4B3SE

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3sE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3sE02
1Z0TA 2VF3A 4X64E 2RS7A 4GKKE 4AQYI 3GONA 3VYYA 3VYXA 4DR4E 5BR8I 3QT6A 1HNXI 4HYMA 2DIXA 1T4NA 3B8HA 4DUYE 4DV0E 2V2VA 2J7KA 3C4TA 4ED4A 2UXBI 1O0WA 2L33A 4P7AA 2V2QA 3V2UC 5GMDA 1N34I 5IWAE 1N0UA 3J80C 4JI3I 1ELOA 2DB2A 4JI5E 4Z7YA 2UU9E 4KQVA 1D6TA 4JV5E 1DARA 4YY3E 4WUDA 4DV6E 4FWDA 4DV5E 5IT9C 1N33E 2F4VE 4DU7A 1J5EI 2L3CA 4LF4I 2UXDI 4MYUA 4LF5I 1U2RA 1Z5BA 1T4OA 4DPWA 4DR1E 2XEXA 1ZM2A 1NHHA 4M30A 3J7AM 2RSMA 4FW9A 1XMOE 4AQYE 4JI8I 2DEIA 4B3RI 1FKAE 1Z0EA 4LF8E 2V8PA 3J80Q 4LF9E 1NHJA 1X49A 1HNXE 4M1KA 3P1XA 4GKJI 4B3ME 3ADLA 3J7Yp 5LMUI 1RC7A 1MU5A 2Q2EB 1PIEA 1UEKA 3F0NA 4DUZE 4X66I 5A2QC 2UUAE 3T1YE 1YYOA 4JI4I 4DR2E 2L2KB 4JI6E 1RR9A 4JI0E 2UUBI 3LTOA 4B3TE 4PU9A 4KHPI 2ZBKB 1BKNA 3D4JA 3QT5A 2UUCI 1XMQI 4WFTA 4ZVIA 4LF4E 3OTOE 2V34A 3T1HI 2VQEI 2AJ4A 3WU6A 3ADIA 4DR3E 4NXNI 2V2ZA 1KVKA 4DPTA 5FLXC 2VQFE 1PKPA 4DR7I 4YHHE 2B7TA 1A6FA 4PRVA 4USKA 1IBME 2NPFA 2A2DA 2NUEA 2R42A 4LFBI 4HACA 4DU8A 2NA2A 2HHHE 2CPNA 4X66E 1YYWA 2HK3A 1ZM9A 3ZZUA 4X65I 4B3SI 2LUPB 4JI7E 2L3JA 1KKHA 2NUGA 3J81C 1N32I 1FNMA 2E5LE 1XNRI 2HKEA 4WYQB 4K0KI 4DV1E 2UUCE 2UXCI 1DI2A 2YT4A 5FLXQ 1ZM4A 3T1HE 4X62E 1MG7A 1I94I 2X7IA 5LMNI 4DV3E 3ZZTA 4LFAI 4DR6I 2LJPA 4NXNE 2KHXA 3WU5A 1UHZA 4NXME 4DR7E 1XNQI 2MDRA 3J81Q 2CZ9A 4LFBE 1HNWI 4RPFA 4DV2E 4JI2I 3H4LA 4I3HA 4FN5A 4LF6I 1HR0I 4B3SE 3WU4A 4DV4I 1KIJA 4JG4A 5BR8E 1HNZI 4X8WA 2EFGA 2UXCE 1Z59A 2WW4A 2UXBE 1Z0VA 4DPYA 1N34E 4DV7I 4JI3E 2ZITA 3B82A 1ZBTA 2JVAA 1IBKI 1IBLI 5IT9Q 2E1RA 2LTRA 4FWHA 2X36A 4UTGA 4LFCI 2LRSA 2LTSA 4JYAI 1NZ0A 1WHQA 3PYFA 3K17A 4DR5I 1H73A 1N36I 3ZKBA 2HK2A 1J5EE 3JAMC 1NHIA 2UXDE 1FWKA 4LF5E 1VISA 1K47A 1HNWE 4X64I 4LF7I 1N0VC 1MX0A 1HR0E 4HACB 1UILA 4DV4E 2RS6A 4HXZA 4DR4I 4JI8E 2ZM6I 4B3RE 5A2QQ 2LJHA 4XTJA 2B3TB 2L2NA 3K1JA 4DUYI 4DV0I 1H72C 5CFFE 3HTXA 4OX9I 1YYKA 2JY9A 4GKJE 2R3VA 2B7VA 1OJ4A 1PVGA 5LMUE 2LBSB 2OI2A 1FJGI 4JI5I 4JI4E 4JV5I 4YY3I 1H7UA 1X47A 1H7SA 2N3HA 2UUBE 4DV6I 3ZKDA 4KHPE 4DV5I 2IHR1 1B63A 1N33I 2F4VI 1Z0CA 2N3GA 1EKZA 1N36E 2NUFA 3QT8A 1XMQE 3J7AG 4DR1I 4M2ZA 1S4EA 4DXLA 2VQEE 1XMOI 1Z5AA 4LF7E 3C4BA 1EI1A 4WUCA 4LF8I 2ZM6E 4LF9I 4HY1A 1STUA 2A2CA 4OX9E 4B3MI 1XHKA 4DUZI 2UUAI 1S16A 3PYEA 3T1YI 1WUUA 4DPUA 4DR2I 1RQ0A 2BM0A 1YZ9A 1FJGE 4JI6I 4JI0I 3QT7A 4DPXA 4X65E 4B3TI 4UT4A 3PYGA 1N32E 3Q1QA 3LPSA 4DKKA 2DMYA 3M6AA 1GQEA 1XNRE 3WU3A 1X48A 1J26A 2BV3A 2HFSA 4K0KE 1Z0GA 3OTOI 1T4LB 4MYTA 3PYDA 5GMEA 3LLHA 3ZZ0A 2DEJA 1I94E 4DR3I 5LMNE 4WUBA 4LFAE 4DR6E 3B78A 5LL6R 3ADJA 2GS8A 2VQFI 4YHHI 4JI1I 1IBMI 1WHNA 1Z5CA 4P52A 1B62A 1XNQE 2HHHI 2LUQA 5L3JA 1QU6A 1H74A 2BM1A 4Z7CA 4JI2E 4URLA 2EZ6A 1ZXMA 4JI7I 4LF6E 2HFUA 4GKKI 1FI4A 1FWLA 3ADGA 2E5LI 1ZXNA 2HKJA 4DV1I 2RTXA 1HNZE 1Z0BA 5IWAI 3CWVA 4X62I 4EMDA 4DV7E 4OOGC 3HULA 4DV3I 1IBLE 1IBKE 2UU9I 3JAMQ 1ZM3A 2L2MA 4LFCE 4FWGA 1EA6A 3LNUA 4NXMI 4JYAE 1Z0WA 4JI1E 3ZM7A 4PRXA 4R1FA 4DR5E 4USMA 1RREA 4DV2I 3V5RA 1QZRA 1KTVA
chains in the Genus database with same CATH superfamily
1Z0TA 2VF3A 4X64E 2EM4A 2RS7A 2BA1G 2BA1D 4GKKE 4AQYI 2I9IA 3THOB 3GONA 3VYYA 1ZR9A 2YTNA 1DGCA 4IFDD 4IFDA 3VYXA 4DR4E 3P3GA 5K36C 5BR8I 3QT6A 4WXCA 1YSAC 1HNXI 4HYMA 2GHFA 2DIXA 1IQSA 1T4NA 1G2DC 1BB8A 2EN8A 4DUYE 1R6MA 2EP3A 2RQLA 4DV0E 2J7KA 2PO2A 2V2VA 3C4TA 4MDTA 4ED4A 1O0WA 2UXBI 2L33A 4P7AA 2V2QA 3V2UC 2YTJA 2ELYA 5GMDA 2EMXA 4KZSA 2EMYA 4QNJA 2LCEA 1BBGA 5IWAE 1USVA 1N34I 1N0UA 2ADRA 3J80C 4JI3I 3MHSC 5KL4A 2V8QB 2EMFA 1ELOA 2Z5CB 2EOMA 2DB2A 4JI5E 5K36D 4BMJA 4Z7YA 5K36A 2EPLX 2L92A 2UU9E 1ZU1A 4LCHA 4KQVA 3H09A 2C39A 3KZYA 5IXMB 5C0XF 1D6TA 4JV5E 1DARA 4YY3E 4WSGA 2GQ0A 3U1KA 3L7ZA 4WUDA 2JYAA 2Z5BA 3KWRA 4GEQB 1WXRA 4DV6E 2VF1A 1TF6A 2Z5EA 4FWDA 4DV5E 5IT9C 1N33E 2F4VE 3AUZA 2EQ0A 2GPIA 4FW6A 2VE7C 2L3CA 4MQYA 2EN4A 4DU7A 4MYUA 1J5EI 4LF4I 4LF5I 4BHCA 2EPAA 1U2RA 1Y4SA 2PNMA 4GZNC 1YUIA 4IZJB 2YTGA 1Z5BA 3GCMA 1T4OA 2YRKA 1Y4UA 4DR1E 4DPWA 2YSPA 3RMPA 2MC5A 2L6MA 1ZM2A 2XEXA 1NHHA 4M30A 3J7AM 2RSMA 4FW9A 4RHBB 1XMOE 1YHCA 2EN1A 4AQYE 1G2FC 5KL3A 3MHHC 2DEIA 4JI8I 2LMZA 4B3RI 4OO1E 4LU9A 2B9DA 1FKAE 4LF8E 1Z0EA 2V8PA 2PO0B 5C0XC 3J80Q 2JXPA 4ZYDA 1KJKA 4O24A 