1J5EI

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1j5eI00
4B3ME 4LF7E 2UUCE 4DUYE 3V5RA 4DV2I 4R1FA 4WUCA 4JV5I 4X64E 5BR8E 4OX9E 4DR4I 4JYAE 1EA6A 2GS8A 1IBKE 4B3TI 1HNZE 4LFCE 3ZZUA 1N33I 1H74A 3QT8A 1Z59A 3WU5A 4X62I 4GKJI 1N0UA 4JI8E 4JI6I 1FI4A 4LFBE 2UU9E 3OTOE 1FNMA 4NXMI 1S4EA 4DV7I 2EFGA 2VQFI 3T1HE 5IT9C 2XEXA 2UXDE 1ZM9A 1N34I 1BKNA 4DV1E 2A2CA 3V2UC 2V2VA 4LF4E 3J7AM 2HHHE 4JI0E 4DXLA 4B3RI 3J80C 4JI2E 1N0VC 4LF4I 3B82A 2HFUA 4DR1I 2HHHI 1XHKA 4I3HA 4P7AA 5GMDA 5FLXC 4B3SE 1FJGI 3LPSA 2HK2A 4K0KI 1PKPA 4URLA 1XMOI 2BM1A 3HULA 1K47A 1HNWI 1IBMI 3T1YI 1XNRI 1D6TA 2UXCE 4X66E 2F4VI 4KQVA 2OI2A 2UUBI 4UTGA 4JI7E 5LMUI 4HY1A 4DU7A 4DUZE 1QZRA 4FN5A 2UUAE 4LF9I 4JV5E 4DPUA 1KIJA 4DR7I 1H7UA 5LL6R 3GONA 4NXNI 2UXCI 5IWAI 4B3TE 1N33E 1H72C 3QT6A 4X62E 4GKJE 3LNUA 4DUZI 3J81C 4JI3E 1J5EI 4JI6E 1FWLA 2UUAI 4WUBA 4NXME 4DR5I 4DV7E 2VQFE 1VISA 2BV3A 4DPTA 3Q1QA 1N34E 1Z5AA 2WW4A 4MYUA 2DEJA 1Z0EA 4DU8A 4JI3I 4WUDA 3K17A 4B3RE 3J80Q 1HNXI 4DV6I 3ZZTA 4USKA 3ZKBA 1S16A 4Z7CA 1HR0I 1ZM4A 4DR3I 4LF6I 4DR1E 4LFAI 5FLXQ 4DR6E 1KKHA 1FJGE 4PRVA 4JI4I 4JI5I 4K0KE 3QT7A 2DEIA 2VQEI 1XMOE 2R3VA 2AJ4A 1FKAE 1NHHA 1HNWE 1IBME 3T1YE 1XNRE 4DV0I 2ZM6I 3H4LA 2F4VE 4DR6I 2UUBE 2ZITA 5LMUE 1N32I 1A6FA 4YY3E 4DV5E 4YHHE 1I94I 4LF9E 3PYEA 1DARA 4DR7E 4DPYA 4MYTA 4NXNE 2NPFA 5IWAE 3D4JA 4EMDA 3J81Q 1NZ0A 4FWHA 4YY3I 4DV5I 1J5EE 4GKKE 4YHHI 2UXBI 1Z0TA 2V8PA 4KHPI 4X65I 3M6AA 3K1JA 2X36A 4DR5E 4LF8I 4DPXA 4ED4A 4LF5I 3PYGA 1MG7A 1Z0BA 1RR9A 2VF3A 5L3JA 3ZKDA 3JAMC 4RPFA 1Z0WA 4GKKI 3WU3A 4DV3I 5IT9Q 2X7IA 1HNXE 4DV6E 3B78A 4XTJA 2V2ZA 4JI1E 2BM0A 5A2QC 1HR0E 1ZXNA 2E5LI 1ELOA 4DR3E 4LF6E 4LFAE 1MX0A 2Q2EB 4JI4E 4JI5E 3ZM7A 2VQEE 1NHIA 2CZ9A 1KTVA 1IBLI 2LJPA 4JI1I 4DV4E 1B63A 4B3MI 2R42A 4PRXA 4DV0E 2ZM6E 4LF7I 2UUCI 4AQYE 1ZXMA 5LMNE 4HACB 4DUYI 1MU5A 1N32E 4X64I 3J7AG 5BR8I 4OX9I 4DPWA 3LTOA 2HKJA 1ZM3A 2HK3A 4JYAI 3F0NA 1IBKI 1HNZI 1I94E 4LFCI 4HYMA 1N36E 4DV4I 1RREA 1H7SA 4FWDA 1WUUA 1Z0GA 3PYDA 2J7KA 4AQYI 4JI8I 1XNQE 5LMNI 1UEKA 4LFBI 2UU9I 5GMEA 3OTOI 3T1HI 1B62A 2UXDI 1PIEA 1XMQE 2UXBE 1FWKA 4FW9A 4M1KA 4DV1I 4KHPE 1ZM2A 4X65E 4PU9A 1N36I 1Z0CA 2HKEA 4LF8E 4DR2E 4ZVIA 4LF5E 1XNQI 3PYFA 3WU4A 4JI0I 4HACA 1Z0VA 3QT5A 3JAMQ 2A2DA 2ZBKB 1U2RA 1NHJA 1EI1A 4JI2I 1XMQI 1PVGA 4DV3E 2E1RA 3B8HA 4USMA 4UT4A 4DR2I 4Z7YA 5A2QQ 3WU6A 1Z5CA 4JG4A 4B3SI 1Z5BA 2E5LE 2V34A 3ZZ0A 1H73A 4FWGA 2HFSA 4HXZA 4P52A 1OJ4A 4DV2E 1KVKA 4DR4E 4X66I 3CWVA 1IBLE 2V2QA 4JI7I
chains in the Genus database with same CATH superfamily
