1J5EI

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1j5eI00
4UT4A 4YY3I 5LMUI 1HNZI 4X64E 3QT5A 5LMNI 4DR3I 2UXDE 1H72C 1XMQI 4X66I 4I3HA 4B3TE 5FLXC 2XEXA 2UUAI 1I94E 4JG4A 4LF4E 5GMEA 4X62E 1NHHA 3V5RA 3QT6A 2DEIA 3LTOA 2DEJA 2F4VI 4MYTA 1IBMI 1XNQI 4JV5E 2Q2EB 3J80Q 1S16A 4OX9E 3PYGA 4FN5A 4DR4I 3K17A 3ZZUA 3K1JA 4B3SI 1XNRI 2UUBI 2UXBI 1FWLA 4LF5I 1K47A 1XHKA 3ZM7A 2NPFA 2VF3A 1ZM2A 4GKKE 4RPFA 1NHJA 2HFUA 1HNWI 5IT9C 4JI3I 1B62A 4DV4I 4AQYE 4USMA 4DPXA 1A6FA 4DR1E 1IBKI 1D6TA 1PVGA 1FNMA 4JYAI 4YHHI 1KVKA 4NXNI 5BR8E 1ZM4A 4JI5E 1QZRA 1N0UA 1IBLI 1UEKA 3CWVA 2ZM6E 2E5LE 1KIJA 1MX0A 2V2QA 4B3RI 1PKPA 3GONA 4DV2E 3JAMC 4FW9A 4FWDA 4DPUA 4LF8I 4LFAE 4WUCA 3WU4A 4HYMA 5GMDA 3WU6A 4DR6E 4DR2I 1N36E 4NXMI 2ZITA 3T1YE 3QT8A 4DV1E 1N32I 4JI0I 2BM1A 1KTVA 2HFSA 4X64I 1H73A 2UXDI 5FLXQ 4B3TI 3B8HA 2HHHE 1J5EE 1I94I 1RR9A 1Z0WA 4URLA 4LF4I 4X62I 4DV3E 1XMOE 4DU7A 3B82A 3ZKDA 1ZM9A 4DV5E 4JV5I 3J7AM 2V2ZA 3WU5A 1EI1A 1H7UA 4OX9I 1Z5BA 4Z7CA 4B3ME 1ZXMA 2UUCE 1EA6A 2VQEE 4M1KA 1B63A 1WUUA 4DV6E 4DV7E 3PYEA 4DUZE 4ED4A 1HR0E 4GKKI 4DR7E 5IT9Q 2CZ9A 2UXCE 1HNXE 1FKAE 4K0KE 4PRVA 4AQYI 2V34A 1RREA 2EFGA 1N34E 4DV0E 1N33E 5LL6R 4DR1I 2OI2A 2WW4A 2A2CA 4JI7E 4JI1E 4WUBA 4DPWA 5IWAE 3PYDA 5A2QC 2UU9E 2A2DA 2BV3A 4DUYE 2R3VA 1FWKA 5BR8I 4JI5I 1NZ0A 2AJ4A 1H7SA 4LF9E 2HK2A 2ZM6I 2E5LI 3JAMQ 3LNUA 1MG7A 4DV2I 4JI2E 1MU5A 2VQFE 4PRXA 3LPSA 4LFCE 4GKJE 4WUDA 1NHIA 4LFBE 1FI4A 4LFAI 1FJGE 4KHPE 2BM0A 3J81C 1PIEA 4DR6I 2V2VA 4JI8E 4X65E 1N36I 4JI6E 4LF7E 4LF6E 3T1YI 3OTOE 4DV1I 4HXZA 3ZZ0A 4DXLA 1VISA 2X36A 3F0NA 4FWGA 4DR5E 4JI4E 3HULA 2ZBKB 4YY3E 5LMUE 2HHHI 1HNZE 1J5EI 5LMNE 3V2UC 4DR3E 2GS8A 4DV3I 1XMOI 1XMQE 3D4JA 4X66E 2V8PA 2HKJA 4XTJA 4JI0E 1ZM3A 4DV5I 1Z0TA 2UUAE 3Q1QA 4PU9A 1ELOA 2HK3A 4P7AA 1H74A 4B3MI 2F4VE 1IBME 1XNQE 1BKNA 2UUCI 4KQVA 2VQEI 4EMDA 3J80C 4DV6I 4DV7I 4DR4E 4ZVIA 4DPYA 4R1FA 4HACA 1ZXNA 4DUZI 3WU3A 4FWHA 4B3SE 1XNRE 1HR0I 4DR7I 4P52A 3J7AG 2UUBE 2UXBE 4LF5E 1Z0EA 1Z0BA 2UXCI 1HNXI 4K0KI 3QT7A 2HKEA 1Z5AA 1N34I 1N0VC 4DV0I 1N33I 1HNWE 4JI3E 4DV4E 4DU8A 2R42A 2LJPA 4JI1I 3PYFA 4JI7I 5A2QQ 4HY1A 5IWAI 2E1RA 5L3JA 2UU9I 1IBKE 1OJ4A 4DUYI 4JYAE 4YHHE 1DARA 4LF9I 4NXNE 4MYUA 3B78A 4JI2I 2VQFI 4LFCI 1IBLE 4GKJI 4LFBI 1Z5CA 1S4EA 1FJGI 3J81Q 4B3RE 4KHPI 3M6AA 1U2RA 4JI8I 4X65I 1Z0VA 2X7IA 4JI6I 3ZZTA 4LF6I 4LF7I 3ZKBA 4LF8E 3OTOI 4HACB 4DR2E 3T1HE 4NXME 3H4LA 3T1HI 4UTGA 4USKA 4DPTA 1Z59A 4DR5I 4JI4I 1N32E 4Z7YA 1Z0GA 1KKHA 2J7KA 1Z0CA
chains in the Genus database with same CATH superfamily