4LF9E 4M0VA 3GMEA 1NHJA 2EPUA 1E3HA 2F1DA 1X49A 1HNXE 4IZKB 2WBUA 4M1KA 5A6BD 3P1XA 4GKJI 1TF3A 1X6FA 4F54A 4B3ME 3ADLA 3J7Yp 2J65A 5LMUI 5DRQA 1RC7A 1MU5A 2Q2EB 1PIEA 1A1JA 1UEKA 3F0NA 2Q8UA 4DUZE 5A2QC 2EWLA 2UUAE 4X66I 2EM9A 3T1YE 1YYOA 4JI4I 2EN7A 2EM2A 2V87A 4DR2E 2CTDA 2L2KB 4JI6E 4BA1B 5C0XD 3PS1A 1RR9A 4BHBA 4JI0E 2UUBI 3LTOA 3PS2A 2JR1A 5A69A 2I13A 3OMLA 2YPNA 4B3TE 4PU9A 4KHPI 1RMDA 2WNRA 2EPKX 3HPSA 1BKNA 2ZBKB 3D4JA 2GLIA 3HKMA 2CG9A 3QT5A 2UUCI 2O1VA 3TQMA 1XMQI 4WFTA 2NN6B 5AE1A 1P47A 4LF4E 2EOHA 4ZVIA 4AIMA 3OTOE 2V34A 2DSYA 3T1HI 2PO1A 2VQEI 2AJ4A 4F9BB 1PDAA 4OO1B 3WU6A 2A25A 1YPNA 2DLKA 3EPJA 2E1MA 3ADIA 4DR3E 4NXNI 3EPLA 4N3OA 2YTIA 5KL2A 2V2ZA 2WP8B 3HXLA 1KVKA 1UDNA 2O1TA 3Q6MA 5JEAA 3M7ND 2EM0A 4DPTA 4WSPA 5FLXC 2VQFE 1PKPA 4DR7I 2RPCA 2B7TA 2EM5A 4YHHE 1A6FA 2V86A 4PRVA 4USKA 1IBME 2YU8A 2EOFA 5F3WA 2NPFA 2A2DA 4BA2A 4Q28A 2NUEA 1TN9A 1MGTA 1IMUA 2MDGA 2LO3A 2EMHA 4NHRA 2R42A 4HACA 4IFDB 4LFBI 4DU8A 2PNZA 3DF6A 2NA2A 2HHHE 2YRMA 2L8TA 2CPNA 2K4VA 4X66E 2WBSA 1YYWA 2GO3A 4R2QA 1L4SA 2PO2B 5AC5A 2HK3A 1ZM9A 3ZZUA 4X65I 1Y60A 5ELWA 4B3SI 2LUPB 2PRTA 1WRJA 4JI7E 5IV8B 5DNYA 2L3JA 3M85G 3M85D 2YTFA 3J81C 2NUGA 1KKHA 1N32I 4ISAA 1FNMA 2E5LE 3HQ1A 2IOQA 4R2AA 3P3EA 3KRNA 2HKEA 1XNRI 4WYQB 2UXDI 4K0KI 5K36B 4DV1E 2UUCE 1T38A 2C39B 2UXCI 1DI2A 3L7ZB 2Z5BB 2EPRA 2YT4A 1LLMC 4O5GA 2EMCA 4ZYGA 1ZM4A 5FLXQ 4J8ZA 2EPNA 4Q35B 3T1HE 2E72A 4X62E 2LE2A 1MG7A 5EL9A 3P06A 1I94I 2X7IA 3ZOQB 5LMNI 1A1LA 4DV3E 2EOJA 2YTQA 3ZZTA 4LFAI 4U3DA 4DR6I 2LJPA 2WBTA 3DD6A 3PS3A 4NXNE 4LTYA 2GO4A 2KHXA 2YU5A 1EH6A 4F9CB 3WU5A 1UHZA 1X6EA 2EM7A 3EQ1A 2EPCA 2M7QA 4NXME 4DR7E 4LOMA 5AE2A 4MLVA 1XNQI 2R1FA 4O4KA 1GTKA 3PRYA 2MDRA 3J81Q 2CZ9A 1YUJA 3BF2A 4LFBE 2HJJA 1A1FA 1DQ3A 1HNWI 4RPFA 4DV2E 4JI2I 3H4LA 4I3HA 4FN5A 4RH8A 1F2IG 4U3BA 4LF6I 5JEAE 2EN3A 2KONA 2NN6E 2FV4B 1HR0I 2MKDA 2V89A 4B3SE 3WU4A 4DV4I 4FW3A 2AE8A 3F6HA 5ADZA 2MC6A 2HGHA 2JE6A 2V83A 5TSEA 4R8OA 1KIJA 2JEBA 5BR8E 4JG4A 5DROA 1HNZI 4X8WA 4F9AB 3ECRA 2EQ1A 2EFGA 5FWKA 3LMLA 5A6BA 2N8XA 4LCGA 4IJDA 2UXCE 1Z59A 2WW4A 2UXBE 1Z0VA 2IERA 2WNRB 2BB8A 3L00A 4MU0A 1AH5A 1P42A 4DPYA 3B4TA 1N34E 1UDSA 4J3DA 4DV7I 4JI3E 2NABA 2JEAA 2ZITA 3B82A 1ZBTA 2CSHA 2JVAA 1IBKI 1IBLI 4IFDE 5KL6A 5IT9Q 1WJPA 3U1YA 2E1RA 2LTRA 1X3CA 2M1SA 4FWHA 5C0XA 2X36A 2PO1B 2EL5A 4UTGA 1GZ6A 4N4RB 2LRSA 2JPAA 2LTSA 3HJCA 5KL5A 4LFCI 4JYAI 2EL6A 1NZ0A 2JWOA 1WHQA 2EM3A 3H1CA 2ELZA 3PYFA 3K17A 2V88A 2HC5A 4DR5I 1H73A 5AASA 1N36I 2V85A 3EPKA 2LT7A 3ZKBA 4I8OA 2EMZA 4BS9A 1BBOA 4OO1F 5JEAB 4X9JA 2HK2A 3JAMC 1J5EE 2EPPA 2EMBA 2ENHA 2UXDE 1FWKA 1NHIA 4LF5E 2JOXA 1VISA 2BA0G 2BA0D 3VK6A 2EOZA 4HTGA 5K36E 3EPHA 2YZTA 1HNWE 2G7HA 1K47A 4X64I 1RHYA 2CVEA 4LF7I 1N0VC 4BA2B 1MX0A 3BGHA 4R2EA 1HR0E 4HACB 1UILA 1QNTA 4NZVA 5LLQA 2PNZB 4DV4E 2RS6A 2O1WA 4HXZA 4DR4I 4JI8E 2ZM6I 2JOBA 4F6MA 4R03A 2EOOA 4HEIA 4B3RE 2J7JA 3M7NG 5A2QQ 2LJHA 4TUIA 2EMKA 4XTJA 2B3TB 2L2NA 3K1JA 4NBQA 4MU4A 2NN6C 4DUYI 4DV0I 2FTXB 4WXDA 3THNA 2DLQA 1H72C 5CFFE 3HTXA 2EOQA 4OX9I 1EH8A 1YYKA 2JY9A 3AV0A 4F6NA 2DGCA 4GKJE 2R3VA 2B7VA 2M9AA 4OO1C 1OJ4A 1PVGA 3JTZA 5LMUE 2LBSB 2OI2A 4O43A 2CT1A 1FJGI 4JI5I 4JI4E 2LVHA 3C6KA 1R6LA 4JV5I 4YY3I 1H7UA 1X47A 1AAYA 2NN6D 4M9VC 1H7SA 2N3HA 2EORA 2UUBE 4MU1A 2KOUA 4DV6I 3M99B 3ZKDA 4KHPE 4DV5I 2IHR1 1SFEA 1B63A 1UDQA 2C37A 4OO1D 2F4VI 1N33I 2D9HA 4TUGA 1Z0CA 5A6JA 3K6QA 2N3GA 1EKZA 4FW7A 4L8NA 1N36E 1A1IA 2NUFA 3QT8A 2RSIA 2YTEA 1XMQE 2EPMX 3J7AG 2EM8A 4DR1I 2YTDA 2EPOA 4M2ZA 5C0XE 1S4EA 5A6KA 1A1GA 4FW4A 4IS9A 4F2JC 2C38A 3CDJA 2EMLA 2VESA 2VQEE 4DXLA 2BR2A 2H36X 2ENAA 1Z5AA 1KYQA 1XMOI 4LF7E 4R2PA 3C4BA 1EI1A 4WUCA 4ZYEA 4LF8I 3UHMA 1A1KA 2ZM6E 3VHTB 4LF9I 1JK2A 4HY1A 1ZBQA 2FGGA 2VRDA 2YSOA 5DRRA 1STUA 2A2CA 4OX9E 4B3MI 3DJWA 1XXEA 1UN6B 2JE6B 2F8BA 1XHKA 4DUZI 1PJTA 2UUAI 1S16A 3PYEA 2JEBB 3T1YI 1WUUA 1A1HA 4DPUA 4DR2I 1RQ0A 2BM0A 5AC4A 4P78A 1FJGE 1YZ9A 4P7DA 2EQ3A 4JI6I 1IQOA 3BIDA 2EN2A 4JI0I 3P76A 3QT7A 4DPXA 4X65E 4B3TI 4UT4A 3PYGA 3BBGA 3IWBA 1N32E 3Q6NA 2MKNA 2DRPA 2JEAB 3Q1QA 3LPSA 2WZOA 3IWDA 4DKKA 2DMYA 1Z1BA 1GQEA 3M6AA 3NZKA 1XNRE 3B8HA 2O1UA 1X48A 5EKWA 3WU3A 2YTPA 3C6MA 1J26A 2BV3A 2HFSA 5C0XB 4IS1C 3FIGA 1YFHA 4K0KE 2EL4A 1Z0GA 2Z5CA 2YTOA 3OTOI 2IOPA 2EE8A 