4B3ME 3M85D 2CGEA 4LF7E 2UUCE 4FW4A 5DRQA 4DUYE 3V5RA 4DV2I 2WP8A 3PS2A 4R1FA 4WUCA 4JV5I 4QNKA 4X64E 5C0XE 5EL9A 5BR8E 4OX9E 4DR4I 2Z5BA 5K36F 4JYAE 1EA6A 2GS8A 5DRRA 1IBKE 4B3TI 5K36D 1HNZE 4AIDA 4LFCE 3PS3A 3ZZUA 4BA2A 1N33I 1H74A 3QT8A 1Z59A 3WU5A 4X62I 4GKJI 2JE6B 2C39A 1N0UA 4JI8E 2PO1A 2Z5CB 4JI6I 1FI4A 4LFBE 2UU9E 3OTOE 1FNMA 4NXMI 1S4EA 4DV7I 1Y4SA 2EFGA 2VQFI 3T1HE 5IT9C 2XEXA 2UXDE 1ZM9A 2IERA 1N34I 1BKNA 4DV1E 2A2CA 3V2UC 5JEAF 2V2VA 4LF4E 5JEAD 3J7AM 2HHHE 4JI0E 4IFDD 1VI7A 4DXLA 4B3RI 5K36B 4LCHA 4MQYA 3J80C 1UDNA 2BA1G 4JI2E 1N0VC 2WNRB 4OKGA 4LF4I 3B82A 2JE6A 2GO4A 2HFUA 4NBQA 4DR1I 2HHHI 4GQUA 2JEBA 1XHKA 2Z5CA 4I3HA 4P7AA 2C38B 5GMDA 5FLXC 4B3SE 1FJGI 3LPSA 2HK2A 4K0KI 1PKPA 4URLA 1OYRA 1XMOI 1Y60A 5JEAB 1R6MA 3DD6A 2BM1A 3HULA 1K47A 4U3BA 1HNWI 1IBMI 3T1YI 1XNRI 2CVEA 4IFDB 1D6TA 2UXCE 2PO2B 4X66E 2GO3A 2PNLA 2F4VI 4KQVA 2OI2A 2J65A 2UUBI 4UTGA 4JI7E 5LMUI 4HY1A 1XXEA 5K36A 4DU7A 4DUZE 2AE8A 1QZRA 3HJCA 4FN5A 2UUAE 2WNRA 4LF9I 4JV5E 4DPUA 5K36C 3Q6NA 1KIJA 4DR7I 1H7UA 5LL6R 3GONA 1USVA 4NXNI 2UXCI 5IWAI 4LPFA 4B3TE 1HK7A 4FW7A 2O3ZA 1RHYA 2C38A 1N33E 1H72C 3QT6A 4X62E 4GKJE 3LNUA 2BA1D 4DUZI 3J81C 4JI3E 1J5EI 4JI6E 5JEAA 1FWLA 2UUAI 4WUBA 5ELWA 5C0XD 4MU1A 4NXME 4DR5I 4DV7E 2O1TA 2VQFE 1VISA 2BV3A 4DPTA 3Q1QA 1N34E 5JEAC 2O1WA 1Z5AA 3L7ZB 4LCFA 2NN6A 2PNMA 3Q6MA 4LCGA 2WW4A 4MYUA 2DEJA 1Z0EA 1UDOA 4DU8A 4JI3I 4WUDA 2BA0D 3K17A 2NN6C 4B3RE 2JT2A 3J80Q 1HNXI 4DV6I 3ZZTA 2F1DA 2GQ0A 5K36E 3P3EA 4USKA 3ZKBA 4MU4A 1S16A 4Z7CA 1HR0I 5DROA 1ZM4A 4FW6A 4DR3I 4LF6I 4DR1E 4LFAI 5FLXQ 4DR6E 4IFDF 1UDSA 2IOQA 1KKHA 1FJGE 4PRVA 4JI4I 4JI5I 4K0KE 3QT7A 3NZKA 2PNZB 2DEIA 2VQEI 3P3CA 3H1CA 1XMOE 2R3VA 2AJ4A 3PRYA 1OYPA 1FKAE 3M7ND 1UDQA 1NHHA 1HNWE 1IBME 3T1YE 1XNRE 4OZEA 5JEAE 2ZM6I 4DV0I 3H4LA 2F4VE 4OO1F 4DR6I 2UUBE 4OO1D 2ZITA 5LMUE 1N32I 1A6FA 3GMEA 4YY3E 4DV5E 2NN6E 4YHHE 1I94I 4LF9E 1USUA 3PYEA 2BA0G 1DARA 4DR7E 2VESA 4DPYA 4MU0A 4MYTA 4NXNE 2NPFA 5IWAE 3D4JA 3GCMA 1E3PA 1Y4UA 3HKMA 4EMDA 3J81Q 1NZ0A 4FWHA 2Z5EA 4YY3I 4DV5I 1J5EE 4GKKE 4YHHI 2UXBI 1Z0TA 2V8PA 4KHPI 4X65I 3M6AA 2JEAB 3K1JA 2X36A 4DR5E 4LF8I 3P76A 4OO1B 3CDIA 4DPXA 4ED4A 5DNLA 4LF5I 3K85A 4BA2B 3PYGA 4J3DA 3GLLA 1MG7A 1Z0BA 1RR9A 2VF3A 5L3JA 3ZKDA 3JAMC 4RPFA 1YHCA 1Z0WA 4GKKI 3WU3A 4DV3I 5C0XF 2PO0B 5IT9Q 2X7IA 1HNXE 4IFDA 4DV6E 3B78A 2PO2A 3U1YA 4XTJA 2V2ZA 4JI1E 2BM0A 3CDJA 5A2QC 2BR2B 1HR0E 4IFDC 1ZXNA 2E5LI 4QNJA 1ELOA 4DR3E 4LF6E 4LFAE 1MX0A 4IS9A 2CG9A 2JEAA 2Q2EB 4JI4E 4JI5E 3ZM7A 3KRNA 4OO1A 2VQEE 1NHIA 2CZ9A 1KTVA 1IBLI 2LJPA 4JI1I 4DV4E 1B63A 2R42A 4B3MI 4PRXA 4DV0E 2ZM6E 4LF7I 4OO1C 1R6LA 2UUCI 4AQYE 1ZXMA 5C0XB 2JEBB 5LMNE 4HACB 4N3OA 4DUYI 1MU5A 2PO0A 1N32E 4X64I 3J7AG 5BR8I 4IZJD 4OX9I 4DPWA 3LTOA 2HKJA 1ZM3A 2HK3A 4JYAI 3F0NA 1IBKI 4LOMA 1HNZI 1I94E 4LFCI 4HYMA 4IZKB 1N36E 4DV4I 1RREA 1H7SA 4FWDA 1Y5YA 2BR2A 1WUUA 3L7ZA 1Z0GA 3PYDA 4U3DA 2J7KA 4AQYI 4AIMA 4JI8I 1XNQE 2O1VA 5LMNI 4AM3A 1UEKA 4LFBI 4IFDE 2UU9I 5GMEA 3B4TA 3PS1A 3OTOI 3M7NG 4MU3A 