4B3TI

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3tI00
4DV4I 1EA6A 4PRVA 2E1RA 4LFAI 3ZKDA 4DR5I 4JI6I 1Z0BA 4HYMA 4X64E 4XTJA 2UU9E 2UXDE 1XNQE 4OX9I 4EMDA 1ZM2A 4JI0I 4LF8I 1DARA 1D6TA 1HNWI 3K1JA 4M1KA 2X36A 2HHHE 1I94E 3Q1QA 2UU9I 4X66I 3J7AM 1ZM4A 2LJPA 2A2CA 4B3RE 1FJGE 5FLXQ 4B3TI 1N33I 1I94I 1H7UA 1XMOE 1H73A 1Z0TA 1MX0A 4X62I 4JI4I 1NHIA 3PYFA 1Z0GA 4LF4E 4JYAE 2ZITA 1XNRI 3J81C 3CWVA 3H4LA 1XMOI 5IWAI 4LF7I 4DXLA 2BV3A 5LMUE 3B78A 5A2QQ 4DV6I 2VF3A 2Q2EB 1Z5CA 4LF4I 3ZZ0A 4LFBE 4B3MI 3PYEA 5BR8I 4GKKI 2E5LE 2HK3A 4DV1I 1PIEA 2UUAE 2UXBE 4Z7YA 4JI3I 2UUCI 1N34I 4KHPE 4FWDA 3WU6A 1VISA 4JI1E 1XMQE 1HNXI 2AJ4A 3JAMC 1MG7A 3QT6A 4DR4E 5GMEA 2V2VA 3QT8A 1N36I 4DV3E 3HULA 4LF6E 3V2UC 4LFCI 4X65I 1PKPA 1Z59A 1A6FA 4JI2E 1FKAE 4DUYI 4JG4A 4K0KI 2UXCI 2R3VA 4MYTA 3GONA 2NPFA 2UUBI 2OI2A 2ZBKB 1HR0I 3T1YE 3OTOE 4DV7I 1IBKE 3J7AG 4HACB 2F4VE 3ZKBA 4YY3I 4ZVIA 2ZM6I 1KIJA 4DUZE 4NXME 1FNMA 1FWKA 1N32E 4ED4A 3K17A 4UT4A 1ELOA 4X64I 4UTGA 2UXDI 1U2RA 2HK2A 3WU5A 1XNQI 4DR6E 5L3JA 4DPYA 3ZZUA 4PRXA 3J80C 2HHHI 1H74A 1PVGA 4DV5E 2XEXA 4DR7E 5GMDA 4DPUA 5LMNE 4B3RI 4LF9E 1FJGI 1H72C 4DV2E 4DR2E 1S4EA 4P7AA 1H7SA 3J80Q 1OJ4A 1IBME 1FWLA 4JYAI 1UEKA 3LTOA 4JV5E 3PYGA 1KVKA 1WUUA 1B63A 3J81Q 1S16A 4AQYE 2GS8A 4JI8E 5LMUI 3B8HA 4B3SE 2A2DA 4LFBI 1NHHA 1RR9A 4YHHE 1NZ0A 1IBLE 2E5LI 4GKJE 2UUAI 1N0VC 2UXBI 4JI5E 4FN5A 4AQYI 4FWGA 4P52A 4WUBA 1BKNA 1ZM9A 4KHPI 4JI1I 1J5EE 2HFSA 1XMQI 2VQFE 3B82A 4DV0E 4DR3E 4DV4E 2R42A 1QZRA 4YHHI 4GKJI 4LFAE 4DR4I 4DR5E 1B62A 3JAMQ 4JI6E 4DV3I 3QT7A 4I3HA 4LF6I 1Z0CA 4FW9A 4DU7A 4DV0I 4DR3I 4JI0E 4JI2I 4DPWA 4LF8E 3M6AA 2EFGA 1Z5AA 1HNWE 1XHKA 3T1YI 3OTOI 4JI7E 1FI4A 1IBKI 4X66E 3WU3A 2F4VI 2V34A 4Z7CA 4R1FA 4DUZI 4NXMI 5FLXC 1N0UA 3LNUA 1N32I 4B3TE 1K47A 4LF5E 1N33E 2CZ9A 4JI7I 3V5RA 4X62E 4JI4E 1ZM3A 4WUDA 2DEIA 4DR6I 5LL6R 3T1HE 1Z0WA 4PU9A 1XNRE 2X7IA 3LPSA 4LF5I 4DPXA 5A2QC 2HFUA 5IWAE 4LF7E 4DV5I 3F0NA 2DEJA 2V2QA 1HNZE 4DR7I 5LMNI 4DV6E 3D4JA 4LF9I 4B3ME 1Z0EA 2BM1A 5BR8E 1RREA 4DV2I 4DR2I 3T1HI 4GKKE 4DV1E 1ZXNA 4HY1A 3QT5A 4JI3E 2UUCE 1N34E 3ZM7A 2J7KA 1HNZI 1IBMI 4NXNE 1MU5A 4DPTA 4USKA 1KTVA 4RPFA 1Z5BA 1HNXE 4MYUA 3ZZTA 4JV5I 2VQEE 2HKJA 3PYDA 4KQVA 3WU4A 1N36E 4HACA 4JI8I 5IT9C 4DR1E 4HXZA 4B3SI 2WW4A 4NXNI 4USMA 2HKEA 4URLA 4X65E 4LFCE 2BM0A 1IBLI 4FWHA 4WUCA 4DUYE 1NHJA 1KKHA 4DU8A 4K0KE 2UXCE 1ZXMA 2VQEI 4JI5I 1Z0VA 2V2ZA 1EI1A 2UUBE 1HR0E 4DV7E 4DR1I 2V8PA 5IT9Q 4YY3E 1J5EI 4OX9E 2ZM6E 2VQFI
chains in the Genus database with same CATH superfamily
