4B3SE

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3sE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3sE02
2V2VA 4DUYE 4DR6I 1RR9A 1FI4A 4YHHI 4RPFA 4HY1A 3WU3A 1XMQI 2BV3A 4DPUA 4DV5E 1KTVA 4LF5I 2HHHE 1EA6A 2X36A 2VF3A 2LUPB 2NUEA 3V5RA 3QT5A 3CWVA 2WW4A 2L3JA 4DR7I 1J26A 1N34E 1RQ0A 2VQEE 1X48A 2ZM6I 4JV5I 1IBLI 4WUCA 4WYQB 3JAMQ 4GKJE 5IT9C 2GS8A 1Z0GA 5FLXC 1XNRE 2L2NA 3D4JA 4DPTA 2B7VA 5GMEA 2V8PA 1Z0BA 4DUZI 4LFBE 1WHNA 2HK2A 2V2ZA 4JI6E 1HNXE 1T4OA 4DXLA 4OX9E 3B78A 4JI8I 4X66E 1N36E 1FKAE 3ZZTA 2UUAI 4B3ME 1S16A 1XMOI 5LMUE 4B3SI 3K1JA 3GONA 4DV5I 5LMNI 2LTSA 3VYYA 2N3HA 1KIJA 1N0VC 4DR6E 4LFCE 3ZZ0A 4DV1E 4DR2I 1NHIA 3ZM7A 4YHHE 1IBKI 1XMQE 1J5EE 1DARA 4LF5E 1N34I 3ZKBA 3PYGA 2V34A 3LPSA 1Z59A 4JI3E 4DR1I 3ADGA 4DR7E 4KHPE 4YY3E 4DV6I 2UXBE 1XNRI 4M2ZA 4DV2E 3J81Q 1BKNA 2CZ9A 4JV5E 3WU5A 4XTJA 4JI6I 4NXNE 4GKKI 4LF4E 1NZ0A 2DEIA 3T1YI 3HULA 4OX9I 4UTGA 3T1HE 3ADJA 4X66I 5LMUI 4DUZE 2HK3A 1QU6A 2DB2A 4X65I 1B62A 4FWDA 2E5LI 4FWHA 4JI8E 2OI2A 4KQVA 4LF7E 3J80Q 1GQEA 1A6FA 3WU6A 2UUAE 3C4TA 1XMOE 1K47A 4B3SE 3V2UC 2HKJA 4LFCI 4DV1I 4USKA 1UILA 5LL6R 4JI1I 2RTXA 1J5EI 2YT4A 5LMNE 2R3VA 4MYUA 3LTOA 4I3HA 1H7UA 2F4VE 3OTOI 1KVKA 4DU8A 2LTRA 4JI3I 4DR2E 2NUFA 5GMDA 4KHPI 1IBKE 4YY3I 4AQYI 4PRXA 2UXBI 2UUCI 4DV2I 2VQFI 2LUQA 4Z7YA 4HXZA 2A2CA 1O0WA 2V2QA 4URLA 4NXNI 5A2QQ 4LF4I 1OJ4A 2RS7A 4DR1E 1FWLA 3T1HI 2NA2A 3ZZUA 4DV6E 2MDRA 3Q1QA 1NHHA 3B8HA 4M1KA 3PYEA 4ED4A 3H4LA 2LBSB 1MG7A 4GKKE 1EKZA 3T1YE 1RREA 4DV3E 4LF7I 4LF8I 4UT4A 1ZM2A 1I94E 2ZITA 4P52A 3WU4A 4X65E 1FJGE 3PYFA 2E5LE 1DI2A 5IT9Q 1HNWE 4FN5A 1YYKA 3P1XA 2HFSA 4JI0I 2F4VI 2L2MA 1EI1A 4P7AA 2UUBI 4MYTA 2JVAA 1N0UA 1UHZA 4LF9E 4JI1E 1X49A 1H74A 3K17A 2R42A 1ZBTA 3OTOE 1YYWA 3J81C 1ZM3A 4M30A 1XNQE 2Q2EB 2L3CA 4AQYE 4JG4A 2UUCE 1HR0I 2L33A 2DMYA 2VQFE 1U2RA 4K0KI 2E1RA 5L3JA 1FWKA 2LJHA 2UU9I 4JI2E 4DKKA 1KKHA 1ZM4A 4LF6E 4DV3I 4DPXA 4WUBA 2LJPA 3ZKDA 2EZ6A 4EMDA 1I94I 5CFFE 3B82A 3J80C 1PIEA 1FJGI 2B3TB 2UXDE 1HNWI 2NUGA 4X64E 3J7AM 4LF8E 3J7Yp 2UXCI 4B3TI 4HYMA 3PYDA 1YYOA 4WFTA 4JYAE 3HTXA 4LF9I 3C4BA 2BM1A 1T4LB 4PU9A 1D6TA 1Z0WA 2EFGA 1H73A 4JI0E 2UUBE 2NPFA 4LFAI 1XNQI 1H72C 4PRVA 5A2QC 3JAMC 2RSMA 3LLHA 1RC7A 4USMA 2N3GA 1HNZI 4DV0I 4FWGA 1MX0A 2CPNA 4JI2I 4DV4I 4Z7CA 4LF6I 3VYXA 1XHKA 4NXMI 4HACB 1HR0E 2ZBKB 5IWAI 1N32I 4K0KE 1ELOA 4JI7E 2L2KB 1NHJA 2HKEA 2UU9E 2UXDI 5BR8E 4X64I 2XEXA 2IHR1 1QZRA 3ADLA 1Z0TA 1YZ9A 2AJ4A 4JYAI 1ZXMA 1ZM9A 1PVGA 2J7KA 4ZVIA 4HACA 4DR4E 4DU7A 1Z0VA 1N33E 4DPYA 1MU5A 1ZXNA 4DR5I 3QT8A 5FLXQ 2JY9A 2DEJA 2A2DA 3F0NA 2UXCE 4B3TE 4B3RE 1T4NA 4X62E 4DV7E 4DUYI 1IBME 3QT7A 4JI5E 1Z5AA 1Z5CA 4JI4E 1STUA 1WHQA 4OOGC 2HHHI 4LFAE 3LNUA 4DR3E 3J7AG 2DIXA 4DPWA 2KHXA 4X8WA 2X7IA 4JI7I 3ADIA 1HNZE 4DV0E 1Z0CA 4DV4E 2VQEI 5BR8I 4WUDA 2BM0A 4NXME 1S4EA 5IWAE 4GKJI 1N32E 1PKPA 1WUUA 2B7TA 1Z0EA 2LRSA 4R1FA 4DR4I 4FW9A 4LFBI 2ZM6E 1N33I 1VISA 1IBLE 1HNXI 1X47A 1Z5BA 1UEKA 2RS6A 1FNMA 4B3RI 1N36I 1B63A 4X62I 4DV7I 4B3MI 1IBMI 4JI5I 4DR5E 1H7SA 4JI4I 3M6AA 2HFUA 3QT6A 4DR3I
chains in the Genus database with same CATH superfamily
2V2VA 4DUYE 2EQ0A 1UDNA 4BA1A 4DR6I 1RR9A 1FI4A 4YHHI 4RPFA 4HY1A 3WU3A 3UK3C 1XMQI 4F9CB 5K36D 5TSEA 2BV3A 4DPUA 2EM4A 4DV5E 1KTVA 1B69A 4LF5I 3PRYA 2HHHE 1EA6A 5JEAD 2JXPA 3THOB 4OZEA 2X36A 4MDTA 2VF3A 2LUPB 2NUEA 3V5RA 3QT5A 4F9AB 3CWVA 2WW4A 2L3JA 2EMIA 2EPKX 2PNZA 4DR7I 1PJTA 1AAYA 5AASA 1NEIA 2EMZA 2WBTA 2ADRA 2LV2A 2EQ1A 5AC5A 2EOIA 1J26A 1N34E 1P42A 1RQ0A 3B4TA 3THNA 2V88A 2VQEE 3M85D 1X48A 3F6HA 2ZM6I 4JV5I 2RQLA 2EQ3A 1IBLI 4WUCA 4WYQB 3JAMQ 4GKJE 5IT9C 4M9VC 2GS8A 1Z0GA 4HTGA 3VK6A 4MU3A 2NN6C 5FLXC 3HQ1A 2I13A 1XNRE 2L2NA 2EM0A 1F2IG 3D4JA 4DPTA 2B7VA 5GMEA 4AIMA 2V8PA 1RHYA 1Z0BA 4MU4A 4DUZI 2ODRC 4LFBE 2GO4A 1WHNA 2D9HA 3M7NG 2HK2A 2V2ZA 3UHMA 4BMJA 2K4VA 4JI6E 1HNXE 1T4OA 4DXLA 2EPOA 2EPAA 2EPZA 4OX9E 3B78A 2PO0B 4JI8I 2WNRA 2EN7A 5IV8B 4X66E 4BA2A 2HGHA 1N36E 2YSPA 1FKAE 2GLIA 4L5NC 3ZZTA 2UUAI 4B3ME 1S16A 1XMOI 2NN6B 5LMUE 4B3SI 2YTFA 2EPNA 2PO1A 3BGHA 1YPNA 3IWDA 2CVEA 3K1JA 3KRNA 3GONA 5AE2A 3P06A 4DV5I 4OO1B 2ELYA 5LMNI 2LTSA 2EN1A 3Q6NA 3VYYA 2N3HA 2WBSA 1UDQA 2EORA 2M7QA 4FW5A 5KL6A 4NHRA 1KIJA 1A1IA 4DR6E 4LFCE 1N0VC 4DV1E 1USUA 2BA0D 4O5GA 4IZJD 