A 4FW9A 3T1HI 4JYAI 4IZJA 4B3TE 1XNQE 2IOQA 1KVKA 3P76A 4IFDA 2IERA 4JI5I 5C0XB 4UTGA 3ZKBA 1ZM2A 1ZM4A 4BA2B 4IFDE 2O1WA 4DR4E 3GCMA 2NN6D 4DV7I 3QT6A 1DARA 3HJCA 4JG4A 1NHJA 1N34I 5IWAE 4FW3A 4JI5E 4DV3E 2UUBI 1XMQE 2WP8A 4DU8A 1Y4UA 2Z5EA 2BM1A 4JI6E 3T1YI 2JEAB 5C0XE 5A2QC 2NN6A 4JI6I 1I94E 3CDJA 5K36C 1UDQA 3P3GA 2C39B 3LPSA 2NN6C 3L7ZB 4X62E 3PYEA 4AQYI 4U3DA 1FWLA 5LL6R 2NN6E 4DR2I 4GKJI 5GMEA 5JEAC 1IBMI 2XEXA 4DUYI 1N36E 2UXDI 2PO1B 3CDIA 1IBLE 2DEIA 2BV3A 2V2QA 4DR4I 2E5LI 4JV5I 1HNWI 2BR2B 2O3ZA 4P52A 4KHPI 2JE6B 4B3MI 3PYFA 1OYPA 4LCFA 4DV4E 4DV5E 4PRVA 4DR5I 4LF4E 4LF7E 1OJ4A 1XHKA 4DUYE 1MG7A 4JI7E 4JI2I 4IFDD 2PNMA 1HNWE 2WW4A 4BA1B 1MX0A 4NXMI 2E5LE 2O1TA 3Q1QA 4DR3E 5A2QQ 4DPUA 1N33E 1I94I 2A2DA 4AQYE 2BA1D 5FWKA 2C38A 5GMDA 4DR6E 4AM3A 3B8HA 4XTJA 1PVGA 4LF8E 4ED4A 3NZKA 4DR7E 4LF8I 4QNKA 3T1YE 3T1HE 4RPFA 4IFDC 5IT9Q 1UDNA 1P42A 3QT5A 4KQVA 1N33I 2JEAA 1YH8A 5C0XF 1N34E 2J65A 1HR0I 4DV3I 3QT7A 4GKKI 4ZVIA 2VQFI 3QT8A 4X66E 4B3SE 1XMQI 2C39A 3J81C 3U1YA 1A6FA 5BR8I 1ZXNA 4B3TI 4LFAE 3B82A 4NXNI 2Z5BB 4ISAA 4LCGA 4MU3A 5K36A 1B63A 3ZZUA 4MDTA 2EFGA 4MU1A 1Z0CA 2BR2A 4DR6I 1UDSA 4HYMA 3P06A 2JE6A 4DR7I 4OO1C 4K0KE 1PKPA 4FWGA 5LMUI 4OO1E 1HNXI 1K47A 1XMOE 2BA0G 4IS9A 4U3BA 4BA2A 4X62I 2AE8A 4OKGA 5FLXQ 3Q6MA 5EKWA 4FN5A 3PYDA 3WU5A 1Y5YA 4JI2E 4EMDA 2O1UA 3PYGA 4LF7I 3J80Q 4NXNE 1EI1A 5K36D 1KKHA 2UUAE 4LFAI 4MYTA 4JI3I 4AIDA 3LNUA 4MQYA 5DRPA 5IWAI 2HHHI 2VQEI 1Z0BA 3HULA 4USKA 3GLLA 2GO3A 2JT2A 1Z0TA 2VQFE 1Z0GA 2NN6F 4GKKE 5DNXA 4DUZE 1NHHA 3L7ZA 4B3SI 1PIEA 4N3OA 3U1KA 4DXLA 1RREA 2CVEA 1Z5AA 2E1RA 4LF5I 3J81Q 4JI8E 3PS3A 2X7IA 4MYUA 3P3EA 1ZXMA 2CZ9A 3H1CA 4FW4A 2R3VA 1Y6ZA 2V2ZA 4HACA 4NBQA 3WU3A 3K1JA 3UHMA 4DR2E 4X65I 5FLXC 2UXCE 4OZEA 2Z5BA 4M1KA 2X36A 4LF5E 1H73A 1WUUA 2JEBB 5JEAE 4IZKB 3JAMC 1ZM9A 5L3JA 2UUBE 1UEKA 1ELOA 4DV0I 2UU9I 2Z5CA 4AIMA 1UDOA 4LF4I 1Z0WA 5JEAA 1R6MA 3OTOE 4DR5E 1NHIA 4DV1E 4LFBI 1Z0VA 4FW5A 5ELWA 2CG9A 2V2VA 1FJGE 5IT9C 2PO0A 3B78A 1N32I 3B4TA 1Y4SA 4LPFA 2C38B 1E3PA 4B3ME 3KRNA 2PNLA 3V5RA 3J7AM 4JV5E 4HY1A 1Y60A 1D6TA 4X64I 2V34A 4DV2I 1IBLI 4LCHA 5JEAD 1QZRA 1KIJA 2ZBKB 4FWHA 1YHCA 4WUBA 4DV6I 2VF3A 5DROA 1IBKE 4LF6E 5LMUE 2F1DA 5LMNI 4R1FA 4OO1B 1RHYA 2O1VA 2BA0D 2R42A 5DNLA 1H74A 2UXBE 4MU0A 4GQUA 4DV2E 5JEAF 4YHHE 1Z5CA 5DRQA 1N0UA 3V2UC 5C0XC 5BR8E 1J5EE 3GONA 5DRRA 4DU7A 2V8PA 