4DV4I 1EA6A 2O3ZA 4PRVA 2Z5BB 2E1RA 5DRPA 2JE6A 4LFAI 3ZKDA 4DR5I 4FW6A 2GO3A 4JI6I 1Z0BA 4HYMA 4X64E 4XTJA 2UU9E 2UXDE 1XNQE 4OX9I 1UDSA 4EMDA 1ZM2A 4JI0I 3H1CA 4LF8I 4AIMA 1DARA 2WNRA 1D6TA 1HNWI 3K1JA 4M1KA 2X36A 2O1UA 2HHHE 1I94E 3Q1QA 4IZKB 2Z5CA 2UU9I 4LCGA 4X66I 1XXEA 3J7AM 1ZM4A 4MU4A 2LJPA 2WP8B 4LCFA 2A2CA 1HK7A 4B3RE 2PO0A 1FJGE 5FLXQ 4B3TI 1N33I 2PNMA 1I94I 4BA1A 1H7UA 1XMOE 1H73A 5DNLA 1Z0TA 1MX0A 4X62I 4JI4I 3PRYA 1NHIA 4IFDE 2VESA 3PYFA 4N3OA 1Y5YA 1Z0GA 4LF4E 4JYAE 2ZITA 1XNRI 3J81C 2PNLA 3CWVA 2JEAB 3H4LA 3CDJA 2NN6C 2PNZB 1XMOI 4IFDA 5IWAI 4LF7I 4DXLA 2BV3A 5LMUE 3B78A 4IS9A 5A2QQ 1E3HA 4DV6I 3K85A 2VF3A 4LPFA 2Q2EB 1Z5CA 4LF4I 3ZZ0A 4LFBE 2JEBB 3PYEA 5BR8I 4B3MI 4GKKI 2E5LE 2HK3A 4DV1I 1PIEA 2UUAE 2CGEA 2UXBE 1OYSA 4OZEA 4Z7YA 2BR2A 2C37A 4JI3I 2UUCI 4MU1A 1N34I 2IOQA 3B4TA 5JEAB 4KHPE 5C0XC 4FWDA 3KRNA 3WU6A 4MU3A 4IFDF 1VISA 4JI1E 2IOPA 2IERA 3HKMA 1XMQE 1YH8A 5DNXA 4IZJB 1HNXI 2AJ4A 3JAMC 1MG7A 3QT6A 4DR4E 5GMEA 2V2VA 1USUA 3QT8A 5C0XB 4OO1B 5EKWA 1N36I 4DV3E 3HULA 4LF6E 3V2UC 3PS1A 4LFCI 4X65I 3P06A 1PKPA 1Z59A 1A6FA 4JI2E 1FKAE 5K36C 4DUYI 4JG4A 4K0KI 2UXCI 2R3VA 4MYTA 1Y6ZA 3GONA 2NPFA 2UUBI 2OI2A 2ZBKB 4IZKA 1HR0I 3T1YE 3OTOE 4DV7I 1IBKE 3J7AG 4HACB 2WP8A 1Y4UA 2F4VE 3ZKBA 4YY3I 4ZVIA 2ZM6I 1KIJA 5K36B 4DUZE 4NXME 4MQYA 1FNMA 1FWKA 1N32E 4ED4A 2CVEA 3K17A 4UT4A 2GQ0A 1Y60A 5DRQA 1ELOA 4X64I 4UTGA 2UXDI 1U2RA 2PO1A 2HK2A 3WU5A 1XNQI 1YHCA 2O1WA 5L3JA 4DR6E 5EL9A 4DPYA 2JEAA 1UDOA 3HJCA 3ZZUA 4PRXA 3DD6A 3J80C 2NN6E 4U3BA 1OYRA 2JE6B 3GCMA 2HHHI 1H74A 1PVGA 4DV5E 2XEXA 4DR7E 5GMDA 4DPUA 5LMNE 2JT2A 2JEBA 2NN6D 4B3RI 3PS3A 2NN6A 4LF9E 1FJGI 1H72C 4DV2E 4DR2E 1S4EA 4P7AA 1H7SA 4MU0A 5DROA 1VI7A 5JEAD 3J80Q 4LOMA 5C0XE 4OO1E 1OJ4A 2GO4A 1RHYA 1IBME 2O1VA 5JEAC 2C38B 4IZJD 4IZJA 1FWLA 4JYAI 5ELWA 1UEKA 4U3DA 2PO0B 4QNKA 3LTOA 5C0XD 4OO1D 2NN6F 4JV5E 3PYGA 5C0XA 1KVKA 1WUUA 1B63A 3J81Q 5FWKA 1S16A 4AQYE 2IESA 2GS8A 4JI8E 4BA1B 1UDQA 5LMUI 3B8HA 4OO1C 4B3SE 3NZKA 2A2DA 2Z5BA 4LFBI 5K36E 1NHHA 1RR9A 3UHMA 4YHHE 1NZ0A 1IBLE 2E5LI 4GKJE 2UUAI 1N0VC 2UXBI 4JI5E 4FN5A 4AQYI 3P3CA 4FWGA 4P52A 4WUBA 1BKNA 5C0XF 4OO1F 1ZM9A 4KHPI 4IFDB 1R6MA 5K36D 5K36A 4JI1I 1J5EE 2HFSA 1XMQI 2VQFE 3B82A 3U1YA 4DV0E 4DR3E 4DV4E 2R42A 1QZRA 4YHHI 4AIDA 4GKJI 4LFAE 4DR4I 2PO2B 4QNJA 4DR5E 1B62A 3JAMQ 4JI6E 2J65A 4DV3I 3QT7A 4I3HA 2BR2B 4J3DA 4LF6I 1Z0CA 3GMEA 1Y4SA 4FW9A 3P3EA 3GLLA 4DU7A 4DV0I 4DR3I 4JI0E 4JI2I 4DPWA 5K36F 2C39B 1E3PA 4LF8E 3M6AA 1UDNA 2EFGA 1Z5AA 1HNWE 3L7ZB 1XHKA 3P3GA 3T1YI 3OTOI 4JI7E 1FI4A 1IBKI 4X66E 3WU3A 2F4VI 2V34A 4Z7CA 4BA2B 4R1FA 4DUZI 2O1TA 4NXMI 5FLXC 3P76A 1N0UA 2CG9A 4FW3A 3LNUA 1N32I 4B3TE 2F1DA 2PNZA 1K47A 4LF5E 1N33E 4MDTA 2AE8A 2CZ9A 4JI7I 2BA1D 3PS2A 3V5RA 4X62E 1OYPA 4JI4E 2C38A 1ZM3A 5JEAE 4WUDA 2DEIA 4DR6I 3Q6NA 5LL6R 3M7ND 2BA0D 3T1HE 2BA1G 1Z0WA 4PU9A 5DRRA 1XNRE 4AM3A 2X7IA 3LPSA 4FW5A 4LF5I 2WNRB 4DPXA 5JEAA 5A2QC 2HFUA 3M7NG 2BA0G 5IWAE 4LF7E 4DV5I 3F0NA 2DEJA 2V2QA 1HNZE 2Z5CB 4DR7I 5LMNI 4DV6E 