1J5EI

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1j5eI00
4LFCE 1HNWE 1A6FA 1HNXE 3F0NA 2DEJA 5BR8E 4LF8I 4DR5I 4UTGA 4DV2E 4DV4E 2WW4A 4DUYE 1N32I 1B62A 2A2DA 4HYMA 5LMNI 4JI3E 2ZM6I 4X62I 2BV3A 4K0KI 3QT8A 3T1HE 5GMEA 4DV3I 4JG4A 1Z59A 4LF7E 5A2QC 4X64E 1XMQE 4X66E 2HHHI 4RPFA 2F4VE 3QT7A 4DR1I 4PU9A 2E5LI 4LFAI 1DARA 3PYFA 4DV5E 2V2ZA 3M6AA 3T1YI 1MX0A 1IBME 3PYEA 4LF9E 1XNQE 2J7KA 4WUBA 4ED4A 4GKJI 1N0UA 4DV0I 5A2QQ 4EMDA 3JAMC 4JI6I 4JI0E 4JI1I 1XMOE 4B3RE 3H4LA 4FW9A 1FI4A 1IBLE 4JI4E 2UXBE 5IT9C 1FWLA 4DV1E 4URLA 4NXNI 1N33I 1HR0E 1XHKA 4DU8A 2UUBE 4Z7YA 4DPXA 2V2QA 4HXZA 4JI7I 2X7IA 4DR3I 4B3TI 2UXCE 3OTOE 4LF5E 1PVGA 2UU9E 5LMUI 4B3ME 1FJGE 2GS8A 4I3HA 3PYGA 1XNRI 1EI1A 3V2UC 4P52A 3HULA 1FNMA 4LF4E 2HKEA 4DR2I 5IWAE 4P7AA 4KHPE 1Z0BA 3ZKDA 3ZZUA 1J5EE 1H73A 1KKHA 4DPYA 1H7UA 3WU6A 4JI8E 2BM0A 4YY3I 4B3SI 1ZM3A 4DPUA 4LFBE 1FKAE 4DR6E 1N36I 2UUAI 1EA6A 3ZKBA 2HK3A 4DXLA 2CZ9A 1Z5CA 1WUUA 3ZZ0A 1NHHA 1Z5AA 1ZM4A 4USMA 4X65I 1N34E 1Z0GA 1S16A 2UUCE 4PRXA 2OI2A 2UXDE 1H72C 1ZXNA 4AQYI 1IBKI 2VQFI 1HNZI 1NZ0A 4LF6E 4JYAI 2R3VA 3LPSA 4DV7I 4LF8E 4DR5E 2NPFA 4GKKE 3K17A 1MG7A 2HFUA 4R1FA 2V2VA 1Z0TA 4DV6I 1N32E 4DR7I 2XEXA 4USKA 1IBLI 5LMNE 4YHHI 4X62E 3CWVA 1ELOA 2DEIA 1RR9A 2X36A 4K0KE 4JI5I 4DV3E 4JI2I 3WU3A 2HHHE 4HACA 4JV5I 4DUZI 4NXMI 1U2RA 4DR1E 2E5LE 4LFAE 1H7SA 3J81Q 2VQEI 2AJ4A 3T1YE 1S4EA 4OX9I 1H74A 3LTOA 4DPTA 4DV0E 1I94I 4JI6E 4DR4I 4JI1E 1KIJA 4M1KA 4LFCI 1HNWI 3PYDA 1HNXI 4Z7CA 5BR8I 1QZRA 4NXNE 1N33E 2ZBKB 4DV2I 2BM1A 4DV4I 1PKPA 4DUYI 3LNUA 4MYUA 2EFGA 2ZITA 4JI7E 4JI3I 1NHIA 4FWGA 4DR3E 4B3TE 2A2CA 5FLXC 5L3JA 1NHJA 3QT5A 5LMUE 2HKJA 1Z0WA 3T1HI 2R42A 3Q1QA 1XNRE 4LF7I 3GONA 4X64I 1XMQI 4X66I 2HFSA 2F4VI 2Q2EB 5LL6R 4DR2E 4GKKI 3K1JA 2VF3A 3QT6A 5FLXQ 4DV5I 4YY3E 1IBMI 4B3SE 4LF9I 4ZVIA 1B63A 1XNQI 4KQVA 1MU5A 1N0VC 1N36E 4PRVA 2UUAE 4JI0I 4XTJA 1XMOI 1ZM2A 4B3RI 1K47A 1Z0VA 1Z0CA 4X65E 2ZM6E 3ZZTA 4FWHA 4HY1A 3WU4A 4JI4I 2UXBI 3J81C 4DV1I 4AQYE 1FWKA 1IBKE 2VQFE 2V8PA 1HNZE 4JYAE 3J80C 1HR0I 4DPWA 2UUBI 4DV7E 5GMDA 2UXCI 3OTOI 4LF5I 4FN5A 3V5RA 3B8HA 3B78A 2UU9I 4DV6E 4DU7A 4B3MI 1FJGI 4DR7E 4FWDA 3B82A 1BKNA 3J80Q 4GKJE 4YHHE 4HACB 2E1RA 3WU5A 4LF4I 1UEKA 5IWAI 4KHPI 1J5EI 4JI5E 4JI2E 3JAMQ 4JI8I 3D4JA 1KVKA 1OJ4A 3J7AM 4JV5E 4DUZE 4LFBI 3ZM7A 4NXME 1D6TA 1ZM9A 1ZXMA 1KTVA 4DR6I 5IT9Q 2VQEE 1Z5BA 4MYTA 1Z0EA 1VISA 4WUDA 4OX9E 4WUCA 3J7AG 1RREA 2HK2A 1N34I 2UUCI 1I94E 2LJPA 2UXDI 2V34A 4DR4E 4LF6I 4UT4A 1PIEA
chains in the Genus database with same CATH superfamily