5DNXA 4KWYA 1T4LB 2M4IA 5DRPA 4BBYA 4MYTA 2WCC3 3PYDA 4OKGA 2EPZA 2YWQA 5GMEA 5DNLA 3LLHA 3ZZ0A 2DEJA 1I94E 1VI7A 4DR3I 4BCAA 1X6HA 4BC7A 5LMNE 4WUBA 1EH7A 2EOEA 4LFAE 2EOSA 4DR6E 5LL6R 1OYPA 3B78A 3P3CA 3ADJA 2EOXA 4ZYHA 2GS8A 4IZJD 4IZJA 2VQFI 4YHHI 2IESA 1PJSA 5JEAF 3KZZA 4JI1I 4R2DA 2NN6F 2EN6A 1IBMI 1WHNA 1Z5CA 4P52A 1B62A 1X5WA 2EOIA 5KL7A 1XNQE 3MSWA 1NEIA 2HHHI 1PJQA 2ODRC 2LV2A 5AE3A 2EMGA 2LUQA 3QG5C 1OYSA 1QU6A 4R2RA 1USUA 5L3JA 2EJ4A 1H74A 2PO0A 2BM1A 4Z7CA 2EMWA 4JI2E 4URLA 2EZ6A 1ZXMA 4JI7I 2EM6A 4LF6E 2HFUA 4GKKI 3HPZA 4FW5A 2EOYA 1FI4A 4IZKA 4BC9A 1OYRA 5A6AA 1JK1A 1FWLA 3ADGA 2E5LI 1MEYC 1ZAAC 2BBGA 4MU3A 4L5NC 2PNLA 1NCSA 1ZXNA 4IFDF 5JEAC 2HKJA 2JT2A 1N3GA 4DV1I 4OZEA 4AM3A 2ODRD 2RTXA 3F6GA 1HNZE 4R2CA 2K7IA 4BA1A 4LPFA 1Z0BA 2EPXA 1HK7A 5IWAI 3CWVA 3GLLA 3K85A 4X62I 1T39A 2C37B 4GQUA 4FK5C 2O3ZA 4EMDA 1Y6ZA 4DV7E 4OOGC 3HULA 4DV3I 2YRHA 3CDIA 1SR9A 2R76A 3IWCA 2DMIA 1IBLE 1IBKE 2UU9I 2CGEA 3JAMQ 3JU0A 4R2SA 1ZM3A 5JEAD 2L2MA 5K36F 2C38B 4LFCE 2NN6A 3UK3C 4FWGA 1EA6A 2BR2B 3LNUA 4NXMI 4JYAE 1Z0WA 1UBDC 4WPYA 4JI1E 3ZM7A 4PRXA 4IFDC 5T6JA 4R1FA 4WX9A 1E3PA 1YH8A 2ENCA 4OO1A 4DR5E 4AIDA 1B69A 4USMA 1RREA 2EMIA 2EMAA 4DV2I 4MLQA 4DMIA 2JP9A 1UDOA 4QNKA 1Y5YA 2WP8A 4LCFA 3V5RA 1QZRA 1KTVA 2LJUA
chains in the Genus database with same CATH topology
1Z0TA 2VF3A 4X64E 2RS7A 4GKKE 4AQYI 3GONA 3VYYA 3VYXA 4DR4E 5BR8I 3QT6A 1HNXI 4HYMA 2DIXA 1T4NA 3B8HA 4DUYE 4DV0E 2V2VA 2J7KA 3C4TA 4ED4A 2UXBI 1O0WA 2L33A 4P7AA 2V2QA 3V2UC 5GMDA 4KZSA 1N34I 5IWAE 1USVA 1N0UA 3J80C 4JI3I 2V8QB 1ELOA 2Z5CB 2DB2A 4JI5E 4BMJA 4Z7YA 2L92A 2UU9E 4KQVA 3H09A 1D6TA 4JV5E 1DARA 4YY3E 2GQ0A 4WUDA 2Z5BA 3KWRA 4GEQB 1WXRA 4DV6E 2VF1A 2Z5EA 4FWDA 4DV5E 5IT9C 1N33E 2F4VE 3AUZA 4DU7A 1J5EI 2VE7C 2L3CA 4LF4I 2UXDI 4MYUA 4LF5I 1U2RA 1Y4SA 4IZJB 2PNMA 1Z5BA 1T4OA 1Y4UA 4DPWA 4DR1E 3RMPA 2MC5A 2L6MA 1ZM2A 2XEXA 1NHHA 4M30A 3J7AM 2RSMA 4FW9A 1XMOE 4AQYE 4JI8I 2DEIA 2LMZA 4B3RI 4LU9A 2B9DA 1FKAE 4LF8E 1Z0EA 2V8PA 3J80Q 4LF9E 4M0VA 1NHJA 4IZKB 1X49A 1HNXE 4M1KA 3P1XA 4GKJI 4F54A 4B3ME 3ADLA 3J7Yp 5LMUI 1RC7A 1MU5A 2Q2EB 1PIEA 1UEKA 3F0NA 4DUZE 4X66I 5A2QC 2EWLA 2UUAE 3T1YE 1YYOA 4JI4I 2V87A 4DR2E 2L2KB 4JI6E 1RR9A 4JI0E 2UUBI 3LTOA 2JR1A 3OMLA 4B3TE 4PU9A 4KHPI 3HPSA 1BKNA 2ZBKB 3D4JA 2CG9A 3QT5A 2UUCI 2O1VA 1XMQI 4WFTA 5AE1A 4ZVIA 4LF4E 3OTOE 2V34A 2DSYA 3T1HI 2VQEI 2AJ4A 4F9BB 3WU6A 2E1MA 3ADIA 4DR3E 4NXNI 4N3OA 2V2ZA 3HXLA 1KVKA 2O1TA 3Q6MA 4DPTA 4WSPA 5FLXC 2VQFE 1PKPA 4DR7I 4YHHE 2B7TA 1A6FA 2V86A 4PRVA 4USKA 1IBME 5F3WA 2NPFA 2A2DA 4Q28A 2NUEA 2R42A 4LFBI 4HACA 4DU8A 3DF6A 2NA2A 2HHHE 2L8TA 2CPNA 2K4VA 4X66E 1YYWA 2HK3A 1ZM9A 3ZZUA 4X65I 4B3SI 2LUPB 4JI7E 2L3JA 5DNYA 3J81C 2NUGA 1KKHA 1N32I 1FNMA 2E5LE 3HQ1A 2IOQA 1XNRI 2HKEA 4WYQB 4K0KI 4DV1E 2UUCE 2UXCI 1DI2A 2Z5BB 2YT4A 5FLXQ 1ZM4A 4J8ZA 3T1HE 4X62E 2LE2A 1MG7A 3P06A 1I94I 2X7IA 3ZOQB 5LMNI 4DV3E 3ZZTA 4LFAI 4DR6I 2LJPA 4NXNE 4LTYA 2KHXA 3WU5A 4F9CB 1UHZA 4NXME 2M7QA 4DR7E 5AE2A 1XNQI 3PRYA 2MDRA 3J81Q 2CZ9A 4LFBE 1DQ3A 1HNWI 4RPFA 4DV2E 4JI2I 3H4LA 4I3HA 4FN5A 4LF6I 2KONA 2FV4B 1HR0I 2V89A 4B3SE 3WU4A 4DV4I 3F6HA 5ADZA 2MC6A 2V83A 4R8OA 1KIJA 4JG4A 5BR8E 1HNZI 4X8WA 4F9AB 5FWKA 2EFGA 3LMLA 2UXCE 1Z59A 2WW4A 2UXBE 1Z0VA 4DPYA 1N34E 4DV7I 4JI3E 2ZITA 3B82A 1ZBTA 2JVAA 1IBKI 1IBLI 5IT9Q 2E1RA 2LTRA 2M1SA 4FWHA 2X36A 4UTGA 1GZ6A 4LFCI 2LRSA 2LTSA 3HJCA 4JYAI 1NZ0A 2JWOA 1WHQA 3PYFA 3K17A 2V88A 4DR5I 1H73A 5AASA 1N36I 2V85A 3ZKBA 4I8OA 4BS9A 2HK2A 3JAMC 1J5EE 1NHIA 2UXDE 1FWKA 4LF5E 2JOXA 1VISA 3VK6A 1K47A 2YZTA 1HNWE 2G7HA 4X64I 4LF7I 1N0VC 1MX0A 1HR0E 4HACB 1UILA 4DV4E 2RS6A 2O1WA 4HXZA 4DR4I 4JI8E 2ZM6I 2JOBA 4R03A 4B3RE 5A2QQ 2LJHA 4TUIA 4XTJA 2B3TB 2L2NA 3K1JA 4DUYI 4DV0I 2FTXB 1H72C 5CFFE 3HTXA 4OX9I 1YYKA 2JY9A 3AV0A 4GKJE 2R3VA 2B7VA 1OJ4A 1PVGA 3JTZA 5LMUE 2LBSB 2OI2A 1FJGI 4JI5I 4JI4E 4JV5I 4YY3I 1H7UA 1X47A 1H7SA 2N3HA 2UUBE 2KOUA 4DV6I 3ZKDA 4KHPE 4DV5I 2IHR1 1B63A 1N33I 2F4VI 4TUGA 1Z0CA 3K6QA 2N3GA 1EKZA 4L8NA 1N36E 2NUFA 3QT8A 1XMQE 3J7AG 4DR1I 4M2ZA 1S4EA 4DXLA 2VQEE 2H36X 1Z5AA 1XMOI 4LF7E 3C4BA 1EI1A 4WUCA 4LF8I 2ZM6E 4LF9I 4HY1A 1ZBQA 2FGGA 1STUA 2A2CA 4OX9E 4B3MI 3DJWA 2F8BA 1XHKA 4DUZI 2UUAI 1S16A 3PYEA 3T1YI 1WUUA 4DPUA 4DR2I 1RQ0A 2BM0A 1YZ9A 