3ZZ0A 5C0XB 4DR2I 2EMHA 1NHIA 3ZM7A 4YHHE 1IBKI 1A1LA 3KWRA 1XMQE 2JT2A 3GCMA 1J5EE 1DARA 1UDOA 4FW4A 2NN6A 2CTDA 2LCEA 2A25A 2YWQA 4LF5E 1N34I 3ZKBA 4R2SA 5A6BD 2MKDA 3EPKA 1ZU1A 2JEAA 3MHHC 3PYGA 2V34A 3LPSA 2H36X 1Z59A 4OO1A 2DLQA 4JI3E 4DR1I 3ADGA 2Z5BA 4DR7E 1DGCA 2AE8A 2EOMA 4KHPE 4YY3E 2MDGA 4DV6I 2UXBE 2EP3A 4P7DA 3DF6A 4IFDE 2BB8A 3BIDA 2CG9A 3C6MA 4M2ZA 1XNRI 4DV2E 2CSHA 3J81Q 4J8ZA 3L7ZB 4Q35B 1BKNA 2CZ9A 4JV5E 3WU5A 4XTJA 1PJQA 4JI6I 4NXNE 4GKKI 2YTOA 2VF1A 4LF4E 1NZ0A 5T6JA 2DEIA 3T1YI 3VHTB 3HULA 4UTGA 4OX9I 4BA1B 5K36C 3T1HE 3BF2A 3ADJA 2PO2A 3CDJA 1YHCA 5JEAC 4X66I 2EL6A 2JOBA 1A1JA 2JWOA 1YUIA 2G7HA 5LMUI 4IFDD 4DUZE 2EMBA 1QU6A 2HK3A 2DB2A 4X65I 2JOXA 4N3OA 1B62A 4FWDA 2E5LI 4FWHA 4JI8E 2YRKA 1USVA 2OI2A 2PNZB 4KQVA 4FK5C 4LF7E 2HC5A 4LU9A 3MSWA 3J80Q 1GQEA 5K36B 1DQ3A 1X6HA 1A6FA 2YZTA 3WU6A 3OMLA 2EM8A 3C4TA 2UUAE 1R6LA 1XMOE 1NCSA 1K47A 1YH8A 4B3SE 3V2UC 2I9IA 2EN2A 2YTQA 2HKJA 1VI7A 4LFCI 4USKA 5EL9A 5KL4A 5JEAB 4DV1I 1UILA 4IJDA 4GZNC 2PRTA 5LL6R 1A1KA 4JI1I 2V85A 2RTXA 1J5EI 2YT4A 3ZOQB 3QG5C 5LMNE 2R3VA 4MYUA 3LTOA 4I3HA 1H7UA 2F4VE 3OTOI 3L00A 3M7ND 2F8BA 4F2JC 1UBDC 1KVKA 1E3PA 4DU8A 2LTRA 2BBGA 3HKMA 4JI3I 2HJJA 1T39A 2EM6A 4DR2E 2NUFA 5GMDA 4KHPI 1IBKE 4YY3I 4AQYI 1G2FC 5K36A 4PRXA 2UXBI 3P3GA 1RMDA 2LVHA 5A6AA 1KJKA 4RH8A 2C38B 4F6NA 1G2DC 4FW7A 2EM9A 1TF3A 4DV2I 2V86A 2WNRB 5JEAA 2VQFI 2CT1A 2LUQA 4BA2B 4M0VA 4Z7YA 4HXZA 2A2CA 1O0WA 2V2QA 4URLA 4NXNI 5A2QQ 5AC4A 4LF4I 1OJ4A 2RS7A 2R76A 4DR1E 1HK7A 3P3EA 2ENAA 1FWLA 2EJ4A 1OYRA 3T1HI 1L4SA 2PO1B 2NA2A 3ZZUA 4DV6E 2GPIA 2MDRA 3Q1QA 2ENHA 2FV4B 3Q6MA 1WRJA 3CDIA 3EPHA 1YSAC 3IWCA 1X5WA 1NHHA 3B8HA 4M1KA 4J3DA 5C0XF 2YTEA 3PYEA 2EMXA 2L8TA 2VRDA 3H4LA 4BC9A 2LBSB 1MG7A 4ED4A 2PNMA 4GKKE 1EKZA 2C38A 3T1YE 4U3BA 2GQ0A 2M1SA 1RREA 4Q28A 4DV3E 4LF7I 4LF8I 2EL5A 4IFDF 2EPPA 1ZM2A 4WXDA 4UT4A 1I94E 2N8XA 2ZITA 1EH8A 4GEQB 4MLVA 4P52A 3WU4A 3KZZA 2JEAB 4X65E 1FJGE 3PYFA 2GHFA 4F6MA 2YTPA 2E5LE 1DI2A 5IT9Q 2BR2A 1HNWE 2KONA 1OYSA 2YRHA 2Z5BB 1A1GA 1YUJA 4GQUA 2EWLA 4FN5A 1YYKA 4ZYGA 3P1XA 3BBGA 2HFSA 4JI0I 2F4VI 4ZYDA 2L2MA 1EI1A 4TUIA 4KWYA 4R2AA 4P7AA 2ELZA 2UUBI 4I8OA 2EPUA 5DNYA 4MYTA 2JVAA 1N0UA 1UHZA 4L8NA 4LF9E 3EPJA 4JI1E 1X49A 1JK2A 4QNKA 1ZBQA 2EOSA 2JR1A 2YSOA 1A1HA 5DROA 2EOHA 1AH5A 2EMFA 2PO2B 1H74A 3K17A 5C0XE 2R42A 2M4IA 4IFDC 1ZBTA 2YTNA 3OTOE 3HXLA 2O1UA 4IZKA 1YYWA 3J81C 4IZJA 2CGEA 1ZM3A 4M30A 1XNQE 3KZYA 2Q2EB 1GZ6A 2L3CA 2C39B 4AQYE 5EKWA 2J7JA 4JG4A 4AM3A 2UUCE 1HR0I 2L33A 5DNLA 4LCFA 2DMYA 5AE3A 2VQFE 2IESA 5A6BA 1U2RA 4R2PA 1X3CA 4K0KI 4F54A 2E1RA 5L3JA 1FWKA 2LJUA 2LJHA 2UU9I 2DSYA 4JI2E 4DKKA 5C0XD 2LMZA 1KKHA 1ZM4A 4LF6E 4R2DA 4DV3I 2DMIA 4DPXA 2O1WA 4WUBA 2LJPA 3ZKDA 4MQYA 4NZVA 2EZ6A 2EMAA 2DRPA 1R6MA 4EMDA 2V87A 1I94I 2YU8A 5CFFE 1Y4SA 3B82A 2EE8A 2EM2A 1EH6A 4BCAA 3J80C 2C39A 1PIEA 4QNJA 1FJGI 1ZAAC 2B3TB 4N4RB 2UXDE 1HNWI 2NUGA 4X64E 2PNLA 1QNTA 3J7AM 4LF8E 3J7Yp 4DMIA 1IMUA 2UXCI 4B3TI 4HYMA 4BHCA 3PYDA 1SFEA 2EM5A 3JTZA 1YYOA 4LOMA 2LE2A 2JYAA 4WFTA 4JYAE 4OKGA 4IFDA 2YTIA 2EPLX 4O4KA 4OO1C 1OYPA 2EOYA 2EOOA 3HTXA 2JEBA 2NABA 4LF9I 2EMWA 3C4BA 2L92A 2BM1A 2YU5A 2EMLA 2BA1G 1T4LB 4PU9A 1D6TA 3PS1A 1Z0WA 2VE7C 2EFGA 1H73A 1PDAA 2EM7A 3TQMA 2RPCA 1P47A 4JI0E 1A1FA 2Z5CA 4R2RA 2VESA 3PS2A 2UUBE 2YPNA 2NPFA 2KOUA 5FWKA 5DRQA 4LFAI 1Y60A 2WP8A 1H72C 4PRVA 1XNQI 1N3GA 3EQ1A 5A2QC 4MU0A 3LMLA 3JAMC 2RSMA 2V83A 4R8OA 1UN6B 2NN6F 2MC6A 3EPLA 3LLHA 1RC7A 4USMA 2JE6B 2Q8UA 4ISAA 2N3GA 4ZYEA 2J65A 1HNZI 4DV0I 3RMPA 4MLQA 5KL5A 1MX0A 2CPNA 4FWGA 4JI2I 3P76A 2IERA 4FW6A 4DV4I 4OO1F 4WPYA 4Z7CA 4LF6I 3VYXA 2EPRA 1XHKA 4NXMI 3HPSA 4HACB 1HR0E 2ZBKB 5IWAI 4FW3A 2BR2B 4IS9A 1Y5YA 1N32I 4IS1C 4K0KE 1ELOA 4JI7E 1IQSA 2DLKA 1WXRA 2L2KB 2WCC3 1NHJA 4RHBB 2HKEA 5DRPA 2B9DA 2UU9E 2UXDI 4O43A 2M9AA 5BR8E 5A69A 2XEXA 4X64I 3AV0A 2EMYA 2JE6A 2IHR1 2DGCA 2MC5A 4HEIA 1QZRA 2YRMA 2F1DA 3ADLA 1Z0TA 2JP9A 2MKNA 1YZ9A 2AJ4A 4JYAI 1ZXMA 3AUZA 1ZM9A 2O1TA 1PVGA 4WSGA 4BHBA 2J7KA 4ZVIA 3DJWA 5KL2A 1GTKA 4DR4E 4HACA 4IZKB 4DU7A 5F3WA 1Z0VA 2EN6A 4IZJB 1N33E 4DPYA 1MU5A 4WSPA 1Y4UA 1KYQA 1ZXNA 2NN6E 2JY9A 2DEJA 3QT8A 5FLXQ 5KL7A 4WXCA 4DR5I 2A2DA 3F0NA 2UXCE 4B3TE 2C37B 3P3CA 3HJCA 2O3ZA 4BC7A 3H1CA 5DRRA 2YTGA 1EH7A 2EPCA 3H09A 