2GO4A 3U1KA 4LFCE 1HNWE 1A6FA 1HNXE 3F0NA 2DEJA 4OO1E 4IFDE 5BR8E 4LF8I 4DR5I 4UTGA 1UDQA 4DV2E 4IZKB 4AIDA 4IS9A 4DV4E 2WW4A 3P3CA 4FW3A 4DUYE 2J65A 1N32I 2F1DA 2PNMA 4LPFA 1B62A 2A2DA 4HYMA 2C39A 2WNRB 5LMNI 4JI3E 2BA0G 2ZM6I 1R6MA 4X62I 4OZEA 2BV3A 4QNJA 2IERA 2AE8A 4K0KI 5EL9A 3QT8A 3T1HE 5GMEA 4DV3I 4JG4A 1Z59A 4LF7E 5A2QC 4X64E 1XMQE 1Y4SA 4X66E 2PO2A 2HHHI 4RPFA 2F4VE 3QT7A 5C0XA 2BR2A 3HKMA 4DR1I 4PU9A 2E5LI 4LFAI 1DARA 5K36D 3PYFA 4DV5E 4IZJB 2BA0D 2V2ZA 2NN6D 3M6AA 3T1YI 1MX0A 1IBME 3PYEA 1RHYA 4LF9E 2Z5BA 1XNQE 2J7KA 4WUBA 4ED4A 4GKJI 1N0UA 4DV0I 5A2QQ 4EMDA 3JAMC 4JI6I 3M7NG 4JI0E 1YH8A 1E3HA 4JI1I 1XMOE 4B3RE 3H4LA 3H1CA 1XXEA 2VESA 3L7ZB 4FW9A 1FI4A 1IBLE 2O1TA 4JI4E 2UXBE 5IT9C 1UDNA 1FWLA 4DV1E 4URLA 1UDOA 5DRQA 4NXNI 1N33I 1HR0E 1XHKA 3HJCA 4DU8A 2O1VA 2UUBE 4Z7YA 2O1WA 4DPXA 2V2QA 4HXZA 4JI7I 2X7IA 3PS3A 4DR3I 4B3TI 1R6LA 2UXCE 1YHCA 3OTOE 4LF5E 3NZKA 1PVGA 2UU9E 3K85A 5C0XE 5LMUI 4B3ME 1FJGE 4IFDC 5K36F 2GS8A 4I3HA 5C0XD 3PYGA 5JEAA 1XNRI 1EI1A 2NN6F 3V2UC 4P52A 3HULA 1UDSA 1FNMA 3PS2A 2JEAA 1VI7A 4LCFA 4LF4E 2HKEA 4DR2I 5IWAE 4P7AA 4KHPE 1Z0BA 3ZKDA 1Y6ZA 2WP8B 4QNKA 3ZZUA 3GCMA 1J5EE 1H73A 1KKHA 4DPYA 1H7UA 3WU6A 3M85G 4JI8E 3KRNA 5ELWA 2BM0A 4YY3I 5K36B 2JE6B 4B3SI 1ZM3A 4DPUA 4LFBE 2NN6B 1FKAE 1USUA 2C38B 5DRRA 4IZKA 4FW6A 4DR6E 4OO1D 4IFDD 1N36I 2UUAI 1EA6A 3ZKBA 4LCGA 3B4TA 2HK3A 4DXLA 5K36C 2CZ9A 2PNZB 4OKGA 1Z5CA 3P06A 2PO0A 1WUUA 3ZZ0A 1NHHA 1Z5AA 1ZM4A 2NN6C 4USMA 4X65I 1N34E 2WNRA 1Z0GA 1S16A 2UUCE 4PRXA 2OI2A 2UXDE 1H72C 1ZXNA 2GO3A 4AQYI 1IBKI 4GQUA 2VQFI 1HNZI 1NZ0A 4LF6E 4JYAI 4LOMA 4BA1A 2R3VA 3P3GA 3LPSA 3P76A 4DV7I 1P42A 4LF8E 2C39B 4DR5E 2NPFA 4GKKE 5JEAE 3K17A 1MG7A 2HFUA 4R1FA 2V2VA 1Z0TA 3CDJA 5JEAD 4IZJA 4DV6I 1N32E 1Y4UA 4DR7I 2XEXA 4USKA 3Q6NA 1IBLI 5LMNE 2PO2B 4YHHI 4X62E 2GQ0A 3CWVA 5C0XB 1ELOA 2BR2B 2DEIA 1RR9A 2X36A 4K0KE 4OO1F 4IFDF 4JI5I 2CGEA 4DV3E 4JI2I 2BA1G 2Z5CB 2Z5BB 3WU3A 4AM3A 2HHHE 4LCHA 4HACA 4JV5I 4DUZI 5C0XC 4NXMI 1U2RA 4DR1E 2JEBA 2E5LE 4LFAE 1H7SA 3J81Q 2VQEI 2AJ4A 3T1YE 1S4EA 2PO1A 4OO1B 4IFDB 4OX9I 1H74A 5DNLA 3M7ND 3LTOA 4DPTA 4DV0E 1I94I 1OYRA 4JI6E 4DR4I 4U3BA 4BA2A 1OYSA 4JI1E 2O1UA 1KIJA 3U1YA 4OO1C 5DNXA 4M1KA 2C37A 3GLLA 4LFCI 1HNWI 3PYDA 3PRYA 1HNXI 4Z7CA 4N3OA 5BR8I 1QZRA 4AIMA 4NXNE 1N33E 2O3ZA 2ZBKB 4DV2I 2BM1A 1HK7A 4DV4I 1PKPA 4DUYI 3LNUA 4MYUA 2JE6A 2EFGA 5JEAB 2ZITA 4JI7E 4JI3I 1NHIA 3PS1A 4FWGA 4DR3E 2A2CA 4B3TE 2JEAB 5FLXC 5L3JA 1NHJA 3QT5A 3UHMA 4MU3A 5LMUE 2HKJA 1Z0WA 3T1HI 2R42A 3Q1QA 2Z5EA 1XNRE 5JEAC 4LF7I 3GONA 1E3PA 4X64I 1XMQI 4X66I 2HFSA 2F4VI 5DROA 2Q2EB 3M85D 5LL6R 4DR2E 4GKKI 4U3DA 4MU1A 3K1JA 2VF3A 2IOQA 4NBQA 3QT6A 5FWKA 5FLXQ 3GMEA 4J3DA 4DV5I 4YY3E 1IBMI 2IOPA 4B3SE 4LF9I 2PO0B 4ZVIA 1B63A 4ISAA 4MU4A 1XNQI 5C0XF 4KQVA 1MU5A 3CDIA 2CG9A 1N0VC 1N36E 3DD6A 4PRVA 2UUAE 4JI0I 4XTJA 1XMOI 2CVEA 1ZM2A 4B3RI 4BA1B 1K47A 1Z0VA 2PNLA 4MQYA 1Z0CA 4X65E 2ZM6E 3P3EA 4FWHA 4HY1A 3WU4A 3ZZTA 4JI4I 2UXBI 3J81C 4DV1I 5K36E 4AQYE 1FWKA 2NN6E 2VQFE 1IBKE 