4B3TI

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3tI00
4DR4E 1OJ4A 5GMDA 2R42A 3ZZUA 4DR2I 2X7IA 1NZ0A 4DV6I 1ELOA 3J7AG 1IBME 5BR8I 1DARA 3ZKBA 2UU9E 4LF9I 2A2DA 1Z0EA 4RPFA 3ZKDA 3T1YI 4B3SE 2VQEI 4R1FA 2R3VA 4DPYA 5IWAI 1H72C 4LF7I 4MYTA 2HKJA 3ZM7A 4KHPE 1Z0BA 2HHHE 4DR4I 5FLXC 3V5RA 2BM0A 4JI1I 1XNRE 4X66E 1HR0I 4OX9E 4Z7YA 1HNWE 1XMQE 1NHJA 4Z7CA 1FNMA 2UXCI 1IBKE 4LF5E 1N33E 4DR3E 2E1RA 4ED4A 3T1YE 4WUDA 4B3SI 1RR9A 4LFAI 4LFCE 1HR0E 1B62A 5LMNE 2UXBI 1PKPA 1ZM2A 2UUBI 1N32I 4KHPI 1XNQE 4DV1I 1N34E 4UTGA 4GKKI 4JI3I 3WU4A 4JI7E 5L3JA 1PVGA 2UUCI 1ZM9A 2ZITA 2HK3A 1I94I 2UUBE 3F0NA 4AQYE 4B3RE 2A2CA 4M1KA 2VQEE 4GKKE 1N33I 4YHHE 4JI7I 2F4VI 3PYDA 3JAMC 4JG4A 4FWHA 2UUCE 4JI2E 5A2QQ 4DR6E 1Z0CA 3M6AA 3PYFA 3QT8A 4DR5I 5BR8E 4NXMI 2HFSA 4B3MI 4DR7I 2UXDI 4YHHI 2UU9I 2UXBE 1MX0A 2DEJA 4P7AA 4DV7E 4UT4A 1MG7A 4JI3E 4FWGA 1KIJA 1Z0GA 2GS8A 4OX9I 2NPFA 1FJGE 4DPTA 4B3ME 2J7KA 1MU5A 3PYEA 4ZVIA 4FWDA 2HHHI 2DEIA 2BV3A 2HKEA 1FJGI 3ZZ0A 1H7UA 1N36E 3V2UC 1HNZI 4DV1E 1N34I 1HNXE 4JI5E 1HNWI 2ZM6E 2V2QA 4DUZI 4X64I 4JI4E 4JI6I 1N0UA 4LF6I 4LF8I 3WU5A 2XEXA 1FI4A 4DV2E 3B82A 1N36I 1IBLI 2E5LE 1K47A 4KQVA 4JI5I 4DPUA 1UEKA 4X64E 1VISA 2WW4A 2F4VE 3QT5A 1ZXNA 4DR6I 4DUYE 2VQFE 1D6TA 4JYAE 3J81Q 5LMUI 3K1JA 4P52A 1NHIA 4NXME 1Z5BA 1XHKA 4B3TE 4JI0E 4PRXA 1Z5AA 4YY3I 1BKNA 4EMDA 4USMA 3GONA 1J5EE 3HULA 2AJ4A 2HFUA 3B78A 3QT6A 1S4EA 3J7AM 3D4JA 4DV4I 4DV2I 1FWLA 4XTJA 2V2VA 4YY3E 4DR5E 3B8HA 1S16A 3LPSA 4HACA 4DPWA 4LF4I 1ZM3A 2BM1A 1XMOI 4X65I 4B3RI 1Z0TA 1KTVA 1A6FA 4USKA 4NXNI 1RREA 3J80Q 3CWVA 1FWKA 4K0KI 4PU9A 2CZ9A 1IBKI 4DR7E 4DR2E 4DR3I 1HNXI 3LTOA 4LFCI 2VQFI 5LMUE 1N0VC 4JI4I 1H7SA 4DUZE 4JYAI 4PRVA 4JI6E 2V34A 3LNUA 1FKAE 3PYGA 4X62E 3T1HE 1XNQI 1KVKA 4HXZA 5GMEA 4GKJE 4DU7A 3JAMQ 3OTOI 4DV3E 4DV5I 2UUAI 1I94E 4LFBE 4LF7E 4DUYI 1H73A 4K0KE 5LL6R 2HK2A 3WU6A 4AQYI 2ZM6I 4DPXA 2ZBKB 4JI0I 4URLA 4B3TI 1WUUA 4JI8I 1EA6A 4WUBA 1KKHA 1ZM4A 4LF6E 1Z59A 4LF9E 5FLXQ 4DV0E 4X65E 4HYMA 2OI2A 1XMQI 3ZZTA 2UXDE 3Q1QA 2UXCE 3QT7A 4X62I 5IWAE 4I3HA 4FW9A 4DV7I 4DU8A 4GKJI 4LFAE 1IBMI 2EFGA 2Q2EB 4DR1I 1Z5CA 1Z0VA 2LJPA 5IT9C 3K17A 1H74A 2V2ZA 1J5EI 4X66I 3H4LA 2X36A 4WUCA 4DR1E 4DV4E 4LF5I 4NXNE 4JV5E 4DXLA 3T1HI 1HNZE 1EI1A 4DV6E 4DV3I 1ZXMA 3OTOE 3WU3A 5IT9Q 4FN5A 4LF8E 1QZRA 4LF4E 4JI2I 1NHHA 1PIEA 4LFBI 3J81C 2UUAE 1U2RA 5LMNI 4JV5I 1XNRI 1B63A 1N32E 4JI1E 1IBLE 2E5LI 1XMOE 5A2QC 4JI8E 3J80C 2V8PA 4DV0I 4MYUA 2VF3A 4HY1A 4HACB 4DV5E 1Z0WA
chains in the Genus database with same CATH superfamily