2HFSA 4X66I 2C37B 5EL9A 5K36F 1MU5A 4J3DA 4DR1I 3F0NA 4IZJB 4JI1I 2Z5CB 3ZZ0A 4IFDB 1Z0EA 2UUCI 2UUAI 2IESA 2UXBI 2OI2A 2ZM6I 4LFCI 4JI4E 2DEJA 1XNQI 5LMNE 3PS2A 4JYAE 4DPWA 4YHHI 2PO0B 4LF9I 1B62A 2VESA 1BKNA 1IBME 2GO4A 4FWDA 4DV6E 2HKEA 4DPTA 1HNZI 1E3HA 3CWVA 1HNZE 4Z7YA 3ZM7A 4DR3I 1XMOI 4LOMA 4LF6I 1VI7A 1NZ0A 2HKJA 1FNMA 2A2CA 4NXME 4WUCA 2F4VI 2NN6B 1RR9A 2WNRB 1H7SA 4DV5I 1FI4A 4KHPE 4OO1A 4Z7CA 1Z5BA 2HFUA 2PO2A 4YY3E 2UUCE 1XNRE 1N32E 4URLA 4JI1E 3M6AA 5K36E 4OX9I 4HACB 4DPXA 4DV0E 2UU9E 2PO1A 1FJGI 1U2RA 3HKMA 4JI0E 2PNZB 3OTOI 4GKJE 2GQ0A 1HR0E 4DV1I 3WU6A 4LFBE 2JEBA 4IZKA 2HK2A 1N0VC 2NPFA
chains in the Genus database with same CATH topology
1S16A 2IOPA 4X65E 1J5EI 2UXCI 2GS8A 4PRXA 1KTVA 1USVA 4I3HA 1ZM3A 4P7AA 2LJPA 2Q2EB 4JI8I 4B3RI 2ZM6E 4B3RE 2HK3A 4IZJD 4LFCE 4DPYA 1EA6A 3ZKDA 4DR1E 1HK7A 3Q6NA 3ZZTA 1H72C 3D4JA 1VISA 3PRYA 4DUZI 4DV7E 3H4LA 3J7AG 1S4EA 4OX9E 4X64E 2VQEE 2J7KA 4JI0I 4PU9A 2AJ4A 3J80C 4JI3E 1H7UA 2HHHE 3JAMQ 2BM0A 4DV4I 4HXZA 1XNRI 1FWKA 3K85A 4YY3I 3LTOA 4USMA 3WU4A 2F4VE 1HNXE 2UXDE 1N36I 1USUA 1FKAE 1IBKI 3K17A 4WUDA 4UT4A 4K0KI 4JI7I 2ZITA 2CGEA 4JI4I 1Z59A 4FW9A 3T1HI 4JYAI 4B3TE 4IZJA 1XNQE 2IOQA 1KVKA 4JI5I 4UTGA 3ZKBA 1ZM2A 1ZM4A 2O1WA 4DR4E 4DV7I 3QT6A 1DARA 3HJCA 4JG4A 1NHJA 1N34I 5IWAE 4JI5E 4DV3E 2UUBI 1XMQE 4DU8A 1Y4UA 2Z5EA 2BM1A 4JI6E 3T1YI 5A2QC 4JI6I 1I94E 3LPSA 4X62E 3PYEA 4AQYI 1FWLA 5LL6R 4GKJI 5GMEA 1IBMI 2XEXA 4DUYI 1N36E 2UXDI 1IBLE 2DEIA 2BV3A 2V2QA 4DR4I 2E5LI 4JV5I 1HNWI 4P52A 4KHPI 4B3MI 3PYFA 4DV4E 4DV5E 4PRVA 4DR5I 4LF4E 4LF7E 1OJ4A 1XHKA 4DUYE 1MG7A 4JI7E 4JI2I 2PNMA 1HNWE 2WW4A 1MX0A 4NXMI 2E5LE 2O1TA 3Q1QA 4DR3E 5A2QQ 4DPUA 1N33E 1I94I 2A2DA 4AQYE 5FWKA 5GMDA 4DR6E 3B8HA 4XTJA 1PVGA 4LF8E 4ED4A 4DR7E 4LF8I 3T1YE 4RPFA 5IT9Q 3QT5A 4KQVA 1N33I 1N34E 1HR0I 4DV3I 3QT7A 4GKKI 4ZVIA 2VQFI 3QT8A 4X66E 4B3SE 1XMQI 3J81C 1A6FA 5BR8I 1ZXNA 4B3TI 4LFAE 3B82A 4NXNI 2Z5BB 1B63A 3ZZUA 2EFGA 1Z0CA 4DR6I 4HYMA 3P06A 4DR7I 4K0KE 1PKPA 4FWGA 5LMUI 1HNXI 1K47A 1XMOE 4X62I 5FLXQ 3Q6MA 4FN5A 3PYDA 3WU5A 4JI2E 4EMDA 2O1UA 3PYGA 4LF7I 3J80Q 4NXNE 1EI1A 1KKHA 2UUAE 4LFAI 4MYTA 4JI3I 3LNUA 5IWAI 2HHHI 2VQEI 1Z0BA 3HULA 4USKA 1Z0TA 2VQFE 1Z0GA 4GKKE 4DUZE 1NHHA 4B3SI 1PIEA 4N3OA 4DXLA 1RREA 1Z5AA 2E1RA 4LF5I 3J81Q 4JI8E 2X7IA 4MYUA 4DR2I 1ZXMA 2CZ9A 4HACA 3WU3A 2R3VA 1Y6ZA 2V2ZA 3T1HE 4LF9E 3K1JA 