2V8PA 1Y5YA 5DRPA 1HNZE 4JYAE 3J80C 1HR0I 3L7ZA 4DPWA 2UUBI 2Z5CA 4DV7E 5GMDA 2UXCI 3OTOI 4LF5I 4FN5A 3V5RA 3B8HA 3B78A 2UU9I 4DV6E 4DU7A 4B3MI 4OO1A 1FJGI 4IFDA 4DR7E 4FWDA 5EKWA 3B82A 1BKNA 3J80Q 1USVA 4GKJE 4MDTA 4HACB 4YHHE 2E1RA 1OYPA 3WU5A 2BA1D 4FW4A 4LF4I 1UEKA 5IWAI 2JEBB 4KHPI 2IESA 1J5EI 4JI5E 4JI2E 3JAMQ 4JI8I 2PO1B 3D4JA 5JEAF 1KVKA 1OJ4A 3J7AM 4JV5E 4DUZE 4LFBI 3ZM7A 4NXME 1Y60A 1D6TA 1ZM9A 1ZXMA 1KTVA 4IZJD 2WP8A 4DR6I 5IT9Q 2VQEE 4BA2B 4FW5A 1Z5BA 4MYTA 4MU0A 1Z0EA 3Q6MA 1VISA 4WUDA 4OX9E 4WUCA 3J7AG 5K36A 1RREA 2HK2A 2NN6A 2C37B 1N34I 2C38A 2UUCI 1I94E 2LJPA 2UXDI 2V34A 4DR4E 4LF6I 2JT2A 4FW7A 2PNZA 4UT4A 1PIEA
chains in the Genus database with same CATH topology
4LFCE 1HNWE 1A6FA 1HNXE 3F0NA 2DEJA 5BR8E 4LF8I 4DR5I 4UTGA 4DV2E 4IZKB 4DV4E 2WW4A 4DUYE 1N32I 2PNMA 1B62A 2A2DA 4HYMA 5LMNI 4JI3E 2ZM6I 4X62I 2BV3A 4K0KI 3QT8A 3T1HE 5GMEA 4DV3I 4JG4A 1Z59A 4LF7E 5A2QC 4X64E 1XMQE 1Y4SA 4X66E 2HHHI 4RPFA 2F4VE 3QT7A 4DR1I 4PU9A 2E5LI 4LFAI 1DARA 3PYFA 4DV5E 4IZJB 2V2ZA 3M6AA 3T1YI 1MX0A 1IBME 3PYEA 4LF9E 2Z5BA 1XNQE 2J7KA 4WUBA 4ED4A 4GKJI 1N0UA 4DV0I 5A2QQ 4EMDA 3JAMC 4JI6I 4JI0E 4JI1I 1XMOE 4B3RE 3H4LA 4FW9A 1FI4A 1IBLE 2O1TA 4JI4E 2UXBE 5IT9C 1FWLA 4DV1E 4URLA 4NXNI 1N33I 1HR0E 1XHKA 3HJCA 4DU8A 2O1VA 2UUBE 4Z7YA 2O1WA 4DPXA 2V2QA 4HXZA 4JI7I 2X7IA 4DR3I 4B3TI 2UXCE 3OTOE 4LF5E 1PVGA 2UU9E 3K85A 5LMUI 4B3ME 1FJGE 2GS8A 4I3HA 3PYGA 1XNRI 1EI1A 3V2UC 4P52A 3HULA 1FNMA 4LF4E 2HKEA 4DR2I 5IWAE 4P7AA 4KHPE 1Z0BA 3ZKDA 1Y6ZA 3ZZUA 1J5EE 1H73A 1KKHA 4DPYA 1H7UA 3WU6A 4JI8E 2BM0A 4YY3I 4B3SI 1ZM3A 4DPUA 4LFBE 1FKAE 1USUA 4IZKA 4DR6E 1N36I 2UUAI 1EA6A 3ZKBA 2HK3A 4DXLA 2CZ9A 1Z5CA 3P06A 1WUUA 3ZZ0A 1NHHA 1Z5AA 1ZM4A 4USMA 4X65I 1N34E 1Z0GA 1S16A 2UUCE 4PRXA 2OI2A 2UXDE 1H72C 1ZXNA 4AQYI 1IBKI 2VQFI 1HNZI 1NZ0A 4LF6E 4JYAI 2R3VA 3LPSA 4DV7I 4LF8E 4DR5E 2NPFA 4GKKE 3K17A 1MG7A 2HFUA 4R1FA 2V2VA 1Z0TA 4DV6I 4IZJA 1N32E 1Y4UA 4DR7I 2XEXA 4USKA 3Q6NA 1IBLI 5LMNE 4YHHI 4X62E 2GQ0A 3CWVA 1ELOA 2DEIA 1RR9A 2X36A 4K0KE 4JI5I 2CGEA 4DV3E 4JI2I 2Z5CB 2Z5BB 3WU3A 2HHHE 4HACA 4JV5I 4DUZI 4NXMI 1U2RA 4DR1E 2E5LE 4LFAE 1H7SA 3J81Q 2VQEI 2AJ4A 3T1YE 1S4EA 4OX9I 1H74A 3LTOA 4DPTA 4DV0E 1I94I 4JI6E 4DR4I 4JI1E 2O1UA 1KIJA 4M1KA 4LFCI 1HNWI 3PYDA 3PRYA 1HNXI 4Z7CA 4N3OA 5BR8I 1QZRA 4NXNE 1N33E 2ZBKB 4DV2I 2BM1A 1HK7A 4DV4I 1PKPA 4DUYI 3LNUA 4MYUA 2EFGA 2ZITA 4JI7E 4JI3I 1NHIA 4FWGA 4DR3E 4B3TE 2A2CA 5FLXC 5L3JA 1NHJA 3QT5A 5LMUE 2HKJA 1Z0WA 3T1HI 2R42A 3Q1QA 2Z5EA 1XNRE 4LF7I 3GONA 4X64I 1XMQI 4X66I 2HFSA 2F4VI 2Q2EB 5LL6R 4DR2E 4GKKI 3K1JA 2VF3A 2IOQA 3QT6A 5FWKA 5FLXQ 4DV5I 4YY3E 1IBMI 2IOPA 4B3SE 4LF9I 4ZVIA 1B63A 1XNQI 4KQVA 1MU5A 2CG9A 1N0VC 1N36E 4PRVA 2UUAE 4JI0I 4XTJA 1XMOI 1ZM2A 4B3RI 1K47A 1Z0VA 2PNLA 1Z0CA 4X65E 