4DR4E 1OJ4A 5GMDA 2R42A 3ZZUA 4DR2I 2X7IA 1NZ0A 2O1VA 3GCMA 4DV6I 1ELOA 2PO2B 3J7AG 3HKMA 3Q6NA 2PNLA 1IBME 5BR8I 1DARA 1RHYA 4FW5A 3ZKBA 5C0XB 2UU9E 4LF9I 4ISAA 2A2DA 3P3GA 1Z0EA 4RPFA 3PRYA 3ZKDA 5DNLA 3K85A 3T1YI 4B3SE 2VQEI 4R1FA 2R3VA 4DPYA 5IWAI 2C37B 1H72C 4LF7I 4MYTA 2PO0B 2HKJA 4IFDD 3ZM7A 4KHPE 1Z0BA 3P3EA 3PS2A 4BA1B 4AIDA 4IFDB 2HHHE 4MQYA 4DR4I 2JEBA 5FLXC 5JEAE 1P42A 3V5RA 4IS9A 2BM0A 4JI1I 1XNRE 2BR2B 4X66E 5EKWA 1HR0I 4OX9E 4Z7YA 1HNWE 1UDQA 1XMQE 1NHJA 4Z7CA 1FNMA 2UXCI 1IBKE 4LF5E 1N33E 4DR3E 2E1RA 4ED4A 3T1YE 2PO1A 4WUDA 1YH8A 4B3SI 1RR9A 3U1YA 4LFAI 4LFCE 1E3PA 1HR0E 1B62A 1YHCA 4OO1F 2WNRB 5LMNE 2UXBI 1PKPA 1ZM2A 2UUBI 1N32I 4KHPI 1XNQE 4BA1A 5C0XD 4DV1I 1N34E 4UTGA 5K36B 1UDNA 4GKKI 3Q6MA 4JI3I 3WU4A 4AM3A 2F1DA 4JI7E 2Z5BB 5L3JA 4IZJD 2BA0D 3M7NG 1R6MA 1PVGA 4QNKA 1ZM9A 2UUCI 4IZJB 2ZITA 3DD6A 2HK3A 1I94I 2UUBE 5JEAF 2O1UA 3F0NA 4AQYE 2NN6B 5EL9A 4B3RE 2A2CA 4M1KA 2VQEE 4GKKE 1N33I 4YHHE 4JI7I 3L7ZB 2F4VI 3PYDA 2BA0G 2CG9A 3JAMC 4JG4A 4FWHA 2UUCE 4JI2E 5A2QQ 3H1CA 4DR6E 1Z0CA 3M6AA 1UDOA 1XXEA 5K36F 3PYFA 3QT8A 4DR5I 5BR8E 4NXMI 2HFSA 3P76A 4B3MI 4OO1B 4NBQA 2WP8A 4DR7I 2UXDI 4YHHI 2UU9I 2UXBE 1MX0A 2PNZA 2DEJA 4P7AA 4DV7E 4FW6A 4UT4A 1MG7A 4JI3E 4FWGA 1KIJA 1Z0GA 2GS8A 4OX9I 2NPFA 1FJGE 4DPTA 4IZKB 4B3ME 4MU1A 4OZEA 2J7KA 1MU5A 3PYEA 1R6LA 2O1WA 4ZVIA 4FW3A 4FWDA 2HHHI 2DEIA 2BV3A 5C0XA 2GO4A 3U1KA 2AE8A 2HKEA 1FJGI 3ZZ0A 5K36D 1H7UA 1N36E 3V2UC 4MU0A 1HNZI 2CVEA 4DV1E 1N34I 1HNXE 4JI5E 1E3HA 1HNWI 2ZM6E 2JEAA 2V2QA 2GQ0A 2IERA 4X64I 4DUZI 4JI4E 4JI6I 1Y5YA 1N0UA 4LF6I 4LF8I 3WU5A 2XEXA 2GO3A 4AIMA 1FI4A 5ELWA 4DV2E 3B82A 1N36I 1IBLI 2C39B 1K47A 2E5LE 4BA2B 2VESA 3CDIA 4KQVA 4JI5I 4IZKA 2JE6A 4DPUA 1UEKA 5DRRA 4X64E 4IFDE 1VISA 2WW4A 2F4VE 3QT5A 1HK7A 1ZXNA 4J3DA 4DR6I 4U3BA 3PS1A 4DUYE 2VQFE 1Y4UA 1D6TA 2CGEA 4JYAE 3J81Q 5LMUI 3K1JA 4P52A 1NHIA 1OYSA 4NXME 1Z5BA 4IFDF 1XHKA 4B3TE 4JI0E 2IOPA 4PRXA 1Z5AA 4LCGA 4YY3I 1BKNA 4EMDA 4USMA 3GONA 1J5EE 3HULA 2AJ4A 2JEBB 2HFUA 3B78A 3QT6A 1S4EA 2PO1B 3J7AM 3D4JA 4DV4I 2Z5CA 5C0XF 2Z5EA 4DV2I 1FWLA 4XTJA 2V2VA 2WNRA 4YY3E 4DR5E 4U3DA 2C38B 3B8HA 1S16A 3LPSA 4HACA 4DPWA 4LF4I 2BA1G 2NN6A 1ZM3A 2BM1A 1XMOI 4X65I 4B3RI 1VI7A 4IFDC 2O1TA 1Z0TA 1KTVA 3M7ND 1A6FA 4USKA 3PS3A 3M85G 4NXNI 1RREA 3J80Q 3CWVA 1FWKA 3HJCA 3GMEA 4OO1C 4K0KI 4PU9A 2CZ9A 1IBKI 4DR7E 3NZKA 5JEAB 2WP8B 2PO2A 4DR2E 4DR3I 1HNXI 3LTOA 2PO0A 4LFCI 4OO1D 2VQFI 5LMUE 1N0VC 1H7SA 4DUZE 4JI4I 5C0XE 4JYAI 4PRVA 4JI6E 2V34A 1Y6ZA 3LNUA 1FKAE 3PYGA 5C0XC 4X62E 3T1HE 1XNQI 5DNXA 1KVKA 4HXZA 5GMEA 4GKJE 4DU7A 3JAMQ 2NN6D 3OTOI 4DV3E 2PNZB 3KRNA 3UHMA 4DV5I 2UUAI 1I94E 4LFBE 2JEAB 4LF7E 2C37A 4DUYI 1H73A 2NN6F 4K0KE 4OO1E 5JEAC 1USUA 5LL6R 2HK2A 3WU6A 4AQYI 2ZM6I 2NN6C 1UDSA 4DPXA 2ZBKB 4JI0I 4URLA 3M85D 4B3TI 1WUUA 4JI8I 3GLLA 4IFDA 1EA6A 4WUBA 5JEAA 1KKHA 1ZM4A 2C39A 4LF6E 4LPFA 4LCFA 1Z59A 4LF9E 2IOQA 5FLXQ 4DV0E 2IESA 4X65E 4HYMA 2OI2A 2BR2A 1Y60A 2NN6E 1XMQI 4BA2A 3ZZTA 2UXDE 4GQUA 3Q1QA 2UXCE 3P3CA 3QT7A 2JE6B 