4DR2E 4X65I 5FLXC 2UXCE 2Z5BA 4M1KA 2X36A 4LF5E 1H73A 1WUUA 4IZKB 3JAMC 1ZM9A 5L3JA 2UUBE 2HK2A 1UEKA 1ELOA 2UU9I 4DV0I 2Z5CA 4LF4I 1Z0WA 3OTOE 4DR5E 1NHIA 4DV1E 4LFBI 1Z0VA 2CG9A 2V2VA 1FJGE 5IT9C 3B78A 1N32I 1Y4SA 4B3ME 2PNLA 3V5RA 3J7AM 4JV5E 4HY1A 1D6TA 4X64I 2V34A 4DV2I 1IBLI 1QZRA 1KIJA 2ZBKB 4FWHA 4WUBA 4DV6I 2VF3A 1IBKE 4LF6E 5LMUE 5LMNI 4R1FA 2O1VA 2R42A 2UXBE 1H74A 4DV2E 4YHHE 1Z5CA 1N0UA 3V2UC 5BR8E 1J5EE 3GONA 4DU7A 2V8PA 2HFSA 4X66I 1MU5A 4DR1I 3F0NA 4IZJB 4JI1I 2Z5CB 3ZZ0A 1Z0EA 2UUCI 2UUAI 2UXBI 2OI2A 2ZM6I 4LFCI 4JI4E 2DEJA 1XNQI 5LMNE 4JYAE 4DPWA 4YHHI 4LF9I 1B62A 1BKNA 4FWDA 4DV6E 2HKEA 4DPTA 1HNZI 3CWVA 1HNZE 4Z7YA 3ZM7A 4DR3I 1XMOI 4LF6I 1NZ0A 2HKJA 1FNMA 2A2CA 4NXME 4WUCA 2F4VI 1RR9A 1H7SA 4DV5I 1FI4A 4KHPE 4Z7CA 1Z5BA 2HFUA 2UUCE 4YY3E 1XNRE 1N32E 4URLA 4JI1E 3M6AA 4OX9I 4HACB 4DPXA 4DV0E 2UU9E 1FJGI 1U2RA 4JI0E 3OTOI 4GKJE 2GQ0A 1HR0E 4DV1I 3WU6A 4LFBE 4IZKA 1IBME 1N0VC 2NPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S16 A;  4X65 E;  1J5E I;  2UXC I;  2GS8 A;  4PRX A;  1KTV A;  4I3H A;  1ZM3 A;  4P7A A;  2LJP A;  2Q2E B;  4JI8 I;  4B3R I;  2ZM6 E;  4B3R E;  2HK3 A;  4LFC E;  4DPY A;  1EA6 A;  3ZKD A;  4DR1 E;  3ZZT A;  1H72 C;  3D4J A;  1VIS A;  4DUZ I;  4DV7 E;  3H4L A;  3J7A G;  1S4E A;  4OX9 E;  4X64 E;  2VQE E;  2J7K A;  4JI0 I;  4PU9 A;  2AJ4 A;  3J80 C;  4JI3 E;  1H7U A;  2HHH E;  3JAM Q;  2BM0 A;  4DV4 I;  4HXZ A;  1XNR I;  1FWK A;  4YY3 I;  3LTO A;  4USM A;  3WU4 A;  2F4V E;  1HNX E;  2UXD E;  1N36 I;  1FKA E;  1IBK I;  3K17 A;  4WUD A;  4UT4 A;  4K0K I;  4JI7 I;  2ZIT A;  4JI4 I;  1Z59 A;  4FW9 A;  3T1H I;  4JYA I;  4B3T E;  1XNQ E;  1KVK A;  4JI5 I;  4UTG A;  3ZKB A;  1ZM2 A;  1ZM4 A;  4DR4 E;  4DV7 I;  3QT6 A;  1DAR A;  4JG4 A;  1NHJ A;  1N34 I;  5IWA E;  4JI5 E;  4DV3 E;  2UUB I;  1XMQ E;  4DU8 A;  2BM1 A;  4JI6 E;  3T1Y I;  5A2Q C;  4JI6 I;  1I94 E;  3LPS A;  4X62 E;  3PYE A;  4AQY I;  1FWL A;  5LL6 R;  4GKJ I;  5GME A;  1IBM I;  2XEX A;  4DUY I;  1N36 E;  2UXD I;  1IBL E;  2DEI A;  2BV3 A;  2V2Q A;  4DR4 I;  2E5L I;  4JV5 I;  1HNW I;  4P52 A;  4KHP I;  4B3M I;  3PYF A;  4DV4 E;  4DV5 E;  4PRV A;  4DR5 I;  4LF4 E;  4LF7 E;  1OJ4 A;  1XHK A;  4DUY E;  1MG7 A;  4JI7 E;  4JI2 I;  1HNW E;  2WW4 A;  1MX0 A;  4NXM I;  2E5L E;  3Q1Q A;  4DR3 E;  5A2Q Q;  4DPU A;  1N33 E;  1I94 I;  2A2D A;  4AQY E;  5GMD