2ZM6E 3ZZTA 4FWHA 4HY1A 3WU4A 4JI4I 2UXBI 3J81C 4DV1I 4AQYE 1FWKA 1IBKE 2VQFE 2V8PA 1HNZE 4JYAE 3J80C 1HR0I 4DPWA 2UUBI 2Z5CA 4DV7E 5GMDA 2UXCI 3OTOI 4LF5I 4FN5A 3V5RA 3B8HA 3B78A 2UU9I 4DV6E 4DU7A 4B3MI 1FJGI 4DR7E 4FWDA 3B82A 1BKNA 3J80Q 1USVA 4GKJE 4YHHE 4HACB 2E1RA 3WU5A 4LF4I 1UEKA 5IWAI 4KHPI 1J5EI 4JI5E 4JI2E 3JAMQ 4JI8I 3D4JA 1KVKA 1OJ4A 3J7AM 4JV5E 4DUZE 4LFBI 3ZM7A 4NXME 1D6TA 1ZM9A 1ZXMA 1KTVA 4IZJD 4DR6I 5IT9Q 2VQEE 1Z5BA 4MYTA 1Z0EA 3Q6MA 1VISA 4WUDA 4OX9E 4WUCA 3J7AG 1RREA 2HK2A 1N34I 2UUCI 1I94E 2LJPA 2UXDI 2V34A 4DR4E 4LF6I 4UT4A 1PIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC E;  1HNW E;  1A6F A;  1HNX E;  3F0N A;  2DEJ A;  5BR8 E;  4LF8 I;  4DR5 I;  4UTG A;  4DV2 E;  4DV4 E;  2WW4 A;  4DUY E;  1N32 I;  1B62 A;  2A2D A;  4HYM A;  5LMN I;  4JI3 E;  2ZM6 I;  4X62 I;  2BV3 A;  4K0K I;  3QT8 A;  3T1H E;  5GME A;  4DV3 I;  4JG4 A;  1Z59 A;  4LF7 E;  5A2Q C;  4X64 E;  1XMQ E;  4X66 E;  2HHH I;  4RPF A;  2F4V E;  3QT7 A;  4DR1 I;  4PU9 A;  2E5L I;  4LFA I;  1DAR A;  3PYF A;  4DV5 E;  2V2Z A;  3M6A A;  3T1Y I;  1MX0 A;  1IBM E;  3PYE A;  4LF9 E;  1XNQ E;  2J7K A;  4WUB A;  4ED4 A;  4GKJ I;  1N0U A;  4DV0 I;  5A2Q Q;  4EMD A;  3JAM C;  4JI6 I;  4JI0 E;  4JI1 I;  1XMO E;  4B3R E;  3H4L A;  4FW9 A;  1FI4 A;  1IBL E;  4JI4 E;  2UXB E;  5IT9 C;  1FWL A;  4DV1 E;  4URL A;  4NXN I;  1N33 I;  1HR0 E;  1XHK A;  4DU8 A;  2UUB E;  4Z7Y A;  4DPX A;  2V2Q A;  4HXZ A;  4JI7 I;  2X7I A;  4DR3 I;  4B3T I;  2UXC E;  3OTO E;  4LF5 E;  1PVG A;  2UU9 E;  5LMU I;  4B3M E;  1FJG E;  2GS8 A;  4I3H A;  3PYG A;  1XNR I;  1EI1 A;  3V2U C;  4P52 A;  3HUL A;  1FNM A;  4LF4 E;  2HKE A;  4DR2 I;  5IWA E;  4P7A A;  4KHP E;  1Z0B A;  3ZKD A;  3ZZU A;  1J5E E;  1H73 A;  1KKH A;  4DPY A;  1H7U A;  3WU6 A;  4JI8 E;  2BM0 A;  4YY3 I;  4B3S I;  1ZM3 A;  4DPU A;  4LFB E;  1FKA E;  4DR6 E;  1N36 I;  2UUA I;  1EA6 A;  3ZKB A;  2HK3 A;  4DXL A;  2CZ9 A;  1Z5C A;  1WUU A;  3ZZ0 A;  1NHH A;  1Z5A A;  1ZM4 A;  4USM A;  4X65 I;  1N34 E;  1Z0G A;  1S16 A;  2UUC E;  4PRX A;  2OI2 A;  2UXD E;  1H72 C;  1ZXN A;  4AQY I;  1IBK I;  2VQF I;  1HNZ I;  1NZ0 A;  4LF6 E;  4JYA I;  2R3V A;  3LPS A;  4DV7 I;  4LF8 E;  4DR5 E;  2NPF A;  4GKK E;  3K17 A;  1MG7 A;  2HFU A;  4R1F A;  2V2V A;  1Z0T A;  4DV6 I;  1N32 E;  4DR7 I;  2XEX A;  4USK A;  1IBL I;  5LMN E;  4YHH I;  4X62 E;  3CWV A;  1ELO A;  2DEI A;  1RR9 A;  2X36 A;  4K0K E;  4JI5 I;  4DV3 E;  4JI2 I;  3WU3 A;  2HHH E;  4HAC A;  4JV5 I;  4DUZ I;  4NXM I;  1U2R A;  4DR1 E;  2E5L E;  4LFA E;  1H7S A;  3J81 Q;  2VQE I;  2AJ4 A;  3T1Y E;  1S4E A;  4OX9 I;  1H74 A;  3LTO A;  4DPT A;  4DV0 E;  1I94 I;  4JI6 E;  4DR4 I;  4JI1 E;  1KIJ A;  4M1K A;  4LFC I;  1HNW I;  3PYD A;  1HNX I;  4Z7C A;  5BR8 I;  1QZR