3T1HI 2NN6F 1B62A 3M85G 2NN6D 2UXDI 1PIEA 2C37B 3UHMA 1XMQE 2UXBE 1FWKA 4FW9A 4M1KA 4DV1I 4KHPE 1ZM2A 4X65E 4PU9A 1Y6ZA 1N36I 5FWKA 1Z0CA 4FW5A 2HKEA 4LF8E 4DR2E 4ZVIA 5DRPA 4LF5E 5C0XA 4BA1B 3PYFA 3WU4A 5DNXA 4JI0I 1XNQI 4HACA 1Z0VA 2IESA 4IZJB 3QT5A 4FW3A 1P42A 4OO1E 3JAMQ 2A2DA 2ZBKB 1U2RA 1NHJA 1E3HA 5C0XC 1EI1A 2PNZA 4JI2I 2IOPA 1XMQI 1PVGA 2WP8B 4DV3E 1OYSA 2E1RA 3B8HA 3P3GA 4IZKA 2O1UA 4ISAA 4MDTA 4USMA 1YH8A 4UT4A 2Z5BB 4DR2I 4Z7YA 5A2QQ 3WU6A 1Z5CA 4JG4A 2NN6B 5EKWA 4B3SI 2C39B 1Z5BA 2E5LE 2V34A 3ZZ0A 1H73A 2C37A 2PO1B 4FWGA 2HFSA 4HXZA 4P52A 1OJ4A 4DV2E 3U1KA 1KVKA 4DR4E 4X66I 3CWVA 4BA1A 3P06A 1IBLE 2V2QA 4JI7I 4IZJA
chains in the Genus database with same CATH topology
4B3ME 2CGEA 4LF7E 2UUCE 4DUYE 3V5RA 4DV2I 4R1FA 4WUCA 4JV5I 4X64E 5BR8E 4OX9E 4DR4I 2Z5BA 4JYAE 1EA6A 2GS8A 1IBKE 4B3TI 1HNZE 4LFCE 3ZZUA 1N33I 1H74A 3QT8A 1Z59A 3WU5A 4X62I 4GKJI 1N0UA 4JI8E 2Z5CB 4JI6I 1FI4A 4LFBE 2UU9E 3OTOE 1FNMA 4NXMI 1S4EA 4DV7I 1Y4SA 2EFGA 2VQFI 3T1HE 5IT9C 2XEXA 2UXDE 1ZM9A 1N34I 1BKNA 4DV1E 2A2CA 3V2UC 2V2VA 4LF4E 3J7AM 2HHHE 4JI0E 4DXLA 4B3RI 3J80C 4JI2E 1N0VC 4LF4I 3B82A 2HFUA 4DR1I 2HHHI 1XHKA 2Z5CA 4I3HA 4P7AA 5GMDA 5FLXC 4B3SE 1FJGI 3LPSA 2HK2A 4K0KI 1PKPA 4URLA 1XMOI 2BM1A 3HULA 1K47A 1HNWI 1IBMI 3T1YI 1XNRI 1D6TA 2UXCE 4X66E 2PNLA 2F4VI 4KQVA 2OI2A 2UUBI 4UTGA 4JI7E 5LMUI 4HY1A 4DU7A 4DUZE 1QZRA 3HJCA 4FN5A 2UUAE 4LF9I 4JV5E 4DPUA 3Q6NA 1KIJA 4DR7I 1H7UA 5LL6R 3GONA 1USVA 4NXNI 2UXCI 5IWAI 4B3TE 1HK7A 1N33E 1H72C 3QT6A 4X62E 4GKJE 3LNUA 4DUZI 3J81C 4JI3E 1J5EI 4JI6E 1FWLA 2UUAI 4WUBA 4NXME 4DR5I 4DV7E 2O1TA 2VQFE 1VISA 2BV3A 4DPTA 3Q1QA 1N34E 2O1WA 1Z5AA 2PNMA 3Q6MA 2WW4A 4MYUA 2DEJA 1Z0EA 4DU8A 4JI3I 4WUDA 3K17A 4B3RE 3J80Q 1HNXI 4DV6I 3ZZTA 2GQ0A 4USKA 3ZKBA 1S16A 4Z7CA 1HR0I 1ZM4A 4DR3I 4LF6I 4DR1E 4LFAI 5FLXQ 4DR6E 2IOQA 1KKHA 1FJGE 4PRVA 4JI4I 4JI5I 4K0KE 3QT7A 2DEIA 2VQEI 1XMOE 2R3VA 2AJ4A 3PRYA 1FKAE 1NHHA 1HNWE 1IBME 3T1YE 1XNRE 4DV0I 2ZM6I 3H4LA 2F4VE 4DR6I 2UUBE 2ZITA 5LMUE 1N32I 1A6FA 4YY3E 4DV5E 4YHHE 1I94I 4LF9E 1USUA 3PYEA 1DARA 4DR7E 4DPYA 4MYTA 4NXNE 2NPFA 5IWAE 3D4JA 1Y4UA 4EMDA 3J81Q 1NZ0A 4FWHA 2Z5EA 4YY3I 4DV5I 1J5EE 4GKKE 4YHHI 2UXBI 1Z0TA 2V8PA 4KHPI 4X65I 3M6AA 3K1JA 2X36A 4DR5E 4LF8I 4DPXA 4ED4A 4LF5I 3K85A 3PYGA 1MG7A 1Z0BA 1RR9A 2VF3A 5L3JA 3ZKDA 3JAMC 4RPFA 1Z0WA 4GKKI 3WU3A 4DV3I 5IT9Q 2X7IA 1HNXE 4DV6E 3B78A 4XTJA 2V2ZA 4JI1E 2BM0A 5A2QC 1HR0E 1ZXNA 2E5LI 1ELOA 4DR3E 4LF6E 4LFAE 1MX0A 2CG9A 2Q2EB 4JI4E 4JI5E 3ZM7A 2VQEE 1NHIA 2CZ9A 1KTVA 1IBLI 2LJPA 4JI1I 4DV4E 1B63A 2R42A 4B3MI 4PRXA 4DV0E 2ZM6E 4LF7I 2UUCI 4AQYE 1ZXMA 5LMNE 4HACB 4N3OA 4DUYI 1MU5A 1N32E 4X64I 3J7AG 5BR8I 4IZJD 4OX9I 4DPWA 3LTOA 2HKJA 1ZM3A 2HK3A 4JYAI 3F0NA 1IBKI 1HNZI 1I94E 4LFCI 4HYMA 4IZKB 1N36E 4DV4I 