4X62I 5IWAE 1OYPA 4I3HA 4FW9A 1OYRA 4DV7I 4DU8A 4GKJI 3CDJA 4LFAE 1IBMI 4MU3A 2EFGA 2Q2EB 4DR1I 4OKGA 1Z5CA 1Z0VA 2LJPA 5K36E 1Y4SA 5IT9C 3K17A 2Z5BA 1H74A 2V2ZA 1J5EI 4LCHA 5DRQA 3H4LA 4X66I 2J65A 5DRPA 5K36A 2X36A 4LOMA 4WUCA 4DR1E 4DV4E 4LF5I 4NXNE 2JT2A 4DXLA 4JV5E 2Z5CB 3T1HI 5K36C 1HNZE 4IZJA 1EI1A 4DV6E 1USVA 4DV3I 1ZXMA 2BA1D 3OTOE 3WU3A 5IT9Q 3P06A 4FN5A 2O3ZA 4LF8E 1QZRA 4LF4E 5DROA 4JI2I 1NHHA 2C38A 3B4TA 4FW4A 1PIEA 3L7ZA 4LFBI 4MDTA 3J81C 1U2RA 5LMNI 2UUAE 4JV5I 1XNRI 1B63A 1N32E 4JI1E 5JEAD 1IBLE 2E5LI 1XMOE 5A2QC 4FW7A 4JI8E 4MU4A 4OO1A 3J80C 4QNJA 2V8PA 4DV0I 2PNMA 4MYUA 2VF3A 4HY1A 5FWKA 4HACB 4N3OA 4DV5E 1Z0WA
chains in the Genus database with same CATH topology
4DR4E 1OJ4A 5GMDA 2R42A 3ZZUA 4DR2I 2X7IA 1NZ0A 2O1VA 4DV6I 1ELOA 3J7AG 3Q6NA 2PNLA 1IBME 5BR8I 1DARA 3ZKBA 2UU9E 4LF9I 2A2DA 1Z0EA 4RPFA 3PRYA 3ZKDA 3K85A 3T1YI 4B3SE 2VQEI 4R1FA 2R3VA 4DPYA 5IWAI 1H72C 4LF7I 4MYTA 2HKJA 3ZM7A 4KHPE 1Z0BA 2HHHE 4DR4I 5FLXC 3V5RA 2BM0A 4JI1I 1XNRE 4X66E 1HR0I 4OX9E 4Z7YA 1HNWE 1XMQE 1NHJA 4Z7CA 1FNMA 2UXCI 1IBKE 4LF5E 1N33E 4DR3E 2E1RA 4ED4A 3T1YE 4WUDA 4B3SI 1RR9A 4LFAI 4LFCE 1HR0E 1B62A 5LMNE 2UXBI 1PKPA 1ZM2A 2UUBI 1N32I 4KHPI 1XNQE 4DV1I 1N34E 4UTGA 4GKKI 3Q6MA 4JI3I 3WU4A 4JI7E 2Z5BB 5L3JA 4IZJD 1PVGA 2UUCI 1ZM9A 4IZJB 2ZITA 2HK3A 1I94I 2UUBE 2O1UA 3F0NA 4AQYE 4B3RE 2A2CA 4M1KA 2VQEE 4GKKE 1N33I 4YHHE 4JI7I 2F4VI 3PYDA 3JAMC 2CG9A 4JG4A 4FWHA 2UUCE 4JI2E 5A2QQ 4DR6E 1Z0CA 3M6AA 3PYFA 3QT8A 4DR5I 5BR8E 4NXMI 2HFSA 4B3MI 4DR7I 2UXDI 4YHHI 2UU9I 2UXBE 1MX0A 2DEJA 4P7AA 4DV7E 4UT4A 1MG7A 4JI3E 4FWGA 1KIJA 1Z0GA 2GS8A 4OX9I 2NPFA 1FJGE 4DPTA 4IZKB 4B3ME 2J7KA 1MU5A 3PYEA 2O1WA 4ZVIA 4FWDA 2HHHI 2DEIA 2BV3A 2HKEA 1FJGI 3ZZ0A 1H7UA 1N36E 3V2UC 1HNZI 4DV1E 1N34I 1HNXE 4JI5E 1HNWI 2ZM6E 2V2QA 2GQ0A 4DUZI 4X64I 4JI4E 4JI6I 1N0UA 4LF6I 4LF8I 3WU5A 2XEXA 1FI4A 4DV2E 3B82A 1N36I 1IBLI 2E5LE 1K47A 4KQVA 4JI5I 4IZKA 4DPUA 1UEKA 4X64E 1VISA 2WW4A 2F4VE 3QT5A 1HK7A 1ZXNA 4DR6I 4DUYE 2VQFE 1Y4UA 1D6TA 2CGEA 4JYAE 3J81Q 5LMUI 3K1JA 4P52A 1NHIA 4NXME 1Z5BA 1XHKA 4B3TE 4JI0E 2IOPA 4PRXA 1Z5AA 4YY3I 1BKNA 4EMDA 4USMA 3GONA 1J5EE 3HULA 2AJ4A 2HFUA 3B78A 3QT6A 1S4EA 3J7AM 3D4JA 4DV4I 2Z5CA 2Z5EA 4DV2I 1FWLA 4XTJA 2V2VA 4YY3E 4DR5E 3B8HA 1S16A 3LPSA 4HACA 4DPWA 4LF4I 1ZM3A 2BM1A 1XMOI 4X65I 4B3RI 2O1TA 1Z0TA 1KTVA 1A6FA 4USKA 4NXNI 1RREA 3J80Q 3CWVA 1FWKA 3HJCA 4K0KI 4PU9A 2CZ9A 1IBKI 4DR7E 4DR2E 4DR3I 1HNXI 3LTOA 4LFCI 2VQFI 5LMUE 1N0VC 1H7SA 4DUZE 4JI4I 4JYAI 4PRVA 4JI6E 2V34A 1Y6ZA 3LNUA 1FKAE 3PYGA 4X62E 3T1HE 1XNQI 1KVKA 4HXZA 5GMEA 4GKJE 4DU7A 3JAMQ 3OTOI 4DV3E 4DV5I 2UUAI 1I94E 4LFBE 4LF7E 4DUYI 1H73A 4K0KE 1USUA 5LL6R 2HK2A 3WU6A 4AQYI 2ZM6I 4DPXA 2ZBKB 4JI0I 4URLA 4B3TI 1WUUA 4JI8I 1EA6A 4WUBA 1KKHA 1ZM4A 4LF6E 1Z59A 