4B3RE 4OO1E 2K7IA 5C0XC 5LLQA 3PS3A 4WX9A 3IWBA 1T4NA 4X62E 4DV7E 4DUYI 1IBME 3QT7A 3M85G 4JI5E 1Z5AA 1Z5CA 1X6EA 1Z1BA 4BS9A 4F9BB 2EMGA 2V8QB 4LCHA 2EN4A 4JI4E 1STUA 2EOZA 1TN9A 1WHQA 1X6FA 4OOGC 1IQOA 2NN6D 2LT7A 1MEYC 2YTJA 2HHHI 1MGTA 1TF6A 1SR9A 4LFAE 1BBGA 3LNUA 4DR3E 4R2QA 3J7AG 4R03A 2C37A 4LTYA 2EOQA 1YFHA 2PO0A 5K36F 1JK1A 4OO1D 2DIXA 2EMKA 2ODRD 2WBUA 3F6GA 4AIDA 5A6JA 4DPWA 2KHXA 4R2EA 4ZYHA 2EPMX 4P78A 4X8WA 5JEAF 2UUCI 2X7IA 1Y6ZA 3ADIA 4JI7I 1HNZE 4DV0E 2IOQA 1Z0CA 2YTDA 4DV4E 3GMEA 4X9JA 2VQEI 4IFDB 2EMCA 4WUDA 5BR8I 2FGGA 2BM0A 5ELWA 3K6QA 5A6KA 2WZOA 2BA1D 5AE1A 5KL3A 2O1VA 4NXME 1S4EA 2JEBB 4NBQA 5IWAE 4GKJI 2L6MA 2R1FA 5IXMB 1WJPA 3JU0A 1N32E 1PKPA 4LCGA 3HPZA 1WUUA 2B7TA 1Z0EA 2LRSA 4R1FA 3M99B 2EL4A 1E3HA 2GO3A 2Z5CB 4DR4I 1LLMC 3U1KA 5C0XA 2EOXA 2EPXA 3C6KA 4BBYA 4FW9A 5DNXA 4LFBI 2ZM6E 1N33I 1PJSA 5ADZA 2EM3A 2EOFA 1IBLE 4KZSA 1VISA 2WP8B 2Z5EA 3NZKA 3U1YA 1X47A 1HNXI 2EOEA 2BA0G 1UDSA 1ZR9A 1Z5BA 1UEKA 4O24A 2IOPA 2RS6A 1FNMA 1BBOA 2V89A 4B3RI 1N36I 3MHSC 1B63A 4U3DA 4X62I 4DV7I 4B3MI 1IBMI 5K36E 4JI5I 1T38A 2E72A 2JPAA 3K85A 4DR5E 1H7SA 1XXEA 2ENCA 1BB8A 5JEAE 4JI4I 4R2CA 4TUGA 3M6AA 2E1MA 2LO3A 2FTXB 3GLLA 2EN3A 4LPFA 2HFUA 3L7ZA 3ECRA 2EN8A 3DD6A 2EOJA 4MU1A 3QT6A 3FIGA 2RSIA 4DR3I
chains in the Genus database with same CATH topology
2V2VA 4DUYE 4DR6I 1RR9A 1FI4A 4YHHI 4RPFA 4HY1A 3WU3A 1XMQI 4F9CB 2BV3A 4DPUA 4DV5E 1KTVA 4LF5I 3PRYA 2HHHE 1EA6A 2X36A 2VF3A 2LUPB 2NUEA 3V5RA 3QT5A 4F9AB 3CWVA 2WW4A 2L3JA 4DR7I 5AASA 1J26A 1N34E 1RQ0A 2V88A 2VQEE 1X48A 3F6HA 2ZM6I 4JV5I 1IBLI 4WUCA 4WYQB 3JAMQ 4GKJE 5IT9C 2GS8A 1Z0GA 3VK6A 5FLXC 3HQ1A 1XNRE 2L2NA 3D4JA 4DPTA 2B7VA 5GMEA 2V8PA 1Z0BA 4DUZI 2ODRC 4LFBE 1WHNA 2HK2A 2V2ZA 4BMJA 2K4VA 4JI6E 1HNXE 1T4OA 4DXLA 4OX9E 3B78A 4JI8I 4X66E 1N36E 1FKAE 4L5NC 3ZZTA 2UUAI 4B3ME 1S16A 1XMOI 5LMUE 4B3SI 3IWDA 3K1JA 3GONA 5AE2A 3P06A 4DV5I 5LMNI 2LTSA 3Q6NA 3VYYA 2N3HA 2M7QA 1KIJA 1N0VC 4DR6E 4LFCE 1USUA 4DV1E 3ZZ0A 4IZJD 4DR2I 1NHIA 3ZM7A 4YHHE 1IBKI 3KWRA 1XMQE 1J5EE 1DARA 4LF5E 1N34I 3ZKBA 3PYGA 2V34A 3LPSA 2H36X 1Z59A 4JI3E 4DR1I 3ADGA 2Z5BA 4DR7E 4KHPE 4YY3E 4DV6I 2UXBE 4P7DA 3DF6A 2CG9A 1XNRI 4M2ZA 4DV2E 3J81Q 4J8ZA 1BKNA 2CZ9A 4JV5E 3WU5A 4XTJA 4JI6I 4NXNE 4GKKI 2VF1A 4LF4E 1NZ0A 5T6JA 2DEIA 3T1YI 3HULA 4OX9I 4UTGA 3T1HE 3ADJA 4X66I 2JOBA 2JWOA 2G7HA 5LMUI 4DUZE 2HK3A 1QU6A 2DB2A 4X65I 2JOXA 4N3OA 1B62A 4FWDA 2E5LI 4FWHA 4JI8E 1USVA 2OI2A 4KQVA 4LF7E 4LU9A 3MSWA 3J80Q 1GQEA 1DQ3A 1A6FA 2YZTA 3WU6A 3OMLA 2UUAE 3C4TA 1XMOE 1K47A 4B3SE 3V2UC 2HKJA 4LFCI 4DV1I 4USKA 1UILA 5LL6R 4JI1I 2V85A 2RTXA 1J5EI 2YT4A 3ZOQB 5LMNE 2R3VA 4MYUA 3LTOA 4I3HA 1H7UA 2F4VE 3OTOI 2F8BA 1KVKA 4DU8A 2LTRA 4JI3I 4DR2E 2NUFA 5GMDA 4KHPI 1IBKE 4YY3I 4AQYI 4PRXA 2UXBI 2UUCI 4DV2I 2V86A 2VQFI 2LUQA 4M0VA 4Z7YA 4HXZA 2A2CA 1O0WA 2V2QA 4URLA 4NXNI 5A2QQ 4LF4I 1OJ4A 2RS7A 4DR1E 1HK7A 1FWLA 3T1HI 2NA2A 3ZZUA 4DV6E 2MDRA 3Q1QA 2FV4B 3Q6MA 3IWCA 1NHHA 3B8HA 4M1KA 3PYEA 4ED4A 2L8TA 3H4LA 4BC9A 2LBSB 1MG7A 2PNMA 4GKKE 1EKZA 3T1YE 2GQ0A 2M1SA 1RREA 4Q28A 4DV3E 4LF7I 4LF8I 4UT4A 1ZM2A 1I94E 2ZITA 4GEQB 4P52A 3WU4A 4X65E 1FJGE 3PYFA 2E5LE 1DI2A 5IT9Q 1HNWE 2KONA 2Z5BB 2EWLA 4FN5A 1YYKA 3P1XA 2HFSA 4JI0I 2F4VI 2L2MA 1EI1A 4TUIA 4P7AA 2UUBI 4I8OA 5DNYA 4MYTA 2JVAA 1N0UA 1UHZA 4L8NA 4LF9E 4JI1E 1X49A 1ZBQA 2JR1A 1H74A 3K17A 2R42A 2M4IA 1ZBTA 3OTOE 3HXLA 2O1UA 4IZKA 1YYWA 3J81C 4IZJA 2CGEA 1ZM3A 4M30A 1XNQE 2Q2EB 1GZ6A 2L3CA 4AQYE 4JG4A 2UUCE 1HR0I 2L33A 2DMYA 5AE3A 2VQFE 1U2RA 4K0KI 4F54A 2E1RA 5L3JA 1FWKA 2LJHA 2UU9I 2DSYA 4JI2E 4DKKA 2LMZA 1KKHA 1ZM4A 4LF6E 4DV3I 4DPXA 2O1WA 4WUBA 2LJPA 3ZKDA 2EZ6A 4EMDA 2V87A 1I94I 5CFFE 1Y4SA 3B82A 4BCAA 3J80C 1PIEA 1FJGI 2B3TB 2UXDE 1HNWI 2NUGA 4X64E 2PNLA 3J7AM 4LF8E 3J7Yp 4DMIA 2UXCI 4B3TI 4HYMA 3PYDA 3JTZA 1YYOA 2LE2A 4WFTA 4JYAE 3HTXA 4LF9I 3C4BA 2L92A 2BM1A 1T4LB 4PU9A 1D6TA 1Z0WA 2VE7C 2EFGA 1H73A 2Z5CA 4JI0E 2UUBE 2NPFA 2KOUA 5FWKA 4LFAI 1XNQI 1H72C 4PRVA 5A2QC 3LMLA 3JAMC 2RSMA 2V83A 4R8OA 2MC6A 3LLHA 1RC7A 4USMA 2N3GA 1HNZI 4DV0I 3RMPA 4FWGA 1MX0A 2CPNA 4JI2I 4DV4I 4WPYA 4Z7CA 4LF6I 3VYXA 1XHKA 4NXMI 3HPSA 4HACB 1HR0E 2ZBKB 5IWAI 1N32I 4K0KE 1ELOA 4JI7E 1WXRA 2L2KB 1NHJA 2HKEA 2B9DA 2UU9E 2UXDI 5BR8E 4X64I 2XEXA 3AV0A 2IHR1 