4P78A 1FJGE 4P7DA 4JI6I 4JI0I 3QT7A 4DPXA 4X65E 4B3TI 4UT4A 3PYGA 3Q6NA 3IWBA 1N32E 3Q1QA 3LPSA 2WZOA 3IWDA 4DKKA 2DMYA 3M6AA 1GQEA 1XNRE 3WU3A 2O1UA 1X48A 1J26A 2BV3A 2HFSA 4K0KE 3FIGA 2Z5CA 1Z0GA 3OTOI 2IOPA 1T4LB 2M4IA 4BBYA 4MYTA 3PYDA 5GMEA 3LLHA 3ZZ0A 2DEJA 1I94E 4DR3I 4BCAA 4BC7A 5LMNE 4WUBA 4LFAE 4DR6E 3B78A 5LL6R 3ADJA 2GS8A 4IZJD 2VQFI 4IZJA 4YHHI 4JI1I 1IBMI 1WHNA 1Z5CA 4P52A 1B62A 1XNQE 3MSWA 2HHHI 2ODRC 5AE3A 2LUQA 5L3JA 1QU6A 1USUA 1H74A 2BM1A 4Z7CA 4JI2E 4URLA 2EZ6A 1ZXMA 4JI7I 4LF6E 2HFUA 4GKKI 3HPZA 4IZKA 1FI4A 4BC9A 1FWLA 3ADGA 2E5LI 4L5NC 2PNLA 1ZXNA 2HKJA 4DV1I 2ODRD 2RTXA 3F6GA 1HNZE 1Z0BA 1HK7A 5IWAI 3CWVA 3K85A 4X62I 4EMDA 1Y6ZA 4DV7E 4OOGC 3HULA 4DV3I 1SR9A 3IWCA 1IBLE 1IBKE 2UU9I 2CGEA 3JAMQ 3JU0A 1ZM3A 2L2MA 4LFCE 4FWGA 1EA6A 3LNUA 4NXMI 4JYAE 1Z0WA 4WPYA 4JI1E 3ZM7A 4PRXA 5T6JA 4R1FA 4DR5E 4USMA 1RREA 4DV2I 4DMIA 3V5RA 1QZRA 1KTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0T A;  2VF3 A;  4X64 E;  2RS7 A;  4GKK E;  4AQY I;  3GON A;  3VYY A;  3VYX A;  4DR4 E;  5BR8 I;  3QT6 A;  1HNX I;  4HYM A;  2DIX A;  1T4N A;  3B8H A;  4DUY E;  4DV0 E;  2V2V A;  2J7K A;  3C4T A;  4ED4 A;  2UXB I;  1O0W A;  2L33 A;  4P7A A;  2V2Q A;  3V2U C;  5GMD A;  1N34 I;  5IWA E;  1N0U A;  3J80 C;  4JI3 I;  1ELO A;  2DB2 A;  4JI5 E;  4Z7Y A;  2UU9 E;  4KQV A;  1D6T A;  4JV5 E;  1DAR A;  4YY3 E;  4WUD A;  4DV6 E;  4FWD A;  4DV5 E;  5IT9 C;  1N33 E;  2F4V E;  4DU7 A;  1J5E I;  2L3C A;  4LF4 I;  2UXD I;  4MYU A;  4LF5 I;  1U2R A;  1Z5B A;  1T4O A;  4DPW A;  4DR1 E;  2XEX A;  1ZM2 A;  1NHH A;  4M30 A;  3J7A M;  2RSM A;  4FW9 A;  1XMO E;  4AQY E;  4JI8 I;  2DEI A;  4B3R I;  1FKA E;  1Z0E A;  4LF8 E;  2V8P A;  3J80 Q;  4LF9 E;  1NHJ A;  1X49 A;  1HNX E;  4M1K A;  3P1X A;  4GKJ I;  4B3M E;  3ADL A;  3J7Y p;  5LMU I;  1RC7 A;  1MU5 A;  2Q2E B;  1PIE A;  1UEK A;  3F0N A;  4DUZ E;  4X66 I;  5A2Q C;  2UUA E;  3T1Y E;  1YYO A;  4JI4 I;  4DR2 E;  2L2K B;  4JI6 E;  1RR9 A;  4JI0 E;  2UUB I;  3LTO A;  4B3T E;  4PU9 A;  4KHP I;  2ZBK B;  1BKN A;  3D4J A;  3QT5 A;  2UUC I;  1XMQ I;  4WFT A;  4ZVI A;  4LF4 E;  3OTO E;  2V34 A;  3T1H I;  2VQE I;  2AJ4 A;  3WU6 A;  3ADI A;  4DR3 E;  4NXN I;  2V2Z A;  1KVK A;  4DPT A;  5FLX C;  2VQF E;  1PKP A;  4DR7 I;  4YHH E;  2B7T A;  1A6F A;  4PRV A;  4USK A;  1IBM E;  2NPF A;  2A2D A;  2NUE A;  2R42 A;  4LFB I;  4HAC A;  4DU8 A;  2NA2 A;  2HHH E;  2CPN A;  4X66 E;  1YYW A;  2HK3 A;  1ZM9 A;  3ZZU A;  4X65 I;  4B3S I;  2LUP B;  4JI7 E;  2L3J A;  1KKH A;  2NUG A;  3J81 C;  1N32 I;  1FNM A;  2E5L E;  1XNR I;  2HKE A;  4WYQ B;  4K0K I;  4DV1 E;  2UUC E;  2UXC I;  1DI2 A;  2YT4 A;  5FLX Q;  1ZM4 A;  3T1H E;  4X62 E;  1MG7 A;  1I94 I;  2X7I A;  5LMN I;  4DV3 E;  3ZZT A;  4LFA I;  4DR6 I;  2LJP A;  4NXN E;  2KHX A;  3WU5 A;  1UHZ A;  4NXM E;  4DR7 E;  1XNQ I;  2MDR A;  3J81 Q;  2CZ9 A;  4LFB E;  1HNW I;  4RPF A;  4DV2 E;  4JI2 I;  3H4L A;  4I3H A;  4FN5 A;  4LF6 I;  1HR0 I;  4B3S E;  3WU4 A;  4DV4 I;  1KIJ A;  4JG4 A;  5BR8 E;  1HNZ I;  4X8W A;  2EFG A;  2UXC E;  1Z59 A;  2WW4 A;  2UXB E;  1Z0V A;  4DPY A;  1N34 E;  4DV7 I;  4JI3 E;  2ZIT A;  3B82 A;  1ZBT A;  2JVA A;  1IBK I;  1IBL I;  5IT9 Q;  2E1R A;  2LTR A;  4FWH A;  2X36 A;  4UTG A;  4LFC I;  2LRS A;  2LTS A;  4JYA I;  1NZ0 A;  1WHQ A;  3PYF A;  3K17 A;  4DR5 I;  1H73 A;  1N36 I;  3ZKB A;  2HK2 A;  1J5E E;  3JAM C;  1NHI A;  2UXD E;  1FWK A;  4LF5 E;  1VIS A;  1K47 A;  1HNW E;  4X64 I;  4LF7 I;  1N0V C;  1MX0 A;  1HR0 E;  4HAC B;  1UIL A;  4DV4 E;  2RS6 A;  4HXZ A;  4DR4 I;  4JI8 E;  2ZM6 I;  4B3R E;  5A2Q Q;  2LJH A;  4XTJ A;  2B3T B;  2L2N A;  3K1J A;  4DUY I;  4DV0 I;  1H72 C;  5CFF E;  3HTX A;  4OX9 I;  1YYK A;  2JY9 A;  4GKJ E;  2R3V A;  2B7V A;  1OJ4 A;  1PVG A;  5LMU E;  2LBS B;  2OI2 A;  1FJG I;  4JI5 I;  4JI4 E;  4JV5 I;  4YY3 I;  1H7U A;  1X47 A;  1H7S A;  2N3H A;  2UUB E;  4DV6 I;  3ZKD A;  4KHP E;  4DV5 I;  2IHR 1;  1B63 A;  1N33 I;  2F4V I;  1Z0C A;  2N3G A;  1EKZ A;  1N36 E;  2NUF A;  3QT8 A;  1XMQ E;  3J7A G;  4DR1 I;  4M2Z A;  1S4E A;  4DXL A;  2VQE E;  1XMO I;  1Z5A A;  4LF7 E;  3C4B A;  1EI1 A;  4WUC A;  4LF8 I;  2ZM6 E;  4LF9 I;  4HY1 A;  1STU A;  2A2C A;  4OX9 E;  4B3M I;  1XHK A;  4DUZ I;  2UUA I;  