A;  4DR6 E;  3B8H A;  4XTJ A;  1PVG A;  4LF8 E;  4ED4 A;  4DR7 E;  4LF8 I;  3T1Y E;  4RPF A;  5IT9 Q;  3QT5 A;  4KQV A;  1N33 I;  1N34 E;  1HR0 I;  4DV3 I;  3QT7 A;  4GKK I;  4ZVI A;  2VQF I;  3QT8 A;  4X66 E;  4B3S E;  1XMQ I;  3J81 C;  1A6F A;  5BR8 I;  1ZXN A;  4B3T I;  4LFA E;  3B82 A;  4NXN I;  1B63 A;  3ZZU A;  2EFG A;  1Z0C A;  4DR6 I;  4HYM A;  4DR7 I;  4K0K E;  1PKP A;  4FWG A;  5LMU I;  1HNX I;  1K47 A;  1XMO E;  4X62 I;  5FLX Q;  4FN5 A;  3PYD A;  3WU5 A;  4JI2 E;  4EMD A;  3PYG A;  4LF7 I;  3J80 Q;  4NXN E;  1EI1 A;  1KKH A;  2UUA E;  4LFA I;  4MYT A;  4JI3 I;  3LNU A;  5IWA I;  2HHH I;  2VQE I;  1Z0B A;  3HUL A;  4USK A;  1Z0T A;  2VQF E;  1Z0G A;  4GKK E;  4DUZ E;  1NHH A;  4B3S I;  1PIE A;  4DXL A;  1RRE A;  1Z5A A;  2E1R A;  4LF5 I;  3J81 Q;  4JI8 E;  2X7I A;  4MYU A;  4DR2 I;  1ZXM A;  2CZ9 A;  4HAC A;  3WU3 A;  2R3V A;  2V2Z A;  3T1H E;  4LF9 E;  3K1J A;  4DR2 E;  4X65 I;  5FLX C;  2UXC E;  4M1K A;  2X36 A;  4LF5 E;  1H73 A;  1WUU A;  3JAM C;  1ZM9 A;  5L3J A;  2UUB E;  2HK2 A;  1UEK A;  1ELO A;  4DV0 I;  2UU9 I;  4LF4 I;  1Z0W A;  3OTO E;  4DR5 E;  1NHI A;  4DV1 E;  4LFB I;  1Z0V A;  2V2V A;  1FJG E;  5IT9 C;  3B78 A;  1N32 I;  4B3M E;  3V5R A;  3J7A M;  4JV5 E;  4HY1 A;  1D6T A;  4X64 I;  2V34 A;  4DV2 I;  1IBL I;  1QZR A;  1KIJ A;  2ZBK B;  4FWH A;  4WUB A;  4DV6 I;  2VF3 A;  1IBK E;  4LF6 E;  5LMU E;  5LMN I;  4R1F A;  2R42 A;  2UXB E;  1H74 A;  4DV2 E;  4YHH E;  1Z5C A;  1N0U A;  3V2U C;  5BR8 E;  1J5E E;  3GON A;  4DU7 A;  2V8P A;  2HFS A;  4X66 I;  1MU5 A;  4DR1 I;  3F0N A;  4JI1 I;  3ZZ0 A;  1Z0E A;  2UUC I;  2UUA I;  2UXB I;  2OI2 A;  2ZM6 I;  4LFC I;  4JI4 E;  2DEJ A;  1XNQ I;  5LMN E;  4JYA E;  4DPW A;  4YHH I;  4LF9 I;  1B62 A;  1BKN A;  4FWD A;  4DV6 E;  2HKE A;  4DPT A;  1HNZ I;  3CWV A;  1HNZ E;  4Z7Y A;  3ZM7 A;  4DR3 I;  1XMO I;  4LF6 I;  1NZ0 A;  2HKJ A;  1FNM A;  2A2C A;  4NXM E;  4WUC A;  2F4V I;  1RR9 A;  1H7S A;  4DV5 I;  1FI4 A;  4KHP E;  4Z7C A;  1Z5B A;  2HFU A;  2UUC E;  4YY3 E;  1XNR E;  1N32 E;  4URL A;  4JI1 E;  3M6A A;  4OX9 I;  4HAC B;  4DPX A;  4DV0 E;  2UU9 E;  1FJG I;  1U2R A;  4JI0 E;  3OTO I;  4GKJ E;  1HR0 E;  4DV1 I;  3WU6 A;  4LFB E;  1IBM E;  1N0V C;  2NPF A; 
#chains in the Genus database with same CATH topology