4UT4A 4YY3I 5LMUI 3P3CA 1HNZI 4X64E 2JE6B 3QT5A 5LMNI 4DR3I 2UXDE 1H72C 1XMQI 4X66I 4I3HA 4B3TE 5FLXC 4OKGA 1Y4UA 2XEXA 2UUAI 1I94E 2IESA 4JG4A 4LCHA 2PNZB 4MU1A 1HK7A 4LF4E 5GMEA 4X62E 1NHHA 3V5RA 3QT6A 4IFDE 2DEIA 4BA1A 3LTOA 2DEJA 2F4VI 4MYTA 5DNXA 1IBMI 1XNQI 4JV5E 2Q2EB 4OO1F 3J80Q 2NN6A 1S16A 2PO0A 4OX9E 3PYGA 4FN5A 4DR4I 1USVA 3K17A 3ZZUA 3M7ND 3K1JA 4B3SI 1XNRI 2WP8A 4FW7A 2UUBI 2UXBI 1FWLA 4LF5I 1K47A 1XHKA 3ZM7A 3CDJA 3K85A 3U1KA 2NN6E 2JEBB 2NPFA 2VF3A 1ZM2A 4GKKE 4RPFA 1NHJA 4IZJD 2HFUA 1HNWI 4IFDD 5IT9C 4JI3I 1B62A 2PO1A 4DV4I 4AQYE 4USMA 1RHYA 2VESA 2PNLA 4DPXA 1A6FA 4DR1E 1IBKI 1D6TA 1PVGA 1FNMA 4JYAI 5JEAF 4YHHI 5DROA 1KVKA 5DNLA 4NXNI 5BR8E 1ZM4A 4JI5E 5K36F 4J3DA 1QZRA 1N0UA 1E3PA 1IBLI 4AM3A 1UEKA 3CWVA 4FW5A 4BA1B 2NN6D 4LCFA 3GMEA 2ZM6E 1KIJA 2E5LE 1MX0A 2V2QA 4B3RI 1PKPA 5ELWA 5C0XF 3GONA 4DV2E 2GQ0A 2PO0B 4FW9A 4FWDA 3JAMC 4DPUA 2GO3A 4LF8I 4LFAE 4OO1E 4WUCA 3WU4A 4HYMA 2F1DA 5GMDA 3WU6A 4DR6E 2WP8B 4DR2I 1Y4SA 1N36E 4NXMI 2ZITA 2CGEA 3T1YE 3QT8A 4DV1E 3Q6NA 2BA0G 4IZJA 1N32I 1UDQA 4IFDA 1R6LA 4NBQA 5FWKA 4JI0I 2BM1A 2JEAA 1KTVA 2HFSA 4X64I 3P76A 4QNJA 2PO1B 1H73A 2UXDI 5FLXQ 4B3TI 3PS2A 2C38A 2JT2A 3B8HA 3M85G 2HHHE 1J5EE 1I94I 2Z5EA 1RR9A 1Z0WA 4URLA 4LF4I 4X62I 5DRRA 5DRQA 4DV3E 1XMOE 4OO1D 2CVEA 2C39A 4DU7A 3B82A 3ZKDA 1ZM9A 4DV5E 4JV5I 5JEAE 3PS1A 3J7AM 2V2ZA 3WU5A 1Y5YA 1EI1A 1H7UA 3P06A 4OX9I 4LOMA 1Z5BA 4FW3A 1E3HA 4Z7CA 4B3ME 2O1WA 1UDSA 5K36E 1ZXMA 2UUCE 1EA6A 2J65A 2VQEE 4M1KA 1B63A 1WUUA 4DV6E 4DV7E 5C0XE 4MQYA 3PYEA 4DUZE 2IERA 4ED4A 1HR0E 3H1CA 2O3ZA 4GKKI 4DR7E 3B4TA 5IT9Q 2CZ9A 2UXCE 1HNXE 1FKAE 4K0KE 4PRVA 2BA1G 4IZJB 4AQYI 4IFDB 2V34A 5JEAD 1RREA 2EFGA 1N34E 2JEAB 4DV0E 1N33E 5LL6R 4DR1I 4IS9A 1OYPA 2OI2A 5K36D 2WW4A 2A2CA 4JI7E 4JI1E 4OO1A 4WUBA 4DPWA 5IWAE 2C38B 3GLLA 3PYDA 5A2QC 5EKWA 2UU9E 2A2DA 4MU3A 2C37A 2PO2A 2BV3A 4DUYE 2R3VA 1FWKA 5BR8I 4JI5I 1NZ0A 2AJ4A 1H7SA 4LF9E 2HK2A 2C39B 2ZM6I 2E5LI 4U3BA 2NN6B 3JAMQ 3LNUA 1MG7A 5EL9A 5DRPA 4DV2I 4JI2E 1MU5A 2VQFE 4PRXA 3LPSA 3NZKA 4AIMA 4LFCE 4GKJE 4WUDA 1NHIA 4LFBE 4IFDC 1FI4A 3P3GA 4LFAI 1FJGE 4KHPE 2BM0A 3L7ZA 3J81C 4FW6A 1PIEA 4DR6I 2V2VA 2O1VA 4JI8E 4X65E 1N36I 4JI6E 4FW4A 4LF7E 4LF6E 3T1YI 3OTOE 4DV1I 4HXZA 3ZZ0A 4DXLA 1VISA 2GO4A 1UDOA 4BA2A 3M85D 2X36A 3F0NA 5JEAA 4FWGA 1OYRA 4DR5E 4JI4E 3HULA 4IZKA 2ZBKB 5K36A 2CG9A 4YY3E 5LMUE 2NN6C 4LCGA 2HHHI 3HJCA 1HNZE 1J5EI 5LMNE 3V2UC 4DR3E 2GS8A 2Z5CA 3PS3A 4DV3I 1XMOI 2O1TA 3D4JA 4X66E 5C0XA 1XMQE 2V8PA 2HKJA 4LPFA 4XTJA 4OO1B 4JI0E 1ZM3A 1USUA 4DV5I 1Z0TA 2UUAE 4U3DA 3Q1QA 2C37B 2PO2B 4PU9A 3CDIA 2BR2A 2WNRA 1ELOA 2HK3A 4P7AA 1H74A 4B3MI 3KRNA 2F4VE 1IBME 1XNQE 1BKNA 2UUCI 4KQVA 2VQEI 3DD6A 1UDNA 1OYSA 4EMDA 3J80C 4DV6I 4DV7I 4DR4E 4ZVIA 4DPYA 2BA1D 4R1FA 1YHCA 2Z5BA 4HACA 3L7ZB 4N3OA 1ZXNA 4DUZI 3WU3A 4FWHA 4B3SE 1XNRE 1HR0I 4DR7I 4P52A 4AIDA 3J7AG 4MU0A 2UUBE 2UXBE 4QNKA 4LF5E 1Z0EA 1Z0BA 2UXCI 4OZEA 1HNXI 4K0KI 3QT7A 4OO1C 2HKEA 3M7NG 4BA2B 1XXEA 1Z5AA 1N34I 1N0VC 4DV0I 5JEAB 4ISAA 1N33I 