4LF9E 2IOQA 5FLXQ 4DV0E 4X65E 4HYMA 2OI2A 1XMQI 3ZZTA 2UXDE 3Q1QA 2UXCE 3QT7A 4X62I 5IWAE 4I3HA 4FW9A 4DV7I 4DU8A 4GKJI 4LFAE 1IBMI 2EFGA 2Q2EB 4DR1I 1Z5CA 1Z0VA 2LJPA 1Y4SA 5IT9C 3K17A 2Z5BA 1H74A 2V2ZA 1J5EI 4X66I 3H4LA 2X36A 4WUCA 4DR1E 4DV4E 4LF5I 4NXNE 4JV5E 4DXLA 2Z5CB 3T1HI 1HNZE 4IZJA 1EI1A 4DV6E 1USVA 4DV3I 1ZXMA 3OTOE 3WU3A 5IT9Q 3P06A 4FN5A 4LF8E 1QZRA 4LF4E 4JI2I 1NHHA 1PIEA 4LFBI 3J81C 2UUAE 1U2RA 5LMNI 4JV5I 1XNRI 1B63A 1N32E 4JI1E 1IBLE 2E5LI 1XMOE 5A2QC 4JI8E 3J80C 2V8PA 4DV0I 2PNMA 4MYUA 2VF3A 4HY1A 5FWKA 4HACB 4N3OA 4DV5E 1Z0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 E;  1OJ4 A;  5GMD A;  2R42 A;  3ZZU A;  4DR2 I;  2X7I A;  1NZ0 A;  4DV6 I;  1ELO A;  3J7A G;  1IBM E;  5BR8 I;  1DAR A;  3ZKB A;  2UU9 E;  4LF9 I;  2A2D A;  1Z0E A;  4RPF A;  3ZKD A;  3T1Y I;  4B3S E;  2VQE I;  4R1F A;  2R3V A;  4DPY A;  5IWA I;  1H72 C;  4LF7 I;  4MYT A;  2HKJ A;  3ZM7 A;  4KHP E;  1Z0B A;  2HHH E;  4DR4 I;  5FLX C;  3V5R A;  2BM0 A;  4JI1 I;  1XNR E;  4X66 E;  1HR0 I;  4OX9 E;  4Z7Y A;  1HNW E;  1XMQ E;  1NHJ A;  4Z7C A;  1FNM A;  2UXC I;  1IBK E;  4LF5 E;  1N33 E;  4DR3 E;  2E1R A;  4ED4 A;  3T1Y E;  4WUD A;  4B3S I;  1RR9 A;  4LFA I;  4LFC E;  1HR0 E;  1B62 A;  5LMN E;  2UXB I;  1PKP A;  1ZM2 A;  2UUB I;  1N32 I;  4KHP I;  1XNQ E;  4DV1 I;  1N34 E;  4UTG A;  4GKK I;  4JI3 I;  3WU4 A;  4JI7 E;  5L3J A;  1PVG A;  2UUC I;  1ZM9 A;  2ZIT A;  2HK3 A;  1I94 I;  2UUB E;  3F0N A;  4AQY E;  4B3R E;  2A2C A;  4M1K A;  2VQE E;  4GKK E;  1N33 I;  4YHH E;  4JI7 I;  2F4V I;  3PYD A;  3JAM C;  4JG4 A;  4FWH A;  2UUC E;  4JI2 E;  5A2Q Q;  4DR6 E;  1Z0C A;  3M6A A;  3PYF A;  3QT8 A;  4DR5 I;  5BR8 E;  4NXM I;  2HFS A;  4B3M I;  4DR7 I;  2UXD I;  4YHH I;  2UU9 I;  2UXB E;  1MX0 A;  2DEJ A;  4P7A A;  4DV7 E;  4UT4 A;  1MG7 A;  4JI3 E;  4FWG A;  1KIJ A;  1Z0G A;  2GS8 A;  4OX9 I;  2NPF A;  1FJG E;  4DPT A;  4B3M E;  2J7K A;  1MU5 A;  3PYE A;  4ZVI A;  4FWD A;  2HHH I;  2DEI A;  2BV3 A;  2HKE A;  1FJG I;  3ZZ0 A;  1H7U A;  1N36 E;  3V2U C;  1HNZ I;  4DV1 E;  1N34 I;  1HNX E;  4JI5 E;  1HNW I;  2ZM6 E;  2V2Q A;  4DUZ I;  4X64 I;  4JI4 E;  4JI6 I;  1N0U A;  4LF6 I;  4LF8 I;  3WU5 A;  2XEX A;  1FI4 A;  4DV2 E;  3B82 A;  1N36 I;  1IBL I;  2E5L E;  1K47 A;  4KQV A;  4JI5 I;  4DPU A;  1UEK A;  4X64 E;  1VIS A;  2WW4 A;  2F4V E;  3QT5 A;  1ZXN A;  4DR6 I;  4DUY E;  2VQF E;  1D6T A;  4JYA E;  3J81 Q;  5LMU I;  3K1J A;  4P52 A;  1NHI A;  4NXM E;  1Z5B A;  1XHK A;  4B3T E;  4JI0 E;  4PRX A;  1Z5A A;  4YY3 I;  1BKN A;  4EMD A;  4USM A;  3GON A;  1J5E E;  3HUL A;  2AJ4 A;  2HFU A;  3B78 A;  3QT6 A;  1S4E A;  3J7A M;  3D4J A;  4DV4 I;  4DV2 I;  1FWL A;  4XTJ A;  2V2V A;  4YY3 E;  4DR5 E;  3B8H A;  1S16 A;  3LPS A;  4HAC A;  4DPW A;  