 1S16 A;  2IOP A;  3M85 G;  4X65 E;  1J5E I;  4MU4 A;  2GS8 A;  2UXC I;  4PRX A;  2C37 A;  1KTV A;  1USV A;  4I3H A;  4LF9 E;  1ZM3 A;  5JEA B;  4P7A A;  5C0X A;  2LJP A;  2Q2E B;  4JI8 I;  4B3R I;  3DD6 A;  2ZM6 E;  4B3R E;  2HK3 A;  3M85 D;  4IZJ D;  4LFC E;  4BA1 A;  4DPY A;  3M7N D;  1EA6 A;  2BA1 G;  4OO1 D;  3ZKD A;  4IFD F;  4DR1 E;  1HK7 A;  3Q6N A;  3ZZT A;  1H72 C;  3D4J A;  1VIS A;  3PRY A;  1XXE A;  4DUZ I;  4DV7 E;  1R6L A;  3H4L A;  2WP8 B;  3PS1 A;  3J7A G;  1S4E A;  4OX9 E;  4X64 E;  2VQE E;  2J7K A;  4JI0 I;  4PU9 A;  2AJ4 A;  3J80 C;  4JI3 E;  1H7U A;  2HHH E;  3JAM Q;  2BM0 A;  4DV4 I;  4HXZ A;  1XNR I;  1FWK A;  5C0X D;  3K85 A;  4YY3 I;  3LTO A;  2WNR A;  4USM A;  4FW7 A;  2PO2 B;  3WU4 A;  3GME A;  2F4V E;  1OYR A;  1HNX E;  1OYS A;  4OO1 F;  2UXD E;  1N36 I;  1USU A;  3M7N G;  1FKA E;  2PNZ A;  1IBK I;  3K17 A;  3P3C A;  5K36 B;  4WUD A;  4FW6 A;  4QNJ A;  4UT4 A;  4K0K I;  4JI7 I;  2ZIT A;  2CGE A;  4JI4 I;  1Z59 A;  4FW9 A;  3T1H I;  4JYA I;  4IZJ A;  4B3T E;  1XNQ E;  2IOQ A;  1KVK A;  3P76 A;  4IFD A;  2IER A;  4JI5 I;  5C0X B;  4UTG A;  3ZKB A;  1ZM2 A;  1ZM4 A;  4BA2 B;  4IFD E;  2O1W A;  4DR4 E;  3GCM A;  2NN6 D;  4DV7 I;  3QT6 A;  1DAR A;  3HJC A;  4JG4 A;  1NHJ A;  1N34 I;  5IWA E;  4FW3 A;  4JI5 E;  4DV3 E;  2UUB I;  1XMQ E;  2WP8 A;  4DU8 A;  1Y4U A;  2Z5E A;  2BM1 A;  4JI6 E;  3T1Y I;  2JEA B;  5C0X E;  5A2Q C;  2NN6 A;  4JI6 I;  1I94 E;  3CDJ A;  5K36 C;  1UDQ A;  3P3G A;  2C39 B;  3LPS A;  2NN6 C;  3L7Z B;  4X62 E;  3PYE A;  4AQY I;  4U3D A;  1FWL A;  5LL6 R;  2NN6 E;  4DR2 I;  4GKJ I;  5GME A;  5JEA C;  1IBM I;  2XEX A;  4DUY I;  1N36 E;  2UXD I;  2PO1 B;  3CDI A;  1IBL E;  2DEI A;  2BV3 A;  2V2Q A;  4DR4 I;  2E5L I;  4JV5 I;  1HNW I;  2BR2 B;  2O3Z A;  4P52 A;  4KHP I;  2JE6 B;  4B3M I;  3PYF A;  1OYP A;  4LCF A;  4DV4 E;  4DV5 E;  4PRV A;  4DR5 I;  4LF4 E;  4LF7 E;  1OJ4 A;  1XHK A;  4DUY E;  1MG7 A;  4JI7 E;  4JI2 I;  4IFD D;  2PNM A;  1HNW E;  2WW4 A;  4BA1 B;  1MX0 A;  4NXM I;  2E5L E;  2O1T A;  3Q1Q A;  4DR3 E;  5A2Q Q;  4DPU A;  1N33 E;  1I94 I;  2A2D A;  4AQY E;  2BA1 D;  5FWK A;  2C38 A;  5GMD A;  4DR6 E;  4AM3 A;  3B8H A;  4XTJ A;  1PVG A;  4LF8 E;  4ED4 A;  3NZK A;  4DR7 E;  4LF8 I;  4QNK A;  3T1Y E;  3T1H E;  4RPF A;  4IFD C;  5IT9 Q;  1UDN A;  1P42 A;  3QT5 A;  4KQV A;  1N33 I;  2JEA A;  1YH8 A;  5C0X F;  1N34 E;  2J65 A;  1HR0 I;  4DV3 I;  3QT7 A;  4GKK