1S16 A;  3PYE A;  3T1Y I;  1WUU A;  4DPU A;  4DR2 I;  1RQ0 A;  2BM0 A;  1YZ9 A;  1FJG E;  4JI6 I;  4JI0 I;  3QT7 A;  4DPX A;  4X65 E;  4B3T I;  4UT4 A;  3PYG A;  1N32 E;  3Q1Q A;  3LPS A;  4DKK A;  2DMY A;  3M6A A;  1GQE A;  1XNR E;  3WU3 A;  1X48 A;  1J26 A;  2BV3 A;  2HFS A;  4K0K E;  1Z0G A;  3OTO I;  1T4L B;  4MYT A;  3PYD A;  5GME A;  3LLH A;  3ZZ0 A;  2DEJ A;  1I94 E;  4DR3 I;  5LMN E;  4WUB A;  4LFA E;  4DR6 E;  3B78 A;  5LL6 R;  3ADJ A;  2GS8 A;  2VQF I;  4YHH I;  4JI1 I;  1IBM I;  1WHN A;  1Z5C A;  4P52 A;  1B62 A;  1XNQ E;  2HHH I;  2LUQ A;  5L3J A;  1QU6 A;  1H74 A;  2BM1 A;  4Z7C A;  4JI2 E;  4URL A;  2EZ6 A;  1ZXM A;  4JI7 I;  4LF6 E;  2HFU A;  4GKK I;  1FI4 A;  1FWL A;  3ADG A;  2E5L I;  1ZXN A;  2HKJ A;  4DV1 I;  2RTX A;  1HNZ E;  1Z0B A;  5IWA I;  3CWV A;  4X62 I;  4EMD A;  4DV7 E;  4OOG C;  3HUL A;  4DV3 I;  1IBL E;  1IBK E;  2UU9 I;  3JAM Q;  1ZM3 A;  2L2M A;  4LFC E;  4FWG A;  1EA6 A;  3LNU A;  4NXM I;  4JYA E;  1Z0W A;  4JI1 E;  3ZM7 A;  4PRX A;  4R1F A;  4DR5 E;  4USM A;  1RRE A;  4DV2 I;  3V5R A;  1QZR A;  1KTV A; 
#chains in the Genus database with same CATH topology
 1Z0T A;  2VF3 A;  4X64 E;  2EM4 A;  2RS7 A;  2BA1 G;  2BA1 D;  4GKK E;  4AQY I;  2I9I A;  3THO B;  3GON A;  3VYY A;  1ZR9 A;  2YTN A;  1DGC A;  4IFD D;  4IFD A;  3VYX A;  4DR4 E;  3P3G A;  5K36 C;  5BR8 I;  3QT6 A;  4WXC A;  1YSA C;  1HNX I;  4HYM A;  2GHF A;  2DIX A;  1IQS A;  1T4N A;  1G2D C;  1BB8 A;  2EN8 A;  4DUY E;  1R6M A;  2EP3 A;  2RQL A;  4DV0 E;  2J7K A;  2PO2 A;  2V2V A;  3C4T A;  4MDT A;  4ED4 A;  1O0W A;  2UXB I;  2L33 A;  4P7A A;  2V2Q A;  3V2U C;  2YTJ A;  2ELY A;  5GMD A;  2EMX A;  4KZS A;  2EMY A;  4QNJ A;  2LCE A;  1BBG A;  5IWA E;  1USV A;  1N34 I;  1N0U A;  2ADR A;  3J80 C;  4JI3 I;  3MHS C;  5KL4 A;  2V8Q B;  2EMF A;  1ELO A;  2Z5C B;  2EOM A;  2DB2 A;  4JI5 E;  5K36 D;  4BMJ A;  4Z7Y A;  5K36 A;  2EPL X;  2L92 A;  2UU9 E;  1ZU1 A;  4LCH A;  4KQV A;  3H09 A;  2C39 A;  3KZY A;  5IXM B;  5C0X F;  1D6T A;  4JV5 E;  1DAR A;  4YY3 E;  4WSG A;  2GQ0 A;  3U1K A;  3L7Z A;  4WUD A;  2JYA A;  2Z5B A;  3KWR A;  4GEQ B;  1WXR A;  4DV6 E;  2VF1 A;  1TF6 A;  2Z5E A;  4FWD A;  4DV5 E;  5IT9 C;  1N33 E;  2F4V E;  3AUZ A;  2EQ0 A;  2GPI A;  4FW6 A;  2VE7 C;  2L3C A;  4MQY A;  2EN4 A;  4DU7 A;  4MYU A;  1J5E I;  4LF4 I;  4LF5 I;  4BHC A;  2EPA A;  1U2R A;  1Y4S A;  2PNM A;  4GZN C;  1YUI A;  4IZJ B;  2YTG A;  1Z5B A;  3GCM A;  1T4O A;  2YRK A;  1Y4U A;  4DR1 E;  4DPW A;  2YSP A;  3RMP A;  2MC5 A;  2L6M A;  1ZM2 A;  2XEX A;  1NHH A;  4M30 A;  3J7A M;  2RSM A;  4FW9 A;  4RHB B;  1XMO E;  1YHC A;  2EN1 A;  4AQY E;  1G2F C;  5KL3 A;  3MHH C;  2DEI A;  4JI8 I;  2LMZ A;  4B3R I;  4OO1 E;  4LU9 A;  2B9D A;  1FKA E;  4LF8 E;  1Z0E A;  2V8P A;  2PO0 B;  5C0X C;  3J80 Q;  2JXP A;  4ZYD A;  1KJK A;  4O24 A;  4LF9 E;  4M0V A;  3GME A;  1NHJ A;  2EPU A;  1E3H A;  2F1D A;  1X49 A;  1HNX E;  4IZK B;  2WBU A;  4M1K A;  5A6B D;  3P1X A;  4GKJ I;  1TF3 A;  1X6F A;  4F54 A;  4B3M E;  3ADL A;  3J7Y p;  2J65 A;  5LMU I;  5DRQ A;  1RC7 A;  1MU5 A;  2Q2E B;  1PIE A;  1A1J A;  1UEK A;  3F0N A;  2Q8U A;  4DUZ E;  5A2Q C;  2EWL A;  2UUA E;  4X66 I;  2EM9 A;  3T1Y E;  1YYO A;  4JI4 I;  2EN7 A;  2EM2 A;  2V87 A;  4DR2 E;  2CTD A;  2L2K B;  4JI6 E;  4BA1 B;  5C0X D;  3PS1 A;  1RR9 A;  4BHB A;  4JI0 E;  2UUB I;  3LTO A;  3PS2 A;  2JR1 A;  5A69 A;  2I13 A;  3OML A;  2YPN A;  4B3T E;  4PU9 A;  4KHP I;  1RMD A;  2WNR A;  2EPK X;  3HPS A;  1BKN A;  2ZBK B;  3D4J A;  2GLI A;  3HKM A;  2CG9 A;  3QT5 A;  2UUC I;  2O1V A;  3TQM A;  1XMQ I;  4WFT A;  2NN6 B;  5AE1 A;  1P47 A;  4LF4 E;  2EOH A;  4ZVI A;  4AIM A;  3OTO E;  2V34 A;  2DSY A;  3T1H I;  2PO1 A;  2VQE I;  2AJ4 A;  4F9B B;  1PDA A;  4OO1 B;  3WU6 A;  2A25 A;  1YPN A;  2DLK A;  3EPJ A;  2E1M A;  3ADI A;  4DR3 E;  4NXN I;  3EPL A;  4N3O A;  2YTI A;  5KL2 A;  2V2Z A;  2WP8 B;  3HXL A;  1KVK A;  1UDN A;  2O1T A;  3Q6M A;  5JEA A;  3M7N D;  2EM0 A;  4DPT A;  4WSP A;  5FLX C;  2VQF E;  1PKP A;  4DR7 I;  2RPC A;  2B7T A;  2EM5 A;  4YHH E;  1A6F A;  2V86 A;  4PRV A;  4USK A;  1IBM E;  2YU8 A;  2EOF A;  5F3W A;  2NPF A;  2A2D A;  4BA2 A;  4Q28 A;  2NUE A;  1TN9 A;  1MGT A;  1IMU A;  2MDG A;  