A;  4NXN E;  1N33 E;  2ZBK B;  4DV2 I;  2BM1 A;  4DV4 I;  1PKP A;  4DUY I;  3LNU A;  4MYU A;  2EFG A;  2ZIT A;  4JI7 E;  4JI3 I;  1NHI A;  4FWG A;  4DR3 E;  4B3T E;  2A2C A;  5FLX C;  5L3J A;  1NHJ A;  3QT5 A;  5LMU E;  2HKJ A;  1Z0W A;  3T1H I;  2R42 A;  3Q1Q A;  1XNR E;  4LF7 I;  3GON A;  4X64 I;  1XMQ I;  4X66 I;  2HFS A;  2F4V I;  2Q2E B;  5LL6 R;  4DR2 E;  4GKK I;  3K1J A;  2VF3 A;  3QT6 A;  5FLX Q;  4DV5 I;  4YY3 E;  1IBM I;  4B3S E;  4LF9 I;  4ZVI A;  1B63 A;  1XNQ I;  4KQV A;  1MU5 A;  1N0V C;  1N36 E;  4PRV A;  2UUA E;  4JI0 I;  4XTJ A;  1XMO I;  1ZM2 A;  4B3R I;  1K47 A;  1Z0V A;  1Z0C A;  4X65 E;  2ZM6 E;  3ZZT A;  4FWH A;  4HY1 A;  3WU4 A;  4JI4 I;  2UXB I;  3J81 C;  4DV1 I;  4AQY E;  1FWK A;  1IBK E;  2VQF E;  2V8P A;  1HNZ E;  4JYA E;  3J80 C;  1HR0 I;  4DPW A;  2UUB I;  4DV7 E;  5GMD A;  2UXC I;  3OTO I;  4LF5 I;  4FN5 A;  3V5R A;  3B8H A;  3B78 A;  2UU9 I;  4DV6 E;  4DU7 A;  4B3M I;  1FJG I;  4DR7 E;  4FWD A;  3B82 A;  1BKN A;  3J80 Q;  4GKJ E;  4YHH E;  4HAC B;  2E1R A;  3WU5 A;  4LF4 I;  1UEK A;  5IWA I;  4KHP I;  1J5E I;  4JI5 E;  4JI2 E;  3JAM Q;  4JI8 I;  3D4J A;  1KVK A;  1OJ4 A;  3J7A M;  4JV5 E;  4DUZ E;  4LFB I;  3ZM7 A;  4NXM E;  1D6T A;  1ZM9 A;  1ZXM A;  1KTV A;  4DR6 I;  5IT9 Q;  2VQE E;  1Z5B A;  4MYT A;  1Z0E A;  1VIS A;  4WUD A;  4OX9 E;  4WUC A;  3J7A G;  1RRE A;  2HK2 A;  1N34 I;  2UUC I;  1I94 E;  2LJP A;  2UXD I;  2V34 A;  4DR4 E;  4LF6 I;  4UT4 A;  1PIE A; 
#chains in the Genus database with same CATH topology
 2GO4 A;  3U1K A;  4LFC E;  1HNW E;  1A6F A;  1HNX E;  3F0N A;  2DEJ A;  4OO1 E;  4IFD E;  5BR8 E;  4LF8 I;  4DR5 I;  4UTG A;  1UDQ A;  4DV2 E;  4IZK B;  4AID A;  4IS9 A;  4DV4 E;  2WW4 A;  3P3C A;  4FW3 A;  4DUY E;  2J65 A;  1N32 I;  2F1D A;  2PNM A;  4LPF A;  1B62 A;  2A2D A;  4HYM A;  2C39 A;  2WNR B;  5LMN I;  4JI3 E;  2BA0 G;  2ZM6 I;  1R6M A;  4X62 I;  4OZE A;  2BV3 A;  4QNJ A;  2IER A;  2AE8 A;  4K0K I;  5EL9 A;  3QT8 A;  3T1H E;  5GME A;  4DV3 I;  4JG4 A;  1Z59 A;  4LF7 E;  5A2Q C;  4X64 E;  1XMQ E;  1Y4S A;  4X66 E;  2PO2 A;  2HHH I;  4RPF A;  2F4V E;  3QT7 A;  5C0X A;  2BR2 A;  3HKM A;  4DR1 I;  4PU9 A;  2E5L I;  4LFA I;  1DAR A;  5K36 D;  3PYF A;  4DV5 E;  4IZJ B;  2BA0 D;  2V2Z A;  2NN6 D;  3M6A A;  3T1Y I;  1MX0 A;  1IBM E;  3PYE A;  1RHY A;  4LF9 E;  2Z5B A;  1XNQ E;  2J7K A;  4WUB A;  4ED4 A;  4GKJ I;  1N0U A;  4DV0 I;  5A2Q Q;  4EMD A;  3JAM C;  4JI6 I;  3M7N G;  4JI0 E;  1YH8 A;  1E3H A;  4JI1 I;  1XMO E;  4B3R E;  3H4L A;  3H1C A;  1XXE A;  2VES A;  3L7Z B;  4FW9 A;  1FI4 A;  1IBL E;  2O1T A;  4JI4 E;  2UXB E;  5IT9 C;  1UDN A;  1FWL A;  4DV1 E;  4URL A;  1UDO A;  5DRQ A;  4NXN I;  1N33 I;  1HR0 E;  1XHK A;  3HJC A;  4DU8 A;  2O1V A;  2UUB E;  4Z7Y A;  2O1W