I;  4ZVI A;  2VQF I;  3QT8 A;  4X66 E;  4B3S E;  1XMQ I;  2C39 A;  3J81 C;  3U1Y A;  1A6F A;  5BR8 I;  1ZXN A;  4B3T I;  4LFA E;  3B82 A;  4NXN I;  2Z5B B;  4ISA A;  4LCG A;  4MU3 A;  5K36 A;  1B63 A;  3ZZU A;  4MDT A;  2EFG A;  4MU1 A;  1Z0C A;  2BR2 A;  4DR6 I;  1UDS A;  4HYM A;  3P06 A;  2JE6 A;  4DR7 I;  4OO1 C;  4K0K E;  1PKP A;  4FWG A;  5LMU I;  4OO1 E;  1HNX I;  1K47 A;  1XMO E;  2BA0 G;  4IS9 A;  4U3B A;  4BA2 A;  4X62 I;  2AE8 A;  4OKG A;  5FLX Q;  3Q6M A;  5EKW A;  4FN5 A;  3PYD A;  3WU5 A;  1Y5Y A;  4JI2 E;  4EMD A;  2O1U A;  3PYG A;  4LF7 I;  3J80 Q;  4NXN E;  1EI1 A;  5K36 D;  1KKH A;  2UUA E;  4LFA I;  4MYT A;  4JI3 I;  4AID A;  3LNU A;  4MQY A;  5DRP A;  5IWA I;  2HHH I;  2VQE I;  1Z0B A;  3HUL A;  4USK A;  3GLL A;  2GO3 A;  2JT2 A;  1Z0T A;  2VQF E;  1Z0G A;  2NN6 F;  4GKK E;  5DNX A;  4DUZ E;  1NHH A;  3L7Z A;  4B3S I;  1PIE A;  4N3O A;  3U1K A;  4DXL A;  1RRE A;  2CVE A;  1Z5A A;  2E1R A;  4LF5 I;  3J81 Q;  4JI8 E;  3PS3 A;  2X7I A;  4MYU A;  3P3E A;  1ZXM A;  2CZ9 A;  3H1C A;  4FW4 A;  2R3V A;  1Y6Z A;  2V2Z A;  4HAC A;  4NBQ A;  3WU3 A;  3K1J A;  3UHM A;  4DR2 E;  4X65 I;  5FLX C;  2UXC E;  4OZE A;  2Z5B A;  4M1K A;  2X36 A;  4LF5 E;  1H73 A;  1WUU A;  2JEB B;  5JEA E;  4IZK B;  3JAM C;  1ZM9 A;  5L3J A;  2UUB E;  1UEK A;  1ELO A;  4DV0 I;  2UU9 I;  2Z5C A;  4AIM A;  1UDO A;  4LF4 I;  1Z0W A;  5JEA A;  1R6M A;  3OTO E;  4DR5 E;  1NHI A;  4DV1 E;  4LFB I;  1Z0V A;  4FW5 A;  5ELW A;  2CG9 A;  2V2V A;  1FJG E;  5IT9 C;  2PO0 A;  3B78 A;  1N32 I;  3B4T A;  1Y4S A;  4LPF A;  2C38 B;  1E3P A;  4B3M E;  3KRN A;  2PNL A;  3V5R A;  3J7A M;  4JV5 E;  4HY1 A;  1Y60 A;  1D6T A;  4X64 I;  2V34 A;  4DV2 I;  1IBL I;  4LCH A;  5JEA D;  1QZR A;  1KIJ A;  2ZBK B;  4FWH A;  1YHC A;  4WUB A;  4DV6 I;  2VF3 A;  5DRO A;  1IBK E;  4LF6 E;  5LMU E;  2F1D A;  5LMN I;  4R1F A;  4OO1 B;  1RHY A;  2O1V A;  2BA0 D;  2R42 A;  5DNL A;  1H74 A;  2UXB E;  4MU0 A;  4GQU A;  4DV2 E;  5JEA F;  4YHH E;  1Z5C A;  5DRQ A;  1N0U A;  3V2U C;  5C0X C;  5BR8 E;  1J5E E;  3GON A;  5DRR A;  4DU7 A;  2V8P A;  2HFS A;  4X66 I;  2C37 B;  5EL9 A;  5K36 F;  1MU5 A;  4J3D A;  4DR1 I;  3F0N A;  4IZJ B;  4JI1 I;  2Z5C B;  3ZZ0 A;  4IFD B;  1Z0E A;  2UUC I;  2UUA I;  2IES A;  2UXB I;  2OI2 A;  2ZM6 I;  4LFC I;  4JI4 E;  2DEJ A;  1XNQ I;  5LMN E;  3PS2 A;  4JYA E;  4DPW