2MC5A 1QZRA 3ADLA 1Z0TA 1YZ9A 2AJ4A 4JYAI 1ZXMA 3AUZA 1ZM9A 2O1TA 1PVGA 2J7KA 4ZVIA 3DJWA 4DR4E 4HACA 4IZKB 4DU7A 5F3WA 1Z0VA 4IZJB 1N33E 4DPYA 1MU5A 4WSPA 1Y4UA 1ZXNA 3QT8A 5FLXQ 2JY9A 2DEJA 4DR5I 2A2DA 3F0NA 2UXCE 4B3TE 3HJCA 4BC7A 3H09A 4B3RE 3IWBA 1T4NA 4X62E 4DV7E 4DUYI 1IBME 3QT7A 4JI5E 1Z5AA 1Z5CA 4BS9A 4F9BB 4JI4E 1STUA 1WHQA 4OOGC 2HHHI 1SR9A 4LFAE 3LNUA 4DR3E 3J7AG 4R03A 4LTYA 2DIXA 2ODRD 4DPWA 3F6GA 2KHXA 4P78A 4X8WA 2X7IA 1Y6ZA 3ADIA 4JI7I 1HNZE 4DV0E 2IOQA 1Z0CA 4DV4E 2VQEI 5BR8I 4WUDA 2FGGA 2BM0A 3K6QA 2WZOA 5AE1A 2O1VA 4NXME 1S4EA 5IWAE 4GKJI 2L6MA 3JU0A 1N32E 1PKPA 3HPZA 1WUUA 2B7TA 1Z0EA 2LRSA 4R1FA 2Z5CB 4DR4I 4BBYA 4FW9A 4LFBI 2ZM6E 1N33I 5ADZA 1VISA 1IBLE 4KZSA 2Z5EA 1HNXI 1X47A 1Z5BA 1UEKA 2IOPA 2RS6A 1FNMA 2V89A 4B3RI 1N36I 1B63A 4X62I 4DV7I 4B3MI 1IBMI 4JI5I 3K85A 4DR5E 1H7SA 4JI4I 4TUGA 3M6AA 2E1MA 2FTXB 2HFUA 3QT6A 3FIGA 2V8QB 4DR3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2V A;  4DUY E;  4DR6 I;  1RR9 A;  1FI4 A;  4YHH I;  4RPF A;  4HY1 A;  3WU3 A;  1XMQ I;  2BV3 A;  4DPU A;  4DV5 E;  1KTV A;  4LF5 I;  2HHH E;  1EA6 A;  2X36 A;  2VF3 A;  2LUP B;  2NUE A;  3V5R A;  3QT5 A;  3CWV A;  2WW4 A;  2L3J A;  4DR7 I;  1J26 A;  1N34 E;  1RQ0 A;  2VQE E;  1X48 A;  2ZM6 I;  4JV5 I;  1IBL I;  4WUC A;  4WYQ B;  3JAM Q;  4GKJ E;  5IT9 C;  2GS8 A;  1Z0G A;  5FLX C;  1XNR E;  2L2N A;  3D4J A;  4DPT A;  2B7V A;  5GME A;  2V8P A;  1Z0B A;  4DUZ I;  4LFB E;  1WHN A;  2HK2 A;  2V2Z A;  4JI6 E;  1HNX E;  1T4O A;  4DXL A;  4OX9 E;  3B78 A;  4JI8 I;  4X66 E;  1N36 E;  1FKA E;  3ZZT A;  2UUA I;  4B3M E;  1S16 A;  1XMO I;  5LMU E;  4B3S I;  3K1J A;  3GON A;  4DV5 I;  5LMN I;  2LTS A;  3VYY A;  2N3H A;  1KIJ A;  1N0V C;  4DR6 E;  4LFC E;  3ZZ0 A;  4DV1 E;  4DR2 I;  1NHI A;  3ZM7 A;  4YHH E;  1IBK I;  1XMQ E;  1J5E E;  1DAR A;  4LF5 E;  1N34 I;  3ZKB A;  3PYG A;  2V34 A;  3LPS A;  1Z59 A;  4JI3 E;  4DR1 I;  3ADG A;  4DR7 E;  4KHP E;  4YY3 E;  4DV6 I;  2UXB E;  1XNR I;  4M2Z A;  4DV2 E;  3J81 Q;  1BKN A;  2CZ9 A;  4JV5 E;  3WU5 A;  4XTJ A;  4JI6 I;  4NXN E;  4GKK I;  4LF4 E;  1NZ0 A;  2DEI A;  3T1Y I;  3HUL A;  4OX9 I;  4UTG A;  3T1H E;  3ADJ A;  4X66 I;  5LMU I;  4DUZ E;  2HK3 A;  1QU6 A;  2DB2 A;  4X65 I;  1B62 A;  4FWD A;  2E5L I;  4FWH A;  4JI8 E;  2OI2 A;  4KQV A;  4LF7 E;  3J80 Q;  1GQE A;  1A6F A;  3WU6 A;  2UUA E;  3C4T A;  1XMO E;  1K47 A;  4B3S E;  3V2U C;  2HKJ A;  4LFC I;  4DV1 I;  4USK A;  1UIL A;  5LL6 R;  4JI1 I;  2RTX A;  1J5E I;  2YT4 A;  5LMN E;  2R3V A;  4MYU A;  3LTO A;  4I3H A;  1H7U A;  2F4V E;  3OTO I;  1KVK A;  4DU8 A;  2LTR A;  4JI3 I;  4DR2 E;  2NUF A;  5GMD A;  4KHP I;  1IBK E;  4YY3 I;  4AQY I;  4PRX A;  2UXB I;  2UUC I;  4DV2 I;  2VQF I;  2LUQ A;  4Z7Y A;  4HXZ A;  2A2C A;  1O0W A;  2V2Q A;  4URL A;  4NXN I;  5A2Q Q;  4LF4 I;  1OJ4 A;  2RS7 A;  4DR1 E;  1FWL A;  3T1H I;  2NA2 A;  3ZZU A;  4DV6 E;  2MDR A;  3Q1Q A;  1NHH A;  3B8H A;  4M1K A;  3PYE A;  4ED4 A;  3H4L A;  2LBS B;  1MG7 A;  4GKK E;  1EKZ A;  3T1Y E;  1RRE A;  4DV3 E;  4LF7 I;  4LF8 I;  4UT4 A;  1ZM2 A;  1I94 E;  2ZIT A;  4P52 A;  3WU4 A;  4X65 E;  1FJG E;  3PYF A;  2E5L E;  1DI2 A;  5IT9 Q;  1HNW E;  4FN5 A;  1YYK A;  3P1X A;  2HFS A;  4JI0 I;  2F4V I;  2L2M A;  1EI1 A;  4P7A A;  2UUB I;  4MYT A;  2JVA A;  1N0U A;  1UHZ A;  4LF9 E;  4JI1 E;  1X49 A;  1H74 A;  3K17 A;  2R42 A;  1ZBT A;  3OTO E;  1YYW A;  3J81 C;  1ZM3 A;  4M30 A;  1XNQ E;  2Q2E B;  2L3C A;  4AQY E;  4JG4 A;  2UUC E;  1HR0 I;  2L33 A;  2DMY A;  2VQF E;  1U2R A;  4K0K I;  2E1R A;  5L3J A;  1FWK A;  2LJH A;  2UU9 I;  4JI2 E;  4DKK A;  1KKH A;  1ZM4 A;  4LF6 E;  4DV3 I;  4DPX A;  4WUB A;  2LJP A;  3ZKD A;  2EZ6 A;  4EMD A;  1I94 I;  5CFF E;  3B82 A;  3J80 C;  1PIE A;  1FJG I;  2B3T B;  2UXD E;  1HNW I;  2NUG A;  4X64 E;  3J7A M;  4LF8 E;  3J7Y p;  2UXC I;  4B3T I;  4HYM A;  3PYD A;  1YYO A;  4WFT A;  4JYA E;  3HTX A;  4LF9 I;  3C4B A;  2BM1 A;  1T4L B;  4PU9 A;  1D6T A;  1Z0W A;  2EFG A;  1H73 A;  4JI0 E;  2UUB E;  2NPF A;  4LFA I;  1XNQ I;  1H72 C;  4PRV A;  5A2Q C;  3JAM C;  2RSM A;  3LLH A;  1RC7 A;  4USM A;  2N3G A;  1HNZ I;  4DV0 I;  4FWG A;  1MX0 A;  2CPN A;  4JI2 I;  4DV4 I;  4Z7C A;  4LF6 I;  3VYX A;  1XHK A;  4NXM I;  4HAC B;  