4LF4 I;  1ZM3 A;  2BM1 A;  1XMO I;  4X65 I;  4B3R I;  1Z0T A;  1KTV A;  1A6F A;  4USK A;  4NXN I;  1RRE A;  3J80 Q;  3CWV A;  1FWK A;  4K0K I;  4PU9 A;  2CZ9 A;  1IBK I;  4DR7 E;  4DR2 E;  4DR3 I;  1HNX I;  3LTO A;  4LFC I;  2VQF I;  5LMU E;  1N0V C;  4JI4 I;  1H7S A;  4DUZ E;  4JYA I;  4PRV A;  4JI6 E;  2V34 A;  3LNU A;  1FKA E;  3PYG A;  4X62 E;  3T1H E;  1XNQ I;  1KVK A;  4HXZ A;  5GME A;  4GKJ E;  4DU7 A;  3JAM Q;  3OTO I;  4DV3 E;  4DV5 I;  2UUA I;  1I94 E;  4LFB E;  4LF7 E;  4DUY I;  1H73 A;  4K0K E;  5LL6 R;  2HK2 A;  3WU6 A;  4AQY I;  2ZM6 I;  4DPX A;  2ZBK B;  4JI0 I;  4URL A;  4B3T I;  1WUU A;  4JI8 I;  1EA6 A;  4WUB A;  1KKH A;  1ZM4 A;  4LF6 E;  1Z59 A;  4LF9 E;  5FLX Q;  4DV0 E;  4X65 E;  4HYM A;  2OI2 A;  1XMQ I;  3ZZT A;  2UXD E;  3Q1Q A;  2UXC E;  3QT7 A;  4X62 I;  5IWA E;  4I3H A;  4FW9 A;  4DV7 I;  4DU8 A;  4GKJ I;  4LFA E;  1IBM I;  2EFG A;  2Q2E B;  4DR1 I;  1Z5C A;  1Z0V A;  2LJP A;  5IT9 C;  3K17 A;  1H74 A;  2V2Z A;  1J5E I;  4X66 I;  3H4L A;  2X36 A;  4WUC A;  4DR1 E;  4DV4 E;  4LF5 I;  4NXN E;  4JV5 E;  4DXL A;  3T1H I;  1HNZ E;  1EI1 A;  4DV6 E;  4DV3 I;  1ZXM A;  3OTO E;  3WU3 A;  5IT9 Q;  4FN5 A;  4LF8 E;  1QZR A;  4LF4 E;  4JI2 I;  1NHH A;  1PIE A;  4LFB I;  3J81 C;  2UUA E;  1U2R A;  5LMN I;  4JV5 I;  1XNR I;  1B63 A;  1N32 E;  4JI1 E;  1IBL E;  2E5L I;  1XMO E;  5A2Q C;  4JI8 E;  3J80 C;  2V8P A;  4DV0 I;  4MYU A;  2VF3 A;  4HY1 A;  4HAC B;  4DV5 E;  1Z0W A; 
#chains in the Genus database with same CATH topology
 4DR4 E;  1OJ4 A;  5GMD A;  2R42 A;  3ZZU A;  4DR2 I;  2X7I A;  1NZ0 A;  2O1V A;  3GCM A;  4DV6 I;  1ELO A;  2PO2 B;  3J7A G;  3HKM A;  3Q6N A;  2PNL A;  1IBM E;  5BR8 I;  1DAR A;  1RHY A;  4FW5 A;  3ZKB A;  5C0X B;  2UU9 E;  4LF9 I;  4ISA A;  2A2D A;  3P3G A;  1Z0E A;  4RPF A;  3PRY A;  3ZKD A;  5DNL A;  3K85 A;  3T1Y I;  4B3S E;  2VQE I;  4R1F A;  2R3V A;  4DPY A;  5IWA I;  2C37 B;  1H72 C;  4LF7 I;  4MYT A;  2PO0 B;  2HKJ A;  4IFD D;  3ZM7 A;  4KHP E;  1Z0B A;  3P3E A;  3PS2 A;  4BA1 B;  4AID A;  4IFD B;  2HHH E;  4MQY A;  4DR4 I;  2JEB A;  5FLX C;  5JEA E;  1P42 A;  3V5R A;  4IS9 A;  2BM0 A;  4JI1 I;  1XNR E;  2BR2 B;  4X66 E;  5EKW A;  1HR0 I;  4OX9 E;  4Z7Y A;  1HNW E;  1UDQ A;  1XMQ E;  1NHJ A;  4Z7C A;  1FNM A;  2UXC I;  1IBK E;  4LF5 E;  1N33 E;  4DR3 E;  2E1R A;  4ED4 A;  3T1Y E;  2PO1 A;  4WUD A;  1YH8 A;  4B3S I;  1RR9 A;  3U1Y A;  4LFA I;  4LFC E;  1E3P A;  1HR0 E;  1B62 A;  1YHC A;  4OO1 F;  2WNR B;  5LMN E;  2UXB I;  1PKP A;  1ZM2 A;  2UUB I;  1N32 I;  4KHP I;  1XNQ E;  4BA1 A;  5C0X D;  4DV1 I;  1N34 E;  4UTG A;  5K36 B;  1UDN A;  4GKK I;  3Q6M A;  4JI3 I;  3WU4 A;  4AM3 A;  2F1D A;  4JI7 E;  2Z5B B;  5L3J A;  4IZJ D;  2BA0 D;  3M7N G;  1R6M A;  1PVG A;  4QNK