2JE6A 1HNWE 1YH8A 4JI3E 4DV4E 4DU8A 2R42A 2LJPA 4IZKB 3PYFA 4JI1I 4JI7I 5A2QQ 3U1YA 5K36B 3HKMA 4HY1A 5IWAI 3PRYA 2E1RA 4GQUA 5L3JA 4IFDF 2UU9I 5C0XD 1IBKE 2PNZA 1OJ4A 4DUYI 1P42A 4JYAE 2Z5CB 4YHHE 1DARA 1Y6ZA 4LF9I 5C0XB 1VI7A 1R6MA 4NXNE 4MYUA 3B78A 4JI2I 2VQFI 4LFCI 1IBLE 2BR2B 2BA0D 2WNRB 4GKJI 4LFBI 1Z5CA 1S4EA 1FJGI 3J81Q 4B3RE 4MDTA 4KHPI 3M6AA 1U2RA 2IOQA 4JI8I 5JEAC 4X65I 1Z0VA 2X7IA 4JI6I 2NN6F 3ZZTA 4LF6I 4LF7I 3ZKBA 4LF8E 3OTOI 1Y60A 2Z5BB 2O1UA 4HACB 3P3EA 5K36C 4MU4A 4DR2E 2JEBA 3T1HE 3GCMA 4NXME 2PNMA 3H4LA 3T1HI 4UTGA 4USKA 4DPTA 1Z59A 4DR5I 2AE8A 5C0XC 4JI4I 2IOPA 3Q6MA 3UHMA 1N32E 4Z7YA 1Z0GA 1KKHA 2J7KA 1Z0CA
chains in the Genus database with same CATH topology
4UT4A 4YY3I 5LMUI 1HNZI 4X64E 3QT5A 5LMNI 4DR3I 2UXDE 1H72C 1XMQI 4X66I 4I3HA 4B3TE 5FLXC 1Y4UA 2XEXA 2UUAI 1I94E 4JG4A 1HK7A 4LF4E 5GMEA 4X62E 1NHHA 3V5RA 3QT6A 2DEIA 3LTOA 2DEJA 2F4VI 4MYTA 1IBMI 1XNQI 4JV5E 2Q2EB 3J80Q 1S16A 4OX9E 3PYGA 4FN5A 4DR4I 1USVA 3K17A 3ZZUA 3K1JA 4B3SI 1XNRI 2UUBI 2UXBI 1FWLA 4LF5I 1K47A 1XHKA 3ZM7A 3K85A 2NPFA 2VF3A 1ZM2A 4GKKE 4RPFA 1NHJA 4IZJD 2HFUA 1HNWI 5IT9C 4JI3I 1B62A 4DV4I 4AQYE 4USMA 2PNLA 4DPXA 1A6FA 4DR1E 1IBKI 1D6TA 1PVGA 1FNMA 4JYAI 4YHHI 1KVKA 4NXNI 5BR8E 1ZM4A 4JI5E 1QZRA 1N0UA 1IBLI 1UEKA 3CWVA 2ZM6E 1KIJA 2E5LE 1MX0A 2V2QA 4B3RI 1PKPA 3GONA 4DV2E 2GQ0A 3JAMC 4FW9A 4FWDA 4DPUA 4LF8I 4LFAE 4WUCA 3WU4A 4HYMA 5GMDA 3WU6A 4DR6E 4DR2I 1Y4SA 1N36E 4NXMI 2ZITA 2CGEA 3T1YE 3QT8A 4DV1E 3Q6NA 4IZJA 1N32I 5FWKA 4JI0I 2BM1A 1KTVA 2HFSA 4X64I 1H73A 2UXDI 5FLXQ 4B3TI 3B8HA 2HHHE 1J5EE 1I94I 2Z5EA 1RR9A 1Z0WA 4URLA 4LF4I 4X62I 1XMOE 4DV3E 4DU7A 3B82A 3ZKDA 1ZM9A 4DV5E 4JV5I 3J7AM 2V2ZA 3WU5A 1EI1A 1H7UA 3P06A 4OX9I 1Z5BA 4Z7CA 4B3ME 2O1WA 1ZXMA 2UUCE 1EA6A 2VQEE 4M1KA 1B63A 1WUUA 4DV6E 4DV7E 3PYEA 4DUZE 4ED4A 1HR0E 4GKKI 4DR7E 5IT9Q 2CZ9A 2UXCE 1HNXE 1FKAE 4K0KE 4PRVA 4IZJB 4AQYI 2V34A 1RREA 2EFGA 1N34E 4DV0E 1N33E 5LL6R 4DR1I 2OI2A 2WW4A 2A2CA 4JI7E 4JI1E 4WUBA 4DPWA 5IWAE 3PYDA 5A2QC 2UU9E 2A2DA 2BV3A 4DUYE 2R3VA 1FWKA 5BR8I 4JI5I 1NZ0A 2AJ4A 1H7SA 4LF9E 2HK2A 2ZM6I 2E5LI 3JAMQ 3LNUA 1MG7A 4DV2I 4JI2E 1MU5A 2VQFE 4PRXA 3LPSA 4LFCE 4GKJE 4WUDA 1NHIA 4LFBE 1FI4A 4LFAI 1FJGE 4KHPE 2BM0A 3J81C 1PIEA 4DR6I 2V2VA 2O1VA 4JI8E 4X65E 1N36I 4JI6E 4LF7E 4LF6E 3T1YI 3OTOE 4DV1I 4HXZA 3ZZ0A 4DXLA 1VISA 2X36A 3F0NA 4FWGA 4DR5E 4JI4E 3HULA 4IZKA 2ZBKB 2CG9A 4YY3E 5LMUE 2HHHI 3HJCA 1HNZE 1J5EI 5LMNE 3V2UC 4DR3E 2GS8A 2Z5CA 4DV3I 1XMOI 2O1TA 3D4JA 4X66E 1XMQE 2V8PA 2HKJA 4XTJA 4JI0E 1ZM3A 1USUA 4DV5I 1Z0TA 2UUAE 3Q1QA 4PU9A 1ELOA 2HK3A 4P7AA 1H74A 4B3MI 2F4VE 1IBME 1XNQE 1BKNA 2UUCI 4KQVA 2VQEI 4EMDA 3J80C 4DV6I 4DV7I 4DR4E 4ZVIA 4DPYA 4R1FA 2Z5BA 4HACA 4N3OA 1ZXNA 4DUZI 3WU3A 4FWHA 4B3SE 1XNRE 1HR0I 4DR7I 4P52A 3J7AG 