1HR0 E;  2ZBK B;  5IWA I;  1N32 I;  4K0K E;  1ELO A;  4JI7 E;  2L2K B;  1NHJ A;  2HKE A;  2UU9 E;  2UXD I;  5BR8 E;  4X64 I;  2XEX A;  2IHR 1;  1QZR A;  3ADL A;  1Z0T A;  1YZ9 A;  2AJ4 A;  4JYA I;  1ZXM A;  1ZM9 A;  1PVG A;  2J7K A;  4ZVI A;  4HAC A;  4DR4 E;  4DU7 A;  1Z0V A;  1N33 E;  4DPY A;  1MU5 A;  1ZXN A;  4DR5 I;  3QT8 A;  5FLX Q;  2JY9 A;  2DEJ A;  2A2D A;  3F0N A;  2UXC E;  4B3T E;  4B3R E;  1T4N A;  4X62 E;  4DV7 E;  4DUY I;  1IBM E;  3QT7 A;  4JI5 E;  1Z5A A;  1Z5C A;  4JI4 E;  1STU A;  1WHQ A;  4OOG C;  2HHH I;  4LFA E;  3LNU A;  4DR3 E;  3J7A G;  2DIX A;  4DPW A;  2KHX A;  4X8W A;  2X7I A;  4JI7 I;  3ADI A;  1HNZ E;  4DV0 E;  1Z0C A;  4DV4 E;  2VQE I;  5BR8 I;  4WUD A;  2BM0 A;  4NXM E;  1S4E A;  5IWA E;  4GKJ I;  1N32 E;  1PKP A;  1WUU A;  2B7T A;  1Z0E A;  2LRS A;  4R1F A;  4DR4 I;  4FW9 A;  4LFB I;  2ZM6 E;  1N33 I;  1VIS A;  1IBL E;  1HNX I;  1X47 A;  1Z5B A;  1UEK A;  2RS6 A;  1FNM A;  4B3R I;  1N36 I;  1B63 A;  4X62 I;  4DV7 I;  4B3M I;  1IBM I;  4JI5 I;  4DR5 E;  1H7S A;  4JI4 I;  3M6A A;  2HFU A;  3QT6 A;  4DR3 I; 
#chains in the Genus database with same CATH topology
 2V2V A;  4DUY E;  2EQ0 A;  1UDN A;  4BA1 A;  4DR6 I;  1RR9 A;  1FI4 A;  4YHH I;  4RPF A;  4HY1 A;  3WU3 A;  3UK3 C;  1XMQ I;  4F9C B;  5K36 D;  5TSE A;  2BV3 A;  4DPU A;  2EM4 A;  4DV5 E;  1KTV A;  1B69 A;  4LF5 I;  3PRY A;  2HHH E;  1EA6 A;  5JEA D;  2JXP A;  3THO B;  4OZE A;  2X36 A;  4MDT A;  2VF3 A;  2LUP B;  2NUE A;  3V5R A;  3QT5 A;  4F9A B;  3CWV A;  2WW4 A;  2L3J A;  2EMI A;  2EPK X;  2PNZ A;  4DR7 I;  1PJT A;  1AAY A;  5AAS A;  1NEI A;  2EMZ A;  2WBT A;  2ADR A;  2LV2 A;  2EQ1 A;  5AC5 A;  2EOI A;  1J26 A;  1N34 E;  1P42 A;  1RQ0 A;  3B4T A;  3THN A;  2V88 A;  2VQE E;  3M85 D;  1X48 A;  3F6H A;  2ZM6 I;  4JV5 I;  2RQL A;  2EQ3 A;  1IBL I;  4WUC A;  4WYQ B;  3JAM Q;  4GKJ E;  5IT9 C;  4M9V C;  2GS8 A;  1Z0G A;  4HTG A;  3VK6 A;  4MU3 A;  2NN6 C;  5FLX C;  3HQ1 A;  2I13 A;  1XNR E;  2L2N A;  2EM0 A;  1F2I G;  3D4J A;  4DPT A;  2B7V A;  5GME A;  4AIM A;  2V8P A;  1RHY A;  1Z0B A;  4MU4 A;  4DUZ I;  2ODR C;  4LFB E;  2GO4 A;  1WHN A;  2D9H A;  3M7N G;  2HK2 A;  2V2Z A;  3UHM A;  4BMJ A;  2K4V A;  4JI6 E;  1HNX E;  1T4O A;  4DXL A;  2EPO A;  2EPA A;  2EPZ A;  4OX9 E;  3B78 A;  2PO0 B;  4JI8 I;  2WNR A;  2EN7 A;  5IV8 B;  4X66 E;  4BA2 A;  2HGH A;  1N36 E;  2YSP A;  1FKA E;  2GLI A;  4L5N C;  3ZZT A;  2UUA I;  4B3M E;  1S16 A;  1XMO I;  2NN6 B;  5LMU E;  4B3S I;  2YTF A;  2EPN A;  2PO1 A;  3BGH A;  1YPN A;  3IWD A;  2CVE A;  3K1J A;  3KRN A;  3GON A;  5AE2 A;  3P06 A;  4DV5 I;  4OO1 B;  2ELY A;  5LMN I;  2LTS A;  2EN1 A;  3Q6N A;  3VYY A;  2N3H A;  2WBS A;  1UDQ A;  2EOR A;  2M7Q A;  4FW5 A;  5KL6 A;  4NHR A;  1KIJ A;  1A1I A;  4DR6 E;  4LFC E;  1N0V C;  4DV1 E;  1USU A;  2BA0 D;  4O5G A;  4IZJ D;  3ZZ0 A;  5C0X B;  4DR2 I;  2EMH A;  1NHI A;  3ZM7 A;  4YHH E;  1IBK I;  1A1L A;  3KWR A;  1XMQ E;  2JT2 A;  3GCM A;  1J5E E;  1DAR A;  1UDO A;  4FW4 A;  2NN6 A;  2CTD A;  2LCE A;  2A25 A;  2YWQ A;  4LF5 E;  1N34 I;  3ZKB A;  4R2S A;  5A6B D;  2MKD A;  3EPK A;  1ZU1 A;  2JEA A;  3MHH C;  3PYG A;  2V34 A;  3LPS A;  2H36 X;  1Z59 A;  4OO1 A;  2DLQ A;  4JI3 E;  4DR1 I;  3ADG A;  2Z5B A;  4DR7 E;  1DGC A;  2AE8 A;  2EOM A;  4KHP E;  4YY3 E;  2MDG A;  4DV6 I;  2UXB E;  2EP3 A;  4P7D A;  3DF6 A;  4IFD E;  2BB8 A;  3BID A;  2CG9 A;  3C6M A;  4M2Z A;  1XNR I;  4DV2 E;  2CSH A;  3J81 Q;  4J8Z A;  3L7Z B;  4Q35 B;  1BKN A;  2CZ9 A;  4JV5 E;  3WU5 A;  4XTJ A;  1PJQ A;  4JI6 I;  4NXN E;  4GKK I;  2YTO A;  2VF1 A;  4LF4 E;  1NZ0 A;  5T6J A;  2DEI A;  3T1Y I;  3VHT B;  3HUL A;  4UTG A;  4OX9 I;  4BA1 B;  5K36 C;  3T1H E;  3BF2 A;  3ADJ A;  2PO2 A;  3CDJ A;  1YHC A;  5JEA C;  4X66 I;  2EL6 A;  2JOB A;  1A1J A;  2JWO A;  1YUI A;  2G7H A;  5LMU I;  4IFD D;  4DUZ E;  2EMB A;  1QU6 A;  2HK3 A;  2DB2 A;  4X65 I;  2JOX A;  4N3O A;  1B62 A;  4FWD A;  2E5L I;  4FWH A;  4JI8 E;  2YRK A;  1USV A;  2OI2 A;  2PNZ B;  4KQV A;  4FK5 C;  4LF7 E;  2HC5 A;  4LU9 A;  3MSW A;  3J80 Q;  1GQE A;  5K36 B;  1DQ3 A;  1X6H A;  1A6F A;  2YZT A;  3WU6 A;  3OML A;  2EM8 A;  3C4T A;  2UUA E;  1R6L A;  1XMO E;  1NCS A;  1K47 A;  1YH8 A;  4B3S E;  3V2U C;  