2PO1B 1P42A 4LCHA 4FW4A 3D4JA 4LF9I 1Z0EA 2BM1A 5BR8E 4B3ME 1RREA 4DV2I 4DR2I 3T1HI 4GKKE 4NBQA 4DV1E 1ZXNA 4HY1A 3QT5A 4OO1A 4IFDD 4JI3E 2UUCE 3Q6MA 1N34E 3ZM7A 2J7KA 1HNZI 5JEAF 1IBMI 4FW7A 4NXNE 4IFDC 1MU5A 4DPTA 4USKA 1KTVA 2PO2A 2NN6B 4RPFA 1Z5BA 1HNXE 4MYUA 3ZZTA 4JV5I 2VQEE 2HKJA 4OKGA 3PYDA 4KQVA 3WU4A 1N36E 4HACA 4JI8I 5IT9C 3M85D 3CDIA 1USVA 4DR1E 4HXZA 4B3SI 2WW4A 4NXNI 3U1KA 2HKEA 4USMA 4URLA 4X65E 4LFCE 2C39A 2BM0A 3M85G 1IBLI 3L7ZA 4FWHA 4WUCA 4DUYE 1NHJA 1KKHA 4DU8A 4K0KE 2UXCE 1ZXMA 2VQEI 4JI5I 1Z0VA 2V2ZA 1EI1A 4GQUA 2UUBE 2Z5EA 1HR0E 2C37B 4DV7E 4ISAA 1R6LA 4DR1I 2V8PA 4BA2A 5IT9Q 4YY3E 1J5EI 4OX9E 2ZM6E 2VQFI
chains in the Genus database with same CATH topology
4DV4I 1EA6A 4PRVA 2Z5BB 2E1RA 4LFAI 3ZKDA 4DR5I 4JI6I 1Z0BA 4HYMA 4X64E 4XTJA 2UU9E 2UXDE 1XNQE 4OX9I 4EMDA 1ZM2A 4JI0I 4LF8I 1DARA 1D6TA 1HNWI 3K1JA 4M1KA 2X36A 2O1UA 2HHHE 1I94E 3Q1QA 4IZKB 2Z5CA 2UU9I 4X66I 3J7AM 1ZM4A 2LJPA 2A2CA 1HK7A 4B3RE 1FJGE 5FLXQ 4B3TI 1N33I 2PNMA 1I94I 1H7UA 1XMOE 1H73A 1Z0TA 1MX0A 4X62I 4JI4I 3PRYA 1NHIA 3PYFA 4N3OA 1Z0GA 4LF4E 4JYAE 2ZITA 1XNRI 3J81C 2PNLA 3CWVA 3H4LA 1XMOI 5IWAI 4LF7I 4DXLA 2BV3A 5LMUE 3B78A 5A2QQ 4DV6I 3K85A 2VF3A 2Q2EB 1Z5CA 4LF4I 3ZZ0A 4LFBE 4B3MI 3PYEA 5BR8I 4GKKI 2E5LE 2HK3A 4DV1I 1PIEA 2UUAE 2CGEA 2UXBE 4Z7YA 4JI3I 2UUCI 1N34I 2IOQA 4KHPE 4FWDA 3WU6A 1VISA 4JI1E 2IOPA 1XMQE 4IZJB 1HNXI 2AJ4A 3JAMC 1MG7A 3QT6A 4DR4E 5GMEA 2V2VA 1USUA 3QT8A 1N36I 4DV3E 3HULA 4LF6E 3V2UC 4LFCI 4X65I 3P06A 1PKPA 1Z59A 1A6FA 4JI2E 1FKAE 4DUYI 4JG4A 4K0KI 2UXCI 2R3VA 4MYTA 1Y6ZA 3GONA 2NPFA 2UUBI 2OI2A 2ZBKB 4IZKA 1HR0I 3T1YE 3OTOE 4DV7I 1IBKE 3J7AG 4HACB 1Y4UA 2F4VE 3ZKBA 4YY3I 4ZVIA 2ZM6I 1KIJA 4DUZE 4NXME 1FNMA 1FWKA 1N32E 4ED4A 3K17A 4UT4A 2GQ0A 1ELOA 4X64I 4UTGA 2UXDI 1U2RA 2HK2A 3WU5A 1XNQI 2O1WA 5L3JA 4DR6E 4DPYA 3HJCA 3ZZUA 4PRXA 3J80C 2HHHI 1H74A 1PVGA 4DV5E 2XEXA 4DR7E 5GMDA 4DPUA 5LMNE 4B3RI 4LF9E 1FJGI 1H72C 4DV2E 4DR2E 1S4EA 4P7AA 1H7SA 3J80Q 1OJ4A 1IBME 2O1VA 4IZJD 4IZJA 1FWLA 4JYAI 1UEKA 3LTOA 4JV5E 3PYGA 1KVKA 1WUUA 1B63A 3J81Q 5FWKA 1S16A 4AQYE 2GS8A 4JI8E 5LMUI 3B8HA 4B3SE 2A2DA 2Z5BA 4LFBI 1NHHA 1RR9A 4YHHE 1NZ0A 1IBLE 2E5LI 4GKJE 2UUAI 1N0VC 2UXBI 4JI5E 4FN5A 4AQYI 4FWGA 4P52A 4WUBA 1BKNA 1ZM9A 4KHPI 4JI1I 1J5EE 2HFSA 1XMQI 2VQFE 3B82A 4DV0E 4DR3E 4DV4E 2R42A 1QZRA 4YHHI 4GKJI 4LFAE 4DR4I 4DR5E 1B62A 3JAMQ 4JI6E 4DV3I 3QT7A 4I3HA 4LF6I 1Z0CA 1Y4SA 4FW9A 4DU7A 4DV0I 4DR3I 4JI0E 4JI2I 4DPWA 4LF8E 3M6AA 2EFGA 1Z5AA 1HNWE 1XHKA 3T1YI 3OTOI 4JI7E 1FI4A 1IBKI 4X66E 3WU3A 2F4VI 2V34A 4Z7CA 4R1FA 4DUZI 2O1TA 4NXMI 5FLXC 1N0UA 2CG9A 3LNUA 1N32I 4B3TE 1K47A 4LF5E 1N33E 2CZ9A 4JI7I 3V5RA 4X62E 4JI4E 1ZM3A 4WUDA 2DEIA 4DR6I 3Q6NA 5LL6R 3T1HE 1Z0WA 4PU9A 1XNRE 2X7IA 3LPSA 4LF5I 4DPXA 5A2QC 2HFUA 5IWAE 