A;  4YHH I;  2PO0 B;  4LF9 I;  1B62 A;  2VES A;  1BKN A;  1IBM E;  2GO4 A;  4FWD A;  4DV6 E;  2HKE A;  4DPT A;  1HNZ I;  1E3H A;  3CWV A;  1HNZ E;  4Z7Y A;  3ZM7 A;  4DR3 I;  1XMO I;  4LOM A;  4LF6 I;  1VI7 A;  1NZ0 A;  2HKJ A;  1FNM A;  2A2C A;  4NXM E;  4WUC A;  2F4V I;  2NN6 B;  1RR9 A;  2WNR B;  1H7S A;  4DV5 I;  1FI4 A;  4KHP E;  4OO1 A;  4Z7C A;  1Z5B A;  2HFU A;  2PO2 A;  4YY3 E;  2UUC E;  1XNR E;  1N32 E;  4URL A;  4JI1 E;  3M6A A;  5K36 E;  4OX9 I;  4HAC B;  4DPX A;  4DV0 E;  2UU9 E;  2PO1 A;  1FJG I;  1U2R A;  3HKM A;  4JI0 E;  2PNZ B;  3OTO I;  4GKJ E;  2GQ0 A;  1HR0 E;  4DV1 I;  3WU6 A;  4LFB E;  2JEB A;  4IZK A;  2HK2 A;  1N0V C;  2NPF A; 
#chains in the Genus database with same CATH homology
 1S16 A;  2IOP A;  4X65 E;  1J5E I;  2UXC I;  2GS8 A;  4PRX A;  1KTV A;  1USV A;  4I3H A;  1ZM3 A;  4P7A A;  2LJP A;  2Q2E B;  4JI8 I;  4B3R I;  2ZM6 E;  4B3R E;  2HK3 A;  4IZJ D;  4LFC E;  4DPY A;  1EA6 A;  3ZKD A;  4DR1 E;  1HK7 A;  3Q6N A;  3ZZT A;  1H72 C;  3D4J A;  1VIS A;  3PRY A;  4DUZ I;  4DV7 E;  3H4L A;  3J7A G;  1S4E A;  4OX9 E;  4X64 E;  2VQE E;  2J7K A;  4JI0 I;  4PU9 A;  2AJ4 A;  3J80 C;  4JI3 E;  1H7U A;  2HHH E;  3JAM Q;  2BM0 A;  4DV4 I;  4HXZ A;  1XNR I;  1FWK A;  3K85 A;  4YY3 I;  3LTO A;  4USM A;  3WU4 A;  2F4V E;  1HNX E;  2UXD E;  1N36 I;  1USU A;  1FKA E;  1IBK I;  3K17 A;  4WUD A;  4UT4 A;  4K0K I;  4JI7 I;  2ZIT A;  2CGE A;  4JI4 I;  1Z59 A;  4FW9 A;  3T1H I;  4JYA I;  4B3T E;  4IZJ A;  1XNQ E;  2IOQ A;  1KVK A;  4JI5 I;  4UTG A;  3ZKB A;  1ZM2 A;  1ZM4 A;  2O1W A;  4DR4 E;  4DV7 I;  3QT6 A;  1DAR A;  3HJC A;  4JG4 A;  1NHJ A;  1N34 I;  5IWA E;  4JI5 E;  4DV3 E;  2UUB I;  1XMQ E;  4DU8 A;  1Y4U A;  2Z5E A;  2BM1 A;  4JI6 E;  3T1Y I;  5A2Q C;  4JI6 I;  1I94 E;  3LPS A;  4X62 E;  3PYE A;  4AQY I;  1FWL A;  5LL6 R;  4GKJ I;  5GME A;  1IBM I;  2XEX A;  4DUY I;  1N36 E;  2UXD I;  1IBL E;  2DEI A;  2BV3 A;  2V2Q A;  4DR4 I;  2E5L I;  4JV5 I;  1HNW I;  4P52 A;  4KHP I;  4B3M I;  3PYF A;  4DV4 E;  4DV5 E;  4PRV A;  4DR5 I;  4LF4 E;  4LF7 E;  1OJ4 A;  1XHK A;  4DUY E;  1MG7 A;  4JI7 E;  4JI2 I;  2PNM A;  1HNW E;  2WW4 A;  1MX0 A;  4NXM I;  2E5L E;  2O1T A;  3Q1Q A;  4DR3 E;  5A2Q Q;  4DPU A;  1N33 E;  1I94 I;  2A2D A;  4AQY E;  5FWK A;  5GMD A;  4DR6 E;  3B8H A;  4XTJ A;  1PVG A;  4LF8 E;  4ED4 A;  4DR7 E;  4LF8 I;  3T1Y