2UUBE 2UXBE 4LF5E 1Z0EA 1Z0BA 2UXCI 1HNXI 4K0KI 3QT7A 2HKEA 1Z5AA 1N34I 1N0VC 4DV0I 1N33I 1HNWE 4JI3E 4DV4E 4DU8A 2R42A 2LJPA 4IZKB 3PYFA 4JI1I 4JI7I 5A2QQ 4HY1A 5IWAI 3PRYA 2E1RA 5L3JA 2UU9I 1IBKE 1OJ4A 4DUYI 4JYAE 2Z5CB 4YHHE 1DARA 1Y6ZA 4LF9I 4NXNE 4MYUA 3B78A 4JI2I 2VQFI 4LFCI 1IBLE 4GKJI 4LFBI 1Z5CA 1S4EA 1FJGI 3J81Q 4B3RE 4KHPI 3M6AA 1U2RA 2IOQA 4JI8I 4X65I 1Z0VA 2X7IA 4JI6I 3ZZTA 4LF6I 4LF7I 3ZKBA 4LF8E 3OTOI 2Z5BB 2O1UA 4HACB 4DR2E 3T1HE 4NXME 2PNMA 3H4LA 3T1HI 4UTGA 4USKA 4DPTA 1Z59A 4DR5I 4JI4I 2IOPA 3Q6MA 1N32E 4Z7YA 1Z0GA 1KKHA 2J7KA 1Z0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UT4 A;  4YY3 I;  5LMU I;  1HNZ I;  4X64 E;  3QT5 A;  5LMN I;  4DR3 I;  2UXD E;  1H72 C;  1XMQ I;  4X66 I;  4I3H A;  4B3T E;  5FLX C;  2XEX A;  2UUA I;  1I94 E;  4JG4 A;  4LF4 E;  5GME A;  4X62 E;  1NHH A;  3V5R A;  3QT6 A;  2DEI A;  3LTO A;  2DEJ A;  2F4V I;  4MYT A;  1IBM I;  1XNQ I;  4JV5 E;  2Q2E B;  3J80 Q;  1S16 A;  4OX9 E;  3PYG A;  4FN5 A;  4DR4 I;  3K17 A;  3ZZU A;  3K1J A;  4B3S I;  1XNR I;  2UUB I;  2UXB I;  1FWL A;  4LF5 I;  1K47 A;  1XHK A;  3ZM7 A;  2NPF A;  2VF3 A;  1ZM2 A;  4GKK E;  4RPF A;  1NHJ A;  2HFU A;  1HNW I;  5IT9 C;  4JI3 I;  1B62 A;  4DV4 I;  4AQY E;  4USM A;  4DPX A;  1A6F A;  4DR1 E;  1IBK I;  1D6T A;  1PVG A;  1FNM A;  4JYA I;  4YHH I;  1KVK A;  4NXN I;  5BR8 E;  1ZM4 A;  4JI5 E;  1QZR A;  1N0U A;  1IBL I;  1UEK A;  3CWV A;  2ZM6 E;  2E5L E;  1KIJ A;  1MX0 A;  2V2Q A;  4B3R I;  1PKP A;  3GON A;  4DV2 E;  3JAM C;  4FW9 A;  4FWD A;  4DPU A;  4LF8 I;  4LFA E;  4WUC A;  3WU4 A;  4HYM A;  5GMD A;  3WU6 A;  4DR6 E;  4DR2 I;  1N36 E;  4NXM I;  2ZIT A;  3T1Y E;  3QT8 A;  4DV1 E;  1N32 I;  4JI0 I;  2BM1 A;  1KTV A;  2HFS A;  4X64 I;  1H73 A;  2UXD I;  5FLX Q;  4B3T I;  3B8H A;  2HHH E;  1J5E E;  1I94 I;  1RR9 A;  1Z0W A;  4URL A;  4LF4 I;  4X62 I;  4DV3 E;  1XMO E;  4DU7 A;  3B82 A;  3ZKD A;  1ZM9 A;  4DV5 E;  4JV5 I;  3J7A M;  2V2Z A;  3WU5 A;  1EI1 A;  1H7U A;  4OX9 I;  1Z5B A;  4Z7C A;  4B3M E;  1ZXM A;  2UUC E;  1EA6 A;  2VQE E;  4M1K A;  1B63 A;  1WUU A;  4DV6 E;  4DV7 E;  3PYE A;  4DUZ E;  4ED4 A;  1HR0 E;  4GKK I;  4DR7 E;  5IT9 Q;  2CZ9 A;  2UXC E;  1HNX E;  1FKA E;  4K0K E;  4PRV A;  4AQY I;  2V34 A;  1RRE A;  2EFG A;  1N34 E;  4DV0 E;  1N33 E;  5LL6 R;  4DR1 I;  2OI2 A;  2WW4 A;  2A2C A;  4JI7 E;  4JI1 E;  4WUB A;  4DPW A;  5IWA E;  3PYD A;  5A2Q C;  2UU9 E;  2A2D A;  2BV3 A;  4DUY E;  2R3V A;  1FWK A;  5BR8 I;  4JI5 I;  1NZ0 A;  2AJ4 A;  1H7S A;  4LF9 E;  2HK2 A;  2ZM6 I;  2E5L I;  3JAM Q;  3LNU A;  1MG7 A;  4DV2 I;  4JI2 E;  1MU5 A;  2VQF E;  4PRX A;  3LPS A;  4LFC E;  4GKJ E;  4WUD A;  1NHI A;  4LFB E;  1FI4 A;  4LFA I;  1FJG E;  4KHP E;  2BM0 A;  3J81 C;  1PIE A;  4DR6 I;  2V2V A;  4JI8 