A;  1ZM9 A;  2UUC I;  4IZJ B;  2ZIT A;  3DD6 A;  2HK3 A;  1I94 I;  2UUB E;  5JEA F;  2O1U A;  3F0N A;  4AQY E;  2NN6 B;  5EL9 A;  4B3R E;  2A2C A;  4M1K A;  2VQE E;  4GKK E;  1N33 I;  4YHH E;  4JI7 I;  3L7Z B;  2F4V I;  3PYD A;  2BA0 G;  2CG9 A;  3JAM C;  4JG4 A;  4FWH A;  2UUC E;  4JI2 E;  5A2Q Q;  3H1C A;  4DR6 E;  1Z0C A;  3M6A A;  1UDO A;  1XXE A;  5K36 F;  3PYF A;  3QT8 A;  4DR5 I;  5BR8 E;  4NXM I;  2HFS A;  3P76 A;  4B3M I;  4OO1 B;  4NBQ A;  2WP8 A;  4DR7 I;  2UXD I;  4YHH I;  2UU9 I;  2UXB E;  1MX0 A;  2PNZ A;  2DEJ A;  4P7A A;  4DV7 E;  4FW6 A;  4UT4 A;  1MG7 A;  4JI3 E;  4FWG A;  1KIJ A;  1Z0G A;  2GS8 A;  4OX9 I;  2NPF A;  1FJG E;  4DPT A;  4IZK B;  4B3M E;  4MU1 A;  4OZE A;  2J7K A;  1MU5 A;  3PYE A;  1R6L A;  2O1W A;  4ZVI A;  4FW3 A;  4FWD A;  2HHH I;  2DEI A;  2BV3 A;  5C0X A;  2GO4 A;  3U1K A;  2AE8 A;  2HKE A;  1FJG I;  3ZZ0 A;  5K36 D;  1H7U A;  1N36 E;  3V2U C;  4MU0 A;  1HNZ I;  2CVE A;  4DV1 E;  1N34 I;  1HNX E;  4JI5 E;  1E3H A;  1HNW I;  2ZM6 E;  2JEA A;  2V2Q A;  2GQ0 A;  2IER A;  4X64 I;  4DUZ I;  4JI4 E;  4JI6 I;  1Y5Y A;  1N0U A;  4LF6 I;  4LF8 I;  3WU5 A;  2XEX A;  2GO3 A;  4AIM A;  1FI4 A;  5ELW A;  4DV2 E;  3B82 A;  1N36 I;  1IBL I;  2C39 B;  1K47 A;  2E5L E;  4BA2 B;  2VES A;  3CDI A;  4KQV A;  4JI5 I;  4IZK A;  2JE6 A;  4DPU A;  1UEK A;  5DRR A;  4X64 E;  4IFD E;  1VIS A;  2WW4 A;  2F4V E;  3QT5 A;  1HK7 A;  1ZXN A;  4J3D A;  4DR6 I;  4U3B A;  3PS1 A;  4DUY E;  2VQF E;  1Y4U A;  1D6T A;  2CGE A;  4JYA E;  3J81 Q;  5LMU I;  3K1J A;  4P52 A;  1NHI A;  1OYS A;  4NXM E;  1Z5B A;  4IFD F;  1XHK A;  4B3T E;  4JI0 E;  2IOP A;  4PRX A;  1Z5A A;  4LCG A;  4YY3 I;  1BKN A;  4EMD A;  4USM A;  3GON A;  1J5E E;  3HUL A;  2AJ4 A;  2JEB B;  2HFU A;  3B78 A;  3QT6 A;  1S4E A;  2PO1 B;  3J7A M;  3D4J A;  4DV4 I;  2Z5C A;  5C0X F;  2Z5E A;  4DV2 I;  1FWL A;  4XTJ A;  2V2V A;  2WNR A;  4YY3 E;  4DR5 E;  4U3D A;  2C38 B;  3B8H A;  1S16 A;  3LPS A;  4HAC A;  4DPW A;  4LF4 I;  2BA1 G;  2NN6 A;  1ZM3 A;  2BM1 A;  1XMO I;  4X65 I;  4B3R I;  1VI7 A;  4IFD C;  2O1T A;  1Z0T A;  1KTV A;  3M7N D;  1A6F A;  4USK A;  3PS3 A;  3M85 G;  4NXN I;  1RRE A;  3J80 Q;  3CWV A;  1FWK A;  3HJC A;  3GME A;  4OO1 C;  4K0K I;  4PU9 A;  2CZ9 A;  1IBK I;  4DR7 E;  3NZK A;  5JEA B;  2WP8 B;  2PO2 A;  4DR2 E;  4DR3 I;  1HNX I;  3LTO A;  2PO0 A;  4LFC I;  4OO1 D;  2VQF I;  5LMU E;  1N0V C;  1H7S A;  4DUZ E;  4JI4 I;  5C0X E;  4JYA I;  4PRV A;  4JI6 E;  2V34 A;  1Y6Z A;  3LNU A;  1FKA E;  3PYG A;  5C0X C;  4X62 E;  3T1H E;  1XNQ I;  5DNX A;  1KVK A;  4HXZ A;  5GME A;  4GKJ E;  4DU7 A;  3JAM Q;  2NN6 D;  3OTO I;  4DV3 E;  2PNZ B;  3KRN A;  3UHM A;  4DV5 I;  2UUA I;  1I94 E;  4LFB E;  2JEA B;  4LF7 E;  2C37 A;  4DUY I;  1H73 A;  