4LF7E 4DV5I 3F0NA 2DEJA 2V2QA 1HNZE 2Z5CB 4DR7I 5LMNI 4DV6E 3D4JA 4LF9I 1Z0EA 2BM1A 5BR8E 4B3ME 1RREA 4DV2I 4DR2I 3T1HI 4GKKE 4DV1E 1ZXNA 4HY1A 3QT5A 4JI3E 2UUCE 3Q6MA 1N34E 3ZM7A 2J7KA 1HNZI 1IBMI 4NXNE 1MU5A 4DPTA 4USKA 1KTVA 4RPFA 1Z5BA 1HNXE 4MYUA 3ZZTA 4JV5I 2VQEE 2HKJA 3PYDA 4KQVA 3WU4A 1N36E 4HACA 4JI8I 5IT9C 1USVA 4DR1E 4HXZA 4B3SI 2WW4A 4NXNI 4USMA 2HKEA 4URLA 4X65E 4LFCE 2BM0A 1IBLI 4FWHA 4WUCA 4DUYE 1NHJA 1KKHA 4DU8A 4K0KE 2UXCE 1ZXMA 2VQEI 4JI5I 1Z0VA 2V2ZA 1EI1A 2UUBE 2Z5EA 1HR0E 4DV7E 4DR1I 2V8PA 5IT9Q 4YY3E 1J5EI 4OX9E 2ZM6E 2VQFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 I;  1EA6 A;  4PRV A;  2E1R A;  4LFA I;  3ZKD A;  4DR5 I;  4JI6 I;  1Z0B A;  4HYM A;  4X64 E;  4XTJ A;  2UU9 E;  2UXD E;  1XNQ E;  4OX9 I;  4EMD A;  1ZM2 A;  4JI0 I;  4LF8 I;  1DAR A;  1D6T A;  1HNW I;  3K1J A;  4M1K A;  2X36 A;  2HHH E;  1I94 E;  3Q1Q A;  2UU9 I;  4X66 I;  3J7A M;  1ZM4 A;  2LJP A;  2A2C A;  4B3R E;  1FJG E;  5FLX Q;  4B3T I;  1N33 I;  1I94 I;  1H7U A;  1XMO E;  1H73 A;  1Z0T A;  1MX0 A;  4X62 I;  4JI4 I;  1NHI A;  3PYF A;  1Z0G A;  4LF4 E;  4JYA E;  2ZIT A;  1XNR I;  3J81 C;  3CWV A;  3H4L A;  1XMO I;  5IWA I;  4LF7 I;  4DXL A;  2BV3 A;  5LMU E;  3B78 A;  5A2Q Q;  4DV6 I;  2VF3 A;  2Q2E B;  1Z5C A;  4LF4 I;  3ZZ0 A;  4LFB E;  4B3M I;  3PYE A;  5BR8 I;  4GKK I;  2E5L E;  2HK3 A;  4DV1 I;  1PIE A;  2UUA E;  2UXB E;  4Z7Y A;  4JI3 I;  2UUC I;  1N34 I;  4KHP E;  4FWD A;  3WU6 A;  1VIS A;  4JI1 E;  1XMQ E;  1HNX I;  2AJ4 A;  3JAM C;  1MG7 A;  3QT6 A;  4DR4 E;  5GME A;  2V2V A;  3QT8 A;  1N36 I;  4DV3 E;  3HUL A;  4LF6 E;  3V2U C;  4LFC I;  4X65 I;  1PKP A;  1Z59 A;  1A6F A;  4JI2 E;  1FKA E;  4DUY I;  4JG4 A;  4K0K I;  2UXC I;  2R3V A;  4MYT A;  3GON A;  2NPF A;  2UUB I;  2OI2 A;  2ZBK B;  1HR0 I;  3T1Y E;  3OTO E;  4DV7 I;  1IBK E;  3J7A G;  4HAC B;  2F4V E;  3ZKB A;  4YY3 I;  4ZVI A;  2ZM6 I;  1KIJ A;  4DUZ E;  4NXM E;  1FNM A;  1FWK A;  1N32 E;  4ED4 A;  3K17 A;  4UT4 A;  1ELO A;  4X64 I;  4UTG A;  2UXD I;  1U2R A;  2HK2 A;  3WU5 A;  1XNQ I;  4DR6 E;  5L3J A;  4DPY A;  3ZZU A;  4PRX A;  3J80 C;  2HHH I;  1H74 A;  1PVG A;  4DV5 E;  2XEX A;  4DR7 E;  5GMD A;  4DPU A;  5LMN E;  4B3R I;  4LF9 E;  1FJG I;  1H72 C;  4DV2 E;  4DR2 E;  1S4E A;  4P7A A;  1H7S A;  3J80 Q;  1OJ4 A;  1IBM E;  1FWL A;  4JYA I;  1UEK A;  3LTO A;  4JV5 E;  3PYG A;  1KVK A;  1WUU A;  1B63 A;  3J81 Q;  1S16 A;  4AQY E;  2GS8 A;  4JI8 E;  5LMU I;  3B8H A;  4B3S E;  2A2D A;  4LFB I;  1NHH A;  1RR9 A;  4YHH E;  1NZ0 A;  1IBL E;  2E5L I;  4GKJ E;  2UUA I;  1N0V C;  2UXB I;  4JI5 E;  4FN5 A;  4AQY I;  4FWG A;  4P52 A;  4WUB A;  1BKN A;  1ZM9 A;  4KHP I;  4JI1 I;  1J5E E;  2HFS A;  1XMQ I;  2VQF E;  3B82 A;  4DV0 E;  4DR3 E;  4DV4 E;  2R42 A;  