E;  4X65 E;  1N36 I;  4JI6 E;  4LF7 E;  4LF6 E;  3T1Y I;  3OTO E;  4DV1 I;  4HXZ A;  3ZZ0 A;  4DXL A;  1VIS A;  2X36 A;  3F0N A;  4FWG A;  4DR5 E;  4JI4 E;  3HUL A;  2ZBK B;  4YY3 E;  5LMU E;  2HHH I;  1HNZ E;  1J5E I;  5LMN E;  3V2U C;  4DR3 E;  2GS8 A;  4DV3 I;  1XMO I;  1XMQ E;  3D4J A;  4X66 E;  2V8P A;  2HKJ A;  4XTJ A;  4JI0 E;  1ZM3 A;  4DV5 I;  1Z0T A;  2UUA E;  3Q1Q A;  4PU9 A;  1ELO A;  2HK3 A;  4P7A A;  1H74 A;  4B3M I;  2F4V E;  1IBM E;  1XNQ E;  1BKN A;  2UUC I;  4KQV A;  2VQE I;  4EMD A;  3J80 C;  4DV6 I;  4DV7 I;  4DR4 E;  4ZVI A;  4DPY A;  4R1F A;  4HAC A;  1ZXN A;  4DUZ I;  3WU3 A;  4FWH A;  4B3S E;  1XNR E;  1HR0 I;  4DR7 I;  4P52 A;  3J7A G;  2UUB E;  2UXB E;  4LF5 E;  1Z0E A;  1Z0B A;  2UXC I;  1HNX I;  4K0K I;  3QT7 A;  2HKE A;  1Z5A A;  1N34 I;  1N0V C;  4DV0 I;  1N33 I;  1HNW E;  4JI3 E;  4DV4 E;  4DU8 A;  2R42 A;  2LJP A;  4JI1 I;  3PYF A;  4JI7 I;  5A2Q Q;  4HY1 A;  5IWA I;  2E1R A;  5L3J A;  2UU9 I;  1IBK E;  1OJ4 A;  4DUY I;  4JYA E;  4YHH E;  1DAR A;  4LF9 I;  4NXN E;  4MYU A;  3B78 A;  4JI2 I;  2VQF I;  4LFC I;  1IBL E;  4GKJ I;  4LFB I;  1Z5C A;  1S4E A;  1FJG I;  3J81 Q;  4B3R E;  4KHP I;  3M6A A;  1U2R A;  4JI8 I;  4X65 I;  1Z0V A;  2X7I A;  4JI6 I;  3ZZT A;  4LF6 I;  4LF7 I;  3ZKB A;  4LF8 E;  3OTO I;  4HAC B;  4DR2 E;  3T1H E;  4NXM E;  3H4L A;  3T1H I;  4UTG A;  4USK A;  4DPT A;  1Z59 A;  4DR5 I;  4JI4 I;  1N32 E;  4Z7Y A;  1Z0G A;  1KKH A;  2J7K A;  1Z0C A; 
#chains in the Genus database with same CATH topology
 4UT4 A;  4YY3 I;  5LMU I;  3P3C A;  1HNZ I;  4X64 E;  2JE6 B;  3QT5 A;  5LMN I;  4DR3 I;  2UXD E;  1H72 C;  1XMQ I;  4X66 I;  4I3H A;  4B3T E;  5FLX C;  4OKG A;  1Y4U A;  2XEX A;  2UUA I;  1I94 E;  2IES A;  4JG4 A;  4LCH A;  2PNZ B;  4MU1 A;  1HK7 A;  4LF4 E;  5GME A;  4X62 E;  1NHH A;  3V5R A;  3QT6 A;  4IFD E;  2DEI A;  4BA1 A;  3LTO A;  2DEJ A;  2F4V I;  4MYT A;  5DNX A;  1IBM I;  1XNQ I;  4JV5 E;  2Q2E B;  4OO1 F;  3J80 Q;  2NN6 A;  1S16 A;  2PO0 A;  4OX9 E;  3PYG A;  4FN5 A;  4DR4 I;  1USV A;  3K17 A;  3ZZU A;  3M7N D;  3K1J A;  4B3S I;  1XNR I;  2WP8 A;  4FW7 A;  2UUB I;  2UXB I;  1FWL A;  4LF5 I;  1K47 A;  1XHK A;  3ZM7 A;  3CDJ A;  3K85 A;  3U1K A;  2NN6 E;  2JEB B;  2NPF A;  2VF3 A;  1ZM2 A;  4GKK E;  4RPF A;  1NHJ A;  4IZJ D;  2HFU A;  1HNW I;  4IFD D;  5IT9 C;  4JI3 I;  1B62 A;  2PO1 A;  4DV4 I;  4AQY E;  4USM A;  1RHY A;  2VES A;  2PNL A;  4DPX A;  1A6F A;  4DR1 E;  1IBK I;  1D6T A;  1PVG A;  1FNM A;  4JYA I;  5JEA F;  4YHH I;  5DRO A;  1KVK A;  5DNL A;  4NXN I;  5BR8 E;  1ZM4 A;  4JI5 E;  5K36 F;  4J3D A;  1QZR A;  1N0U A;  1E3P A;  1IBL I;  4AM3 A;  1UEK A;  3CWV A;  4FW5 A;  4BA1 B;  2NN6 D;  4LCF A;  3GME A;  2ZM6 E;  1KIJ A;  2E5L E;  1MX0 A;  2V2Q A;  4B3R