1RREA 1H7SA 4FWDA 1WUUA 1Z0GA 3PYDA 2J7KA 4AQYI 4JI8I 1XNQE 2O1VA 5LMNI 1UEKA 4LFBI 2UU9I 5GMEA 3OTOI 3T1HI 1B62A 2UXDI 1PIEA 1XMQE 2UXBE 1FWKA 4FW9A 4M1KA 4DV1I 4KHPE 1ZM2A 4X65E 4PU9A 1Y6ZA 1N36I 5FWKA 1Z0CA 2HKEA 4LF8E 4DR2E 4ZVIA 4LF5E 1XNQI 3PYFA 3WU4A 4JI0I 4HACA 1Z0VA 4IZJB 3QT5A 3JAMQ 2A2DA 2ZBKB 1U2RA 1NHJA 1EI1A 4JI2I 2IOPA 1XMQI 1PVGA 4DV3E 2E1RA 3B8HA 4IZKA 2O1UA 4USMA 4UT4A 2Z5BB 4DR2I 4Z7YA 5A2QQ 3WU6A 1Z5CA 4JG4A 4B3SI 1Z5BA 2E5LE 2V34A 3ZZ0A 1H73A 4FWGA 2HFSA 4HXZA 4P52A 1OJ4A 4DV2E 1KVKA 4DR4E 4X66I 3CWVA 1IBLE 3P06A 2V2QA 4JI7I 4IZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M E;  4LF7 E;  2UUC E;  4DUY E;  3V5R A;  4DV2 I;  4R1F A;  4WUC A;  4JV5 I;  4X64 E;  5BR8 E;  4OX9 E;  4DR4 I;  4JYA E;  1EA6 A;  2GS8 A;  1IBK E;  4B3T I;  1HNZ E;  4LFC E;  3ZZU A;  1N33 I;  1H74 A;  3QT8 A;  1Z59 A;  3WU5 A;  4X62 I;  4GKJ I;  1N0U A;  4JI8 E;  4JI6 I;  1FI4 A;  4LFB E;  2UU9 E;  3OTO E;  1FNM A;  4NXM I;  1S4E A;  4DV7 I;  2EFG A;  2VQF I;  3T1H E;  5IT9 C;  2XEX A;  2UXD E;  1ZM9 A;  1N34 I;  1BKN A;  4DV1 E;  2A2C A;  3V2U C;  2V2V A;  4LF4 E;  3J7A M;  2HHH E;  4JI0 E;  4DXL A;  4B3R I;  3J80 C;  4JI2 E;  1N0V C;  4LF4 I;  3B82 A;  2HFU A;  4DR1 I;  2HHH I;  1XHK A;  4I3H A;  4P7A A;  5GMD A;  5FLX C;  4B3S E;  1FJG I;  3LPS A;  2HK2 A;  4K0K I;  1PKP A;  4URL A;  1XMO I;  2BM1 A;  3HUL A;  1K47 A;  1HNW I;  1IBM I;  3T1Y I;  1XNR I;  1D6T A;  2UXC E;  4X66 E;  2F4V I;  4KQV A;  2OI2 A;  2UUB I;  4UTG A;  4JI7 E;  5LMU I;  4HY1 A;  4DU7 A;  4DUZ E;  1QZR A;  4FN5 A;  2UUA E;  4LF9 I;  4JV5 E;  4DPU A;  1KIJ A;  4DR7 I;  1H7U A;  5LL6 R;  3GON A;  4NXN I;  2UXC I;  5IWA I;  4B3T E;  1N33 E;  1H72 C;  3QT6 A;  4X62 E;  4GKJ E;  3LNU A;  4DUZ I;  3J81 C;  4JI3 E;  1J5E I;  4JI6 E;  1FWL A;  2UUA I;  4WUB A;  4NXM E;  4DR5 I;  4DV7 E;  2VQF E;  1VIS A;  2BV3 A;  4DPT A;  3Q1Q A;  1N34 E;  1Z5A A;  2WW4 A;  4MYU A;  2DEJ A;  1Z0E A;  4DU8 A;  4JI3 I;  4WUD A;  3K17 A;  4B3R E;  3J80 Q;  1HNX I;  4DV6 I;  3ZZT A;  4USK A;  3ZKB A;  1S16 A;  4Z7C A;  1HR0 I;  1ZM4 A;  4DR3 I;  4LF6 I;  4DR1 E;  4LFA I;  5FLX Q;  4DR6 E;  1KKH A;  1FJG E;  4PRV A;  4JI4 I;  4JI5 I;  4K0K E;  3QT7 A;  2DEI A;  2VQE I;  1XMO E;  2R3V A;  2AJ4 A;  1FKA E;  1NHH A;  1HNW E;  1IBM E;  3T1Y E;  1XNR E;  4DV0 I;  2ZM6 I;  3H4L A;  2F4V E;  4DR6 I;  2UUB E;  2ZIT A;  5LMU E;  1N32 I;  1A6F A;  4YY3 E;  4DV5 E;  4YHH E;  1I94 I;  4LF9 E;  3PYE A;  1DAR A;  4DR7 E;  4DPY A;  4MYT A;  4NXN E;  2NPF A;  5IWA E;  3D4J A;  4EMD A;  3J81 Q;  1NZ0 A;  4FWH A;  4YY3 I;  4DV5 I;  1J5E E;  4GKK E;  4YHH I;  2UXB I;  1Z0T A;  2V8P A;  4KHP I;  4X65 I;  3M6A A;  3K1J A;  2X36 A;  4DR5 E;  4LF8 I;  4DPX A;  4ED4 A;  4LF5 I;  3PYG A;  1MG7 A;  1Z0B A;  1RR9 A;  2VF3 A;  5L3J A;  3ZKD A;  3JAM C;  4RPF A;  1Z0W A;  4GKK I;  3WU3 A;  4DV3 I;  5IT9 Q;  2X7I A;  1HNX E;  4DV6 E;  3B78 A;  4XTJ A;  2V2Z A;  4JI1 E;  2BM0 A;  5A2Q C;  1HR0 E;  1ZXN A;  2E5L I;  1ELO A;  4DR3 E;  4LF6 E;  4LFA E;  1MX0 A;  2Q2E B;  4JI4 E;  4JI5 E;  3ZM7 A;  2VQE E;  1NHI A;  2CZ9 A;  1KTV A;  1IBL I;  2LJP A;  4JI1 I;  4DV4 E;  1B63 A;  4B3M I;  2R42 A;  4PRX A;  4DV0 E;  2ZM6 E;  4LF7 I;  2UUC I;  4AQY E;  1ZXM A;  5LMN E;  4HAC B;  4DUY I;  1MU5 A;  1N32 E;  4X64 I;  3J7A G;  5BR8 I;  4OX9 I;  4DPW A;  3LTO A;  2HKJ A;  1ZM3 A;  2HK3 A;  4JYA I;  3F0N A;  1IBK I;  1HNZ I;  1I94 E;  4LFC I;  4HYM A;  1N36 E;  4DV4 I;  1RRE A;  1H7S A;  4FWD A;  1WUU A;  1Z0G A;  3PYD A;  2J7K A;  4AQY I;  4JI8 I;  1XNQ E;  5LMN I;  1UEK A;  4LFB I;  2UU9 I;  5GME A;  3OTO I;  3T1H I;  1B62 A;  2UXD I;  1PIE A;  1XMQ E;  2UXB E;  1FWK A;  4FW9 A;  4M1K A;  4DV1 I;  4KHP E;  1ZM2 A;  4X65 E;  4PU9 A;  1N36 I;  1Z0C A;  2HKE A;  4LF8 E;  4DR2 E;  4ZVI A;  4LF5 E;  1XNQ I;  3PYF A;  3WU4 A;  4JI0 I;  4HAC A;  1Z0V A;  3QT5 A;  3JAM Q;  2A2D A;  2ZBK B;  1U2R A;  1NHJ A;  1EI1 A;  4JI2 I;  1XMQ I;  1PVG A;  4DV3 E;  2E1R A;  3B8H A;  4USM A;  4UT4 A;  4DR2 I;  4Z7Y A;  5A2Q Q;  3WU6 A;  1Z5C A;  4JG4 A;  4B3S I;  1Z5B A;  2E5L E;  2V34 A;  3ZZ0 A;  1H73 A;  4FWG A;  2HFS A;  4HXZ A;  4P52 A;  1OJ4 A;  4DV2 E;  1KVK A;  4DR4 E;  4X66 I;  3CWV A;  1IBL E;  2V2Q A;  4JI7 I; 
#chains in the Genus database with same CATH topology
 4B3M E;  3M85 D;  2CGE A;  4LF7 E;  2UUC E;  4FW4 A;  5DRQ A;  4DUY E;  3V5R A;  4DV2 I;  2WP8 A;  3PS2 A;  4R1F A;  4WUC A;  4JV5 I;  4QNK A;  4X64 E;  5C0X E;  5EL9 A;  5BR8 E;  4OX9 E;  4DR4 I;  2Z5B A;  5K36 F;  4JYA E;  1EA6 A;  2GS8 A;  5DRR A;  1IBK E;  4B3T I;  5K36 D;  1HNZ E;  4AID A;  4LFC E;  3PS3 A;  3ZZU A;  4BA2 A;  1N33 I;  1H74 A;  3QT8 A;  1Z59 A;  3WU5 A;  4X62 I;  4GKJ I;  2JE6 B;  2C39 A;  1N0U A;  4JI8 E;  2PO1 A;  2Z5C B;  4JI6 I;  1FI4 A;  4LFB E;  2UU9 E;  3OTO E;  1FNM A;  4NXM I;  1S4E A;  4DV7 I;  1Y4S A;  2EFG A;  2VQF I;  3T1H E;  5IT9 C;  2XEX A;  2UXD E;  1ZM9 A;  2IER A;  1N34 I;  1BKN A;  4DV1 E;  2A2C A;  3V2U C;  5JEA F;  2V2V A;  4LF4 E;  5JEA D;  3J7A M;  2HHH E;  4JI0 E;  4IFD D;  1VI7 A;  4DXL A;  4B3R I;  5K36 B;  4LCH A;  4MQY A;  3J80 C;  1UDN A;  2BA1 G;  4JI2 E;  1N0V C;  2WNR B;  4OKG A;  4LF4 I;  3B82 A;  2JE6 A;  2GO4 A;  2HFU A;  4NBQ A;  4DR1 I;  2HHH I;  4GQU A;  2JEB A;  1XHK A;  2Z5C A;  4I3H A;  4P7A A;  2C38 B;  5GMD A;  5FLX C;  4B3S E;  1FJG I;  3LPS A;  2HK2 A;  4K0K I;  1PKP A;  4URL A;  1OYR A;  1XMO I;  1Y60 A;  5JEA B;  1R6M A;  3DD6 A;  2BM1 A;  3HUL A;  1K47 A;  4U3B A;  1HNW I;  1IBM I;  3T1Y I;  1XNR I;  2CVE