1QZR A;  4YHH I;  4GKJ I;  4LFA E;  4DR4 I;  4DR5 E;  1B62 A;  3JAM Q;  4JI6 E;  4DV3 I;  3QT7 A;  4I3H A;  4LF6 I;  1Z0C A;  4FW9 A;  4DU7 A;  4DV0 I;  4DR3 I;  4JI0 E;  4JI2 I;  4DPW A;  4LF8 E;  3M6A A;  2EFG A;  1Z5A A;  1HNW E;  1XHK A;  3T1Y I;  3OTO I;  4JI7 E;  1FI4 A;  1IBK I;  4X66 E;  3WU3 A;  2F4V I;  2V34 A;  4Z7C A;  4R1F A;  4DUZ I;  4NXM I;  5FLX C;  1N0U A;  3LNU A;  1N32 I;  4B3T E;  1K47 A;  4LF5 E;  1N33 E;  2CZ9 A;  4JI7 I;  3V5R A;  4X62 E;  4JI4 E;  1ZM3 A;  4WUD A;  2DEI A;  4DR6 I;  5LL6 R;  3T1H E;  1Z0W A;  4PU9 A;  1XNR E;  2X7I A;  3LPS A;  4LF5 I;  4DPX A;  5A2Q C;  2HFU A;  5IWA E;  4LF7 E;  4DV5 I;  3F0N A;  2DEJ A;  2V2Q A;  1HNZ E;  4DR7 I;  5LMN I;  4DV6 E;  3D4J A;  4LF9 I;  4B3M E;  1Z0E A;  2BM1 A;  5BR8 E;  1RRE A;  4DV2 I;  4DR2 I;  3T1H I;  4GKK E;  4DV1 E;  1ZXN A;  4HY1 A;  3QT5 A;  4JI3 E;  2UUC E;  1N34 E;  3ZM7 A;  2J7K A;  1HNZ I;  1IBM I;  4NXN E;  1MU5 A;  4DPT A;  4USK A;  1KTV A;  4RPF A;  1Z5B A;  1HNX E;  4MYU A;  3ZZT A;  4JV5 I;  2VQE E;  2HKJ A;  3PYD A;  4KQV A;  3WU4 A;  1N36 E;  4HAC A;  4JI8 I;  5IT9 C;  4DR1 E;  4HXZ A;  4B3S I;  2WW4 A;  4NXN I;  4USM A;  2HKE A;  4URL A;  4X65 E;  4LFC E;  2BM0 A;  1IBL I;  4FWH A;  4WUC A;  4DUY E;  1NHJ A;  1KKH A;  4DU8 A;  4K0K E;  2UXC E;  1ZXM A;  2VQE I;  4JI5 I;  1Z0V A;  2V2Z A;  1EI1 A;  2UUB E;  1HR0 E;  4DV7 E;  4DR1 I;  2V8P A;  5IT9 Q;  4YY3 E;  1J5E I;  4OX9 E;  2ZM6 E;  2VQF I; 
#chains in the Genus database with same CATH topology
 4DV4 I;  1EA6 A;  2O3Z A;  4PRV A;  2Z5B B;  2E1R A;  5DRP A;  2JE6 A;  4LFA I;  3ZKD A;  4DR5 I;  4FW6 A;  2GO3 A;  4JI6 I;  1Z0B A;  4HYM A;  4X64 E;  4XTJ A;  2UU9 E;  2UXD E;  1XNQ E;  4OX9 I;  1UDS A;  4EMD A;  1ZM2 A;  4JI0 I;  3H1C A;  4LF8 I;  4AIM A;  1DAR A;  2WNR A;  1D6T A;  1HNW I;  3K1J A;  4M1K A;  2X36 A;  2O1U A;  2HHH E;  1I94 E;  3Q1Q A;  4IZK B;  2Z5C A;  2UU9 I;  4LCG A;  4X66 I;  1XXE A;  3J7A M;  1ZM4 A;  4MU4 A;  2LJP A;  2WP8 B;  4LCF A;  2A2C A;  1HK7 A;  4B3R E;  2PO0 A;  1FJG E;  5FLX Q;  4B3T I;  1N33 I;  2PNM A;  1I94 I;  4BA1 A;  1H7U A;  1XMO E;  1H73 A;  5DNL A;  1Z0T A;  1MX0 A;  4X62 I;  4JI4 I;  3PRY A;  1NHI A;  4IFD E;  2VES A;  3PYF A;  4N3O A;  1Y5Y A;  1Z0G A;  4LF4 E;  4JYA E;  2ZIT A;  1XNR I;  3J81 C;  2PNL A;  3CWV A;  2JEA B;  3H4L A;  3CDJ A;  2NN6 C;  2PNZ B;  1XMO I;  4IFD A;  5IWA I;  4LF7 I;  4DXL A;  2BV3 A;  5LMU E;  3B78 A;  4IS9 A;  5A2Q Q;  1E3H A;  4DV6 I;  3K85 A;  2VF3 A;  4LPF A;  2Q2E B;  1Z5C A;  4LF4 I;  3ZZ0 A;  4LFB E;  2JEB B;  3PYE A;  5BR8 I;  4B3M I;  4GKK I;  2E5L E;  2HK3 A;  4DV1 I;  1PIE A;  2UUA E;  2CGE A;  2UXB E;  1OYS A;  4OZE A;  4Z7Y A;  2BR2 A;  2C37 A;  4JI3 I;  2UUC I;  4MU1 A;  1N34 I;  2IOQ A;  3B4T A;  5JEA B;  4KHP E;  5C0X C;  4FWD A;  3KRN A;  3WU6 A;  4MU3 A;  4IFD F;  1VIS A;  4JI1 E;  2IOP A;  2IER A;  3HKM A;  1XMQ E;  1YH8 A;  5DNX A;  4IZJ B;  1HNX I;  2AJ4 A;  3JAM C;  1MG7 A;  3QT6 A;  4DR4 E;  5GME A;  2V2V A;  1USU A;  3QT8 A;  5C0X B;  4OO1 B;  5EKW A;  1N36 I;  4DV3 E;  3HUL A;  4LF6 E;  3V2U C;  3PS1 A;  4LFC I;  4X65 I;  3P06 A;  1PKP A;  1Z59 A;  1A6F A;  4JI2 E;  1FKA E;  5K36 C;  4DUY I;  4JG4 A;  4K0K I;  2UXC I;  2R3V A;  4MYT A;  1Y6Z A;  3GON A;  2NPF A;  2UUB I;  2OI2 A;  2ZBK B;  4IZK A;  1HR0 I;  3T1Y E;  3OTO E;  4DV7 I;  1IBK E;  3J7A G;  4HAC B;  2WP8 A;  1Y4U A;  2F4V E;  3ZKB A;  4YY3 I;  4ZVI A;  2ZM6 I;  1KIJ A;  5K36 B;  4DUZ E;  4NXM E;  4MQY A;  1FNM A;  1FWK A;  1N32 E;  4ED4 A;  2CVE A;  3K17 A;  4UT4 A;  2GQ0 A;  1Y60 A;  5DRQ A;  1ELO A;  4X64 I;  4UTG A;  2UXD I;  1U2R A;  2PO1 A;  2HK2 A;  3WU5 A;  1XNQ I;  1YHC A;  2O1W A;  5L3J A;  4DR6 E;  5EL9 A;  4DPY A;  2JEA A;  1UDO A;  3HJC A;  3ZZU A;  4PRX A;  3DD6 A;  3J80 C;  2NN6 E;  4U3B A;  1OYR A;  2JE6 B;  3GCM A;  2HHH I;  1H74 A;  1PVG A;  4DV5 E;  2XEX A;  4DR7 E;  5GMD A;  4DPU A;  5LMN E;  2JT2 A;  2JEB A;  2NN6 D;  4B3R I;  3PS3 A;  2NN6 A;  4LF9 E;  1FJG I;  1H72 C;  4DV2 E;  4DR2 E;  1S4E A;  4P7A A;  1H7S A;  4MU0 A;  5DRO A;  1VI7 A;  5JEA D;  3J80 Q;  4LOM A;  5C0X E;  4OO1 E;  1OJ4 A;  2GO4 A;  1RHY A;  1IBM E;  2O1V A;  5JEA C;  2C38 B;  4IZJ D;  4IZJ A;  1FWL A;  4JYA I;  5ELW A;  1UEK A;  4U3D A;  2PO0 B;  4QNK A;  3LTO A;  5C0X D;  4OO1 D;  2NN6 F;  4JV5 E;  3PYG A;  5C0X A;  1KVK A;  1WUU A;  1B63 A;  3J81 Q;  5FWK A;  1S16 A;  4AQY E;  2IES A;  2GS8 A;  4JI8 E;  4BA1 B;  1UDQ A;  5LMU I;  3B8H A;  4OO1 C;  4B3S E;  3NZK A;  2A2D A;  2Z5B A;  4LFB I;  5K36 E;  1NHH A;  1RR9 A;  3UHM A;  4YHH E;  1NZ0 A;  1IBL E;  2E5L I;  4GKJ E;  2UUA I;  1N0V C;  2UXB I;  4JI5 E;  4FN5 A;  4AQY I;  3P3C A;  4FWG A;  4P52 A;  4WUB A;  1BKN A;  5C0X F;  4OO1 F;  1ZM9 A;  4KHP I;  4IFD B;  1R6M A;  5K36 D;  5K36 A;  4JI1 I;  1J5E E;  2HFS A;  1XMQ I;  2VQF E;  3B82 A;  3U1Y A;  4DV0 E;  4DR3 E;  4DV4 E;  2R42 A;  1QZR A;  4YHH I;  4AID A;  4GKJ I;  4LFA E;  4DR4 I;  2PO2 B;  4QNJ A;  4DR5 E;  1B62 A;  3JAM Q;  4JI6 E;  2J65 A;  4DV3 I;  3QT7 A;  4I3H A;  2BR2 B;  4J3D A;  4LF6 I;  1Z0C A;  3GME A;  1Y4S A;  4FW9 A;  3P3E A;  3GLL A;  4DU7 A;  4DV0 I;  4DR3 I;  4JI0 E;  4JI2 I;  4DPW A;  5K36 F;  2C39 B;  1E3P A;  4LF8 E;  3M6A A;  1UDN A;  2EFG A;  1Z5A A;  1HNW E;  3L7Z B;  1XHK A;  3P3G A;  3T1Y I;  3OTO I;  4JI7 E;  1FI4 A;  1IBK I;  4X66 E;  3WU3 A;  2F4V I;  2V34 A;  4Z7C A;  4BA2 B;  4R1F A;  4DUZ I;  2O1T A;  4NXM I;  5FLX C;  3P76 A;  1N0U A;  2CG9 A;  4FW3 A;  3LNU A;  1N32 I;  4B3T E;  2F1D A;  2PNZ A;  1K47 A;  4LF5 E;  1N33 E;  4MDT A;  2AE8 A;  2CZ9 A;  4JI7 I;  2BA1 D;  3PS2 A;  3V5R A;  4X62 E;  1OYP A;  4JI4 E;  2C38 A;  1ZM3 A;  5JEA E;  4WUD A;  2DEI A;  4DR6 I;  3Q6N A;  5LL6 R;  3M7N D;  2BA0 D;  3T1H E;  2BA1 G;  1Z0W A;  4PU9 A;  5DRR A;  1XNR E;  4AM3 A;  2X7I A;  3LPS A;  4FW5 A;  4LF5 I;  2WNR B;  4DPX A;  5JEA A;  5A2Q C;  2HFU A;  3M7N G;  2BA0 G;  5IWA E;  4LF7 E;  4DV5 I;  3F0N A;  2DEJ A;  2V2Q A;  1HNZ E;  2Z5C B;  4DR7 I;  5LMN I;  4DV6 E;  2PO1 B;  1P42 A;  4LCH A;  4FW4 A;  3D4J A;  4LF9 I;  1Z0E A;  2BM1 A;  5BR8 E;  4B3M E;  1RRE A;  4DV2 I;  4DR2 I;  3T1H I;  4GKK E;  4NBQ A;  4DV1 E;  1ZXN A;  4HY1 A;  3QT5 A;  4OO1 A;  4IFD D;  4JI3 E;  2UUC E;  3Q6M A;  1N34 E;  3ZM7 A;  2J7K A;  1HNZ I;  5JEA F;  1IBM I;  4FW7 A;  4NXN E;  4IFD C;  1MU5 A;  4DPT A;  4USK A;  1KTV A;  2PO2 A;  2NN6 B;  4RPF A;  1Z5B A;  1HNX E;  4MYU A;  3ZZT A;  4JV5 I;  2VQE E;  2HKJ A;  4OKG A;  3PYD A;  4KQV A;  3WU4 A;  1N36 E;  4HAC A;  4JI8 I;  5IT9 C;  3M85 D;  3CDI A;  1USV A;  4DR1 E;  4HXZ A;  4B3S I;  2WW4 A;  4NXN I;  3U1K A;  2HKE A;  4USM A;  4URL A;  4X65 E;  4LFC E;  2C39 A;  2BM0 A;  3M85 G;  1IBL I;  3L7Z A;  4FWH A;  4WUC A;  4DUY E;  1NHJ A;  1KKH A;  4DU8 A;  4K0K E;  2UXC E;  1ZXM A;  2VQE I;  4JI5 I;  1Z0V A;  2V2Z A;  1EI1 A;  4GQU A;  2UUB E;  2Z5E A;  1HR0 E;  2C37 B;  4DV7 E;  4ISA A;  1R6L A;  4DR1 I;  2V8P A;  4BA2 A;  5IT9 Q;  4YY3 E;  1J5E I;  4OX9 E;  2ZM6 E;  2VQF I; 
#chains in the Genus database with same CATH homology
 4DV4 I;  1EA6 A;  4PRV A;  2Z5B B;  2E1R A;  4LFA I;  3ZKD A;  4DR5 I;  4JI6 I;  1Z0B A;  4HYM A;  4X64 E;  4XTJ A;  2UU9 E;  2UXD E;  1XNQ E;  4OX9 I;  4EMD A;  1ZM2 A;  4JI0 I;  4LF8 I;  1DAR A;  1D6T A;  1HNW I;  3K1J A;  4M1K A;  2X36 A;  2O1U A;  2HHH E;  1I94 E;  3Q1Q A;  4IZK B;  2Z5C A;  2UU9 I;  4X66 I;  3J7A M;  1ZM4 A;  2LJP A;  2A2C A;  1HK7 A;  4B3R E;  1FJG E;  5FLX Q;  4B3T I;  1N33 I;  2PNM A;  1I94 I;  1H7U A;  1XMO E;  1H73 A;  1Z0T A;  1MX0 A;  4X62 I;  4JI4 I;  3PRY A;  1NHI A;  3PYF A;  4N3O A;  1Z0G A;  4LF4 E;  4JYA E;  2ZIT A;  1XNR I;  3J81 C;  2PNL A;  3CWV A;  3H4L A;  1XMO I;  5IWA I;  4LF7 I;  4DXL A;  2BV3 A;  5LMU E;  3B78 A;  5A2Q Q;  4DV6 I;  3K85 A;  2VF3 A;  2Q2E B;  1Z5C A;  4LF4 I;  3ZZ0 A;  4LFB E;  4B3M I;  3PYE A;  5BR8 I;  4GKK I;  2E5L E;  2HK3 A;  4DV1 I;  1PIE A;  2UUA E;  2CGE A;  2UXB E;  4Z7Y A;  4JI3 I;  2UUC I;  1N34 I;  2IOQ A;  4KHP E;  4FWD A;  3WU6 A;  1VIS A;  4JI1 E;  2IOP A;  1XMQ E;  4IZJ B;  1HNX I;  2AJ4 A;  3JAM C;  1MG7 A;  3QT6 A;  4DR4 E;  5GME A;  2V2V A;  1USU A;  3QT8 A;  1N36 I;  4DV3 E;  3HUL A;  4LF6 E;  3V2U C;  4LFC I;  4X65 I;  3P06 A;  1PKP A;  1Z59 A;  1A6F A;  4JI2 E;  1FKA E;  4DUY I;  