2I9I A;  2EN2 A;  2YTQ A;  2HKJ A;  1VI7 A;  4LFC I;  4USK A;  5EL9 A;  5KL4 A;  5JEA B;  4DV1 I;  1UIL A;  4IJD A;  4GZN C;  2PRT A;  5LL6 R;  1A1K A;  4JI1 I;  2V85 A;  2RTX A;  1J5E I;  2YT4 A;  3ZOQ B;  3QG5 C;  5LMN E;  2R3V A;  4MYU A;  3LTO A;  4I3H A;  1H7U A;  2F4V E;  3OTO I;  3L00 A;  3M7N D;  2F8B A;  4F2J C;  1UBD C;  1KVK A;  1E3P A;  4DU8 A;  2LTR A;  2BBG A;  3HKM A;  4JI3 I;  2HJJ A;  1T39 A;  2EM6 A;  4DR2 E;  2NUF A;  5GMD A;  4KHP I;  1IBK E;  4YY3 I;  4AQY I;  1G2F C;  5K36 A;  4PRX A;  2UXB I;  3P3G A;  1RMD A;  2LVH A;  5A6A A;  1KJK A;  4RH8 A;  2C38 B;  4F6N A;  1G2D C;  4FW7 A;  2EM9 A;  1TF3 A;  4DV2 I;  2V86 A;  2WNR B;  5JEA A;  2VQF I;  2CT1 A;  2LUQ A;  4BA2 B;  4M0V A;  4Z7Y A;  4HXZ A;  2A2C A;  1O0W A;  2V2Q A;  4URL A;  4NXN I;  5A2Q Q;  5AC4 A;  4LF4 I;  1OJ4 A;  2RS7 A;  2R76 A;  4DR1 E;  1HK7 A;  3P3E A;  2ENA A;  1FWL A;  2EJ4 A;  1OYR A;  3T1H I;  1L4S A;  2PO1 B;  2NA2 A;  3ZZU A;  4DV6 E;  2GPI A;  2MDR A;  3Q1Q A;  2ENH A;  2FV4 B;  3Q6M A;  1WRJ A;  3CDI A;  3EPH A;  1YSA C;  3IWC A;  1X5W A;  1NHH A;  3B8H A;  4M1K A;  4J3D A;  5C0X F;  2YTE A;  3PYE A;  2EMX A;  2L8T A;  2VRD A;  3H4L A;  4BC9 A;  2LBS B;  1MG7 A;  4ED4 A;  2PNM A;  4GKK E;  1EKZ A;  2C38 A;  3T1Y E;  4U3B A;  2GQ0 A;  2M1S A;  1RRE A;  4Q28 A;  4DV3 E;  4LF7 I;  4LF8 I;  2EL5 A;  4IFD F;  2EPP A;  1ZM2 A;  4WXD A;  4UT4 A;  1I94 E;  2N8X A;  2ZIT A;  1EH8 A;  4GEQ B;  4MLV A;  4P52 A;  3WU4 A;  3KZZ A;  2JEA B;  4X65 E;  1FJG E;  3PYF A;  2GHF A;  4F6M A;  2YTP A;  2E5L E;  1DI2 A;  5IT9 Q;  2BR2 A;  1HNW E;  2KON A;  1OYS A;  2YRH A;  2Z5B B;  1A1G A;  1YUJ A;  4GQU A;  2EWL A;  4FN5 A;  1YYK A;  4ZYG A;  3P1X A;  3BBG A;  2HFS A;  4JI0 I;  2F4V I;  4ZYD A;  2L2M A;  1EI1 A;  4TUI A;  4KWY A;  4R2A A;  4P7A A;  2ELZ A;  2UUB I;  4I8O A;  2EPU A;  5DNY A;  4MYT A;  2JVA A;  1N0U A;  1UHZ A;  4L8N A;  4LF9 E;  3EPJ A;  4JI1 E;  1X49 A;  1JK2 A;  4QNK A;  1ZBQ A;  2EOS A;  2JR1 A;  2YSO A;  1A1H A;  5DRO A;  2EOH A;  1AH5 A;  2EMF A;  2PO2 B;  1H74 A;  3K17 A;  5C0X E;  2R42 A;  2M4I A;  4IFD C;  1ZBT A;  2YTN A;  3OTO E;  3HXL A;  2O1U A;  4IZK A;  1YYW A;  3J81 C;  4IZJ A;  2CGE A;  1ZM3 A;  4M30 A;  1XNQ E;  3KZY A;  2Q2E B;  1GZ6 A;  2L3C A;  2C39 B;  4AQY E;  5EKW A;  2J7J A;  4JG4 A;  4AM3 A;  2UUC E;  1HR0 I;  2L33 A;  5DNL A;  4LCF A;  2DMY A;  5AE3 A;  2VQF E;  2IES A;  5A6B A;  1U2R A;  4R2P A;  1X3C A;  4K0K I;  4F54 A;  2E1R A;  5L3J A;  1FWK A;  2LJU A;  2LJH A;  2UU9 I;  2DSY A;  4JI2 E;  4DKK A;  5C0X D;  2LMZ A;  1KKH A;  1ZM4 A;  4LF6 E;  4R2D A;  4DV3 I;  2DMI A;  4DPX A;  2O1W A;  4WUB A;  2LJP A;  3ZKD A;  4MQY A;  4NZV A;  2EZ6 A;  2EMA A;  2DRP A;  1R6M A;  4EMD A;  2V87 A;  1I94 I;  2YU8 A;  5CFF E;  1Y4S A;  3B82 A;  2EE8 A;  2EM2 A;  1EH6 A;  4BCA A;  3J80 C;  2C39 A;  1PIE A;  4QNJ A;  1FJG I;  1ZAA C;  2B3T B;  4N4R B;  2UXD E;  1HNW I;  2NUG A;  4X64 E;  2PNL A;  1QNT A;  3J7A M;  4LF8 E;  3J7Y p;  4DMI A;  1IMU A;  2UXC I;  4B3T I;  4HYM A;  4BHC A;  3PYD A;  1SFE A;  2EM5 A;  3JTZ A;  1YYO A;  4LOM A;  2LE2 A;  2JYA A;  4WFT A;  4JYA E;  4OKG A;  4IFD A;  2YTI A;  2EPL X;  4O4K A;  4OO1 C;  1OYP A;  2EOY A;  2EOO A;  3HTX A;  2JEB A;  2NAB A;  4LF9 I;  2EMW A;  3C4B A;  2L92 A;  2BM1 A;  2YU5 A;  2EML A;  2BA1 G;  1T4L B;  4PU9 A;  1D6T A;  3PS1 A;  1Z0W A;  2VE7 C;  2EFG A;  1H73 A;  1PDA A;  2EM7 A;  3TQM A;  2RPC A;  1P47 A;  4JI0 E;  1A1F A;  2Z5C A;  4R2R A;  2VES A;  3PS2 A;  2UUB E;  2YPN A;  2NPF A;  2KOU A;  5FWK A;  5DRQ A;  4LFA I;  1Y60 A;  2WP8 A;  1H72 C;  4PRV A;  1XNQ I;  1N3G A;  3EQ1 A;  5A2Q C;  4MU0 A;  3LML A;  3JAM C;  2RSM A;  2V83 A;  4R8O A;  1UN6 B;  2NN6 F;  2MC6 A;  3EPL A;  3LLH A;  1RC7 A;  4USM A;  2JE6 B;  2Q8U A;  4ISA A;  2N3G A;  4ZYE A;  2J65 A;  1HNZ I;  4DV0 I;  3RMP A;  4MLQ A;  5KL5 A;  1MX0 A;  2CPN A;  4FWG A;  4JI2 I;  3P76 A;  2IER A;  4FW6 A;  4DV4 I;  4OO1 F;  4WPY A;  4Z7C A;  4LF6 I;  3VYX A;  2EPR A;  1XHK A;  4NXM I;  3HPS A;  4HAC B;  1HR0 E;  2ZBK B;  5IWA I;  4FW3 A;  2BR2 B;  4IS9 A;  1Y5Y A;  1N32 I;  4IS1 C;  4K0K E;  1ELO A;  4JI7 E;  1IQS A;  2DLK A;  1WXR A;  2L2K B;  2WCC 3;  1NHJ A;  4RHB B;  