A;  4IFD B;  1D6T A;  2UXC E;  2PO2 B;  4X66 E;  2GO3 A;  2PNL A;  2F4V I;  4KQV A;  2OI2 A;  2J65 A;  2UUB I;  4UTG A;  4JI7 E;  5LMU I;  4HY1 A;  1XXE A;  5K36 A;  4DU7 A;  4DUZ E;  2AE8 A;  1QZR A;  3HJC A;  4FN5 A;  2UUA E;  2WNR A;  4LF9 I;  4JV5 E;  4DPU A;  5K36 C;  3Q6N A;  1KIJ A;  4DR7 I;  1H7U A;  5LL6 R;  3GON A;  1USV A;  4NXN I;  2UXC I;  5IWA I;  4LPF A;  4B3T E;  1HK7 A;  4FW7 A;  2O3Z A;  1RHY A;  2C38 A;  1N33 E;  1H72 C;  3QT6 A;  4X62 E;  4GKJ E;  3LNU A;  2BA1 D;  4DUZ I;  3J81 C;  4JI3 E;  1J5E I;  4JI6 E;  5JEA A;  1FWL A;  2UUA I;  4WUB A;  5ELW A;  5C0X D;  4MU1 A;  4NXM E;  4DR5 I;  4DV7 E;  2O1T A;  2VQF E;  1VIS A;  2BV3 A;  4DPT A;  3Q1Q A;  1N34 E;  5JEA C;  2O1W A;  1Z5A A;  3L7Z B;  4LCF A;  2NN6 A;  2PNM A;  3Q6M A;  4LCG A;  2WW4 A;  4MYU A;  2DEJ A;  1Z0E A;  1UDO A;  4DU8 A;  4JI3 I;  4WUD A;  2BA0 D;  3K17 A;  2NN6 C;  4B3R E;  2JT2 A;  3J80 Q;  1HNX I;  4DV6 I;  3ZZT A;  2F1D A;  2GQ0 A;  5K36 E;  3P3E A;  4USK A;  3ZKB A;  4MU4 A;  1S16 A;  4Z7C A;  1HR0 I;  5DRO A;  1ZM4 A;  4FW6 A;  4DR3 I;  4LF6 I;  4DR1 E;  4LFA I;  5FLX Q;  4DR6 E;  4IFD F;  1UDS A;  2IOQ A;  1KKH A;  1FJG E;  4PRV A;  4JI4 I;  4JI5 I;  4K0K E;  3QT7 A;  3NZK A;  2PNZ B;  2DEI A;  2VQE I;  3P3C A;  3H1C A;  1XMO E;  2R3V A;  2AJ4 A;  3PRY A;  1OYP A;  1FKA E;  3M7N D;  1UDQ A;  1NHH A;  1HNW E;  1IBM E;  3T1Y E;  1XNR E;  4OZE A;  5JEA E;  2ZM6 I;  4DV0 I;  3H4L A;  2F4V E;  4OO1 F;  4DR6 I;  2UUB E;  4OO1 D;  2ZIT A;  5LMU E;  1N32 I;  1A6F A;  3GME A;  4YY3 E;  4DV5 E;  2NN6 E;  4YHH E;  1I94 I;  4LF9 E;  1USU A;  3PYE A;  2BA0 G;  1DAR A;  4DR7 E;  2VES A;  4DPY A;  4MU0 A;  4MYT A;  4NXN E;  2NPF A;  5IWA E;  3D4J A;  3GCM A;  1E3P A;  1Y4U A;  3HKM A;  4EMD A;  3J81 Q;  1NZ0 A;  4FWH A;  2Z5E A;  4YY3 I;  4DV5 I;  1J5E E;  4GKK E;  4YHH I;  2UXB I;  1Z0T A;  2V8P A;  4KHP I;  4X65 I;  3M6A A;  2JEA B;  3K1J A;  2X36 A;  4DR5 E;  4LF8 I;  3P76 A;  4OO1 B;  3CDI A;  4DPX A;  4ED4 A;  5DNL A;  4LF5 I;  3K85 A;  4BA2 B;  3PYG A;  4J3D A;  3GLL A;  1MG7 A;  1Z0B A;  1RR9 A;  2VF3 A;  5L3J A;  3ZKD A;  3JAM C;  4RPF A;  1YHC A;  1Z0W A;  4GKK I;  3WU3 A;  4DV3 I;  5C0X F;  2PO0 B;  5IT9 Q;  2X7I A;  1HNX E;  4IFD A;  4DV6 E;  3B78 A;  2PO2 A;  3U1Y A;  4XTJ A;  2V2Z A;  4JI1 E;  2BM0 A;  3CDJ A;  5A2Q C;  2BR2 B;  1HR0 E;  4IFD C;  1ZXN A;  2E5L I;  4QNJ A;  1ELO A;  4DR3 E;  4LF6 E;  4LFA E;  1MX0 A;  4IS9 A;  2CG9 A;  2JEA A;  2Q2E B;  4JI4 E;  4JI5 E;  3ZM7 A;  3KRN A;  4OO1 A;  2VQE E;  1NHI A;  2CZ9 A;  1KTV A;  1IBL I;  2LJP A;  4JI1 I;  4DV4 E;  1B63 A;  2R42 A;  4B3M I;  4PRX A;  4DV0 E;  2ZM6 E;  4LF7 I;  4OO1 C;  1R6L A;  2UUC I;  4AQY E;  1ZXM A;  5C0X B;  2JEB B;  5LMN E;  4HAC B;  4N3O A;  