2NN6 F;  4K0K E;  4OO1 E;  5JEA C;  1USU A;  5LL6 R;  2HK2 A;  3WU6 A;  4AQY I;  2ZM6 I;  2NN6 C;  1UDS A;  4DPX A;  2ZBK B;  4JI0 I;  4URL A;  3M85 D;  4B3T I;  1WUU A;  4JI8 I;  3GLL A;  4IFD A;  1EA6 A;  4WUB A;  5JEA A;  1KKH A;  1ZM4 A;  2C39 A;  4LF6 E;  4LPF A;  4LCF A;  1Z59 A;  4LF9 E;  2IOQ A;  5FLX Q;  4DV0 E;  2IES A;  4X65 E;  4HYM A;  2OI2 A;  2BR2 A;  1Y60 A;  2NN6 E;  1XMQ I;  4BA2 A;  3ZZT A;  2UXD E;  4GQU A;  3Q1Q A;  2UXC E;  3P3C A;  3QT7 A;  2JE6 B;  4X62 I;  5IWA E;  1OYP A;  4I3H A;  4FW9 A;  1OYR A;  4DV7 I;  4DU8 A;  4GKJ I;  3CDJ A;  4LFA E;  1IBM I;  4MU3 A;  2EFG A;  2Q2E B;  4DR1 I;  4OKG A;  1Z5C A;  1Z0V A;  2LJP A;  5K36 E;  1Y4S A;  5IT9 C;  3K17 A;  2Z5B A;  1H74 A;  2V2Z A;  1J5E I;  4LCH A;  5DRQ A;  3H4L A;  4X66 I;  2J65 A;  5DRP A;  5K36 A;  2X36 A;  4LOM A;  4WUC A;  4DR1 E;  4DV4 E;  4LF5 I;  4NXN E;  2JT2 A;  4DXL A;  4JV5 E;  2Z5C B;  3T1H I;  5K36 C;  1HNZ E;  4IZJ A;  1EI1 A;  4DV6 E;  1USV A;  4DV3 I;  1ZXM A;  2BA1 D;  3OTO E;  3WU3 A;  5IT9 Q;  3P06 A;  4FN5 A;  2O3Z A;  4LF8 E;  1QZR A;  4LF4 E;  5DRO A;  4JI2 I;  1NHH A;  2C38 A;  3B4T A;  4FW4 A;  1PIE A;  3L7Z A;  4LFB I;  4MDT A;  3J81 C;  1U2R A;  5LMN I;  2UUA E;  4JV5 I;  1XNR I;  1B63 A;  1N32 E;  4JI1 E;  5JEA D;  1IBL E;  2E5L I;  1XMO E;  5A2Q C;  4FW7 A;  4JI8 E;  4MU4 A;  4OO1 A;  3J80 C;  4QNJ A;  2V8P A;  4DV0 I;  2PNM A;  4MYU A;  2VF3 A;  4HY1 A;  5FWK A;  4HAC B;  4N3O A;  4DV5 E;  1Z0W A; 
#chains in the Genus database with same CATH homology
 4DR4 E;  1OJ4 A;  5GMD A;  2R42 A;  3ZZU A;  4DR2 I;  2X7I A;  1NZ0 A;  2O1V A;  4DV6 I;  1ELO A;  3J7A G;  3Q6N A;  2PNL A;  1IBM E;  5BR8 I;  1DAR A;  3ZKB A;  2UU9 E;  4LF9 I;  2A2D A;  1Z0E A;  4RPF A;  3PRY A;  3ZKD A;  3K85 A;  3T1Y I;  4B3S E;  2VQE I;  4R1F A;  2R3V A;  4DPY A;  5IWA I;  1H72 C;  4LF7 I;  4MYT A;  2HKJ A;  3ZM7 A;  4KHP E;  1Z0B A;  2HHH E;  4DR4 I;  5FLX C;  3V5R A;  2BM0 A;  4JI1 I;  1XNR E;  4X66 E;  1HR0 I;  4OX9 E;  4Z7Y A;  1HNW E;  1XMQ E;  1NHJ A;  4Z7C A;  1FNM A;  2UXC I;  1IBK E;  4LF5 E;  1N33 E;  4DR3 E;  2E1R A;  4ED4 A;  3T1Y E;  4WUD A;  4B3S I;  1RR9 A;  4LFA I;  4LFC E;  1HR0 E;  1B62 A;  5LMN E;  2UXB I;  1PKP A;  1ZM2 A;  2UUB I;  1N32 I;  4KHP I;  1XNQ E;  4DV1 I;  1N34 E;  4UTG A;  4GKK I;  3Q6M A;  4JI3 I;  3WU4 A;  4JI7 E;  2Z5B B;  5L3J A;  4IZJ D;  1PVG A;  2UUC I;  1ZM9 A;  4IZJ B;  2ZIT A;  2HK3 A;  1I94 I;  2UUB E;  2O1U A;  3F0N A;  4AQY E;  4B3R E;  2A2C A;  4M1K A;  2VQE E;  4GKK E;  1N33 I;  4YHH E;  4JI7 I;  2F4V I;  3PYD A;  3JAM C;  2CG9 A;  4JG4 A;  4FWH A;  2UUC E;  4JI2 E;  5A2Q Q;  4DR6 E;  1Z0C A;  3M6A A;  3PYF A;  3QT8 A;  4DR5 I;  5BR8 E;  4NXM I;  2HFS A;  4B3M I;  4DR7 I;  2UXD I;  4YHH I;  