2HKE A;  5DRP A;  2B9D A;  2UU9 E;  2UXD I;  4O43 A;  2M9A A;  5BR8 E;  5A69 A;  2XEX A;  4X64 I;  3AV0 A;  2EMY A;  2JE6 A;  2IHR 1;  2DGC A;  2MC5 A;  4HEI A;  1QZR A;  2YRM A;  2F1D A;  3ADL A;  1Z0T A;  2JP9 A;  2MKN A;  1YZ9 A;  2AJ4 A;  4JYA I;  1ZXM A;  3AUZ A;  1ZM9 A;  2O1T A;  1PVG A;  4WSG A;  4BHB A;  2J7K A;  4ZVI A;  3DJW A;  5KL2 A;  1GTK A;  4DR4 E;  4HAC A;  4IZK B;  4DU7 A;  5F3W A;  1Z0V A;  2EN6 A;  4IZJ B;  1N33 E;  4DPY A;  1MU5 A;  4WSP A;  1Y4U A;  1KYQ A;  1ZXN A;  2NN6 E;  2JY9 A;  2DEJ A;  3QT8 A;  5FLX Q;  5KL7 A;  4WXC A;  4DR5 I;  2A2D A;  3F0N A;  2UXC E;  4B3T E;  2C37 B;  3P3C A;  3HJC A;  2O3Z A;  4BC7 A;  3H1C A;  5DRR A;  2YTG A;  1EH7 A;  2EPC A;  3H09 A;  4B3R E;  4OO1 E;  2K7I A;  5C0X C;  5LLQ A;  3PS3 A;  4WX9 A;  3IWB A;  1T4N A;  4X62 E;  4DV7 E;  4DUY I;  1IBM E;  3QT7 A;  3M85 G;  4JI5 E;  1Z5A A;  1Z5C A;  1X6E A;  1Z1B A;  4BS9 A;  4F9B B;  2EMG A;  2V8Q B;  4LCH A;  2EN4 A;  4JI4 E;  1STU A;  2EOZ A;  1TN9 A;  1WHQ A;  1X6F A;  4OOG C;  1IQO A;  2NN6 D;  2LT7 A;  1MEY C;  2YTJ A;  2HHH I;  1MGT A;  1TF6 A;  1SR9 A;  4LFA E;  1BBG A;  3LNU A;  4DR3 E;  4R2Q A;  3J7A G;  4R03 A;  2C37 A;  4LTY A;  2EOQ A;  1YFH A;  2PO0 A;  5K36 F;  1JK1 A;  4OO1 D;  2DIX A;  2EMK A;  2ODR D;  2WBU A;  3F6G A;  4AID A;  5A6J A;  4DPW A;  2KHX A;  4R2E A;  4ZYH A;  2EPM X;  4P78 A;  4X8W A;  5JEA F;  2UUC I;  2X7I A;  1Y6Z A;  3ADI A;  4JI7 I;  1HNZ E;  4DV0 E;  2IOQ A;  1Z0C A;  2YTD A;  4DV4 E;  3GME A;  4X9J A;  2VQE I;  4IFD B;  2EMC A;  4WUD A;  5BR8 I;  2FGG A;  2BM0 A;  5ELW A;  3K6Q A;  5A6K A;  2WZO A;  2BA1 D;  5AE1 A;  5KL3 A;  2O1V A;  4NXM E;  1S4E A;  2JEB B;  4NBQ A;  5IWA E;  4GKJ I;  2L6M A;  2R1F A;  5IXM B;  1WJP A;  3JU0 A;  1N32 E;  1PKP A;  4LCG A;  3HPZ A;  1WUU A;  2B7T A;  1Z0E A;  2LRS A;  4R1F A;  3M99 B;  2EL4 A;  1E3H A;  2GO3 A;  2Z5C B;  4DR4 I;  1LLM C;  3U1K A;  5C0X A;  2EOX A;  2EPX A;  3C6K A;  4BBY A;  4FW9 A;  5DNX A;  4LFB I;  2ZM6 E;  1N33 I;  1PJS A;  5ADZ A;  2EM3 A;  2EOF A;  1IBL E;  4KZS A;  1VIS A;  2WP8 B;  2Z5E A;  3NZK A;  3U1Y A;  1X47 A;  1HNX I;  2EOE A;  2BA0 G;  1UDS A;  1ZR9 A;  1Z5B A;  1UEK A;  4O24 A;  2IOP A;  2RS6 A;  1FNM A;  1BBO A;  2V89 A;  4B3R I;  1N36 I;  3MHS C;  1B63 A;  4U3D A;  4X62 I;  4DV7 I;  4B3M I;  1IBM I;  5K36 E;  4JI5 I;  1T38 A;  2E72 A;  2JPA A;  3K85 A;  4DR5 E;  1H7S A;  1XXE A;  2ENC A;  1BB8 A;  5JEA E;  4JI4 I;  4R2C A;  4TUG A;  3M6A A;  2E1M A;  2LO3 A;  2FTX B;  3GLL A;  2EN3 A;  4LPF A;  2HFU A;  3L7Z A;  3ECR A;  2EN8 A;  3DD6 A;  2EOJ A;  4MU1 A;  3QT6 A;  3FIG A;  2RSI A;  4DR3 I; 
#chains in the Genus database with same CATH homology
 2V2V A;  4DUY E;  4DR6 I;  1RR9 A;  1FI4 A;  4YHH I;  4RPF A;  4HY1 A;  3WU3 A;  1XMQ I;  4F9C B;  2BV3 A;  4DPU A;  4DV5 E;  1KTV A;  4LF5 I;  3PRY A;  2HHH E;  1EA6 A;  2X36 A;  2VF3 A;  2LUP B;  2NUE A;  3V5R A;  3QT5 A;  4F9A B;  3CWV A;  2WW4 A;  2L3J A;  4DR7 I;  5AAS A;  1J26 A;  1N34 E;  1RQ0 A;  2V88 A;  2VQE E;  1X48 A;  3F6H A;  2ZM6 I;  4JV5 I;  1IBL I;  4WUC A;  4WYQ B;  3JAM Q;  4GKJ E;  5IT9 C;  2GS8 A;  1Z0G A;  3VK6 A;  5FLX C;  3HQ1 A;  1XNR E;  2L2N A;  3D4J A;  4DPT A;  2B7V A;  5GME A;  2V8P A;  1Z0B A;  4DUZ I;  2ODR C;  4LFB E;  1WHN A;  2HK2 A;  2V2Z A;  4BMJ A;  2K4V A;  4JI6 E;  1HNX E;  1T4O A;  4DXL A;  4OX9 E;  3B78 A;  4JI8 I;  4X66 E;  1N36 E;  1FKA E;  4L5N C;  3ZZT A;  2UUA I;  4B3M E;  1S16 A;  1XMO I;  5LMU E;  4B3S I;  3IWD A;  3K1J A;  3GON A;  5AE2 A;  3P06 A;  4DV5 I;  5LMN I;  2LTS A;  3Q6N A;  3VYY A;  2N3H A;  2M7Q A;  1KIJ A;  1N0V C;  4DR6 E;  4LFC E;  1USU A;  4DV1 E;  3ZZ0 A;  4IZJ D;  4DR2 I;  1NHI A;  3ZM7 A;  4YHH E;  1IBK I;  3KWR A;  1XMQ E;  1J5E E;  1DAR A;  4LF5 E;  1N34 I;  3ZKB A;  3PYG A;  2V34 A;  3LPS A;  2H36 X;  1Z59 A;  4JI3 E;  4DR1 I;  3ADG A;  2Z5B A;  4DR7 E;  4KHP E;  4YY3 E;  4DV6 I;  2UXB E;  4P7D A;  3DF6 A;  2CG9 A;  1XNR I;  4M2Z A;  4DV2 E;  3J81 Q;  4J8Z A;  1BKN A;  2CZ9 A;  4JV5 E;  3WU5 A;  4XTJ A;  4JI6 I;  4NXN E;  4GKK I;  2VF1 A;  4LF4 E;  1NZ0 A;  5T6J A;  2DEI A;  3T1Y I;  3HUL A;  4OX9 I;  4UTG A;  3T1H E;  3ADJ A;  4X66 I;  2JOB A;  2JWO A;  2G7H A;  5LMU