4DUY I;  1MU5 A;  2PO0 A;  1N32 E;  4X64 I;  3J7A G;  5BR8 I;  4IZJ D;  4OX9 I;  4DPW A;  3LTO A;  2HKJ A;  1ZM3 A;  2HK3 A;  4JYA I;  3F0N A;  1IBK I;  4LOM A;  1HNZ I;  1I94 E;  4LFC I;  4HYM A;  4IZK B;  1N36 E;  4DV4 I;  1RRE A;  1H7S A;  4FWD A;  1Y5Y A;  2BR2 A;  1WUU A;  3L7Z A;  1Z0G A;  3PYD A;  4U3D A;  2J7K A;  4AQY I;  4AIM A;  4JI8 I;  1XNQ E;  2O1V A;  5LMN I;  4AM3 A;  1UEK A;  4LFB I;  4IFD E;  2UU9 I;  5GME A;  3B4T A;  3PS1 A;  3OTO I;  3M7N G;  4MU3 A;  3T1H I;  2NN6 F;  1B62 A;  3M85 G;  2NN6 D;  2UXD I;  1PIE A;  2C37 B;  3UHM A;  1XMQ E;  2UXB E;  1FWK A;  4FW9 A;  4M1K A;  4DV1 I;  4KHP E;  1ZM2 A;  4X65 E;  4PU9 A;  1Y6Z A;  1N36 I;  5FWK A;  1Z0C A;  4FW5 A;  2HKE A;  4LF8 E;  4DR2 E;  4ZVI A;  5DRP A;  4LF5 E;  5C0X A;  4BA1 B;  3PYF A;  3WU4 A;  5DNX A;  4JI0 I;  1XNQ I;  4HAC A;  1Z0V A;  2IES A;  4IZJ B;  3QT5 A;  4FW3 A;  1P42 A;  4OO1 E;  3JAM Q;  2A2D A;  2ZBK B;  1U2R A;  1NHJ A;  1E3H A;  5C0X C;  1EI1 A;  2PNZ A;  4JI2 I;  2IOP A;  1XMQ I;  1PVG A;  2WP8 B;  4DV3 E;  1OYS A;  2E1R A;  3B8H A;  3P3G A;  4IZK A;  2O1U A;  4ISA A;  4MDT A;  4USM A;  1YH8 A;  4UT4 A;  2Z5B B;  4DR2 I;  4Z7Y A;  5A2Q Q;  3WU6 A;  1Z5C A;  4JG4 A;  2NN6 B;  5EKW A;  4B3S I;  2C39 B;  1Z5B A;  2E5L E;  2V34 A;  3ZZ0 A;  1H73 A;  2C37 A;  2PO1 B;  4FWG A;  2HFS A;  4HXZ A;  4P52 A;  1OJ4 A;  4DV2 E;  3U1K A;  1KVK A;  4DR4 E;  4X66 I;  3CWV A;  4BA1 A;  3P06 A;  1IBL E;  2V2Q A;  4JI7 I;  4IZJ A; 
#chains in the Genus database with same CATH homology
 4B3M E;  2CGE A;  4LF7 E;  2UUC E;  4DUY E;  3V5R A;  4DV2 I;  4R1F A;  4WUC A;  4JV5 I;  4X64 E;  5BR8 E;  4OX9 E;  4DR4 I;  2Z5B A;  4JYA E;  1EA6 A;  2GS8 A;  1IBK E;  4B3T I;  1HNZ E;  4LFC E;  3ZZU A;  1N33 I;  1H74 A;  3QT8 A;  1Z59 A;  3WU5 A;  4X62 I;  4GKJ I;  1N0U A;  4JI8 E;  2Z5C B;  4JI6 I;  1FI4 A;  4LFB E;  2UU9 E;  3OTO E;  1FNM A;  4NXM I;  1S4E A;  4DV7 I;  1Y4S A;  2EFG A;  2VQF I;  3T1H E;  5IT9 C;  2XEX A;  2UXD E;  1ZM9 A;  1N34 I;  1BKN A;  4DV1 E;  2A2C A;  3V2U C;  2V2V A;  4LF4 E;  3J7A M;  2HHH E;  4JI0 E;  4DXL A;  4B3R I;  3J80 C;  4JI2 E;  1N0V C;  4LF4 I;  3B82 A;  2HFU A;  4DR1 I;  2HHH I;  1XHK A;  2Z5C A;  4I3H A;  4P7A A;  5GMD A;  5FLX C;  4B3S E;  1FJG I;  3LPS A;  2HK2 A;  4K0K I;  1PKP A;  4URL A;  1XMO I;  2BM1 A;  3HUL A;  1K47 A;  1HNW I;  1IBM I;  3T1Y I;  1XNR I;  1D6T A;  2UXC E;  4X66 E;  2PNL A;  2F4V I;  4KQV A;  2OI2 A;  2UUB I;  4UTG A;  4JI7 E;  5LMU I;  4HY1 A;  4DU7 A;  4DUZ E;  1QZR A;  3HJC A;  4FN5 A;  2UUA E;  4LF9 I;  4JV5 E;  4DPU A;  3Q6N A;  1KIJ A;  4DR7 I;  1H7U A;  5LL6 R;  3GON A;  1USV A;  4NXN I;  2UXC I;  5IWA I;  4B3T E;  1HK7 A;  1N33 E;  1H72 C;  3QT6 A;  4X62 E;  4GKJ E;  3LNU A;  4DUZ I;  