I;  1PKP A;  5ELW A;  5C0X F;  3GON A;  4DV2 E;  2GQ0 A;  2PO0 B;  4FW9 A;  4FWD A;  3JAM C;  4DPU A;  2GO3 A;  4LF8 I;  4LFA E;  4OO1 E;  4WUC A;  3WU4 A;  4HYM A;  2F1D A;  5GMD A;  3WU6 A;  4DR6 E;  2WP8 B;  4DR2 I;  1Y4S A;  1N36 E;  4NXM I;  2ZIT A;  2CGE A;  3T1Y E;  3QT8 A;  4DV1 E;  3Q6N A;  2BA0 G;  4IZJ A;  1N32 I;  1UDQ A;  4IFD A;  1R6L A;  4NBQ A;  5FWK A;  4JI0 I;  2BM1 A;  2JEA A;  1KTV A;  2HFS A;  4X64 I;  3P76 A;  4QNJ A;  2PO1 B;  1H73 A;  2UXD I;  5FLX Q;  4B3T I;  3PS2 A;  2C38 A;  2JT2 A;  3B8H A;  3M85 G;  2HHH E;  1J5E E;  1I94 I;  2Z5E A;  1RR9 A;  1Z0W A;  4URL A;  4LF4 I;  4X62 I;  5DRR A;  5DRQ A;  4DV3 E;  1XMO E;  4OO1 D;  2CVE A;  2C39 A;  4DU7 A;  3B82 A;  3ZKD A;  1ZM9 A;  4DV5 E;  4JV5 I;  5JEA E;  3PS1 A;  3J7A M;  2V2Z A;  3WU5 A;  1Y5Y A;  1EI1 A;  1H7U A;  3P06 A;  4OX9 I;  4LOM A;  1Z5B A;  4FW3 A;  1E3H A;  4Z7C A;  4B3M E;  2O1W A;  1UDS A;  5K36 E;  1ZXM A;  2UUC E;  1EA6 A;  2J65 A;  2VQE E;  4M1K A;  1B63 A;  1WUU A;  4DV6 E;  4DV7 E;  5C0X E;  4MQY A;  3PYE A;  4DUZ E;  2IER A;  4ED4 A;  1HR0 E;  3H1C A;  2O3Z A;  4GKK I;  4DR7 E;  3B4T A;  5IT9 Q;  2CZ9 A;  2UXC E;  1HNX E;  1FKA E;  4K0K E;  4PRV A;  2BA1 G;  4IZJ B;  4AQY I;  4IFD B;  2V34 A;  5JEA D;  1RRE A;  2EFG A;  1N34 E;  2JEA B;  4DV0 E;  1N33 E;  5LL6 R;  4DR1 I;  4IS9 A;  1OYP A;  2OI2 A;  5K36 D;  2WW4 A;  2A2C A;  4JI7 E;  4JI1 E;  4OO1 A;  4WUB A;  4DPW A;  5IWA E;  2C38 B;  3GLL A;  3PYD A;  5A2Q C;  5EKW A;  2UU9 E;  2A2D A;  4MU3 A;  2C37 A;  2PO2 A;  2BV3 A;  4DUY E;  2R3V A;  1FWK A;  5BR8 I;  4JI5 I;  1NZ0 A;  2AJ4 A;  1H7S A;  4LF9 E;  2HK2 A;  2C39 B;  2ZM6 I;  2E5L I;  4U3B A;  2NN6 B;  3JAM Q;  3LNU A;  1MG7 A;  5EL9 A;  5DRP A;  4DV2 I;  4JI2 E;  1MU5 A;  2VQF E;  4PRX A;  3LPS A;  3NZK A;  4AIM A;  4LFC E;  4GKJ E;  4WUD A;  1NHI A;  4LFB E;  4IFD C;  1FI4 A;  3P3G A;  4LFA I;  1FJG E;  4KHP E;  2BM0 A;  3L7Z A;  3J81 C;  4FW6 A;  1PIE A;  4DR6 I;  2V2V A;  2O1V A;  4JI8 E;  4X65 E;  1N36 I;  4JI6 E;  4FW4 A;  4LF7 E;  4LF6 E;  3T1Y I;  3OTO E;  4DV1 I;  4HXZ A;  3ZZ0 A;  4DXL A;  1VIS A;  2GO4 A;  1UDO A;  4BA2 A;  3M85 D;  2X36 A;  3F0N A;  5JEA A;  4FWG A;  1OYR A;  4DR5 E;  4JI4 E;  3HUL A;  4IZK A;  2ZBK B;  5K36 A;  2CG9 A;  4YY3 E;  5LMU E;  2NN6 C;  4LCG A;  2HHH I;  3HJC A;  1HNZ E;  1J5E I;  5LMN E;  3V2U C;  4DR3 E;  2GS8 A;  2Z5C A;  3PS3 A;  4DV3 I;  1XMO I;  2O1T A;  3D4J A;  4X66 E;  5C0X A;  1XMQ E;  2V8P A;  2HKJ A;  4LPF A;  4XTJ A;  4OO1 B;  4JI0 E;  1ZM3 A;  1USU A;  4DV5 I;  1Z0T A;  2UUA E;  4U3D A;  3Q1Q A;  2C37 B;  2PO2 B;  4PU9 A;  3CDI A;  2BR2 A;  2WNR A;  1ELO A;  2HK3 A;  4P7A A;  1H74 A;  4B3M I;  3KRN A;  2F4V E;  1IBM E;  1XNQ E;  1BKN A;  2UUC I;  4KQV A;  