2LO3 A;  2EMH A;  4NHR A;  2R42 A;  4HAC A;  4IFD B;  4LFB I;  4DU8 A;  2PNZ A;  3DF6 A;  2NA2 A;  2HHH E;  2YRM A;  2L8T A;  2CPN A;  2K4V A;  4X66 E;  2WBS A;  1YYW A;  2GO3 A;  4R2Q A;  1L4S A;  2PO2 B;  5AC5 A;  2HK3 A;  1ZM9 A;  3ZZU A;  4X65 I;  1Y60 A;  5ELW A;  4B3S I;  2LUP B;  2PRT A;  1WRJ A;  4JI7 E;  5IV8 B;  5DNY A;  2L3J A;  3M85 G;  3M85 D;  2YTF A;  3J81 C;  2NUG A;  1KKH A;  1N32 I;  4ISA A;  1FNM A;  2E5L E;  3HQ1 A;  2IOQ A;  4R2A A;  3P3E A;  3KRN A;  2HKE A;  1XNR I;  4WYQ B;  2UXD I;  4K0K I;  5K36 B;  4DV1 E;  2UUC E;  1T38 A;  2C39 B;  2UXC I;  1DI2 A;  3L7Z B;  2Z5B B;  2EPR A;  2YT4 A;  1LLM C;  4O5G A;  2EMC A;  4ZYG A;  1ZM4 A;  5FLX Q;  4J8Z A;  2EPN A;  4Q35 B;  3T1H E;  2E72 A;  4X62 E;  2LE2 A;  1MG7 A;  5EL9 A;  3P06 A;  1I94 I;  2X7I A;  3ZOQ B;  5LMN I;  1A1L A;  4DV3 E;  2EOJ A;  2YTQ A;  3ZZT A;  4LFA I;  4U3D A;  4DR6 I;  2LJP A;  2WBT A;  3DD6 A;  3PS3 A;  4NXN E;  4LTY A;  2GO4 A;  2KHX A;  2YU5 A;  1EH6 A;  4F9C B;  3WU5 A;  1UHZ A;  1X6E A;  2EM7 A;  3EQ1 A;  2EPC A;  2M7Q A;  4NXM E;  4DR7 E;  4LOM A;  5AE2 A;  4MLV A;  1XNQ I;  2R1F A;  4O4K A;  1GTK A;  3PRY A;  2MDR A;  3J81 Q;  2CZ9 A;  1YUJ A;  3BF2 A;  4LFB E;  2HJJ A;  1A1F A;  1DQ3 A;  1HNW I;  4RPF A;  4DV2 E;  4JI2 I;  3H4L A;  4I3H A;  4FN5 A;  4RH8 A;  1F2I G;  4U3B A;  4LF6 I;  5JEA E;  2EN3 A;  2KON A;  2NN6 E;  2FV4 B;  1HR0 I;  2MKD A;  2V89 A;  4B3S E;  3WU4 A;  4DV4 I;  4FW3 A;  2AE8 A;  3F6H A;  5ADZ A;  2MC6 A;  2HGH A;  2JE6 A;  2V83 A;  5TSE A;  4R8O A;  1KIJ A;  2JEB A;  5BR8 E;  4JG4 A;  5DRO A;  1HNZ I;  4X8W A;  4F9A B;  3ECR A;  2EQ1 A;  2EFG A;  5FWK A;  3LML A;  5A6B A;  2N8X A;  4LCG A;  4IJD A;  2UXC E;  1Z59 A;  2WW4 A;  2UXB E;  1Z0V A;  2IER A;  2WNR B;  2BB8 A;  3L00 A;  4MU0 A;  1AH5 A;  1P42 A;  4DPY A;  3B4T A;  1N34 E;  1UDS A;  4J3D A;  4DV7 I;  4JI3 E;  2NAB A;  2JEA A;  2ZIT A;  3B82 A;  1ZBT A;  2CSH A;  2JVA A;  1IBK I;  1IBL I;  4IFD E;  5KL6 A;  5IT9 Q;  1WJP A;  3U1Y A;  2E1R A;  2LTR A;  1X3C A;  2M1S A;  4FWH A;  5C0X A;  2X36 A;  2PO1 B;  2EL5 A;  4UTG A;  1GZ6 A;  4N4R B;  2LRS A;  2JPA A;  2LTS A;  3HJC A;  5KL5 A;  4LFC I;  4JYA I;  2EL6 A;  1NZ0 A;  2JWO A;  1WHQ A;  2EM3 A;  3H1C A;  2ELZ A;  3PYF A;  3K17 A;  2V88 A;  2HC5 A;  4DR5 I;  1H73 A;  5AAS A;  1N36 I;  2V85 A;  3EPK A;  2LT7 A;  3ZKB A;  4I8O A;  2EMZ A;  4BS9 A;  1BBO A;  4OO1 F;  5JEA B;  4X9J A;  2HK2 A;  3JAM C;  1J5E E;  2EPP A;  2EMB A;  2ENH A;  2UXD E;  1FWK A;  1NHI A;  4LF5 E;  2JOX A;  1VIS A;  2BA0 G;  2BA0 D;  3VK6 A;  2EOZ A;  4HTG A;  5K36 E;  3EPH A;  2YZT A;  1HNW E;  2G7H A;  1K47 A;  4X64 I;  1RHY A;  2CVE A;  4LF7 I;  1N0V C;  4BA2 B;  1MX0 A;  3BGH A;  4R2E A;  1HR0 E;  4HAC B;  1UIL A;  1QNT A;  4NZV A;  5LLQ A;  2PNZ B;  4DV4 E;  2RS6 A;  2O1W A;  4HXZ A;  4DR4 I;  4JI8 E;  2ZM6 I;  2JOB A;  4F6M A;  4R03 A;  2EOO A;  4HEI A;  4B3R E;  2J7J A;  3M7N G;  5A2Q Q;  2LJH A;  4TUI A;  2EMK A;  4XTJ A;  2B3T B;  2L2N A;  3K1J A;  4NBQ A;  4MU4 A;  2NN6 C;  4DUY I;  4DV0 I;  2FTX B;  4WXD A;  3THN A;  2DLQ A;  1H72 C;  5CFF E;  3HTX A;  2EOQ A;  4OX9 I;  1EH8 A;  1YYK A;  2JY9 A;  3AV0 A;  4F6N A;  2DGC A;  4GKJ E;  2R3V A;  2B7V A;  2M9A A;  4OO1 C;  1OJ4 A;  1PVG A;  3JTZ A;  5LMU E;  2LBS B;  2OI2 A;  4O43 A;  2CT1 A;  1FJG I;  4JI5 I;  4JI4 E;  2LVH A;  3C6K A;  1R6L A;  4JV5 I;  4YY3 I;  1H7U A;  1X47 A;  1AAY A;  2NN6 D;  4M9V C;  1H7S A;  2N3H A;  2EOR A;  2UUB E;  4MU1 A;  2KOU A;  4DV6 I;  3M99 B;  3ZKD A;  4KHP E;  4DV5 I;  2IHR 1;  1SFE A;  1B63 A;  1UDQ A;  2C37 A;  4OO1 D;  2F4V I;  1N33 I;  2D9H A;  4TUG A;  1Z0C A;  5A6J A;  3K6Q A;  2N3G A;  1EKZ A;  4FW7 A;  4L8N A;  1N36 E;  1A1I A;  2NUF A;  3QT8 A;  2RSI A;  2YTE A;  1XMQ E;  2EPM X;  3J7A G;  2EM8 A;  4DR1 I;  2YTD A;  2EPO A;  4M2Z A;  5C0X E;  1S4E A;  5A6K A;  1A1G A;  4FW4 A;  4IS9 A;  4F2J C;  2C38 A;  3CDJ A;  2EML A;  2VES A;  2VQE E;  4DXL A;  2BR2 A;  2H36 X;  2ENA A;  1Z5A A;  1KYQ A;  1XMO I;  4LF7 E;  4R2P A;  3C4B A;  1EI1 A;  4WUC A;  4ZYE A;  4LF8 I;  3UHM A;  1A1K A;  2ZM6 E;  3VHT B;  4LF9 I;  1JK2 A;  4HY1 A;  1ZBQ A;  2FGG A;  2VRD A;  2YSO A;  5DRR A;  1STU A;  2A2C A;  4OX9 E;  4B3M I;  3DJW A;  1XXE A;  1UN6 B;  2JE6 B;  2F8B A;  1XHK A;  4DUZ I;  1PJT A;  2UUA I;  1S16 A;  3PYE A;  2JEB B;  3T1Y I;  1WUU A;  1A1H A;  4DPU A;  4DR2 I;  1RQ0 A;  2BM0 A;  5AC4 A;  4P78 A;  1FJG E;  1YZ9 A;  4P7D A;  2EQ3 A;  4JI6 I;  1IQO A;  3BID A;  2EN2 A;  4JI0 I;  3P76 A;  3QT7 A;  4DPX A;  4X65 E;  4B3T I;  4UT4 A;  3PYG A;  3BBG A;  3IWB A;  1N32 E;  3Q6N A;  2MKN A;  2DRP A;  2JEA B;  3Q1Q A;  3LPS A;  2WZO A;  3IWD A;  4DKK A;  2DMY A;  1Z1B A;  1GQE A;  3M6A A;  3NZK A;  1XNR E;  3B8H A;  2O1U A;  1X48 A;  5EKW A;  3WU3 A;  2YTP A;  3C6M A;  1J26 A;  2BV3 A;  2HFS A;  5C0X B;  4IS1 C;  3FIG A;  1YFH A;  4K0K E;  2EL4 A;  1Z0G A;  2Z5C A;  2YTO A;  3OTO I;  2IOP A;  2EE8 A;  5DNX A;  4KWY A;  1T4L B;  2M4I A;  5DRP A;  4BBY A;  4MYT A;  2WCC 3;  3PYD A;  4OKG A;  2EPZ A;  2YWQ A;  5GME A;  5DNL A;  3LLH A;  3ZZ0 A;  2DEJ A;  1I94 E;  1VI7 A;  4DR3 I;  4BCA A;  1X6H A;  4BC7 A;  5LMN E;  4WUB A;  1EH7 A;  2EOE A;  4LFA E;  2EOS A;  4DR6 E;  5LL6 R;  1OYP A;  3B78 A;  3P3C A;  3ADJ A;  2EOX A;  4ZYH A;  2GS8 A;  4IZJ D;  4IZJ A;  2VQF I;  4YHH I;  2IES A;  1PJS A;  5JEA F;  3KZZ A;  4JI1 I;  4R2D A;  2NN6 F;  2EN6 A;  1IBM I;  1WHN A;  1Z5C A;  4P52 A;  1B62 A;  1X5W A;  2EOI A;  5KL7 A;  1XNQ E;  3MSW A;  1NEI A;  2HHH I;  1PJQ A;  2ODR C;  2LV2 A;  5AE3 A;  2EMG A;  2LUQ A;  3QG5 C;  1OYS A;  1QU6 A;  4R2R A;  1USU A;  5L3J A;  2EJ4 A;  1H74 A;  2PO0 A;  2BM1 A;  4Z7C A;  2EMW A;  4JI2 E;  4URL A;  2EZ6 A;  1ZXM A;  4JI7 I;  2EM6 A;  4LF6 E;  2HFU A;  4GKK I;  3HPZ A;  4FW5 A;  2EOY A;  1FI4 A;  4IZK A;  4BC9 A;  1OYR A;  5A6A A;  1JK1 A;  1FWL A;  3ADG A;  2E5L I;  1MEY C;  1ZAA C;  2BBG A;  4MU3 A;  4L5N C;  2PNL A;  1NCS A;  1ZXN A;  4IFD F;  5JEA C;  2HKJ A;  2JT2 A;  1N3G A;  4DV1 I;  4OZE A;  4AM3 A;  2ODR D;  2RTX A;  3F6G A;  1HNZ E;  4R2C A;  2K7I A;  4BA1 A;  4LPF A;  1Z0B A;  2EPX A;  1HK7 A;  5IWA I;  3CWV A;  3GLL A;  3K85 A;  4X62 I;  1T39 A;  2C37 B;  4GQU A;  4FK5 C;  2O3Z A;  4EMD A;  1Y6Z A;  4DV7 E;  4OOG C;  3HUL A;  4DV3 I;  2YRH A;  3CDI A;  1SR9 A;  2R76 A;  3IWC A;  2DMI A;  1IBL E;  1IBK E;  2UU9 I;  2CGE A;  3JAM Q;  3JU0 A;  4R2S A;  1ZM3 A;  5JEA D;  2L2M A;  5K36 F;  2C38 B;  4LFC E;  2NN6 A;  3UK3 C;  4FWG A;  1EA6 A;  2BR2 B;  3LNU A;  4NXM I;  4JYA E;  1Z0W A;  1UBD C;  4WPY A;  4JI1 E;  3ZM7 A;  4PRX A;  4IFD C;  5T6J A;  4R1F A;  4WX9 A;  1E3P A;  1YH8 A;  2ENC A;  4OO1 A;  4DR5 E;  4AID A;  1B69 A;  4USM A;  1RRE A;  2EMI A;  2EMA A;  4DV2 I;  4MLQ A;  4DMI A;  2JP9 A;  1UDO A;  4QNK A;  1Y5Y A;  2WP8 A;  4LCF A;  3V5R A;  1QZR A;  1KTV A;  2LJU A; 
#chains in the Genus database with same CATH homology
 1Z0T A;  2VF3 A;  4X64 E;  2RS7 A;  4GKK E;  4AQY I;  3GON A;  3VYY A;  3VYX A;  4DR4 E;  5BR8 I;  3QT6 A;  1HNX I;  4HYM A;  2DIX A;  1T4N A;  3B8H A;  4DUY E;  4DV0 E;  2V2V A;  2J7K A;  3C4T A;  4ED4 A;  2UXB I;  1O0W A;  2L33 A;  4P7A A;  2V2Q A;  3V2U C;  5GMD A;  4KZS A;  1N34 I;  5IWA E;  1USV A;  1N0U A;  3J80 C;  4JI3 I;  2V8Q B;  1ELO A;  2Z5C B;  2DB2 A;  4JI5 E;  4BMJ A;  4Z7Y A;  2L92 A;  2UU9 E;  4KQV A;  3H09 A;  1D6T A;  4JV5 E;  1DAR A;  4YY3 E;  2GQ0 A;  4WUD A;  2Z5B A;  3KWR A;  4GEQ B;  1WXR A;  4DV6 E;  2VF1 A;  2Z5E A;  4FWD A;  4DV5 E;  5IT9 C;  1N33 E;  2F4V E;  3AUZ A;  4DU7 A;  1J5E I;  2VE7 C;  2L3C A;  4LF4 I;  2UXD I;  4MYU A;  4LF5 I;  1U2R A;  1Y4S A;  4IZJ B;  2PNM A;  1Z5B A;  1T4O A;  1Y4U A;  4DPW A;  4DR1 E;  3RMP A;  2MC5 A;  2L6M A;  1ZM2 A;  2XEX A;  1NHH A;  4M30 A;  3J7A M;  2RSM A;  4FW9 A;  1XMO E;  4AQY E;  4JI8 I;  2DEI A;  2LMZ A;  4B3R I;  4LU9 A;  2B9D A;  1FKA E;  4LF8 E;  1Z0E A;  2V8P A;  3J80 Q;  4LF9 E;  4M0V A;  1NHJ A;  4IZK B;  1X49 A;  1HNX E;  4M1K A;  3P1X A;  4GKJ I;  4F54 A;  4B3M E;  3ADL A;  3J7Y p;  5LMU I;  1RC7 A;  1MU5 A;  2Q2E B;  1PIE A;  1UEK A;  3F0N A;  4DUZ E;  4X66 I;  5A2Q C;  2EWL A;  2UUA E;  3T1Y E;  1YYO A;  4JI4 I;  2V87 A;  4DR2 E;  2L2K B;  4JI6 E;  1RR9 A;  4JI0 E;  2UUB I;  3LTO A;  2JR1 A;  3OML A;  4B3T E;  4PU9 A;  4KHP I;  3HPS A;  1BKN A;  2ZBK B;  3D4J A;  2CG9 A;  3QT5 A;  2UUC I;  2O1V A;  1XMQ I;  4WFT A;  5AE1 A;  4ZVI A;  4LF4 E;  3OTO E;  2V34 