A;  4DPX A;  2V2Q A;  4HXZ A;  4JI7 I;  2X7I A;  3PS3 A;  4DR3 I;  4B3T I;  1R6L A;  2UXC E;  1YHC A;  3OTO E;  4LF5 E;  3NZK A;  1PVG A;  2UU9 E;  3K85 A;  5C0X E;  5LMU I;  4B3M E;  1FJG E;  4IFD C;  5K36 F;  2GS8 A;  4I3H A;  5C0X D;  3PYG A;  5JEA A;  1XNR I;  1EI1 A;  2NN6 F;  3V2U C;  4P52 A;  3HUL A;  1UDS A;  1FNM A;  3PS2 A;  2JEA A;  1VI7 A;  4LCF A;  4LF4 E;  2HKE A;  4DR2 I;  5IWA E;  4P7A A;  4KHP E;  1Z0B A;  3ZKD A;  1Y6Z A;  2WP8 B;  4QNK A;  3ZZU A;  3GCM A;  1J5E E;  1H73 A;  1KKH A;  4DPY A;  1H7U A;  3WU6 A;  3M85 G;  4JI8 E;  3KRN A;  5ELW A;  2BM0 A;  4YY3 I;  5K36 B;  2JE6 B;  4B3S I;  1ZM3 A;  4DPU A;  4LFB E;  2NN6 B;  1FKA E;  1USU A;  2C38 B;  5DRR A;  4IZK A;  4FW6 A;  4DR6 E;  4OO1 D;  4IFD D;  1N36 I;  2UUA I;  1EA6 A;  3ZKB A;  4LCG A;  3B4T A;  2HK3 A;  4DXL A;  5K36 C;  2CZ9 A;  2PNZ B;  4OKG A;  1Z5C A;  3P06 A;  2PO0 A;  1WUU A;  3ZZ0 A;  1NHH A;  1Z5A A;  1ZM4 A;  2NN6 C;  4USM A;  4X65 I;  1N34 E;  2WNR A;  1Z0G A;  1S16 A;  2UUC E;  4PRX A;  2OI2 A;  2UXD E;  1H72 C;  1ZXN A;  2GO3 A;  4AQY I;  1IBK I;  4GQU A;  2VQF I;  1HNZ I;  1NZ0 A;  4LF6 E;  4JYA I;  4LOM A;  4BA1 A;  2R3V A;  3P3G A;  3LPS A;  3P76 A;  4DV7 I;  1P42 A;  4LF8 E;  2C39 B;  4DR5 E;  2NPF A;  4GKK E;  5JEA E;  3K17 A;  1MG7 A;  2HFU A;  4R1F A;  2V2V A;  1Z0T A;  3CDJ A;  5JEA D;  4IZJ A;  4DV6 I;  1N32 E;  1Y4U A;  4DR7 I;  2XEX A;  4USK A;  3Q6N A;  1IBL I;  5LMN E;  2PO2 B;  4YHH I;  4X62 E;  2GQ0 A;  3CWV A;  5C0X B;  1ELO A;  2BR2 B;  2DEI A;  1RR9 A;  2X36 A;  4K0K E;  4OO1 F;  4IFD F;  4JI5 I;  2CGE A;  4DV3 E;  4JI2 I;  2BA1 G;  2Z5C B;  2Z5B B;  3WU3 A;  4AM3 A;  2HHH E;  4LCH A;  4HAC A;  4JV5 I;  4DUZ I;  5C0X C;  4NXM I;  1U2R A;  4DR1 E;  2JEB A;  2E5L E;  4LFA E;  1H7S A;  3J81 Q;  2VQE I;  2AJ4 A;  3T1Y E;  1S4E A;  2PO1 A;  4OO1 B;  4IFD B;  4OX9 I;  1H74 A;  5DNL A;  3M7N D;  3LTO A;  4DPT A;  4DV0 E;  1I94 I;  1OYR A;  4JI6 E;  4DR4 I;  4U3B A;  4BA2 A;  1OYS A;  4JI1 E;  2O1U A;  1KIJ A;  3U1Y A;  4OO1 C;  5DNX A;  4M1K A;  2C37 A;  3GLL A;  4LFC I;  1HNW I;  3PYD A;  3PRY A;  1HNX I;  4Z7C A;  4N3O A;  5BR8 I;  1QZR A;  4AIM A;  4NXN E;  1N33 E;  2O3Z A;  2ZBK B;  4DV2 I;  2BM1 A;  1HK7 A;  4DV4 I;  1PKP A;  4DUY I;  3LNU A;  4MYU A;  2JE6 A;  2EFG A;  5JEA B;  2ZIT A;  4JI7 E;  4JI3 I;  1NHI A;  3PS1 A;  4FWG A;  4DR3 E;  2A2C A;  4B3T E;  2JEA B;  5FLX C;  5L3J A;  1NHJ A;  3QT5 A;  3UHM A;  4MU3 A;  5LMU E;  2HKJ A;  1Z0W A;  3T1H I;  2R42 A;  3Q1Q A;  2Z5E A;  1XNR E;  5JEA C;  4LF7 I;  3GON A;  1E3P A;  4X64 I;  1XMQ I;  4X66 I;  2HFS A;  2F4V I;  5DRO A;  2Q2E B;  3M85 D;  5LL6 R;  4DR2 E;  4GKK I;  4U3D A;  4MU1 A;  3K1J A;  2VF3 A;  2IOQ A;  4NBQ A;  3QT6 A;  5FWK A;  5FLX Q;  