2VQE I;  3DD6 A;  1UDN A;  1OYS A;  4EMD A;  3J80 C;  4DV6 I;  4DV7 I;  4DR4 E;  4ZVI A;  4DPY A;  2BA1 D;  4R1F A;  1YHC A;  2Z5B A;  4HAC A;  3L7Z B;  4N3O A;  1ZXN A;  4DUZ I;  3WU3 A;  4FWH A;  4B3S E;  1XNR E;  1HR0 I;  4DR7 I;  4P52 A;  4AID A;  3J7A G;  4MU0 A;  2UUB E;  2UXB E;  4QNK A;  4LF5 E;  1Z0E A;  1Z0B A;  2UXC I;  4OZE A;  1HNX I;  4K0K I;  3QT7 A;  4OO1 C;  2HKE A;  3M7N G;  4BA2 B;  1XXE A;  1Z5A A;  1N34 I;  1N0V C;  4DV0 I;  5JEA B;  4ISA A;  1N33 I;  2JE6 A;  1HNW E;  1YH8 A;  4JI3 E;  4DV4 E;  4DU8 A;  2R42 A;  2LJP A;  4IZK B;  3PYF A;  4JI1 I;  4JI7 I;  5A2Q Q;  3U1Y A;  5K36 B;  3HKM A;  4HY1 A;  5IWA I;  3PRY A;  2E1R A;  4GQU A;  5L3J A;  4IFD F;  2UU9 I;  5C0X D;  1IBK E;  2PNZ A;  1OJ4 A;  4DUY I;  1P42 A;  4JYA E;  2Z5C B;  4YHH E;  1DAR A;  1Y6Z A;  4LF9 I;  5C0X B;  1VI7 A;  1R6M A;  4NXN E;  4MYU A;  3B78 A;  4JI2 I;  2VQF I;  4LFC I;  1IBL E;  2BR2 B;  2BA0 D;  2WNR B;  4GKJ I;  4LFB I;  1Z5C A;  1S4E A;  1FJG I;  3J81 Q;  4B3R E;  4MDT A;  4KHP I;  3M6A A;  1U2R A;  2IOQ A;  4JI8 I;  5JEA C;  4X65 I;  1Z0V A;  2X7I A;  4JI6 I;  2NN6 F;  3ZZT A;  4LF6 I;  4LF7 I;  3ZKB A;  4LF8 E;  3OTO I;  1Y60 A;  2Z5B B;  2O1U A;  4HAC B;  3P3E A;  5K36 C;  4MU4 A;  4DR2 E;  2JEB A;  3T1H E;  3GCM A;  4NXM E;  2PNM A;  3H4L A;  3T1H I;  4UTG A;  4USK A;  4DPT A;  1Z59 A;  4DR5 I;  2AE8 A;  5C0X C;  4JI4 I;  2IOP A;  3Q6M A;  3UHM A;  1N32 E;  4Z7Y A;  1Z0G A;  1KKH A;  2J7K A;  1Z0C A; 
#chains in the Genus database with same CATH homology
 4UT4 A;  4YY3 I;  5LMU I;  1HNZ I;  4X64 E;  3QT5 A;  5LMN I;  4DR3 I;  2UXD E;  1H72 C;  1XMQ I;  4X66 I;  4I3H A;  4B3T E;  5FLX C;  1Y4U A;  2XEX A;  2UUA I;  1I94 E;  4JG4 A;  1HK7 A;  4LF4 E;  5GME A;  4X62 E;  1NHH A;  3V5R A;  3QT6 A;  2DEI A;  3LTO A;  2DEJ A;  2F4V I;  4MYT A;  1IBM I;  1XNQ I;  4JV5 E;  2Q2E B;  3J80 Q;  1S16 A;  4OX9 E;  3PYG A;  4FN5 A;  4DR4 I;  1USV A;  3K17 A;  3ZZU A;  3K1J A;  4B3S I;  1XNR I;  2UUB I;  2UXB I;  1FWL A;  4LF5 I;  1K47 A;  1XHK A;  3ZM7 A;  3K85 A;  2NPF A;  2VF3 A;  1ZM2 A;  4GKK E;  4RPF A;  1NHJ A;  4IZJ D;  2HFU A;  1HNW I;  5IT9 C;  4JI3 I;  1B62 A;  4DV4 I;  4AQY E;  4USM A;  2PNL A;  4DPX A;  1A6F A;  4DR1 E;  1IBK I;  1D6T A;  1PVG A;  1FNM A;  4JYA I;  4YHH I;  1KVK A;  4NXN I;  5BR8 E;  1ZM4 A;  4JI5 E;  1QZR A;  1N0U A;  1IBL I;  1UEK A;  3CWV A;  2ZM6 E;  1KIJ A;  2E5L E;  1MX0 A;  2V2Q A;  4B3R I;  1PKP A;  3GON A;  4DV2 E;  2GQ0 A;  3JAM C;  4FW9 A;  4FWD A;  4DPU A;  4LF8 I;  4LFA E;  4WUC A;  3WU4 A;  4HYM A;  5GMD A;  3WU6 A;  4DR6 E;  4DR2 I;  1Y4S A;  1N36 E;  4NXM I;  2ZIT A;  2CGE A;  3T1Y E;  3QT8 A;  4DV1 E;  3Q6N A;  4IZJ A;  1N32 I;  5FWK A;  4JI0 I;  2BM1 A;  1KTV A;  2HFS A;  4X64 