E;  4RPF A;  5IT9 Q;  3QT5 A;  4KQV A;  1N33 I;  1N34 E;  1HR0 I;  4DV3 I;  3QT7 A;  4GKK I;  4ZVI A;  2VQF I;  3QT8 A;  4X66 E;  4B3S E;  1XMQ I;  3J81 C;  1A6F A;  5BR8 I;  1ZXN A;  4B3T I;  4LFA E;  3B82 A;  4NXN I;  2Z5B B;  1B63 A;  3ZZU A;  2EFG A;  1Z0C A;  4DR6 I;  4HYM A;  3P06 A;  4DR7 I;  4K0K E;  1PKP A;  4FWG A;  5LMU I;  1HNX I;  1K47 A;  1XMO E;  4X62 I;  5FLX Q;  3Q6M A;  4FN5 A;  3PYD A;  3WU5 A;  4JI2 E;  4EMD A;  2O1U A;  3PYG A;  4LF7 I;  3J80 Q;  4NXN E;  1EI1 A;  1KKH A;  2UUA E;  4LFA I;  4MYT A;  4JI3 I;  3LNU A;  5IWA I;  2HHH I;  2VQE I;  1Z0B A;  3HUL A;  4USK A;  1Z0T A;  2VQF E;  1Z0G A;  4GKK E;  4DUZ E;  1NHH A;  4B3S I;  1PIE A;  4N3O A;  4DXL A;  1RRE A;  1Z5A A;  2E1R A;  4LF5 I;  3J81 Q;  4JI8 E;  2X7I A;  4MYU A;  4DR2 I;  1ZXM A;  2CZ9 A;  4HAC A;  3WU3 A;  2R3V A;  1Y6Z A;  2V2Z A;  3T1H E;  4LF9 E;  3K1J A;  4DR2 E;  4X65 I;  5FLX C;  2UXC E;  2Z5B A;  4M1K A;  2X36 A;  4LF5 E;  1H73 A;  1WUU A;  4IZK B;  3JAM C;  1ZM9 A;  5L3J A;  2UUB E;  2HK2 A;  1UEK A;  1ELO A;  2UU9 I;  4DV0 I;  2Z5C A;  4LF4 I;  1Z0W A;  3OTO E;  4DR5 E;  1NHI A;  4DV1 E;  4LFB I;  1Z0V A;  2CG9 A;  2V2V A;  1FJG E;  5IT9 C;  3B78 A;  1N32 I;  1Y4S A;  4B3M E;  2PNL A;  3V5R A;  3J7A M;  4JV5 E;  4HY1 A;  1D6T A;  4X64 I;  2V34 A;  4DV2 I;  1IBL I;  1QZR A;  1KIJ A;  2ZBK B;  4FWH A;  4WUB A;  4DV6 I;  2VF3 A;  1IBK E;  4LF6 E;  5LMU E;  5LMN I;  4R1F A;  2O1V A;  2R42 A;  2UXB E;  1H74 A;  4DV2 E;  4YHH E;  1Z5C A;  1N0U A;  3V2U C;  5BR8 E;  1J5E E;  3GON A;  4DU7 A;  2V8P A;  2HFS A;  4X66 I;  1MU5 A;  4DR1 I;  3F0N A;  4IZJ B;  4JI1 I;  2Z5C B;  3ZZ0 A;  1Z0E A;  2UUC I;  2UUA I;  2UXB I;  2OI2 A;  2ZM6 I;  4LFC I;  4JI4 E;  2DEJ A;  1XNQ I;  5LMN E;  4JYA E;  4DPW A;  4YHH I;  4LF9 I;  1B62 A;  1BKN A;  4FWD A;  4DV6 E;  2HKE A;  4DPT A;  1HNZ I;  3CWV A;  1HNZ E;  4Z7Y A;  3ZM7 A;  4DR3 I;  1XMO I;  4LF6 I;  1NZ0 A;  2HKJ A;  1FNM A;  2A2C A;  4NXM E;  4WUC A;  2F4V I;  1RR9 A;  1H7S A;  4DV5 I;  1FI4 A;  4KHP E;  4Z7C A;  1Z5B A;  2HFU A;  2UUC E;  4YY3 E;  1XNR E;  1N32 E;  4URL A;  4JI1 E;  3M6A A;  4OX9 I;  4HAC B;  4DPX A;  4DV0 E;  2UU9 E;  1FJG I;  1U2R A;  4JI0 E;  3OTO I;  4GKJ E;  2GQ0 A;  1HR0 E;  4DV1 I;  3WU6 A;  4LFB E;  4IZK A;  1IBM E;  1N0V C;  2NPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...