3GME A;  4J3D A;  4DV5 I;  4YY3 E;  1IBM I;  2IOP A;  4B3S E;  4LF9 I;  2PO0 B;  4ZVI A;  1B63 A;  4ISA A;  4MU4 A;  1XNQ I;  5C0X F;  4KQV A;  1MU5 A;  3CDI A;  2CG9 A;  1N0V C;  1N36 E;  3DD6 A;  4PRV A;  2UUA E;  4JI0 I;  4XTJ A;  1XMO I;  2CVE A;  1ZM2 A;  4B3R I;  4BA1 B;  1K47 A;  1Z0V A;  2PNL A;  4MQY A;  1Z0C A;  4X65 E;  2ZM6 E;  3P3E A;  4FWH A;  4HY1 A;  3WU4 A;  3ZZT A;  4JI4 I;  2UXB I;  3J81 C;  4DV1 I;  5K36 E;  4AQY E;  1FWK A;  2NN6 E;  2VQF E;  1IBK E;  2V8P A;  1Y5Y A;  5DRP A;  1HNZ E;  4JYA E;  3J80 C;  1HR0 I;  3L7Z A;  4DPW A;  2UUB I;  2Z5C A;  4DV7 E;  5GMD A;  2UXC I;  3OTO I;  4LF5 I;  4FN5 A;  3V5R A;  3B8H A;  3B78 A;  2UU9 I;  4DV6 E;  4DU7 A;  4B3M I;  4OO1 A;  1FJG I;  4IFD A;  4DR7 E;  4FWD A;  5EKW A;  3B82 A;  1BKN A;  3J80 Q;  1USV A;  4GKJ E;  4MDT A;  4HAC B;  4YHH E;  2E1R A;  1OYP A;  3WU5 A;  2BA1 D;  4FW4 A;  4LF4 I;  1UEK A;  5IWA I;  2JEB B;  4KHP I;  2IES A;  1J5E I;  4JI5 E;  4JI2 E;  3JAM Q;  4JI8 I;  2PO1 B;  3D4J A;  5JEA F;  1KVK A;  1OJ4 A;  3J7A M;  4JV5 E;  4DUZ E;  4LFB I;  3ZM7 A;  4NXM E;  1Y60 A;  1D6T A;  1ZM9 A;  1ZXM A;  1KTV A;  4IZJ D;  2WP8 A;  4DR6 I;  5IT9 Q;  2VQE E;  4BA2 B;  4FW5 A;  1Z5B A;  4MYT A;  4MU0 A;  1Z0E A;  3Q6M A;  1VIS A;  4WUD A;  4OX9 E;  4WUC A;  3J7A G;  5K36 A;  1RRE A;  2HK2 A;  2NN6 A;  2C37 B;  1N34 I;  2C38 A;  2UUC I;  1I94 E;  2LJP A;  2UXD I;  2V34 A;  4DR4 E;  4LF6 I;  2JT2 A;  4FW7 A;  2PNZ A;  4UT4 A;  1PIE A; 
#chains in the Genus database with same CATH homology
 4LFC E;  1HNW E;  1A6F A;  1HNX E;  3F0N A;  2DEJ A;  5BR8 E;  4LF8 I;  4DR5 I;  4UTG A;  4DV2 E;  4IZK B;  4DV4 E;  2WW4 A;  4DUY E;  1N32 I;  2PNM A;  1B62 A;  2A2D A;  4HYM A;  5LMN I;  4JI3 E;  2ZM6 I;  4X62 I;  2BV3 A;  4K0K I;  3QT8 A;  3T1H E;  5GME A;  4DV3 I;  4JG4 A;  1Z59 A;  4LF7 E;  5A2Q C;  4X64 E;  1XMQ E;  1Y4S A;  4X66 E;  2HHH I;  4RPF A;  2F4V E;  3QT7 A;  4DR1 I;  4PU9 A;  2E5L I;  4LFA I;  1DAR A;  3PYF A;  4DV5 E;  4IZJ B;  2V2Z A;  3M6A A;  3T1Y I;  1MX0 A;  1IBM E;  3PYE A;  4LF9 E;  2Z5B A;  1XNQ E;  2J7K A;  4WUB A;  4ED4 A;  4GKJ I;  1N0U A;  4DV0 I;  5A2Q Q;  4EMD A;  3JAM C;  4JI6 I;  4JI0 E;  4JI1 I;  1XMO E;  4B3R E;  3H4L A;  4FW9 A;  1FI4 A;  1IBL E;  2O1T A;  4JI4 E;  2UXB E;  5IT9 C;  1FWL A;  4DV1 E;  4URL A;  4NXN I;  1N33 I;  1HR0 E;  1XHK A;  3HJC A;  4DU8 A;  2O1V A;  2UUB E;  4Z7Y A;  2O1W A;  4DPX A;  2V2Q A;  4HXZ A;  4JI7 I;  2X7I A;  4DR3 I;  4B3T I;  2UXC E;  3OTO E;  4LF5 E;  1PVG A;  2UU9 E;  3K85 A;  5LMU I;  4B3M E;  1FJG E;  2GS8 A;  4I3H A;  3PYG A;  1XNR I;  1EI1 A;  3V2U C;  4P52 A;  3HUL A;  1FNM A;  4LF4 E;  2HKE A;  4DR2 I;  5IWA E;  4P7A A;  4KHP E;  1Z0B A;  3ZKD A;  1Y6Z A;  3ZZU A;  1J5E E;  1H73 A;  