I;  1H73 A;  2UXD I;  5FLX Q;  4B3T I;  3B8H A;  2HHH E;  1J5E E;  1I94 I;  2Z5E A;  1RR9 A;  1Z0W A;  4URL A;  4LF4 I;  4X62 I;  1XMO E;  4DV3 E;  4DU7 A;  3B82 A;  3ZKD A;  1ZM9 A;  4DV5 E;  4JV5 I;  3J7A M;  2V2Z A;  3WU5 A;  1EI1 A;  1H7U A;  3P06 A;  4OX9 I;  1Z5B A;  4Z7C A;  4B3M E;  2O1W A;  1ZXM A;  2UUC E;  1EA6 A;  2VQE E;  4M1K A;  1B63 A;  1WUU A;  4DV6 E;  4DV7 E;  3PYE A;  4DUZ E;  4ED4 A;  1HR0 E;  4GKK I;  4DR7 E;  5IT9 Q;  2CZ9 A;  2UXC E;  1HNX E;  1FKA E;  4K0K E;  4PRV A;  4IZJ B;  4AQY I;  2V34 A;  1RRE A;  2EFG A;  1N34 E;  4DV0 E;  1N33 E;  5LL6 R;  4DR1 I;  2OI2 A;  2WW4 A;  2A2C A;  4JI7 E;  4JI1 E;  4WUB A;  4DPW A;  5IWA E;  3PYD A;  5A2Q C;  2UU9 E;  2A2D A;  2BV3 A;  4DUY E;  2R3V A;  1FWK A;  5BR8 I;  4JI5 I;  1NZ0 A;  2AJ4 A;  1H7S A;  4LF9 E;  2HK2 A;  2ZM6 I;  2E5L I;  3JAM Q;  3LNU A;  1MG7 A;  4DV2 I;  4JI2 E;  1MU5 A;  2VQF E;  4PRX A;  3LPS A;  4LFC E;  4GKJ E;  4WUD A;  1NHI A;  4LFB E;  1FI4 A;  4LFA I;  1FJG E;  4KHP E;  2BM0 A;  3J81 C;  1PIE A;  4DR6 I;  2V2V A;  2O1V A;  4JI8 E;  4X65 E;  1N36 I;  4JI6 E;  4LF7 E;  4LF6 E;  3T1Y I;  3OTO E;  4DV1 I;  4HXZ A;  3ZZ0 A;  4DXL A;  1VIS A;  2X36 A;  3F0N A;  4FWG A;  4DR5 E;  4JI4 E;  3HUL A;  4IZK A;  2ZBK B;  2CG9 A;  4YY3 E;  5LMU E;  2HHH I;  3HJC A;  1HNZ E;  1J5E I;  5LMN E;  3V2U C;  4DR3 E;  2GS8 A;  2Z5C A;  4DV3 I;  1XMO I;  2O1T A;  3D4J A;  4X66 E;  1XMQ E;  2V8P A;  2HKJ A;  4XTJ A;  4JI0 E;  1ZM3 A;  1USU A;  4DV5 I;  1Z0T A;  2UUA E;  3Q1Q A;  4PU9 A;  1ELO A;  2HK3 A;  4P7A A;  1H74 A;  4B3M I;  2F4V E;  1IBM E;  1XNQ E;  1BKN A;  2UUC I;  4KQV A;  2VQE I;  4EMD A;  3J80 C;  4DV6 I;  4DV7 I;  4DR4 E;  4ZVI A;  4DPY A;  4R1F A;  2Z5B A;  4HAC A;  4N3O A;  1ZXN A;  4DUZ I;  3WU3 A;  4FWH A;  4B3S E;  1XNR E;  1HR0 I;  4DR7 I;  4P52 A;  3J7A G;  2UUB E;  2UXB E;  4LF5 E;  1Z0E A;  1Z0B A;  2UXC I;  1HNX I;  4K0K I;  3QT7 A;  2HKE A;  1Z5A A;  1N34 I;  1N0V C;  4DV0 I;  1N33 I;  1HNW E;  4JI3 E;  4DV4 E;  4DU8 A;  2R42 A;  2LJP A;  4IZK B;  3PYF A;  4JI1 I;  4JI7 I;  5A2Q Q;  4HY1 A;  5IWA I;  3PRY A;  2E1R A;  5L3J A;  2UU9 I;  1IBK E;  1OJ4 A;  4DUY I;  4JYA E;  2Z5C B;  4YHH E;  1DAR A;  1Y6Z A;  4LF9 I;  4NXN E;  4MYU A;  3B78 A;  4JI2 I;  2VQF I;  4LFC I;  1IBL E;  4GKJ I;  4LFB I;  1Z5C A;  1S4E A;  1FJG I;  3J81 Q;  4B3R E;  4KHP I;  3M6A A;  1U2R A;  2IOQ A;  4JI8 I;  4X65 I;  1Z0V A;  2X7I A;  4JI6 I;  3ZZT A;  4LF6 I;  4LF7 I;  3ZKB A;  4LF8 E;  3OTO I;  2Z5B B;  2O1U A;  4HAC B;  4DR2 E;  3T1H E;  4NXM E;  2PNM A;  3H4L A;  3T1H I;  4UTG A;  4USK A;  4DPT A;  1Z59 A;  4DR5 I;  4JI4 I;  2IOP A;  3Q6M A;  1N32 E;  4Z7Y A;  1Z0G A;  1KKH A;  2J7K A;  1Z0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...