2UU9 I;  2UXB E;  1MX0 A;  2DEJ A;  4P7A A;  4DV7 E;  4UT4 A;  1MG7 A;  4JI3 E;  4FWG A;  1KIJ A;  1Z0G A;  2GS8 A;  4OX9 I;  2NPF A;  1FJG E;  4DPT A;  4IZK B;  4B3M E;  2J7K A;  1MU5 A;  3PYE A;  2O1W A;  4ZVI A;  4FWD A;  2HHH I;  2DEI A;  2BV3 A;  2HKE A;  1FJG I;  3ZZ0 A;  1H7U A;  1N36 E;  3V2U C;  1HNZ I;  4DV1 E;  1N34 I;  1HNX E;  4JI5 E;  1HNW I;  2ZM6 E;  2V2Q A;  2GQ0 A;  4DUZ I;  4X64 I;  4JI4 E;  4JI6 I;  1N0U A;  4LF6 I;  4LF8 I;  3WU5 A;  2XEX A;  1FI4 A;  4DV2 E;  3B82 A;  1N36 I;  1IBL I;  2E5L E;  1K47 A;  4KQV A;  4JI5 I;  4IZK A;  4DPU A;  1UEK A;  4X64 E;  1VIS A;  2WW4 A;  2F4V E;  3QT5 A;  1HK7 A;  1ZXN A;  4DR6 I;  4DUY E;  2VQF E;  1Y4U A;  1D6T A;  2CGE A;  4JYA E;  3J81 Q;  5LMU I;  3K1J A;  4P52 A;  1NHI A;  4NXM E;  1Z5B A;  1XHK A;  4B3T E;  4JI0 E;  2IOP A;  4PRX A;  1Z5A A;  4YY3 I;  1BKN A;  4EMD A;  4USM A;  3GON A;  1J5E E;  3HUL A;  2AJ4 A;  2HFU A;  3B78 A;  3QT6 A;  1S4E A;  3J7A M;  3D4J A;  4DV4 I;  2Z5C A;  2Z5E A;  4DV2 I;  1FWL A;  4XTJ A;  2V2V A;  4YY3 E;  4DR5 E;  3B8H A;  1S16 A;  3LPS A;  4HAC A;  4DPW A;  4LF4 I;  1ZM3 A;  2BM1 A;  1XMO I;  4X65 I;  4B3R I;  2O1T A;  1Z0T A;  1KTV A;  1A6F A;  4USK A;  4NXN I;  1RRE A;  3J80 Q;  3CWV A;  1FWK A;  3HJC A;  4K0K I;  4PU9 A;  2CZ9 A;  1IBK I;  4DR7 E;  4DR2 E;  4DR3 I;  1HNX I;  3LTO A;  4LFC I;  2VQF I;  5LMU E;  1N0V C;  1H7S A;  4DUZ E;  4JI4 I;  4JYA I;  4PRV A;  4JI6 E;  2V34 A;  1Y6Z A;  3LNU A;  1FKA E;  3PYG A;  4X62 E;  3T1H E;  1XNQ I;  1KVK A;  4HXZ A;  5GME A;  4GKJ E;  4DU7 A;  3JAM Q;  3OTO I;  4DV3 E;  4DV5 I;  2UUA I;  1I94 E;  4LFB E;  4LF7 E;  4DUY I;  1H73 A;  4K0K E;  1USU A;  5LL6 R;  2HK2 A;  3WU6 A;  4AQY I;  2ZM6 I;  4DPX A;  2ZBK B;  4JI0 I;  4URL A;  4B3T I;  1WUU A;  4JI8 I;  1EA6 A;  4WUB A;  1KKH A;  1ZM4 A;  4LF6 E;  1Z59 A;  4LF9 E;  2IOQ A;  5FLX Q;  4DV0 E;  4X65 E;  4HYM A;  2OI2 A;  1XMQ I;  3ZZT A;  2UXD E;  3Q1Q A;  2UXC E;  3QT7 A;  4X62 I;  5IWA E;  4I3H A;  4FW9 A;  4DV7 I;  4DU8 A;  4GKJ I;  4LFA E;  1IBM I;  2EFG A;  2Q2E B;  4DR1 I;  1Z5C A;  1Z0V A;  2LJP A;  1Y4S A;  5IT9 C;  3K17 A;  2Z5B A;  1H74 A;  2V2Z A;  1J5E I;  4X66 I;  3H4L A;  2X36 A;  4WUC A;  4DR1 E;  4DV4 E;  4LF5 I;  4NXN E;  4JV5 E;  4DXL A;  2Z5C B;  3T1H I;  1HNZ E;  4IZJ A;  1EI1 A;  4DV6 E;  1USV A;  4DV3 I;  1ZXM A;  3OTO E;  3WU3 A;  5IT9 Q;  3P06 A;  4FN5 A;  4LF8 E;  1QZR A;  4LF4 E;  4JI2 I;  1NHH A;  1PIE A;  4LFB I;  3J81 C;  2UUA E;  1U2R A;  5LMN I;  4JV5 I;  1XNR I;  1B63 A;  1N32 E;  4JI1 E;  1IBL E;  2E5L I;  1XMO E;  5A2Q C;  4JI8 E;  3J80 C;  2V8P A;  4DV0 I;  2PNM A;  4MYU A;  2VF3 A;  4HY1 A;  5FWK A;  4HAC B;  4N3O A;  4DV5 E;  1Z0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...