I;  4DUZ E;  2HK3 A;  1QU6 A;  2DB2 A;  4X65 I;  2JOX A;  4N3O A;  1B62 A;  4FWD A;  2E5L I;  4FWH A;  4JI8 E;  1USV A;  2OI2 A;  4KQV A;  4LF7 E;  4LU9 A;  3MSW A;  3J80 Q;  1GQE A;  1DQ3 A;  1A6F A;  2YZT A;  3WU6 A;  3OML A;  2UUA E;  3C4T A;  1XMO E;  1K47 A;  4B3S E;  3V2U C;  2HKJ A;  4LFC I;  4DV1 I;  4USK A;  1UIL A;  5LL6 R;  4JI1 I;  2V85 A;  2RTX A;  1J5E I;  2YT4 A;  3ZOQ B;  5LMN E;  2R3V A;  4MYU A;  3LTO A;  4I3H A;  1H7U A;  2F4V E;  3OTO I;  2F8B A;  1KVK A;  4DU8 A;  2LTR A;  4JI3 I;  4DR2 E;  2NUF A;  5GMD A;  4KHP I;  1IBK E;  4YY3 I;  4AQY I;  4PRX A;  2UXB I;  2UUC I;  4DV2 I;  2V86 A;  2VQF I;  2LUQ A;  4M0V A;  4Z7Y A;  4HXZ A;  2A2C A;  1O0W A;  2V2Q A;  4URL A;  4NXN I;  5A2Q Q;  4LF4 I;  1OJ4 A;  2RS7 A;  4DR1 E;  1HK7 A;  1FWL A;  3T1H I;  2NA2 A;  3ZZU A;  4DV6 E;  2MDR A;  3Q1Q A;  2FV4 B;  3Q6M A;  3IWC A;  1NHH A;  3B8H A;  4M1K A;  3PYE A;  4ED4 A;  2L8T A;  3H4L A;  4BC9 A;  2LBS B;  1MG7 A;  2PNM A;  4GKK E;  1EKZ A;  3T1Y E;  2GQ0 A;  2M1S A;  1RRE A;  4Q28 A;  4DV3 E;  4LF7 I;  4LF8 I;  4UT4 A;  1ZM2 A;  1I94 E;  2ZIT A;  4GEQ B;  4P52 A;  3WU4 A;  4X65 E;  1FJG E;  3PYF A;  2E5L E;  1DI2 A;  5IT9 Q;  1HNW E;  2KON A;  2Z5B B;  2EWL A;  4FN5 A;  1YYK A;  3P1X A;  2HFS A;  4JI0 I;  2F4V I;  2L2M A;  1EI1 A;  4TUI A;  4P7A A;  2UUB I;  4I8O A;  5DNY A;  4MYT A;  2JVA A;  1N0U A;  1UHZ A;  4L8N A;  4LF9 E;  4JI1 E;  1X49 A;  1ZBQ A;  2JR1 A;  1H74 A;  3K17 A;  2R42 A;  2M4I A;  1ZBT A;  3OTO E;  3HXL A;  2O1U A;  4IZK A;  1YYW A;  3J81 C;  4IZJ A;  2CGE A;  1ZM3 A;  4M30 A;  1XNQ E;  2Q2E B;  1GZ6 A;  2L3C A;  4AQY E;  4JG4 A;  2UUC E;  1HR0 I;  2L33 A;  2DMY A;  5AE3 A;  2VQF E;  1U2R A;  4K0K I;  4F54 A;  2E1R A;  5L3J A;  1FWK A;  2LJH A;  2UU9 I;  2DSY A;  4JI2 E;  4DKK A;  2LMZ A;  1KKH A;  1ZM4 A;  4LF6 E;  4DV3 I;  4DPX A;  2O1W A;  4WUB A;  2LJP A;  3ZKD A;  2EZ6 A;  4EMD A;  2V87 A;  1I94 I;  5CFF E;  1Y4S A;  3B82 A;  4BCA A;  3J80 C;  1PIE A;  1FJG I;  2B3T B;  2UXD E;  1HNW I;  2NUG A;  4X64 E;  2PNL A;  3J7A M;  4LF8 E;  3J7Y p;  4DMI A;  2UXC I;  4B3T I;  4HYM A;  3PYD A;  3JTZ A;  1YYO A;  2LE2 A;  4WFT A;  4JYA E;  3HTX A;  4LF9 I;  3C4B A;  2L92 A;  2BM1 A;  1T4L B;  4PU9 A;  1D6T A;  1Z0W A;  2VE7 C;  2EFG A;  1H73 A;  2Z5C A;  4JI0 E;  2UUB E;  2NPF A;  2KOU A;  5FWK A;  4LFA I;  1XNQ I;  1H72 C;  4PRV A;  5A2Q C;  3LML A;  3JAM C;  2RSM A;  2V83 A;  4R8O A;  2MC6 A;  3LLH A;  1RC7 A;  4USM A;  2N3G A;  1HNZ I;  4DV0 I;  3RMP A;  4FWG A;  1MX0 A;  2CPN A;  4JI2 I;  4DV4 I;  4WPY A;  4Z7C A;  4LF6 I;  3VYX A;  1XHK A;  4NXM I;  3HPS A;  4HAC B;  1HR0 E;  2ZBK B;  5IWA I;  1N32 I;  4K0K E;  1ELO A;  4JI7 E;  1WXR A;  2L2K B;  1NHJ A;  2HKE A;  2B9D A;  2UU9 E;  2UXD I;  5BR8 E;  4X64 I;  2XEX A;  3AV0 A;  2IHR 1;  2MC5 A;  1QZR A;  3ADL A;  1Z0T A;  1YZ9 A;  2AJ4 A;  4JYA I;  1ZXM A;  3AUZ A;  1ZM9 A;  2O1T A;  1PVG A;  2J7K A;  4ZVI A;  3DJW A;  4DR4 E;  4HAC A;  4IZK B;  4DU7 A;  5F3W A;  1Z0V A;  4IZJ B;  1N33 E;  4DPY A;  1MU5 A;  4WSP A;  1Y4U A;  1ZXN A;  3QT8 A;  5FLX Q;  2JY9 A;  2DEJ A;  4DR5 I;  2A2D A;  3F0N A;  2UXC E;  4B3T E;  3HJC A;  4BC7 A;  3H09 A;  4B3R E;  3IWB A;  1T4N A;  4X62 E;  4DV7 E;  4DUY I;  1IBM E;  3QT7 A;  4JI5 E;  1Z5A A;  1Z5C A;  4BS9 A;  4F9B B;  4JI4 E;  1STU A;  1WHQ A;  4OOG C;  2HHH I;  1SR9 A;  4LFA E;  3LNU A;  4DR3 E;  3J7A G;  4R03 A;  4LTY A;  2DIX A;  2ODR D;  4DPW A;  3F6G A;  2KHX A;  4P78 A;  4X8W A;  2X7I A;  1Y6Z A;  3ADI A;  4JI7 I;  1HNZ E;  4DV0 E;  2IOQ A;  1Z0C A;  4DV4 E;  2VQE I;  5BR8 I;  4WUD A;  2FGG A;  2BM0 A;  3K6Q A;  2WZO A;  5AE1 A;  2O1V A;  4NXM E;  1S4E A;  5IWA E;  4GKJ I;  2L6M A;  3JU0 A;  1N32 E;  1PKP A;  3HPZ A;  1WUU A;  2B7T A;  1Z0E A;  2LRS A;  4R1F A;  2Z5C B;  4DR4 I;  4BBY A;  4FW9 A;  4LFB I;  2ZM6 E;  1N33 I;  5ADZ A;  1VIS A;  1IBL E;  4KZS A;  2Z5E A;  1HNX I;  1X47 A;  1Z5B A;  1UEK A;  2IOP A;  2RS6 A;  1FNM A;  2V89 A;  4B3R I;  1N36 I;  1B63 A;  4X62 I;  4DV7 I;  4B3M I;  1IBM I;  4JI5 I;  3K85 A;  4DR5 E;  1H7S A;  4JI4 I;  4TUG A;  3M6A A;  2E1M A;  2FTX B;  2HFU A;  3QT6 A;  3FIG A;  2V8Q B;  4DR3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...