1KKH A;  4DPY A;  1H7U A;  3WU6 A;  4JI8 E;  2BM0 A;  4YY3 I;  4B3S I;  1ZM3 A;  4DPU A;  4LFB E;  1FKA E;  1USU A;  4IZK A;  4DR6 E;  1N36 I;  2UUA I;  1EA6 A;  3ZKB A;  2HK3 A;  4DXL A;  2CZ9 A;  1Z5C A;  3P06 A;  1WUU A;  3ZZ0 A;  1NHH A;  1Z5A A;  1ZM4 A;  4USM A;  4X65 I;  1N34 E;  1Z0G A;  1S16 A;  2UUC E;  4PRX A;  2OI2 A;  2UXD E;  1H72 C;  1ZXN A;  4AQY I;  1IBK I;  2VQF I;  1HNZ I;  1NZ0 A;  4LF6 E;  4JYA I;  2R3V A;  3LPS A;  4DV7 I;  4LF8 E;  4DR5 E;  2NPF A;  4GKK E;  3K17 A;  1MG7 A;  2HFU A;  4R1F A;  2V2V A;  1Z0T A;  4DV6 I;  4IZJ A;  1N32 E;  1Y4U A;  4DR7 I;  2XEX A;  4USK A;  3Q6N A;  1IBL I;  5LMN E;  4YHH I;  4X62 E;  2GQ0 A;  3CWV A;  1ELO A;  2DEI A;  1RR9 A;  2X36 A;  4K0K E;  4JI5 I;  2CGE A;  4DV3 E;  4JI2 I;  2Z5C B;  2Z5B B;  3WU3 A;  2HHH E;  4HAC A;  4JV5 I;  4DUZ I;  4NXM I;  1U2R A;  4DR1 E;  2E5L E;  4LFA E;  1H7S A;  3J81 Q;  2VQE I;  2AJ4 A;  3T1Y E;  1S4E A;  4OX9 I;  1H74 A;  3LTO A;  4DPT A;  4DV0 E;  1I94 I;  4JI6 E;  4DR4 I;  4JI1 E;  2O1U A;  1KIJ A;  4M1K A;  4LFC I;  1HNW I;  3PYD A;  3PRY A;  1HNX I;  4Z7C A;  4N3O A;  5BR8 I;  1QZR A;  4NXN E;  1N33 E;  2ZBK B;  4DV2 I;  2BM1 A;  1HK7 A;  4DV4 I;  1PKP A;  4DUY I;  3LNU A;  4MYU A;  2EFG A;  2ZIT A;  4JI7 E;  4JI3 I;  1NHI A;  4FWG A;  4DR3 E;  4B3T E;  2A2C A;  5FLX C;  5L3J A;  1NHJ A;  3QT5 A;  5LMU E;  2HKJ A;  1Z0W A;  3T1H I;  2R42 A;  3Q1Q A;  2Z5E A;  1XNR E;  4LF7 I;  3GON A;  4X64 I;  1XMQ I;  4X66 I;  2HFS A;  2F4V I;  2Q2E B;  5LL6 R;  4DR2 E;  4GKK I;  3K1J A;  2VF3 A;  2IOQ A;  3QT6 A;  5FWK A;  5FLX Q;  4DV5 I;  4YY3 E;  1IBM I;  2IOP A;  4B3S E;  4LF9 I;  4ZVI A;  1B63 A;  1XNQ I;  4KQV A;  1MU5 A;  2CG9 A;  1N0V C;  1N36 E;  4PRV A;  2UUA E;  4JI0 I;  4XTJ A;  1XMO I;  1ZM2 A;  4B3R I;  1K47 A;  1Z0V A;  2PNL A;  1Z0C A;  4X65 E;  2ZM6 E;  3ZZT A;  4FWH A;  4HY1 A;  3WU4 A;  4JI4 I;  2UXB I;  3J81 C;  4DV1 I;  4AQY E;  1FWK A;  1IBK E;  2VQF E;  2V8P A;  1HNZ E;  4JYA E;  3J80 C;  1HR0 I;  4DPW A;  2UUB I;  2Z5C A;  4DV7 E;  5GMD A;  2UXC I;  3OTO I;  4LF5 I;  4FN5 A;  3V5R A;  3B8H A;  3B78 A;  2UU9 I;  4DV6 E;  4DU7 A;  4B3M I;  1FJG I;  4DR7 E;  4FWD A;  3B82 A;  1BKN A;  3J80 Q;  1USV A;  4GKJ E;  4YHH E;  4HAC B;  2E1R A;  3WU5 A;  4LF4 I;  1UEK A;  5IWA I;  4KHP I;  1J5E I;  4JI5 E;  4JI2 E;  3JAM Q;  4JI8 I;  3D4J A;  1KVK A;  1OJ4 A;  3J7A M;  4JV5 E;  4DUZ E;  4LFB I;  3ZM7 A;  4NXM E;  1D6T A;  1ZM9 A;  1ZXM A;  1KTV A;  4IZJ D;  4DR6 I;  5IT9 Q;  2VQE E;  1Z5B A;  4MYT A;  1Z0E A;  3Q6M A;  1VIS A;  4WUD A;  4OX9 E;  4WUC A;  3J7A G;  1RRE A;  2HK2 A;  1N34 I;  2UUC I;  1I94 E;  2LJP A;  2UXD I;  2V34 A;  4DR4 E;  4LF6 I;  4UT4 A;  1PIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...