4JG4 A;  4K0K I;  2UXC I;  2R3V A;  4MYT A;  1Y6Z A;  3GON A;  2NPF A;  2UUB I;  2OI2 A;  2ZBK B;  4IZK A;  1HR0 I;  3T1Y E;  3OTO E;  4DV7 I;  1IBK E;  3J7A G;  4HAC B;  1Y4U A;  2F4V E;  3ZKB A;  4YY3 I;  4ZVI A;  2ZM6 I;  1KIJ A;  4DUZ E;  4NXM E;  1FNM A;  1FWK A;  1N32 E;  4ED4 A;  3K17 A;  4UT4 A;  2GQ0 A;  1ELO A;  4X64 I;  4UTG A;  2UXD I;  1U2R A;  2HK2 A;  3WU5 A;  1XNQ I;  2O1W A;  5L3J A;  4DR6 E;  4DPY A;  3HJC A;  3ZZU A;  4PRX A;  3J80 C;  2HHH I;  1H74 A;  1PVG A;  4DV5 E;  2XEX A;  4DR7 E;  5GMD A;  4DPU A;  5LMN E;  4B3R I;  4LF9 E;  1FJG I;  1H72 C;  4DV2 E;  4DR2 E;  1S4E A;  4P7A A;  1H7S A;  3J80 Q;  1OJ4 A;  1IBM E;  2O1V A;  4IZJ D;  4IZJ A;  1FWL A;  4JYA I;  1UEK A;  3LTO A;  4JV5 E;  3PYG A;  1KVK A;  1WUU A;  1B63 A;  3J81 Q;  5FWK A;  1S16 A;  4AQY E;  2GS8 A;  4JI8 E;  5LMU I;  3B8H A;  4B3S E;  2A2D A;  2Z5B A;  4LFB I;  1NHH A;  1RR9 A;  4YHH E;  1NZ0 A;  1IBL E;  2E5L I;  4GKJ E;  2UUA I;  1N0V C;  2UXB I;  4JI5 E;  4FN5 A;  4AQY I;  4FWG A;  4P52 A;  4WUB A;  1BKN A;  1ZM9 A;  4KHP I;  4JI1 I;  1J5E E;  2HFS A;  1XMQ I;  2VQF E;  3B82 A;  4DV0 E;  4DR3 E;  4DV4 E;  2R42 A;  1QZR A;  4YHH I;  4GKJ I;  4LFA E;  4DR4 I;  4DR5 E;  1B62 A;  3JAM Q;  4JI6 E;  4DV3 I;  3QT7 A;  4I3H A;  4LF6 I;  1Z0C A;  1Y4S A;  4FW9 A;  4DU7 A;  4DV0 I;  4DR3 I;  4JI0 E;  4JI2 I;  4DPW A;  4LF8 E;  3M6A A;  2EFG A;  1Z5A A;  1HNW E;  1XHK A;  3T1Y I;  3OTO I;  4JI7 E;  1FI4 A;  1IBK I;  4X66 E;  3WU3 A;  2F4V I;  2V34 A;  4Z7C A;  4R1F A;  4DUZ I;  2O1T A;  4NXM I;  5FLX C;  1N0U A;  2CG9 A;  3LNU A;  1N32 I;  4B3T E;  1K47 A;  4LF5 E;  1N33 E;  2CZ9 A;  4JI7 I;  3V5R A;  4X62 E;  4JI4 E;  1ZM3 A;  4WUD A;  2DEI A;  4DR6 I;  3Q6N A;  5LL6 R;  3T1H E;  1Z0W A;  4PU9 A;  1XNR E;  2X7I A;  3LPS A;  4LF5 I;  4DPX A;  5A2Q C;  2HFU A;  5IWA E;  4LF7 E;  4DV5 I;  3F0N A;  2DEJ A;  2V2Q A;  1HNZ E;  2Z5C B;  4DR7 I;  5LMN I;  4DV6 E;  3D4J A;  4LF9 I;  1Z0E A;  2BM1 A;  5BR8 E;  4B3M E;  1RRE A;  4DV2 I;  4DR2 I;  3T1H I;  4GKK E;  4DV1 E;  1ZXN A;  4HY1 A;  3QT5 A;  4JI3 E;  2UUC E;  3Q6M A;  1N34 E;  3ZM7 A;  2J7K A;  1HNZ I;  1IBM I;  4NXN E;  1MU5 A;  4DPT A;  4USK A;  1KTV A;  4RPF A;  1Z5B A;  1HNX E;  4MYU A;  3ZZT A;  4JV5 I;  2VQE E;  2HKJ A;  3PYD A;  4KQV A;  3WU4 A;  1N36 E;  4HAC A;  4JI8 I;  5IT9 C;  1USV A;  4DR1 E;  4HXZ A;  4B3S I;  2WW4 A;  4NXN I;  4USM A;  2HKE A;  4URL A;  4X65 E;  4LFC E;  2BM0 A;  1IBL I;  4FWH A;  4WUC A;  4DUY E;  1NHJ A;  1KKH A;  4DU8 A;  4K0K E;  2UXC E;  1ZXM A;  2VQE I;  4JI5 I;  1Z0V A;  2V2Z A;  1EI1 A;  2UUB E;  2Z5E A;  1HR0 E;  4DV7 E;  4DR1 I;  2V8P A;  5IT9 Q;  4YY3 E;  1J5E I;  4OX9 E;  2ZM6 E;  2VQF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...