3J81 C;  4JI3 E;  1J5E I;  4JI6 E;  1FWL A;  2UUA I;  4WUB A;  4NXM E;  4DR5 I;  4DV7 E;  2O1T A;  2VQF E;  1VIS A;  2BV3 A;  4DPT A;  3Q1Q A;  1N34 E;  2O1W A;  1Z5A A;  2PNM A;  3Q6M A;  2WW4 A;  4MYU A;  2DEJ A;  1Z0E A;  4DU8 A;  4JI3 I;  4WUD A;  3K17 A;  4B3R E;  3J80 Q;  1HNX I;  4DV6 I;  3ZZT A;  2GQ0 A;  4USK A;  3ZKB A;  1S16 A;  4Z7C A;  1HR0 I;  1ZM4 A;  4DR3 I;  4LF6 I;  4DR1 E;  4LFA I;  5FLX Q;  4DR6 E;  2IOQ A;  1KKH A;  1FJG E;  4PRV A;  4JI4 I;  4JI5 I;  4K0K E;  3QT7 A;  2DEI A;  2VQE I;  1XMO E;  2R3V A;  2AJ4 A;  3PRY A;  1FKA E;  1NHH A;  1HNW E;  1IBM E;  3T1Y E;  1XNR E;  4DV0 I;  2ZM6 I;  3H4L A;  2F4V E;  4DR6 I;  2UUB E;  2ZIT A;  5LMU E;  1N32 I;  1A6F A;  4YY3 E;  4DV5 E;  4YHH E;  1I94 I;  4LF9 E;  1USU A;  3PYE A;  1DAR A;  4DR7 E;  4DPY A;  4MYT A;  4NXN E;  2NPF A;  5IWA E;  3D4J A;  1Y4U A;  4EMD A;  3J81 Q;  1NZ0 A;  4FWH A;  2Z5E A;  4YY3 I;  4DV5 I;  1J5E E;  4GKK E;  4YHH I;  2UXB I;  1Z0T A;  2V8P A;  4KHP I;  4X65 I;  3M6A A;  3K1J A;  2X36 A;  4DR5 E;  4LF8 I;  4DPX A;  4ED4 A;  4LF5 I;  3K85 A;  3PYG A;  1MG7 A;  1Z0B A;  1RR9 A;  2VF3 A;  5L3J A;  3ZKD A;  3JAM C;  4RPF A;  1Z0W A;  4GKK I;  3WU3 A;  4DV3 I;  5IT9 Q;  2X7I A;  1HNX E;  4DV6 E;  3B78 A;  4XTJ A;  2V2Z A;  4JI1 E;  2BM0 A;  5A2Q C;  1HR0 E;  1ZXN A;  2E5L I;  1ELO A;  4DR3 E;  4LF6 E;  4LFA E;  1MX0 A;  2CG9 A;  2Q2E B;  4JI4 E;  4JI5 E;  3ZM7 A;  2VQE E;  1NHI A;  2CZ9 A;  1KTV A;  1IBL I;  2LJP A;  4JI1 I;  4DV4 E;  1B63 A;  2R42 A;  4B3M I;  4PRX A;  4DV0 E;  2ZM6 E;  4LF7 I;  2UUC I;  4AQY E;  1ZXM A;  5LMN E;  4HAC B;  4N3O A;  4DUY I;  1MU5 A;  1N32 E;  4X64 I;  3J7A G;  5BR8 I;  4IZJ D;  4OX9 I;  4DPW A;  3LTO A;  2HKJ A;  1ZM3 A;  2HK3 A;  4JYA I;  3F0N A;  1IBK I;  1HNZ I;  1I94 E;  4LFC I;  4HYM A;  4IZK B;  1N36 E;  4DV4 I;  1RRE A;  1H7S A;  4FWD A;  1WUU A;  1Z0G A;  3PYD A;  2J7K A;  4AQY I;  4JI8 I;  1XNQ E;  2O1V A;  5LMN I;  1UEK A;  4LFB I;  2UU9 I;  5GME A;  3OTO I;  3T1H I;  1B62 A;  2UXD I;  1PIE A;  1XMQ E;  2UXB E;  1FWK A;  4FW9 A;  4M1K A;  4DV1 I;  4KHP E;  1ZM2 A;  4X65 E;  4PU9 A;  1Y6Z A;  1N36 I;  5FWK A;  1Z0C A;  2HKE A;  4LF8 E;  4DR2 E;  4ZVI A;  4LF5 E;  1XNQ I;  3PYF A;  3WU4 A;  4JI0 I;  4HAC A;  1Z0V A;  4IZJ B;  3QT5 A;  3JAM Q;  2A2D A;  2ZBK B;  1U2R A;  1NHJ A;  1EI1 A;  4JI2 I;  2IOP A;  1XMQ I;  1PVG A;  4DV3 E;  2E1R A;  3B8H A;  4IZK A;  2O1U A;  4USM A;  4UT4 A;  2Z5B B;  4DR2 I;  4Z7Y A;  5A2Q Q;  3WU6 A;  1Z5C A;  4JG4 A;  4B3S I;  1Z5B A;  2E5L E;  2V34 A;  3ZZ0 A;  1H73 A;  4FWG A;  2HFS A;  4HXZ A;  4P52 A;  1OJ4 A;  4DV2 E;  1KVK A;  4DR4 E;  4X66 I;  3CWV A;  1IBL E;  3P06 A;  2V2Q A;  4JI7 I;  4IZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...