A;  2DSY A;  3T1H I;  2VQE I;  2AJ4 A;  4F9B B;  3WU6 A;  2E1M A;  3ADI A;  4DR3 E;  4NXN I;  4N3O A;  2V2Z A;  3HXL A;  1KVK A;  2O1T A;  3Q6M A;  4DPT A;  4WSP A;  5FLX C;  2VQF E;  1PKP A;  4DR7 I;  4YHH E;  2B7T A;  1A6F A;  2V86 A;  4PRV A;  4USK A;  1IBM E;  5F3W A;  2NPF A;  2A2D A;  4Q28 A;  2NUE A;  2R42 A;  4LFB I;  4HAC A;  4DU8 A;  3DF6 A;  2NA2 A;  2HHH E;  2L8T A;  2CPN A;  2K4V A;  4X66 E;  1YYW A;  2HK3 A;  1ZM9 A;  3ZZU A;  4X65 I;  4B3S I;  2LUP B;  4JI7 E;  2L3J A;  5DNY A;  3J81 C;  2NUG A;  1KKH A;  1N32 I;  1FNM A;  2E5L E;  3HQ1 A;  2IOQ A;  1XNR I;  2HKE A;  4WYQ B;  4K0K I;  4DV1 E;  2UUC E;  2UXC I;  1DI2 A;  2Z5B B;  2YT4 A;  5FLX Q;  1ZM4 A;  4J8Z A;  3T1H E;  4X62 E;  2LE2 A;  1MG7 A;  3P06 A;  1I94 I;  2X7I A;  3ZOQ B;  5LMN I;  4DV3 E;  3ZZT A;  4LFA I;  4DR6 I;  2LJP A;  4NXN E;  4LTY A;  2KHX A;  3WU5 A;  4F9C B;  1UHZ A;  4NXM E;  2M7Q A;  4DR7 E;  5AE2 A;  1XNQ I;  3PRY A;  2MDR A;  3J81 Q;  2CZ9 A;  4LFB E;  1DQ3 A;  1HNW I;  4RPF A;  4DV2 E;  4JI2 I;  3H4L A;  4I3H A;  4FN5 A;  4LF6 I;  2KON A;  2FV4 B;  1HR0 I;  2V89 A;  4B3S E;  3WU4 A;  4DV4 I;  3F6H A;  5ADZ A;  2MC6 A;  2V83 A;  4R8O A;  1KIJ A;  4JG4 A;  5BR8 E;  1HNZ I;  4X8W A;  4F9A B;  5FWK A;  2EFG A;  3LML A;  2UXC E;  1Z59 A;  2WW4 A;  2UXB E;  1Z0V A;  4DPY A;  1N34 E;  4DV7 I;  4JI3 E;  2ZIT A;  3B82 A;  1ZBT A;  2JVA A;  1IBK I;  1IBL I;  5IT9 Q;  2E1R A;  2LTR A;  2M1S A;  4FWH A;  2X36 A;  4UTG A;  1GZ6 A;  4LFC I;  2LRS A;  2LTS A;  3HJC A;  4JYA I;  1NZ0 A;  2JWO A;  1WHQ A;  3PYF A;  3K17 A;  2V88 A;  4DR5 I;  1H73 A;  5AAS A;  1N36 I;  2V85 A;  3ZKB A;  4I8O A;  4BS9 A;  2HK2 A;  3JAM C;  1J5E E;  1NHI A;  2UXD E;  1FWK A;  4LF5 E;  2JOX A;  1VIS A;  3VK6 A;  1K47 A;  2YZT A;  1HNW E;  2G7H A;  4X64 I;  4LF7 I;  1N0V C;  1MX0 A;  1HR0 E;  4HAC B;  1UIL A;  4DV4 E;  2RS6 A;  2O1W A;  4HXZ A;  4DR4 I;  4JI8 E;  2ZM6 I;  2JOB A;  4R03 A;  4B3R E;  5A2Q Q;  2LJH A;  4TUI A;  4XTJ A;  2B3T B;  2L2N A;  3K1J A;  4DUY I;  4DV0 I;  2FTX B;  1H72 C;  5CFF E;  3HTX A;  4OX9 I;  1YYK A;  2JY9 A;  3AV0 A;  4GKJ E;  2R3V A;  2B7V A;  1OJ4 A;  1PVG A;  3JTZ A;  5LMU E;  2LBS B;  2OI2 A;  1FJG I;  4JI5 I;  4JI4 E;  4JV5 I;  4YY3 I;  1H7U A;  1X47 A;  1H7S A;  2N3H A;  2UUB E;  2KOU A;  4DV6 I;  3ZKD A;  4KHP E;  4DV5 I;  2IHR 1;  1B63 A;  1N33 I;  2F4V I;  4TUG A;  1Z0C A;  3K6Q A;  2N3G A;  1EKZ A;  4L8N A;  1N36 E;  2NUF A;  3QT8 A;  1XMQ E;  3J7A G;  4DR1 I;  4M2Z A;  1S4E A;  4DXL A;  2VQE E;  2H36 X;  1Z5A A;  1XMO I;  4LF7 E;  3C4B A;  1EI1 A;  4WUC A;  4LF8 I;  2ZM6 E;  4LF9 I;  4HY1 A;  1ZBQ A;  2FGG A;  1STU A;  2A2C A;  4OX9 E;  4B3M I;  3DJW A;  2F8B A;  1XHK A;  4DUZ I;  2UUA I;  1S16 A;  3PYE A;  3T1Y I;  1WUU A;  4DPU A;  4DR2 I;  1RQ0 A;  2BM0 A;  1YZ9 A;  4P78 A;  1FJG E;  4P7D A;  4JI6 I;  4JI0 I;  3QT7 A;  4DPX A;  4X65 E;  4B3T I;  4UT4 A;  3PYG A;  3Q6N A;  3IWB A;  1N32 E;  3Q1Q A;  3LPS A;  2WZO A;  3IWD A;  4DKK A;  2DMY A;  3M6A A;  1GQE A;  1XNR E;  3WU3 A;  2O1U A;  1X48 A;  1J26 A;  2BV3 A;  2HFS A;  4K0K E;  3FIG A;  2Z5C A;  1Z0G A;  3OTO I;  2IOP A;  1T4L B;  2M4I A;  4BBY A;  4MYT A;  3PYD A;  5GME A;  3LLH A;  3ZZ0 A;  2DEJ A;  1I94 E;  4DR3 I;  4BCA A;  4BC7 A;  5LMN E;  4WUB A;  4LFA E;  4DR6 E;  3B78 A;  5LL6 R;  3ADJ A;  2GS8 A;  4IZJ D;  2VQF I;  4IZJ A;  4YHH I;  4JI1 I;  1IBM I;  1WHN A;  1Z5C A;  4P52 A;  1B62 A;  1XNQ E;  3MSW A;  2HHH I;  2ODR C;  5AE3 A;  2LUQ A;  5L3J A;  1QU6 A;  1USU A;  1H74 A;  2BM1 A;  4Z7C A;  4JI2 E;  4URL A;  2EZ6 A;  1ZXM A;  4JI7 I;  4LF6 E;  2HFU A;  4GKK I;  3HPZ A;  4IZK A;  1FI4 A;  4BC9 A;  1FWL A;  3ADG A;  2E5L I;  4L5N C;  2PNL A;  1ZXN A;  2HKJ A;  4DV1 I;  2ODR D;  2RTX A;  3F6G A;  1HNZ E;  1Z0B A;  1HK7 A;  5IWA I;  3CWV A;  3K85 A;  4X62 I;  4EMD A;  1Y6Z A;  4DV7 E;  4OOG C;  3HUL A;  4DV3 I;  1SR9 A;  3IWC A;  1IBL E;  1IBK E;  2UU9 I;  2CGE A;  3JAM Q;  3JU0 A;  1ZM3 A;  2L2M A;  4LFC E;  4FWG A;  1EA6 A;  3LNU A;  4NXM I;  4JYA E;  1Z0W A;  4WPY A;  4JI1 E;  3ZM7 A;  4PRX A;  5T6J A;  4R1F A;  4DR5 E;  4USM A;  1RRE A;  4DV2 I;  4DMI A;  3V5R A;  1QZR A;  1KTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...